data_2BWG
# 
_entry.id   2BWG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.382 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2BWG         pdb_00002bwg 10.2210/pdb2bwg/pdb 
PDBE  EBI-24893    ?            ?                   
WWPDB D_1290024893 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2BLE 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'STRUCTURE OF HUMAN GUANOSINE MONOPHOSPHATE REDUCTASE GMPR1 IN COMPLEX WITH GMP' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2BWG 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-13 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bunkoczi, G.'   1 
'Haroniti, A.'   2 
'Ng, S.'         3 
'von Delft, F.'  4 
'Gileadi, O.'    5 
'Oppermann, U.'  6 
'Arrowsmith, C.' 7 
'Edwards, A.'    8 
'Sundstrom, M.'  9 
# 
_citation.id                        primary 
_citation.title                     'Structure of Human Guanosine Monophosphate Reductase Gmpr1 in Complex with Gmp' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bunkoczi, G.'   1 ? 
primary 'Haroniti, A.'   2 ? 
primary 'Ng, S.'         3 ? 
primary 'von Delft, F.'  4 ? 
primary 'Gileadi, O.'    5 ? 
primary 'Oppermann, U.'  6 ? 
primary 'Arrowsmith, C.' 7 ? 
primary 'Edwards, A.'    8 ? 
primary 'Sundstrom, M.'  9 ? 
# 
_cell.entry_id           2BWG 
_cell.length_a           55.312 
_cell.length_b           114.418 
_cell.length_c           115.129 
_cell.angle_alpha        90.00 
_cell.angle_beta         102.74 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2BWG 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GMP REDUCTASE I'            39991.539 4   1.7.1.7 ? ? ? 
2 non-polymer syn 'POTASSIUM ION'              39.098    4   ?       ? ? ? 
3 non-polymer syn "GUANOSINE-5'-MONOPHOSPHATE" 363.221   4   ?       ? ? ? 
4 water       nat water                        18.015    193 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;GUANOSINE 5'-MONOPHOSPHATE OXIDOREDUCTASE 1, GUANOSINE MONOPHOSPHATE REDUCTASE 1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTV
GTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHF
VEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIIS
DGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYK
GDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTV
GTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHF
VEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIIS
DGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYK
GDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  PRO n 
1 25  ARG n 
1 26  ILE n 
1 27  ASP n 
1 28  ALA n 
1 29  ASP n 
1 30  LEU n 
1 31  LYS n 
1 32  LEU n 
1 33  ASP n 
1 34  PHE n 
1 35  LYS n 
1 36  ASP n 
1 37  VAL n 
1 38  LEU n 
1 39  LEU n 
1 40  ARG n 
1 41  PRO n 
1 42  LYS n 
1 43  ARG n 
1 44  SER n 
1 45  SER n 
1 46  LEU n 
1 47  LYS n 
1 48  SER n 
1 49  ARG n 
1 50  ALA n 
1 51  GLU n 
1 52  VAL n 
1 53  ASP n 
1 54  LEU n 
1 55  GLU n 
1 56  ARG n 
1 57  THR n 
1 58  PHE n 
1 59  THR n 
1 60  PHE n 
1 61  ARG n 
1 62  ASN n 
1 63  SER n 
1 64  LYS n 
1 65  GLN n 
1 66  THR n 
1 67  TYR n 
1 68  SER n 
1 69  GLY n 
1 70  ILE n 
1 71  PRO n 
1 72  ILE n 
1 73  ILE n 
1 74  VAL n 
1 75  ALA n 
1 76  ASN n 
1 77  MET n 
1 78  ASP n 
1 79  THR n 
1 80  VAL n 
1 81  GLY n 
1 82  THR n 
1 83  PHE n 
1 84  GLU n 
1 85  MET n 
1 86  ALA n 
1 87  ALA n 
1 88  VAL n 
1 89  MET n 
1 90  SER n 
1 91  GLN n 
1 92  HIS n 
1 93  SER n 
1 94  MET n 
1 95  PHE n 
1 96  THR n 
1 97  ALA n 
1 98  ILE n 
1 99  HIS n 
1 100 LYS n 
1 101 HIS n 
1 102 TYR n 
1 103 SER n 
1 104 LEU n 
1 105 ASP n 
1 106 ASP n 
1 107 TRP n 
1 108 LYS n 
1 109 LEU n 
1 110 PHE n 
1 111 ALA n 
1 112 THR n 
1 113 ASN n 
1 114 HIS n 
1 115 PRO n 
1 116 GLU n 
1 117 CYS n 
1 118 LEU n 
1 119 GLN n 
1 120 ASN n 
1 121 VAL n 
1 122 ALA n 
1 123 VAL n 
1 124 SER n 
1 125 SER n 
1 126 GLY n 
1 127 SER n 
1 128 GLY n 
1 129 GLN n 
1 130 ASN n 
1 131 ASP n 
1 132 LEU n 
1 133 GLU n 
1 134 LYS n 
1 135 MET n 
1 136 THR n 
1 137 SER n 
1 138 ILE n 
1 139 LEU n 
1 140 GLU n 
1 141 ALA n 
1 142 VAL n 
1 143 PRO n 
1 144 GLN n 
1 145 VAL n 
1 146 LYS n 
1 147 PHE n 
1 148 ILE n 
1 149 CYS n 
1 150 LEU n 
1 151 ASP n 
1 152 VAL n 
1 153 ALA n 
1 154 ASN n 
1 155 GLY n 
1 156 TYR n 
1 157 SER n 
1 158 GLU n 
1 159 HIS n 
1 160 PHE n 
1 161 VAL n 
1 162 GLU n 
1 163 PHE n 
1 164 VAL n 
1 165 LYS n 
1 166 LEU n 
1 167 VAL n 
1 168 ARG n 
1 169 ALA n 
1 170 LYS n 
1 171 PHE n 
1 172 PRO n 
1 173 GLU n 
1 174 HIS n 
1 175 THR n 
1 176 ILE n 
1 177 MET n 
1 178 ALA n 
1 179 GLY n 
1 180 ASN n 
1 181 VAL n 
1 182 VAL n 
1 183 THR n 
1 184 GLY n 
1 185 GLU n 
1 186 MET n 
1 187 VAL n 
1 188 GLU n 
1 189 GLU n 
1 190 LEU n 
1 191 ILE n 
1 192 LEU n 
1 193 SER n 
1 194 GLY n 
1 195 ALA n 
1 196 ASP n 
1 197 ILE n 
1 198 ILE n 
1 199 LYS n 
1 200 VAL n 
1 201 GLY n 
1 202 VAL n 
1 203 GLY n 
1 204 PRO n 
1 205 GLY n 
1 206 SER n 
1 207 VAL n 
1 208 CYS n 
1 209 THR n 
1 210 THR n 
1 211 ARG n 
1 212 THR n 
1 213 LYS n 
1 214 THR n 
1 215 GLY n 
1 216 VAL n 
1 217 GLY n 
1 218 TYR n 
1 219 PRO n 
1 220 GLN n 
1 221 LEU n 
1 222 SER n 
1 223 ALA n 
1 224 VAL n 
1 225 ILE n 
1 226 GLU n 
1 227 CYS n 
1 228 ALA n 
1 229 ASP n 
1 230 SER n 
1 231 ALA n 
1 232 HIS n 
1 233 GLY n 
1 234 LEU n 
1 235 LYS n 
1 236 GLY n 
1 237 HIS n 
1 238 ILE n 
1 239 ILE n 
1 240 SER n 
1 241 ASP n 
1 242 GLY n 
1 243 GLY n 
1 244 CYS n 
1 245 THR n 
1 246 CYS n 
1 247 PRO n 
1 248 GLY n 
1 249 ASP n 
1 250 VAL n 
1 251 ALA n 
1 252 LYS n 
1 253 ALA n 
1 254 PHE n 
1 255 GLY n 
1 256 ALA n 
1 257 GLY n 
1 258 ALA n 
1 259 ASP n 
1 260 PHE n 
1 261 VAL n 
1 262 MET n 
1 263 LEU n 
1 264 GLY n 
1 265 GLY n 
1 266 MET n 
1 267 PHE n 
1 268 SER n 
1 269 GLY n 
1 270 HIS n 
1 271 THR n 
1 272 GLU n 
1 273 CYS n 
1 274 ALA n 
1 275 GLY n 
1 276 GLU n 
1 277 VAL n 
1 278 ILE n 
1 279 GLU n 
1 280 ARG n 
1 281 ASN n 
1 282 GLY n 
1 283 ARG n 
1 284 LYS n 
1 285 LEU n 
1 286 LYS n 
1 287 LEU n 
1 288 PHE n 
1 289 TYR n 
1 290 GLY n 
1 291 MET n 
1 292 SER n 
1 293 SER n 
1 294 ASP n 
1 295 THR n 
1 296 ALA n 
1 297 MET n 
1 298 ASN n 
1 299 LYS n 
1 300 HIS n 
1 301 ALA n 
1 302 GLY n 
1 303 GLY n 
1 304 VAL n 
1 305 ALA n 
1 306 GLU n 
1 307 TYR n 
1 308 ARG n 
1 309 ALA n 
1 310 SER n 
1 311 GLU n 
1 312 GLY n 
1 313 LYS n 
1 314 THR n 
1 315 VAL n 
1 316 GLU n 
1 317 VAL n 
1 318 PRO n 
1 319 TYR n 
1 320 LYS n 
1 321 GLY n 
1 322 ASP n 
1 323 VAL n 
1 324 GLU n 
1 325 ASN n 
1 326 THR n 
1 327 ILE n 
1 328 LEU n 
1 329 ASP n 
1 330 ILE n 
1 331 LEU n 
1 332 GLY n 
1 333 GLY n 
1 334 LEU n 
1 335 ARG n 
1 336 SER n 
1 337 THR n 
1 338 CYS n 
1 339 THR n 
1 340 TYR n 
1 341 VAL n 
1 342 GLY n 
1 343 ALA n 
1 344 ALA n 
1 345 LYS n 
1 346 LEU n 
1 347 LYS n 
1 348 GLU n 
1 349 LEU n 
1 350 SER n 
1 351 ARG n 
1 352 ARG n 
1 353 ALA n 
1 354 THR n 
1 355 PHE n 
1 356 ILE n 
1 357 ARG n 
1 358 VAL n 
1 359 THR n 
1 360 GLN n 
1 361 GLN n 
1 362 HIS n 
1 363 ASN n 
1 364 THR n 
1 365 VAL n 
1 366 PHE n 
1 367 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GMPR1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P36959 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2BWG A 23 ? 367 ? P36959 1 ? 345 ? 1 345 
2 1 2BWG B 23 ? 367 ? P36959 1 ? 345 ? 1 345 
3 1 2BWG C 23 ? 367 ? P36959 1 ? 345 ? 1 345 
4 1 2BWG D 23 ? 367 ? P36959 1 ? 345 ? 1 345 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2BWG MET A 1   ? UNP P36959 ?   ?   'expression tag' -21 1  
1 2BWG HIS A 2   ? UNP P36959 ?   ?   'expression tag' -20 2  
1 2BWG HIS A 3   ? UNP P36959 ?   ?   'expression tag' -19 3  
1 2BWG HIS A 4   ? UNP P36959 ?   ?   'expression tag' -18 4  
1 2BWG HIS A 5   ? UNP P36959 ?   ?   'expression tag' -17 5  
1 2BWG HIS A 6   ? UNP P36959 ?   ?   'expression tag' -16 6  
1 2BWG HIS A 7   ? UNP P36959 ?   ?   'expression tag' -15 7  
1 2BWG SER A 8   ? UNP P36959 ?   ?   'expression tag' -14 8  
1 2BWG SER A 9   ? UNP P36959 ?   ?   'expression tag' -13 9  
1 2BWG GLY A 10  ? UNP P36959 ?   ?   'expression tag' -12 10 
1 2BWG VAL A 11  ? UNP P36959 ?   ?   'expression tag' -11 11 
1 2BWG ASP A 12  ? UNP P36959 ?   ?   'expression tag' -10 12 
1 2BWG LEU A 13  ? UNP P36959 ?   ?   'expression tag' -9  13 
1 2BWG GLY A 14  ? UNP P36959 ?   ?   'expression tag' -8  14 
1 2BWG THR A 15  ? UNP P36959 ?   ?   'expression tag' -7  15 
1 2BWG GLU A 16  ? UNP P36959 ?   ?   'expression tag' -6  16 
1 2BWG ASN A 17  ? UNP P36959 ?   ?   'expression tag' -5  17 
1 2BWG LEU A 18  ? UNP P36959 ?   ?   'expression tag' -4  18 
1 2BWG TYR A 19  ? UNP P36959 ?   ?   'expression tag' -3  19 
1 2BWG PHE A 20  ? UNP P36959 ?   ?   'expression tag' -2  20 
1 2BWG GLN A 21  ? UNP P36959 ?   ?   'expression tag' -1  21 
1 2BWG SER A 22  ? UNP P36959 ?   ?   'expression tag' 0   22 
1 2BWG ILE A 278 ? UNP P36959 PHE 256 variant          256 23 
2 2BWG MET B 1   ? UNP P36959 ?   ?   'expression tag' -21 24 
2 2BWG HIS B 2   ? UNP P36959 ?   ?   'expression tag' -20 25 
2 2BWG HIS B 3   ? UNP P36959 ?   ?   'expression tag' -19 26 
2 2BWG HIS B 4   ? UNP P36959 ?   ?   'expression tag' -18 27 
2 2BWG HIS B 5   ? UNP P36959 ?   ?   'expression tag' -17 28 
2 2BWG HIS B 6   ? UNP P36959 ?   ?   'expression tag' -16 29 
2 2BWG HIS B 7   ? UNP P36959 ?   ?   'expression tag' -15 30 
2 2BWG SER B 8   ? UNP P36959 ?   ?   'expression tag' -14 31 
2 2BWG SER B 9   ? UNP P36959 ?   ?   'expression tag' -13 32 
2 2BWG GLY B 10  ? UNP P36959 ?   ?   'expression tag' -12 33 
2 2BWG VAL B 11  ? UNP P36959 ?   ?   'expression tag' -11 34 
2 2BWG ASP B 12  ? UNP P36959 ?   ?   'expression tag' -10 35 
2 2BWG LEU B 13  ? UNP P36959 ?   ?   'expression tag' -9  36 
2 2BWG GLY B 14  ? UNP P36959 ?   ?   'expression tag' -8  37 
2 2BWG THR B 15  ? UNP P36959 ?   ?   'expression tag' -7  38 
2 2BWG GLU B 16  ? UNP P36959 ?   ?   'expression tag' -6  39 
2 2BWG ASN B 17  ? UNP P36959 ?   ?   'expression tag' -5  40 
2 2BWG LEU B 18  ? UNP P36959 ?   ?   'expression tag' -4  41 
2 2BWG TYR B 19  ? UNP P36959 ?   ?   'expression tag' -3  42 
2 2BWG PHE B 20  ? UNP P36959 ?   ?   'expression tag' -2  43 
2 2BWG GLN B 21  ? UNP P36959 ?   ?   'expression tag' -1  44 
2 2BWG SER B 22  ? UNP P36959 ?   ?   'expression tag' 0   45 
2 2BWG ILE B 278 ? UNP P36959 PHE 256 variant          256 46 
3 2BWG MET C 1   ? UNP P36959 ?   ?   'expression tag' -21 47 
3 2BWG HIS C 2   ? UNP P36959 ?   ?   'expression tag' -20 48 
3 2BWG HIS C 3   ? UNP P36959 ?   ?   'expression tag' -19 49 
3 2BWG HIS C 4   ? UNP P36959 ?   ?   'expression tag' -18 50 
3 2BWG HIS C 5   ? UNP P36959 ?   ?   'expression tag' -17 51 
3 2BWG HIS C 6   ? UNP P36959 ?   ?   'expression tag' -16 52 
3 2BWG HIS C 7   ? UNP P36959 ?   ?   'expression tag' -15 53 
3 2BWG SER C 8   ? UNP P36959 ?   ?   'expression tag' -14 54 
3 2BWG SER C 9   ? UNP P36959 ?   ?   'expression tag' -13 55 
3 2BWG GLY C 10  ? UNP P36959 ?   ?   'expression tag' -12 56 
3 2BWG VAL C 11  ? UNP P36959 ?   ?   'expression tag' -11 57 
3 2BWG ASP C 12  ? UNP P36959 ?   ?   'expression tag' -10 58 
3 2BWG LEU C 13  ? UNP P36959 ?   ?   'expression tag' -9  59 
3 2BWG GLY C 14  ? UNP P36959 ?   ?   'expression tag' -8  60 
3 2BWG THR C 15  ? UNP P36959 ?   ?   'expression tag' -7  61 
3 2BWG GLU C 16  ? UNP P36959 ?   ?   'expression tag' -6  62 
3 2BWG ASN C 17  ? UNP P36959 ?   ?   'expression tag' -5  63 
3 2BWG LEU C 18  ? UNP P36959 ?   ?   'expression tag' -4  64 
3 2BWG TYR C 19  ? UNP P36959 ?   ?   'expression tag' -3  65 
3 2BWG PHE C 20  ? UNP P36959 ?   ?   'expression tag' -2  66 
3 2BWG GLN C 21  ? UNP P36959 ?   ?   'expression tag' -1  67 
3 2BWG SER C 22  ? UNP P36959 ?   ?   'expression tag' 0   68 
3 2BWG ILE C 278 ? UNP P36959 PHE 256 variant          256 69 
4 2BWG MET D 1   ? UNP P36959 ?   ?   'expression tag' -21 70 
4 2BWG HIS D 2   ? UNP P36959 ?   ?   'expression tag' -20 71 
4 2BWG HIS D 3   ? UNP P36959 ?   ?   'expression tag' -19 72 
4 2BWG HIS D 4   ? UNP P36959 ?   ?   'expression tag' -18 73 
4 2BWG HIS D 5   ? UNP P36959 ?   ?   'expression tag' -17 74 
4 2BWG HIS D 6   ? UNP P36959 ?   ?   'expression tag' -16 75 
4 2BWG HIS D 7   ? UNP P36959 ?   ?   'expression tag' -15 76 
4 2BWG SER D 8   ? UNP P36959 ?   ?   'expression tag' -14 77 
4 2BWG SER D 9   ? UNP P36959 ?   ?   'expression tag' -13 78 
4 2BWG GLY D 10  ? UNP P36959 ?   ?   'expression tag' -12 79 
4 2BWG VAL D 11  ? UNP P36959 ?   ?   'expression tag' -11 80 
4 2BWG ASP D 12  ? UNP P36959 ?   ?   'expression tag' -10 81 
4 2BWG LEU D 13  ? UNP P36959 ?   ?   'expression tag' -9  82 
4 2BWG GLY D 14  ? UNP P36959 ?   ?   'expression tag' -8  83 
4 2BWG THR D 15  ? UNP P36959 ?   ?   'expression tag' -7  84 
4 2BWG GLU D 16  ? UNP P36959 ?   ?   'expression tag' -6  85 
4 2BWG ASN D 17  ? UNP P36959 ?   ?   'expression tag' -5  86 
4 2BWG LEU D 18  ? UNP P36959 ?   ?   'expression tag' -4  87 
4 2BWG TYR D 19  ? UNP P36959 ?   ?   'expression tag' -3  88 
4 2BWG PHE D 20  ? UNP P36959 ?   ?   'expression tag' -2  89 
4 2BWG GLN D 21  ? UNP P36959 ?   ?   'expression tag' -1  90 
4 2BWG SER D 22  ? UNP P36959 ?   ?   'expression tag' 0   91 
4 2BWG ILE D 278 ? UNP P36959 PHE 256 variant          256 92 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5GP non-polymer         . "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'              ? 'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2BWG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.2 
_exptl_crystal.density_percent_sol   42.4 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '16% PEG3350 0.30 M K3CIT' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU IMAGE PLATE' 
_diffrn_detector.pdbx_collection_date   2005-01-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'OSMIC HR MULTILAYER OPTICS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2BWG 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.900 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   154258 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.1 
_reflns.pdbx_Rmerge_I_obs            0.12000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.1400 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.830 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.50 
_reflns_shell.percent_possible_all   80.8 
_reflns_shell.Rmerge_I_obs           0.37000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.000 
_reflns_shell.pdbx_redundancy        2.27 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2BWG 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               UNVERIFIED 
_refine.ls_number_reflns_obs                     46582 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    90.1 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_R_factor_R_free                       0.245 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2520 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.941 
_refine.correlation_coeff_Fo_to_Fc_free          0.914 
_refine.B_iso_mean                               19.81 
_refine.aniso_B[1][1]                            3.10000 
_refine.aniso_B[2][2]                            -1.68000 
_refine.aniso_B[3][3]                            -2.19000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -1.74000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1EEP' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.650 
_refine.pdbx_overall_ESU_R_Free                  0.290 
_refine.overall_SU_ML                            0.222 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             18.356 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9820 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         100 
_refine_hist.number_atoms_solvent             193 
_refine_hist.number_atoms_total               10113 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 10154 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 9250  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.352  1.966  ? 13757 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.802  3.000  ? 21445 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.767  5.000  ? 1328  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.271 24.010 ? 384   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.003 15.000 ? 1679  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       21.286 15.000 ? 46    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.071  0.200  ? 1604  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 11315 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 2007  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.191  0.200  ? 2248  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.182  0.200  ? 9861  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.174  0.200  ? 4945  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.085  0.200  ? 6103  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.174  0.200  ? 399   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.130  0.200  ? 11    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.194  0.200  ? 38    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.085  0.200  ? 3     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.104  3.000  ? 6539  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.054  5.000  ? 10486 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.630  8.000  ? 3655  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.509  11.000 ? 3262  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
1 A 1918 0.05 0.05 'tight positional'  1 1  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 B 1918 0.04 0.05 'tight positional'  1 2  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
3 C 1918 0.04 0.05 'tight positional'  1 3  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
4 D 1918 0.04 0.05 'tight positional'  1 4  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 A 2656 0.31 0.50 'medium positional' 1 5  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 B 2656 0.31 0.50 'medium positional' 1 6  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
3 C 2656 0.29 0.50 'medium positional' 1 7  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
4 D 2656 0.26 0.50 'medium positional' 1 8  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 A 1918 0.11 0.50 'tight thermal'     1 9  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 B 1918 0.10 0.50 'tight thermal'     1 10 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
3 C 1918 0.10 0.50 'tight thermal'     1 11 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
4 D 1918 0.08 0.50 'tight thermal'     1 12 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 A 2656 0.77 2.00 'medium thermal'    1 13 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 B 2656 0.68 2.00 'medium thermal'    1 14 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
3 C 2656 0.66 2.00 'medium thermal'    1 15 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
4 D 2656 0.55 2.00 'medium thermal'    1 16 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.46 
_refine_ls_shell.number_reflns_R_work             2952 
_refine_ls_shell.R_factor_R_work                  0.2790 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3580 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             171 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.920800 0.217450  -0.323800 -0.334600 0.013810  -0.942260 -0.200420 0.975970  0.085470  -27.14677 -78.05757 -75.52034  
2 given ? 0.909240 -0.369890 -0.190940 0.204500  -0.002600 0.978860  -0.362570 -0.929070 0.073280  -16.18703 80.67178  -76.31460  
3 given ? 0.820140 -0.133730 -0.556320 -0.133590 -0.990180 0.041080  -0.556350 0.040630  -0.829950 -46.05553 2.96094   -151.13560 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
3 C 1 
4 D 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_auth_comp_id 
_struct_ncs_dom_lim.end_auth_comp_id 
1 A 2 A 339 1 2 ? ? ? ? ? ? ? ? 1 ? ? ? 
2 B 2 B 339 1 2 ? ? ? ? ? ? ? ? 1 ? ? ? 
3 C 2 C 339 1 2 ? ? ? ? ? ? ? ? 1 ? ? ? 
4 D 2 D 339 1 2 ? ? ? ? ? ? ? ? 1 ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2BWG 
_struct.title                     'Structure of human guanosine monophosphate reductase GMPR1 in complex with GMP' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2BWG 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'NUCLEOTIDE PATHWAY, TIM BARREL, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 33  ? LYS A 35  ? ASP A 11  LYS A 13  5 ? 3  
HELX_P HELX_P2  2  SER A 48  ? VAL A 52  ? SER A 26  VAL A 30  5 ? 5  
HELX_P HELX_P3  3  THR A 82  ? SER A 90  ? THR A 60  SER A 68  1 ? 9  
HELX_P HELX_P4  4  SER A 103 ? HIS A 114 ? SER A 81  HIS A 92  1 ? 12 
HELX_P HELX_P5  5  PRO A 115 ? GLN A 119 ? PRO A 93  GLN A 97  5 ? 5  
HELX_P HELX_P6  6  GLY A 128 ? VAL A 142 ? GLY A 106 VAL A 120 1 ? 15 
HELX_P HELX_P7  7  SER A 157 ? PHE A 171 ? SER A 135 PHE A 149 1 ? 15 
HELX_P HELX_P8  8  THR A 183 ? GLY A 194 ? THR A 161 GLY A 172 1 ? 12 
HELX_P HELX_P9  9  THR A 209 ? GLY A 215 ? THR A 187 GLY A 193 1 ? 7  
HELX_P HELX_P10 10 PRO A 219 ? LEU A 234 ? PRO A 197 LEU A 212 1 ? 16 
HELX_P HELX_P11 11 CYS A 246 ? GLY A 257 ? CYS A 224 GLY A 235 1 ? 12 
HELX_P HELX_P12 12 SER A 293 ? HIS A 300 ? SER A 271 HIS A 278 1 ? 8  
HELX_P HELX_P13 13 ASP A 322 ? GLY A 342 ? ASP A 300 GLY A 320 1 ? 21 
HELX_P HELX_P14 14 GLU A 348 ? ALA A 353 ? GLU A 326 ALA A 331 1 ? 6  
HELX_P HELX_P15 15 ASP B 33  ? LYS B 35  ? ASP B 11  LYS B 13  5 ? 3  
HELX_P HELX_P16 16 SER B 48  ? VAL B 52  ? SER B 26  VAL B 30  5 ? 5  
HELX_P HELX_P17 17 THR B 82  ? HIS B 92  ? THR B 60  HIS B 70  1 ? 11 
HELX_P HELX_P18 18 SER B 103 ? HIS B 114 ? SER B 81  HIS B 92  1 ? 12 
HELX_P HELX_P19 19 PRO B 115 ? GLN B 119 ? PRO B 93  GLN B 97  5 ? 5  
HELX_P HELX_P20 20 GLY B 128 ? VAL B 142 ? GLY B 106 VAL B 120 1 ? 15 
HELX_P HELX_P21 21 SER B 157 ? PHE B 171 ? SER B 135 PHE B 149 1 ? 15 
HELX_P HELX_P22 22 THR B 183 ? SER B 193 ? THR B 161 SER B 171 1 ? 11 
HELX_P HELX_P23 23 THR B 209 ? THR B 214 ? THR B 187 THR B 192 1 ? 6  
HELX_P HELX_P24 24 PRO B 219 ? GLY B 233 ? PRO B 197 GLY B 211 1 ? 15 
HELX_P HELX_P25 25 CYS B 246 ? GLY B 257 ? CYS B 224 GLY B 235 1 ? 12 
HELX_P HELX_P26 26 SER B 293 ? HIS B 300 ? SER B 271 HIS B 278 1 ? 8  
HELX_P HELX_P27 27 ASP B 322 ? GLY B 342 ? ASP B 300 GLY B 320 1 ? 21 
HELX_P HELX_P28 28 GLU B 348 ? ALA B 353 ? GLU B 326 ALA B 331 1 ? 6  
HELX_P HELX_P29 29 ASP C 33  ? LYS C 35  ? ASP C 11  LYS C 13  5 ? 3  
HELX_P HELX_P30 30 SER C 48  ? VAL C 52  ? SER C 26  VAL C 30  5 ? 5  
HELX_P HELX_P31 31 THR C 82  ? HIS C 92  ? THR C 60  HIS C 70  1 ? 11 
HELX_P HELX_P32 32 SER C 103 ? HIS C 114 ? SER C 81  HIS C 92  1 ? 12 
HELX_P HELX_P33 33 PRO C 115 ? GLN C 119 ? PRO C 93  GLN C 97  5 ? 5  
HELX_P HELX_P34 34 GLY C 128 ? VAL C 142 ? GLY C 106 VAL C 120 1 ? 15 
HELX_P HELX_P35 35 SER C 157 ? PHE C 171 ? SER C 135 PHE C 149 1 ? 15 
HELX_P HELX_P36 36 THR C 183 ? SER C 193 ? THR C 161 SER C 171 1 ? 11 
HELX_P HELX_P37 37 THR C 209 ? GLY C 215 ? THR C 187 GLY C 193 1 ? 7  
HELX_P HELX_P38 38 PRO C 219 ? LEU C 234 ? PRO C 197 LEU C 212 1 ? 16 
HELX_P HELX_P39 39 CYS C 246 ? GLY C 257 ? CYS C 224 GLY C 235 1 ? 12 
HELX_P HELX_P40 40 SER C 293 ? HIS C 300 ? SER C 271 HIS C 278 1 ? 8  
HELX_P HELX_P41 41 ASP C 322 ? GLY C 342 ? ASP C 300 GLY C 320 1 ? 21 
HELX_P HELX_P42 42 GLU C 348 ? ALA C 353 ? GLU C 326 ALA C 331 1 ? 6  
HELX_P HELX_P43 43 ASP D 33  ? LYS D 35  ? ASP D 11  LYS D 13  5 ? 3  
HELX_P HELX_P44 44 SER D 48  ? VAL D 52  ? SER D 26  VAL D 30  5 ? 5  
HELX_P HELX_P45 45 THR D 82  ? HIS D 92  ? THR D 60  HIS D 70  1 ? 11 
HELX_P HELX_P46 46 SER D 103 ? HIS D 114 ? SER D 81  HIS D 92  1 ? 12 
HELX_P HELX_P47 47 PRO D 115 ? GLN D 119 ? PRO D 93  GLN D 97  5 ? 5  
HELX_P HELX_P48 48 GLY D 128 ? VAL D 142 ? GLY D 106 VAL D 120 1 ? 15 
HELX_P HELX_P49 49 SER D 157 ? PHE D 171 ? SER D 135 PHE D 149 1 ? 15 
HELX_P HELX_P50 50 THR D 183 ? SER D 193 ? THR D 161 SER D 171 1 ? 11 
HELX_P HELX_P51 51 THR D 209 ? THR D 214 ? THR D 187 THR D 192 1 ? 6  
HELX_P HELX_P52 52 PRO D 219 ? GLY D 233 ? PRO D 197 GLY D 211 1 ? 15 
HELX_P HELX_P53 53 CYS D 246 ? ALA D 256 ? CYS D 224 ALA D 234 1 ? 11 
HELX_P HELX_P54 54 SER D 293 ? HIS D 300 ? SER D 271 HIS D 278 1 ? 8  
HELX_P HELX_P55 55 ASP D 322 ? GLY D 342 ? ASP D 300 GLY D 320 1 ? 21 
HELX_P HELX_P56 56 LYS D 347 ? ALA D 353 ? LYS D 325 ALA D 331 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A GLY 203 O   ? ? ? 1_555 E K   . K ? ? A GLY 181  A K   1339 1_555 ? ? ? ? ? ? ? 2.466 ? ? 
metalc2  metalc ? ? A GLY 205 O   ? ? ? 1_555 E K   . K ? ? A GLY 183  A K   1339 1_555 ? ? ? ? ? ? ? 2.750 ? ? 
metalc3  metalc ? ? A CYS 208 O   ? ? ? 1_555 E K   . K ? ? A CYS 186  A K   1339 1_555 ? ? ? ? ? ? ? 3.061 ? ? 
metalc4  metalc ? ? A ARG 211 NH2 ? ? ? 1_555 E K   . K ? ? A ARG 189  A K   1339 1_555 ? ? ? ? ? ? ? 3.158 ? ? 
metalc5  metalc ? ? E K   .   K   ? ? ? 1_555 M HOH . O ? ? A K   1339 A HOH 2036 1_555 ? ? ? ? ? ? ? 3.151 ? ? 
metalc6  metalc ? ? B GLY 203 O   ? ? ? 1_555 G K   . K ? ? B GLY 181  B K   1338 1_555 ? ? ? ? ? ? ? 2.999 ? ? 
metalc7  metalc ? ? B GLY 205 O   ? ? ? 1_555 G K   . K ? ? B GLY 183  B K   1338 1_555 ? ? ? ? ? ? ? 2.788 ? ? 
metalc8  metalc ? ? B CYS 208 O   ? ? ? 1_555 G K   . K ? ? B CYS 186  B K   1338 1_555 ? ? ? ? ? ? ? 2.793 ? ? 
metalc9  metalc ? ? G K   .   K   ? ? ? 1_555 N HOH . O ? ? B K   1338 B HOH 2027 1_555 ? ? ? ? ? ? ? 3.497 ? ? 
metalc10 metalc ? ? C GLY 203 O   ? ? ? 1_555 I K   . K ? ? C GLY 181  C K   1338 1_555 ? ? ? ? ? ? ? 2.938 ? ? 
metalc11 metalc ? ? C GLY 205 O   ? ? ? 1_555 I K   . K ? ? C GLY 183  C K   1338 1_555 ? ? ? ? ? ? ? 2.850 ? ? 
metalc12 metalc ? ? C CYS 208 O   ? ? ? 1_555 I K   . K ? ? C CYS 186  C K   1338 1_555 ? ? ? ? ? ? ? 2.784 ? ? 
metalc13 metalc ? ? C ARG 211 NH2 ? ? ? 1_555 I K   . K ? ? C ARG 189  C K   1338 1_555 ? ? ? ? ? ? ? 3.518 ? ? 
metalc14 metalc ? ? D GLY 203 O   ? ? ? 1_555 K K   . K ? ? D GLY 181  D K   1338 1_555 ? ? ? ? ? ? ? 2.803 ? ? 
metalc15 metalc ? ? D GLY 205 O   ? ? ? 1_555 K K   . K ? ? D GLY 183  D K   1338 1_555 ? ? ? ? ? ? ? 2.768 ? ? 
metalc16 metalc ? ? D CYS 208 O   ? ? ? 1_555 K K   . K ? ? D CYS 186  D K   1338 1_555 ? ? ? ? ? ? ? 2.969 ? ? 
metalc17 metalc ? ? D ARG 211 NH2 ? ? ? 1_555 K K   . K ? ? D ARG 189  D K   1338 1_555 ? ? ? ? ? ? ? 3.490 ? ? 
metalc18 metalc ? ? K K   .   K   ? ? ? 1_555 P HOH . O ? ? D K   1338 D HOH 2011 1_555 ? ? ? ? ? ? ? 3.638 ? ? 
metalc19 metalc ? ? K K   .   K   ? ? ? 1_555 P HOH . O ? ? D K   1338 D HOH 2026 1_555 ? ? ? ? ? ? ? 3.662 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 179 A . ? GLY 157 A ASN 180 A ? ASN 158 A 1 3.24 
2 GLY 179 B . ? GLY 157 B ASN 180 B ? ASN 158 B 1 0.09 
3 GLY 179 C . ? GLY 157 C ASN 180 C ? ASN 158 C 1 3.21 
4 GLY 179 D . ? GLY 157 D ASN 180 D ? ASN 158 D 1 1.76 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 3  ? 
AC ? 10 ? 
AD ? 3  ? 
BA ? 3  ? 
BB ? 10 ? 
BC ? 2  ? 
CA ? 3  ? 
CB ? 21 ? 
CC ? 2  ? 
DA ? 18 ? 
DB ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? parallel      
AA 2  3  ? anti-parallel 
AB 1  2  ? anti-parallel 
AB 2  3  ? parallel      
AC 1  2  ? anti-parallel 
AC 2  3  ? parallel      
AC 3  4  ? parallel      
AC 4  5  ? parallel      
AC 5  6  ? parallel      
AC 6  7  ? parallel      
AC 7  8  ? parallel      
AC 8  9  ? parallel      
AD 1  2  ? anti-parallel 
AD 2  3  ? anti-parallel 
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? parallel      
BB 3  4  ? parallel      
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BC 1  2  ? anti-parallel 
CA 1  2  ? parallel      
CA 2  3  ? anti-parallel 
CB 1  2  ? anti-parallel 
CB 2  3  ? parallel      
CB 3  4  ? parallel      
CB 4  5  ? parallel      
CB 6  7  ? anti-parallel 
CB 8  9  ? parallel      
CB 10 11 ? parallel      
CB 12 13 ? parallel      
CB 14 15 ? parallel      
CB 16 17 ? parallel      
CB 18 19 ? parallel      
CB 20 21 ? parallel      
CC 1  2  ? anti-parallel 
DA 1  2  ? anti-parallel 
DA 2  3  ? parallel      
DA 3  4  ? anti-parallel 
DA 5  6  ? parallel      
DA 7  8  ? parallel      
DA 9  10 ? parallel      
DA 11 12 ? parallel      
DA 13 14 ? parallel      
DA 15 16 ? parallel      
DA 17 18 ? parallel      
DB 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  ARG A 25  ? LEU A 30  ? ARG A 3   LEU A 8   
AA 2  THR C 354 ? ARG C 357 ? THR C 332 ARG C 335 
AA 3  VAL C 37  ? LEU C 39  ? VAL C 15  LEU C 17  
AB 1  VAL A 37  ? LEU A 39  ? VAL A 15  LEU A 17  
AB 2  THR A 354 ? ARG A 357 ? THR A 332 ARG A 335 
AB 3  ARG B 25  ? LEU B 30  ? ARG B 3   LEU B 8   
AC 1  ARG A 56  ? THR A 59  ? ARG A 34  THR A 37  
AC 2  THR A 66  ? VAL A 74  ? THR A 44  VAL A 52  
AC 3  PHE A 260 ? LEU A 263 ? PHE A 238 LEU A 241 
AC 4  HIS A 237 ? ASP A 241 ? HIS A 215 ASP A 219 
AC 5  ILE A 197 ? VAL A 200 ? ILE A 175 VAL A 178 
AC 6  THR A 175 ? VAL A 181 ? THR A 153 VAL A 159 
AC 7  PHE A 147 ? ASP A 151 ? PHE A 125 ASP A 129 
AC 8  VAL A 121 ? SER A 125 ? VAL A 99  SER A 103 
AC 9  MET A 94  ? ALA A 97  ? MET A 72  ALA A 75  
AC 10 ARG A 56  ? THR A 59  ? ARG A 34  THR A 37  
AD 1  ILE A 278 ? GLU A 279 ? ILE A 256 GLU A 257 
AD 2  LYS A 284 ? TYR A 289 ? LYS A 262 TYR A 267 
AD 3  THR A 314 ? PRO A 318 ? THR A 292 PRO A 296 
BA 1  VAL B 37  ? LEU B 39  ? VAL B 15  LEU B 17  
BA 2  THR B 354 ? ARG B 357 ? THR B 332 ARG B 335 
BA 3  ARG D 25  ? LEU D 30  ? ARG D 3   LEU D 8   
BB 1  ARG B 56  ? THR B 59  ? ARG B 34  THR B 37  
BB 2  THR B 66  ? VAL B 74  ? THR B 44  VAL B 52  
BB 3  PHE B 260 ? LEU B 263 ? PHE B 238 LEU B 241 
BB 4  HIS B 237 ? ASP B 241 ? HIS B 215 ASP B 219 
BB 5  ILE B 197 ? VAL B 200 ? ILE B 175 VAL B 178 
BB 6  THR B 175 ? VAL B 181 ? THR B 153 VAL B 159 
BB 7  PHE B 147 ? ASP B 151 ? PHE B 125 ASP B 129 
BB 8  VAL B 121 ? SER B 125 ? VAL B 99  SER B 103 
BB 9  MET B 94  ? ALA B 97  ? MET B 72  ALA B 75  
BB 10 ARG B 56  ? THR B 59  ? ARG B 34  THR B 37  
BC 1  LEU B 285 ? TYR B 289 ? LEU B 263 TYR B 267 
BC 2  THR B 314 ? PRO B 318 ? THR B 292 PRO B 296 
CA 1  ARG C 25  ? LYS C 31  ? ARG C 3   LYS C 9   
CA 2  THR D 354 ? VAL D 358 ? THR D 332 VAL D 336 
CA 3  VAL D 37  ? LEU D 39  ? VAL D 15  LEU D 17  
CB 1  ARG C 56  ? THR C 59  ? ARG C 34  THR C 37  
CB 2  THR C 66  ? VAL C 74  ? THR C 44  VAL C 52  
CB 3  PHE C 260 ? LEU C 263 ? PHE C 238 LEU C 241 
CB 4  HIS C 237 ? ASP C 241 ? HIS C 215 ASP C 219 
CB 5  ILE C 197 ? VAL C 200 ? ILE C 175 VAL C 178 
CB 6  THR C 66  ? VAL C 74  ? THR C 44  VAL C 52  
CB 7  ARG C 56  ? THR C 59  ? ARG C 34  THR C 37  
CB 8  MET C 94  ? ILE C 98  ? MET C 72  ILE C 76  
CB 9  THR C 66  ? VAL C 74  ? THR C 44  VAL C 52  
CB 10 VAL C 121 ? SER C 125 ? VAL C 99  SER C 103 
CB 11 MET C 94  ? ILE C 98  ? MET C 72  ILE C 76  
CB 12 PHE C 147 ? ASP C 151 ? PHE C 125 ASP C 129 
CB 13 VAL C 121 ? SER C 125 ? VAL C 99  SER C 103 
CB 14 THR C 175 ? VAL C 181 ? THR C 153 VAL C 159 
CB 15 PHE C 147 ? ASP C 151 ? PHE C 125 ASP C 129 
CB 16 ILE C 197 ? VAL C 200 ? ILE C 175 VAL C 178 
CB 17 THR C 175 ? VAL C 181 ? THR C 153 VAL C 159 
CB 18 HIS C 237 ? ASP C 241 ? HIS C 215 ASP C 219 
CB 19 ILE C 197 ? VAL C 200 ? ILE C 175 VAL C 178 
CB 20 PHE C 260 ? LEU C 263 ? PHE C 238 LEU C 241 
CB 21 THR C 66  ? VAL C 74  ? THR C 44  VAL C 52  
CC 1  LEU C 285 ? TYR C 289 ? LEU C 263 TYR C 267 
CC 2  THR C 314 ? PRO C 318 ? THR C 292 PRO C 296 
DA 1  ARG D 56  ? THR D 59  ? ARG D 34  THR D 37  
DA 2  THR D 66  ? VAL D 74  ? THR D 44  VAL D 52  
DA 3  THR D 66  ? VAL D 74  ? THR D 44  VAL D 52  
DA 4  ARG D 56  ? THR D 59  ? ARG D 34  THR D 37  
DA 5  MET D 94  ? ILE D 98  ? MET D 72  ILE D 76  
DA 6  THR D 66  ? VAL D 74  ? THR D 44  VAL D 52  
DA 7  VAL D 121 ? SER D 125 ? VAL D 99  SER D 103 
DA 8  MET D 94  ? ILE D 98  ? MET D 72  ILE D 76  
DA 9  PHE D 147 ? ASP D 151 ? PHE D 125 ASP D 129 
DA 10 VAL D 121 ? SER D 125 ? VAL D 99  SER D 103 
DA 11 THR D 175 ? VAL D 181 ? THR D 153 VAL D 159 
DA 12 PHE D 147 ? ASP D 151 ? PHE D 125 ASP D 129 
DA 13 ILE D 197 ? VAL D 200 ? ILE D 175 VAL D 178 
DA 14 THR D 175 ? VAL D 181 ? THR D 153 VAL D 159 
DA 15 HIS D 237 ? ASP D 241 ? HIS D 215 ASP D 219 
DA 16 ILE D 197 ? VAL D 200 ? ILE D 175 VAL D 178 
DA 17 PHE D 260 ? LEU D 263 ? PHE D 238 LEU D 241 
DA 18 THR D 66  ? VAL D 74  ? THR D 44  VAL D 52  
DB 1  LEU D 285 ? TYR D 289 ? LEU D 263 TYR D 267 
DB 2  THR D 314 ? PRO D 318 ? THR D 292 PRO D 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N ASP A 27  ? N ASP A 5   O PHE C 355 ? O PHE C 333 
AA 2  3  N ILE C 356 ? N ILE C 334 O LEU C 38  ? O LEU C 16  
AB 1  2  N LEU A 38  ? N LEU A 16  O ILE A 356 ? O ILE A 334 
AB 2  3  N PHE A 355 ? N PHE A 333 O ARG B 25  ? O ARG B 3   
AC 1  2  N PHE A 58  ? N PHE A 36  O TYR A 67  ? O TYR A 45  
AC 2  3  N ILE A 73  ? N ILE A 51  O VAL A 261 ? O VAL A 239 
AC 3  4  N PHE A 260 ? N PHE A 238 O ILE A 238 ? O ILE A 216 
AC 4  5  N ILE A 239 ? N ILE A 217 O ILE A 198 ? O ILE A 176 
AC 5  6  N ILE A 197 ? N ILE A 175 O ILE A 176 ? O ILE A 154 
AC 6  7  N MET A 177 ? N MET A 155 O ILE A 148 ? O ILE A 126 
AC 7  8  N CYS A 149 ? N CYS A 127 O VAL A 123 ? O VAL A 101 
AC 8  9  N ALA A 122 ? N ALA A 100 O THR A 96  ? O THR A 74  
AD 1  2  N ILE A 278 ? N ILE A 256 O LEU A 285 ? O LEU A 263 
AD 2  3  N PHE A 288 ? N PHE A 266 O VAL A 315 ? O VAL A 293 
BA 1  2  N LEU B 38  ? N LEU B 16  O ILE B 356 ? O ILE B 334 
BA 2  3  N PHE B 355 ? N PHE B 333 O ARG D 25  ? O ARG D 3   
BB 1  2  N PHE B 58  ? N PHE B 36  O TYR B 67  ? O TYR B 45  
BB 2  3  N ILE B 73  ? N ILE B 51  O VAL B 261 ? O VAL B 239 
BB 3  4  N PHE B 260 ? N PHE B 238 O ILE B 238 ? O ILE B 216 
BB 4  5  N ILE B 239 ? N ILE B 217 O ILE B 198 ? O ILE B 176 
BB 5  6  N LYS B 199 ? N LYS B 177 O ALA B 178 ? O ALA B 156 
BB 6  7  N MET B 177 ? N MET B 155 O ILE B 148 ? O ILE B 126 
BB 7  8  N CYS B 149 ? N CYS B 127 O VAL B 123 ? O VAL B 101 
BB 8  9  N ALA B 122 ? N ALA B 100 O THR B 96  ? O THR B 74  
BC 1  2  N PHE B 288 ? N PHE B 266 O VAL B 315 ? O VAL B 293 
CA 1  2  N ASP C 27  ? N ASP C 5   O PHE D 355 ? O PHE D 333 
CA 2  3  N ILE D 356 ? N ILE D 334 O LEU D 38  ? O LEU D 16  
CB 1  2  N PHE C 58  ? N PHE C 36  O TYR C 67  ? O TYR C 45  
CB 2  3  N ILE C 73  ? N ILE C 51  O VAL C 261 ? O VAL C 239 
CB 3  4  N PHE C 260 ? N PHE C 238 O ILE C 238 ? O ILE C 216 
CB 4  5  N ILE C 239 ? N ILE C 217 O ILE C 198 ? O ILE C 176 
CB 6  7  N GLY C 69  ? N GLY C 47  O ARG C 56  ? O ARG C 34  
CB 8  9  N PHE C 95  ? N PHE C 73  O ILE C 72  ? O ILE C 50  
CB 10 11 N ALA C 122 ? N ALA C 100 O THR C 96  ? O THR C 74  
CB 12 13 N CYS C 149 ? N CYS C 127 O VAL C 123 ? O VAL C 101 
CB 14 15 N MET C 177 ? N MET C 155 O ILE C 148 ? O ILE C 126 
CB 16 17 N ILE C 197 ? N ILE C 175 O ILE C 176 ? O ILE C 154 
CB 18 19 N ILE C 239 ? N ILE C 217 O ILE C 198 ? O ILE C 176 
CB 20 21 N VAL C 261 ? N VAL C 239 O PRO C 71  ? O PRO C 49  
CC 1  2  N PHE C 288 ? N PHE C 266 O VAL C 315 ? O VAL C 293 
DA 1  2  N PHE D 58  ? N PHE D 36  O TYR D 67  ? O TYR D 45  
DA 2  3  N ILE D 72  ? N ILE D 50  O ILE D 70  ? O ILE D 48  
DA 3  4  N GLY D 69  ? N GLY D 47  O ARG D 56  ? O ARG D 34  
DA 5  6  N PHE D 95  ? N PHE D 73  O ILE D 72  ? O ILE D 50  
DA 7  8  N ALA D 122 ? N ALA D 100 O THR D 96  ? O THR D 74  
DA 9  10 N CYS D 149 ? N CYS D 127 O VAL D 123 ? O VAL D 101 
DA 11 12 N MET D 177 ? N MET D 155 O ILE D 148 ? O ILE D 126 
DA 13 14 N ILE D 197 ? N ILE D 175 O ILE D 176 ? O ILE D 154 
DA 15 16 N ILE D 239 ? N ILE D 217 O ILE D 198 ? O ILE D 176 
DA 17 18 N VAL D 261 ? N VAL D 239 O PRO D 71  ? O PRO D 49  
DB 1  2  N PHE D 288 ? N PHE D 266 O VAL D 315 ? O VAL D 293 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE K A1339'   
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE K B1338'   
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE K C1338'   
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE K D1338'   
AC5 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE 5GP A1340' 
AC6 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE 5GP B1339' 
AC7 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE 5GP C1339' 
AC8 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE 5GP D1339' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  GLY A 203 ? GLY A 181  . ? 1_555 ? 
2   AC1 5  PRO A 204 ? PRO A 182  . ? 1_555 ? 
3   AC1 5  GLY A 205 ? GLY A 183  . ? 1_555 ? 
4   AC1 5  CYS A 208 ? CYS A 186  . ? 1_555 ? 
5   AC1 5  ARG A 211 ? ARG A 189  . ? 1_555 ? 
6   AC2 3  GLY B 203 ? GLY B 181  . ? 1_555 ? 
7   AC2 3  GLY B 205 ? GLY B 183  . ? 1_555 ? 
8   AC2 3  CYS B 208 ? CYS B 186  . ? 1_555 ? 
9   AC3 4  GLY C 203 ? GLY C 181  . ? 1_555 ? 
10  AC3 4  GLY C 205 ? GLY C 183  . ? 1_555 ? 
11  AC3 4  CYS C 208 ? CYS C 186  . ? 1_555 ? 
12  AC3 4  ARG C 211 ? ARG C 189  . ? 1_555 ? 
13  AC4 4  GLY D 203 ? GLY D 181  . ? 1_555 ? 
14  AC4 4  GLY D 205 ? GLY D 183  . ? 1_555 ? 
15  AC4 4  CYS D 208 ? CYS D 186  . ? 1_555 ? 
16  AC4 4  ARG D 211 ? ARG D 189  . ? 1_555 ? 
17  AC5 24 ALA A 75  ? ALA A 53   . ? 1_555 ? 
18  AC5 24 MET A 77  ? MET A 55   . ? 1_555 ? 
19  AC5 24 GLY A 205 ? GLY A 183  . ? 1_555 ? 
20  AC5 24 SER A 206 ? SER A 184  . ? 1_555 ? 
21  AC5 24 CYS A 208 ? CYS A 186  . ? 1_555 ? 
22  AC5 24 ASP A 241 ? ASP A 219  . ? 1_555 ? 
23  AC5 24 GLY A 242 ? GLY A 220  . ? 1_555 ? 
24  AC5 24 GLY A 243 ? GLY A 221  . ? 1_555 ? 
25  AC5 24 MET A 262 ? MET A 240  . ? 1_555 ? 
26  AC5 24 LEU A 263 ? LEU A 241  . ? 1_555 ? 
27  AC5 24 GLY A 264 ? GLY A 242  . ? 1_555 ? 
28  AC5 24 GLY A 265 ? GLY A 243  . ? 1_555 ? 
29  AC5 24 GLY A 290 ? GLY A 268  . ? 1_555 ? 
30  AC5 24 MET A 291 ? MET A 269  . ? 1_555 ? 
31  AC5 24 SER A 292 ? SER A 270  . ? 1_555 ? 
32  AC5 24 ARG A 308 ? ARG A 286  . ? 1_555 ? 
33  AC5 24 ALA A 309 ? ALA A 287  . ? 1_555 ? 
34  AC5 24 SER A 310 ? SER A 288  . ? 1_555 ? 
35  AC5 24 GLY A 312 ? GLY A 290  . ? 1_555 ? 
36  AC5 24 HOH M .   ? HOH A 2009 . ? 1_555 ? 
37  AC5 24 HOH M .   ? HOH A 2046 . ? 1_555 ? 
38  AC5 24 HOH M .   ? HOH A 2058 . ? 1_555 ? 
39  AC5 24 HOH M .   ? HOH A 2059 . ? 1_555 ? 
40  AC5 24 HOH M .   ? HOH A 2060 . ? 1_555 ? 
41  AC6 23 ALA B 75  ? ALA B 53   . ? 1_555 ? 
42  AC6 23 MET B 77  ? MET B 55   . ? 1_555 ? 
43  AC6 23 ASN B 180 ? ASN B 158  . ? 1_555 ? 
44  AC6 23 GLY B 205 ? GLY B 183  . ? 1_555 ? 
45  AC6 23 SER B 206 ? SER B 184  . ? 1_555 ? 
46  AC6 23 CYS B 208 ? CYS B 186  . ? 1_555 ? 
47  AC6 23 ASP B 241 ? ASP B 219  . ? 1_555 ? 
48  AC6 23 GLY B 242 ? GLY B 220  . ? 1_555 ? 
49  AC6 23 GLY B 243 ? GLY B 221  . ? 1_555 ? 
50  AC6 23 LEU B 263 ? LEU B 241  . ? 1_555 ? 
51  AC6 23 GLY B 264 ? GLY B 242  . ? 1_555 ? 
52  AC6 23 GLY B 265 ? GLY B 243  . ? 1_555 ? 
53  AC6 23 GLY B 290 ? GLY B 268  . ? 1_555 ? 
54  AC6 23 MET B 291 ? MET B 269  . ? 1_555 ? 
55  AC6 23 SER B 292 ? SER B 270  . ? 1_555 ? 
56  AC6 23 ARG B 308 ? ARG B 286  . ? 1_555 ? 
57  AC6 23 ALA B 309 ? ALA B 287  . ? 1_555 ? 
58  AC6 23 SER B 310 ? SER B 288  . ? 1_555 ? 
59  AC6 23 GLY B 312 ? GLY B 290  . ? 1_555 ? 
60  AC6 23 HOH N .   ? HOH B 2010 . ? 1_555 ? 
61  AC6 23 HOH N .   ? HOH B 2036 . ? 1_555 ? 
62  AC6 23 HOH N .   ? HOH B 2049 . ? 1_555 ? 
63  AC6 23 HOH N .   ? HOH B 2050 . ? 1_555 ? 
64  AC7 21 ALA C 75  ? ALA C 53   . ? 1_555 ? 
65  AC7 21 MET C 77  ? MET C 55   . ? 1_555 ? 
66  AC7 21 ASN C 180 ? ASN C 158  . ? 1_555 ? 
67  AC7 21 GLY C 205 ? GLY C 183  . ? 1_555 ? 
68  AC7 21 SER C 206 ? SER C 184  . ? 1_555 ? 
69  AC7 21 CYS C 208 ? CYS C 186  . ? 1_555 ? 
70  AC7 21 ASP C 241 ? ASP C 219  . ? 1_555 ? 
71  AC7 21 GLY C 242 ? GLY C 220  . ? 1_555 ? 
72  AC7 21 GLY C 243 ? GLY C 221  . ? 1_555 ? 
73  AC7 21 MET C 262 ? MET C 240  . ? 1_555 ? 
74  AC7 21 GLY C 264 ? GLY C 242  . ? 1_555 ? 
75  AC7 21 GLY C 265 ? GLY C 243  . ? 1_555 ? 
76  AC7 21 GLY C 290 ? GLY C 268  . ? 1_555 ? 
77  AC7 21 MET C 291 ? MET C 269  . ? 1_555 ? 
78  AC7 21 SER C 292 ? SER C 270  . ? 1_555 ? 
79  AC7 21 ARG C 308 ? ARG C 286  . ? 1_555 ? 
80  AC7 21 SER C 310 ? SER C 288  . ? 1_555 ? 
81  AC7 21 GLY C 312 ? GLY C 290  . ? 1_555 ? 
82  AC7 21 HOH O .   ? HOH C 2033 . ? 1_555 ? 
83  AC7 21 HOH O .   ? HOH C 2046 . ? 1_555 ? 
84  AC7 21 HOH O .   ? HOH C 2047 . ? 1_555 ? 
85  AC8 20 ALA D 75  ? ALA D 53   . ? 1_555 ? 
86  AC8 20 MET D 77  ? MET D 55   . ? 1_555 ? 
87  AC8 20 ASN D 180 ? ASN D 158  . ? 1_555 ? 
88  AC8 20 GLY D 205 ? GLY D 183  . ? 1_555 ? 
89  AC8 20 SER D 206 ? SER D 184  . ? 1_555 ? 
90  AC8 20 CYS D 208 ? CYS D 186  . ? 1_555 ? 
91  AC8 20 ASP D 241 ? ASP D 219  . ? 1_555 ? 
92  AC8 20 GLY D 242 ? GLY D 220  . ? 1_555 ? 
93  AC8 20 GLY D 243 ? GLY D 221  . ? 1_555 ? 
94  AC8 20 LEU D 263 ? LEU D 241  . ? 1_555 ? 
95  AC8 20 GLY D 264 ? GLY D 242  . ? 1_555 ? 
96  AC8 20 GLY D 265 ? GLY D 243  . ? 1_555 ? 
97  AC8 20 GLY D 290 ? GLY D 268  . ? 1_555 ? 
98  AC8 20 MET D 291 ? MET D 269  . ? 1_555 ? 
99  AC8 20 SER D 292 ? SER D 270  . ? 1_555 ? 
100 AC8 20 ARG D 308 ? ARG D 286  . ? 1_555 ? 
101 AC8 20 ALA D 309 ? ALA D 287  . ? 1_555 ? 
102 AC8 20 SER D 310 ? SER D 288  . ? 1_555 ? 
103 AC8 20 GLY D 312 ? GLY D 290  . ? 1_555 ? 
104 AC8 20 HOH P .   ? HOH D 2029 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2BWG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2BWG 
_atom_sites.fract_transf_matrix[1][1]   0.018079 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004088 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008740 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008905 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . PRO A 1 24  ? 17.007  18.360  -75.442  1.00 65.31 ? 2    PRO A N     1 
ATOM   2     C CA    . PRO A 1 24  ? 15.806  17.516  -75.484  1.00 63.65 ? 2    PRO A CA    1 
ATOM   3     C C     . PRO A 1 24  ? 16.000  16.237  -76.326  1.00 60.16 ? 2    PRO A C     1 
ATOM   4     O O     . PRO A 1 24  ? 15.604  16.181  -77.492  1.00 61.61 ? 2    PRO A O     1 
ATOM   5     C CB    . PRO A 1 24  ? 14.721  18.440  -76.068  1.00 63.65 ? 2    PRO A CB    1 
ATOM   6     C CG    . PRO A 1 24  ? 15.336  19.783  -76.217  1.00 64.71 ? 2    PRO A CG    1 
ATOM   7     C CD    . PRO A 1 24  ? 16.824  19.637  -76.146  1.00 65.53 ? 2    PRO A CD    1 
ATOM   8     N N     . ARG A 1 25  ? 16.604  15.224  -75.707  1.00 54.37 ? 3    ARG A N     1 
ATOM   9     C CA    . ARG A 1 25  ? 16.921  13.953  -76.361  1.00 51.51 ? 3    ARG A CA    1 
ATOM   10    C C     . ARG A 1 25  ? 15.774  12.930  -76.251  1.00 51.45 ? 3    ARG A C     1 
ATOM   11    O O     . ARG A 1 25  ? 15.053  12.879  -75.245  1.00 51.15 ? 3    ARG A O     1 
ATOM   12    C CB    . ARG A 1 25  ? 18.204  13.348  -75.760  1.00 51.43 ? 3    ARG A CB    1 
ATOM   13    N N     . ILE A 1 26  ? 15.612  12.136  -77.312  1.00 52.58 ? 4    ILE A N     1 
ATOM   14    C CA    . ILE A 1 26  ? 14.720  10.986  -77.316  1.00 52.47 ? 4    ILE A CA    1 
ATOM   15    C C     . ILE A 1 26  ? 15.560  9.728   -77.210  1.00 52.50 ? 4    ILE A C     1 
ATOM   16    O O     . ILE A 1 26  ? 16.470  9.511   -78.010  1.00 51.87 ? 4    ILE A O     1 
ATOM   17    C CB    . ILE A 1 26  ? 13.899  10.899  -78.609  1.00 52.08 ? 4    ILE A CB    1 
ATOM   18    C CG1   . ILE A 1 26  ? 13.142  12.207  -78.848  1.00 51.29 ? 4    ILE A CG1   1 
ATOM   19    C CG2   . ILE A 1 26  ? 12.940  9.710   -78.546  1.00 51.97 ? 4    ILE A CG2   1 
ATOM   20    C CD1   . ILE A 1 26  ? 12.421  12.271  -80.179  1.00 51.25 ? 4    ILE A CD1   1 
ATOM   21    N N     . ASP A 1 27  ? 15.247  8.905   -76.214  1.00 53.01 ? 5    ASP A N     1 
ATOM   22    C CA    . ASP A 1 27  ? 15.902  7.614   -76.020  1.00 52.37 ? 5    ASP A CA    1 
ATOM   23    C C     . ASP A 1 27  ? 15.524  6.701   -77.187  1.00 49.90 ? 5    ASP A C     1 
ATOM   24    O O     . ASP A 1 27  ? 14.338  6.488   -77.463  1.00 47.48 ? 5    ASP A O     1 
ATOM   25    C CB    . ASP A 1 27  ? 15.459  7.003   -74.679  1.00 53.24 ? 5    ASP A CB    1 
ATOM   26    C CG    . ASP A 1 27  ? 16.367  5.875   -74.199  1.00 55.27 ? 5    ASP A CG    1 
ATOM   27    O OD1   . ASP A 1 27  ? 16.564  4.886   -74.940  1.00 57.06 ? 5    ASP A OD1   1 
ATOM   28    O OD2   . ASP A 1 27  ? 16.858  5.972   -73.051  1.00 53.86 ? 5    ASP A OD2   1 
ATOM   29    N N     . ALA A 1 28  ? 16.544  6.189   -77.871  1.00 48.80 ? 6    ALA A N     1 
ATOM   30    C CA    . ALA A 1 28  ? 16.374  5.306   -79.033  1.00 48.71 ? 6    ALA A CA    1 
ATOM   31    C C     . ALA A 1 28  ? 15.669  3.980   -78.682  1.00 47.62 ? 6    ALA A C     1 
ATOM   32    O O     . ALA A 1 28  ? 14.809  3.485   -79.434  1.00 46.23 ? 6    ALA A O     1 
ATOM   33    C CB    . ALA A 1 28  ? 17.743  5.007   -79.653  1.00 48.61 ? 6    ALA A CB    1 
ATOM   34    N N     . ASP A 1 29  ? 16.060  3.418   -77.537  1.00 45.85 ? 7    ASP A N     1 
ATOM   35    C CA    . ASP A 1 29  ? 15.456  2.206   -76.996  1.00 43.90 ? 7    ASP A CA    1 
ATOM   36    C C     . ASP A 1 29  ? 13.974  2.419   -76.706  1.00 40.17 ? 7    ASP A C     1 
ATOM   37    O O     . ASP A 1 29  ? 13.598  3.338   -75.970  1.00 40.55 ? 7    ASP A O     1 
ATOM   38    C CB    . ASP A 1 29  ? 16.177  1.798   -75.703  1.00 44.62 ? 7    ASP A CB    1 
ATOM   39    C CG    . ASP A 1 29  ? 15.666  0.482   -75.123  1.00 49.29 ? 7    ASP A CG    1 
ATOM   40    O OD1   . ASP A 1 29  ? 15.224  -0.395  -75.895  1.00 55.68 ? 7    ASP A OD1   1 
ATOM   41    O OD2   . ASP A 1 29  ? 15.725  0.320   -73.882  1.00 50.93 ? 7    ASP A OD2   1 
ATOM   42    N N     . LEU A 1 30  ? 13.139  1.577   -77.314  1.00 36.33 ? 8    LEU A N     1 
ATOM   43    C CA    . LEU A 1 30  ? 11.722  1.513   -76.987  1.00 32.86 ? 8    LEU A CA    1 
ATOM   44    C C     . LEU A 1 30  ? 11.572  0.807   -75.655  1.00 30.61 ? 8    LEU A C     1 
ATOM   45    O O     . LEU A 1 30  ? 12.171  -0.241  -75.434  1.00 32.04 ? 8    LEU A O     1 
ATOM   46    C CB    . LEU A 1 30  ? 10.945  0.741   -78.050  1.00 32.15 ? 8    LEU A CB    1 
ATOM   47    C CG    . LEU A 1 30  ? 9.441   0.622   -77.765  1.00 32.60 ? 8    LEU A CG    1 
ATOM   48    C CD1   . LEU A 1 30  ? 8.752   1.950   -77.962  1.00 28.44 ? 8    LEU A CD1   1 
ATOM   49    C CD2   . LEU A 1 30  ? 8.781   -0.423  -78.638  1.00 35.79 ? 8    LEU A CD2   1 
ATOM   50    N N     . LYS A 1 31  ? 10.764  1.382   -74.772  1.00 26.81 ? 9    LYS A N     1 
ATOM   51    C CA    . LYS A 1 31  ? 10.533  0.812   -73.471  1.00 23.65 ? 9    LYS A CA    1 
ATOM   52    C C     . LYS A 1 31  ? 9.187   0.099   -73.476  1.00 22.64 ? 9    LYS A C     1 
ATOM   53    O O     . LYS A 1 31  ? 8.167   0.675   -73.831  1.00 19.14 ? 9    LYS A O     1 
ATOM   54    C CB    . LYS A 1 31  ? 10.573  1.902   -72.405  1.00 23.01 ? 9    LYS A CB    1 
ATOM   55    C CG    . LYS A 1 31  ? 11.794  2.792   -72.456  1.00 22.34 ? 9    LYS A CG    1 
ATOM   56    C CD    . LYS A 1 31  ? 13.086  2.022   -72.288  1.00 23.51 ? 9    LYS A CD    1 
ATOM   57    C CE    . LYS A 1 31  ? 14.269  2.969   -72.273  1.00 23.29 ? 9    LYS A CE    1 
ATOM   58    N NZ    . LYS A 1 31  ? 15.474  2.290   -71.761  1.00 24.82 ? 9    LYS A NZ    1 
ATOM   59    N N     . LEU A 1 32  ? 9.207   -1.164  -73.047  1.00 24.11 ? 10   LEU A N     1 
ATOM   60    C CA    . LEU A 1 32  ? 8.027   -2.036  -73.102  1.00 23.05 ? 10   LEU A CA    1 
ATOM   61    C C     . LEU A 1 32  ? 7.300   -2.144  -71.764  1.00 20.53 ? 10   LEU A C     1 
ATOM   62    O O     . LEU A 1 32  ? 7.927   -2.069  -70.722  1.00 20.28 ? 10   LEU A O     1 
ATOM   63    C CB    . LEU A 1 32  ? 8.447   -3.429  -73.537  1.00 23.99 ? 10   LEU A CB    1 
ATOM   64    C CG    . LEU A 1 32  ? 9.115   -3.580  -74.896  1.00 23.40 ? 10   LEU A CG    1 
ATOM   65    C CD1   . LEU A 1 32  ? 9.373   -5.039  -75.112  1.00 26.06 ? 10   LEU A CD1   1 
ATOM   66    C CD2   . LEU A 1 32  ? 8.302   -3.005  -76.042  1.00 22.88 ? 10   LEU A CD2   1 
ATOM   67    N N     . ASP A 1 33  ? 5.983   -2.305  -71.803  1.00 20.58 ? 11   ASP A N     1 
ATOM   68    C CA    . ASP A 1 33  ? 5.215   -2.698  -70.619  1.00 23.44 ? 11   ASP A CA    1 
ATOM   69    C C     . ASP A 1 33  ? 4.821   -4.185  -70.732  1.00 22.96 ? 11   ASP A C     1 
ATOM   70    O O     . ASP A 1 33  ? 5.279   -4.898  -71.626  1.00 23.77 ? 11   ASP A O     1 
ATOM   71    C CB    . ASP A 1 33  ? 3.971   -1.796  -70.418  1.00 25.01 ? 11   ASP A CB    1 
ATOM   72    C CG    . ASP A 1 33  ? 3.668   -1.491  -68.896  1.00 32.41 ? 11   ASP A CG    1 
ATOM   73    O OD1   . ASP A 1 33  ? 3.485   -2.444  -68.087  1.00 28.00 ? 11   ASP A OD1   1 
ATOM   74    O OD2   . ASP A 1 33  ? 3.604   -0.288  -68.513  1.00 31.71 ? 11   ASP A OD2   1 
ATOM   75    N N     . PHE A 1 34  ? 3.967   -4.654  -69.828  1.00 21.99 ? 12   PHE A N     1 
ATOM   76    C CA    . PHE A 1 34  ? 3.671   -6.080  -69.740  1.00 20.19 ? 12   PHE A CA    1 
ATOM   77    C C     . PHE A 1 34  ? 2.933   -6.585  -70.951  1.00 19.11 ? 12   PHE A C     1 
ATOM   78    O O     . PHE A 1 34  ? 3.144   -7.727  -71.357  1.00 19.49 ? 12   PHE A O     1 
ATOM   79    C CB    . PHE A 1 34  ? 2.838   -6.390  -68.509  1.00 19.93 ? 12   PHE A CB    1 
ATOM   80    C CG    . PHE A 1 34  ? 3.544   -6.125  -67.222  1.00 20.67 ? 12   PHE A CG    1 
ATOM   81    C CD1   . PHE A 1 34  ? 4.855   -6.579  -67.020  1.00 19.58 ? 12   PHE A CD1   1 
ATOM   82    C CD2   . PHE A 1 34  ? 2.905   -5.435  -66.200  1.00 13.11 ? 12   PHE A CD2   1 
ATOM   83    C CE1   . PHE A 1 34  ? 5.509   -6.325  -65.823  1.00 18.71 ? 12   PHE A CE1   1 
ATOM   84    C CE2   . PHE A 1 34  ? 3.565   -5.166  -65.007  1.00 12.82 ? 12   PHE A CE2   1 
ATOM   85    C CZ    . PHE A 1 34  ? 4.851   -5.618  -64.812  1.00 17.08 ? 12   PHE A CZ    1 
ATOM   86    N N     . LYS A 1 35  ? 2.078   -5.739  -71.520  1.00 18.93 ? 13   LYS A N     1 
ATOM   87    C CA    . LYS A 1 35  ? 1.238   -6.104  -72.664  1.00 19.50 ? 13   LYS A CA    1 
ATOM   88    C C     . LYS A 1 35  ? 2.079   -6.373  -73.910  1.00 18.35 ? 13   LYS A C     1 
ATOM   89    O O     . LYS A 1 35  ? 1.633   -7.022  -74.861  1.00 19.31 ? 13   LYS A O     1 
ATOM   90    C CB    . LYS A 1 35  ? 0.255   -4.963  -73.011  1.00 20.32 ? 13   LYS A CB    1 
ATOM   91    C CG    . LYS A 1 35  ? 0.929   -3.728  -73.765  1.00 24.35 ? 13   LYS A CG    1 
ATOM   92    C CD    . LYS A 1 35  ? 0.050   -3.122  -74.907  1.00 29.06 ? 13   LYS A CD    1 
ATOM   93    C CE    . LYS A 1 35  ? 0.803   -2.816  -76.228  1.00 28.28 ? 13   LYS A CE    1 
ATOM   94    N NZ    . LYS A 1 35  ? 0.628   -3.874  -77.320  1.00 23.69 ? 13   LYS A NZ    1 
ATOM   95    N N     . ASP A 1 36  ? 3.282   -5.822  -73.919  1.00 16.34 ? 14   ASP A N     1 
ATOM   96    C CA    . ASP A 1 36  ? 4.133   -5.912  -75.073  1.00 15.59 ? 14   ASP A CA    1 
ATOM   97    C C     . ASP A 1 36  ? 4.866   -7.242  -75.164  1.00 14.53 ? 14   ASP A C     1 
ATOM   98    O O     . ASP A 1 36  ? 5.439   -7.575  -76.207  1.00 15.82 ? 14   ASP A O     1 
ATOM   99    C CB    . ASP A 1 36  ? 5.131   -4.763  -75.064  1.00 14.00 ? 14   ASP A CB    1 
ATOM   100   C CG    . ASP A 1 36  ? 4.485   -3.460  -75.422  1.00 16.39 ? 14   ASP A CG    1 
ATOM   101   O OD1   . ASP A 1 36  ? 4.106   -3.295  -76.619  1.00 15.85 ? 14   ASP A OD1   1 
ATOM   102   O OD2   . ASP A 1 36  ? 4.350   -2.607  -74.505  1.00 16.72 ? 14   ASP A OD2   1 
ATOM   103   N N     . VAL A 1 37  ? 4.866   -8.011  -74.083  1.00 14.91 ? 15   VAL A N     1 
ATOM   104   C CA    . VAL A 1 37  ? 5.624   -9.279  -74.086  1.00 14.21 ? 15   VAL A CA    1 
ATOM   105   C C     . VAL A 1 37  ? 4.780   -10.456 -73.653  1.00 13.36 ? 15   VAL A C     1 
ATOM   106   O O     . VAL A 1 37  ? 3.687   -10.288 -73.101  1.00 13.91 ? 15   VAL A O     1 
ATOM   107   C CB    . VAL A 1 37  ? 6.887   -9.267  -73.171  1.00 13.04 ? 15   VAL A CB    1 
ATOM   108   C CG1   . VAL A 1 37  ? 7.897   -8.275  -73.657  1.00 14.76 ? 15   VAL A CG1   1 
ATOM   109   C CG2   . VAL A 1 37  ? 6.495   -8.974  -71.724  1.00 15.17 ? 15   VAL A CG2   1 
ATOM   110   N N     . LEU A 1 38  ? 5.319   -11.640 -73.947  1.00 12.43 ? 16   LEU A N     1 
ATOM   111   C CA    . LEU A 1 38  ? 4.886   -12.892 -73.362  1.00 11.27 ? 16   LEU A CA    1 
ATOM   112   C C     . LEU A 1 38  ? 6.111   -13.659 -72.917  1.00 12.27 ? 16   LEU A C     1 
ATOM   113   O O     . LEU A 1 38  ? 7.207   -13.499 -73.485  1.00 11.97 ? 16   LEU A O     1 
ATOM   114   C CB    . LEU A 1 38  ? 4.111   -13.740 -74.364  1.00 9.98  ? 16   LEU A CB    1 
ATOM   115   C CG    . LEU A 1 38  ? 2.654   -13.353 -74.676  1.00 14.90 ? 16   LEU A CG    1 
ATOM   116   C CD1   . LEU A 1 38  ? 2.192   -14.100 -75.904  1.00 18.10 ? 16   LEU A CD1   1 
ATOM   117   C CD2   . LEU A 1 38  ? 1.655   -13.587 -73.524  1.00 8.23  ? 16   LEU A CD2   1 
ATOM   118   N N     . LEU A 1 39  ? 5.923   -14.510 -71.913  1.00 12.58 ? 17   LEU A N     1 
ATOM   119   C CA    . LEU A 1 39  ? 6.952   -15.470 -71.516  1.00 13.43 ? 17   LEU A CA    1 
ATOM   120   C C     . LEU A 1 39  ? 6.897   -16.731 -72.369  1.00 14.49 ? 17   LEU A C     1 
ATOM   121   O O     . LEU A 1 39  ? 5.840   -17.299 -72.617  1.00 15.14 ? 17   LEU A O     1 
ATOM   122   C CB    . LEU A 1 39  ? 6.803   -15.868 -70.045  1.00 14.00 ? 17   LEU A CB    1 
ATOM   123   C CG    . LEU A 1 39  ? 7.240   -14.817 -69.024  1.00 13.01 ? 17   LEU A CG    1 
ATOM   124   C CD1   . LEU A 1 39  ? 6.589   -15.035 -67.654  1.00 12.39 ? 17   LEU A CD1   1 
ATOM   125   C CD2   . LEU A 1 39  ? 8.743   -14.809 -68.912  1.00 9.66  ? 17   LEU A CD2   1 
ATOM   126   N N     . ARG A 1 40  ? 8.059   -17.171 -72.789  1.00 14.75 ? 18   ARG A N     1 
ATOM   127   C CA    . ARG A 1 40  ? 8.215   -18.355 -73.590  1.00 16.54 ? 18   ARG A CA    1 
ATOM   128   C C     . ARG A 1 40  ? 8.181   -19.603 -72.687  1.00 17.69 ? 18   ARG A C     1 
ATOM   129   O O     . ARG A 1 40  ? 8.851   -19.634 -71.645  1.00 17.16 ? 18   ARG A O     1 
ATOM   130   C CB    . ARG A 1 40  ? 9.591   -18.270 -74.300  1.00 18.39 ? 18   ARG A CB    1 
ATOM   131   C CG    . ARG A 1 40  ? 9.989   -19.463 -75.153  1.00 19.19 ? 18   ARG A CG    1 
ATOM   132   C CD    . ARG A 1 40  ? 11.471  -19.399 -75.515  1.00 23.61 ? 18   ARG A CD    1 
ATOM   133   N NE    . ARG A 1 40  ? 11.818  -20.279 -76.640  1.00 27.15 ? 18   ARG A NE    1 
ATOM   134   C CZ    . ARG A 1 40  ? 11.941  -21.616 -76.598  1.00 33.35 ? 18   ARG A CZ    1 
ATOM   135   N NH1   . ARG A 1 40  ? 11.755  -22.315 -75.481  1.00 28.29 ? 18   ARG A NH1   1 
ATOM   136   N NH2   . ARG A 1 40  ? 12.242  -22.269 -77.711  1.00 35.21 ? 18   ARG A NH2   1 
ATOM   137   N N     . PRO A 1 41  ? 7.418   -20.643 -73.087  1.00 17.39 ? 19   PRO A N     1 
ATOM   138   C CA    . PRO A 1 41  ? 7.518   -21.877 -72.326  1.00 17.16 ? 19   PRO A CA    1 
ATOM   139   C C     . PRO A 1 41  ? 8.820   -22.566 -72.646  1.00 17.51 ? 19   PRO A C     1 
ATOM   140   O O     . PRO A 1 41  ? 9.372   -22.362 -73.726  1.00 16.88 ? 19   PRO A O     1 
ATOM   141   C CB    . PRO A 1 41  ? 6.324   -22.707 -72.795  1.00 15.81 ? 19   PRO A CB    1 
ATOM   142   C CG    . PRO A 1 41  ? 5.993   -22.185 -74.109  1.00 17.34 ? 19   PRO A CG    1 
ATOM   143   C CD    . PRO A 1 41  ? 6.461   -20.757 -74.194  1.00 17.41 ? 19   PRO A CD    1 
ATOM   144   N N     . LYS A 1 42  ? 9.305   -23.360 -71.699  1.00 18.48 ? 20   LYS A N     1 
ATOM   145   C CA    . LYS A 1 42  ? 10.562  -24.080 -71.852  1.00 19.34 ? 20   LYS A CA    1 
ATOM   146   C C     . LYS A 1 42  ? 10.483  -25.490 -71.307  1.00 20.27 ? 20   LYS A C     1 
ATOM   147   O O     . LYS A 1 42  ? 9.626   -25.799 -70.480  1.00 18.92 ? 20   LYS A O     1 
ATOM   148   C CB    . LYS A 1 42  ? 11.684  -23.333 -71.144  1.00 19.72 ? 20   LYS A CB    1 
ATOM   149   C CG    . LYS A 1 42  ? 12.012  -22.019 -71.784  1.00 19.38 ? 20   LYS A CG    1 
ATOM   150   C CD    . LYS A 1 42  ? 13.136  -21.352 -71.078  1.00 18.53 ? 20   LYS A CD    1 
ATOM   151   C CE    . LYS A 1 42  ? 13.325  -19.934 -71.557  1.00 16.94 ? 20   LYS A CE    1 
ATOM   152   N NZ    . LYS A 1 42  ? 14.196  -19.227 -70.575  1.00 14.49 ? 20   LYS A NZ    1 
ATOM   153   N N     . ARG A 1 43  ? 11.379  -26.345 -71.797  1.00 22.38 ? 21   ARG A N     1 
ATOM   154   C CA    . ARG A 1 43  ? 11.423  -27.761 -71.413  1.00 25.06 ? 21   ARG A CA    1 
ATOM   155   C C     . ARG A 1 43  ? 11.746  -27.908 -69.940  1.00 26.14 ? 21   ARG A C     1 
ATOM   156   O O     . ARG A 1 43  ? 12.636  -27.235 -69.447  1.00 26.35 ? 21   ARG A O     1 
ATOM   157   C CB    . ARG A 1 43  ? 12.496  -28.511 -72.187  1.00 25.12 ? 21   ARG A CB    1 
ATOM   158   C CG    . ARG A 1 43  ? 12.446  -28.383 -73.705  1.00 31.81 ? 21   ARG A CG    1 
ATOM   159   C CD    . ARG A 1 43  ? 13.408  -29.391 -74.365  1.00 37.00 ? 21   ARG A CD    1 
ATOM   160   N NE    . ARG A 1 43  ? 13.083  -30.756 -73.944  1.00 40.14 ? 21   ARG A NE    1 
ATOM   161   C CZ    . ARG A 1 43  ? 13.887  -31.805 -74.048  1.00 36.30 ? 21   ARG A CZ    1 
ATOM   162   N NH1   . ARG A 1 43  ? 15.099  -31.696 -74.579  1.00 35.24 ? 21   ARG A NH1   1 
ATOM   163   N NH2   . ARG A 1 43  ? 13.460  -32.980 -73.611  1.00 35.00 ? 21   ARG A NH2   1 
ATOM   164   N N     . SER A 1 44  ? 11.024  -28.783 -69.245  1.00 27.81 ? 22   SER A N     1 
ATOM   165   C CA    . SER A 1 44  ? 11.325  -29.089 -67.844  1.00 28.83 ? 22   SER A CA    1 
ATOM   166   C C     . SER A 1 44  ? 10.740  -30.436 -67.438  1.00 31.00 ? 22   SER A C     1 
ATOM   167   O O     . SER A 1 44  ? 10.155  -31.135 -68.253  1.00 31.41 ? 22   SER A O     1 
ATOM   168   C CB    . SER A 1 44  ? 10.853  -27.979 -66.906  1.00 26.90 ? 22   SER A CB    1 
ATOM   169   O OG    . SER A 1 44  ? 9.445   -27.940 -66.791  1.00 25.55 ? 22   SER A OG    1 
ATOM   170   N N     . SER A 1 45  ? 10.937  -30.798 -66.175  1.00 33.10 ? 23   SER A N     1 
ATOM   171   C CA    . SER A 1 45  ? 10.435  -32.041 -65.621  1.00 34.23 ? 23   SER A CA    1 
ATOM   172   C C     . SER A 1 45  ? 9.191   -31.830 -64.775  1.00 35.09 ? 23   SER A C     1 
ATOM   173   O O     . SER A 1 45  ? 8.682   -32.772 -64.167  1.00 36.11 ? 23   SER A O     1 
ATOM   174   C CB    . SER A 1 45  ? 11.521  -32.682 -64.758  1.00 33.87 ? 23   SER A CB    1 
ATOM   175   O OG    . SER A 1 45  ? 12.570  -33.169 -65.562  1.00 33.55 ? 23   SER A OG    1 
ATOM   176   N N     . LEU A 1 46  ? 8.676   -30.608 -64.768  1.00 36.24 ? 24   LEU A N     1 
ATOM   177   C CA    . LEU A 1 46  ? 7.559   -30.249 -63.893  1.00 37.33 ? 24   LEU A CA    1 
ATOM   178   C C     . LEU A 1 46  ? 6.263   -30.462 -64.658  1.00 37.95 ? 24   LEU A C     1 
ATOM   179   O O     . LEU A 1 46  ? 6.026   -29.806 -65.676  1.00 39.07 ? 24   LEU A O     1 
ATOM   180   C CB    . LEU A 1 46  ? 7.679   -28.792 -63.397  1.00 38.01 ? 24   LEU A CB    1 
ATOM   181   C CG    . LEU A 1 46  ? 9.085   -28.177 -63.224  1.00 36.76 ? 24   LEU A CG    1 
ATOM   182   C CD1   . LEU A 1 46  ? 8.972   -26.780 -62.659  1.00 34.66 ? 24   LEU A CD1   1 
ATOM   183   C CD2   . LEU A 1 46  ? 10.003  -29.032 -62.350  1.00 38.03 ? 24   LEU A CD2   1 
ATOM   184   N N     . LYS A 1 47  ? 5.445   -31.400 -64.192  1.00 38.22 ? 25   LYS A N     1 
ATOM   185   C CA    . LYS A 1 47  ? 4.158   -31.678 -64.829  1.00 37.49 ? 25   LYS A CA    1 
ATOM   186   C C     . LYS A 1 47  ? 3.129   -30.683 -64.307  1.00 35.85 ? 25   LYS A C     1 
ATOM   187   O O     . LYS A 1 47  ? 2.535   -29.925 -65.076  1.00 35.22 ? 25   LYS A O     1 
ATOM   188   C CB    . LYS A 1 47  ? 3.704   -33.129 -64.578  1.00 36.76 ? 25   LYS A CB    1 
ATOM   189   N N     . SER A 1 48  ? 2.958   -30.679 -62.987  1.00 34.14 ? 26   SER A N     1 
ATOM   190   C CA    . SER A 1 48  ? 1.849   -29.997 -62.327  1.00 32.10 ? 26   SER A CA    1 
ATOM   191   C C     . SER A 1 48  ? 2.290   -28.762 -61.544  1.00 29.57 ? 26   SER A C     1 
ATOM   192   O O     . SER A 1 48  ? 3.378   -28.719 -60.981  1.00 28.53 ? 26   SER A O     1 
ATOM   193   C CB    . SER A 1 48  ? 1.127   -30.986 -61.392  1.00 32.26 ? 26   SER A CB    1 
ATOM   194   O OG    . SER A 1 48  ? 0.239   -30.324 -60.508  1.00 33.65 ? 26   SER A OG    1 
ATOM   195   N N     . ARG A 1 49  ? 1.401   -27.773 -61.492  1.00 27.80 ? 27   ARG A N     1 
ATOM   196   C CA    . ARG A 1 49  ? 1.685   -26.493 -60.839  1.00 25.86 ? 27   ARG A CA    1 
ATOM   197   C C     . ARG A 1 49  ? 1.762   -26.605 -59.311  1.00 24.22 ? 27   ARG A C     1 
ATOM   198   O O     . ARG A 1 49  ? 2.351   -25.753 -58.653  1.00 20.84 ? 27   ARG A O     1 
ATOM   199   C CB    . ARG A 1 49  ? 0.644   -25.454 -61.224  1.00 25.92 ? 27   ARG A CB    1 
ATOM   200   C CG    . ARG A 1 49  ? -0.668  -25.560 -60.449  1.00 27.85 ? 27   ARG A CG    1 
ATOM   201   C CD    . ARG A 1 49  ? -1.747  -24.836 -61.205  1.00 30.43 ? 27   ARG A CD    1 
ATOM   202   N NE    . ARG A 1 49  ? -2.793  -24.292 -60.360  1.00 32.77 ? 27   ARG A NE    1 
ATOM   203   C CZ    . ARG A 1 49  ? -3.624  -23.318 -60.728  1.00 39.05 ? 27   ARG A CZ    1 
ATOM   204   N NH1   . ARG A 1 49  ? -4.561  -22.905 -59.870  1.00 39.34 ? 27   ARG A NH1   1 
ATOM   205   N NH2   . ARG A 1 49  ? -3.528  -22.741 -61.936  1.00 37.94 ? 27   ARG A NH2   1 
ATOM   206   N N     . ALA A 1 50  ? 1.144   -27.640 -58.743  1.00 24.33 ? 28   ALA A N     1 
ATOM   207   C CA    . ALA A 1 50  ? 1.158   -27.816 -57.286  1.00 25.31 ? 28   ALA A CA    1 
ATOM   208   C C     . ALA A 1 50  ? 2.581   -28.131 -56.811  1.00 25.71 ? 28   ALA A C     1 
ATOM   209   O O     . ALA A 1 50  ? 2.973   -27.812 -55.682  1.00 26.36 ? 28   ALA A O     1 
ATOM   210   C CB    . ALA A 1 50  ? 0.155   -28.899 -56.840  1.00 24.76 ? 28   ALA A CB    1 
ATOM   211   N N     . GLU A 1 51  ? 3.372   -28.720 -57.691  1.00 26.08 ? 29   GLU A N     1 
ATOM   212   C CA    . GLU A 1 51  ? 4.788   -28.971 -57.397  1.00 26.76 ? 29   GLU A CA    1 
ATOM   213   C C     . GLU A 1 51  ? 5.613   -27.696 -57.101  1.00 25.93 ? 29   GLU A C     1 
ATOM   214   O O     . GLU A 1 51  ? 6.636   -27.788 -56.444  1.00 27.97 ? 29   GLU A O     1 
ATOM   215   C CB    . GLU A 1 51  ? 5.430   -29.735 -58.554  1.00 28.40 ? 29   GLU A CB    1 
ATOM   216   C CG    . GLU A 1 51  ? 4.743   -31.071 -58.919  1.00 31.75 ? 29   GLU A CG    1 
ATOM   217   C CD    . GLU A 1 51  ? 5.189   -31.601 -60.284  1.00 35.91 ? 29   GLU A CD    1 
ATOM   218   O OE1   . GLU A 1 51  ? 6.377   -31.427 -60.641  1.00 38.54 ? 29   GLU A OE1   1 
ATOM   219   O OE2   . GLU A 1 51  ? 4.350   -32.193 -60.994  1.00 37.74 ? 29   GLU A OE2   1 
ATOM   220   N N     . VAL A 1 52  ? 5.172   -26.523 -57.575  1.00 23.35 ? 30   VAL A N     1 
ATOM   221   C CA    . VAL A 1 52  ? 5.962   -25.281 -57.468  1.00 20.05 ? 30   VAL A CA    1 
ATOM   222   C C     . VAL A 1 52  ? 5.898   -24.613 -56.085  1.00 19.14 ? 30   VAL A C     1 
ATOM   223   O O     . VAL A 1 52  ? 4.813   -24.376 -55.530  1.00 18.63 ? 30   VAL A O     1 
ATOM   224   C CB    . VAL A 1 52  ? 5.542   -24.210 -58.528  1.00 19.19 ? 30   VAL A CB    1 
ATOM   225   C CG1   . VAL A 1 52  ? 6.417   -22.918 -58.406  1.00 17.58 ? 30   VAL A CG1   1 
ATOM   226   C CG2   . VAL A 1 52  ? 5.646   -24.766 -59.923  1.00 17.86 ? 30   VAL A CG2   1 
ATOM   227   N N     . ASP A 1 53  ? 7.070   -24.251 -55.576  1.00 18.62 ? 31   ASP A N     1 
ATOM   228   C CA    . ASP A 1 53  ? 7.222   -23.509 -54.313  1.00 19.80 ? 31   ASP A CA    1 
ATOM   229   C C     . ASP A 1 53  ? 7.351   -21.997 -54.567  1.00 18.94 ? 31   ASP A C     1 
ATOM   230   O O     . ASP A 1 53  ? 8.352   -21.517 -55.131  1.00 16.93 ? 31   ASP A O     1 
ATOM   231   C CB    . ASP A 1 53  ? 8.481   -24.016 -53.557  1.00 23.27 ? 31   ASP A CB    1 
ATOM   232   C CG    . ASP A 1 53  ? 8.584   -23.504 -52.082  1.00 27.89 ? 31   ASP A CG    1 
ATOM   233   O OD1   . ASP A 1 53  ? 7.556   -23.399 -51.355  1.00 35.05 ? 31   ASP A OD1   1 
ATOM   234   O OD2   . ASP A 1 53  ? 9.723   -23.231 -51.643  1.00 30.41 ? 31   ASP A OD2   1 
ATOM   235   N N     . LEU A 1 54  ? 6.330   -21.251 -54.148  1.00 18.73 ? 32   LEU A N     1 
ATOM   236   C CA    . LEU A 1 54  ? 6.291   -19.803 -54.358  1.00 19.07 ? 32   LEU A CA    1 
ATOM   237   C C     . LEU A 1 54  ? 7.019   -18.994 -53.256  1.00 20.72 ? 32   LEU A C     1 
ATOM   238   O O     . LEU A 1 54  ? 7.377   -17.812 -53.454  1.00 20.31 ? 32   LEU A O     1 
ATOM   239   C CB    . LEU A 1 54  ? 4.831   -19.344 -54.466  1.00 18.60 ? 32   LEU A CB    1 
ATOM   240   C CG    . LEU A 1 54  ? 3.991   -19.713 -55.679  1.00 14.99 ? 32   LEU A CG    1 
ATOM   241   C CD1   . LEU A 1 54  ? 2.721   -18.895 -55.660  1.00 22.87 ? 32   LEU A CD1   1 
ATOM   242   C CD2   . LEU A 1 54  ? 4.703   -19.490 -56.964  1.00 15.85 ? 32   LEU A CD2   1 
ATOM   243   N N     . GLU A 1 55  ? 7.199   -19.616 -52.090  1.00 22.76 ? 33   GLU A N     1 
ATOM   244   C CA    . GLU A 1 55  ? 7.965   -19.011 -51.016  1.00 23.99 ? 33   GLU A CA    1 
ATOM   245   C C     . GLU A 1 55  ? 9.381   -18.706 -51.467  1.00 23.08 ? 33   GLU A C     1 
ATOM   246   O O     . GLU A 1 55  ? 10.005  -19.493 -52.168  1.00 22.77 ? 33   GLU A O     1 
ATOM   247   C CB    . GLU A 1 55  ? 7.990   -19.872 -49.749  1.00 25.00 ? 33   GLU A CB    1 
ATOM   248   C CG    . GLU A 1 55  ? 6.660   -19.878 -49.002  1.00 32.68 ? 33   GLU A CG    1 
ATOM   249   C CD    . GLU A 1 55  ? 6.802   -19.866 -47.489  1.00 43.91 ? 33   GLU A CD    1 
ATOM   250   O OE1   . GLU A 1 55  ? 5.941   -20.491 -46.834  1.00 50.24 ? 33   GLU A OE1   1 
ATOM   251   O OE2   . GLU A 1 55  ? 7.747   -19.228 -46.956  1.00 49.55 ? 33   GLU A OE2   1 
ATOM   252   N N     . ARG A 1 56  ? 9.838   -17.534 -51.037  1.00 23.64 ? 34   ARG A N     1 
ATOM   253   C CA    A ARG A 1 56  ? 11.174  -17.015 -51.317  0.50 22.75 ? 34   ARG A CA    1 
ATOM   254   C CA    B ARG A 1 56  ? 11.175  -17.024 -51.330  0.50 22.48 ? 34   ARG A CA    1 
ATOM   255   C C     . ARG A 1 56  ? 11.840  -16.566 -50.022  1.00 23.19 ? 34   ARG A C     1 
ATOM   256   O O     . ARG A 1 56  ? 11.200  -16.008 -49.141  1.00 22.46 ? 34   ARG A O     1 
ATOM   257   C CB    A ARG A 1 56  ? 11.091  -15.827 -52.273  0.50 22.43 ? 34   ARG A CB    1 
ATOM   258   C CB    B ARG A 1 56  ? 11.108  -15.851 -52.321  0.50 21.94 ? 34   ARG A CB    1 
ATOM   259   C CG    A ARG A 1 56  ? 11.614  -16.090 -53.677  0.50 20.11 ? 34   ARG A CG    1 
ATOM   260   C CG    B ARG A 1 56  ? 11.642  -16.099 -53.772  0.50 18.29 ? 34   ARG A CG    1 
ATOM   261   C CD    A ARG A 1 56  ? 13.115  -15.786 -53.793  0.50 20.30 ? 34   ARG A CD    1 
ATOM   262   C CD    B ARG A 1 56  ? 12.713  -15.023 -54.083  0.50 16.54 ? 34   ARG A CD    1 
ATOM   263   N NE    A ARG A 1 56  ? 13.452  -15.089 -55.038  0.50 20.47 ? 34   ARG A NE    1 
ATOM   264   N NE    B ARG A 1 56  ? 12.831  -14.401 -55.424  0.50 14.49 ? 34   ARG A NE    1 
ATOM   265   C CZ    A ARG A 1 56  ? 14.685  -14.763 -55.415  0.50 14.13 ? 34   ARG A CZ    1 
ATOM   266   C CZ    B ARG A 1 56  ? 11.893  -13.716 -56.096  0.50 9.62  ? 34   ARG A CZ    1 
ATOM   267   N NH1   A ARG A 1 56  ? 15.732  -15.070 -54.652  0.50 15.81 ? 34   ARG A NH1   1 
ATOM   268   N NH1   B ARG A 1 56  ? 10.640  -13.586 -55.664  0.50 2.00  ? 34   ARG A NH1   1 
ATOM   269   N NH2   A ARG A 1 56  ? 14.870  -14.123 -56.557  0.50 2.81  ? 34   ARG A NH2   1 
ATOM   270   N NH2   B ARG A 1 56  ? 12.209  -13.184 -57.265  0.50 9.04  ? 34   ARG A NH2   1 
ATOM   271   N N     . THR A 1 57  ? 13.134  -16.810 -49.923  1.00 22.98 ? 35   THR A N     1 
ATOM   272   C CA    . THR A 1 57  ? 13.923  -16.390 -48.787  1.00 23.56 ? 35   THR A CA    1 
ATOM   273   C C     . THR A 1 57  ? 14.852  -15.275 -49.222  1.00 22.67 ? 35   THR A C     1 
ATOM   274   O O     . THR A 1 57  ? 15.653  -15.462 -50.133  1.00 21.84 ? 35   THR A O     1 
ATOM   275   C CB    . THR A 1 57  ? 14.773  -17.552 -48.209  1.00 24.12 ? 35   THR A CB    1 
ATOM   276   O OG1   . THR A 1 57  ? 13.961  -18.303 -47.303  1.00 25.02 ? 35   THR A OG1   1 
ATOM   277   C CG2   . THR A 1 57  ? 16.025  -17.016 -47.461  1.00 25.12 ? 35   THR A CG2   1 
ATOM   278   N N     . PHE A 1 58  ? 14.741  -14.136 -48.537  1.00 22.65 ? 36   PHE A N     1 
ATOM   279   C CA    . PHE A 1 58  ? 15.593  -12.990 -48.774  1.00 22.27 ? 36   PHE A CA    1 
ATOM   280   C C     . PHE A 1 58  ? 16.377  -12.630 -47.532  1.00 21.65 ? 36   PHE A C     1 
ATOM   281   O O     . PHE A 1 58  ? 15.819  -12.640 -46.434  1.00 20.12 ? 36   PHE A O     1 
ATOM   282   C CB    . PHE A 1 58  ? 14.727  -11.786 -49.170  1.00 21.97 ? 36   PHE A CB    1 
ATOM   283   C CG    . PHE A 1 58  ? 13.999  -11.967 -50.469  1.00 19.86 ? 36   PHE A CG    1 
ATOM   284   C CD1   . PHE A 1 58  ? 14.687  -12.129 -51.645  1.00 24.09 ? 36   PHE A CD1   1 
ATOM   285   C CD2   . PHE A 1 58  ? 12.635  -11.960 -50.521  1.00 20.96 ? 36   PHE A CD2   1 
ATOM   286   C CE1   . PHE A 1 58  ? 14.013  -12.299 -52.841  1.00 21.68 ? 36   PHE A CE1   1 
ATOM   287   C CE2   . PHE A 1 58  ? 11.978  -12.114 -51.706  1.00 23.68 ? 36   PHE A CE2   1 
ATOM   288   C CZ    . PHE A 1 58  ? 12.665  -12.275 -52.859  1.00 20.19 ? 36   PHE A CZ    1 
ATOM   289   N N     . THR A 1 59  ? 17.656  -12.300 -47.723  1.00 22.03 ? 37   THR A N     1 
ATOM   290   C CA    . THR A 1 59  ? 18.441  -11.654 -46.689  1.00 23.30 ? 37   THR A CA    1 
ATOM   291   C C     . THR A 1 59  ? 18.826  -10.251 -47.135  1.00 23.52 ? 37   THR A C     1 
ATOM   292   O O     . THR A 1 59  ? 19.636  -10.084 -48.042  1.00 25.07 ? 37   THR A O     1 
ATOM   293   C CB    . THR A 1 59  ? 19.675  -12.457 -46.387  1.00 23.43 ? 37   THR A CB    1 
ATOM   294   O OG1   . THR A 1 59  ? 19.260  -13.724 -45.871  1.00 24.75 ? 37   THR A OG1   1 
ATOM   295   C CG2   . THR A 1 59  ? 20.559  -11.731 -45.361  1.00 24.74 ? 37   THR A CG2   1 
ATOM   296   N N     . PHE A 1 60  ? 18.271  -9.245  -46.474  1.00 22.03 ? 38   PHE A N     1 
ATOM   297   C CA    . PHE A 1 60  ? 18.425  -7.858  -46.945  1.00 20.88 ? 38   PHE A CA    1 
ATOM   298   C C     . PHE A 1 60  ? 19.821  -7.219  -46.708  1.00 20.62 ? 38   PHE A C     1 
ATOM   299   O O     . PHE A 1 60  ? 20.553  -7.531  -45.760  1.00 20.45 ? 38   PHE A O     1 
ATOM   300   C CB    . PHE A 1 60  ? 17.303  -6.988  -46.407  1.00 19.31 ? 38   PHE A CB    1 
ATOM   301   C CG    . PHE A 1 60  ? 15.950  -7.545  -46.670  1.00 14.68 ? 38   PHE A CG    1 
ATOM   302   C CD1   . PHE A 1 60  ? 15.459  -7.609  -47.949  1.00 19.45 ? 38   PHE A CD1   1 
ATOM   303   C CD2   . PHE A 1 60  ? 15.157  -8.018  -45.620  1.00 19.75 ? 38   PHE A CD2   1 
ATOM   304   C CE1   . PHE A 1 60  ? 14.164  -8.148  -48.188  1.00 20.53 ? 38   PHE A CE1   1 
ATOM   305   C CE2   . PHE A 1 60  ? 13.883  -8.552  -45.834  1.00 12.70 ? 38   PHE A CE2   1 
ATOM   306   C CZ    . PHE A 1 60  ? 13.385  -8.615  -47.123  1.00 15.46 ? 38   PHE A CZ    1 
ATOM   307   N N     . ARG A 1 61  ? 20.177  -6.301  -47.593  1.00 20.41 ? 39   ARG A N     1 
ATOM   308   C CA    . ARG A 1 61  ? 21.550  -5.829  -47.657  1.00 20.45 ? 39   ARG A CA    1 
ATOM   309   C C     . ARG A 1 61  ? 21.926  -4.944  -46.485  1.00 19.53 ? 39   ARG A C     1 
ATOM   310   O O     . ARG A 1 61  ? 23.035  -5.047  -45.960  1.00 20.99 ? 39   ARG A O     1 
ATOM   311   C CB    . ARG A 1 61  ? 21.818  -5.069  -48.971  1.00 21.75 ? 39   ARG A CB    1 
ATOM   312   C CG    . ARG A 1 61  ? 23.239  -4.489  -49.069  1.00 20.25 ? 39   ARG A CG    1 
ATOM   313   C CD    . ARG A 1 61  ? 23.333  -3.405  -50.149  1.00 22.85 ? 39   ARG A CD    1 
ATOM   314   N NE    . ARG A 1 61  ? 24.735  -3.052  -50.446  1.00 23.52 ? 39   ARG A NE    1 
ATOM   315   C CZ    . ARG A 1 61  ? 25.335  -1.919  -50.077  1.00 24.04 ? 39   ARG A CZ    1 
ATOM   316   N NH1   . ARG A 1 61  ? 24.670  -0.962  -49.406  1.00 25.50 ? 39   ARG A NH1   1 
ATOM   317   N NH2   . ARG A 1 61  ? 26.609  -1.727  -50.391  1.00 21.33 ? 39   ARG A NH2   1 
ATOM   318   N N     . ASN A 1 62  ? 21.021  -4.055  -46.102  1.00 18.54 ? 40   ASN A N     1 
ATOM   319   C CA    . ASN A 1 62  ? 21.338  -3.048  -45.109  1.00 17.18 ? 40   ASN A CA    1 
ATOM   320   C C     . ASN A 1 62  ? 20.798  -3.426  -43.725  1.00 16.45 ? 40   ASN A C     1 
ATOM   321   O O     . ASN A 1 62  ? 21.494  -3.243  -42.729  1.00 16.83 ? 40   ASN A O     1 
ATOM   322   C CB    . ASN A 1 62  ? 20.818  -1.684  -45.582  1.00 17.64 ? 40   ASN A CB    1 
ATOM   323   C CG    . ASN A 1 62  ? 21.519  -1.199  -46.837  1.00 17.40 ? 40   ASN A CG    1 
ATOM   324   O OD1   . ASN A 1 62  ? 22.746  -1.211  -46.912  1.00 12.99 ? 40   ASN A OD1   1 
ATOM   325   N ND2   . ASN A 1 62  ? 20.738  -0.752  -47.828  1.00 17.97 ? 40   ASN A ND2   1 
ATOM   326   N N     . SER A 1 63  ? 19.570  -3.952  -43.676  1.00 16.29 ? 41   SER A N     1 
ATOM   327   C CA    . SER A 1 63  ? 18.942  -4.371  -42.425  1.00 16.63 ? 41   SER A CA    1 
ATOM   328   C C     . SER A 1 63  ? 19.580  -5.672  -41.919  1.00 17.24 ? 41   SER A C     1 
ATOM   329   O O     . SER A 1 63  ? 19.587  -5.966  -40.725  1.00 17.81 ? 41   SER A O     1 
ATOM   330   C CB    . SER A 1 63  ? 17.430  -4.559  -42.624  1.00 15.24 ? 41   SER A CB    1 
ATOM   331   O OG    . SER A 1 63  ? 17.135  -5.767  -43.321  1.00 9.62  ? 41   SER A OG    1 
ATOM   332   N N     . LYS A 1 64  ? 20.117  -6.438  -42.857  1.00 19.01 ? 42   LYS A N     1 
ATOM   333   C CA    . LYS A 1 64  ? 20.690  -7.760  -42.602  1.00 19.37 ? 42   LYS A CA    1 
ATOM   334   C C     . LYS A 1 64  ? 19.642  -8.768  -42.066  1.00 19.18 ? 42   LYS A C     1 
ATOM   335   O O     . LYS A 1 64  ? 19.986  -9.862  -41.673  1.00 20.07 ? 42   LYS A O     1 
ATOM   336   C CB    . LYS A 1 64  ? 21.916  -7.627  -41.707  1.00 20.17 ? 42   LYS A CB    1 
ATOM   337   C CG    . LYS A 1 64  ? 22.958  -6.636  -42.251  1.00 24.66 ? 42   LYS A CG    1 
ATOM   338   C CD    . LYS A 1 64  ? 23.562  -7.160  -43.576  1.00 29.44 ? 42   LYS A CD    1 
ATOM   339   C CE    . LYS A 1 64  ? 24.840  -6.421  -43.996  1.00 31.87 ? 42   LYS A CE    1 
ATOM   340   N N     . GLN A 1 65  ? 18.362  -8.402  -42.107  1.00 19.61 ? 43   GLN A N     1 
ATOM   341   C CA    . GLN A 1 65  ? 17.281  -9.298  -41.702  1.00 19.88 ? 43   GLN A CA    1 
ATOM   342   C C     . GLN A 1 65  ? 17.053  -10.369 -42.762  1.00 20.08 ? 43   GLN A C     1 
ATOM   343   O O     . GLN A 1 65  ? 17.487  -10.210 -43.911  1.00 19.91 ? 43   GLN A O     1 
ATOM   344   C CB    . GLN A 1 65  ? 15.954  -8.538  -41.531  1.00 20.03 ? 43   GLN A CB    1 
ATOM   345   C CG    . GLN A 1 65  ? 15.973  -7.440  -40.488  1.00 24.83 ? 43   GLN A CG    1 
ATOM   346   C CD    . GLN A 1 65  ? 16.238  -7.960  -39.099  1.00 27.11 ? 43   GLN A CD    1 
ATOM   347   O OE1   . GLN A 1 65  ? 17.390  -7.955  -38.622  1.00 21.45 ? 43   GLN A OE1   1 
ATOM   348   N NE2   . GLN A 1 65  ? 15.177  -8.432  -38.441  1.00 22.77 ? 43   GLN A NE2   1 
ATOM   349   N N     . THR A 1 66  ? 16.362  -11.447 -42.376  1.00 19.69 ? 44   THR A N     1 
ATOM   350   C CA    . THR A 1 66  ? 15.988  -12.506 -43.316  1.00 18.91 ? 44   THR A CA    1 
ATOM   351   C C     . THR A 1 66  ? 14.494  -12.605 -43.346  1.00 18.97 ? 44   THR A C     1 
ATOM   352   O O     . THR A 1 66  ? 13.855  -12.588 -42.307  1.00 16.42 ? 44   THR A O     1 
ATOM   353   C CB    . THR A 1 66  ? 16.634  -13.876 -42.973  1.00 17.90 ? 44   THR A CB    1 
ATOM   354   O OG1   . THR A 1 66  ? 18.021  -13.840 -43.322  1.00 21.62 ? 44   THR A OG1   1 
ATOM   355   C CG2   . THR A 1 66  ? 16.006  -15.026 -43.746  1.00 18.69 ? 44   THR A CG2   1 
ATOM   356   N N     . TYR A 1 67  ? 13.949  -12.687 -44.559  1.00 20.33 ? 45   TYR A N     1 
ATOM   357   C CA    . TYR A 1 67  ? 12.511  -12.775 -44.778  1.00 20.37 ? 45   TYR A CA    1 
ATOM   358   C C     . TYR A 1 67  ? 12.211  -14.117 -45.462  1.00 20.25 ? 45   TYR A C     1 
ATOM   359   O O     . TYR A 1 67  ? 12.985  -14.580 -46.280  1.00 20.48 ? 45   TYR A O     1 
ATOM   360   C CB    . TYR A 1 67  ? 12.025  -11.565 -45.607  1.00 19.60 ? 45   TYR A CB    1 
ATOM   361   C CG    . TYR A 1 67  ? 10.780  -11.823 -46.402  1.00 20.84 ? 45   TYR A CG    1 
ATOM   362   C CD1   . TYR A 1 67  ? 9.515   -11.588 -45.862  1.00 20.90 ? 45   TYR A CD1   1 
ATOM   363   C CD2   . TYR A 1 67  ? 10.869  -12.352 -47.694  1.00 20.91 ? 45   TYR A CD2   1 
ATOM   364   C CE1   . TYR A 1 67  ? 8.354   -11.878 -46.600  1.00 21.19 ? 45   TYR A CE1   1 
ATOM   365   C CE2   . TYR A 1 67  ? 9.736   -12.642 -48.440  1.00 22.90 ? 45   TYR A CE2   1 
ATOM   366   C CZ    . TYR A 1 67  ? 8.468   -12.401 -47.888  1.00 24.51 ? 45   TYR A CZ    1 
ATOM   367   O OH    . TYR A 1 67  ? 7.330   -12.666 -48.639  1.00 20.33 ? 45   TYR A OH    1 
ATOM   368   N N     . SER A 1 68  ? 11.089  -14.735 -45.112  1.00 18.78 ? 46   SER A N     1 
ATOM   369   C CA    . SER A 1 68  ? 10.571  -15.842 -45.889  1.00 19.57 ? 46   SER A CA    1 
ATOM   370   C C     . SER A 1 68  ? 9.058   -15.700 -46.102  1.00 18.41 ? 46   SER A C     1 
ATOM   371   O O     . SER A 1 68  ? 8.276   -15.471 -45.165  1.00 16.67 ? 46   SER A O     1 
ATOM   372   C CB    . SER A 1 68  ? 10.897  -17.202 -45.220  1.00 22.04 ? 46   SER A CB    1 
ATOM   373   O OG    . SER A 1 68  ? 11.040  -18.271 -46.157  1.00 23.71 ? 46   SER A OG    1 
ATOM   374   N N     . GLY A 1 69  ? 8.652   -15.863 -47.357  1.00 17.65 ? 47   GLY A N     1 
ATOM   375   C CA    . GLY A 1 69  ? 7.253   -15.855 -47.692  1.00 16.77 ? 47   GLY A CA    1 
ATOM   376   C C     . GLY A 1 69  ? 7.040   -15.786 -49.183  1.00 16.44 ? 47   GLY A C     1 
ATOM   377   O O     . GLY A 1 69  ? 7.981   -15.864 -49.980  1.00 12.53 ? 47   GLY A O     1 
ATOM   378   N N     . ILE A 1 70  ? 5.766   -15.656 -49.535  1.00 18.01 ? 48   ILE A N     1 
ATOM   379   C CA    . ILE A 1 70  ? 5.360   -15.433 -50.906  1.00 19.43 ? 48   ILE A CA    1 
ATOM   380   C C     . ILE A 1 70  ? 5.465   -13.941 -51.151  1.00 19.31 ? 48   ILE A C     1 
ATOM   381   O O     . ILE A 1 70  ? 4.668   -13.166 -50.604  1.00 21.12 ? 48   ILE A O     1 
ATOM   382   C CB    . ILE A 1 70  ? 3.916   -15.945 -51.180  1.00 19.74 ? 48   ILE A CB    1 
ATOM   383   C CG1   . ILE A 1 70  ? 3.847   -17.438 -50.806  1.00 18.78 ? 48   ILE A CG1   1 
ATOM   384   C CG2   . ILE A 1 70  ? 3.531   -15.669 -52.655  1.00 19.24 ? 48   ILE A CG2   1 
ATOM   385   C CD1   . ILE A 1 70  ? 2.873   -18.242 -51.572  1.00 12.45 ? 48   ILE A CD1   1 
ATOM   386   N N     . PRO A 1 71  ? 6.436   -13.530 -51.976  1.00 17.60 ? 49   PRO A N     1 
ATOM   387   C CA    . PRO A 1 71  ? 6.807   -12.133 -52.080  1.00 16.73 ? 49   PRO A CA    1 
ATOM   388   C C     . PRO A 1 71  ? 5.838   -11.332 -52.933  1.00 17.04 ? 49   PRO A C     1 
ATOM   389   O O     . PRO A 1 71  ? 6.238   -10.637 -53.852  1.00 17.60 ? 49   PRO A O     1 
ATOM   390   C CB    . PRO A 1 71  ? 8.220   -12.208 -52.676  1.00 18.00 ? 49   PRO A CB    1 
ATOM   391   C CG    . PRO A 1 71  ? 8.210   -13.376 -53.487  1.00 18.03 ? 49   PRO A CG    1 
ATOM   392   C CD    . PRO A 1 71  ? 7.244   -14.364 -52.880  1.00 18.03 ? 49   PRO A CD    1 
ATOM   393   N N     . ILE A 1 72  ? 4.555   -11.426 -52.602  1.00 18.99 ? 50   ILE A N     1 
ATOM   394   C CA    . ILE A 1 72  ? 3.528   -10.579 -53.202  1.00 19.33 ? 50   ILE A CA    1 
ATOM   395   C C     . ILE A 1 72  ? 3.006   -9.714  -52.085  1.00 19.18 ? 50   ILE A C     1 
ATOM   396   O O     . ILE A 1 72  ? 2.626   -10.248 -51.043  1.00 18.39 ? 50   ILE A O     1 
ATOM   397   C CB    . ILE A 1 72  ? 2.394   -11.409 -53.810  1.00 20.28 ? 50   ILE A CB    1 
ATOM   398   C CG1   . ILE A 1 72  ? 2.935   -12.194 -55.019  1.00 22.05 ? 50   ILE A CG1   1 
ATOM   399   C CG2   . ILE A 1 72  ? 1.243   -10.509 -54.242  1.00 22.24 ? 50   ILE A CG2   1 
ATOM   400   C CD1   . ILE A 1 72  ? 2.120   -13.404 -55.381  1.00 26.26 ? 50   ILE A CD1   1 
ATOM   401   N N     . ILE A 1 73  ? 2.984   -8.396  -52.325  1.00 19.24 ? 51   ILE A N     1 
ATOM   402   C CA    . ILE A 1 73  ? 2.658   -7.387  -51.325  1.00 17.84 ? 51   ILE A CA    1 
ATOM   403   C C     . ILE A 1 73  ? 1.342   -6.666  -51.667  1.00 18.14 ? 51   ILE A C     1 
ATOM   404   O O     . ILE A 1 73  ? 1.140   -6.236  -52.813  1.00 20.00 ? 51   ILE A O     1 
ATOM   405   C CB    . ILE A 1 73  ? 3.756   -6.325  -51.267  1.00 15.87 ? 51   ILE A CB    1 
ATOM   406   C CG1   . ILE A 1 73  ? 5.071   -6.938  -50.828  1.00 19.04 ? 51   ILE A CG1   1 
ATOM   407   C CG2   . ILE A 1 73  ? 3.399   -5.193  -50.294  1.00 13.76 ? 51   ILE A CG2   1 
ATOM   408   C CD1   . ILE A 1 73  ? 6.279   -6.103  -51.228  1.00 17.06 ? 51   ILE A CD1   1 
ATOM   409   N N     . VAL A 1 74  ? 0.464   -6.490  -50.686  1.00 15.01 ? 52   VAL A N     1 
ATOM   410   C CA    . VAL A 1 74  ? -0.678  -5.619  -50.891  1.00 14.15 ? 52   VAL A CA    1 
ATOM   411   C C     . VAL A 1 74  ? -0.170  -4.195  -50.702  1.00 14.64 ? 52   VAL A C     1 
ATOM   412   O O     . VAL A 1 74  ? 0.534   -3.927  -49.727  1.00 14.15 ? 52   VAL A O     1 
ATOM   413   C CB    . VAL A 1 74  ? -1.798  -5.848  -49.884  1.00 13.65 ? 52   VAL A CB    1 
ATOM   414   C CG1   . VAL A 1 74  ? -2.984  -4.920  -50.200  1.00 13.49 ? 52   VAL A CG1   1 
ATOM   415   C CG2   . VAL A 1 74  ? -2.228  -7.286  -49.858  1.00 9.94  ? 52   VAL A CG2   1 
ATOM   416   N N     . ALA A 1 75  ? -0.504  -3.298  -51.634  1.00 15.86 ? 53   ALA A N     1 
ATOM   417   C CA    . ALA A 1 75  ? 0.015   -1.920  -51.607  1.00 16.16 ? 53   ALA A CA    1 
ATOM   418   C C     . ALA A 1 75  ? -0.581  -1.224  -50.421  1.00 17.75 ? 53   ALA A C     1 
ATOM   419   O O     . ALA A 1 75  ? -1.676  -1.585  -49.962  1.00 17.65 ? 53   ALA A O     1 
ATOM   420   C CB    . ALA A 1 75  ? -0.319  -1.156  -52.897  1.00 14.63 ? 53   ALA A CB    1 
ATOM   421   N N     . ASN A 1 76  ? 0.141   -0.231  -49.913  1.00 19.14 ? 54   ASN A N     1 
ATOM   422   C CA    . ASN A 1 76  ? -0.283  0.498   -48.695  1.00 18.13 ? 54   ASN A CA    1 
ATOM   423   C C     . ASN A 1 76  ? -1.282  1.610   -49.001  1.00 16.57 ? 54   ASN A C     1 
ATOM   424   O O     . ASN A 1 76  ? -1.092  2.770   -48.650  1.00 18.52 ? 54   ASN A O     1 
ATOM   425   C CB    . ASN A 1 76  ? 0.943   1.014   -47.928  1.00 19.05 ? 54   ASN A CB    1 
ATOM   426   C CG    . ASN A 1 76  ? 1.887   1.718   -48.820  1.00 14.27 ? 54   ASN A CG    1 
ATOM   427   O OD1   . ASN A 1 76  ? 1.753   1.596   -50.023  1.00 12.59 ? 54   ASN A OD1   1 
ATOM   428   N ND2   . ASN A 1 76  ? 2.812   2.493   -48.262  1.00 11.56 ? 54   ASN A ND2   1 
ATOM   429   N N     . MET A 1 77  ? -2.345  1.227   -49.679  1.00 15.77 ? 55   MET A N     1 
ATOM   430   C CA    . MET A 1 77  ? -3.391  2.130   -50.047  1.00 16.70 ? 55   MET A CA    1 
ATOM   431   C C     . MET A 1 77  ? -4.487  2.014   -49.040  1.00 16.85 ? 55   MET A C     1 
ATOM   432   O O     . MET A 1 77  ? -4.529  1.058   -48.300  1.00 17.36 ? 55   MET A O     1 
ATOM   433   C CB    . MET A 1 77  ? -3.911  1.754   -51.419  1.00 17.23 ? 55   MET A CB    1 
ATOM   434   C CG    . MET A 1 77  ? -2.872  1.923   -52.487  1.00 16.13 ? 55   MET A CG    1 
ATOM   435   S SD    . MET A 1 77  ? -3.461  1.477   -54.105  1.00 20.17 ? 55   MET A SD    1 
ATOM   436   C CE    . MET A 1 77  ? -4.531  2.879   -54.466  1.00 24.17 ? 55   MET A CE    1 
ATOM   437   N N     . ASP A 1 78  ? -5.379  2.993   -49.020  1.00 19.67 ? 56   ASP A N     1 
ATOM   438   C CA    . ASP A 1 78  ? -6.409  3.109   -47.971  1.00 22.25 ? 56   ASP A CA    1 
ATOM   439   C C     . ASP A 1 78  ? -7.339  1.928   -47.874  1.00 21.79 ? 56   ASP A C     1 
ATOM   440   O O     . ASP A 1 78  ? -7.784  1.538   -46.770  1.00 24.02 ? 56   ASP A O     1 
ATOM   441   C CB    . ASP A 1 78  ? -7.286  4.343   -48.199  1.00 23.62 ? 56   ASP A CB    1 
ATOM   442   C CG    . ASP A 1 78  ? -6.668  5.612   -47.646  1.00 29.55 ? 56   ASP A CG    1 
ATOM   443   O OD1   . ASP A 1 78  ? -6.891  5.893   -46.440  1.00 28.53 ? 56   ASP A OD1   1 
ATOM   444   O OD2   . ASP A 1 78  ? -5.982  6.323   -48.434  1.00 36.89 ? 56   ASP A OD2   1 
ATOM   445   N N     . THR A 1 79  ? -7.679  1.386   -49.022  1.00 20.38 ? 57   THR A N     1 
ATOM   446   C CA    . THR A 1 79  ? -8.730  0.381   -49.089  1.00 21.70 ? 57   THR A CA    1 
ATOM   447   C C     . THR A 1 79  ? -8.175  -1.069  -49.026  1.00 20.49 ? 57   THR A C     1 
ATOM   448   O O     . THR A 1 79  ? -8.806  -1.995  -48.495  1.00 16.61 ? 57   THR A O     1 
ATOM   449   C CB    . THR A 1 79  ? -9.534  0.618   -50.362  1.00 22.71 ? 57   THR A CB    1 
ATOM   450   O OG1   . THR A 1 79  ? -8.726  1.393   -51.277  1.00 28.76 ? 57   THR A OG1   1 
ATOM   451   C CG2   . THR A 1 79  ? -10.809 1.406   -50.043  1.00 24.74 ? 57   THR A CG2   1 
ATOM   452   N N     . VAL A 1 80  ? -6.977  -1.252  -49.578  1.00 18.29 ? 58   VAL A N     1 
ATOM   453   C CA    . VAL A 1 80  ? -6.403  -2.594  -49.641  1.00 17.76 ? 58   VAL A CA    1 
ATOM   454   C C     . VAL A 1 80  ? -5.386  -2.884  -48.543  1.00 16.46 ? 58   VAL A C     1 
ATOM   455   O O     . VAL A 1 80  ? -5.249  -4.018  -48.114  1.00 15.59 ? 58   VAL A O     1 
ATOM   456   C CB    . VAL A 1 80  ? -5.748  -2.886  -51.011  1.00 17.55 ? 58   VAL A CB    1 
ATOM   457   C CG1   . VAL A 1 80  ? -6.807  -2.912  -52.064  1.00 22.54 ? 58   VAL A CG1   1 
ATOM   458   C CG2   . VAL A 1 80  ? -4.640  -1.848  -51.363  1.00 16.36 ? 58   VAL A CG2   1 
ATOM   459   N N     . GLY A 1 81  ? -4.646  -1.872  -48.111  1.00 15.76 ? 59   GLY A N     1 
ATOM   460   C CA    . GLY A 1 81  ? -3.597  -2.072  -47.107  1.00 15.55 ? 59   GLY A CA    1 
ATOM   461   C C     . GLY A 1 81  ? -4.179  -2.001  -45.708  1.00 14.23 ? 59   GLY A C     1 
ATOM   462   O O     . GLY A 1 81  ? -3.805  -1.124  -44.912  1.00 13.27 ? 59   GLY A O     1 
ATOM   463   N N     . THR A 1 82  ? -5.110  -2.922  -45.420  1.00 14.19 ? 60   THR A N     1 
ATOM   464   C CA    . THR A 1 82  ? -5.788  -2.936  -44.147  1.00 13.82 ? 60   THR A CA    1 
ATOM   465   C C     . THR A 1 82  ? -5.350  -4.086  -43.282  1.00 14.26 ? 60   THR A C     1 
ATOM   466   O O     . THR A 1 82  ? -4.629  -4.996  -43.752  1.00 14.34 ? 60   THR A O     1 
ATOM   467   C CB    . THR A 1 82  ? -7.309  -2.895  -44.281  1.00 15.17 ? 60   THR A CB    1 
ATOM   468   O OG1   . THR A 1 82  ? -7.845  -4.145  -44.766  1.00 14.61 ? 60   THR A OG1   1 
ATOM   469   C CG2   . THR A 1 82  ? -7.661  -1.735  -45.177  1.00 12.49 ? 60   THR A CG2   1 
ATOM   470   N N     . PHE A 1 83  ? -5.742  -4.015  -42.004  1.00 12.62 ? 61   PHE A N     1 
ATOM   471   C CA    . PHE A 1 83  ? -5.456  -5.075  -41.063  1.00 13.57 ? 61   PHE A CA    1 
ATOM   472   C C     . PHE A 1 83  ? -6.270  -6.328  -41.374  1.00 15.53 ? 61   PHE A C     1 
ATOM   473   O O     . PHE A 1 83  ? -5.798  -7.458  -41.174  1.00 15.88 ? 61   PHE A O     1 
ATOM   474   C CB    . PHE A 1 83  ? -5.712  -4.609  -39.620  1.00 11.48 ? 61   PHE A CB    1 
ATOM   475   C CG    . PHE A 1 83  ? -4.706  -3.624  -39.114  1.00 9.88  ? 61   PHE A CG    1 
ATOM   476   C CD1   . PHE A 1 83  ? -3.346  -3.848  -39.266  1.00 13.83 ? 61   PHE A CD1   1 
ATOM   477   C CD2   . PHE A 1 83  ? -5.107  -2.459  -38.496  1.00 12.08 ? 61   PHE A CD2   1 
ATOM   478   C CE1   . PHE A 1 83  ? -2.412  -2.916  -38.813  1.00 11.90 ? 61   PHE A CE1   1 
ATOM   479   C CE2   . PHE A 1 83  ? -4.182  -1.523  -38.040  1.00 6.27  ? 61   PHE A CE2   1 
ATOM   480   C CZ    . PHE A 1 83  ? -2.839  -1.757  -38.198  1.00 8.54  ? 61   PHE A CZ    1 
ATOM   481   N N     . GLU A 1 84  ? -7.483  -6.124  -41.873  1.00 16.46 ? 62   GLU A N     1 
ATOM   482   C CA    . GLU A 1 84  ? -8.361  -7.230  -42.218  1.00 17.98 ? 62   GLU A CA    1 
ATOM   483   C C     . GLU A 1 84  ? -7.796  -7.962  -43.438  1.00 17.80 ? 62   GLU A C     1 
ATOM   484   O O     . GLU A 1 84  ? -7.840  -9.188  -43.498  1.00 18.78 ? 62   GLU A O     1 
ATOM   485   C CB    . GLU A 1 84  ? -9.782  -6.701  -42.426  1.00 18.21 ? 62   GLU A CB    1 
ATOM   486   C CG    . GLU A 1 84  ? -10.395 -6.124  -41.146  1.00 21.42 ? 62   GLU A CG    1 
ATOM   487   C CD    . GLU A 1 84  ? -9.739  -4.821  -40.616  1.00 28.43 ? 62   GLU A CD    1 
ATOM   488   O OE1   . GLU A 1 84  ? -9.201  -4.016  -41.405  1.00 25.92 ? 62   GLU A OE1   1 
ATOM   489   O OE2   . GLU A 1 84  ? -9.800  -4.579  -39.382  1.00 33.39 ? 62   GLU A OE2   1 
ATOM   490   N N     . MET A 1 85  ? -7.246  -7.213  -44.386  1.00 17.84 ? 63   MET A N     1 
ATOM   491   C CA    . MET A 1 85  ? -6.585  -7.819  -45.521  1.00 19.09 ? 63   MET A CA    1 
ATOM   492   C C     . MET A 1 85  ? -5.339  -8.561  -45.093  1.00 19.34 ? 63   MET A C     1 
ATOM   493   O O     . MET A 1 85  ? -5.069  -9.646  -45.586  1.00 20.79 ? 63   MET A O     1 
ATOM   494   C CB    . MET A 1 85  ? -6.159  -6.797  -46.536  1.00 19.00 ? 63   MET A CB    1 
ATOM   495   C CG    . MET A 1 85  ? -5.914  -7.439  -47.884  1.00 27.27 ? 63   MET A CG    1 
ATOM   496   S SD    . MET A 1 85  ? -7.461  -7.828  -48.766  1.00 35.44 ? 63   MET A SD    1 
ATOM   497   C CE    . MET A 1 85  ? -7.511  -6.383  -49.837  1.00 27.25 ? 63   MET A CE    1 
ATOM   498   N N     . ALA A 1 86  ? -4.567  -7.975  -44.187  1.00 18.98 ? 64   ALA A N     1 
ATOM   499   C CA    . ALA A 1 86  ? -3.318  -8.613  -43.718  1.00 17.43 ? 64   ALA A CA    1 
ATOM   500   C C     . ALA A 1 86  ? -3.574  -9.969  -43.068  1.00 16.78 ? 64   ALA A C     1 
ATOM   501   O O     . ALA A 1 86  ? -2.756  -10.882 -43.181  1.00 17.70 ? 64   ALA A O     1 
ATOM   502   C CB    . ALA A 1 86  ? -2.567  -7.700  -42.731  1.00 16.37 ? 64   ALA A CB    1 
ATOM   503   N N     . ALA A 1 87  ? -4.699  -10.087 -42.365  1.00 14.99 ? 65   ALA A N     1 
ATOM   504   C CA    . ALA A 1 87  ? -5.008  -11.286 -41.620  1.00 14.72 ? 65   ALA A CA    1 
ATOM   505   C C     . ALA A 1 87  ? -5.290  -12.466 -42.556  1.00 15.49 ? 65   ALA A C     1 
ATOM   506   O O     . ALA A 1 87  ? -5.052  -13.620 -42.201  1.00 15.88 ? 65   ALA A O     1 
ATOM   507   C CB    . ALA A 1 87  ? -6.172  -11.031 -40.709  1.00 13.96 ? 65   ALA A CB    1 
ATOM   508   N N     . VAL A 1 88  ? -5.798  -12.158 -43.748  1.00 17.52 ? 66   VAL A N     1 
ATOM   509   C CA    . VAL A 1 88  ? -5.987  -13.118 -44.838  1.00 17.39 ? 66   VAL A CA    1 
ATOM   510   C C     . VAL A 1 88  ? -4.665  -13.396 -45.558  1.00 16.06 ? 66   VAL A C     1 
ATOM   511   O O     . VAL A 1 88  ? -4.293  -14.536 -45.793  1.00 16.77 ? 66   VAL A O     1 
ATOM   512   C CB    . VAL A 1 88  ? -7.030  -12.537 -45.833  1.00 16.39 ? 66   VAL A CB    1 
ATOM   513   C CG1   . VAL A 1 88  ? -7.063  -13.317 -47.115  1.00 20.41 ? 66   VAL A CG1   1 
ATOM   514   C CG2   . VAL A 1 88  ? -8.397  -12.521 -45.180  1.00 19.50 ? 66   VAL A CG2   1 
ATOM   515   N N     . MET A 1 89  ? -3.961  -12.340 -45.900  1.00 16.74 ? 67   MET A N     1 
ATOM   516   C CA    . MET A 1 89  ? -2.707  -12.458 -46.668  1.00 17.46 ? 67   MET A CA    1 
ATOM   517   C C     . MET A 1 89  ? -1.672  -13.326 -45.974  1.00 17.36 ? 67   MET A C     1 
ATOM   518   O O     . MET A 1 89  ? -1.029  -14.146 -46.586  1.00 17.48 ? 67   MET A O     1 
ATOM   519   C CB    . MET A 1 89  ? -2.154  -11.076 -46.894  1.00 17.13 ? 67   MET A CB    1 
ATOM   520   C CG    . MET A 1 89  ? -2.992  -10.269 -47.840  1.00 19.21 ? 67   MET A CG    1 
ATOM   521   S SD    . MET A 1 89  ? -3.273  -11.136 -49.383  1.00 22.95 ? 67   MET A SD    1 
ATOM   522   C CE    . MET A 1 89  ? -4.577  -10.106 -50.063  1.00 26.96 ? 67   MET A CE    1 
ATOM   523   N N     . SER A 1 90  ? -1.565  -13.136 -44.670  1.00 19.77 ? 68   SER A N     1 
ATOM   524   C CA    . SER A 1 90  ? -0.636  -13.859 -43.820  1.00 19.58 ? 68   SER A CA    1 
ATOM   525   C C     . SER A 1 90  ? -0.874  -15.347 -43.844  1.00 20.98 ? 68   SER A C     1 
ATOM   526   O O     . SER A 1 90  ? 0.079   -16.124 -43.788  1.00 21.69 ? 68   SER A O     1 
ATOM   527   C CB    . SER A 1 90  ? -0.786  -13.405 -42.364  1.00 19.80 ? 68   SER A CB    1 
ATOM   528   O OG    . SER A 1 90  ? 0.387   -12.775 -41.909  1.00 21.07 ? 68   SER A OG    1 
ATOM   529   N N     . GLN A 1 91  ? -2.147  -15.748 -43.861  1.00 21.47 ? 69   GLN A N     1 
ATOM   530   C CA    . GLN A 1 91  ? -2.506  -17.158 -43.994  1.00 21.43 ? 69   GLN A CA    1 
ATOM   531   C C     . GLN A 1 91  ? -1.837  -17.806 -45.213  1.00 21.56 ? 69   GLN A C     1 
ATOM   532   O O     . GLN A 1 91  ? -1.535  -19.000 -45.200  1.00 22.07 ? 69   GLN A O     1 
ATOM   533   C CB    . GLN A 1 91  ? -4.027  -17.336 -44.134  1.00 22.91 ? 69   GLN A CB    1 
ATOM   534   C CG    . GLN A 1 91  ? -4.806  -17.396 -42.805  1.00 25.99 ? 69   GLN A CG    1 
ATOM   535   C CD    . GLN A 1 91  ? -6.319  -17.599 -43.020  1.00 34.69 ? 69   GLN A CD    1 
ATOM   536   O OE1   . GLN A 1 91  ? -6.858  -18.694 -42.773  1.00 37.54 ? 69   GLN A OE1   1 
ATOM   537   N NE2   . GLN A 1 91  ? -7.006  -16.547 -43.494  1.00 34.75 ? 69   GLN A NE2   1 
ATOM   538   N N     . HIS A 1 92  ? -1.633  -17.024 -46.273  1.00 19.67 ? 70   HIS A N     1 
ATOM   539   C CA    . HIS A 1 92  ? -1.005  -17.514 -47.494  1.00 18.86 ? 70   HIS A CA    1 
ATOM   540   C C     . HIS A 1 92  ? 0.467   -17.158 -47.565  1.00 19.63 ? 70   HIS A C     1 
ATOM   541   O O     . HIS A 1 92  ? 1.058   -17.193 -48.639  1.00 20.26 ? 70   HIS A O     1 
ATOM   542   C CB    . HIS A 1 92  ? -1.696  -16.909 -48.711  1.00 18.55 ? 70   HIS A CB    1 
ATOM   543   C CG    . HIS A 1 92  ? -3.123  -17.310 -48.843  1.00 19.91 ? 70   HIS A CG    1 
ATOM   544   N ND1   . HIS A 1 92  ? -3.499  -18.493 -49.438  1.00 18.02 ? 70   HIS A ND1   1 
ATOM   545   C CD2   . HIS A 1 92  ? -4.264  -16.702 -48.439  1.00 20.41 ? 70   HIS A CD2   1 
ATOM   546   C CE1   . HIS A 1 92  ? -4.815  -18.590 -49.407  1.00 22.48 ? 70   HIS A CE1   1 
ATOM   547   N NE2   . HIS A 1 92  ? -5.304  -17.515 -48.810  1.00 19.11 ? 70   HIS A NE2   1 
ATOM   548   N N     . SER A 1 93  ? 1.049   -16.804 -46.425  1.00 20.23 ? 71   SER A N     1 
ATOM   549   C CA    . SER A 1 93  ? 2.448   -16.354 -46.337  1.00 21.50 ? 71   SER A CA    1 
ATOM   550   C C     . SER A 1 93  ? 2.713   -15.151 -47.236  1.00 20.74 ? 71   SER A C     1 
ATOM   551   O O     . SER A 1 93  ? 3.834   -14.975 -47.722  1.00 20.36 ? 71   SER A O     1 
ATOM   552   C CB    . SER A 1 93  ? 3.449   -17.505 -46.615  1.00 22.95 ? 71   SER A CB    1 
ATOM   553   O OG    . SER A 1 93  ? 3.811   -18.194 -45.417  1.00 25.68 ? 71   SER A OG    1 
ATOM   554   N N     . MET A 1 94  ? 1.680   -14.332 -47.448  1.00 20.60 ? 72   MET A N     1 
ATOM   555   C CA    . MET A 1 94  ? 1.783   -13.130 -48.277  1.00 21.48 ? 72   MET A CA    1 
ATOM   556   C C     . MET A 1 94  ? 1.844   -11.873 -47.410  1.00 21.25 ? 72   MET A C     1 
ATOM   557   O O     . MET A 1 94  ? 1.407   -11.882 -46.258  1.00 21.66 ? 72   MET A O     1 
ATOM   558   C CB    . MET A 1 94  ? 0.592   -13.044 -49.252  1.00 21.44 ? 72   MET A CB    1 
ATOM   559   C CG    . MET A 1 94  ? 0.721   -13.954 -50.462  1.00 22.52 ? 72   MET A CG    1 
ATOM   560   S SD    . MET A 1 94  ? -0.805  -14.308 -51.356  1.00 16.93 ? 72   MET A SD    1 
ATOM   561   C CE    . MET A 1 94  ? -1.003  -12.800 -52.306  1.00 22.31 ? 72   MET A CE    1 
ATOM   562   N N     . PHE A 1 95  ? 2.370   -10.795 -47.992  1.00 19.50 ? 73   PHE A N     1 
ATOM   563   C CA    . PHE A 1 95  ? 2.741   -9.596  -47.253  1.00 18.49 ? 73   PHE A CA    1 
ATOM   564   C C     . PHE A 1 95  ? 1.756   -8.464  -47.472  1.00 17.51 ? 73   PHE A C     1 
ATOM   565   O O     . PHE A 1 95  ? 1.203   -8.334  -48.558  1.00 18.25 ? 73   PHE A O     1 
ATOM   566   C CB    . PHE A 1 95  ? 4.115   -9.117  -47.683  1.00 18.14 ? 73   PHE A CB    1 
ATOM   567   C CG    . PHE A 1 95  ? 4.803   -8.274  -46.659  1.00 19.48 ? 73   PHE A CG    1 
ATOM   568   C CD1   . PHE A 1 95  ? 5.450   -8.861  -45.581  1.00 15.92 ? 73   PHE A CD1   1 
ATOM   569   C CD2   . PHE A 1 95  ? 4.814   -6.894  -46.775  1.00 23.40 ? 73   PHE A CD2   1 
ATOM   570   C CE1   . PHE A 1 95  ? 6.092   -8.085  -44.641  1.00 20.10 ? 73   PHE A CE1   1 
ATOM   571   C CE2   . PHE A 1 95  ? 5.457   -6.110  -45.846  1.00 19.62 ? 73   PHE A CE2   1 
ATOM   572   C CZ    . PHE A 1 95  ? 6.100   -6.696  -44.783  1.00 19.79 ? 73   PHE A CZ    1 
ATOM   573   N N     . THR A 1 96  ? 1.551   -7.646  -46.443  1.00 16.12 ? 74   THR A N     1 
ATOM   574   C CA    . THR A 1 96  ? 0.654   -6.508  -46.542  1.00 15.69 ? 74   THR A CA    1 
ATOM   575   C C     . THR A 1 96  ? 1.423   -5.275  -46.096  1.00 15.99 ? 74   THR A C     1 
ATOM   576   O O     . THR A 1 96  ? 1.958   -5.262  -44.984  1.00 15.38 ? 74   THR A O     1 
ATOM   577   C CB    . THR A 1 96  ? -0.653  -6.672  -45.662  1.00 17.07 ? 74   THR A CB    1 
ATOM   578   O OG1   . THR A 1 96  ? -1.357  -7.895  -45.975  1.00 14.77 ? 74   THR A OG1   1 
ATOM   579   C CG2   . THR A 1 96  ? -1.594  -5.488  -45.851  1.00 13.91 ? 74   THR A CG2   1 
ATOM   580   N N     . ALA A 1 97  ? 1.493   -4.257  -46.969  1.00 15.95 ? 75   ALA A N     1 
ATOM   581   C CA    . ALA A 1 97  ? 1.975   -2.916  -46.569  1.00 15.52 ? 75   ALA A CA    1 
ATOM   582   C C     . ALA A 1 97  ? 0.753   -2.166  -46.075  1.00 16.46 ? 75   ALA A C     1 
ATOM   583   O O     . ALA A 1 97  ? -0.180  -1.907  -46.827  1.00 15.34 ? 75   ALA A O     1 
ATOM   584   C CB    . ALA A 1 97  ? 2.672   -2.172  -47.718  1.00 13.06 ? 75   ALA A CB    1 
ATOM   585   N N     . ILE A 1 98  ? 0.756   -1.867  -44.783  1.00 17.59 ? 76   ILE A N     1 
ATOM   586   C CA    . ILE A 1 98  ? -0.372  -1.259  -44.112  1.00 15.47 ? 76   ILE A CA    1 
ATOM   587   C C     . ILE A 1 98  ? -0.359  0.243   -44.383  1.00 16.48 ? 76   ILE A C     1 
ATOM   588   O O     . ILE A 1 98  ? 0.662   0.908   -44.268  1.00 16.22 ? 76   ILE A O     1 
ATOM   589   C CB    . ILE A 1 98  ? -0.256  -1.534  -42.612  1.00 13.79 ? 76   ILE A CB    1 
ATOM   590   C CG1   . ILE A 1 98  ? -0.439  -3.025  -42.336  1.00 16.58 ? 76   ILE A CG1   1 
ATOM   591   C CG2   . ILE A 1 98  ? -1.284  -0.737  -41.827  1.00 15.99 ? 76   ILE A CG2   1 
ATOM   592   C CD1   . ILE A 1 98  ? -1.937  -3.587  -42.485  1.00 13.71 ? 76   ILE A CD1   1 
ATOM   593   N N     . HIS A 1 99  ? -1.501  0.794   -44.751  1.00 17.88 ? 77   HIS A N     1 
ATOM   594   C CA    . HIS A 1 99  ? -1.545  2.217   -45.052  1.00 17.45 ? 77   HIS A CA    1 
ATOM   595   C C     . HIS A 1 99  ? -1.228  3.027   -43.791  1.00 17.85 ? 77   HIS A C     1 
ATOM   596   O O     . HIS A 1 99  ? -1.502  2.591   -42.656  1.00 17.58 ? 77   HIS A O     1 
ATOM   597   C CB    . HIS A 1 99  ? -2.885  2.586   -45.685  1.00 17.04 ? 77   HIS A CB    1 
ATOM   598   C CG    . HIS A 1 99  ? -3.999  2.682   -44.711  1.00 14.53 ? 77   HIS A CG    1 
ATOM   599   N ND1   . HIS A 1 99  ? -4.891  1.657   -44.498  1.00 22.01 ? 77   HIS A ND1   1 
ATOM   600   C CD2   . HIS A 1 99  ? -4.365  3.680   -43.881  1.00 13.66 ? 77   HIS A CD2   1 
ATOM   601   C CE1   . HIS A 1 99  ? -5.777  2.031   -43.587  1.00 17.02 ? 77   HIS A CE1   1 
ATOM   602   N NE2   . HIS A 1 99  ? -5.471  3.250   -43.186  1.00 10.84 ? 77   HIS A NE2   1 
ATOM   603   N N     . LYS A 1 100 ? -0.696  4.228   -44.006  1.00 18.90 ? 78   LYS A N     1 
ATOM   604   C CA    . LYS A 1 100 ? -0.132  5.048   -42.927  1.00 18.39 ? 78   LYS A CA    1 
ATOM   605   C C     . LYS A 1 100 ? -1.151  5.829   -42.057  1.00 16.55 ? 78   LYS A C     1 
ATOM   606   O O     . LYS A 1 100 ? -0.751  6.604   -41.214  1.00 16.99 ? 78   LYS A O     1 
ATOM   607   C CB    . LYS A 1 100 ? 0.976   5.978   -43.489  1.00 18.64 ? 78   LYS A CB    1 
ATOM   608   C CG    . LYS A 1 100 ? 0.509   7.085   -44.432  1.00 20.40 ? 78   LYS A CG    1 
ATOM   609   C CD    . LYS A 1 100 ? 1.523   8.210   -44.493  1.00 25.16 ? 78   LYS A CD    1 
ATOM   610   C CE    . LYS A 1 100 ? 0.903   9.519   -44.986  1.00 26.26 ? 78   LYS A CE    1 
ATOM   611   N NZ    . LYS A 1 100 ? 1.891   10.316  -45.827  1.00 22.23 ? 78   LYS A NZ    1 
ATOM   612   N N     . HIS A 1 101 ? -2.443  5.578   -42.211  1.00 16.75 ? 79   HIS A N     1 
ATOM   613   C CA    . HIS A 1 101 ? -3.479  6.406   -41.542  1.00 17.64 ? 79   HIS A CA    1 
ATOM   614   C C     . HIS A 1 101 ? -4.143  5.706   -40.386  1.00 17.71 ? 79   HIS A C     1 
ATOM   615   O O     . HIS A 1 101 ? -5.064  6.252   -39.780  1.00 21.05 ? 79   HIS A O     1 
ATOM   616   C CB    . HIS A 1 101 ? -4.516  6.911   -42.557  1.00 17.03 ? 79   HIS A CB    1 
ATOM   617   C CG    . HIS A 1 101 ? -3.898  7.617   -43.730  1.00 20.60 ? 79   HIS A CG    1 
ATOM   618   N ND1   . HIS A 1 101 ? -3.638  8.971   -43.730  1.00 18.23 ? 79   HIS A ND1   1 
ATOM   619   C CD2   . HIS A 1 101 ? -3.432  7.146   -44.915  1.00 17.59 ? 79   HIS A CD2   1 
ATOM   620   C CE1   . HIS A 1 101 ? -3.074  9.307   -44.877  1.00 20.90 ? 79   HIS A CE1   1 
ATOM   621   N NE2   . HIS A 1 101 ? -2.952  8.220   -45.619  1.00 16.32 ? 79   HIS A NE2   1 
ATOM   622   N N     . TYR A 1 102 ? -3.672  4.503   -40.091  1.00 16.94 ? 80   TYR A N     1 
ATOM   623   C CA    . TYR A 1 102 ? -4.045  3.785   -38.905  1.00 15.81 ? 80   TYR A CA    1 
ATOM   624   C C     . TYR A 1 102 ? -3.401  4.430   -37.687  1.00 15.81 ? 80   TYR A C     1 
ATOM   625   O O     . TYR A 1 102 ? -2.263  4.838   -37.741  1.00 17.15 ? 80   TYR A O     1 
ATOM   626   C CB    . TYR A 1 102 ? -3.523  2.366   -39.032  1.00 15.55 ? 80   TYR A CB    1 
ATOM   627   C CG    . TYR A 1 102 ? -4.432  1.417   -39.748  1.00 16.14 ? 80   TYR A CG    1 
ATOM   628   C CD1   . TYR A 1 102 ? -5.718  1.201   -39.296  1.00 14.81 ? 80   TYR A CD1   1 
ATOM   629   C CD2   . TYR A 1 102 ? -3.992  0.676   -40.833  1.00 14.37 ? 80   TYR A CD2   1 
ATOM   630   C CE1   . TYR A 1 102 ? -6.554  0.312   -39.917  1.00 13.83 ? 80   TYR A CE1   1 
ATOM   631   C CE2   . TYR A 1 102 ? -4.838  -0.253  -41.464  1.00 15.07 ? 80   TYR A CE2   1 
ATOM   632   C CZ    . TYR A 1 102 ? -6.120  -0.420  -40.984  1.00 12.86 ? 80   TYR A CZ    1 
ATOM   633   O OH    . TYR A 1 102 ? -7.002  -1.325  -41.527  1.00 14.54 ? 80   TYR A OH    1 
ATOM   634   N N     . SER A 1 103 ? -4.124  4.501   -36.586  1.00 16.59 ? 81   SER A N     1 
ATOM   635   C CA    . SER A 1 103 ? -3.598  5.074   -35.360  1.00 15.53 ? 81   SER A CA    1 
ATOM   636   C C     . SER A 1 103 ? -2.695  4.097   -34.638  1.00 15.81 ? 81   SER A C     1 
ATOM   637   O O     . SER A 1 103 ? -2.676  2.901   -34.912  1.00 17.12 ? 81   SER A O     1 
ATOM   638   C CB    . SER A 1 103 ? -4.741  5.453   -34.431  1.00 15.60 ? 81   SER A CB    1 
ATOM   639   O OG    . SER A 1 103 ? -5.385  4.290   -33.966  1.00 12.33 ? 81   SER A OG    1 
ATOM   640   N N     . LEU A 1 104 ? -1.960  4.628   -33.679  1.00 16.63 ? 82   LEU A N     1 
ATOM   641   C CA    . LEU A 1 104 ? -1.178  3.818   -32.767  1.00 16.44 ? 82   LEU A CA    1 
ATOM   642   C C     . LEU A 1 104 ? -2.026  2.772   -32.084  1.00 15.05 ? 82   LEU A C     1 
ATOM   643   O O     . LEU A 1 104 ? -1.633  1.614   -32.008  1.00 14.63 ? 82   LEU A O     1 
ATOM   644   C CB    . LEU A 1 104 ? -0.544  4.696   -31.699  1.00 15.92 ? 82   LEU A CB    1 
ATOM   645   C CG    . LEU A 1 104 ? 0.362   3.917   -30.742  1.00 20.33 ? 82   LEU A CG    1 
ATOM   646   C CD1   . LEU A 1 104 ? 1.543   3.265   -31.472  1.00 16.75 ? 82   LEU A CD1   1 
ATOM   647   C CD2   . LEU A 1 104 ? 0.837   4.859   -29.625  1.00 20.79 ? 82   LEU A CD2   1 
ATOM   648   N N     . ASP A 1 105 ? -3.181  3.192   -31.565  1.00 14.98 ? 83   ASP A N     1 
ATOM   649   C CA    . ASP A 1 105 ? -4.120  2.263   -30.922  1.00 14.72 ? 83   ASP A CA    1 
ATOM   650   C C     . ASP A 1 105 ? -4.590  1.155   -31.854  1.00 14.32 ? 83   ASP A C     1 
ATOM   651   O O     . ASP A 1 105 ? -4.669  0.005   -31.453  1.00 13.83 ? 83   ASP A O     1 
ATOM   652   C CB    . ASP A 1 105 ? -5.299  3.012   -30.320  1.00 15.02 ? 83   ASP A CB    1 
ATOM   653   C CG    . ASP A 1 105 ? -4.967  3.580   -28.947  1.00 20.94 ? 83   ASP A CG    1 
ATOM   654   O OD1   . ASP A 1 105 ? -4.781  2.805   -27.974  1.00 19.61 ? 83   ASP A OD1   1 
ATOM   655   O OD2   . ASP A 1 105 ? -4.863  4.814   -28.847  1.00 33.68 ? 83   ASP A OD2   1 
ATOM   656   N N     . ASP A 1 106 ? -4.857  1.502   -33.108  1.00 15.76 ? 84   ASP A N     1 
ATOM   657   C CA    . ASP A 1 106 ? -5.274  0.544   -34.118  1.00 14.63 ? 84   ASP A CA    1 
ATOM   658   C C     . ASP A 1 106 ? -4.200  -0.520  -34.278  1.00 14.72 ? 84   ASP A C     1 
ATOM   659   O O     . ASP A 1 106 ? -4.521  -1.698  -34.370  1.00 15.04 ? 84   ASP A O     1 
ATOM   660   C CB    . ASP A 1 106 ? -5.514  1.248   -35.469  1.00 15.32 ? 84   ASP A CB    1 
ATOM   661   C CG    . ASP A 1 106 ? -6.740  2.193   -35.475  1.00 15.56 ? 84   ASP A CG    1 
ATOM   662   O OD1   . ASP A 1 106 ? -7.722  1.940   -34.718  1.00 21.32 ? 84   ASP A OD1   1 
ATOM   663   O OD2   . ASP A 1 106 ? -6.727  3.188   -36.266  1.00 10.80 ? 84   ASP A OD2   1 
ATOM   664   N N     . TRP A 1 107 ? -2.933  -0.108  -34.320  1.00 14.69 ? 85   TRP A N     1 
ATOM   665   C CA    . TRP A 1 107 ? -1.797  -1.066  -34.390  1.00 15.86 ? 85   TRP A CA    1 
ATOM   666   C C     . TRP A 1 107 ? -1.692  -1.935  -33.143  1.00 16.39 ? 85   TRP A C     1 
ATOM   667   O O     . TRP A 1 107 ? -1.520  -3.155  -33.226  1.00 17.27 ? 85   TRP A O     1 
ATOM   668   C CB    . TRP A 1 107 ? -0.449  -0.335  -34.566  1.00 15.60 ? 85   TRP A CB    1 
ATOM   669   C CG    . TRP A 1 107 ? -0.161  0.022   -35.960  1.00 14.43 ? 85   TRP A CG    1 
ATOM   670   C CD1   . TRP A 1 107 ? -0.423  1.202   -36.562  1.00 19.38 ? 85   TRP A CD1   1 
ATOM   671   C CD2   . TRP A 1 107 ? 0.434   -0.816  -36.960  1.00 21.42 ? 85   TRP A CD2   1 
ATOM   672   N NE1   . TRP A 1 107 ? -0.024  1.165   -37.882  1.00 19.85 ? 85   TRP A NE1   1 
ATOM   673   C CE2   . TRP A 1 107 ? 0.501   -0.065  -38.148  1.00 18.64 ? 85   TRP A CE2   1 
ATOM   674   C CE3   . TRP A 1 107 ? 0.919   -2.130  -36.964  1.00 21.27 ? 85   TRP A CE3   1 
ATOM   675   C CZ2   . TRP A 1 107 ? 1.032   -0.573  -39.314  1.00 23.49 ? 85   TRP A CZ2   1 
ATOM   676   C CZ3   . TRP A 1 107 ? 1.439   -2.633  -38.120  1.00 20.77 ? 85   TRP A CZ3   1 
ATOM   677   C CH2   . TRP A 1 107 ? 1.500   -1.862  -39.282  1.00 21.85 ? 85   TRP A CH2   1 
ATOM   678   N N     . LYS A 1 108 ? -1.792  -1.304  -31.976  1.00 16.15 ? 86   LYS A N     1 
ATOM   679   C CA    . LYS A 1 108 ? -1.741  -2.045  -30.720  1.00 15.80 ? 86   LYS A CA    1 
ATOM   680   C C     . LYS A 1 108 ? -2.802  -3.132  -30.707  1.00 15.93 ? 86   LYS A C     1 
ATOM   681   O O     . LYS A 1 108 ? -2.525  -4.261  -30.281  1.00 17.68 ? 86   LYS A O     1 
ATOM   682   C CB    . LYS A 1 108 ? -1.914  -1.134  -29.515  1.00 14.70 ? 86   LYS A CB    1 
ATOM   683   C CG    . LYS A 1 108 ? -0.683  -0.303  -29.157  1.00 13.85 ? 86   LYS A CG    1 
ATOM   684   C CD    . LYS A 1 108 ? -1.064  0.698   -28.066  1.00 18.43 ? 86   LYS A CD    1 
ATOM   685   C CE    . LYS A 1 108 ? 0.037   1.684   -27.722  1.00 22.38 ? 86   LYS A CE    1 
ATOM   686   N NZ    . LYS A 1 108 ? -0.536  3.023   -27.329  1.00 25.33 ? 86   LYS A NZ    1 
ATOM   687   N N     . LEU A 1 109 ? -4.007  -2.805  -31.181  1.00 15.15 ? 87   LEU A N     1 
ATOM   688   C CA    . LEU A 1 109 ? -5.109  -3.778  -31.216  1.00 14.59 ? 87   LEU A CA    1 
ATOM   689   C C     . LEU A 1 109 ? -4.823  -4.887  -32.195  1.00 14.76 ? 87   LEU A C     1 
ATOM   690   O O     . LEU A 1 109 ? -5.151  -6.029  -31.954  1.00 16.08 ? 87   LEU A O     1 
ATOM   691   C CB    . LEU A 1 109 ? -6.450  -3.129  -31.583  1.00 14.70 ? 87   LEU A CB    1 
ATOM   692   C CG    . LEU A 1 109 ? -7.700  -4.019  -31.341  1.00 16.46 ? 87   LEU A CG    1 
ATOM   693   C CD1   . LEU A 1 109 ? -7.800  -4.510  -29.891  1.00 11.42 ? 87   LEU A CD1   1 
ATOM   694   C CD2   . LEU A 1 109 ? -9.013  -3.326  -31.743  1.00 14.13 ? 87   LEU A CD2   1 
ATOM   695   N N     . PHE A 1 110 ? -4.210  -4.542  -33.311  1.00 15.47 ? 88   PHE A N     1 
ATOM   696   C CA    . PHE A 1 110 ? -3.865  -5.531  -34.312  1.00 15.89 ? 88   PHE A CA    1 
ATOM   697   C C     . PHE A 1 110 ? -2.786  -6.495  -33.807  1.00 16.76 ? 88   PHE A C     1 
ATOM   698   O O     . PHE A 1 110 ? -2.812  -7.694  -34.111  1.00 17.05 ? 88   PHE A O     1 
ATOM   699   C CB    . PHE A 1 110 ? -3.406  -4.837  -35.592  1.00 14.70 ? 88   PHE A CB    1 
ATOM   700   C CG    . PHE A 1 110 ? -3.024  -5.788  -36.680  1.00 15.47 ? 88   PHE A CG    1 
ATOM   701   C CD1   . PHE A 1 110 ? -3.973  -6.642  -37.229  1.00 15.99 ? 88   PHE A CD1   1 
ATOM   702   C CD2   . PHE A 1 110 ? -1.712  -5.862  -37.140  1.00 14.23 ? 88   PHE A CD2   1 
ATOM   703   C CE1   . PHE A 1 110 ? -3.622  -7.532  -38.243  1.00 16.73 ? 88   PHE A CE1   1 
ATOM   704   C CE2   . PHE A 1 110 ? -1.355  -6.758  -38.150  1.00 12.44 ? 88   PHE A CE2   1 
ATOM   705   C CZ    . PHE A 1 110 ? -2.303  -7.589  -38.704  1.00 13.42 ? 88   PHE A CZ    1 
ATOM   706   N N     . ALA A 1 111 ? -1.837  -5.960  -33.047  1.00 17.85 ? 89   ALA A N     1 
ATOM   707   C CA    . ALA A 1 111 ? -0.775  -6.760  -32.465  1.00 17.98 ? 89   ALA A CA    1 
ATOM   708   C C     . ALA A 1 111 ? -1.337  -7.688  -31.413  1.00 17.81 ? 89   ALA A C     1 
ATOM   709   O O     . ALA A 1 111 ? -0.935  -8.840  -31.306  1.00 18.95 ? 89   ALA A O     1 
ATOM   710   C CB    . ALA A 1 111 ? 0.280   -5.848  -31.859  1.00 18.68 ? 89   ALA A CB    1 
ATOM   711   N N     . THR A 1 112 ? -2.269  -7.170  -30.628  1.00 17.74 ? 90   THR A N     1 
ATOM   712   C CA    . THR A 1 112 ? -2.949  -7.950  -29.592  1.00 17.36 ? 90   THR A CA    1 
ATOM   713   C C     . THR A 1 112 ? -3.683  -9.133  -30.211  1.00 16.75 ? 90   THR A C     1 
ATOM   714   O O     . THR A 1 112 ? -3.571  -10.275 -29.755  1.00 16.80 ? 90   THR A O     1 
ATOM   715   C CB    . THR A 1 112 ? -3.998  -7.068  -28.868  1.00 17.97 ? 90   THR A CB    1 
ATOM   716   O OG1   . THR A 1 112 ? -3.346  -5.939  -28.283  1.00 18.94 ? 90   THR A OG1   1 
ATOM   717   C CG2   . THR A 1 112 ? -4.752  -7.841  -27.793  1.00 18.94 ? 90   THR A CG2   1 
ATOM   718   N N     . ASN A 1 113 ? -4.430  -8.840  -31.267  1.00 15.87 ? 91   ASN A N     1 
ATOM   719   C CA    . ASN A 1 113 ? -5.348  -9.809  -31.845  1.00 15.94 ? 91   ASN A CA    1 
ATOM   720   C C     . ASN A 1 113 ? -4.759  -10.682 -32.939  1.00 15.44 ? 91   ASN A C     1 
ATOM   721   O O     . ASN A 1 113 ? -5.188  -11.811 -33.094  1.00 15.76 ? 91   ASN A O     1 
ATOM   722   C CB    . ASN A 1 113 ? -6.601  -9.088  -32.347  1.00 16.78 ? 91   ASN A CB    1 
ATOM   723   C CG    . ASN A 1 113 ? -7.504  -8.653  -31.216  1.00 18.41 ? 91   ASN A CG    1 
ATOM   724   O OD1   . ASN A 1 113 ? -7.286  -9.033  -30.063  1.00 18.48 ? 91   ASN A OD1   1 
ATOM   725   N ND2   . ASN A 1 113 ? -8.527  -7.854  -31.533  1.00 26.73 ? 91   ASN A ND2   1 
ATOM   726   N N     . HIS A 1 114 ? -3.774  -10.167 -33.675  1.00 14.40 ? 92   HIS A N     1 
ATOM   727   C CA    . HIS A 1 114 ? -3.188  -10.888 -34.799  1.00 15.91 ? 92   HIS A CA    1 
ATOM   728   C C     . HIS A 1 114 ? -1.652  -10.905 -34.751  1.00 16.82 ? 92   HIS A C     1 
ATOM   729   O O     . HIS A 1 114 ? -0.982  -10.498 -35.714  1.00 15.14 ? 92   HIS A O     1 
ATOM   730   C CB    . HIS A 1 114 ? -3.705  -10.280 -36.121  1.00 16.11 ? 92   HIS A CB    1 
ATOM   731   C CG    . HIS A 1 114 ? -5.171  -10.485 -36.325  1.00 21.02 ? 92   HIS A CG    1 
ATOM   732   N ND1   . HIS A 1 114 ? -5.699  -11.677 -36.784  1.00 25.81 ? 92   HIS A ND1   1 
ATOM   733   C CD2   . HIS A 1 114 ? -6.230  -9.679  -36.066  1.00 26.31 ? 92   HIS A CD2   1 
ATOM   734   C CE1   . HIS A 1 114 ? -7.017  -11.582 -36.827  1.00 25.46 ? 92   HIS A CE1   1 
ATOM   735   N NE2   . HIS A 1 114 ? -7.365  -10.379 -36.399  1.00 25.52 ? 92   HIS A NE2   1 
ATOM   736   N N     . PRO A 1 115 ? -1.076  -11.390 -33.632  1.00 18.63 ? 93   PRO A N     1 
ATOM   737   C CA    . PRO A 1 115 ? 0.398   -11.451 -33.500  1.00 19.89 ? 93   PRO A CA    1 
ATOM   738   C C     . PRO A 1 115 ? 1.095   -12.278 -34.574  1.00 21.49 ? 93   PRO A C     1 
ATOM   739   O O     . PRO A 1 115 ? 2.228   -11.965 -34.955  1.00 21.37 ? 93   PRO A O     1 
ATOM   740   C CB    . PRO A 1 115 ? 0.614   -12.072 -32.113  1.00 20.76 ? 93   PRO A CB    1 
ATOM   741   C CG    . PRO A 1 115 ? -0.701  -12.672 -31.726  1.00 20.55 ? 93   PRO A CG    1 
ATOM   742   C CD    . PRO A 1 115 ? -1.758  -11.884 -32.426  1.00 19.23 ? 93   PRO A CD    1 
ATOM   743   N N     . GLU A 1 116 ? 0.413   -13.314 -35.056  1.00 24.29 ? 94   GLU A N     1 
ATOM   744   C CA    . GLU A 1 116 ? 0.910   -14.162 -36.149  1.00 26.14 ? 94   GLU A CA    1 
ATOM   745   C C     . GLU A 1 116 ? 1.164   -13.422 -37.477  1.00 26.22 ? 94   GLU A C     1 
ATOM   746   O O     . GLU A 1 116 ? 1.937   -13.900 -38.305  1.00 26.61 ? 94   GLU A O     1 
ATOM   747   C CB    . GLU A 1 116 ? -0.047  -15.359 -36.345  1.00 26.40 ? 94   GLU A CB    1 
ATOM   748   C CG    . GLU A 1 116 ? -1.471  -15.016 -36.863  1.00 29.14 ? 94   GLU A CG    1 
ATOM   749   C CD    . GLU A 1 116 ? -2.463  -14.612 -35.777  1.00 31.06 ? 94   GLU A CD    1 
ATOM   750   O OE1   . GLU A 1 116 ? -2.034  -14.233 -34.660  1.00 29.08 ? 94   GLU A OE1   1 
ATOM   751   O OE2   . GLU A 1 116 ? -3.683  -14.666 -36.055  1.00 32.34 ? 94   GLU A OE2   1 
ATOM   752   N N     . CYS A 1 117 ? 0.524   -12.265 -37.666  1.00 26.50 ? 95   CYS A N     1 
ATOM   753   C CA    . CYS A 1 117 ? 0.667   -11.450 -38.897  1.00 25.26 ? 95   CYS A CA    1 
ATOM   754   C C     . CYS A 1 117 ? 1.780   -10.415 -38.917  1.00 23.65 ? 95   CYS A C     1 
ATOM   755   O O     . CYS A 1 117 ? 2.158   -9.946  -39.985  1.00 22.23 ? 95   CYS A O     1 
ATOM   756   C CB    . CYS A 1 117 ? -0.640  -10.736 -39.151  1.00 25.76 ? 95   CYS A CB    1 
ATOM   757   S SG    . CYS A 1 117 ? -1.933  -11.921 -39.103  1.00 23.14 ? 95   CYS A SG    1 
ATOM   758   N N     . LEU A 1 118 ? 2.306   -10.063 -37.751  1.00 22.88 ? 96   LEU A N     1 
ATOM   759   C CA    . LEU A 1 118 ? 3.186   -8.899  -37.620  1.00 22.47 ? 96   LEU A CA    1 
ATOM   760   C C     . LEU A 1 118 ? 4.482   -9.052  -38.421  1.00 23.72 ? 96   LEU A C     1 
ATOM   761   O O     . LEU A 1 118 ? 5.095   -8.056  -38.834  1.00 24.53 ? 96   LEU A O     1 
ATOM   762   C CB    . LEU A 1 118 ? 3.506   -8.613  -36.136  1.00 22.42 ? 96   LEU A CB    1 
ATOM   763   C CG    . LEU A 1 118 ? 2.300   -8.343  -35.220  1.00 20.82 ? 96   LEU A CG    1 
ATOM   764   C CD1   . LEU A 1 118 ? 2.721   -8.033  -33.810  1.00 19.88 ? 96   LEU A CD1   1 
ATOM   765   C CD2   . LEU A 1 118 ? 1.471   -7.210  -35.734  1.00 21.98 ? 96   LEU A CD2   1 
ATOM   766   N N     . GLN A 1 119 ? 4.896   -10.297 -38.649  1.00 23.50 ? 97   GLN A N     1 
ATOM   767   C CA    . GLN A 1 119 ? 6.072   -10.565 -39.463  1.00 24.12 ? 97   GLN A CA    1 
ATOM   768   C C     . GLN A 1 119 ? 5.777   -10.348 -40.956  1.00 22.61 ? 97   GLN A C     1 
ATOM   769   O O     . GLN A 1 119 ? 6.712   -10.217 -41.770  1.00 22.88 ? 97   GLN A O     1 
ATOM   770   C CB    . GLN A 1 119 ? 6.571   -11.995 -39.207  1.00 25.75 ? 97   GLN A CB    1 
ATOM   771   C CG    . GLN A 1 119 ? 5.605   -13.093 -39.673  1.00 34.67 ? 97   GLN A CG    1 
ATOM   772   C CD    . GLN A 1 119 ? 5.449   -14.224 -38.665  1.00 41.64 ? 97   GLN A CD    1 
ATOM   773   O OE1   . GLN A 1 119 ? 6.288   -15.122 -38.582  1.00 40.38 ? 97   GLN A OE1   1 
ATOM   774   N NE2   . GLN A 1 119 ? 4.363   -14.180 -37.892  1.00 45.16 ? 97   GLN A NE2   1 
ATOM   775   N N     . ASN A 1 120 ? 4.485   -10.311 -41.298  1.00 20.88 ? 98   ASN A N     1 
ATOM   776   C CA    . ASN A 1 120 ? 4.005   -10.189 -42.677  1.00 19.89 ? 98   ASN A CA    1 
ATOM   777   C C     . ASN A 1 120 ? 3.405   -8.843  -43.057  1.00 17.14 ? 98   ASN A C     1 
ATOM   778   O O     . ASN A 1 120 ? 2.731   -8.764  -44.082  1.00 16.81 ? 98   ASN A O     1 
ATOM   779   C CB    . ASN A 1 120 ? 2.919   -11.254 -42.920  1.00 21.42 ? 98   ASN A CB    1 
ATOM   780   C CG    . ASN A 1 120 ? 3.468   -12.645 -42.980  1.00 19.70 ? 98   ASN A CG    1 
ATOM   781   O OD1   . ASN A 1 120 ? 4.082   -13.039 -43.975  1.00 32.20 ? 98   ASN A OD1   1 
ATOM   782   N ND2   . ASN A 1 120 ? 3.235   -13.410 -41.938  1.00 22.89 ? 98   ASN A ND2   1 
ATOM   783   N N     . VAL A 1 121 ? 3.659   -7.817  -42.241  1.00 15.58 ? 99   VAL A N     1 
ATOM   784   C CA    . VAL A 1 121 ? 3.202   -6.446  -42.489  1.00 14.79 ? 99   VAL A CA    1 
ATOM   785   C C     . VAL A 1 121 ? 4.339   -5.420  -42.389  1.00 15.55 ? 99   VAL A C     1 
ATOM   786   O O     . VAL A 1 121 ? 5.391   -5.666  -41.767  1.00 14.31 ? 99   VAL A O     1 
ATOM   787   C CB    . VAL A 1 121 ? 2.062   -5.986  -41.542  1.00 15.22 ? 99   VAL A CB    1 
ATOM   788   C CG1   . VAL A 1 121 ? 0.775   -6.856  -41.710  1.00 16.54 ? 99   VAL A CG1   1 
ATOM   789   C CG2   . VAL A 1 121 ? 2.511   -5.945  -40.099  1.00 17.70 ? 99   VAL A CG2   1 
ATOM   790   N N     . ALA A 1 122 ? 4.118   -4.277  -43.041  1.00 16.22 ? 100  ALA A N     1 
ATOM   791   C CA    . ALA A 1 122 ? 5.022   -3.149  -42.978  1.00 16.25 ? 100  ALA A CA    1 
ATOM   792   C C     . ALA A 1 122 ? 4.232   -1.950  -42.558  1.00 17.34 ? 100  ALA A C     1 
ATOM   793   O O     . ALA A 1 122 ? 3.081   -1.783  -42.947  1.00 17.72 ? 100  ALA A O     1 
ATOM   794   C CB    . ALA A 1 122 ? 5.646   -2.889  -44.329  1.00 17.14 ? 100  ALA A CB    1 
ATOM   795   N N     . VAL A 1 123 ? 4.859   -1.113  -41.750  1.00 18.68 ? 101  VAL A N     1 
ATOM   796   C CA    . VAL A 1 123 ? 4.265   0.134   -41.328  1.00 18.15 ? 101  VAL A CA    1 
ATOM   797   C C     . VAL A 1 123 ? 4.732   1.137   -42.364  1.00 17.87 ? 101  VAL A C     1 
ATOM   798   O O     . VAL A 1 123 ? 5.862   1.051   -42.857  1.00 17.24 ? 101  VAL A O     1 
ATOM   799   C CB    . VAL A 1 123 ? 4.621   0.497   -39.828  1.00 17.53 ? 101  VAL A CB    1 
ATOM   800   C CG1   . VAL A 1 123 ? 6.070   0.872   -39.657  1.00 17.05 ? 101  VAL A CG1   1 
ATOM   801   C CG2   . VAL A 1 123 ? 3.729   1.605   -39.301  1.00 18.77 ? 101  VAL A CG2   1 
ATOM   802   N N     . SER A 1 124 ? 3.841   2.058   -42.717  1.00 17.12 ? 102  SER A N     1 
ATOM   803   C CA    . SER A 1 124 ? 4.078   2.995   -43.794  1.00 17.36 ? 102  SER A CA    1 
ATOM   804   C C     . SER A 1 124 ? 4.226   4.417   -43.270  1.00 18.19 ? 102  SER A C     1 
ATOM   805   O O     . SER A 1 124 ? 3.612   4.799   -42.290  1.00 15.64 ? 102  SER A O     1 
ATOM   806   C CB    . SER A 1 124 ? 2.927   2.935   -44.800  1.00 18.91 ? 102  SER A CB    1 
ATOM   807   O OG    . SER A 1 124 ? 2.764   1.654   -45.416  1.00 14.17 ? 102  SER A OG    1 
ATOM   808   N N     . SER A 1 125 ? 5.060   5.191   -43.936  1.00 20.70 ? 103  SER A N     1 
ATOM   809   C CA    . SER A 1 125 ? 5.285   6.585   -43.591  1.00 21.80 ? 103  SER A CA    1 
ATOM   810   C C     . SER A 1 125 ? 5.696   7.423   -44.826  1.00 23.05 ? 103  SER A C     1 
ATOM   811   O O     . SER A 1 125 ? 6.412   6.956   -45.725  1.00 21.43 ? 103  SER A O     1 
ATOM   812   C CB    . SER A 1 125 ? 6.361   6.687   -42.523  1.00 21.77 ? 103  SER A CB    1 
ATOM   813   O OG    . SER A 1 125 ? 6.633   8.044   -42.198  1.00 22.69 ? 103  SER A OG    1 
ATOM   814   N N     . GLY A 1 126 ? 5.212   8.666   -44.865  1.00 24.41 ? 104  GLY A N     1 
ATOM   815   C CA    . GLY A 1 126 ? 5.784   9.684   -45.746  1.00 24.64 ? 104  GLY A CA    1 
ATOM   816   C C     . GLY A 1 126 ? 7.071   10.241  -45.148  1.00 25.91 ? 104  GLY A C     1 
ATOM   817   O O     . GLY A 1 126 ? 7.560   9.762   -44.111  1.00 25.91 ? 104  GLY A O     1 
ATOM   818   N N     . SER A 1 127 ? 7.628   11.260  -45.792  1.00 27.75 ? 105  SER A N     1 
ATOM   819   C CA    . SER A 1 127 ? 8.899   11.842  -45.334  1.00 28.31 ? 105  SER A CA    1 
ATOM   820   C C     . SER A 1 127 ? 8.707   13.055  -44.432  1.00 27.91 ? 105  SER A C     1 
ATOM   821   O O     . SER A 1 127 ? 9.677   13.739  -44.121  1.00 27.50 ? 105  SER A O     1 
ATOM   822   C CB    . SER A 1 127 ? 9.831   12.186  -46.500  1.00 28.02 ? 105  SER A CB    1 
ATOM   823   O OG    . SER A 1 127 ? 9.348   13.267  -47.267  1.00 27.72 ? 105  SER A OG    1 
ATOM   824   N N     . GLY A 1 128 ? 7.475   13.310  -43.994  1.00 28.50 ? 106  GLY A N     1 
ATOM   825   C CA    . GLY A 1 128 ? 7.213   14.377  -43.036  1.00 29.19 ? 106  GLY A CA    1 
ATOM   826   C C     . GLY A 1 128 ? 7.561   14.012  -41.598  1.00 30.47 ? 106  GLY A C     1 
ATOM   827   O O     . GLY A 1 128 ? 7.655   12.834  -41.240  1.00 30.89 ? 106  GLY A O     1 
ATOM   828   N N     . GLN A 1 129 ? 7.734   15.040  -40.767  1.00 31.92 ? 107  GLN A N     1 
ATOM   829   C CA    . GLN A 1 129 ? 8.145   14.874  -39.366  1.00 31.62 ? 107  GLN A CA    1 
ATOM   830   C C     . GLN A 1 129 ? 7.074   14.117  -38.557  1.00 30.55 ? 107  GLN A C     1 
ATOM   831   O O     . GLN A 1 129 ? 7.400   13.230  -37.763  1.00 30.99 ? 107  GLN A O     1 
ATOM   832   C CB    . GLN A 1 129 ? 8.479   16.247  -38.737  1.00 32.01 ? 107  GLN A CB    1 
ATOM   833   C CG    . GLN A 1 129 ? 9.600   16.230  -37.667  1.00 36.26 ? 107  GLN A CG    1 
ATOM   834   C CD    . GLN A 1 129 ? 10.218  17.631  -37.334  1.00 43.46 ? 107  GLN A CD    1 
ATOM   835   O OE1   . GLN A 1 129 ? 10.191  18.572  -38.144  1.00 43.22 ? 107  GLN A OE1   1 
ATOM   836   N NE2   . GLN A 1 129 ? 10.791  17.745  -36.131  1.00 46.05 ? 107  GLN A NE2   1 
ATOM   837   N N     . ASN A 1 130 ? 5.803   14.452  -38.781  1.00 30.10 ? 108  ASN A N     1 
ATOM   838   C CA    . ASN A 1 130 ? 4.683   13.815  -38.068  1.00 29.75 ? 108  ASN A CA    1 
ATOM   839   C C     . ASN A 1 130 ? 4.566   12.319  -38.378  1.00 30.00 ? 108  ASN A C     1 
ATOM   840   O O     . ASN A 1 130 ? 4.250   11.517  -37.493  1.00 29.67 ? 108  ASN A O     1 
ATOM   841   C CB    . ASN A 1 130 ? 3.343   14.469  -38.431  1.00 29.07 ? 108  ASN A CB    1 
ATOM   842   C CG    . ASN A 1 130 ? 3.194   15.879  -37.880  1.00 32.13 ? 108  ASN A CG    1 
ATOM   843   O OD1   . ASN A 1 130 ? 3.449   16.139  -36.703  1.00 34.54 ? 108  ASN A OD1   1 
ATOM   844   N ND2   . ASN A 1 130 ? 2.747   16.795  -38.734  1.00 31.60 ? 108  ASN A ND2   1 
ATOM   845   N N     . ASP A 1 131 ? 4.772   11.974  -39.652  1.00 29.03 ? 109  ASP A N     1 
ATOM   846   C CA    . ASP A 1 131 ? 4.724   10.598  -40.098  1.00 28.22 ? 109  ASP A CA    1 
ATOM   847   C C     . ASP A 1 131 ? 5.828   9.805   -39.436  1.00 26.81 ? 109  ASP A C     1 
ATOM   848   O O     . ASP A 1 131 ? 5.604   8.690   -38.976  1.00 27.75 ? 109  ASP A O     1 
ATOM   849   C CB    . ASP A 1 131 ? 4.904   10.509  -41.617  1.00 30.31 ? 109  ASP A CB    1 
ATOM   850   C CG    . ASP A 1 131 ? 3.647   10.852  -42.396  1.00 29.01 ? 109  ASP A CG    1 
ATOM   851   O OD1   . ASP A 1 131 ? 2.628   11.203  -41.784  1.00 34.97 ? 109  ASP A OD1   1 
ATOM   852   O OD2   . ASP A 1 131 ? 3.697   10.753  -43.640  1.00 27.68 ? 109  ASP A OD2   1 
ATOM   853   N N     . LEU A 1 132 ? 7.017   10.386  -39.392  1.00 25.28 ? 110  LEU A N     1 
ATOM   854   C CA    . LEU A 1 132 ? 8.167   9.706   -38.821  1.00 25.27 ? 110  LEU A CA    1 
ATOM   855   C C     . LEU A 1 132 ? 7.933   9.431   -37.338  1.00 25.29 ? 110  LEU A C     1 
ATOM   856   O O     . LEU A 1 132 ? 8.200   8.322   -36.858  1.00 26.19 ? 110  LEU A O     1 
ATOM   857   C CB    . LEU A 1 132 ? 9.466   10.521  -39.026  1.00 26.05 ? 110  LEU A CB    1 
ATOM   858   C CG    . LEU A 1 132 ? 10.807  9.826   -38.698  1.00 23.91 ? 110  LEU A CG    1 
ATOM   859   C CD1   . LEU A 1 132 ? 11.024  8.591   -39.541  1.00 24.61 ? 110  LEU A CD1   1 
ATOM   860   C CD2   . LEU A 1 132 ? 12.019  10.741  -38.862  1.00 22.00 ? 110  LEU A CD2   1 
ATOM   861   N N     . GLU A 1 133 ? 7.423   10.435  -36.628  1.00 24.46 ? 111  GLU A N     1 
ATOM   862   C CA    . GLU A 1 133 ? 7.114   10.294  -35.200  1.00 24.65 ? 111  GLU A CA    1 
ATOM   863   C C     . GLU A 1 133 ? 6.019   9.271   -34.936  1.00 22.16 ? 111  GLU A C     1 
ATOM   864   O O     . GLU A 1 133 ? 6.146   8.505   -34.003  1.00 22.83 ? 111  GLU A O     1 
ATOM   865   C CB    . GLU A 1 133 ? 6.789   11.652  -34.558  1.00 25.96 ? 111  GLU A CB    1 
ATOM   866   C CG    . GLU A 1 133 ? 8.033   12.591  -34.478  1.00 32.59 ? 111  GLU A CG    1 
ATOM   867   C CD    . GLU A 1 133 ? 7.734   13.966  -33.853  1.00 38.68 ? 111  GLU A CD    1 
ATOM   868   O OE1   . GLU A 1 133 ? 7.571   14.036  -32.615  1.00 38.38 ? 111  GLU A OE1   1 
ATOM   869   O OE2   . GLU A 1 133 ? 7.683   14.976  -34.597  1.00 40.26 ? 111  GLU A OE2   1 
ATOM   870   N N     . LYS A 1 134 ? 4.966   9.236   -35.752  1.00 20.67 ? 112  LYS A N     1 
ATOM   871   C CA    . LYS A 1 134 ? 3.899   8.247   -35.556  1.00 20.45 ? 112  LYS A CA    1 
ATOM   872   C C     . LYS A 1 134 ? 4.425   6.852   -35.816  1.00 17.89 ? 112  LYS A C     1 
ATOM   873   O O     . LYS A 1 134 ? 4.145   5.933   -35.072  1.00 16.36 ? 112  LYS A O     1 
ATOM   874   C CB    . LYS A 1 134 ? 2.650   8.502   -36.417  1.00 20.80 ? 112  LYS A CB    1 
ATOM   875   C CG    . LYS A 1 134 ? 1.457   7.590   -35.971  1.00 24.87 ? 112  LYS A CG    1 
ATOM   876   C CD    . LYS A 1 134 ? 0.093   8.037   -36.451  1.00 26.59 ? 112  LYS A CD    1 
ATOM   877   C CE    . LYS A 1 134 ? -0.282  7.409   -37.772  1.00 25.25 ? 112  LYS A CE    1 
ATOM   878   N NZ    . LYS A 1 134 ? -1.574  7.963   -38.246  1.00 27.31 ? 112  LYS A NZ    1 
ATOM   879   N N     . MET A 1 135 ? 5.196   6.703   -36.876  1.00 17.65 ? 113  MET A N     1 
ATOM   880   C CA    . MET A 1 135 ? 5.769   5.408   -37.218  1.00 18.94 ? 113  MET A CA    1 
ATOM   881   C C     . MET A 1 135 ? 6.725   4.902   -36.120  1.00 18.57 ? 113  MET A C     1 
ATOM   882   O O     . MET A 1 135 ? 6.721   3.724   -35.735  1.00 18.65 ? 113  MET A O     1 
ATOM   883   C CB    . MET A 1 135 ? 6.513   5.505   -38.543  1.00 18.21 ? 113  MET A CB    1 
ATOM   884   C CG    . MET A 1 135 ? 7.003   4.175   -39.020  1.00 17.97 ? 113  MET A CG    1 
ATOM   885   S SD    . MET A 1 135 ? 7.972   4.349   -40.496  1.00 26.37 ? 113  MET A SD    1 
ATOM   886   C CE    . MET A 1 135 ? 9.466   5.089   -39.839  1.00 29.93 ? 113  MET A CE    1 
ATOM   887   N N     . THR A 1 136 ? 7.553   5.814   -35.645  1.00 18.69 ? 114  THR A N     1 
ATOM   888   C CA    . THR A 1 136 ? 8.438   5.558   -34.528  1.00 17.88 ? 114  THR A CA    1 
ATOM   889   C C     . THR A 1 136 ? 7.676   5.049   -33.308  1.00 16.91 ? 114  THR A C     1 
ATOM   890   O O     . THR A 1 136 ? 8.071   4.064   -32.695  1.00 15.99 ? 114  THR A O     1 
ATOM   891   C CB    . THR A 1 136 ? 9.218   6.820   -34.211  1.00 16.77 ? 114  THR A CB    1 
ATOM   892   O OG1   . THR A 1 136 ? 10.032  7.129   -35.347  1.00 18.87 ? 114  THR A OG1   1 
ATOM   893   C CG2   . THR A 1 136 ? 10.115  6.615   -33.026  1.00 18.60 ? 114  THR A CG2   1 
ATOM   894   N N     . SER A 1 137 ? 6.559   5.681   -32.986  1.00 16.58 ? 115  SER A N     1 
ATOM   895   C CA    . SER A 1 137 ? 5.741   5.240   -31.861  1.00 17.65 ? 115  SER A CA    1 
ATOM   896   C C     . SER A 1 137 ? 5.183   3.819   -32.069  1.00 18.59 ? 115  SER A C     1 
ATOM   897   O O     . SER A 1 137 ? 5.164   3.007   -31.133  1.00 20.77 ? 115  SER A O     1 
ATOM   898   C CB    . SER A 1 137 ? 4.601   6.239   -31.605  1.00 16.89 ? 115  SER A CB    1 
ATOM   899   O OG    . SER A 1 137 ? 3.627   6.161   -32.622  1.00 18.17 ? 115  SER A OG    1 
ATOM   900   N N     . ILE A 1 138 ? 4.735   3.534   -33.294  1.00 19.10 ? 116  ILE A N     1 
ATOM   901   C CA    . ILE A 1 138 ? 4.182   2.235   -33.660  1.00 18.30 ? 116  ILE A CA    1 
ATOM   902   C C     . ILE A 1 138 ? 5.233   1.142   -33.549  1.00 18.52 ? 116  ILE A C     1 
ATOM   903   O O     . ILE A 1 138 ? 4.961   0.074   -33.006  1.00 18.23 ? 116  ILE A O     1 
ATOM   904   C CB    . ILE A 1 138 ? 3.635   2.280   -35.067  1.00 17.40 ? 116  ILE A CB    1 
ATOM   905   C CG1   . ILE A 1 138 ? 2.384   3.168   -35.085  1.00 20.10 ? 116  ILE A CG1   1 
ATOM   906   C CG2   . ILE A 1 138 ? 3.308   0.869   -35.557  1.00 21.91 ? 116  ILE A CG2   1 
ATOM   907   C CD1   . ILE A 1 138 ? 1.943   3.675   -36.452  1.00 17.42 ? 116  ILE A CD1   1 
ATOM   908   N N     . LEU A 1 139 ? 6.428   1.413   -34.074  1.00 18.86 ? 117  LEU A N     1 
ATOM   909   C CA    . LEU A 1 139 ? 7.537   0.455   -34.053  1.00 19.38 ? 117  LEU A CA    1 
ATOM   910   C C     . LEU A 1 139 ? 8.038   0.151   -32.655  1.00 20.77 ? 117  LEU A C     1 
ATOM   911   O O     . LEU A 1 139 ? 8.369   -0.995  -32.323  1.00 20.49 ? 117  LEU A O     1 
ATOM   912   C CB    . LEU A 1 139 ? 8.702   0.983   -34.889  1.00 19.32 ? 117  LEU A CB    1 
ATOM   913   C CG    . LEU A 1 139 ? 8.497   0.887   -36.402  1.00 20.51 ? 117  LEU A CG    1 
ATOM   914   C CD1   . LEU A 1 139 ? 9.604   1.622   -37.109  1.00 23.50 ? 117  LEU A CD1   1 
ATOM   915   C CD2   . LEU A 1 139 ? 8.438   -0.574  -36.895  1.00 19.21 ? 117  LEU A CD2   1 
ATOM   916   N N     . GLU A 1 140 ? 8.103   1.186   -31.830  1.00 23.14 ? 118  GLU A N     1 
ATOM   917   C CA    . GLU A 1 140 ? 8.473   1.017   -30.419  1.00 23.94 ? 118  GLU A CA    1 
ATOM   918   C C     . GLU A 1 140 ? 7.416   0.225   -29.671  1.00 21.92 ? 118  GLU A C     1 
ATOM   919   O O     . GLU A 1 140 ? 7.750   -0.623  -28.857  1.00 21.61 ? 118  GLU A O     1 
ATOM   920   C CB    . GLU A 1 140 ? 8.650   2.374   -29.726  1.00 24.59 ? 118  GLU A CB    1 
ATOM   921   C CG    . GLU A 1 140 ? 9.940   3.100   -30.094  1.00 31.68 ? 118  GLU A CG    1 
ATOM   922   C CD    . GLU A 1 140 ? 10.057  4.492   -29.464  1.00 37.96 ? 118  GLU A CD    1 
ATOM   923   O OE1   . GLU A 1 140 ? 9.170   4.891   -28.672  1.00 41.00 ? 118  GLU A OE1   1 
ATOM   924   O OE2   . GLU A 1 140 ? 11.048  5.193   -29.769  1.00 36.61 ? 118  GLU A OE2   1 
ATOM   925   N N     . ALA A 1 141 ? 6.145   0.505   -29.950  1.00 21.18 ? 119  ALA A N     1 
ATOM   926   C CA    . ALA A 1 141 ? 5.037   -0.199  -29.294  1.00 20.05 ? 119  ALA A CA    1 
ATOM   927   C C     . ALA A 1 141 ? 4.860   -1.617  -29.829  1.00 18.84 ? 119  ALA A C     1 
ATOM   928   O O     . ALA A 1 141 ? 4.399   -2.495  -29.105  1.00 18.71 ? 119  ALA A O     1 
ATOM   929   C CB    . ALA A 1 141 ? 3.754   0.575   -29.440  1.00 18.69 ? 119  ALA A CB    1 
ATOM   930   N N     . VAL A 1 142 ? 5.233   -1.843  -31.088  1.00 18.64 ? 120  VAL A N     1 
ATOM   931   C CA    . VAL A 1 142 ? 5.074   -3.144  -31.730  1.00 18.12 ? 120  VAL A CA    1 
ATOM   932   C C     . VAL A 1 142 ? 6.419   -3.596  -32.312  1.00 18.62 ? 120  VAL A C     1 
ATOM   933   O O     . VAL A 1 142 ? 6.662   -3.522  -33.534  1.00 17.04 ? 120  VAL A O     1 
ATOM   934   C CB    . VAL A 1 142 ? 3.994   -3.115  -32.819  1.00 18.63 ? 120  VAL A CB    1 
ATOM   935   C CG1   . VAL A 1 142 ? 3.667   -4.546  -33.255  1.00 20.30 ? 120  VAL A CG1   1 
ATOM   936   C CG2   . VAL A 1 142 ? 2.719   -2.407  -32.315  1.00 17.21 ? 120  VAL A CG2   1 
ATOM   937   N N     . PRO A 1 143 ? 7.304   -4.089  -31.432  1.00 19.59 ? 121  PRO A N     1 
ATOM   938   C CA    . PRO A 1 143 ? 8.632   -4.542  -31.857  1.00 20.94 ? 121  PRO A CA    1 
ATOM   939   C C     . PRO A 1 143 ? 8.647   -5.684  -32.886  1.00 22.62 ? 121  PRO A C     1 
ATOM   940   O O     . PRO A 1 143 ? 9.697   -5.940  -33.507  1.00 23.34 ? 121  PRO A O     1 
ATOM   941   C CB    . PRO A 1 143 ? 9.276   -5.009  -30.542  1.00 20.46 ? 121  PRO A CB    1 
ATOM   942   C CG    . PRO A 1 143 ? 8.446   -4.400  -29.434  1.00 19.10 ? 121  PRO A CG    1 
ATOM   943   C CD    . PRO A 1 143 ? 7.088   -4.249  -29.975  1.00 18.69 ? 121  PRO A CD    1 
ATOM   944   N N     . GLN A 1 144 ? 7.512   -6.363  -33.055  1.00 22.90 ? 122  GLN A N     1 
ATOM   945   C CA    . GLN A 1 144 ? 7.400   -7.485  -33.978  1.00 23.17 ? 122  GLN A CA    1 
ATOM   946   C C     . GLN A 1 144 ? 7.270   -7.038  -35.438  1.00 22.73 ? 122  GLN A C     1 
ATOM   947   O O     . GLN A 1 144 ? 7.466   -7.842  -36.358  1.00 22.58 ? 122  GLN A O     1 
ATOM   948   C CB    . GLN A 1 144 ? 6.212   -8.354  -33.588  1.00 24.30 ? 122  GLN A CB    1 
ATOM   949   C CG    . GLN A 1 144 ? 6.320   -9.013  -32.189  1.00 26.18 ? 122  GLN A CG    1 
ATOM   950   C CD    . GLN A 1 144 ? 5.995   -8.064  -31.014  1.00 32.71 ? 122  GLN A CD    1 
ATOM   951   O OE1   . GLN A 1 144 ? 5.465   -6.954  -31.202  1.00 28.25 ? 122  GLN A OE1   1 
ATOM   952   N NE2   . GLN A 1 144 ? 6.325   -8.508  -29.791  1.00 35.04 ? 122  GLN A NE2   1 
ATOM   953   N N     . VAL A 1 145 ? 6.931   -5.762  -35.651  1.00 22.97 ? 123  VAL A N     1 
ATOM   954   C CA    . VAL A 1 145 ? 6.894   -5.175  -36.995  1.00 22.11 ? 123  VAL A CA    1 
ATOM   955   C C     . VAL A 1 145 ? 8.315   -4.792  -37.382  1.00 21.57 ? 123  VAL A C     1 
ATOM   956   O O     . VAL A 1 145 ? 8.905   -3.926  -36.760  1.00 22.27 ? 123  VAL A O     1 
ATOM   957   C CB    . VAL A 1 145 ? 5.970   -3.918  -37.046  1.00 21.62 ? 123  VAL A CB    1 
ATOM   958   C CG1   . VAL A 1 145 ? 6.092   -3.181  -38.378  1.00 25.26 ? 123  VAL A CG1   1 
ATOM   959   C CG2   . VAL A 1 145 ? 4.534   -4.295  -36.833  1.00 21.86 ? 123  VAL A CG2   1 
ATOM   960   N N     . LYS A 1 146 ? 8.850   -5.454  -38.408  1.00 22.12 ? 124  LYS A N     1 
ATOM   961   C CA    . LYS A 1 146 ? 10.256  -5.302  -38.791  1.00 21.78 ? 124  LYS A CA    1 
ATOM   962   C C     . LYS A 1 146 ? 10.461  -4.792  -40.215  1.00 20.76 ? 124  LYS A C     1 
ATOM   963   O O     . LYS A 1 146 ? 11.573  -4.870  -40.751  1.00 19.48 ? 124  LYS A O     1 
ATOM   964   C CB    . LYS A 1 146 ? 10.997  -6.625  -38.578  1.00 23.56 ? 124  LYS A CB    1 
ATOM   965   C CG    . LYS A 1 146 ? 11.111  -7.003  -37.103  1.00 26.49 ? 124  LYS A CG    1 
ATOM   966   C CD    . LYS A 1 146 ? 11.981  -6.024  -36.293  1.00 30.87 ? 124  LYS A CD    1 
ATOM   967   C CE    . LYS A 1 146 ? 13.412  -5.961  -36.840  1.00 34.14 ? 124  LYS A CE    1 
ATOM   968   N NZ    . LYS A 1 146 ? 14.416  -5.634  -35.791  1.00 36.79 ? 124  LYS A NZ    1 
ATOM   969   N N     . PHE A 1 147 ? 9.394   -4.261  -40.810  1.00 20.02 ? 125  PHE A N     1 
ATOM   970   C CA    . PHE A 1 147 ? 9.448   -3.671  -42.155  1.00 18.45 ? 125  PHE A CA    1 
ATOM   971   C C     . PHE A 1 147 ? 8.865   -2.272  -42.140  1.00 17.07 ? 125  PHE A C     1 
ATOM   972   O O     . PHE A 1 147 ? 7.770   -2.044  -41.604  1.00 15.30 ? 125  PHE A O     1 
ATOM   973   C CB    . PHE A 1 147 ? 8.614   -4.462  -43.148  1.00 18.64 ? 125  PHE A CB    1 
ATOM   974   C CG    . PHE A 1 147 ? 9.242   -5.724  -43.620  1.00 19.94 ? 125  PHE A CG    1 
ATOM   975   C CD1   . PHE A 1 147 ? 9.830   -5.784  -44.870  1.00 18.81 ? 125  PHE A CD1   1 
ATOM   976   C CD2   . PHE A 1 147 ? 9.172   -6.876  -42.853  1.00 20.86 ? 125  PHE A CD2   1 
ATOM   977   C CE1   . PHE A 1 147 ? 10.363  -6.968  -45.336  1.00 22.56 ? 125  PHE A CE1   1 
ATOM   978   C CE2   . PHE A 1 147 ? 9.712   -8.050  -43.302  1.00 20.57 ? 125  PHE A CE2   1 
ATOM   979   C CZ    . PHE A 1 147 ? 10.312  -8.097  -44.557  1.00 22.38 ? 125  PHE A CZ    1 
ATOM   980   N N     . ILE A 1 148 ? 9.586   -1.357  -42.771  1.00 16.96 ? 126  ILE A N     1 
ATOM   981   C CA    . ILE A 1 148 ? 9.161   0.025   -42.918  1.00 16.61 ? 126  ILE A CA    1 
ATOM   982   C C     . ILE A 1 148 ? 8.943   0.320   -44.391  1.00 16.72 ? 126  ILE A C     1 
ATOM   983   O O     . ILE A 1 148 ? 9.768   -0.057  -45.238  1.00 15.79 ? 126  ILE A O     1 
ATOM   984   C CB    . ILE A 1 148 ? 10.247  0.980   -42.381  1.00 15.63 ? 126  ILE A CB    1 
ATOM   985   C CG1   . ILE A 1 148 ? 10.375  0.818   -40.874  1.00 18.92 ? 126  ILE A CG1   1 
ATOM   986   C CG2   . ILE A 1 148 ? 9.921   2.427   -42.693  1.00 17.25 ? 126  ILE A CG2   1 
ATOM   987   C CD1   . ILE A 1 148 ? 11.667  1.423   -40.282  1.00 20.98 ? 126  ILE A CD1   1 
ATOM   988   N N     . CYS A 1 149 ? 7.829   0.985   -44.701  1.00 17.54 ? 127  CYS A N     1 
ATOM   989   C CA    . CYS A 1 149 ? 7.532   1.424   -46.091  1.00 18.45 ? 127  CYS A CA    1 
ATOM   990   C C     . CYS A 1 149 ? 7.567   2.953   -46.209  1.00 18.65 ? 127  CYS A C     1 
ATOM   991   O O     . CYS A 1 149 ? 6.712   3.642   -45.647  1.00 17.53 ? 127  CYS A O     1 
ATOM   992   C CB    . CYS A 1 149 ? 6.135   0.909   -46.543  1.00 19.11 ? 127  CYS A CB    1 
ATOM   993   S SG    . CYS A 1 149 ? 5.798   0.963   -48.375  1.00 19.62 ? 127  CYS A SG    1 
ATOM   994   N N     . LEU A 1 150 ? 8.543   3.468   -46.950  1.00 19.22 ? 128  LEU A N     1 
ATOM   995   C CA    . LEU A 1 150 ? 8.695   4.912   -47.156  1.00 19.32 ? 128  LEU A CA    1 
ATOM   996   C C     . LEU A 1 150 ? 8.324   5.354   -48.562  1.00 21.14 ? 128  LEU A C     1 
ATOM   997   O O     . LEU A 1 150 ? 8.802   4.796   -49.559  1.00 22.69 ? 128  LEU A O     1 
ATOM   998   C CB    . LEU A 1 150 ? 10.131  5.327   -46.921  1.00 19.67 ? 128  LEU A CB    1 
ATOM   999   C CG    . LEU A 1 150 ? 10.664  5.021   -45.529  1.00 18.20 ? 128  LEU A CG    1 
ATOM   1000  C CD1   . LEU A 1 150 ? 12.082  5.636   -45.411  1.00 10.78 ? 128  LEU A CD1   1 
ATOM   1001  C CD2   . LEU A 1 150 ? 9.624   5.483   -44.391  1.00 10.50 ? 128  LEU A CD2   1 
ATOM   1002  N N     . ASP A 1 151 ? 7.504   6.396   -48.641  1.00 23.42 ? 129  ASP A N     1 
ATOM   1003  C CA    . ASP A 1 151 ? 6.925   6.815   -49.918  1.00 24.11 ? 129  ASP A CA    1 
ATOM   1004  C C     . ASP A 1 151 ? 6.891   8.330   -50.037  1.00 23.13 ? 129  ASP A C     1 
ATOM   1005  O O     . ASP A 1 151 ? 6.379   9.029   -49.152  1.00 21.92 ? 129  ASP A O     1 
ATOM   1006  C CB    . ASP A 1 151 ? 5.508   6.250   -50.070  1.00 24.32 ? 129  ASP A CB    1 
ATOM   1007  C CG    . ASP A 1 151 ? 5.487   4.731   -50.185  1.00 28.71 ? 129  ASP A CG    1 
ATOM   1008  O OD1   . ASP A 1 151 ? 6.296   4.182   -50.979  1.00 31.74 ? 129  ASP A OD1   1 
ATOM   1009  O OD2   . ASP A 1 151 ? 4.648   4.090   -49.496  1.00 33.46 ? 129  ASP A OD2   1 
ATOM   1010  N N     . VAL A 1 152 ? 7.436   8.819   -51.160  1.00 22.50 ? 130  VAL A N     1 
ATOM   1011  C CA    . VAL A 1 152 ? 7.467   10.237  -51.445  1.00 21.08 ? 130  VAL A CA    1 
ATOM   1012  C C     . VAL A 1 152 ? 6.920   10.509  -52.828  1.00 20.32 ? 130  VAL A C     1 
ATOM   1013  O O     . VAL A 1 152 ? 6.692   9.571   -53.590  1.00 21.15 ? 130  VAL A O     1 
ATOM   1014  C CB    . VAL A 1 152 ? 8.878   10.766  -51.294  1.00 21.76 ? 130  VAL A CB    1 
ATOM   1015  C CG1   . VAL A 1 152 ? 9.278   10.712  -49.818  1.00 22.55 ? 130  VAL A CG1   1 
ATOM   1016  C CG2   . VAL A 1 152 ? 9.859   9.977   -52.163  1.00 22.03 ? 130  VAL A CG2   1 
ATOM   1017  N N     . ALA A 1 153 ? 6.642   11.779  -53.118  1.00 18.98 ? 131  ALA A N     1 
ATOM   1018  C CA    . ALA A 1 153 ? 6.194   12.189  -54.449  1.00 18.71 ? 131  ALA A CA    1 
ATOM   1019  C C     . ALA A 1 153 ? 7.336   12.084  -55.396  1.00 17.07 ? 131  ALA A C     1 
ATOM   1020  O O     . ALA A 1 153 ? 7.162   11.619  -56.518  1.00 15.88 ? 131  ALA A O     1 
ATOM   1021  C CB    . ALA A 1 153 ? 5.663   13.625  -54.445  1.00 19.49 ? 131  ALA A CB    1 
ATOM   1022  N N     . ASN A 1 154 ? 8.500   12.519  -54.937  1.00 17.44 ? 132  ASN A N     1 
ATOM   1023  C CA    . ASN A 1 154 ? 9.738   12.488  -55.755  1.00 17.99 ? 132  ASN A CA    1 
ATOM   1024  C C     . ASN A 1 154 ? 10.835  11.646  -55.142  1.00 16.05 ? 132  ASN A C     1 
ATOM   1025  O O     . ASN A 1 154 ? 11.624  12.167  -54.351  1.00 14.85 ? 132  ASN A O     1 
ATOM   1026  C CB    . ASN A 1 154 ? 10.292  13.900  -55.953  1.00 19.03 ? 132  ASN A CB    1 
ATOM   1027  C CG    . ASN A 1 154 ? 11.451  13.932  -56.934  1.00 17.52 ? 132  ASN A CG    1 
ATOM   1028  O OD1   . ASN A 1 154 ? 11.655  12.977  -57.659  1.00 21.62 ? 132  ASN A OD1   1 
ATOM   1029  N ND2   . ASN A 1 154 ? 12.181  15.033  -56.983  1.00 11.23 ? 132  ASN A ND2   1 
ATOM   1030  N N     . GLY A 1 155 ? 10.861  10.358  -55.508  1.00 14.70 ? 133  GLY A N     1 
ATOM   1031  C CA    . GLY A 1 155 ? 11.855  9.383   -55.060  1.00 13.57 ? 133  GLY A CA    1 
ATOM   1032  C C     . GLY A 1 155 ? 13.268  9.624   -55.589  1.00 15.62 ? 133  GLY A C     1 
ATOM   1033  O O     . GLY A 1 155 ? 14.226  8.946   -55.183  1.00 15.57 ? 133  GLY A O     1 
ATOM   1034  N N     . TYR A 1 156 ? 13.391  10.594  -56.492  1.00 15.01 ? 134  TYR A N     1 
ATOM   1035  C CA    . TYR A 1 156 ? 14.659  11.028  -57.029  1.00 15.16 ? 134  TYR A CA    1 
ATOM   1036  C C     . TYR A 1 156 ? 15.243  12.219  -56.276  1.00 16.32 ? 134  TYR A C     1 
ATOM   1037  O O     . TYR A 1 156 ? 16.283  12.725  -56.654  1.00 17.05 ? 134  TYR A O     1 
ATOM   1038  C CB    . TYR A 1 156 ? 14.500  11.362  -58.519  1.00 13.58 ? 134  TYR A CB    1 
ATOM   1039  C CG    . TYR A 1 156 ? 14.347  10.132  -59.390  1.00 8.20  ? 134  TYR A CG    1 
ATOM   1040  C CD1   . TYR A 1 156 ? 15.467  9.565   -60.059  1.00 11.26 ? 134  TYR A CD1   1 
ATOM   1041  C CD2   . TYR A 1 156 ? 13.111  9.525   -59.531  1.00 9.45  ? 134  TYR A CD2   1 
ATOM   1042  C CE1   . TYR A 1 156 ? 15.342  8.437   -60.848  1.00 12.82 ? 134  TYR A CE1   1 
ATOM   1043  C CE2   . TYR A 1 156 ? 12.946  8.387   -60.313  1.00 11.47 ? 134  TYR A CE2   1 
ATOM   1044  C CZ    . TYR A 1 156 ? 14.050  7.846   -60.972  1.00 16.03 ? 134  TYR A CZ    1 
ATOM   1045  O OH    . TYR A 1 156 ? 13.828  6.720   -61.730  1.00 11.26 ? 134  TYR A OH    1 
ATOM   1046  N N     . SER A 1 157 ? 14.605  12.637  -55.194  1.00 16.92 ? 135  SER A N     1 
ATOM   1047  C CA    . SER A 1 157 ? 15.004  13.842  -54.462  1.00 18.42 ? 135  SER A CA    1 
ATOM   1048  C C     . SER A 1 157 ? 16.133  13.559  -53.514  1.00 18.69 ? 135  SER A C     1 
ATOM   1049  O O     . SER A 1 157 ? 16.182  12.473  -52.931  1.00 20.14 ? 135  SER A O     1 
ATOM   1050  C CB    . SER A 1 157 ? 13.804  14.383  -53.655  1.00 19.44 ? 135  SER A CB    1 
ATOM   1051  O OG    . SER A 1 157 ? 14.020  15.686  -53.123  1.00 25.81 ? 135  SER A OG    1 
ATOM   1052  N N     . GLU A 1 158 ? 17.019  14.541  -53.336  1.00 19.87 ? 136  GLU A N     1 
ATOM   1053  C CA    . GLU A 1 158 ? 18.116  14.433  -52.359  1.00 21.49 ? 136  GLU A CA    1 
ATOM   1054  C C     . GLU A 1 158 ? 17.569  14.476  -50.941  1.00 21.00 ? 136  GLU A C     1 
ATOM   1055  O O     . GLU A 1 158 ? 18.178  13.976  -49.991  1.00 22.21 ? 136  GLU A O     1 
ATOM   1056  C CB    . GLU A 1 158 ? 19.179  15.537  -52.540  1.00 22.51 ? 136  GLU A CB    1 
ATOM   1057  C CG    . GLU A 1 158 ? 20.327  15.194  -53.488  1.00 26.35 ? 136  GLU A CG    1 
ATOM   1058  C CD    . GLU A 1 158 ? 21.030  13.903  -53.099  1.00 36.17 ? 136  GLU A CD    1 
ATOM   1059  O OE1   . GLU A 1 158 ? 22.263  13.767  -53.315  1.00 41.80 ? 136  GLU A OE1   1 
ATOM   1060  O OE2   . GLU A 1 158 ? 20.345  13.011  -52.559  1.00 39.17 ? 136  GLU A OE2   1 
ATOM   1061  N N     . HIS A 1 159 ? 16.397  15.067  -50.808  1.00 20.56 ? 137  HIS A N     1 
ATOM   1062  C CA    A HIS A 1 159 ? 15.738  15.107  -49.521  0.50 19.89 ? 137  HIS A CA    1 
ATOM   1063  C CA    B HIS A 1 159 ? 15.679  15.101  -49.539  0.50 19.87 ? 137  HIS A CA    1 
ATOM   1064  C C     . HIS A 1 159 ? 15.229  13.706  -49.151  1.00 19.98 ? 137  HIS A C     1 
ATOM   1065  O O     . HIS A 1 159 ? 15.133  13.387  -47.980  1.00 22.30 ? 137  HIS A O     1 
ATOM   1066  C CB    A HIS A 1 159 ? 14.644  16.182  -49.519  0.50 18.53 ? 137  HIS A CB    1 
ATOM   1067  C CB    B HIS A 1 159 ? 14.460  16.014  -49.629  0.50 18.49 ? 137  HIS A CB    1 
ATOM   1068  C CG    A HIS A 1 159 ? 15.135  17.541  -49.941  0.50 15.85 ? 137  HIS A CG    1 
ATOM   1069  C CG    B HIS A 1 159 ? 13.648  16.058  -48.374  0.50 16.08 ? 137  HIS A CG    1 
ATOM   1070  N ND1   A HIS A 1 159 ? 15.644  18.467  -49.053  0.50 17.87 ? 137  HIS A ND1   1 
ATOM   1071  N ND1   B HIS A 1 159 ? 13.859  16.993  -47.382  0.50 10.63 ? 137  HIS A ND1   1 
ATOM   1072  C CD2   A HIS A 1 159 ? 15.207  18.122  -51.163  0.50 10.98 ? 137  HIS A CD2   1 
ATOM   1073  C CD2   B HIS A 1 159 ? 12.621  15.286  -47.951  0.50 12.88 ? 137  HIS A CD2   1 
ATOM   1074  C CE1   A HIS A 1 159 ? 15.991  19.562  -49.708  0.50 8.00  ? 137  HIS A CE1   1 
ATOM   1075  C CE1   B HIS A 1 159 ? 12.996  16.793  -46.402  0.50 9.57  ? 137  HIS A CE1   1 
ATOM   1076  N NE2   A HIS A 1 159 ? 15.741  19.376  -50.990  0.50 2.00  ? 137  HIS A NE2   1 
ATOM   1077  N NE2   B HIS A 1 159 ? 12.235  15.763  -46.722  0.50 11.76 ? 137  HIS A NE2   1 
ATOM   1078  N N     . PHE A 1 160 ? 14.934  12.869  -50.141  1.00 20.15 ? 138  PHE A N     1 
ATOM   1079  C CA    . PHE A 1 160 ? 14.475  11.514  -49.847  1.00 19.70 ? 138  PHE A CA    1 
ATOM   1080  C C     . PHE A 1 160 ? 15.649  10.614  -49.539  1.00 19.09 ? 138  PHE A C     1 
ATOM   1081  O O     . PHE A 1 160 ? 15.562  9.724   -48.706  1.00 17.93 ? 138  PHE A O     1 
ATOM   1082  C CB    . PHE A 1 160 ? 13.705  10.942  -51.012  1.00 20.61 ? 138  PHE A CB    1 
ATOM   1083  C CG    . PHE A 1 160 ? 13.019  9.648   -50.710  1.00 21.24 ? 138  PHE A CG    1 
ATOM   1084  C CD1   . PHE A 1 160 ? 12.322  9.474   -49.514  1.00 18.76 ? 138  PHE A CD1   1 
ATOM   1085  C CD2   . PHE A 1 160 ? 13.041  8.608   -51.649  1.00 23.18 ? 138  PHE A CD2   1 
ATOM   1086  C CE1   . PHE A 1 160 ? 11.653  8.288   -49.252  1.00 20.89 ? 138  PHE A CE1   1 
ATOM   1087  C CE2   . PHE A 1 160 ? 12.387  7.407   -51.405  1.00 17.10 ? 138  PHE A CE2   1 
ATOM   1088  C CZ    . PHE A 1 160 ? 11.679  7.246   -50.211  1.00 21.71 ? 138  PHE A CZ    1 
ATOM   1089  N N     . VAL A 1 161 ? 16.745  10.834  -50.242  1.00 18.55 ? 139  VAL A N     1 
ATOM   1090  C CA    . VAL A 1 161 ? 17.990  10.141  -49.946  1.00 19.06 ? 139  VAL A CA    1 
ATOM   1091  C C     . VAL A 1 161 ? 18.342  10.303  -48.469  1.00 20.42 ? 139  VAL A C     1 
ATOM   1092  O O     . VAL A 1 161 ? 18.761  9.336   -47.808  1.00 19.29 ? 139  VAL A O     1 
ATOM   1093  C CB    . VAL A 1 161 ? 19.185  10.699  -50.804  1.00 19.21 ? 139  VAL A CB    1 
ATOM   1094  C CG1   . VAL A 1 161 ? 20.529  10.314  -50.194  1.00 20.68 ? 139  VAL A CG1   1 
ATOM   1095  C CG2   . VAL A 1 161 ? 19.096  10.241  -52.247  1.00 17.49 ? 139  VAL A CG2   1 
ATOM   1096  N N     . GLU A 1 162 ? 18.206  11.541  -47.985  1.00 21.86 ? 140  GLU A N     1 
ATOM   1097  C CA    . GLU A 1 162 ? 18.558  11.912  -46.626  1.00 21.35 ? 140  GLU A CA    1 
ATOM   1098  C C     . GLU A 1 162 ? 17.606  11.346  -45.623  1.00 19.06 ? 140  GLU A C     1 
ATOM   1099  O O     . GLU A 1 162 ? 17.990  11.004  -44.510  1.00 18.90 ? 140  GLU A O     1 
ATOM   1100  C CB    . GLU A 1 162 ? 18.569  13.450  -46.479  1.00 22.09 ? 140  GLU A CB    1 
ATOM   1101  C CG    . GLU A 1 162 ? 19.840  14.143  -46.995  1.00 28.11 ? 140  GLU A CG    1 
ATOM   1102  C CD    . GLU A 1 162 ? 21.135  13.297  -46.852  1.00 32.24 ? 140  GLU A CD    1 
ATOM   1103  O OE1   . GLU A 1 162 ? 21.548  12.972  -45.712  1.00 33.31 ? 140  GLU A OE1   1 
ATOM   1104  O OE2   . GLU A 1 162 ? 21.731  12.964  -47.898  1.00 33.40 ? 140  GLU A OE2   1 
ATOM   1105  N N     . PHE A 1 163 ? 16.346  11.291  -46.002  1.00 18.22 ? 141  PHE A N     1 
ATOM   1106  C CA    . PHE A 1 163 ? 15.312  10.758  -45.124  1.00 19.16 ? 141  PHE A CA    1 
ATOM   1107  C C     . PHE A 1 163 ? 15.529  9.248   -44.911  1.00 19.52 ? 141  PHE A C     1 
ATOM   1108  O O     . PHE A 1 163 ? 15.382  8.726   -43.797  1.00 19.82 ? 141  PHE A O     1 
ATOM   1109  C CB    . PHE A 1 163 ? 13.928  11.014  -45.700  1.00 17.63 ? 141  PHE A CB    1 
ATOM   1110  C CG    . PHE A 1 163 ? 12.842  10.513  -44.833  1.00 18.78 ? 141  PHE A CG    1 
ATOM   1111  C CD1   . PHE A 1 163 ? 12.683  11.018  -43.551  1.00 18.52 ? 141  PHE A CD1   1 
ATOM   1112  C CD2   . PHE A 1 163 ? 11.970  9.552   -45.284  1.00 17.33 ? 141  PHE A CD2   1 
ATOM   1113  C CE1   . PHE A 1 163 ? 11.651  10.560  -42.741  1.00 18.31 ? 141  PHE A CE1   1 
ATOM   1114  C CE2   . PHE A 1 163 ? 10.941  9.089   -44.479  1.00 21.37 ? 141  PHE A CE2   1 
ATOM   1115  C CZ    . PHE A 1 163 ? 10.798  9.576   -43.203  1.00 20.42 ? 141  PHE A CZ    1 
ATOM   1116  N N     . VAL A 1 164 ? 15.886  8.570   -45.993  1.00 19.89 ? 142  VAL A N     1 
ATOM   1117  C CA    . VAL A 1 164 ? 16.246  7.160   -45.943  1.00 21.18 ? 142  VAL A CA    1 
ATOM   1118  C C     . VAL A 1 164 ? 17.442  6.956   -45.014  1.00 20.46 ? 142  VAL A C     1 
ATOM   1119  O O     . VAL A 1 164 ? 17.381  6.068   -44.173  1.00 22.28 ? 142  VAL A O     1 
ATOM   1120  C CB    . VAL A 1 164 ? 16.472  6.602   -47.397  1.00 22.17 ? 142  VAL A CB    1 
ATOM   1121  C CG1   . VAL A 1 164 ? 17.302  5.296   -47.432  1.00 23.27 ? 142  VAL A CG1   1 
ATOM   1122  C CG2   . VAL A 1 164 ? 15.124  6.435   -48.078  1.00 19.77 ? 142  VAL A CG2   1 
ATOM   1123  N N     . LYS A 1 165 ? 18.500  7.771   -45.142  1.00 19.49 ? 143  LYS A N     1 
ATOM   1124  C CA    . LYS A 1 165 ? 19.682  7.685   -44.247  1.00 18.84 ? 143  LYS A CA    1 
ATOM   1125  C C     . LYS A 1 165 ? 19.320  7.822   -42.768  1.00 19.36 ? 143  LYS A C     1 
ATOM   1126  O O     . LYS A 1 165 ? 19.897  7.162   -41.901  1.00 19.98 ? 143  LYS A O     1 
ATOM   1127  C CB    . LYS A 1 165 ? 20.706  8.775   -44.551  1.00 18.15 ? 143  LYS A CB    1 
ATOM   1128  C CG    . LYS A 1 165 ? 21.241  8.796   -45.957  1.00 23.25 ? 143  LYS A CG    1 
ATOM   1129  C CD    . LYS A 1 165 ? 22.721  9.163   -45.969  1.00 21.85 ? 143  LYS A CD    1 
ATOM   1130  C CE    . LYS A 1 165 ? 23.242  9.488   -47.379  1.00 23.37 ? 143  LYS A CE    1 
ATOM   1131  N NZ    . LYS A 1 165 ? 24.279  10.577  -47.299  1.00 10.04 ? 143  LYS A NZ    1 
ATOM   1132  N N     . LEU A 1 166 ? 18.373  8.711   -42.494  1.00 19.33 ? 144  LEU A N     1 
ATOM   1133  C CA    . LEU A 1 166 ? 17.902  8.969   -41.143  1.00 19.17 ? 144  LEU A CA    1 
ATOM   1134  C C     . LEU A 1 166 ? 17.056  7.791   -40.603  1.00 18.15 ? 144  LEU A C     1 
ATOM   1135  O O     . LEU A 1 166 ? 17.165  7.433   -39.444  1.00 19.59 ? 144  LEU A O     1 
ATOM   1136  C CB    . LEU A 1 166 ? 17.125  10.293  -41.116  1.00 18.26 ? 144  LEU A CB    1 
ATOM   1137  C CG    . LEU A 1 166 ? 16.423  10.638  -39.796  1.00 18.37 ? 144  LEU A CG    1 
ATOM   1138  C CD1   . LEU A 1 166 ? 17.447  10.902  -38.736  1.00 13.36 ? 144  LEU A CD1   1 
ATOM   1139  C CD2   . LEU A 1 166 ? 15.434  11.800  -39.944  1.00 14.58 ? 144  LEU A CD2   1 
ATOM   1140  N N     . VAL A 1 167 ? 16.199  7.222   -41.431  1.00 17.97 ? 145  VAL A N     1 
ATOM   1141  C CA    . VAL A 1 167 ? 15.376  6.094   -41.004  1.00 17.58 ? 145  VAL A CA    1 
ATOM   1142  C C     . VAL A 1 167 ? 16.272  4.888   -40.750  1.00 15.83 ? 145  VAL A C     1 
ATOM   1143  O O     . VAL A 1 167 ? 16.114  4.172   -39.760  1.00 15.25 ? 145  VAL A O     1 
ATOM   1144  C CB    . VAL A 1 167 ? 14.244  5.792   -42.027  1.00 16.76 ? 145  VAL A CB    1 
ATOM   1145  C CG1   . VAL A 1 167 ? 13.429  4.538   -41.630  1.00 18.66 ? 145  VAL A CG1   1 
ATOM   1146  C CG2   . VAL A 1 167 ? 13.311  6.989   -42.121  1.00 15.05 ? 145  VAL A CG2   1 
ATOM   1147  N N     . ARG A 1 168 ? 17.231  4.682   -41.637  1.00 15.01 ? 146  ARG A N     1 
ATOM   1148  C CA    . ARG A 1 168 ? 18.219  3.639   -41.472  1.00 14.36 ? 146  ARG A CA    1 
ATOM   1149  C C     . ARG A 1 168 ? 18.899  3.762   -40.116  1.00 14.40 ? 146  ARG A C     1 
ATOM   1150  O O     . ARG A 1 168 ? 18.958  2.797   -39.337  1.00 17.01 ? 146  ARG A O     1 
ATOM   1151  C CB    . ARG A 1 168 ? 19.264  3.728   -42.600  1.00 15.98 ? 146  ARG A CB    1 
ATOM   1152  C CG    . ARG A 1 168 ? 20.527  2.832   -42.461  1.00 17.39 ? 146  ARG A CG    1 
ATOM   1153  C CD    . ARG A 1 168 ? 20.201  1.388   -42.074  1.00 19.05 ? 146  ARG A CD    1 
ATOM   1154  N NE    . ARG A 1 168 ? 19.382  0.760   -43.095  1.00 17.32 ? 146  ARG A NE    1 
ATOM   1155  C CZ    . ARG A 1 168 ? 18.443  -0.147  -42.874  1.00 18.33 ? 146  ARG A CZ    1 
ATOM   1156  N NH1   . ARG A 1 168 ? 18.165  -0.563  -41.653  1.00 23.62 ? 146  ARG A NH1   1 
ATOM   1157  N NH2   . ARG A 1 168 ? 17.762  -0.641  -43.895  1.00 21.39 ? 146  ARG A NH2   1 
ATOM   1158  N N     . ALA A 1 169 ? 19.401  4.955   -39.830  1.00 13.70 ? 147  ALA A N     1 
ATOM   1159  C CA    . ALA A 1 169 ? 20.105  5.223   -38.584  1.00 11.65 ? 147  ALA A CA    1 
ATOM   1160  C C     . ALA A 1 169 ? 19.194  5.055   -37.352  1.00 11.93 ? 147  ALA A C     1 
ATOM   1161  O O     . ALA A 1 169 ? 19.610  4.507   -36.328  1.00 12.78 ? 147  ALA A O     1 
ATOM   1162  C CB    . ALA A 1 169 ? 20.704  6.610   -38.627  1.00 11.64 ? 147  ALA A CB    1 
ATOM   1163  N N     . LYS A 1 170 ? 17.962  5.534   -37.457  1.00 12.05 ? 148  LYS A N     1 
ATOM   1164  C CA    . LYS A 1 170 ? 16.981  5.388   -36.393  1.00 13.61 ? 148  LYS A CA    1 
ATOM   1165  C C     . LYS A 1 170 ? 16.569  3.933   -36.136  1.00 15.68 ? 148  LYS A C     1 
ATOM   1166  O O     . LYS A 1 170 ? 16.309  3.552   -34.993  1.00 16.83 ? 148  LYS A O     1 
ATOM   1167  C CB    . LYS A 1 170 ? 15.745  6.220   -36.695  1.00 14.14 ? 148  LYS A CB    1 
ATOM   1168  C CG    . LYS A 1 170 ? 15.915  7.707   -36.387  1.00 17.00 ? 148  LYS A CG    1 
ATOM   1169  C CD    . LYS A 1 170 ? 14.697  8.511   -36.869  1.00 21.86 ? 148  LYS A CD    1 
ATOM   1170  C CE    . LYS A 1 170 ? 13.361  8.133   -36.178  1.00 21.30 ? 148  LYS A CE    1 
ATOM   1171  N NZ    . LYS A 1 170 ? 13.095  8.941   -34.945  1.00 21.80 ? 148  LYS A NZ    1 
ATOM   1172  N N     . PHE A 1 171 ? 16.486  3.136   -37.200  1.00 17.37 ? 149  PHE A N     1 
ATOM   1173  C CA    . PHE A 1 171 ? 16.042  1.736   -37.116  1.00 17.31 ? 149  PHE A CA    1 
ATOM   1174  C C     . PHE A 1 171 ? 17.007  0.821   -37.879  1.00 17.49 ? 149  PHE A C     1 
ATOM   1175  O O     . PHE A 1 171 ? 16.684  0.331   -38.939  1.00 18.43 ? 149  PHE A O     1 
ATOM   1176  C CB    . PHE A 1 171 ? 14.632  1.616   -37.681  1.00 17.28 ? 149  PHE A CB    1 
ATOM   1177  C CG    . PHE A 1 171 ? 13.673  2.629   -37.127  1.00 20.75 ? 149  PHE A CG    1 
ATOM   1178  C CD1   . PHE A 1 171 ? 13.228  2.536   -35.819  1.00 19.07 ? 149  PHE A CD1   1 
ATOM   1179  C CD2   . PHE A 1 171 ? 13.235  3.692   -37.907  1.00 20.84 ? 149  PHE A CD2   1 
ATOM   1180  C CE1   . PHE A 1 171 ? 12.348  3.484   -35.302  1.00 20.96 ? 149  PHE A CE1   1 
ATOM   1181  C CE2   . PHE A 1 171 ? 12.345  4.635   -37.392  1.00 21.77 ? 149  PHE A CE2   1 
ATOM   1182  C CZ    . PHE A 1 171 ? 11.910  4.534   -36.091  1.00 19.58 ? 149  PHE A CZ    1 
ATOM   1183  N N     . PRO A 1 172 ? 18.209  0.594   -37.338  1.00 17.93 ? 150  PRO A N     1 
ATOM   1184  C CA    . PRO A 1 172 ? 19.245  -0.174  -38.045  1.00 18.46 ? 150  PRO A CA    1 
ATOM   1185  C C     . PRO A 1 172 ? 18.936  -1.645  -38.370  1.00 18.71 ? 150  PRO A C     1 
ATOM   1186  O O     . PRO A 1 172 ? 19.635  -2.240  -39.199  1.00 16.59 ? 150  PRO A O     1 
ATOM   1187  C CB    . PRO A 1 172 ? 20.446  -0.133  -37.084  1.00 17.32 ? 150  PRO A CB    1 
ATOM   1188  C CG    . PRO A 1 172 ? 19.915  0.283   -35.794  1.00 17.51 ? 150  PRO A CG    1 
ATOM   1189  C CD    . PRO A 1 172 ? 18.680  1.070   -36.028  1.00 17.98 ? 150  PRO A CD    1 
ATOM   1190  N N     . GLU A 1 173 ? 17.933  -2.218  -37.706  1.00 20.92 ? 151  GLU A N     1 
ATOM   1191  C CA    . GLU A 1 173 ? 17.612  -3.639  -37.856  1.00 22.70 ? 151  GLU A CA    1 
ATOM   1192  C C     . GLU A 1 173 ? 16.286  -3.838  -38.553  1.00 22.80 ? 151  GLU A C     1 
ATOM   1193  O O     . GLU A 1 173 ? 15.877  -4.982  -38.772  1.00 22.56 ? 151  GLU A O     1 
ATOM   1194  C CB    . GLU A 1 173 ? 17.529  -4.334  -36.491  1.00 24.52 ? 151  GLU A CB    1 
ATOM   1195  C CG    . GLU A 1 173 ? 18.609  -3.936  -35.439  1.00 30.10 ? 151  GLU A CG    1 
ATOM   1196  C CD    . GLU A 1 173 ? 19.928  -4.669  -35.590  1.00 35.76 ? 151  GLU A CD    1 
ATOM   1197  O OE1   . GLU A 1 173 ? 19.957  -5.756  -36.217  1.00 41.30 ? 151  GLU A OE1   1 
ATOM   1198  O OE2   . GLU A 1 173 ? 20.937  -4.152  -35.059  1.00 41.61 ? 151  GLU A OE2   1 
ATOM   1199  N N     . HIS A 1 174 ? 15.599  -2.740  -38.869  1.00 22.05 ? 152  HIS A N     1 
ATOM   1200  C CA    . HIS A 1 174 ? 14.365  -2.808  -39.641  1.00 20.89 ? 152  HIS A CA    1 
ATOM   1201  C C     . HIS A 1 174 ? 14.687  -2.849  -41.142  1.00 20.12 ? 152  HIS A C     1 
ATOM   1202  O O     . HIS A 1 174 ? 15.680  -2.258  -41.617  1.00 19.07 ? 152  HIS A O     1 
ATOM   1203  C CB    . HIS A 1 174 ? 13.443  -1.625  -39.299  1.00 20.07 ? 152  HIS A CB    1 
ATOM   1204  C CG    . HIS A 1 174 ? 12.908  -1.685  -37.908  1.00 15.81 ? 152  HIS A CG    1 
ATOM   1205  N ND1   . HIS A 1 174 ? 13.703  -1.488  -36.798  1.00 15.02 ? 152  HIS A ND1   1 
ATOM   1206  C CD2   . HIS A 1 174 ? 11.668  -1.965  -37.442  1.00 11.80 ? 152  HIS A CD2   1 
ATOM   1207  C CE1   . HIS A 1 174 ? 12.971  -1.627  -35.708  1.00 15.12 ? 152  HIS A CE1   1 
ATOM   1208  N NE2   . HIS A 1 174 ? 11.736  -1.929  -36.071  1.00 17.38 ? 152  HIS A NE2   1 
ATOM   1209  N N     . THR A 1 175 ? 13.840  -3.572  -41.873  1.00 19.45 ? 153  THR A N     1 
ATOM   1210  C CA    . THR A 1 175 ? 13.940  -3.665  -43.329  1.00 17.00 ? 153  THR A CA    1 
ATOM   1211  C C     . THR A 1 175 ? 13.223  -2.484  -43.967  1.00 16.23 ? 153  THR A C     1 
ATOM   1212  O O     . THR A 1 175 ? 12.036  -2.237  -43.703  1.00 13.19 ? 153  THR A O     1 
ATOM   1213  C CB    . THR A 1 175 ? 13.344  -4.988  -43.820  1.00 15.06 ? 153  THR A CB    1 
ATOM   1214  O OG1   . THR A 1 175 ? 14.144  -6.078  -43.329  1.00 8.48  ? 153  THR A OG1   1 
ATOM   1215  C CG2   . THR A 1 175 ? 13.266  -5.027  -45.337  1.00 15.11 ? 153  THR A CG2   1 
ATOM   1216  N N     . ILE A 1 176 ? 13.931  -1.750  -44.819  1.00 17.74 ? 154  ILE A N     1 
ATOM   1217  C CA    . ILE A 1 176 ? 13.358  -0.526  -45.401  1.00 17.64 ? 154  ILE A CA    1 
ATOM   1218  C C     . ILE A 1 176 ? 12.991  -0.669  -46.884  1.00 17.60 ? 154  ILE A C     1 
ATOM   1219  O O     . ILE A 1 176 ? 13.831  -0.941  -47.740  1.00 13.59 ? 154  ILE A O     1 
ATOM   1220  C CB    . ILE A 1 176 ? 14.283  0.703   -45.164  1.00 18.50 ? 154  ILE A CB    1 
ATOM   1221  C CG1   . ILE A 1 176 ? 14.560  0.845   -43.658  1.00 18.00 ? 154  ILE A CG1   1 
ATOM   1222  C CG2   . ILE A 1 176 ? 13.658  2.017   -45.762  1.00 18.88 ? 154  ILE A CG2   1 
ATOM   1223  C CD1   . ILE A 1 176 ? 15.477  1.993   -43.277  1.00 17.80 ? 154  ILE A CD1   1 
ATOM   1224  N N     . MET A 1 177 ? 11.680  -0.520  -47.125  1.00 20.77 ? 155  MET A N     1 
ATOM   1225  C CA    . MET A 1 177 ? 11.074  -0.321  -48.438  1.00 22.00 ? 155  MET A CA    1 
ATOM   1226  C C     . MET A 1 177 ? 11.062  1.184   -48.703  1.00 22.20 ? 155  MET A C     1 
ATOM   1227  O O     . MET A 1 177 ? 10.617  1.936   -47.845  1.00 23.45 ? 155  MET A O     1 
ATOM   1228  C CB    . MET A 1 177 ? 9.607   -0.833  -48.443  1.00 22.29 ? 155  MET A CB    1 
ATOM   1229  C CG    . MET A 1 177 ? 9.463   -2.310  -48.676  1.00 19.99 ? 155  MET A CG    1 
ATOM   1230  S SD    . MET A 1 177 ? 8.075   -3.153  -47.831  1.00 30.34 ? 155  MET A SD    1 
ATOM   1231  C CE    . MET A 1 177 ? 6.624   -2.494  -48.612  1.00 27.81 ? 155  MET A CE    1 
ATOM   1232  N N     . ALA A 1 178 ? 11.541  1.604   -49.877  1.00 22.04 ? 156  ALA A N     1 
ATOM   1233  C CA    . ALA A 1 178 ? 11.582  3.002   -50.241  1.00 21.56 ? 156  ALA A CA    1 
ATOM   1234  C C     . ALA A 1 178 ? 11.252  3.185   -51.720  1.00 20.79 ? 156  ALA A C     1 
ATOM   1235  O O     . ALA A 1 178 ? 11.793  2.490   -52.568  1.00 19.71 ? 156  ALA A O     1 
ATOM   1236  C CB    . ALA A 1 178 ? 12.937  3.588   -49.947  1.00 20.91 ? 156  ALA A CB    1 
ATOM   1237  N N     . GLY A 1 179 ? 10.360  4.127   -52.025  1.00 20.47 ? 157  GLY A N     1 
ATOM   1238  C CA    . GLY A 1 179 ? 10.104  4.447   -53.417  1.00 19.02 ? 157  GLY A CA    1 
ATOM   1239  C C     . GLY A 1 179 ? 9.422   5.764   -53.644  1.00 16.71 ? 157  GLY A C     1 
ATOM   1240  O O     . GLY A 1 179 ? 9.243   6.498   -52.712  1.00 16.08 ? 157  GLY A O     1 
ATOM   1241  N N     . ASN A 1 180 ? 9.029   6.050   -54.881  1.00 18.24 ? 158  ASN A N     1 
ATOM   1242  C CA    . ASN A 1 180 ? 9.173   5.109   -56.001  1.00 18.81 ? 158  ASN A CA    1 
ATOM   1243  C C     . ASN A 1 180 ? 10.113  5.640   -57.032  1.00 18.20 ? 158  ASN A C     1 
ATOM   1244  O O     . ASN A 1 180 ? 10.175  6.844   -57.199  1.00 17.40 ? 158  ASN A O     1 
ATOM   1245  C CB    . ASN A 1 180 ? 7.827   4.808   -56.653  1.00 18.01 ? 158  ASN A CB    1 
ATOM   1246  C CG    . ASN A 1 180 ? 7.047   3.754   -55.898  1.00 15.54 ? 158  ASN A CG    1 
ATOM   1247  O OD1   . ASN A 1 180 ? 7.025   3.766   -54.668  1.00 16.66 ? 158  ASN A OD1   1 
ATOM   1248  N ND2   . ASN A 1 180 ? 6.407   2.841   -56.617  1.00 7.65  ? 158  ASN A ND2   1 
ATOM   1249  N N     . VAL A 1 181 ? 10.842  4.742   -57.705  1.00 18.57 ? 159  VAL A N     1 
ATOM   1250  C CA    . VAL A 1 181 ? 11.711  5.130   -58.816  1.00 18.66 ? 159  VAL A CA    1 
ATOM   1251  C C     . VAL A 1 181 ? 11.435  4.233   -60.029  1.00 18.84 ? 159  VAL A C     1 
ATOM   1252  O O     . VAL A 1 181 ? 10.563  3.342   -59.959  1.00 18.16 ? 159  VAL A O     1 
ATOM   1253  C CB    . VAL A 1 181 ? 13.194  5.147   -58.408  1.00 17.63 ? 159  VAL A CB    1 
ATOM   1254  C CG1   . VAL A 1 181 ? 13.388  6.101   -57.225  1.00 14.09 ? 159  VAL A CG1   1 
ATOM   1255  C CG2   . VAL A 1 181 ? 13.743  3.732   -58.120  1.00 19.43 ? 159  VAL A CG2   1 
ATOM   1256  N N     . VAL A 1 182 ? 12.124  4.516   -61.148  1.00 18.06 ? 160  VAL A N     1 
ATOM   1257  C CA    . VAL A 1 182 ? 11.999  3.710   -62.374  1.00 17.32 ? 160  VAL A CA    1 
ATOM   1258  C C     . VAL A 1 182 ? 13.315  3.452   -63.060  1.00 18.00 ? 160  VAL A C     1 
ATOM   1259  O O     . VAL A 1 182 ? 13.324  2.742   -64.074  1.00 16.04 ? 160  VAL A O     1 
ATOM   1260  C CB    . VAL A 1 182 ? 11.023  4.341   -63.395  1.00 16.48 ? 160  VAL A CB    1 
ATOM   1261  C CG1   . VAL A 1 182 ? 9.598   4.327   -62.840  1.00 21.81 ? 160  VAL A CG1   1 
ATOM   1262  C CG2   . VAL A 1 182 ? 11.419  5.762   -63.762  1.00 14.17 ? 160  VAL A CG2   1 
ATOM   1263  N N     . THR A 1 183 ? 14.406  3.972   -62.477  1.00 18.13 ? 161  THR A N     1 
ATOM   1264  C CA    . THR A 1 183 ? 15.723  3.955   -63.106  1.00 20.52 ? 161  THR A CA    1 
ATOM   1265  C C     . THR A 1 183 ? 16.826  3.490   -62.122  1.00 20.58 ? 161  THR A C     1 
ATOM   1266  O O     . THR A 1 183 ? 16.775  3.772   -60.919  1.00 21.60 ? 161  THR A O     1 
ATOM   1267  C CB    . THR A 1 183 ? 16.062  5.352   -63.713  1.00 23.02 ? 161  THR A CB    1 
ATOM   1268  O OG1   . THR A 1 183 ? 15.747  6.410   -62.779  1.00 17.33 ? 161  THR A OG1   1 
ATOM   1269  C CG2   . THR A 1 183 ? 15.304  5.583   -65.043  1.00 24.31 ? 161  THR A CG2   1 
ATOM   1270  N N     . GLY A 1 184 ? 17.799  2.758   -62.630  1.00 19.60 ? 162  GLY A N     1 
ATOM   1271  C CA    . GLY A 1 184 ? 18.725  2.066   -61.766  1.00 21.13 ? 162  GLY A CA    1 
ATOM   1272  C C     . GLY A 1 184 ? 19.741  2.912   -61.015  1.00 21.43 ? 162  GLY A C     1 
ATOM   1273  O O     . GLY A 1 184 ? 20.296  2.452   -60.011  1.00 22.40 ? 162  GLY A O     1 
ATOM   1274  N N     . GLU A 1 185 ? 20.023  4.121   -61.494  1.00 20.55 ? 163  GLU A N     1 
ATOM   1275  C CA    . GLU A 1 185 ? 20.960  4.996   -60.788  1.00 19.51 ? 163  GLU A CA    1 
ATOM   1276  C C     . GLU A 1 185 ? 20.321  5.428   -59.452  1.00 18.34 ? 163  GLU A C     1 
ATOM   1277  O O     . GLU A 1 185 ? 20.995  5.575   -58.447  1.00 18.86 ? 163  GLU A O     1 
ATOM   1278  C CB    . GLU A 1 185 ? 21.352  6.189   -61.658  1.00 20.69 ? 163  GLU A CB    1 
ATOM   1279  C CG    . GLU A 1 185 ? 20.411  7.403   -61.537  1.00 23.56 ? 163  GLU A CG    1 
ATOM   1280  C CD    . GLU A 1 185 ? 19.168  7.272   -62.345  1.00 24.05 ? 163  GLU A CD    1 
ATOM   1281  O OE1   . GLU A 1 185 ? 18.796  6.130   -62.698  1.00 29.79 ? 163  GLU A OE1   1 
ATOM   1282  O OE2   . GLU A 1 185 ? 18.564  8.327   -62.629  1.00 26.29 ? 163  GLU A OE2   1 
ATOM   1283  N N     . MET A 1 186 ? 19.011  5.594   -59.441  1.00 16.66 ? 164  MET A N     1 
ATOM   1284  C CA    . MET A 1 186 ? 18.304  5.932   -58.190  1.00 17.00 ? 164  MET A CA    1 
ATOM   1285  C C     . MET A 1 186 ? 18.108  4.718   -57.286  1.00 16.79 ? 164  MET A C     1 
ATOM   1286  O O     . MET A 1 186 ? 18.008  4.833   -56.065  1.00 17.29 ? 164  MET A O     1 
ATOM   1287  C CB    . MET A 1 186 ? 16.926  6.599   -58.437  1.00 15.79 ? 164  MET A CB    1 
ATOM   1288  C CG    . MET A 1 186 ? 16.529  7.498   -57.328  1.00 13.76 ? 164  MET A CG    1 
ATOM   1289  S SD    . MET A 1 186 ? 17.744  8.816   -57.016  1.00 18.25 ? 164  MET A SD    1 
ATOM   1290  C CE    . MET A 1 186 ? 17.539  9.010   -55.237  1.00 17.16 ? 164  MET A CE    1 
ATOM   1291  N N     . VAL A 1 187 ? 18.030  3.554   -57.897  1.00 16.21 ? 165  VAL A N     1 
ATOM   1292  C CA    . VAL A 1 187 ? 18.035  2.327   -57.155  1.00 15.78 ? 165  VAL A CA    1 
ATOM   1293  C C     . VAL A 1 187 ? 19.300  2.248   -56.349  1.00 15.69 ? 165  VAL A C     1 
ATOM   1294  O O     . VAL A 1 187 ? 19.247  2.133   -55.131  1.00 16.06 ? 165  VAL A O     1 
ATOM   1295  C CB    . VAL A 1 187 ? 17.923  1.113   -58.099  1.00 16.42 ? 165  VAL A CB    1 
ATOM   1296  C CG1   . VAL A 1 187 ? 18.249  -0.182  -57.389  1.00 16.40 ? 165  VAL A CG1   1 
ATOM   1297  C CG2   . VAL A 1 187 ? 16.527  1.050   -58.663  1.00 20.84 ? 165  VAL A CG2   1 
ATOM   1298  N N     . GLU A 1 188 ? 20.440  2.346   -57.037  1.00 16.77 ? 166  GLU A N     1 
ATOM   1299  C CA    . GLU A 1 188 ? 21.779  2.288   -56.399  1.00 17.84 ? 166  GLU A CA    1 
ATOM   1300  C C     . GLU A 1 188 ? 21.913  3.301   -55.279  1.00 18.85 ? 166  GLU A C     1 
ATOM   1301  O O     . GLU A 1 188 ? 22.486  2.991   -54.233  1.00 19.65 ? 166  GLU A O     1 
ATOM   1302  C CB    . GLU A 1 188 ? 22.917  2.609   -57.393  1.00 15.19 ? 166  GLU A CB    1 
ATOM   1303  C CG    . GLU A 1 188 ? 23.286  1.508   -58.355  1.00 24.77 ? 166  GLU A CG    1 
ATOM   1304  C CD    . GLU A 1 188 ? 24.781  1.574   -58.908  1.00 34.32 ? 166  GLU A CD    1 
ATOM   1305  O OE1   . GLU A 1 188 ? 25.752  1.900   -58.166  1.00 29.94 ? 166  GLU A OE1   1 
ATOM   1306  O OE2   . GLU A 1 188 ? 24.979  1.250   -60.110  1.00 32.48 ? 166  GLU A OE2   1 
ATOM   1307  N N     . GLU A 1 189 ? 21.439  4.527   -55.522  1.00 18.07 ? 167  GLU A N     1 
ATOM   1308  C CA    . GLU A 1 189 ? 21.632  5.589   -54.568  1.00 18.26 ? 167  GLU A CA    1 
ATOM   1309  C C     . GLU A 1 189 ? 20.866  5.306   -53.319  1.00 18.64 ? 167  GLU A C     1 
ATOM   1310  O O     . GLU A 1 189 ? 21.378  5.452   -52.214  1.00 18.33 ? 167  GLU A O     1 
ATOM   1311  C CB    . GLU A 1 189 ? 21.194  6.915   -55.142  1.00 16.98 ? 167  GLU A CB    1 
ATOM   1312  C CG    . GLU A 1 189 ? 21.424  8.081   -54.199  1.00 22.41 ? 167  GLU A CG    1 
ATOM   1313  C CD    . GLU A 1 189 ? 22.895  8.431   -53.934  1.00 35.02 ? 167  GLU A CD    1 
ATOM   1314  O OE1   . GLU A 1 189 ? 23.828  7.829   -54.563  1.00 34.90 ? 167  GLU A OE1   1 
ATOM   1315  O OE2   . GLU A 1 189 ? 23.115  9.347   -53.087  1.00 38.20 ? 167  GLU A OE2   1 
ATOM   1316  N N     . LEU A 1 190 ? 19.618  4.889   -53.505  1.00 19.97 ? 168  LEU A N     1 
ATOM   1317  C CA    . LEU A 1 190 ? 18.736  4.615   -52.394  1.00 20.26 ? 168  LEU A CA    1 
ATOM   1318  C C     . LEU A 1 190 ? 19.197  3.399   -51.609  1.00 20.04 ? 168  LEU A C     1 
ATOM   1319  O O     . LEU A 1 190 ? 19.083  3.370   -50.385  1.00 19.29 ? 168  LEU A O     1 
ATOM   1320  C CB    . LEU A 1 190 ? 17.321  4.428   -52.895  1.00 20.15 ? 168  LEU A CB    1 
ATOM   1321  C CG    . LEU A 1 190 ? 16.673  5.698   -53.422  1.00 21.21 ? 168  LEU A CG    1 
ATOM   1322  C CD1   . LEU A 1 190 ? 15.170  5.426   -53.595  1.00 25.61 ? 168  LEU A CD1   1 
ATOM   1323  C CD2   . LEU A 1 190 ? 16.920  6.871   -52.472  1.00 24.39 ? 168  LEU A CD2   1 
ATOM   1324  N N     . ILE A 1 191 ? 19.736  2.399   -52.290  1.00 19.48 ? 169  ILE A N     1 
ATOM   1325  C CA    . ILE A 1 191 ? 20.217  1.233   -51.558  1.00 20.13 ? 169  ILE A CA    1 
ATOM   1326  C C     . ILE A 1 191 ? 21.456  1.617   -50.774  1.00 20.93 ? 169  ILE A C     1 
ATOM   1327  O O     . ILE A 1 191 ? 21.550  1.293   -49.595  1.00 21.85 ? 169  ILE A O     1 
ATOM   1328  C CB    . ILE A 1 191 ? 20.458  -0.005  -52.463  1.00 20.00 ? 169  ILE A CB    1 
ATOM   1329  C CG1   . ILE A 1 191 ? 19.145  -0.462  -53.061  1.00 17.51 ? 169  ILE A CG1   1 
ATOM   1330  C CG2   . ILE A 1 191 ? 21.062  -1.200  -51.671  1.00 21.26 ? 169  ILE A CG2   1 
ATOM   1331  C CD1   . ILE A 1 191 ? 19.271  -1.538  -54.082  1.00 20.18 ? 169  ILE A CD1   1 
ATOM   1332  N N     . LEU A 1 192 ? 22.389  2.328   -51.417  1.00 22.14 ? 170  LEU A N     1 
ATOM   1333  C CA    . LEU A 1 192 ? 23.627  2.775   -50.759  1.00 21.61 ? 170  LEU A CA    1 
ATOM   1334  C C     . LEU A 1 192 ? 23.298  3.693   -49.601  1.00 21.25 ? 170  LEU A C     1 
ATOM   1335  O O     . LEU A 1 192 ? 24.046  3.742   -48.631  1.00 21.69 ? 170  LEU A O     1 
ATOM   1336  C CB    . LEU A 1 192 ? 24.550  3.496   -51.733  1.00 20.59 ? 170  LEU A CB    1 
ATOM   1337  C CG    . LEU A 1 192 ? 25.138  2.661   -52.878  1.00 24.63 ? 170  LEU A CG    1 
ATOM   1338  C CD1   . LEU A 1 192 ? 25.767  3.622   -53.878  1.00 22.96 ? 170  LEU A CD1   1 
ATOM   1339  C CD2   . LEU A 1 192 ? 26.154  1.611   -52.433  1.00 25.22 ? 170  LEU A CD2   1 
ATOM   1340  N N     . SER A 1 193 ? 22.171  4.404   -49.697  1.00 20.94 ? 171  SER A N     1 
ATOM   1341  C CA    . SER A 1 193 ? 21.755  5.297   -48.635  1.00 19.65 ? 171  SER A CA    1 
ATOM   1342  C C     . SER A 1 193 ? 21.041  4.614   -47.454  1.00 18.69 ? 171  SER A C     1 
ATOM   1343  O O     . SER A 1 193 ? 20.853  5.250   -46.421  1.00 19.40 ? 171  SER A O     1 
ATOM   1344  C CB    . SER A 1 193 ? 20.963  6.426   -49.253  1.00 20.37 ? 171  SER A CB    1 
ATOM   1345  O OG    . SER A 1 193 ? 21.876  7.234   -49.993  1.00 22.56 ? 171  SER A OG    1 
ATOM   1346  N N     . GLY A 1 194 ? 20.693  3.326   -47.597  1.00 17.48 ? 172  GLY A N     1 
ATOM   1347  C CA    . GLY A 1 194 ? 20.179  2.477   -46.503  1.00 17.00 ? 172  GLY A CA    1 
ATOM   1348  C C     . GLY A 1 194 ? 18.845  1.721   -46.750  1.00 18.37 ? 172  GLY A C     1 
ATOM   1349  O O     . GLY A 1 194 ? 18.384  0.954   -45.891  1.00 18.20 ? 172  GLY A O     1 
ATOM   1350  N N     . ALA A 1 195 ? 18.190  1.939   -47.895  1.00 17.59 ? 173  ALA A N     1 
ATOM   1351  C CA    . ALA A 1 195 ? 16.973  1.209   -48.211  1.00 17.31 ? 173  ALA A CA    1 
ATOM   1352  C C     . ALA A 1 195 ? 17.368  -0.208  -48.589  1.00 16.44 ? 173  ALA A C     1 
ATOM   1353  O O     . ALA A 1 195 ? 18.413  -0.431  -49.214  1.00 17.22 ? 173  ALA A O     1 
ATOM   1354  C CB    . ALA A 1 195 ? 16.199  1.899   -49.353  1.00 17.30 ? 173  ALA A CB    1 
ATOM   1355  N N     . ASP A 1 196 ? 16.557  -1.172  -48.182  1.00 16.69 ? 174  ASP A N     1 
ATOM   1356  C CA    . ASP A 1 196 ? 16.827  -2.584  -48.514  1.00 17.05 ? 174  ASP A CA    1 
ATOM   1357  C C     . ASP A 1 196 ? 16.129  -2.970  -49.828  1.00 17.81 ? 174  ASP A C     1 
ATOM   1358  O O     . ASP A 1 196 ? 16.692  -3.658  -50.676  1.00 16.89 ? 174  ASP A O     1 
ATOM   1359  C CB    . ASP A 1 196 ? 16.345  -3.522  -47.405  1.00 15.10 ? 174  ASP A CB    1 
ATOM   1360  C CG    . ASP A 1 196 ? 16.949  -3.213  -46.063  1.00 16.72 ? 174  ASP A CG    1 
ATOM   1361  O OD1   . ASP A 1 196 ? 18.178  -3.425  -45.883  1.00 11.37 ? 174  ASP A OD1   1 
ATOM   1362  O OD2   . ASP A 1 196 ? 16.162  -2.776  -45.178  1.00 18.80 ? 174  ASP A OD2   1 
ATOM   1363  N N     . ILE A 1 197 ? 14.905  -2.479  -49.970  1.00 18.43 ? 175  ILE A N     1 
ATOM   1364  C CA    . ILE A 1 197 ? 14.059  -2.808  -51.073  1.00 19.21 ? 175  ILE A CA    1 
ATOM   1365  C C     . ILE A 1 197 ? 13.511  -1.519  -51.668  1.00 19.90 ? 175  ILE A C     1 
ATOM   1366  O O     . ILE A 1 197 ? 12.978  -0.672  -50.966  1.00 19.28 ? 175  ILE A O     1 
ATOM   1367  C CB    . ILE A 1 197 ? 12.858  -3.685  -50.643  1.00 18.77 ? 175  ILE A CB    1 
ATOM   1368  C CG1   . ILE A 1 197 ? 13.300  -4.828  -49.738  1.00 17.21 ? 175  ILE A CG1   1 
ATOM   1369  C CG2   . ILE A 1 197 ? 12.152  -4.238  -51.867  1.00 19.99 ? 175  ILE A CG2   1 
ATOM   1370  C CD1   . ILE A 1 197 ? 12.104  -5.387  -48.945  1.00 22.85 ? 175  ILE A CD1   1 
ATOM   1371  N N     . ILE A 1 198 ? 13.641  -1.417  -52.982  1.00 20.27 ? 176  ILE A N     1 
ATOM   1372  C CA    . ILE A 1 198 ? 13.294  -0.233  -53.713  1.00 19.19 ? 176  ILE A CA    1 
ATOM   1373  C C     . ILE A 1 198 ? 12.011  -0.484  -54.453  1.00 16.83 ? 176  ILE A C     1 
ATOM   1374  O O     . ILE A 1 198 ? 11.904  -1.447  -55.197  1.00 16.59 ? 176  ILE A O     1 
ATOM   1375  C CB    . ILE A 1 198 ? 14.422  0.144   -54.716  1.00 17.58 ? 176  ILE A CB    1 
ATOM   1376  C CG1   . ILE A 1 198 ? 15.742  0.377   -53.984  1.00 17.92 ? 176  ILE A CG1   1 
ATOM   1377  C CG2   . ILE A 1 198 ? 14.057  1.391   -55.502  1.00 25.10 ? 176  ILE A CG2   1 
ATOM   1378  C CD1   . ILE A 1 198 ? 15.646  1.301   -52.772  1.00 18.89 ? 176  ILE A CD1   1 
ATOM   1379  N N     . LYS A 1 199 ? 11.035  0.385   -54.252  1.00 15.37 ? 177  LYS A N     1 
ATOM   1380  C CA    . LYS A 1 199 ? 9.760   0.239   -54.927  1.00 15.56 ? 177  LYS A CA    1 
ATOM   1381  C C     . LYS A 1 199 ? 9.846   0.886   -56.309  1.00 15.20 ? 177  LYS A C     1 
ATOM   1382  O O     . LYS A 1 199 ? 10.079  2.083   -56.453  1.00 14.69 ? 177  LYS A O     1 
ATOM   1383  C CB    . LYS A 1 199 ? 8.597   0.834   -54.101  1.00 12.87 ? 177  LYS A CB    1 
ATOM   1384  C CG    . LYS A 1 199 ? 8.489   0.237   -52.749  1.00 13.37 ? 177  LYS A CG    1 
ATOM   1385  C CD    . LYS A 1 199 ? 7.524   0.998   -51.814  1.00 22.49 ? 177  LYS A CD    1 
ATOM   1386  C CE    . LYS A 1 199 ? 6.047   1.017   -52.308  1.00 16.79 ? 177  LYS A CE    1 
ATOM   1387  N NZ    . LYS A 1 199 ? 5.637   2.383   -52.712  1.00 16.10 ? 177  LYS A NZ    1 
ATOM   1388  N N     . VAL A 1 200 ? 9.603   0.074   -57.324  1.00 15.37 ? 178  VAL A N     1 
ATOM   1389  C CA    . VAL A 1 200 ? 9.782   0.489   -58.698  1.00 16.49 ? 178  VAL A CA    1 
ATOM   1390  C C     . VAL A 1 200 ? 8.434   0.590   -59.386  1.00 16.52 ? 178  VAL A C     1 
ATOM   1391  O O     . VAL A 1 200 ? 7.636   -0.369  -59.418  1.00 14.06 ? 178  VAL A O     1 
ATOM   1392  C CB    . VAL A 1 200 ? 10.699  -0.492  -59.469  1.00 16.17 ? 178  VAL A CB    1 
ATOM   1393  C CG1   . VAL A 1 200 ? 10.715  -0.175  -60.959  1.00 13.33 ? 178  VAL A CG1   1 
ATOM   1394  C CG2   . VAL A 1 200 ? 12.086  -0.502  -58.854  1.00 14.40 ? 178  VAL A CG2   1 
ATOM   1395  N N     . GLY A 1 201 ? 8.188   1.774   -59.931  1.00 18.05 ? 179  GLY A N     1 
ATOM   1396  C CA    . GLY A 1 201 ? 7.032   2.025   -60.797  1.00 19.82 ? 179  GLY A CA    1 
ATOM   1397  C C     . GLY A 1 201 ? 6.581   3.441   -60.636  1.00 20.54 ? 179  GLY A C     1 
ATOM   1398  O O     . GLY A 1 201 ? 6.334   3.861   -59.510  1.00 23.47 ? 179  GLY A O     1 
ATOM   1399  N N     . VAL A 1 202 ? 6.513   4.172   -61.753  1.00 20.64 ? 180  VAL A N     1 
ATOM   1400  C CA    . VAL A 1 202 ? 5.970   5.552   -61.812  1.00 19.99 ? 180  VAL A CA    1 
ATOM   1401  C C     . VAL A 1 202 ? 5.172   5.683   -63.117  1.00 20.35 ? 180  VAL A C     1 
ATOM   1402  O O     . VAL A 1 202 ? 5.755   5.652   -64.190  1.00 21.01 ? 180  VAL A O     1 
ATOM   1403  C CB    . VAL A 1 202 ? 7.113   6.614   -61.743  1.00 18.52 ? 180  VAL A CB    1 
ATOM   1404  C CG1   . VAL A 1 202 ? 6.594   8.039   -61.964  1.00 18.34 ? 180  VAL A CG1   1 
ATOM   1405  C CG2   . VAL A 1 202 ? 7.797   6.532   -60.423  1.00 16.02 ? 180  VAL A CG2   1 
ATOM   1406  N N     . GLY A 1 203 ? 3.843   5.775   -63.014  1.00 20.66 ? 181  GLY A N     1 
ATOM   1407  C CA    . GLY A 1 203 ? 2.975   5.826   -64.188  1.00 20.04 ? 181  GLY A CA    1 
ATOM   1408  C C     . GLY A 1 203 ? 1.934   4.711   -64.310  1.00 20.02 ? 181  GLY A C     1 
ATOM   1409  O O     . GLY A 1 203 ? 0.716   5.002   -64.326  1.00 19.78 ? 181  GLY A O     1 
ATOM   1410  N N     . PRO A 1 204 ? 2.382   3.434   -64.443  1.00 19.45 ? 182  PRO A N     1 
ATOM   1411  C CA    . PRO A 1 204 ? 1.498   2.256   -64.645  1.00 18.75 ? 182  PRO A CA    1 
ATOM   1412  C C     . PRO A 1 204 ? 0.399   1.981   -63.601  1.00 18.54 ? 182  PRO A C     1 
ATOM   1413  O O     . PRO A 1 204 ? -0.589  1.301   -63.939  1.00 19.95 ? 182  PRO A O     1 
ATOM   1414  C CB    . PRO A 1 204 ? 2.470   1.078   -64.714  1.00 18.62 ? 182  PRO A CB    1 
ATOM   1415  C CG    . PRO A 1 204 ? 3.783   1.679   -65.122  1.00 22.22 ? 182  PRO A CG    1 
ATOM   1416  C CD    . PRO A 1 204 ? 3.807   3.056   -64.526  1.00 20.84 ? 182  PRO A CD    1 
ATOM   1417  N N     . GLY A 1 205 ? 0.524   2.486   -62.370  1.00 16.51 ? 183  GLY A N     1 
ATOM   1418  C CA    . GLY A 1 205 ? -0.488  2.190   -61.330  1.00 16.09 ? 183  GLY A CA    1 
ATOM   1419  C C     . GLY A 1 205 ? -1.939  2.424   -61.737  1.00 13.75 ? 183  GLY A C     1 
ATOM   1420  O O     . GLY A 1 205 ? -2.237  3.394   -62.357  1.00 11.93 ? 183  GLY A O     1 
ATOM   1421  N N     . SER A 1 206 ? -2.855  1.539   -61.381  1.00 14.82 ? 184  SER A N     1 
ATOM   1422  C CA    . SER A 1 206 ? -4.247  1.658   -61.844  1.00 14.45 ? 184  SER A CA    1 
ATOM   1423  C C     . SER A 1 206 ? -4.851  3.054   -61.645  1.00 13.68 ? 184  SER A C     1 
ATOM   1424  O O     . SER A 1 206 ? -5.460  3.597   -62.558  1.00 12.66 ? 184  SER A O     1 
ATOM   1425  C CB    . SER A 1 206 ? -5.149  0.585   -61.222  1.00 14.57 ? 184  SER A CB    1 
ATOM   1426  O OG    . SER A 1 206 ? -4.966  0.479   -59.828  1.00 19.21 ? 184  SER A OG    1 
ATOM   1427  N N     . VAL A 1 207 ? -4.641  3.647   -60.473  1.00 14.69 ? 185  VAL A N     1 
ATOM   1428  C CA    . VAL A 1 207 ? -5.146  5.007   -60.183  1.00 14.31 ? 185  VAL A CA    1 
ATOM   1429  C C     . VAL A 1 207 ? -4.057  6.098   -60.139  1.00 13.65 ? 185  VAL A C     1 
ATOM   1430  O O     . VAL A 1 207 ? -4.329  7.252   -59.845  1.00 14.72 ? 185  VAL A O     1 
ATOM   1431  C CB    . VAL A 1 207 ? -6.033  5.059   -58.908  1.00 13.77 ? 185  VAL A CB    1 
ATOM   1432  C CG1   . VAL A 1 207 ? -7.288  4.290   -59.126  1.00 12.59 ? 185  VAL A CG1   1 
ATOM   1433  C CG2   . VAL A 1 207 ? -5.314  4.507   -57.702  1.00 16.27 ? 185  VAL A CG2   1 
ATOM   1434  N N     . CYS A 1 208 ? -2.835  5.745   -60.482  1.00 13.36 ? 186  CYS A N     1 
ATOM   1435  C CA    . CYS A 1 208 ? -1.798  6.728   -60.743  1.00 12.88 ? 186  CYS A CA    1 
ATOM   1436  C C     . CYS A 1 208 ? -2.181  7.578   -61.971  1.00 14.22 ? 186  CYS A C     1 
ATOM   1437  O O     . CYS A 1 208 ? -2.837  7.072   -62.899  1.00 16.90 ? 186  CYS A O     1 
ATOM   1438  C CB    . CYS A 1 208 ? -0.447  6.001   -60.908  1.00 12.29 ? 186  CYS A CB    1 
ATOM   1439  S SG    . CYS A 1 208 ? 0.906   7.021   -61.462  1.00 15.32 ? 186  CYS A SG    1 
ATOM   1440  N N     . THR A 1 209 ? -1.823  8.865   -61.955  1.00 13.34 ? 187  THR A N     1 
ATOM   1441  C CA    . THR A 1 209 ? -2.106  9.769   -63.064  1.00 11.87 ? 187  THR A CA    1 
ATOM   1442  C C     . THR A 1 209 ? -0.906  10.640  -63.444  1.00 11.66 ? 187  THR A C     1 
ATOM   1443  O O     . THR A 1 209 ? -1.091  11.752  -63.971  1.00 11.67 ? 187  THR A O     1 
ATOM   1444  C CB    . THR A 1 209 ? -3.252  10.764  -62.749  1.00 9.03  ? 187  THR A CB    1 
ATOM   1445  O OG1   . THR A 1 209 ? -2.861  11.612  -61.668  1.00 16.77 ? 187  THR A OG1   1 
ATOM   1446  C CG2   . THR A 1 209 ? -4.575  10.051  -62.403  1.00 17.10 ? 187  THR A CG2   1 
ATOM   1447  N N     . THR A 1 210 ? 0.305   10.172  -63.193  1.00 12.44 ? 188  THR A N     1 
ATOM   1448  C CA    . THR A 1 210 ? 1.488   10.968  -63.490  1.00 14.14 ? 188  THR A CA    1 
ATOM   1449  C C     . THR A 1 210 ? 1.559   11.302  -64.966  1.00 14.64 ? 188  THR A C     1 
ATOM   1450  O O     . THR A 1 210 ? 1.891   12.406  -65.326  1.00 16.20 ? 188  THR A O     1 
ATOM   1451  C CB    . THR A 1 210 ? 2.776   10.201  -63.156  1.00 14.39 ? 188  THR A CB    1 
ATOM   1452  O OG1   . THR A 1 210 ? 2.803   9.011   -63.936  1.00 17.85 ? 188  THR A OG1   1 
ATOM   1453  C CG2   . THR A 1 210 ? 2.854   9.819   -61.669  1.00 13.60 ? 188  THR A CG2   1 
ATOM   1454  N N     . ARG A 1 211 ? 1.238   10.341  -65.814  1.00 16.47 ? 189  ARG A N     1 
ATOM   1455  C CA    . ARG A 1 211 ? 1.455   10.472  -67.275  1.00 17.86 ? 189  ARG A CA    1 
ATOM   1456  C C     . ARG A 1 211 ? 0.573   11.584  -67.821  1.00 17.05 ? 189  ARG A C     1 
ATOM   1457  O O     . ARG A 1 211 ? 0.997   12.453  -68.565  1.00 17.61 ? 189  ARG A O     1 
ATOM   1458  C CB    . ARG A 1 211 ? 1.204   9.105   -67.984  1.00 18.61 ? 189  ARG A CB    1 
ATOM   1459  C CG    . ARG A 1 211 ? 2.094   7.929   -67.424  1.00 19.03 ? 189  ARG A CG    1 
ATOM   1460  C CD    . ARG A 1 211 ? 1.875   6.531   -68.057  1.00 20.34 ? 189  ARG A CD    1 
ATOM   1461  N NE    . ARG A 1 211 ? 0.481   6.061   -67.934  1.00 30.15 ? 189  ARG A NE    1 
ATOM   1462  C CZ    . ARG A 1 211 ? 0.063   4.779   -67.881  1.00 30.00 ? 189  ARG A CZ    1 
ATOM   1463  N NH1   . ARG A 1 211 ? 0.904   3.731   -67.920  1.00 28.55 ? 189  ARG A NH1   1 
ATOM   1464  N NH2   . ARG A 1 211 ? -1.243  4.547   -67.759  1.00 26.37 ? 189  ARG A NH2   1 
ATOM   1465  N N     . THR A 1 212 ? -0.656  11.571  -67.351  1.00 17.90 ? 190  THR A N     1 
ATOM   1466  C CA    . THR A 1 212 ? -1.683  12.497  -67.719  1.00 16.70 ? 190  THR A CA    1 
ATOM   1467  C C     . THR A 1 212 ? -1.487  13.896  -67.094  1.00 17.69 ? 190  THR A C     1 
ATOM   1468  O O     . THR A 1 212 ? -1.816  14.923  -67.709  1.00 16.49 ? 190  THR A O     1 
ATOM   1469  C CB    . THR A 1 212 ? -3.023  11.836  -67.307  1.00 17.63 ? 190  THR A CB    1 
ATOM   1470  O OG1   . THR A 1 212 ? -3.637  11.294  -68.487  1.00 23.49 ? 190  THR A OG1   1 
ATOM   1471  C CG2   . THR A 1 212 ? -3.995  12.799  -66.605  1.00 22.99 ? 190  THR A CG2   1 
ATOM   1472  N N     . LYS A 1 213 ? -0.963  13.934  -65.868  1.00 17.72 ? 191  LYS A N     1 
ATOM   1473  C CA    . LYS A 1 213 ? -0.834  15.187  -65.131  1.00 17.69 ? 191  LYS A CA    1 
ATOM   1474  C C     . LYS A 1 213 ? 0.541   15.824  -65.268  1.00 16.61 ? 191  LYS A C     1 
ATOM   1475  O O     . LYS A 1 213 ? 0.648   17.044  -65.195  1.00 16.87 ? 191  LYS A O     1 
ATOM   1476  C CB    . LYS A 1 213 ? -1.200  14.983  -63.648  1.00 17.32 ? 191  LYS A CB    1 
ATOM   1477  C CG    . LYS A 1 213 ? -2.670  14.618  -63.479  1.00 21.80 ? 191  LYS A CG    1 
ATOM   1478  C CD    . LYS A 1 213 ? -3.259  14.755  -62.060  1.00 27.30 ? 191  LYS A CD    1 
ATOM   1479  C CE    . LYS A 1 213 ? -4.774  14.366  -62.085  1.00 27.75 ? 191  LYS A CE    1 
ATOM   1480  N NZ    . LYS A 1 213 ? -5.523  14.474  -60.773  1.00 31.19 ? 191  LYS A NZ    1 
ATOM   1481  N N     . THR A 1 214 ? 1.570   15.005  -65.496  1.00 16.00 ? 192  THR A N     1 
ATOM   1482  C CA    . THR A 1 214 ? 2.956   15.443  -65.522  1.00 15.84 ? 192  THR A CA    1 
ATOM   1483  C C     . THR A 1 214 ? 3.738   15.006  -66.750  1.00 16.55 ? 192  THR A C     1 
ATOM   1484  O O     . THR A 1 214 ? 4.790   15.586  -67.033  1.00 17.79 ? 192  THR A O     1 
ATOM   1485  C CB    . THR A 1 214 ? 3.720   14.884  -64.275  1.00 18.40 ? 192  THR A CB    1 
ATOM   1486  O OG1   . THR A 1 214 ? 4.210   13.544  -64.532  1.00 17.46 ? 192  THR A OG1   1 
ATOM   1487  C CG2   . THR A 1 214 ? 2.841   14.920  -62.994  1.00 11.01 ? 192  THR A CG2   1 
ATOM   1488  N N     . GLY A 1 215 ? 3.258   13.979  -67.460  1.00 16.45 ? 193  GLY A N     1 
ATOM   1489  C CA    . GLY A 1 215 ? 3.953   13.440  -68.631  1.00 16.25 ? 193  GLY A CA    1 
ATOM   1490  C C     . GLY A 1 215 ? 5.208   12.666  -68.255  1.00 16.00 ? 193  GLY A C     1 
ATOM   1491  O O     . GLY A 1 215 ? 5.989   12.276  -69.120  1.00 14.05 ? 193  GLY A O     1 
ATOM   1492  N N     . VAL A 1 216 ? 5.399   12.450  -66.956  1.00 17.88 ? 194  VAL A N     1 
ATOM   1493  C CA    . VAL A 1 216 ? 6.569   11.730  -66.449  1.00 18.30 ? 194  VAL A CA    1 
ATOM   1494  C C     . VAL A 1 216 ? 6.075   10.331  -66.125  1.00 18.88 ? 194  VAL A C     1 
ATOM   1495  O O     . VAL A 1 216 ? 4.907   10.132  -65.719  1.00 20.62 ? 194  VAL A O     1 
ATOM   1496  C CB    . VAL A 1 216 ? 7.179   12.410  -65.206  1.00 19.03 ? 194  VAL A CB    1 
ATOM   1497  C CG1   . VAL A 1 216 ? 8.425   11.662  -64.710  1.00 19.04 ? 194  VAL A CG1   1 
ATOM   1498  C CG2   . VAL A 1 216 ? 7.500   13.904  -65.501  1.00 15.45 ? 194  VAL A CG2   1 
ATOM   1499  N N     . GLY A 1 217 ? 6.934   9.364   -66.363  1.00 17.79 ? 195  GLY A N     1 
ATOM   1500  C CA    . GLY A 1 217 ? 6.581   7.977   -66.129  1.00 18.69 ? 195  GLY A CA    1 
ATOM   1501  C C     . GLY A 1 217 ? 7.552   7.034   -66.805  1.00 18.18 ? 195  GLY A C     1 
ATOM   1502  O O     . GLY A 1 217 ? 8.557   7.469   -67.384  1.00 18.98 ? 195  GLY A O     1 
ATOM   1503  N N     . TYR A 1 218 ? 7.263   5.738   -66.713  1.00 17.73 ? 196  TYR A N     1 
ATOM   1504  C CA    . TYR A 1 218 ? 8.100   4.721   -67.353  1.00 17.41 ? 196  TYR A CA    1 
ATOM   1505  C C     . TYR A 1 218 ? 7.305   3.445   -67.460  1.00 17.49 ? 196  TYR A C     1 
ATOM   1506  O O     . TYR A 1 218 ? 6.596   3.112   -66.534  1.00 18.95 ? 196  TYR A O     1 
ATOM   1507  C CB    . TYR A 1 218 ? 9.317   4.448   -66.514  1.00 16.97 ? 196  TYR A CB    1 
ATOM   1508  C CG    . TYR A 1 218 ? 10.592  4.177   -67.253  1.00 14.27 ? 196  TYR A CG    1 
ATOM   1509  C CD1   . TYR A 1 218 ? 11.494  5.197   -67.479  1.00 14.81 ? 196  TYR A CD1   1 
ATOM   1510  C CD2   . TYR A 1 218 ? 10.947  2.901   -67.628  1.00 11.54 ? 196  TYR A CD2   1 
ATOM   1511  C CE1   . TYR A 1 218 ? 12.688  4.957   -68.084  1.00 17.97 ? 196  TYR A CE1   1 
ATOM   1512  C CE2   . TYR A 1 218 ? 12.134  2.653   -68.255  1.00 16.31 ? 196  TYR A CE2   1 
ATOM   1513  C CZ    . TYR A 1 218 ? 13.016  3.692   -68.475  1.00 18.60 ? 196  TYR A CZ    1 
ATOM   1514  O OH    . TYR A 1 218 ? 14.243  3.495   -69.108  1.00 22.45 ? 196  TYR A OH    1 
ATOM   1515  N N     . PRO A 1 219 ? 7.399   2.746   -68.608  1.00 18.22 ? 197  PRO A N     1 
ATOM   1516  C CA    . PRO A 1 219 ? 6.819   1.418   -68.733  1.00 17.96 ? 197  PRO A CA    1 
ATOM   1517  C C     . PRO A 1 219 ? 7.256   0.455   -67.630  1.00 17.72 ? 197  PRO A C     1 
ATOM   1518  O O     . PRO A 1 219 ? 8.424   0.434   -67.275  1.00 20.14 ? 197  PRO A O     1 
ATOM   1519  C CB    . PRO A 1 219 ? 7.325   0.964   -70.116  1.00 17.69 ? 197  PRO A CB    1 
ATOM   1520  C CG    . PRO A 1 219 ? 7.401   2.217   -70.892  1.00 15.28 ? 197  PRO A CG    1 
ATOM   1521  C CD    . PRO A 1 219 ? 7.973   3.197   -69.900  1.00 16.88 ? 197  PRO A CD    1 
ATOM   1522  N N     . GLN A 1 220 ? 6.326   -0.324  -67.093  1.00 16.30 ? 198  GLN A N     1 
ATOM   1523  C CA    . GLN A 1 220 ? 6.620   -1.115  -65.892  1.00 17.45 ? 198  GLN A CA    1 
ATOM   1524  C C     . GLN A 1 220 ? 7.550   -2.275  -66.120  1.00 16.54 ? 198  GLN A C     1 
ATOM   1525  O O     . GLN A 1 220 ? 8.339   -2.566  -65.241  1.00 17.44 ? 198  GLN A O     1 
ATOM   1526  C CB    . GLN A 1 220 ? 5.360   -1.648  -65.213  1.00 17.76 ? 198  GLN A CB    1 
ATOM   1527  C CG    . GLN A 1 220 ? 5.602   -2.198  -63.800  1.00 21.73 ? 198  GLN A CG    1 
ATOM   1528  C CD    . GLN A 1 220 ? 6.145   -1.166  -62.821  1.00 19.02 ? 198  GLN A CD    1 
ATOM   1529  O OE1   . GLN A 1 220 ? 5.851   0.035   -62.933  1.00 17.27 ? 198  GLN A OE1   1 
ATOM   1530  N NE2   . GLN A 1 220 ? 6.938   -1.632  -61.850  1.00 16.04 ? 198  GLN A NE2   1 
ATOM   1531  N N     . LEU A 1 221 ? 7.438   -2.954  -67.256  1.00 16.52 ? 199  LEU A N     1 
ATOM   1532  C CA    . LEU A 1 221 ? 8.374   -4.046  -67.547  1.00 18.85 ? 199  LEU A CA    1 
ATOM   1533  C C     . LEU A 1 221 ? 9.821   -3.532  -67.671  1.00 18.13 ? 199  LEU A C     1 
ATOM   1534  O O     . LEU A 1 221 ? 10.733  -4.054  -67.007  1.00 18.20 ? 199  LEU A O     1 
ATOM   1535  C CB    . LEU A 1 221 ? 7.960   -4.847  -68.800  1.00 18.57 ? 199  LEU A CB    1 
ATOM   1536  C CG    . LEU A 1 221 ? 8.826   -6.074  -69.102  1.00 20.83 ? 199  LEU A CG    1 
ATOM   1537  C CD1   . LEU A 1 221 ? 8.273   -7.313  -68.447  1.00 23.56 ? 199  LEU A CD1   1 
ATOM   1538  C CD2   . LEU A 1 221 ? 8.962   -6.297  -70.593  1.00 23.67 ? 199  LEU A CD2   1 
ATOM   1539  N N     . SER A 1 222 ? 10.015  -2.495  -68.476  1.00 18.24 ? 200  SER A N     1 
ATOM   1540  C CA    . SER A 1 222 ? 11.354  -1.947  -68.687  1.00 19.62 ? 200  SER A CA    1 
ATOM   1541  C C     . SER A 1 222 ? 11.914  -1.362  -67.397  1.00 20.07 ? 200  SER A C     1 
ATOM   1542  O O     . SER A 1 222 ? 13.146  -1.388  -67.177  1.00 20.99 ? 200  SER A O     1 
ATOM   1543  C CB    . SER A 1 222 ? 11.344  -0.912  -69.827  1.00 19.67 ? 200  SER A CB    1 
ATOM   1544  O OG    . SER A 1 222 ? 10.961  -1.523  -71.064  1.00 17.89 ? 200  SER A OG    1 
ATOM   1545  N N     . ALA A 1 223 ? 11.020  -0.857  -66.557  1.00 18.58 ? 201  ALA A N     1 
ATOM   1546  C CA    . ALA A 1 223 ? 11.394  -0.357  -65.251  1.00 18.98 ? 201  ALA A CA    1 
ATOM   1547  C C     . ALA A 1 223 ? 12.016  -1.469  -64.430  1.00 18.91 ? 201  ALA A C     1 
ATOM   1548  O O     . ALA A 1 223 ? 13.126  -1.386  -63.951  1.00 17.04 ? 201  ALA A O     1 
ATOM   1549  C CB    . ALA A 1 223 ? 10.138  0.186   -64.533  1.00 18.88 ? 201  ALA A CB    1 
ATOM   1550  N N     . VAL A 1 224 ? 11.256  -2.523  -64.261  1.00 20.67 ? 202  VAL A N     1 
ATOM   1551  C CA    . VAL A 1 224 ? 11.661  -3.670  -63.475  1.00 19.75 ? 202  VAL A CA    1 
ATOM   1552  C C     . VAL A 1 224 ? 12.955  -4.288  -64.017  1.00 20.82 ? 202  VAL A C     1 
ATOM   1553  O O     . VAL A 1 224 ? 13.847  -4.598  -63.245  1.00 22.11 ? 202  VAL A O     1 
ATOM   1554  C CB    . VAL A 1 224 ? 10.515  -4.704  -63.446  1.00 18.64 ? 202  VAL A CB    1 
ATOM   1555  C CG1   . VAL A 1 224 ? 10.980  -5.985  -62.877  1.00 21.93 ? 202  VAL A CG1   1 
ATOM   1556  C CG2   . VAL A 1 224 ? 9.267   -4.174  -62.624  1.00 18.64 ? 202  VAL A CG2   1 
ATOM   1557  N N     . ILE A 1 225 ? 13.064  -4.435  -65.333  1.00 22.51 ? 203  ILE A N     1 
ATOM   1558  C CA    . ILE A 1 225 ? 14.249  -5.037  -65.947  1.00 25.51 ? 203  ILE A CA    1 
ATOM   1559  C C     . ILE A 1 225 ? 15.524  -4.298  -65.572  1.00 25.77 ? 203  ILE A C     1 
ATOM   1560  O O     . ILE A 1 225 ? 16.523  -4.908  -65.156  1.00 23.80 ? 203  ILE A O     1 
ATOM   1561  C CB    . ILE A 1 225 ? 14.111  -5.160  -67.488  1.00 26.47 ? 203  ILE A CB    1 
ATOM   1562  C CG1   . ILE A 1 225 ? 13.048  -6.231  -67.796  1.00 30.52 ? 203  ILE A CG1   1 
ATOM   1563  C CG2   . ILE A 1 225 ? 15.483  -5.525  -68.123  1.00 28.45 ? 203  ILE A CG2   1 
ATOM   1564  C CD1   . ILE A 1 225 ? 12.972  -6.690  -69.222  1.00 32.57 ? 203  ILE A CD1   1 
ATOM   1565  N N     . GLU A 1 226 ? 15.461  -2.983  -65.705  1.00 27.64 ? 204  GLU A N     1 
ATOM   1566  C CA    . GLU A 1 226 ? 16.612  -2.113  -65.506  1.00 28.77 ? 204  GLU A CA    1 
ATOM   1567  C C     . GLU A 1 226 ? 16.981  -1.994  -64.048  1.00 26.74 ? 204  GLU A C     1 
ATOM   1568  O O     . GLU A 1 226 ? 18.164  -2.119  -63.669  1.00 27.54 ? 204  GLU A O     1 
ATOM   1569  C CB    . GLU A 1 226 ? 16.254  -0.735  -66.077  1.00 30.83 ? 204  GLU A CB    1 
ATOM   1570  C CG    . GLU A 1 226 ? 16.080  -0.768  -67.627  1.00 37.38 ? 204  GLU A CG    1 
ATOM   1571  C CD    . GLU A 1 226 ? 15.457  0.499   -68.201  1.00 41.16 ? 204  GLU A CD    1 
ATOM   1572  O OE1   . GLU A 1 226 ? 15.601  1.577   -67.563  1.00 41.61 ? 204  GLU A OE1   1 
ATOM   1573  O OE2   . GLU A 1 226 ? 14.842  0.400   -69.293  1.00 34.69 ? 204  GLU A OE2   1 
ATOM   1574  N N     . CYS A 1 227 ? 15.948  -1.762  -63.250  1.00 25.22 ? 205  CYS A N     1 
ATOM   1575  C CA    . CYS A 1 227 ? 16.070  -1.533  -61.813  1.00 24.34 ? 205  CYS A CA    1 
ATOM   1576  C C     . CYS A 1 227 ? 16.370  -2.777  -61.019  1.00 23.82 ? 205  CYS A C     1 
ATOM   1577  O O     . CYS A 1 227 ? 17.022  -2.694  -59.988  1.00 24.02 ? 205  CYS A O     1 
ATOM   1578  C CB    . CYS A 1 227 ? 14.787  -0.915  -61.251  1.00 25.25 ? 205  CYS A CB    1 
ATOM   1579  S SG    . CYS A 1 227 ? 14.425  0.749   -61.831  1.00 20.93 ? 205  CYS A SG    1 
ATOM   1580  N N     . ALA A 1 228 ? 15.886  -3.933  -61.475  1.00 24.01 ? 206  ALA A N     1 
ATOM   1581  C CA    . ALA A 1 228 ? 16.247  -5.197  -60.840  1.00 22.64 ? 206  ALA A CA    1 
ATOM   1582  C C     . ALA A 1 228 ? 17.761  -5.499  -60.993  1.00 22.73 ? 206  ALA A C     1 
ATOM   1583  O O     . ALA A 1 228 ? 18.436  -5.811  -60.018  1.00 22.07 ? 206  ALA A O     1 
ATOM   1584  C CB    . ALA A 1 228 ? 15.380  -6.307  -61.371  1.00 22.80 ? 206  ALA A CB    1 
ATOM   1585  N N     . ASP A 1 229 ? 18.293  -5.361  -62.201  1.00 24.66 ? 207  ASP A N     1 
ATOM   1586  C CA    . ASP A 1 229 ? 19.713  -5.505  -62.437  1.00 26.27 ? 207  ASP A CA    1 
ATOM   1587  C C     . ASP A 1 229 ? 20.509  -4.663  -61.460  1.00 25.29 ? 207  ASP A C     1 
ATOM   1588  O O     . ASP A 1 229 ? 21.459  -5.130  -60.848  1.00 26.89 ? 207  ASP A O     1 
ATOM   1589  C CB    . ASP A 1 229 ? 19.997  -5.031  -63.863  1.00 29.56 ? 207  ASP A CB    1 
ATOM   1590  C CG    . ASP A 1 229 ? 21.081  -5.824  -64.539  1.00 32.04 ? 207  ASP A CG    1 
ATOM   1591  O OD1   . ASP A 1 229 ? 20.838  -7.017  -64.806  1.00 35.22 ? 207  ASP A OD1   1 
ATOM   1592  O OD2   . ASP A 1 229 ? 22.142  -5.235  -64.824  1.00 37.43 ? 207  ASP A OD2   1 
ATOM   1593  N N     . SER A 1 230 ? 20.098  -3.410  -61.341  1.00 24.53 ? 208  SER A N     1 
ATOM   1594  C CA    . SER A 1 230 ? 20.812  -2.409  -60.582  1.00 23.91 ? 208  SER A CA    1 
ATOM   1595  C C     . SER A 1 230 ? 20.821  -2.751  -59.100  1.00 22.77 ? 208  SER A C     1 
ATOM   1596  O O     . SER A 1 230 ? 21.854  -2.663  -58.431  1.00 23.55 ? 208  SER A O     1 
ATOM   1597  C CB    . SER A 1 230 ? 20.146  -1.057  -60.816  1.00 22.40 ? 208  SER A CB    1 
ATOM   1598  O OG    . SER A 1 230 ? 20.871  -0.027  -60.191  1.00 27.66 ? 208  SER A OG    1 
ATOM   1599  N N     . ALA A 1 231 ? 19.665  -3.161  -58.606  1.00 21.36 ? 209  ALA A N     1 
ATOM   1600  C CA    . ALA A 1 231 ? 19.499  -3.549  -57.216  1.00 19.78 ? 209  ALA A CA    1 
ATOM   1601  C C     . ALA A 1 231 ? 20.298  -4.812  -56.873  1.00 19.40 ? 209  ALA A C     1 
ATOM   1602  O O     . ALA A 1 231 ? 20.971  -4.869  -55.847  1.00 19.27 ? 209  ALA A O     1 
ATOM   1603  C CB    . ALA A 1 231 ? 17.988  -3.731  -56.896  1.00 19.28 ? 209  ALA A CB    1 
ATOM   1604  N N     . HIS A 1 232 ? 20.242  -5.808  -57.747  1.00 19.52 ? 210  HIS A N     1 
ATOM   1605  C CA    . HIS A 1 232 ? 20.913  -7.088  -57.503  1.00 19.47 ? 210  HIS A CA    1 
ATOM   1606  C C     . HIS A 1 232 ? 22.408  -7.044  -57.609  1.00 19.14 ? 210  HIS A C     1 
ATOM   1607  O O     . HIS A 1 232 ? 23.088  -7.859  -56.983  1.00 18.83 ? 210  HIS A O     1 
ATOM   1608  C CB    . HIS A 1 232 ? 20.414  -8.157  -58.461  1.00 19.36 ? 210  HIS A CB    1 
ATOM   1609  C CG    . HIS A 1 232 ? 18.944  -8.356  -58.400  1.00 17.18 ? 210  HIS A CG    1 
ATOM   1610  N ND1   . HIS A 1 232 ? 18.216  -8.830  -59.466  1.00 11.11 ? 210  HIS A ND1   1 
ATOM   1611  C CD2   . HIS A 1 232 ? 18.057  -8.088  -57.415  1.00 16.35 ? 210  HIS A CD2   1 
ATOM   1612  C CE1   . HIS A 1 232 ? 16.939  -8.855  -59.132  1.00 21.10 ? 210  HIS A CE1   1 
ATOM   1613  N NE2   . HIS A 1 232 ? 16.813  -8.410  -57.892  1.00 13.38 ? 210  HIS A NE2   1 
ATOM   1614  N N     . GLY A 1 233 ? 22.917  -6.112  -58.405  1.00 20.95 ? 211  GLY A N     1 
ATOM   1615  C CA    . GLY A 1 233 ? 24.354  -5.837  -58.451  1.00 21.50 ? 211  GLY A CA    1 
ATOM   1616  C C     . GLY A 1 233 ? 24.890  -5.443  -57.083  1.00 21.73 ? 211  GLY A C     1 
ATOM   1617  O O     . GLY A 1 233 ? 26.065  -5.665  -56.772  1.00 22.15 ? 211  GLY A O     1 
ATOM   1618  N N     . LEU A 1 234 ? 24.018  -4.873  -56.258  1.00 21.41 ? 212  LEU A N     1 
ATOM   1619  C CA    . LEU A 1 234 ? 24.386  -4.459  -54.916  1.00 22.40 ? 212  LEU A CA    1 
ATOM   1620  C C     . LEU A 1 234 ? 23.982  -5.457  -53.853  1.00 22.03 ? 212  LEU A C     1 
ATOM   1621  O O     . LEU A 1 234 ? 24.190  -5.216  -52.676  1.00 23.82 ? 212  LEU A O     1 
ATOM   1622  C CB    . LEU A 1 234 ? 23.719  -3.131  -54.630  1.00 22.40 ? 212  LEU A CB    1 
ATOM   1623  C CG    . LEU A 1 234 ? 24.314  -1.970  -55.394  1.00 22.59 ? 212  LEU A CG    1 
ATOM   1624  C CD1   . LEU A 1 234 ? 23.389  -0.773  -55.221  1.00 26.53 ? 212  LEU A CD1   1 
ATOM   1625  C CD2   . LEU A 1 234 ? 25.694  -1.658  -54.889  1.00 23.13 ? 212  LEU A CD2   1 
ATOM   1626  N N     . LYS A 1 235 ? 23.451  -6.594  -54.282  1.00 21.55 ? 213  LYS A N     1 
ATOM   1627  C CA    . LYS A 1 235 ? 22.818  -7.554  -53.404  1.00 20.96 ? 213  LYS A CA    1 
ATOM   1628  C C     . LYS A 1 235 ? 21.594  -6.965  -52.702  1.00 19.55 ? 213  LYS A C     1 
ATOM   1629  O O     . LYS A 1 235 ? 21.193  -7.408  -51.608  1.00 19.70 ? 213  LYS A O     1 
ATOM   1630  C CB    . LYS A 1 235 ? 23.845  -8.177  -52.460  1.00 20.71 ? 213  LYS A CB    1 
ATOM   1631  C CG    . LYS A 1 235 ? 24.712  -9.273  -53.184  1.00 26.18 ? 213  LYS A CG    1 
ATOM   1632  C CD    . LYS A 1 235 ? 26.195  -9.269  -52.754  1.00 34.32 ? 213  LYS A CD    1 
ATOM   1633  C CE    . LYS A 1 235 ? 27.067  -8.289  -53.607  1.00 33.00 ? 213  LYS A CE    1 
ATOM   1634  N N     . GLY A 1 236 ? 20.976  -5.982  -53.361  1.00 17.93 ? 214  GLY A N     1 
ATOM   1635  C CA    . GLY A 1 236 ? 19.717  -5.379  -52.898  1.00 16.94 ? 214  GLY A CA    1 
ATOM   1636  C C     . GLY A 1 236 ? 18.500  -6.018  -53.542  1.00 15.13 ? 214  GLY A C     1 
ATOM   1637  O O     . GLY A 1 236 ? 18.615  -7.033  -54.210  1.00 12.38 ? 214  GLY A O     1 
ATOM   1638  N N     . HIS A 1 237 ? 17.333  -5.411  -53.342  1.00 16.06 ? 215  HIS A N     1 
ATOM   1639  C CA    . HIS A 1 237 ? 16.054  -5.984  -53.801  1.00 16.29 ? 215  HIS A CA    1 
ATOM   1640  C C     . HIS A 1 237 ? 15.037  -4.932  -54.278  1.00 17.09 ? 215  HIS A C     1 
ATOM   1641  O O     . HIS A 1 237 ? 15.087  -3.738  -53.894  1.00 16.52 ? 215  HIS A O     1 
ATOM   1642  C CB    . HIS A 1 237 ? 15.412  -6.772  -52.698  1.00 14.55 ? 215  HIS A CB    1 
ATOM   1643  C CG    . HIS A 1 237 ? 16.225  -7.926  -52.230  1.00 11.33 ? 215  HIS A CG    1 
ATOM   1644  N ND1   . HIS A 1 237 ? 17.029  -7.863  -51.115  1.00 14.18 ? 215  HIS A ND1   1 
ATOM   1645  C CD2   . HIS A 1 237 ? 16.347  -9.186  -52.713  1.00 14.31 ? 215  HIS A CD2   1 
ATOM   1646  C CE1   . HIS A 1 237 ? 17.616  -9.033  -50.931  1.00 12.26 ? 215  HIS A CE1   1 
ATOM   1647  N NE2   . HIS A 1 237 ? 17.217  -9.857  -51.889  1.00 8.85  ? 215  HIS A NE2   1 
ATOM   1648  N N     . ILE A 1 238 ? 14.112  -5.355  -55.132  1.00 17.24 ? 216  ILE A N     1 
ATOM   1649  C CA    . ILE A 1 238 ? 13.085  -4.428  -55.560  1.00 16.71 ? 216  ILE A CA    1 
ATOM   1650  C C     . ILE A 1 238 ? 11.699  -5.000  -55.472  1.00 16.26 ? 216  ILE A C     1 
ATOM   1651  O O     . ILE A 1 238 ? 11.491  -6.211  -55.528  1.00 16.87 ? 216  ILE A O     1 
ATOM   1652  C CB    . ILE A 1 238 ? 13.285  -3.904  -56.994  1.00 16.89 ? 216  ILE A CB    1 
ATOM   1653  C CG1   . ILE A 1 238 ? 12.989  -4.973  -58.040  1.00 15.47 ? 216  ILE A CG1   1 
ATOM   1654  C CG2   . ILE A 1 238 ? 14.694  -3.372  -57.182  1.00 22.14 ? 216  ILE A CG2   1 
ATOM   1655  C CD1   . ILE A 1 238 ? 12.654  -4.391  -59.359  1.00 17.49 ? 216  ILE A CD1   1 
ATOM   1656  N N     . ILE A 1 239 ? 10.746  -4.084  -55.375  1.00 15.20 ? 217  ILE A N     1 
ATOM   1657  C CA    . ILE A 1 239 ? 9.352   -4.355  -55.548  1.00 12.66 ? 217  ILE A CA    1 
ATOM   1658  C C     . ILE A 1 239 ? 8.916   -3.753  -56.881  1.00 13.43 ? 217  ILE A C     1 
ATOM   1659  O O     . ILE A 1 239 ? 9.125   -2.583  -57.131  1.00 15.33 ? 217  ILE A O     1 
ATOM   1660  C CB    . ILE A 1 239 ? 8.547   -3.681  -54.428  1.00 10.99 ? 217  ILE A CB    1 
ATOM   1661  C CG1   . ILE A 1 239 ? 8.885   -4.303  -53.096  1.00 12.95 ? 217  ILE A CG1   1 
ATOM   1662  C CG2   . ILE A 1 239 ? 7.046   -3.819  -54.649  1.00 12.77 ? 217  ILE A CG2   1 
ATOM   1663  C CD1   . ILE A 1 239 ? 8.734   -3.399  -51.974  1.00 13.77 ? 217  ILE A CD1   1 
ATOM   1664  N N     . SER A 1 240 ? 8.304   -4.548  -57.738  1.00 12.89 ? 218  SER A N     1 
ATOM   1665  C CA    . SER A 1 240 ? 7.502   -4.010  -58.832  1.00 12.99 ? 218  SER A CA    1 
ATOM   1666  C C     . SER A 1 240 ? 6.155   -3.435  -58.271  1.00 14.63 ? 218  SER A C     1 
ATOM   1667  O O     . SER A 1 240 ? 5.210   -4.173  -57.934  1.00 11.55 ? 218  SER A O     1 
ATOM   1668  C CB    . SER A 1 240 ? 7.191   -5.087  -59.882  1.00 12.30 ? 218  SER A CB    1 
ATOM   1669  O OG    . SER A 1 240 ? 6.591   -4.531  -61.051  1.00 9.63  ? 218  SER A OG    1 
ATOM   1670  N N     . ASP A 1 241 ? 6.089   -2.107  -58.233  1.00 16.05 ? 219  ASP A N     1 
ATOM   1671  C CA    . ASP A 1 241 ? 4.960   -1.424  -57.661  1.00 18.20 ? 219  ASP A CA    1 
ATOM   1672  C C     . ASP A 1 241 ? 4.020   -0.854  -58.699  1.00 17.80 ? 219  ASP A C     1 
ATOM   1673  O O     . ASP A 1 241 ? 4.306   0.157   -59.314  1.00 20.03 ? 219  ASP A O     1 
ATOM   1674  C CB    . ASP A 1 241 ? 5.401   -0.291  -56.725  1.00 20.55 ? 219  ASP A CB    1 
ATOM   1675  C CG    . ASP A 1 241 ? 4.230   0.276   -55.954  1.00 15.96 ? 219  ASP A CG    1 
ATOM   1676  O OD1   . ASP A 1 241 ? 3.270   -0.508  -55.813  1.00 12.76 ? 219  ASP A OD1   1 
ATOM   1677  O OD2   . ASP A 1 241 ? 4.263   1.463   -55.530  1.00 10.88 ? 219  ASP A OD2   1 
ATOM   1678  N N     . GLY A 1 242 ? 2.893   -1.529  -58.878  1.00 18.51 ? 220  GLY A N     1 
ATOM   1679  C CA    . GLY A 1 242 ? 1.847   -1.089  -59.782  1.00 17.67 ? 220  GLY A CA    1 
ATOM   1680  C C     . GLY A 1 242 ? 1.967   -1.612  -61.217  1.00 17.15 ? 220  GLY A C     1 
ATOM   1681  O O     . GLY A 1 242 ? 3.054   -2.033  -61.695  1.00 17.63 ? 220  GLY A O     1 
ATOM   1682  N N     . GLY A 1 243 ? 0.831   -1.549  -61.909  1.00 16.48 ? 221  GLY A N     1 
ATOM   1683  C CA    . GLY A 1 243 ? 0.729   -1.908  -63.328  1.00 16.64 ? 221  GLY A CA    1 
ATOM   1684  C C     . GLY A 1 243 ? 0.122   -3.273  -63.621  1.00 15.95 ? 221  GLY A C     1 
ATOM   1685  O O     . GLY A 1 243 ? -0.356  -3.490  -64.720  1.00 18.42 ? 221  GLY A O     1 
ATOM   1686  N N     . CYS A 1 244 ? 0.182   -4.210  -62.674  1.00 16.64 ? 222  CYS A N     1 
ATOM   1687  C CA    . CYS A 1 244 ? -0.363  -5.557  -62.900  1.00 16.49 ? 222  CYS A CA    1 
ATOM   1688  C C     . CYS A 1 244 ? -1.876  -5.524  -62.855  1.00 18.34 ? 222  CYS A C     1 
ATOM   1689  O O     . CYS A 1 244 ? -2.481  -5.068  -61.862  1.00 18.09 ? 222  CYS A O     1 
ATOM   1690  C CB    . CYS A 1 244 ? 0.128   -6.556  -61.867  1.00 16.29 ? 222  CYS A CB    1 
ATOM   1691  S SG    . CYS A 1 244 ? 1.886   -6.751  -61.997  1.00 20.82 ? 222  CYS A SG    1 
ATOM   1692  N N     . THR A 1 245 ? -2.479  -5.993  -63.952  1.00 18.53 ? 223  THR A N     1 
ATOM   1693  C CA    . THR A 1 245 ? -3.930  -6.032  -64.106  1.00 18.01 ? 223  THR A CA    1 
ATOM   1694  C C     . THR A 1 245 ? -4.410  -7.466  -64.099  1.00 17.94 ? 223  THR A C     1 
ATOM   1695  O O     . THR A 1 245 ? -5.604  -7.722  -64.146  1.00 17.16 ? 223  THR A O     1 
ATOM   1696  C CB    . THR A 1 245 ? -4.382  -5.423  -65.453  1.00 19.31 ? 223  THR A CB    1 
ATOM   1697  O OG1   . THR A 1 245 ? -3.482  -5.851  -66.494  1.00 21.52 ? 223  THR A OG1   1 
ATOM   1698  C CG2   . THR A 1 245 ? -4.399  -3.901  -65.376  1.00 19.29 ? 223  THR A CG2   1 
ATOM   1699  N N     . CYS A 1 246 ? -3.468  -8.413  -64.068  1.00 17.33 ? 224  CYS A N     1 
ATOM   1700  C CA    . CYS A 1 246 ? -3.815  -9.813  -64.037  1.00 15.80 ? 224  CYS A CA    1 
ATOM   1701  C C     . CYS A 1 246 ? -2.620  -10.621 -63.577  1.00 15.27 ? 224  CYS A C     1 
ATOM   1702  O O     . CYS A 1 246 ? -1.486  -10.132 -63.597  1.00 14.30 ? 224  CYS A O     1 
ATOM   1703  C CB    . CYS A 1 246 ? -4.256  -10.290 -65.434  1.00 17.66 ? 224  CYS A CB    1 
ATOM   1704  S SG    . CYS A 1 246 ? -2.942  -10.148 -66.694  1.00 16.75 ? 224  CYS A SG    1 
ATOM   1705  N N     . PRO A 1 247 ? -2.870  -11.893 -63.210  1.00 14.07 ? 225  PRO A N     1 
ATOM   1706  C CA    . PRO A 1 247 ? -1.810  -12.751 -62.736  1.00 13.93 ? 225  PRO A CA    1 
ATOM   1707  C C     . PRO A 1 247 ? -0.660  -12.936 -63.703  1.00 14.43 ? 225  PRO A C     1 
ATOM   1708  O O     . PRO A 1 247 ? 0.448   -13.206 -63.274  1.00 17.14 ? 225  PRO A O     1 
ATOM   1709  C CB    . PRO A 1 247 ? -2.538  -14.081 -62.511  1.00 15.54 ? 225  PRO A CB    1 
ATOM   1710  C CG    . PRO A 1 247 ? -3.974  -13.704 -62.289  1.00 11.28 ? 225  PRO A CG    1 
ATOM   1711  C CD    . PRO A 1 247 ? -4.186  -12.590 -63.203  1.00 12.85 ? 225  PRO A CD    1 
ATOM   1712  N N     . GLY A 1 248 ? -0.921  -12.826 -64.998  1.00 15.01 ? 226  GLY A N     1 
ATOM   1713  C CA    . GLY A 1 248 ? 0.121   -12.908 -66.007  1.00 15.70 ? 226  GLY A CA    1 
ATOM   1714  C C     . GLY A 1 248 ? 1.161   -11.818 -65.834  1.00 17.87 ? 226  GLY A C     1 
ATOM   1715  O O     . GLY A 1 248 ? 2.377   -12.084 -65.878  1.00 18.95 ? 226  GLY A O     1 
ATOM   1716  N N     . ASP A 1 249 ? 0.685   -10.587 -65.622  1.00 19.74 ? 227  ASP A N     1 
ATOM   1717  C CA    . ASP A 1 249 ? 1.546   -9.435  -65.358  1.00 18.48 ? 227  ASP A CA    1 
ATOM   1718  C C     . ASP A 1 249 ? 2.378   -9.664  -64.134  1.00 17.37 ? 227  ASP A C     1 
ATOM   1719  O O     . ASP A 1 249 ? 3.569   -9.357  -64.117  1.00 18.41 ? 227  ASP A O     1 
ATOM   1720  C CB    . ASP A 1 249 ? 0.717   -8.187  -65.106  1.00 19.15 ? 227  ASP A CB    1 
ATOM   1721  C CG    . ASP A 1 249 ? 0.000   -7.684  -66.343  1.00 23.14 ? 227  ASP A CG    1 
ATOM   1722  O OD1   . ASP A 1 249 ? 0.446   -8.029  -67.466  1.00 26.30 ? 227  ASP A OD1   1 
ATOM   1723  O OD2   . ASP A 1 249 ? -1.016  -6.929  -66.180  1.00 27.59 ? 227  ASP A OD2   1 
ATOM   1724  N N     . VAL A 1 250 ? 1.760   -10.213 -63.099  1.00 17.34 ? 228  VAL A N     1 
ATOM   1725  C CA    . VAL A 1 250 ? 2.498   -10.539 -61.874  1.00 16.56 ? 228  VAL A CA    1 
ATOM   1726  C C     . VAL A 1 250 ? 3.631   -11.480 -62.203  1.00 16.41 ? 228  VAL A C     1 
ATOM   1727  O O     . VAL A 1 250 ? 4.749   -11.323 -61.678  1.00 17.24 ? 228  VAL A O     1 
ATOM   1728  C CB    . VAL A 1 250 ? 1.642   -11.211 -60.839  1.00 14.40 ? 228  VAL A CB    1 
ATOM   1729  C CG1   . VAL A 1 250 ? 2.479   -11.544 -59.599  1.00 20.38 ? 228  VAL A CG1   1 
ATOM   1730  C CG2   . VAL A 1 250 ? 0.457   -10.311 -60.465  1.00 16.31 ? 228  VAL A CG2   1 
ATOM   1731  N N     . ALA A 1 251 ? 3.347   -12.453 -63.074  1.00 15.43 ? 229  ALA A N     1 
ATOM   1732  C CA    . ALA A 1 251 ? 4.347   -13.441 -63.460  1.00 14.97 ? 229  ALA A CA    1 
ATOM   1733  C C     . ALA A 1 251 ? 5.470   -12.792 -64.248  1.00 15.17 ? 229  ALA A C     1 
ATOM   1734  O O     . ALA A 1 251 ? 6.641   -13.145 -64.095  1.00 12.59 ? 229  ALA A O     1 
ATOM   1735  C CB    . ALA A 1 251 ? 3.714   -14.545 -64.257  1.00 14.63 ? 229  ALA A CB    1 
ATOM   1736  N N     . LYS A 1 252 ? 5.076   -11.855 -65.108  1.00 17.98 ? 230  LYS A N     1 
ATOM   1737  C CA    . LYS A 1 252 ? 5.991   -11.099 -65.947  1.00 18.28 ? 230  LYS A CA    1 
ATOM   1738  C C     . LYS A 1 252 ? 6.906   -10.218 -65.121  1.00 18.86 ? 230  LYS A C     1 
ATOM   1739  O O     . LYS A 1 252 ? 8.120   -10.157 -65.364  1.00 20.33 ? 230  LYS A O     1 
ATOM   1740  C CB    . LYS A 1 252 ? 5.152   -10.251 -66.921  1.00 19.19 ? 230  LYS A CB    1 
ATOM   1741  C CG    . LYS A 1 252 ? 4.426   -11.095 -67.974  1.00 15.98 ? 230  LYS A CG    1 
ATOM   1742  C CD    . LYS A 1 252 ? 3.755   -10.229 -69.012  1.00 18.88 ? 230  LYS A CD    1 
ATOM   1743  C CE    . LYS A 1 252 ? 2.850   -11.055 -69.906  1.00 17.56 ? 230  LYS A CE    1 
ATOM   1744  N NZ    . LYS A 1 252 ? 2.502   -10.265 -71.101  1.00 10.97 ? 230  LYS A NZ    1 
ATOM   1745  N N     . ALA A 1 253 ? 6.323   -9.554  -64.127  1.00 18.86 ? 231  ALA A N     1 
ATOM   1746  C CA    . ALA A 1 253 ? 7.120   -8.774  -63.164  1.00 19.02 ? 231  ALA A CA    1 
ATOM   1747  C C     . ALA A 1 253 ? 8.258   -9.631  -62.559  1.00 19.30 ? 231  ALA A C     1 
ATOM   1748  O O     . ALA A 1 253 ? 9.458   -9.275  -62.607  1.00 17.57 ? 231  ALA A O     1 
ATOM   1749  C CB    . ALA A 1 253 ? 6.214   -8.239  -62.066  1.00 18.27 ? 231  ALA A CB    1 
ATOM   1750  N N     . PHE A 1 254 ? 7.856   -10.769 -61.992  1.00 18.35 ? 232  PHE A N     1 
ATOM   1751  C CA    . PHE A 1 254 ? 8.832   -11.691 -61.414  1.00 18.30 ? 232  PHE A CA    1 
ATOM   1752  C C     . PHE A 1 254 ? 9.874   -12.175 -62.437  1.00 17.34 ? 232  PHE A C     1 
ATOM   1753  O O     . PHE A 1 254 ? 11.076  -12.276 -62.099  1.00 15.35 ? 232  PHE A O     1 
ATOM   1754  C CB    . PHE A 1 254 ? 8.142   -12.866 -60.726  1.00 15.85 ? 232  PHE A CB    1 
ATOM   1755  C CG    . PHE A 1 254 ? 7.548   -12.519 -59.380  1.00 18.80 ? 232  PHE A CG    1 
ATOM   1756  C CD1   . PHE A 1 254 ? 8.333   -11.938 -58.389  1.00 14.34 ? 232  PHE A CD1   1 
ATOM   1757  C CD2   . PHE A 1 254 ? 6.214   -12.802 -59.096  1.00 14.31 ? 232  PHE A CD2   1 
ATOM   1758  C CE1   . PHE A 1 254 ? 7.818   -11.640 -57.150  1.00 10.99 ? 232  PHE A CE1   1 
ATOM   1759  C CE2   . PHE A 1 254 ? 5.676   -12.499 -57.838  1.00 21.71 ? 232  PHE A CE2   1 
ATOM   1760  C CZ    . PHE A 1 254 ? 6.495   -11.911 -56.860  1.00 15.26 ? 232  PHE A CZ    1 
ATOM   1761  N N     . GLY A 1 255 ? 9.404   -12.455 -63.665  1.00 17.23 ? 233  GLY A N     1 
ATOM   1762  C CA    . GLY A 1 255 ? 10.261  -12.907 -64.765  1.00 16.65 ? 233  GLY A CA    1 
ATOM   1763  C C     . GLY A 1 255 ? 11.301  -11.882 -65.142  1.00 16.12 ? 233  GLY A C     1 
ATOM   1764  O O     . GLY A 1 255 ? 12.382  -12.229 -65.525  1.00 17.66 ? 233  GLY A O     1 
ATOM   1765  N N     . ALA A 1 256 ? 10.939  -10.616 -65.029  1.00 17.08 ? 234  ALA A N     1 
ATOM   1766  C CA    . ALA A 1 256 ? 11.794  -9.491  -65.338  1.00 17.82 ? 234  ALA A CA    1 
ATOM   1767  C C     . ALA A 1 256 ? 12.822  -9.165  -64.258  1.00 17.66 ? 234  ALA A C     1 
ATOM   1768  O O     . ALA A 1 256 ? 13.728  -8.390  -64.512  1.00 19.98 ? 234  ALA A O     1 
ATOM   1769  C CB    . ALA A 1 256 ? 10.923  -8.279  -65.600  1.00 19.25 ? 234  ALA A CB    1 
ATOM   1770  N N     . GLY A 1 257 ? 12.673  -9.737  -63.067  1.00 16.52 ? 235  GLY A N     1 
ATOM   1771  C CA    . GLY A 1 257 ? 13.675  -9.605  -62.001  1.00 16.37 ? 235  GLY A CA    1 
ATOM   1772  C C     . GLY A 1 257 ? 13.160  -9.112  -60.670  1.00 17.29 ? 235  GLY A C     1 
ATOM   1773  O O     . GLY A 1 257 ? 13.902  -9.049  -59.713  1.00 17.72 ? 235  GLY A O     1 
ATOM   1774  N N     . ALA A 1 258 ? 11.879  -8.757  -60.606  1.00 18.76 ? 236  ALA A N     1 
ATOM   1775  C CA    . ALA A 1 258 ? 11.258  -8.250  -59.399  1.00 17.26 ? 236  ALA A CA    1 
ATOM   1776  C C     . ALA A 1 258 ? 11.397  -9.253  -58.285  1.00 18.55 ? 236  ALA A C     1 
ATOM   1777  O O     . ALA A 1 258 ? 11.101  -10.441 -58.460  1.00 19.17 ? 236  ALA A O     1 
ATOM   1778  C CB    . ALA A 1 258 ? 9.806   -7.959  -59.649  1.00 19.32 ? 236  ALA A CB    1 
ATOM   1779  N N     . ASP A 1 259 ? 11.867  -8.777  -57.137  1.00 18.93 ? 237  ASP A N     1 
ATOM   1780  C CA    . ASP A 1 259 ? 11.997  -9.631  -55.980  1.00 17.18 ? 237  ASP A CA    1 
ATOM   1781  C C     . ASP A 1 259 ? 10.637  -9.796  -55.312  1.00 15.78 ? 237  ASP A C     1 
ATOM   1782  O O     . ASP A 1 259 ? 10.275  -10.886 -54.946  1.00 15.01 ? 237  ASP A O     1 
ATOM   1783  C CB    . ASP A 1 259 ? 13.068  -9.059  -55.095  1.00 15.78 ? 237  ASP A CB    1 
ATOM   1784  C CG    . ASP A 1 259 ? 14.414  -9.136  -55.763  1.00 17.55 ? 237  ASP A CG    1 
ATOM   1785  O OD1   . ASP A 1 259 ? 14.920  -10.273 -55.792  1.00 12.54 ? 237  ASP A OD1   1 
ATOM   1786  O OD2   . ASP A 1 259 ? 14.942  -8.108  -56.286  1.00 14.03 ? 237  ASP A OD2   1 
ATOM   1787  N N     . PHE A 1 260 ? 9.887   -8.704  -55.201  1.00 15.86 ? 238  PHE A N     1 
ATOM   1788  C CA    . PHE A 1 260 ? 8.474   -8.709  -54.742  1.00 16.24 ? 238  PHE A CA    1 
ATOM   1789  C C     . PHE A 1 260 ? 7.645   -8.019  -55.800  1.00 14.90 ? 238  PHE A C     1 
ATOM   1790  O O     . PHE A 1 260 ? 8.164   -7.347  -56.677  1.00 15.34 ? 238  PHE A O     1 
ATOM   1791  C CB    . PHE A 1 260 ? 8.251   -7.922  -53.429  1.00 15.69 ? 238  PHE A CB    1 
ATOM   1792  C CG    . PHE A 1 260 ? 9.163   -8.327  -52.308  1.00 16.99 ? 238  PHE A CG    1 
ATOM   1793  C CD1   . PHE A 1 260 ? 8.662   -8.980  -51.186  1.00 18.56 ? 238  PHE A CD1   1 
ATOM   1794  C CD2   . PHE A 1 260 ? 10.554  -8.085  -52.392  1.00 22.06 ? 238  PHE A CD2   1 
ATOM   1795  C CE1   . PHE A 1 260 ? 9.519   -9.395  -50.164  1.00 16.24 ? 238  PHE A CE1   1 
ATOM   1796  C CE2   . PHE A 1 260 ? 11.414  -8.470  -51.375  1.00 18.75 ? 238  PHE A CE2   1 
ATOM   1797  C CZ    . PHE A 1 260 ? 10.903  -9.118  -50.257  1.00 17.83 ? 238  PHE A CZ    1 
ATOM   1798  N N     . VAL A 1 261 ? 6.350   -8.217  -55.722  1.00 13.89 ? 239  VAL A N     1 
ATOM   1799  C CA    . VAL A 1 261 ? 5.403   -7.540  -56.588  1.00 14.59 ? 239  VAL A CA    1 
ATOM   1800  C C     . VAL A 1 261 ? 4.313   -6.983  -55.702  1.00 14.86 ? 239  VAL A C     1 
ATOM   1801  O O     . VAL A 1 261 ? 3.656   -7.727  -54.958  1.00 12.95 ? 239  VAL A O     1 
ATOM   1802  C CB    . VAL A 1 261 ? 4.765   -8.511  -57.632  1.00 14.52 ? 239  VAL A CB    1 
ATOM   1803  C CG1   . VAL A 1 261 ? 3.451   -7.950  -58.206  1.00 11.50 ? 239  VAL A CG1   1 
ATOM   1804  C CG2   . VAL A 1 261 ? 5.760   -8.805  -58.741  1.00 12.59 ? 239  VAL A CG2   1 
ATOM   1805  N N     . MET A 1 262 ? 4.113   -5.675  -55.819  1.00 16.58 ? 240  MET A N     1 
ATOM   1806  C CA    . MET A 1 262 ? 3.104   -4.962  -55.053  1.00 17.18 ? 240  MET A CA    1 
ATOM   1807  C C     . MET A 1 262 ? 1.853   -4.656  -55.884  1.00 17.41 ? 240  MET A C     1 
ATOM   1808  O O     . MET A 1 262 ? 1.935   -4.159  -57.025  1.00 17.60 ? 240  MET A O     1 
ATOM   1809  C CB    . MET A 1 262 ? 3.690   -3.658  -54.482  1.00 18.07 ? 240  MET A CB    1 
ATOM   1810  C CG    . MET A 1 262 ? 2.691   -2.878  -53.602  1.00 16.86 ? 240  MET A CG    1 
ATOM   1811  S SD    . MET A 1 262 ? 3.496   -1.439  -52.884  1.00 17.99 ? 240  MET A SD    1 
ATOM   1812  C CE    . MET A 1 262 ? 4.306   -2.106  -51.439  1.00 16.81 ? 240  MET A CE    1 
ATOM   1813  N N     . LEU A 1 263 ? 0.704   -4.948  -55.293  1.00 16.37 ? 241  LEU A N     1 
ATOM   1814  C CA    . LEU A 1 263 ? -0.593  -4.867  -55.999  1.00 17.36 ? 241  LEU A CA    1 
ATOM   1815  C C     . LEU A 1 263 ? -1.656  -4.105  -55.207  1.00 15.33 ? 241  LEU A C     1 
ATOM   1816  O O     . LEU A 1 263 ? -1.856  -4.366  -54.042  1.00 15.40 ? 241  LEU A O     1 
ATOM   1817  C CB    . LEU A 1 263 ? -1.150  -6.276  -56.246  1.00 17.93 ? 241  LEU A CB    1 
ATOM   1818  C CG    . LEU A 1 263 ? -0.240  -7.340  -56.858  1.00 15.09 ? 241  LEU A CG    1 
ATOM   1819  C CD1   . LEU A 1 263 ? -0.929  -8.668  -56.762  1.00 16.57 ? 241  LEU A CD1   1 
ATOM   1820  C CD2   . LEU A 1 263 ? 0.063   -7.037  -58.273  1.00 14.39 ? 241  LEU A CD2   1 
ATOM   1821  N N     . GLY A 1 264 ? -2.333  -3.188  -55.864  1.00 14.82 ? 242  GLY A N     1 
ATOM   1822  C CA    . GLY A 1 264 ? -3.415  -2.421  -55.278  1.00 15.44 ? 242  GLY A CA    1 
ATOM   1823  C C     . GLY A 1 264 ? -4.717  -2.700  -55.984  1.00 16.56 ? 242  GLY A C     1 
ATOM   1824  O O     . GLY A 1 264 ? -5.650  -3.204  -55.369  1.00 16.36 ? 242  GLY A O     1 
ATOM   1825  N N     . GLY A 1 265 ? -4.767  -2.410  -57.293  1.00 19.01 ? 243  GLY A N     1 
ATOM   1826  C CA    . GLY A 1 265 ? -6.012  -2.569  -58.070  1.00 18.31 ? 243  GLY A CA    1 
ATOM   1827  C C     . GLY A 1 265 ? -6.524  -4.005  -58.102  1.00 17.89 ? 243  GLY A C     1 
ATOM   1828  O O     . GLY A 1 265 ? -7.719  -4.261  -57.997  1.00 17.91 ? 243  GLY A O     1 
ATOM   1829  N N     . MET A 1 266 ? -5.604  -4.954  -58.233  1.00 17.99 ? 244  MET A N     1 
ATOM   1830  C CA    . MET A 1 266 ? -5.968  -6.371  -58.198  1.00 19.09 ? 244  MET A CA    1 
ATOM   1831  C C     . MET A 1 266 ? -6.560  -6.847  -56.861  1.00 18.32 ? 244  MET A C     1 
ATOM   1832  O O     . MET A 1 266 ? -7.350  -7.829  -56.854  1.00 17.43 ? 244  MET A O     1 
ATOM   1833  C CB    . MET A 1 266 ? -4.783  -7.249  -58.569  1.00 19.79 ? 244  MET A CB    1 
ATOM   1834  C CG    . MET A 1 266 ? -4.705  -7.503  -60.071  1.00 21.03 ? 244  MET A CG    1 
ATOM   1835  S SD    . MET A 1 266 ? -3.027  -7.935  -60.525  1.00 25.75 ? 244  MET A SD    1 
ATOM   1836  C CE    . MET A 1 266 ? -3.152  -9.723  -60.475  1.00 22.25 ? 244  MET A CE    1 
ATOM   1837  N N     . PHE A 1 267 ? -6.196  -6.175  -55.756  1.00 16.51 ? 245  PHE A N     1 
ATOM   1838  C CA    . PHE A 1 267 ? -6.808  -6.488  -54.449  1.00 16.38 ? 245  PHE A CA    1 
ATOM   1839  C C     . PHE A 1 267 ? -7.994  -5.603  -54.129  1.00 16.98 ? 245  PHE A C     1 
ATOM   1840  O O     . PHE A 1 267 ? -8.776  -5.919  -53.233  1.00 16.63 ? 245  PHE A O     1 
ATOM   1841  C CB    . PHE A 1 267 ? -5.822  -6.471  -53.291  1.00 14.78 ? 245  PHE A CB    1 
ATOM   1842  C CG    . PHE A 1 267 ? -4.862  -7.602  -53.319  1.00 15.79 ? 245  PHE A CG    1 
ATOM   1843  C CD1   . PHE A 1 267 ? -5.333  -8.932  -53.290  1.00 14.73 ? 245  PHE A CD1   1 
ATOM   1844  C CD2   . PHE A 1 267 ? -3.486  -7.359  -53.404  1.00 11.17 ? 245  PHE A CD2   1 
ATOM   1845  C CE1   . PHE A 1 267 ? -4.449  -10.005 -53.365  1.00 17.44 ? 245  PHE A CE1   1 
ATOM   1846  C CE2   . PHE A 1 267 ? -2.565  -8.440  -53.447  1.00 17.26 ? 245  PHE A CE2   1 
ATOM   1847  C CZ    . PHE A 1 267 ? -3.049  -9.768  -53.432  1.00 18.92 ? 245  PHE A CZ    1 
ATOM   1848  N N     . SER A 1 268 ? -8.152  -4.514  -54.877  1.00 17.52 ? 246  SER A N     1 
ATOM   1849  C CA    . SER A 1 268 ? -9.319  -3.635  -54.726  1.00 16.72 ? 246  SER A CA    1 
ATOM   1850  C C     . SER A 1 268 ? -10.629 -4.380  -54.974  1.00 16.34 ? 246  SER A C     1 
ATOM   1851  O O     . SER A 1 268 ? -10.659 -5.332  -55.709  1.00 17.02 ? 246  SER A O     1 
ATOM   1852  C CB    . SER A 1 268 ? -9.185  -2.386  -55.640  1.00 17.93 ? 246  SER A CB    1 
ATOM   1853  O OG    . SER A 1 268 ? -9.321  -2.621  -57.054  1.00 12.12 ? 246  SER A OG    1 
ATOM   1854  N N     . GLY A 1 269 ? -11.697 -3.970  -54.311  1.00 18.45 ? 247  GLY A N     1 
ATOM   1855  C CA    . GLY A 1 269 ? -13.045 -4.457  -54.615  1.00 18.94 ? 247  GLY A CA    1 
ATOM   1856  C C     . GLY A 1 269 ? -13.544 -5.677  -53.853  1.00 20.72 ? 247  GLY A C     1 
ATOM   1857  O O     . GLY A 1 269 ? -14.692 -6.125  -54.071  1.00 21.27 ? 247  GLY A O     1 
ATOM   1858  N N     . HIS A 1 270 ? -12.729 -6.199  -52.933  1.00 20.84 ? 248  HIS A N     1 
ATOM   1859  C CA    . HIS A 1 270 ? -13.125 -7.384  -52.180  1.00 19.17 ? 248  HIS A CA    1 
ATOM   1860  C C     . HIS A 1 270 ? -13.802 -7.005  -50.875  1.00 19.22 ? 248  HIS A C     1 
ATOM   1861  O O     . HIS A 1 270 ? -13.783 -5.852  -50.476  1.00 19.15 ? 248  HIS A O     1 
ATOM   1862  C CB    . HIS A 1 270 ? -11.912 -8.291  -51.985  1.00 19.30 ? 248  HIS A CB    1 
ATOM   1863  C CG    . HIS A 1 270 ? -11.312 -8.769  -53.271  1.00 14.55 ? 248  HIS A CG    1 
ATOM   1864  N ND1   . HIS A 1 270 ? -10.132 -8.265  -53.779  1.00 16.26 ? 248  HIS A ND1   1 
ATOM   1865  C CD2   . HIS A 1 270 ? -11.729 -9.703  -54.152  1.00 13.71 ? 248  HIS A CD2   1 
ATOM   1866  C CE1   . HIS A 1 270 ? -9.850  -8.869  -54.919  1.00 18.84 ? 248  HIS A CE1   1 
ATOM   1867  N NE2   . HIS A 1 270 ? -10.798 -9.755  -55.163  1.00 17.76 ? 248  HIS A NE2   1 
ATOM   1868  N N     . THR A 1 271 ? -14.359 -8.012  -50.215  1.00 20.72 ? 249  THR A N     1 
ATOM   1869  C CA    . THR A 1 271 ? -15.031 -7.926  -48.918  1.00 20.80 ? 249  THR A CA    1 
ATOM   1870  C C     . THR A 1 271 ? -14.121 -7.491  -47.778  1.00 21.42 ? 249  THR A C     1 
ATOM   1871  O O     . THR A 1 271 ? -14.549 -6.808  -46.866  1.00 21.67 ? 249  THR A O     1 
ATOM   1872  C CB    . THR A 1 271 ? -15.667 -9.304  -48.655  1.00 21.22 ? 249  THR A CB    1 
ATOM   1873  O OG1   . THR A 1 271 ? -16.045 -9.883  -49.912  1.00 19.26 ? 249  THR A OG1   1 
ATOM   1874  C CG2   . THR A 1 271 ? -16.944 -9.198  -47.794  1.00 26.78 ? 249  THR A CG2   1 
ATOM   1875  N N     . GLU A 1 272 ? -12.848 -7.825  -47.879  1.00 23.51 ? 250  GLU A N     1 
ATOM   1876  C CA    . GLU A 1 272 ? -11.845 -7.522  -46.869  1.00 24.37 ? 250  GLU A CA    1 
ATOM   1877  C C     . GLU A 1 272 ? -11.414 -6.060  -46.953  1.00 25.50 ? 250  GLU A C     1 
ATOM   1878  O O     . GLU A 1 272 ? -10.822 -5.507  -46.008  1.00 26.84 ? 250  GLU A O     1 
ATOM   1879  C CB    . GLU A 1 272 ? -10.687 -8.510  -47.092  1.00 23.78 ? 250  GLU A CB    1 
ATOM   1880  C CG    . GLU A 1 272 ? -11.087 -10.007 -46.832  1.00 26.24 ? 250  GLU A CG    1 
ATOM   1881  C CD    . GLU A 1 272 ? -12.019 -10.677 -47.910  1.00 30.44 ? 250  GLU A CD    1 
ATOM   1882  O OE1   . GLU A 1 272 ? -11.831 -10.408 -49.126  1.00 27.93 ? 250  GLU A OE1   1 
ATOM   1883  O OE2   . GLU A 1 272 ? -12.919 -11.493 -47.547  1.00 20.25 ? 250  GLU A OE2   1 
ATOM   1884  N N     . CYS A 1 273 ? -11.738 -5.436  -48.084  1.00 26.79 ? 251  CYS A N     1 
ATOM   1885  C CA    . CYS A 1 273 ? -11.304 -4.079  -48.388  1.00 27.01 ? 251  CYS A CA    1 
ATOM   1886  C C     . CYS A 1 273 ? -12.105 -3.098  -47.574  1.00 26.19 ? 251  CYS A C     1 
ATOM   1887  O O     . CYS A 1 273 ? -13.286 -3.333  -47.323  1.00 25.05 ? 251  CYS A O     1 
ATOM   1888  C CB    . CYS A 1 273 ? -11.470 -3.795  -49.890  1.00 28.65 ? 251  CYS A CB    1 
ATOM   1889  S SG    . CYS A 1 273 ? -10.475 -4.882  -50.946  1.00 29.04 ? 251  CYS A SG    1 
ATOM   1890  N N     . ALA A 1 274 ? -11.438 -2.019  -47.159  1.00 25.97 ? 252  ALA A N     1 
ATOM   1891  C CA    . ALA A 1 274 ? -12.084 -0.950  -46.436  1.00 26.82 ? 252  ALA A CA    1 
ATOM   1892  C C     . ALA A 1 274 ? -13.177 -0.391  -47.346  1.00 26.97 ? 252  ALA A C     1 
ATOM   1893  O O     . ALA A 1 274 ? -12.973 -0.233  -48.558  1.00 27.37 ? 252  ALA A O     1 
ATOM   1894  C CB    . ALA A 1 274 ? -11.062 0.152   -46.060  1.00 28.44 ? 252  ALA A CB    1 
ATOM   1895  N N     . GLY A 1 275 ? -14.326 -0.092  -46.755  1.00 26.41 ? 253  GLY A N     1 
ATOM   1896  C CA    . GLY A 1 275 ? -15.425 0.528   -47.477  1.00 26.52 ? 253  GLY A CA    1 
ATOM   1897  C C     . GLY A 1 275 ? -16.604 -0.402  -47.575  1.00 27.41 ? 253  GLY A C     1 
ATOM   1898  O O     . GLY A 1 275 ? -16.441 -1.617  -47.520  1.00 27.10 ? 253  GLY A O     1 
ATOM   1899  N N     . GLU A 1 276 ? -17.791 0.188   -47.715  1.00 28.72 ? 254  GLU A N     1 
ATOM   1900  C CA    . GLU A 1 276 ? -19.036 -0.541  -47.891  1.00 29.01 ? 254  GLU A CA    1 
ATOM   1901  C C     . GLU A 1 276 ? -19.363 -0.708  -49.382  1.00 28.85 ? 254  GLU A C     1 
ATOM   1902  O O     . GLU A 1 276 ? -18.870 0.022   -50.233  1.00 27.57 ? 254  GLU A O     1 
ATOM   1903  C CB    . GLU A 1 276 ? -20.179 0.210   -47.191  1.00 28.87 ? 254  GLU A CB    1 
ATOM   1904  N N     . VAL A 1 277 ? -20.212 -1.680  -49.687  1.00 29.17 ? 255  VAL A N     1 
ATOM   1905  C CA    . VAL A 1 277 ? -20.603 -1.943  -51.060  1.00 29.67 ? 255  VAL A CA    1 
ATOM   1906  C C     . VAL A 1 277 ? -21.548 -0.843  -51.556  1.00 29.81 ? 255  VAL A C     1 
ATOM   1907  O O     . VAL A 1 277 ? -22.492 -0.437  -50.849  1.00 29.65 ? 255  VAL A O     1 
ATOM   1908  C CB    . VAL A 1 277 ? -21.281 -3.334  -51.194  1.00 29.75 ? 255  VAL A CB    1 
ATOM   1909  C CG1   . VAL A 1 277 ? -21.885 -3.550  -52.586  1.00 28.99 ? 255  VAL A CG1   1 
ATOM   1910  C CG2   . VAL A 1 277 ? -20.280 -4.421  -50.897  1.00 31.91 ? 255  VAL A CG2   1 
ATOM   1911  N N     . ILE A 1 278 ? -21.300 -0.394  -52.785  1.00 29.07 ? 256  ILE A N     1 
ATOM   1912  C CA    . ILE A 1 278 ? -22.083 0.633   -53.464  1.00 28.51 ? 256  ILE A CA    1 
ATOM   1913  C C     . ILE A 1 278 ? -23.099 -0.028  -54.421  1.00 27.66 ? 256  ILE A C     1 
ATOM   1914  O O     . ILE A 1 278 ? -22.813 -1.064  -55.006  1.00 26.73 ? 256  ILE A O     1 
ATOM   1915  C CB    . ILE A 1 278 ? -21.102 1.532   -54.294  1.00 27.73 ? 256  ILE A CB    1 
ATOM   1916  C CG1   . ILE A 1 278 ? -20.233 2.387   -53.367  1.00 23.10 ? 256  ILE A CG1   1 
ATOM   1917  C CG2   . ILE A 1 278 ? -21.843 2.417   -55.304  1.00 29.11 ? 256  ILE A CG2   1 
ATOM   1918  C CD1   . ILE A 1 278 ? -18.978 2.965   -54.035  1.00 25.33 ? 256  ILE A CD1   1 
ATOM   1919  N N     . GLU A 1 279 ? -24.269 0.562   -54.612  1.00 26.06 ? 257  GLU A N     1 
ATOM   1920  C CA    . GLU A 1 279 ? -25.265 -0.099  -55.442  1.00 26.08 ? 257  GLU A CA    1 
ATOM   1921  C C     . GLU A 1 279 ? -25.968 0.819   -56.438  1.00 26.21 ? 257  GLU A C     1 
ATOM   1922  O O     . GLU A 1 279 ? -27.000 1.446   -56.128  1.00 27.14 ? 257  GLU A O     1 
ATOM   1923  C CB    . GLU A 1 279 ? -26.248 -0.853  -54.553  1.00 26.06 ? 257  GLU A CB    1 
ATOM   1924  C CG    . GLU A 1 279 ? -25.889 -2.332  -54.406  1.00 30.21 ? 257  GLU A CG    1 
ATOM   1925  C CD    . GLU A 1 279 ? -26.278 -2.920  -53.076  1.00 29.32 ? 257  GLU A CD    1 
ATOM   1926  O OE1   . GLU A 1 279 ? -25.701 -2.489  -52.056  1.00 31.29 ? 257  GLU A OE1   1 
ATOM   1927  O OE2   . GLU A 1 279 ? -27.144 -3.822  -53.060  1.00 27.43 ? 257  GLU A OE2   1 
ATOM   1928  N N     . ARG A 1 280 ? -25.405 0.847   -57.648  1.00 25.27 ? 258  ARG A N     1 
ATOM   1929  C CA    . ARG A 1 280 ? -25.905 1.659   -58.746  1.00 25.72 ? 258  ARG A CA    1 
ATOM   1930  C C     . ARG A 1 280 ? -26.196 0.832   -60.018  1.00 25.60 ? 258  ARG A C     1 
ATOM   1931  O O     . ARG A 1 280 ? -25.320 0.194   -60.580  1.00 23.62 ? 258  ARG A O     1 
ATOM   1932  C CB    . ARG A 1 280 ? -24.897 2.776   -59.048  1.00 25.60 ? 258  ARG A CB    1 
ATOM   1933  C CG    . ARG A 1 280 ? -25.237 3.624   -60.282  1.00 28.53 ? 258  ARG A CG    1 
ATOM   1934  C CD    . ARG A 1 280 ? -24.396 4.890   -60.439  1.00 31.76 ? 258  ARG A CD    1 
ATOM   1935  N NE    . ARG A 1 280 ? -24.140 5.534   -59.154  1.00 33.51 ? 258  ARG A NE    1 
ATOM   1936  C CZ    . ARG A 1 280 ? -23.043 5.363   -58.422  1.00 32.93 ? 258  ARG A CZ    1 
ATOM   1937  N NH1   . ARG A 1 280 ? -22.068 4.570   -58.853  1.00 35.33 ? 258  ARG A NH1   1 
ATOM   1938  N NH2   . ARG A 1 280 ? -22.925 5.983   -57.246  1.00 28.50 ? 258  ARG A NH2   1 
ATOM   1939  N N     . ASN A 1 281 ? -27.441 0.871   -60.477  1.00 27.59 ? 259  ASN A N     1 
ATOM   1940  C CA    . ASN A 1 281 ? -27.817 0.294   -61.773  1.00 28.57 ? 259  ASN A CA    1 
ATOM   1941  C C     . ASN A 1 281 ? -27.583 -1.208  -61.877  1.00 27.91 ? 259  ASN A C     1 
ATOM   1942  O O     . ASN A 1 281 ? -27.071 -1.672  -62.890  1.00 27.89 ? 259  ASN A O     1 
ATOM   1943  C CB    . ASN A 1 281 ? -27.090 1.015   -62.934  1.00 28.97 ? 259  ASN A CB    1 
ATOM   1944  C CG    . ASN A 1 281 ? -27.316 2.532   -62.931  1.00 31.58 ? 259  ASN A CG    1 
ATOM   1945  O OD1   . ASN A 1 281 ? -28.417 3.025   -62.622  1.00 29.83 ? 259  ASN A OD1   1 
ATOM   1946  N ND2   . ASN A 1 281 ? -26.269 3.277   -63.287  1.00 32.26 ? 259  ASN A ND2   1 
ATOM   1947  N N     . GLY A 1 282 ? -27.979 -1.958  -60.845  1.00 27.94 ? 260  GLY A N     1 
ATOM   1948  C CA    . GLY A 1 282 ? -27.904 -3.430  -60.855  1.00 27.28 ? 260  GLY A CA    1 
ATOM   1949  C C     . GLY A 1 282 ? -26.465 -3.919  -60.862  1.00 27.50 ? 260  GLY A C     1 
ATOM   1950  O O     . GLY A 1 282 ? -26.123 -4.878  -61.548  1.00 28.68 ? 260  GLY A O     1 
ATOM   1951  N N     . ARG A 1 283 ? -25.650 -3.278  -60.031  1.00 25.50 ? 261  ARG A N     1 
ATOM   1952  C CA    . ARG A 1 283 ? -24.187 -3.373  -60.041  1.00 24.65 ? 261  ARG A CA    1 
ATOM   1953  C C     . ARG A 1 283 ? -23.682 -3.161  -58.616  1.00 22.93 ? 261  ARG A C     1 
ATOM   1954  O O     . ARG A 1 283 ? -23.976 -2.124  -58.031  1.00 22.71 ? 261  ARG A O     1 
ATOM   1955  C CB    . ARG A 1 283 ? -23.635 -2.230  -60.910  1.00 25.31 ? 261  ARG A CB    1 
ATOM   1956  C CG    . ARG A 1 283 ? -23.216 -2.527  -62.353  1.00 33.86 ? 261  ARG A CG    1 
ATOM   1957  C CD    . ARG A 1 283 ? -21.669 -2.706  -62.468  1.00 43.19 ? 261  ARG A CD    1 
ATOM   1958  N NE    . ARG A 1 283 ? -21.062 -1.815  -63.465  1.00 50.71 ? 261  ARG A NE    1 
ATOM   1959  C CZ    . ARG A 1 283 ? -19.759 -1.491  -63.521  1.00 59.17 ? 261  ARG A CZ    1 
ATOM   1960  N NH1   . ARG A 1 283 ? -18.886 -1.973  -62.640  1.00 61.62 ? 261  ARG A NH1   1 
ATOM   1961  N NH2   . ARG A 1 283 ? -19.312 -0.667  -64.470  1.00 57.95 ? 261  ARG A NH2   1 
ATOM   1962  N N     . LYS A 1 284 ? -22.961 -4.132  -58.052  1.00 21.61 ? 262  LYS A N     1 
ATOM   1963  C CA    . LYS A 1 284 ? -22.306 -3.970  -56.747  1.00 20.69 ? 262  LYS A CA    1 
ATOM   1964  C C     . LYS A 1 284 ? -20.874 -3.436  -56.976  1.00 20.32 ? 262  LYS A C     1 
ATOM   1965  O O     . LYS A 1 284 ? -20.119 -3.961  -57.812  1.00 18.15 ? 262  LYS A O     1 
ATOM   1966  C CB    . LYS A 1 284 ? -22.289 -5.293  -55.961  1.00 20.53 ? 262  LYS A CB    1 
ATOM   1967  C CG    . LYS A 1 284 ? -23.669 -5.860  -55.595  1.00 14.24 ? 262  LYS A CG    1 
ATOM   1968  N N     . LEU A 1 285 ? -20.510 -2.379  -56.249  1.00 20.44 ? 263  LEU A N     1 
ATOM   1969  C CA    . LEU A 1 285 ? -19.172 -1.792  -56.373  1.00 19.88 ? 263  LEU A CA    1 
ATOM   1970  C C     . LEU A 1 285 ? -18.599 -1.333  -55.035  1.00 18.90 ? 263  LEU A C     1 
ATOM   1971  O O     . LEU A 1 285 ? -19.333 -1.118  -54.044  1.00 15.48 ? 263  LEU A O     1 
ATOM   1972  C CB    . LEU A 1 285 ? -19.117 -0.616  -57.360  1.00 20.02 ? 263  LEU A CB    1 
ATOM   1973  C CG    . LEU A 1 285 ? -19.837 -0.649  -58.719  1.00 23.51 ? 263  LEU A CG    1 
ATOM   1974  C CD1   . LEU A 1 285 ? -20.996 0.381   -58.737  1.00 22.63 ? 263  LEU A CD1   1 
ATOM   1975  C CD2   . LEU A 1 285 ? -18.871 -0.358  -59.865  1.00 14.80 ? 263  LEU A CD2   1 
ATOM   1976  N N     . LYS A 1 286 ? -17.272 -1.216  -55.034  1.00 19.24 ? 264  LYS A N     1 
ATOM   1977  C CA    . LYS A 1 286 ? -16.520 -0.697  -53.913  1.00 21.20 ? 264  LYS A CA    1 
ATOM   1978  C C     . LYS A 1 286 ? -15.681 0.457   -54.431  1.00 21.45 ? 264  LYS A C     1 
ATOM   1979  O O     . LYS A 1 286 ? -15.201 0.412   -55.552  1.00 22.51 ? 264  LYS A O     1 
ATOM   1980  C CB    . LYS A 1 286 ? -15.630 -1.801  -53.334  1.00 21.20 ? 264  LYS A CB    1 
ATOM   1981  C CG    . LYS A 1 286 ? -16.319 -2.791  -52.394  1.00 23.60 ? 264  LYS A CG    1 
ATOM   1982  C CD    . LYS A 1 286 ? -16.211 -2.364  -50.918  1.00 28.58 ? 264  LYS A CD    1 
ATOM   1983  C CE    . LYS A 1 286 ? -15.941 -3.546  -49.991  1.00 28.11 ? 264  LYS A CE    1 
ATOM   1984  N NZ    . LYS A 1 286 ? -17.141 -4.377  -49.741  1.00 25.19 ? 264  LYS A NZ    1 
ATOM   1985  N N     . LEU A 1 287 ? -15.492 1.482   -53.609  1.00 21.69 ? 265  LEU A N     1 
ATOM   1986  C CA    . LEU A 1 287 ? -14.679 2.644   -54.002  1.00 21.27 ? 265  LEU A CA    1 
ATOM   1987  C C     . LEU A 1 287 ? -13.193 2.383   -53.814  1.00 20.54 ? 265  LEU A C     1 
ATOM   1988  O O     . LEU A 1 287 ? -12.781 1.842   -52.805  1.00 22.90 ? 265  LEU A O     1 
ATOM   1989  C CB    . LEU A 1 287 ? -15.092 3.864   -53.182  1.00 21.58 ? 265  LEU A CB    1 
ATOM   1990  C CG    . LEU A 1 287 ? -14.654 5.251   -53.645  1.00 19.30 ? 265  LEU A CG    1 
ATOM   1991  C CD1   . LEU A 1 287 ? -15.414 5.692   -54.872  1.00 14.99 ? 265  LEU A CD1   1 
ATOM   1992  C CD2   . LEU A 1 287 ? -14.799 6.226   -52.518  1.00 18.40 ? 265  LEU A CD2   1 
ATOM   1993  N N     . PHE A 1 288 ? -12.390 2.758   -54.792  1.00 19.75 ? 266  PHE A N     1 
ATOM   1994  C CA    . PHE A 1 288 ? -10.935 2.555   -54.737  1.00 18.98 ? 266  PHE A CA    1 
ATOM   1995  C C     . PHE A 1 288 ? -10.288 3.864   -55.156  1.00 19.64 ? 266  PHE A C     1 
ATOM   1996  O O     . PHE A 1 288 ? -10.612 4.403   -56.214  1.00 19.13 ? 266  PHE A O     1 
ATOM   1997  C CB    . PHE A 1 288 ? -10.516 1.417   -55.667  1.00 18.81 ? 266  PHE A CB    1 
ATOM   1998  C CG    . PHE A 1 288 ? -9.038  1.103   -55.661  1.00 12.58 ? 266  PHE A CG    1 
ATOM   1999  C CD1   . PHE A 1 288 ? -8.314  1.149   -56.845  1.00 11.45 ? 266  PHE A CD1   1 
ATOM   2000  C CD2   . PHE A 1 288 ? -8.394  0.720   -54.487  1.00 8.37  ? 266  PHE A CD2   1 
ATOM   2001  C CE1   . PHE A 1 288 ? -6.924  0.850   -56.878  1.00 11.75 ? 266  PHE A CE1   1 
ATOM   2002  C CE2   . PHE A 1 288 ? -7.026  0.417   -54.485  1.00 15.27 ? 266  PHE A CE2   1 
ATOM   2003  C CZ    . PHE A 1 288 ? -6.278  0.475   -55.703  1.00 14.59 ? 266  PHE A CZ    1 
ATOM   2004  N N     . TYR A 1 289 ? -9.406  4.395   -54.313  1.00 20.56 ? 267  TYR A N     1 
ATOM   2005  C CA    . TYR A 1 289 ? -8.833  5.709   -54.569  1.00 21.99 ? 267  TYR A CA    1 
ATOM   2006  C C     . TYR A 1 289 ? -7.331  5.840   -54.317  1.00 22.96 ? 267  TYR A C     1 
ATOM   2007  O O     . TYR A 1 289 ? -6.731  5.137   -53.487  1.00 23.32 ? 267  TYR A O     1 
ATOM   2008  C CB    . TYR A 1 289 ? -9.565  6.765   -53.793  1.00 20.97 ? 267  TYR A CB    1 
ATOM   2009  C CG    . TYR A 1 289 ? -9.689  6.463   -52.342  1.00 21.63 ? 267  TYR A CG    1 
ATOM   2010  C CD1   . TYR A 1 289 ? -10.724 5.651   -51.864  1.00 16.70 ? 267  TYR A CD1   1 
ATOM   2011  C CD2   . TYR A 1 289 ? -8.789  7.008   -51.431  1.00 22.66 ? 267  TYR A CD2   1 
ATOM   2012  C CE1   . TYR A 1 289 ? -10.847 5.392   -50.523  1.00 19.98 ? 267  TYR A CE1   1 
ATOM   2013  C CE2   . TYR A 1 289 ? -8.903  6.746   -50.078  1.00 25.07 ? 267  TYR A CE2   1 
ATOM   2014  C CZ    . TYR A 1 289 ? -9.939  5.940   -49.626  1.00 24.46 ? 267  TYR A CZ    1 
ATOM   2015  O OH    . TYR A 1 289 ? -10.029 5.673   -48.276  1.00 23.36 ? 267  TYR A OH    1 
ATOM   2016  N N     . GLY A 1 290 ? -6.733  6.749   -55.079  1.00 22.73 ? 268  GLY A N     1 
ATOM   2017  C CA    . GLY A 1 290 ? -5.305  7.060   -54.970  1.00 22.44 ? 268  GLY A CA    1 
ATOM   2018  C C     . GLY A 1 290 ? -4.901  7.507   -53.578  1.00 22.09 ? 268  GLY A C     1 
ATOM   2019  O O     . GLY A 1 290 ? -5.694  8.121   -52.835  1.00 22.91 ? 268  GLY A O     1 
ATOM   2020  N N     . MET A 1 291 ? -3.673  7.164   -53.216  1.00 20.93 ? 269  MET A N     1 
ATOM   2021  C CA    . MET A 1 291 ? -3.085  7.552   -51.949  1.00 20.37 ? 269  MET A CA    1 
ATOM   2022  C C     . MET A 1 291 ? -2.975  9.082   -51.818  1.00 20.87 ? 269  MET A C     1 
ATOM   2023  O O     . MET A 1 291 ? -3.043  9.614   -50.705  1.00 21.27 ? 269  MET A O     1 
ATOM   2024  C CB    . MET A 1 291 ? -1.709  6.896   -51.810  1.00 20.91 ? 269  MET A CB    1 
ATOM   2025  C CG    . MET A 1 291 ? -1.769  5.432   -51.385  1.00 20.97 ? 269  MET A CG    1 
ATOM   2026  S SD    . MET A 1 291 ? -0.305  4.471   -51.883  1.00 20.61 ? 269  MET A SD    1 
ATOM   2027  C CE    . MET A 1 291 ? 1.055   5.133   -50.898  1.00 18.73 ? 269  MET A CE    1 
ATOM   2028  N N     . SER A 1 292 ? -2.795  9.775   -52.941  1.00 20.36 ? 270  SER A N     1 
ATOM   2029  C CA    . SER A 1 292 ? -2.743  11.237  -52.971  1.00 19.34 ? 270  SER A CA    1 
ATOM   2030  C C     . SER A 1 292 ? -3.939  11.801  -53.740  1.00 19.06 ? 270  SER A C     1 
ATOM   2031  O O     . SER A 1 292 ? -3.899  12.933  -54.224  1.00 19.14 ? 270  SER A O     1 
ATOM   2032  C CB    . SER A 1 292 ? -1.422  11.728  -53.610  1.00 20.79 ? 270  SER A CB    1 
ATOM   2033  O OG    . SER A 1 292 ? -0.275  11.303  -52.885  1.00 14.31 ? 270  SER A OG    1 
ATOM   2034  N N     . SER A 1 293 ? -5.022  11.034  -53.798  1.00 18.25 ? 271  SER A N     1 
ATOM   2035  C CA    . SER A 1 293 ? -6.237  11.454  -54.486  1.00 18.48 ? 271  SER A CA    1 
ATOM   2036  C C     . SER A 1 293 ? -6.906  12.590  -53.738  1.00 17.87 ? 271  SER A C     1 
ATOM   2037  O O     . SER A 1 293 ? -6.576  12.863  -52.603  1.00 16.33 ? 271  SER A O     1 
ATOM   2038  C CB    . SER A 1 293 ? -7.231  10.287  -54.611  1.00 18.56 ? 271  SER A CB    1 
ATOM   2039  O OG    . SER A 1 293 ? -7.552  9.775   -53.326  1.00 16.77 ? 271  SER A OG    1 
ATOM   2040  N N     . ASP A 1 294 ? -7.850  13.241  -54.396  1.00 20.25 ? 272  ASP A N     1 
ATOM   2041  C CA    . ASP A 1 294 ? -8.775  14.196  -53.719  1.00 23.17 ? 272  ASP A CA    1 
ATOM   2042  C C     . ASP A 1 294 ? -9.554  13.546  -52.572  1.00 20.96 ? 272  ASP A C     1 
ATOM   2043  O O     . ASP A 1 294 ? -9.759  14.174  -51.544  1.00 21.12 ? 272  ASP A O     1 
ATOM   2044  C CB    . ASP A 1 294 ? -9.776  14.839  -54.706  1.00 23.25 ? 272  ASP A CB    1 
ATOM   2045  C CG    . ASP A 1 294 ? -9.122  15.909  -55.613  1.00 32.42 ? 272  ASP A CG    1 
ATOM   2046  O OD1   . ASP A 1 294 ? -7.877  16.100  -55.540  1.00 37.50 ? 272  ASP A OD1   1 
ATOM   2047  O OD2   . ASP A 1 294 ? -9.869  16.558  -56.404  1.00 43.37 ? 272  ASP A OD2   1 
ATOM   2048  N N     . THR A 1 295 ? -9.980  12.298  -52.785  1.00 20.24 ? 273  THR A N     1 
ATOM   2049  C CA    . THR A 1 295 ? -10.676 11.489  -51.786  1.00 20.10 ? 273  THR A CA    1 
ATOM   2050  C C     . THR A 1 295 ? -9.827  11.314  -50.534  1.00 20.18 ? 273  THR A C     1 
ATOM   2051  O O     . THR A 1 295 ? -10.285 11.487  -49.419  1.00 18.73 ? 273  THR A O     1 
ATOM   2052  C CB    . THR A 1 295 ? -11.007 10.071  -52.359  1.00 20.74 ? 273  THR A CB    1 
ATOM   2053  O OG1   . THR A 1 295 ? -11.931 10.208  -53.444  1.00 20.80 ? 273  THR A OG1   1 
ATOM   2054  C CG2   . THR A 1 295 ? -11.620 9.141   -51.301  1.00 18.35 ? 273  THR A CG2   1 
ATOM   2055  N N     . ALA A 1 296 ? -8.581  10.954  -50.729  1.00 22.47 ? 274  ALA A N     1 
ATOM   2056  C CA    . ALA A 1 296 ? -7.668  10.796  -49.618  1.00 24.51 ? 274  ALA A CA    1 
ATOM   2057  C C     . ALA A 1 296 ? -7.423  12.149  -48.938  1.00 25.92 ? 274  ALA A C     1 
ATOM   2058  O O     . ALA A 1 296 ? -7.391  12.241  -47.715  1.00 26.28 ? 274  ALA A O     1 
ATOM   2059  C CB    . ALA A 1 296 ? -6.331  10.177  -50.109  1.00 24.89 ? 274  ALA A CB    1 
ATOM   2060  N N     . MET A 1 297 ? -7.239  13.194  -49.738  1.00 27.60 ? 275  MET A N     1 
ATOM   2061  C CA    . MET A 1 297 ? -7.004  14.535  -49.205  1.00 30.29 ? 275  MET A CA    1 
ATOM   2062  C C     . MET A 1 297 ? -8.145  14.975  -48.297  1.00 28.28 ? 275  MET A C     1 
ATOM   2063  O O     . MET A 1 297 ? -7.902  15.516  -47.230  1.00 28.83 ? 275  MET A O     1 
ATOM   2064  C CB    . MET A 1 297 ? -6.818  15.557  -50.336  1.00 32.66 ? 275  MET A CB    1 
ATOM   2065  C CG    . MET A 1 297 ? -5.947  16.761  -49.956  1.00 39.59 ? 275  MET A CG    1 
ATOM   2066  S SD    . MET A 1 297 ? -4.161  16.425  -50.079  1.00 51.96 ? 275  MET A SD    1 
ATOM   2067  C CE    . MET A 1 297 ? -3.517  18.083  -49.856  1.00 49.74 ? 275  MET A CE    1 
ATOM   2068  N N     . ASN A 1 298 ? -9.378  14.731  -48.716  1.00 27.90 ? 276  ASN A N     1 
ATOM   2069  C CA    . ASN A 1 298 ? -10.547 15.093  -47.895  1.00 28.89 ? 276  ASN A CA    1 
ATOM   2070  C C     . ASN A 1 298 ? -10.698 14.214  -46.670  1.00 28.38 ? 276  ASN A C     1 
ATOM   2071  O O     . ASN A 1 298 ? -11.097 14.668  -45.615  1.00 27.78 ? 276  ASN A O     1 
ATOM   2072  C CB    . ASN A 1 298 ? -11.858 15.036  -48.701  1.00 30.00 ? 276  ASN A CB    1 
ATOM   2073  C CG    . ASN A 1 298 ? -11.912 16.077  -49.806  1.00 32.70 ? 276  ASN A CG    1 
ATOM   2074  O OD1   . ASN A 1 298 ? -11.498 17.223  -49.611  1.00 31.46 ? 276  ASN A OD1   1 
ATOM   2075  N ND2   . ASN A 1 298 ? -12.416 15.681  -50.979  1.00 34.16 ? 276  ASN A ND2   1 
ATOM   2076  N N     . LYS A 1 299 ? -10.396 12.936  -46.828  1.00 29.68 ? 277  LYS A N     1 
ATOM   2077  C CA    . LYS A 1 299 ? -10.511 11.965  -45.734  1.00 29.65 ? 277  LYS A CA    1 
ATOM   2078  C C     . LYS A 1 299 ? -9.391  12.139  -44.672  1.00 29.94 ? 277  LYS A C     1 
ATOM   2079  O O     . LYS A 1 299 ? -9.599  11.900  -43.477  1.00 28.26 ? 277  LYS A O     1 
ATOM   2080  C CB    . LYS A 1 299 ? -10.512 10.532  -46.294  1.00 28.62 ? 277  LYS A CB    1 
ATOM   2081  C CG    . LYS A 1 299 ? -10.973 9.488   -45.311  1.00 29.08 ? 277  LYS A CG    1 
ATOM   2082  C CD    . LYS A 1 299 ? -10.864 8.069   -45.859  1.00 35.58 ? 277  LYS A CD    1 
ATOM   2083  C CE    . LYS A 1 299 ? -11.717 7.849   -47.110  1.00 41.03 ? 277  LYS A CE    1 
ATOM   2084  N NZ    . LYS A 1 299 ? -12.121 6.405   -47.234  1.00 42.44 ? 277  LYS A NZ    1 
ATOM   2085  N N     . HIS A 1 300 ? -8.204  12.553  -45.121  1.00 30.62 ? 278  HIS A N     1 
ATOM   2086  C CA    . HIS A 1 300 ? -7.052  12.733  -44.238  1.00 30.36 ? 278  HIS A CA    1 
ATOM   2087  C C     . HIS A 1 300 ? -6.459  14.152  -44.372  1.00 30.32 ? 278  HIS A C     1 
ATOM   2088  O O     . HIS A 1 300 ? -6.724  15.039  -43.554  1.00 30.43 ? 278  HIS A O     1 
ATOM   2089  C CB    . HIS A 1 300 ? -5.963  11.680  -44.558  1.00 30.73 ? 278  HIS A CB    1 
ATOM   2090  C CG    . HIS A 1 300 ? -6.480  10.292  -44.852  1.00 29.91 ? 278  HIS A CG    1 
ATOM   2091  N ND1   . HIS A 1 300 ? -7.048  9.477   -43.893  1.00 27.13 ? 278  HIS A ND1   1 
ATOM   2092  C CD2   . HIS A 1 300 ? -6.455  9.559   -45.996  1.00 27.02 ? 278  HIS A CD2   1 
ATOM   2093  C CE1   . HIS A 1 300 ? -7.383  8.322   -44.443  1.00 28.03 ? 278  HIS A CE1   1 
ATOM   2094  N NE2   . HIS A 1 300 ? -7.027  8.343   -45.716  1.00 21.19 ? 278  HIS A NE2   1 
ATOM   2095  N N     . GLY A 1 303 ? -2.598  15.331  -45.051  1.00 37.62 ? 281  GLY A N     1 
ATOM   2096  C CA    . GLY A 1 303 ? -1.209  14.828  -45.057  1.00 38.03 ? 281  GLY A CA    1 
ATOM   2097  C C     . GLY A 1 303 ? -0.917  13.745  -46.099  1.00 38.10 ? 281  GLY A C     1 
ATOM   2098  O O     . GLY A 1 303 ? -0.319  12.695  -45.785  1.00 35.25 ? 281  GLY A O     1 
ATOM   2099  N N     . VAL A 1 304 ? -1.362  13.991  -47.333  1.00 37.68 ? 282  VAL A N     1 
ATOM   2100  C CA    . VAL A 1 304 ? -1.095  13.096  -48.459  1.00 38.37 ? 282  VAL A CA    1 
ATOM   2101  C C     . VAL A 1 304 ? -0.681  13.853  -49.701  1.00 39.36 ? 282  VAL A C     1 
ATOM   2102  O O     . VAL A 1 304 ? -0.468  13.259  -50.758  1.00 40.98 ? 282  VAL A O     1 
ATOM   2103  C CB    . VAL A 1 304 ? -2.313  12.226  -48.807  1.00 40.09 ? 282  VAL A CB    1 
ATOM   2104  C CG1   . VAL A 1 304 ? -2.507  11.146  -47.745  1.00 44.50 ? 282  VAL A CG1   1 
ATOM   2105  C CG2   . VAL A 1 304 ? -3.598  13.063  -48.998  1.00 40.11 ? 282  VAL A CG2   1 
ATOM   2106  N N     . ALA A 1 305 ? -0.493  15.157  -49.542  1.00 39.68 ? 283  ALA A N     1 
ATOM   2107  C CA    . ALA A 1 305 ? -0.345  16.089  -50.654  1.00 39.32 ? 283  ALA A CA    1 
ATOM   2108  C C     . ALA A 1 305 ? 0.699   15.612  -51.664  1.00 38.46 ? 283  ALA A C     1 
ATOM   2109  O O     . ALA A 1 305 ? 0.387   15.443  -52.852  1.00 39.22 ? 283  ALA A O     1 
ATOM   2110  C CB    . ALA A 1 305 ? 0.005   17.471  -50.137  1.00 39.71 ? 283  ALA A CB    1 
ATOM   2111  N N     . GLU A 1 306 ? 1.921   15.381  -51.200  1.00 35.23 ? 284  GLU A N     1 
ATOM   2112  C CA    . GLU A 1 306 ? 2.960   14.908  -52.087  1.00 33.06 ? 284  GLU A CA    1 
ATOM   2113  C C     . GLU A 1 306 ? 3.545   13.593  -51.543  1.00 30.89 ? 284  GLU A C     1 
ATOM   2114  O O     . GLU A 1 306 ? 4.754   13.398  -51.457  1.00 29.25 ? 284  GLU A O     1 
ATOM   2115  C CB    . GLU A 1 306 ? 3.994   16.016  -52.272  1.00 34.60 ? 284  GLU A CB    1 
ATOM   2116  N N     . TYR A 1 307 ? 2.634   12.695  -51.183  1.00 28.91 ? 285  TYR A N     1 
ATOM   2117  C CA    . TYR A 1 307 ? 2.969   11.358  -50.704  1.00 26.96 ? 285  TYR A CA    1 
ATOM   2118  C C     . TYR A 1 307 ? 3.381   10.505  -51.917  1.00 24.83 ? 285  TYR A C     1 
ATOM   2119  O O     . TYR A 1 307 ? 4.343   9.755   -51.859  1.00 22.07 ? 285  TYR A O     1 
ATOM   2120  C CB    . TYR A 1 307 ? 1.743   10.815  -49.953  1.00 24.63 ? 285  TYR A CB    1 
ATOM   2121  C CG    . TYR A 1 307 ? 1.844   9.494   -49.222  1.00 25.82 ? 285  TYR A CG    1 
ATOM   2122  C CD1   . TYR A 1 307 ? 3.040   9.015   -48.685  1.00 25.95 ? 285  TYR A CD1   1 
ATOM   2123  C CD2   . TYR A 1 307 ? 0.699   8.743   -49.022  1.00 24.10 ? 285  TYR A CD2   1 
ATOM   2124  C CE1   . TYR A 1 307 ? 3.077   7.784   -47.982  1.00 29.22 ? 285  TYR A CE1   1 
ATOM   2125  C CE2   . TYR A 1 307 ? 0.715   7.545   -48.342  1.00 27.41 ? 285  TYR A CE2   1 
ATOM   2126  C CZ    . TYR A 1 307 ? 1.889   7.046   -47.822  1.00 29.67 ? 285  TYR A CZ    1 
ATOM   2127  O OH    . TYR A 1 307 ? 1.812   5.820   -47.158  1.00 17.79 ? 285  TYR A OH    1 
ATOM   2128  N N     . ARG A 1 308 ? 2.636   10.648  -53.006  1.00 23.88 ? 286  ARG A N     1 
ATOM   2129  C CA    . ARG A 1 308 ? 2.894   9.937   -54.253  1.00 22.63 ? 286  ARG A CA    1 
ATOM   2130  C C     . ARG A 1 308 ? 3.082   10.962  -55.360  1.00 21.10 ? 286  ARG A C     1 
ATOM   2131  O O     . ARG A 1 308 ? 2.702   12.140  -55.209  1.00 21.42 ? 286  ARG A O     1 
ATOM   2132  C CB    . ARG A 1 308 ? 1.732   8.978   -54.590  1.00 23.92 ? 286  ARG A CB    1 
ATOM   2133  C CG    . ARG A 1 308 ? 1.414   7.875   -53.566  1.00 18.23 ? 286  ARG A CG    1 
ATOM   2134  C CD    . ARG A 1 308 ? 2.326   6.643   -53.772  1.00 18.44 ? 286  ARG A CD    1 
ATOM   2135  N NE    . ARG A 1 308 ? 3.715   6.959   -53.429  1.00 21.00 ? 286  ARG A NE    1 
ATOM   2136  C CZ    . ARG A 1 308 ? 4.787   6.249   -53.788  1.00 19.04 ? 286  ARG A CZ    1 
ATOM   2137  N NH1   . ARG A 1 308 ? 4.646   5.148   -54.496  1.00 19.40 ? 286  ARG A NH1   1 
ATOM   2138  N NH2   . ARG A 1 308 ? 6.000   6.642   -53.417  1.00 10.65 ? 286  ARG A NH2   1 
ATOM   2139  N N     . ALA A 1 309 ? 3.616   10.502  -56.480  1.00 19.59 ? 287  ALA A N     1 
ATOM   2140  C CA    . ALA A 1 309 ? 4.006   11.389  -57.576  1.00 20.20 ? 287  ALA A CA    1 
ATOM   2141  C C     . ALA A 1 309 ? 2.862   12.152  -58.267  1.00 19.96 ? 287  ALA A C     1 
ATOM   2142  O O     . ALA A 1 309 ? 3.078   13.192  -58.865  1.00 19.10 ? 287  ALA A O     1 
ATOM   2143  C CB    . ALA A 1 309 ? 4.847   10.614  -58.614  1.00 20.22 ? 287  ALA A CB    1 
ATOM   2144  N N     . SER A 1 310 ? 1.652   11.640  -58.161  1.00 20.22 ? 288  SER A N     1 
ATOM   2145  C CA    . SER A 1 310 ? 0.497   12.238  -58.819  1.00 20.47 ? 288  SER A CA    1 
ATOM   2146  C C     . SER A 1 310 ? -0.678  12.193  -57.860  1.00 20.38 ? 288  SER A C     1 
ATOM   2147  O O     . SER A 1 310 ? -0.718  11.348  -56.966  1.00 20.62 ? 288  SER A O     1 
ATOM   2148  C CB    . SER A 1 310 ? 0.164   11.478  -60.120  1.00 21.44 ? 288  SER A CB    1 
ATOM   2149  O OG    . SER A 1 310 ? -0.389  10.193  -59.863  1.00 19.35 ? 288  SER A OG    1 
ATOM   2150  N N     . GLU A 1 311 ? -1.616  13.117  -58.047  1.00 22.53 ? 289  GLU A N     1 
ATOM   2151  C CA    . GLU A 1 311 ? -2.889  13.086  -57.339  1.00 23.10 ? 289  GLU A CA    1 
ATOM   2152  C C     . GLU A 1 311 ? -3.684  12.016  -58.062  1.00 23.02 ? 289  GLU A C     1 
ATOM   2153  O O     . GLU A 1 311 ? -3.960  12.140  -59.257  1.00 24.04 ? 289  GLU A O     1 
ATOM   2154  C CB    . GLU A 1 311 ? -3.600  14.433  -57.388  1.00 23.30 ? 289  GLU A CB    1 
ATOM   2155  C CG    . GLU A 1 311 ? -2.798  15.578  -56.740  1.00 26.69 ? 289  GLU A CG    1 
ATOM   2156  C CD    . GLU A 1 311 ? -3.240  16.989  -57.184  1.00 32.05 ? 289  GLU A CD    1 
ATOM   2157  O OE1   . GLU A 1 311 ? -4.118  17.106  -58.075  1.00 27.03 ? 289  GLU A OE1   1 
ATOM   2158  O OE2   . GLU A 1 311 ? -2.689  17.987  -56.637  1.00 38.68 ? 289  GLU A OE2   1 
ATOM   2159  N N     . GLY A 1 312 ? -3.976  10.936  -57.358  1.00 22.06 ? 290  GLY A N     1 
ATOM   2160  C CA    . GLY A 1 312 ? -4.477  9.746   -57.990  1.00 21.80 ? 290  GLY A CA    1 
ATOM   2161  C C     . GLY A 1 312 ? -5.957  9.778   -58.248  1.00 21.88 ? 290  GLY A C     1 
ATOM   2162  O O     . GLY A 1 312 ? -6.659  10.638  -57.738  1.00 22.08 ? 290  GLY A O     1 
ATOM   2163  N N     . LYS A 1 313 ? -6.412  8.826   -59.055  1.00 22.56 ? 291  LYS A N     1 
ATOM   2164  C CA    . LYS A 1 313 ? -7.813  8.689   -59.425  1.00 23.42 ? 291  LYS A CA    1 
ATOM   2165  C C     . LYS A 1 313 ? -8.663  8.212   -58.230  1.00 21.80 ? 291  LYS A C     1 
ATOM   2166  O O     . LYS A 1 313 ? -8.165  7.641   -57.276  1.00 22.00 ? 291  LYS A O     1 
ATOM   2167  C CB    . LYS A 1 313 ? -7.952  7.661   -60.587  1.00 24.63 ? 291  LYS A CB    1 
ATOM   2168  C CG    . LYS A 1 313 ? -7.558  8.140   -61.991  1.00 25.26 ? 291  LYS A CG    1 
ATOM   2169  C CD    . LYS A 1 313 ? -7.780  7.046   -63.060  1.00 23.60 ? 291  LYS A CD    1 
ATOM   2170  N N     . THR A 1 314 ? -9.954  8.464   -58.302  1.00 21.74 ? 292  THR A N     1 
ATOM   2171  C CA    . THR A 1 314 ? -10.932 7.757   -57.474  1.00 22.18 ? 292  THR A CA    1 
ATOM   2172  C C     . THR A 1 314 ? -11.822 6.967   -58.432  1.00 22.21 ? 292  THR A C     1 
ATOM   2173  O O     . THR A 1 314 ? -12.456 7.551   -59.301  1.00 20.97 ? 292  THR A O     1 
ATOM   2174  C CB    . THR A 1 314 ? -11.803 8.710   -56.634  1.00 21.20 ? 292  THR A CB    1 
ATOM   2175  O OG1   . THR A 1 314 ? -10.973 9.514   -55.782  1.00 21.76 ? 292  THR A OG1   1 
ATOM   2176  C CG2   . THR A 1 314 ? -12.803 7.902   -55.774  1.00 21.52 ? 292  THR A CG2   1 
ATOM   2177  N N     . VAL A 1 315 ? -11.857 5.645   -58.280  1.00 23.15 ? 293  VAL A N     1 
ATOM   2178  C CA    . VAL A 1 315 ? -12.686 4.794   -59.143  1.00 23.44 ? 293  VAL A CA    1 
ATOM   2179  C C     . VAL A 1 315 ? -13.688 3.949   -58.345  1.00 23.04 ? 293  VAL A C     1 
ATOM   2180  O O     . VAL A 1 315 ? -13.456 3.632   -57.184  1.00 23.01 ? 293  VAL A O     1 
ATOM   2181  C CB    . VAL A 1 315 ? -11.789 3.868   -60.011  1.00 23.03 ? 293  VAL A CB    1 
ATOM   2182  C CG1   . VAL A 1 315 ? -10.888 4.701   -60.907  1.00 22.94 ? 293  VAL A CG1   1 
ATOM   2183  C CG2   . VAL A 1 315 ? -10.950 2.973   -59.146  1.00 22.02 ? 293  VAL A CG2   1 
ATOM   2184  N N     . GLU A 1 316 ? -14.792 3.592   -58.979  1.00 22.67 ? 294  GLU A N     1 
ATOM   2185  C CA    . GLU A 1 316 ? -15.657 2.519   -58.484  1.00 23.60 ? 294  GLU A CA    1 
ATOM   2186  C C     . GLU A 1 316 ? -15.216 1.224   -59.194  1.00 24.49 ? 294  GLU A C     1 
ATOM   2187  O O     . GLU A 1 316 ? -15.201 1.128   -60.434  1.00 24.10 ? 294  GLU A O     1 
ATOM   2188  C CB    . GLU A 1 316 ? -17.127 2.829   -58.749  1.00 21.70 ? 294  GLU A CB    1 
ATOM   2189  C CG    . GLU A 1 316 ? -17.510 4.207   -58.272  1.00 23.14 ? 294  GLU A CG    1 
ATOM   2190  C CD    . GLU A 1 316 ? -18.970 4.526   -58.478  1.00 30.51 ? 294  GLU A CD    1 
ATOM   2191  O OE1   . GLU A 1 316 ? -19.433 4.482   -59.642  1.00 30.69 ? 294  GLU A OE1   1 
ATOM   2192  O OE2   . GLU A 1 316 ? -19.654 4.834   -57.472  1.00 26.48 ? 294  GLU A OE2   1 
ATOM   2193  N N     . VAL A 1 317 ? -14.822 0.235   -58.406  1.00 24.79 ? 295  VAL A N     1 
ATOM   2194  C CA    . VAL A 1 317 ? -14.422 -1.042  -58.969  1.00 24.90 ? 295  VAL A CA    1 
ATOM   2195  C C     . VAL A 1 317 ? -15.537 -2.064  -58.664  1.00 24.94 ? 295  VAL A C     1 
ATOM   2196  O O     . VAL A 1 317 ? -16.133 -2.024  -57.595  1.00 23.81 ? 295  VAL A O     1 
ATOM   2197  C CB    . VAL A 1 317 ? -12.985 -1.472  -58.508  1.00 24.45 ? 295  VAL A CB    1 
ATOM   2198  C CG1   . VAL A 1 317 ? -12.562 -0.751  -57.269  1.00 24.90 ? 295  VAL A CG1   1 
ATOM   2199  C CG2   . VAL A 1 317 ? -12.855 -3.009  -58.309  1.00 24.34 ? 295  VAL A CG2   1 
ATOM   2200  N N     . PRO A 1 318 ? -15.852 -2.939  -59.638  1.00 25.99 ? 296  PRO A N     1 
ATOM   2201  C CA    . PRO A 1 318 ? -16.752 -4.074  -59.431  1.00 26.25 ? 296  PRO A CA    1 
ATOM   2202  C C     . PRO A 1 318 ? -16.454 -4.879  -58.175  1.00 25.53 ? 296  PRO A C     1 
ATOM   2203  O O     . PRO A 1 318 ? -15.291 -5.199  -57.930  1.00 25.14 ? 296  PRO A O     1 
ATOM   2204  C CB    . PRO A 1 318 ? -16.500 -4.930  -60.684  1.00 26.28 ? 296  PRO A CB    1 
ATOM   2205  C CG    . PRO A 1 318 ? -16.135 -3.972  -61.737  1.00 24.35 ? 296  PRO A CG    1 
ATOM   2206  C CD    . PRO A 1 318 ? -15.408 -2.848  -61.048  1.00 25.89 ? 296  PRO A CD    1 
ATOM   2207  N N     . TYR A 1 319 ? -17.497 -5.167  -57.394  1.00 25.24 ? 297  TYR A N     1 
ATOM   2208  C CA    . TYR A 1 319 ? -17.399 -5.967  -56.186  1.00 25.74 ? 297  TYR A CA    1 
ATOM   2209  C C     . TYR A 1 319 ? -16.951 -7.372  -56.560  1.00 26.27 ? 297  TYR A C     1 
ATOM   2210  O O     . TYR A 1 319 ? -17.651 -8.063  -57.280  1.00 26.48 ? 297  TYR A O     1 
ATOM   2211  C CB    . TYR A 1 319 ? -18.778 -6.006  -55.505  1.00 24.89 ? 297  TYR A CB    1 
ATOM   2212  C CG    . TYR A 1 319 ? -18.865 -6.906  -54.295  1.00 24.67 ? 297  TYR A CG    1 
ATOM   2213  C CD1   . TYR A 1 319 ? -18.058 -6.676  -53.184  1.00 24.82 ? 297  TYR A CD1   1 
ATOM   2214  C CD2   . TYR A 1 319 ? -19.768 -7.977  -54.250  1.00 24.13 ? 297  TYR A CD2   1 
ATOM   2215  C CE1   . TYR A 1 319 ? -18.139 -7.486  -52.056  1.00 28.51 ? 297  TYR A CE1   1 
ATOM   2216  C CE2   . TYR A 1 319 ? -19.853 -8.804  -53.124  1.00 25.12 ? 297  TYR A CE2   1 
ATOM   2217  C CZ    . TYR A 1 319 ? -19.034 -8.548  -52.025  1.00 27.68 ? 297  TYR A CZ    1 
ATOM   2218  O OH    . TYR A 1 319 ? -19.092 -9.349  -50.897  1.00 28.34 ? 297  TYR A OH    1 
ATOM   2219  N N     . LYS A 1 320 ? -15.786 -7.787  -56.080  1.00 26.17 ? 298  LYS A N     1 
ATOM   2220  C CA    . LYS A 1 320 ? -15.221 -9.078  -56.464  1.00 25.67 ? 298  LYS A CA    1 
ATOM   2221  C C     . LYS A 1 320 ? -15.561 -10.223 -55.491  1.00 24.79 ? 298  LYS A C     1 
ATOM   2222  O O     . LYS A 1 320 ? -15.349 -11.392 -55.813  1.00 25.28 ? 298  LYS A O     1 
ATOM   2223  C CB    . LYS A 1 320 ? -13.709 -8.910  -56.640  1.00 25.59 ? 298  LYS A CB    1 
ATOM   2224  C CG    . LYS A 1 320 ? -13.367 -7.694  -57.491  1.00 25.68 ? 298  LYS A CG    1 
ATOM   2225  C CD    . LYS A 1 320 ? -12.168 -7.905  -58.404  1.00 26.27 ? 298  LYS A CD    1 
ATOM   2226  C CE    . LYS A 1 320 ? -10.922 -7.193  -57.924  1.00 28.16 ? 298  LYS A CE    1 
ATOM   2227  N NZ    . LYS A 1 320 ? -11.043 -5.720  -58.054  1.00 27.31 ? 298  LYS A NZ    1 
ATOM   2228  N N     . GLY A 1 321 ? -16.065 -9.891  -54.305  1.00 23.38 ? 299  GLY A N     1 
ATOM   2229  C CA    . GLY A 1 321 ? -16.349 -10.905 -53.286  1.00 21.90 ? 299  GLY A CA    1 
ATOM   2230  C C     . GLY A 1 321 ? -15.154 -11.083 -52.394  1.00 20.90 ? 299  GLY A C     1 
ATOM   2231  O O     . GLY A 1 321 ? -14.356 -10.140 -52.236  1.00 20.01 ? 299  GLY A O     1 
ATOM   2232  N N     . ASP A 1 322 ? -15.023 -12.276 -51.810  1.00 19.80 ? 300  ASP A N     1 
ATOM   2233  C CA    . ASP A 1 322 ? -13.929 -12.547 -50.872  1.00 20.56 ? 300  ASP A CA    1 
ATOM   2234  C C     . ASP A 1 322 ? -12.566 -12.642 -51.587  1.00 18.42 ? 300  ASP A C     1 
ATOM   2235  O O     . ASP A 1 322 ? -12.477 -13.164 -52.676  1.00 17.75 ? 300  ASP A O     1 
ATOM   2236  C CB    . ASP A 1 322 ? -14.273 -13.775 -50.035  1.00 21.49 ? 300  ASP A CB    1 
ATOM   2237  C CG    . ASP A 1 322 ? -15.430 -13.479 -49.066  1.00 27.82 ? 300  ASP A CG    1 
ATOM   2238  O OD1   . ASP A 1 322 ? -15.142 -13.143 -47.884  1.00 32.48 ? 300  ASP A OD1   1 
ATOM   2239  O OD2   . ASP A 1 322 ? -16.614 -13.505 -49.512  1.00 24.46 ? 300  ASP A OD2   1 
ATOM   2240  N N     . VAL A 1 323 ? -11.527 -12.099 -50.966  1.00 17.81 ? 301  VAL A N     1 
ATOM   2241  C CA    . VAL A 1 323 ? -10.231 -12.009 -51.616  1.00 18.34 ? 301  VAL A CA    1 
ATOM   2242  C C     . VAL A 1 323 ? -9.549  -13.373 -51.750  1.00 18.96 ? 301  VAL A C     1 
ATOM   2243  O O     . VAL A 1 323 ? -8.651  -13.545 -52.563  1.00 19.74 ? 301  VAL A O     1 
ATOM   2244  C CB    . VAL A 1 323 ? -9.329  -11.002 -50.898  1.00 17.03 ? 301  VAL A CB    1 
ATOM   2245  C CG1   . VAL A 1 323 ? -8.719  -11.627 -49.650  1.00 20.19 ? 301  VAL A CG1   1 
ATOM   2246  C CG2   . VAL A 1 323 ? -8.292  -10.499 -51.830  1.00 16.06 ? 301  VAL A CG2   1 
ATOM   2247  N N     . GLU A 1 324 ? -9.961  -14.324 -50.920  1.00 20.51 ? 302  GLU A N     1 
ATOM   2248  C CA    . GLU A 1 324 ? -9.437  -15.674 -50.970  1.00 20.88 ? 302  GLU A CA    1 
ATOM   2249  C C     . GLU A 1 324 ? -9.314  -16.118 -52.423  1.00 20.14 ? 302  GLU A C     1 
ATOM   2250  O O     . GLU A 1 324 ? -8.259  -16.521 -52.913  1.00 17.88 ? 302  GLU A O     1 
ATOM   2251  C CB    . GLU A 1 324 ? -10.400 -16.603 -50.232  1.00 21.32 ? 302  GLU A CB    1 
ATOM   2252  C CG    . GLU A 1 324 ? -9.814  -17.936 -49.879  1.00 28.90 ? 302  GLU A CG    1 
ATOM   2253  C CD    . GLU A 1 324 ? -8.479  -17.774 -49.181  1.00 35.22 ? 302  GLU A CD    1 
ATOM   2254  O OE1   . GLU A 1 324 ? -8.387  -16.984 -48.206  1.00 34.99 ? 302  GLU A OE1   1 
ATOM   2255  O OE2   . GLU A 1 324 ? -7.519  -18.416 -49.639  1.00 41.26 ? 302  GLU A OE2   1 
ATOM   2256  N N     . ASN A 1 325 ? -10.436 -16.025 -53.114  1.00 20.47 ? 303  ASN A N     1 
ATOM   2257  C CA    . ASN A 1 325 ? -10.537 -16.494 -54.495  1.00 19.74 ? 303  ASN A CA    1 
ATOM   2258  C C     . ASN A 1 325 ? -9.551  -15.823 -55.415  1.00 18.09 ? 303  ASN A C     1 
ATOM   2259  O O     . ASN A 1 325 ? -8.954  -16.511 -56.249  1.00 17.85 ? 303  ASN A O     1 
ATOM   2260  C CB    . ASN A 1 325 ? -11.937 -16.261 -55.069  1.00 20.49 ? 303  ASN A CB    1 
ATOM   2261  C CG    . ASN A 1 325 ? -13.001 -17.059 -54.351  1.00 27.42 ? 303  ASN A CG    1 
ATOM   2262  O OD1   . ASN A 1 325 ? -12.703 -18.106 -53.770  1.00 33.35 ? 303  ASN A OD1   1 
ATOM   2263  N ND2   . ASN A 1 325 ? -14.254 -16.569 -54.378  1.00 27.37 ? 303  ASN A ND2   1 
ATOM   2264  N N     . THR A 1 326 ? -9.394  -14.494 -55.273  1.00 16.60 ? 304  THR A N     1 
ATOM   2265  C CA    . THR A 1 326 ? -8.384  -13.748 -56.059  1.00 15.51 ? 304  THR A CA    1 
ATOM   2266  C C     . THR A 1 326 ? -6.941  -14.202 -55.766  1.00 16.44 ? 304  THR A C     1 
ATOM   2267  O O     . THR A 1 326 ? -6.152  -14.356 -56.678  1.00 16.46 ? 304  THR A O     1 
ATOM   2268  C CB    . THR A 1 326 ? -8.452  -12.209 -55.895  1.00 15.92 ? 304  THR A CB    1 
ATOM   2269  O OG1   . THR A 1 326 ? -9.609  -11.711 -56.557  1.00 9.94  ? 304  THR A OG1   1 
ATOM   2270  C CG2   . THR A 1 326 ? -7.168  -11.513 -56.492  1.00 14.12 ? 304  THR A CG2   1 
ATOM   2271  N N     . ILE A 1 327 ? -6.615  -14.355 -54.493  1.00 17.57 ? 305  ILE A N     1 
ATOM   2272  C CA    . ILE A 1 327 ? -5.339  -14.869 -54.072  1.00 17.31 ? 305  ILE A CA    1 
ATOM   2273  C C     . ILE A 1 327 ? -5.042  -16.193 -54.765  1.00 18.37 ? 305  ILE A C     1 
ATOM   2274  O O     . ILE A 1 327 ? -3.948  -16.381 -55.350  1.00 19.19 ? 305  ILE A O     1 
ATOM   2275  C CB    . ILE A 1 327 ? -5.343  -15.086 -52.550  1.00 17.61 ? 305  ILE A CB    1 
ATOM   2276  C CG1   . ILE A 1 327 ? -5.258  -13.738 -51.816  1.00 16.73 ? 305  ILE A CG1   1 
ATOM   2277  C CG2   . ILE A 1 327 ? -4.232  -16.021 -52.140  1.00 15.69 ? 305  ILE A CG2   1 
ATOM   2278  C CD1   . ILE A 1 327 ? -5.761  -13.797 -50.380  1.00 11.62 ? 305  ILE A CD1   1 
ATOM   2279  N N     . LEU A 1 328 ? -5.998  -17.104 -54.703  1.00 18.00 ? 306  LEU A N     1 
ATOM   2280  C CA    . LEU A 1 328 ? -5.806  -18.434 -55.277  1.00 19.36 ? 306  LEU A CA    1 
ATOM   2281  C C     . LEU A 1 328 ? -5.577  -18.376 -56.788  1.00 19.73 ? 306  LEU A C     1 
ATOM   2282  O O     . LEU A 1 328 ? -4.805  -19.170 -57.340  1.00 19.07 ? 306  LEU A O     1 
ATOM   2283  C CB    . LEU A 1 328 ? -7.004  -19.360 -54.960  1.00 19.87 ? 306  LEU A CB    1 
ATOM   2284  C CG    . LEU A 1 328 ? -7.075  -19.789 -53.480  1.00 21.18 ? 306  LEU A CG    1 
ATOM   2285  C CD1   . LEU A 1 328 ? -8.326  -20.654 -53.174  1.00 19.62 ? 306  LEU A CD1   1 
ATOM   2286  C CD2   . LEU A 1 328 ? -5.757  -20.498 -53.054  1.00 19.04 ? 306  LEU A CD2   1 
ATOM   2287  N N     . ASP A 1 329 ? -6.253  -17.433 -57.451  1.00 20.31 ? 307  ASP A N     1 
ATOM   2288  C CA    . ASP A 1 329 ? -6.055  -17.218 -58.892  1.00 20.49 ? 307  ASP A CA    1 
ATOM   2289  C C     . ASP A 1 329 ? -4.652  -16.699 -59.168  1.00 18.84 ? 307  ASP A C     1 
ATOM   2290  O O     . ASP A 1 329 ? -4.004  -17.136 -60.114  1.00 19.18 ? 307  ASP A O     1 
ATOM   2291  C CB    . ASP A 1 329 ? -7.079  -16.229 -59.475  1.00 22.22 ? 307  ASP A CB    1 
ATOM   2292  C CG    . ASP A 1 329 ? -8.498  -16.818 -59.574  1.00 30.37 ? 307  ASP A CG    1 
ATOM   2293  O OD1   . ASP A 1 329 ? -8.667  -18.060 -59.455  1.00 39.82 ? 307  ASP A OD1   1 
ATOM   2294  O OD2   . ASP A 1 329 ? -9.461  -16.029 -59.775  1.00 38.85 ? 307  ASP A OD2   1 
ATOM   2295  N N     . ILE A 1 330 ? -4.176  -15.775 -58.339  1.00 17.69 ? 308  ILE A N     1 
ATOM   2296  C CA    . ILE A 1 330 ? -2.837  -15.168 -58.532  1.00 16.60 ? 308  ILE A CA    1 
ATOM   2297  C C     . ILE A 1 330 ? -1.729  -16.187 -58.345  1.00 16.27 ? 308  ILE A C     1 
ATOM   2298  O O     . ILE A 1 330 ? -0.869  -16.365 -59.212  1.00 16.56 ? 308  ILE A O     1 
ATOM   2299  C CB    . ILE A 1 330 ? -2.609  -13.987 -57.542  1.00 16.21 ? 308  ILE A CB    1 
ATOM   2300  C CG1   . ILE A 1 330 ? -3.598  -12.848 -57.855  1.00 17.41 ? 308  ILE A CG1   1 
ATOM   2301  C CG2   . ILE A 1 330 ? -1.156  -13.475 -57.589  1.00 16.80 ? 308  ILE A CG2   1 
ATOM   2302  C CD1   . ILE A 1 330 ? -3.340  -11.526 -57.095  1.00 17.10 ? 308  ILE A CD1   1 
ATOM   2303  N N     . LEU A 1 331 ? -1.762  -16.856 -57.198  1.00 16.96 ? 309  LEU A N     1 
ATOM   2304  C CA    . LEU A 1 331 ? -0.801  -17.905 -56.845  1.00 16.16 ? 309  LEU A CA    1 
ATOM   2305  C C     . LEU A 1 331 ? -0.886  -19.076 -57.810  1.00 15.40 ? 309  LEU A C     1 
ATOM   2306  O O     . LEU A 1 331 ? 0.121   -19.570 -58.285  1.00 15.66 ? 309  LEU A O     1 
ATOM   2307  C CB    . LEU A 1 331 ? -1.028  -18.385 -55.400  1.00 15.73 ? 309  LEU A CB    1 
ATOM   2308  C CG    . LEU A 1 331 ? -0.993  -17.287 -54.333  1.00 14.58 ? 309  LEU A CG    1 
ATOM   2309  C CD1   . LEU A 1 331 ? -1.228  -17.817 -52.936  1.00 10.70 ? 309  LEU A CD1   1 
ATOM   2310  C CD2   . LEU A 1 331 ? 0.349   -16.576 -54.392  1.00 12.34 ? 309  LEU A CD2   1 
ATOM   2311  N N     . GLY A 1 332 ? -2.089  -19.517 -58.115  1.00 14.67 ? 310  GLY A N     1 
ATOM   2312  C CA    . GLY A 1 332 ? -2.234  -20.597 -59.075  1.00 16.67 ? 310  GLY A CA    1 
ATOM   2313  C C     . GLY A 1 332 ? -1.629  -20.303 -60.439  1.00 17.80 ? 310  GLY A C     1 
ATOM   2314  O O     . GLY A 1 332 ? -0.938  -21.137 -61.014  1.00 19.07 ? 310  GLY A O     1 
ATOM   2315  N N     . GLY A 1 333 ? -1.905  -19.113 -60.956  1.00 18.43 ? 311  GLY A N     1 
ATOM   2316  C CA    . GLY A 1 333 ? -1.385  -18.688 -62.241  1.00 18.56 ? 311  GLY A CA    1 
ATOM   2317  C C     . GLY A 1 333 ? 0.129   -18.487 -62.269  1.00 17.98 ? 311  GLY A C     1 
ATOM   2318  O O     . GLY A 1 333 ? 0.771   -18.625 -63.311  1.00 18.33 ? 311  GLY A O     1 
ATOM   2319  N N     . LEU A 1 334 ? 0.697   -18.146 -61.130  1.00 17.64 ? 312  LEU A N     1 
ATOM   2320  C CA    . LEU A 1 334 ? 2.149   -17.964 -61.025  1.00 17.47 ? 312  LEU A CA    1 
ATOM   2321  C C     . LEU A 1 334 ? 2.862   -19.326 -60.855  1.00 16.86 ? 312  LEU A C     1 
ATOM   2322  O O     . LEU A 1 334 ? 4.031   -19.505 -61.243  1.00 15.63 ? 312  LEU A O     1 
ATOM   2323  C CB    . LEU A 1 334 ? 2.472   -16.983 -59.889  1.00 16.83 ? 312  LEU A CB    1 
ATOM   2324  C CG    . LEU A 1 334 ? 3.934   -16.649 -59.613  1.00 21.70 ? 312  LEU A CG    1 
ATOM   2325  C CD1   . LEU A 1 334 ? 4.589   -15.874 -60.777  1.00 22.38 ? 312  LEU A CD1   1 
ATOM   2326  C CD2   . LEU A 1 334 ? 4.046   -15.871 -58.291  1.00 17.69 ? 312  LEU A CD2   1 
ATOM   2327  N N     . ARG A 1 335 ? 2.146   -20.290 -60.286  1.00 15.99 ? 313  ARG A N     1 
ATOM   2328  C CA    . ARG A 1 335 ? 2.636   -21.665 -60.227  1.00 14.18 ? 313  ARG A CA    1 
ATOM   2329  C C     . ARG A 1 335 ? 2.662   -22.247 -61.620  1.00 12.65 ? 313  ARG A C     1 
ATOM   2330  O O     . ARG A 1 335 ? 3.636   -22.877 -62.020  1.00 13.67 ? 313  ARG A O     1 
ATOM   2331  C CB    . ARG A 1 335 ? 1.777   -22.521 -59.281  1.00 15.74 ? 313  ARG A CB    1 
ATOM   2332  C CG    . ARG A 1 335 ? 2.127   -22.294 -57.802  1.00 16.21 ? 313  ARG A CG    1 
ATOM   2333  C CD    . ARG A 1 335 ? 1.239   -23.044 -56.820  1.00 21.81 ? 313  ARG A CD    1 
ATOM   2334  N NE    . ARG A 1 335 ? 1.736   -22.761 -55.471  1.00 22.23 ? 313  ARG A NE    1 
ATOM   2335  C CZ    . ARG A 1 335 ? 1.040   -22.214 -54.477  1.00 25.85 ? 313  ARG A CZ    1 
ATOM   2336  N NH1   . ARG A 1 335 ? -0.254  -21.903 -54.610  1.00 25.44 ? 313  ARG A NH1   1 
ATOM   2337  N NH2   . ARG A 1 335 ? 1.651   -21.998 -53.312  1.00 28.08 ? 313  ARG A NH2   1 
ATOM   2338  N N     . SER A 1 336 ? 1.593   -22.013 -62.369  1.00 11.73 ? 314  SER A N     1 
ATOM   2339  C CA    . SER A 1 336 ? 1.498   -22.448 -63.750  1.00 10.03 ? 314  SER A CA    1 
ATOM   2340  C C     . SER A 1 336 ? 2.625   -21.846 -64.574  1.00 9.97  ? 314  SER A C     1 
ATOM   2341  O O     . SER A 1 336 ? 3.331   -22.577 -65.268  1.00 9.88  ? 314  SER A O     1 
ATOM   2342  C CB    . SER A 1 336 ? 0.156   -22.052 -64.329  1.00 9.42  ? 314  SER A CB    1 
ATOM   2343  O OG    . SER A 1 336 ? -0.883  -22.707 -63.622  1.00 15.67 ? 314  SER A OG    1 
ATOM   2344  N N     . THR A 1 337 ? 2.807   -20.529 -64.487  1.00 8.63  ? 315  THR A N     1 
ATOM   2345  C CA    . THR A 1 337 ? 3.911   -19.858 -65.188  1.00 10.41 ? 315  THR A CA    1 
ATOM   2346  C C     . THR A 1 337 ? 5.246   -20.560 -64.944  1.00 11.84 ? 315  THR A C     1 
ATOM   2347  O O     . THR A 1 337 ? 5.997   -20.845 -65.880  1.00 12.15 ? 315  THR A O     1 
ATOM   2348  C CB    . THR A 1 337 ? 4.086   -18.416 -64.707  1.00 11.24 ? 315  THR A CB    1 
ATOM   2349  O OG1   . THR A 1 337 ? 2.814   -17.737 -64.712  1.00 12.53 ? 315  THR A OG1   1 
ATOM   2350  C CG2   . THR A 1 337 ? 5.119   -17.671 -65.581  1.00 6.68  ? 315  THR A CG2   1 
ATOM   2351  N N     . CYS A 1 338 ? 5.517   -20.822 -63.664  1.00 14.00 ? 316  CYS A N     1 
ATOM   2352  C CA    . CYS A 1 338 ? 6.764   -21.437 -63.212  1.00 13.78 ? 316  CYS A CA    1 
ATOM   2353  C C     . CYS A 1 338 ? 6.905   -22.828 -63.762  1.00 14.10 ? 316  CYS A C     1 
ATOM   2354  O O     . CYS A 1 338 ? 7.978   -23.207 -64.229  1.00 14.19 ? 316  CYS A O     1 
ATOM   2355  C CB    . CYS A 1 338 ? 6.844   -21.451 -61.676  1.00 14.40 ? 316  CYS A CB    1 
ATOM   2356  S SG    . CYS A 1 338 ? 7.308   -19.824 -60.913  1.00 14.36 ? 316  CYS A SG    1 
ATOM   2357  N N     . THR A 1 339 ? 5.810   -23.592 -63.735  1.00 15.00 ? 317  THR A N     1 
ATOM   2358  C CA    . THR A 1 339 ? 5.782   -24.888 -64.397  1.00 14.96 ? 317  THR A CA    1 
ATOM   2359  C C     . THR A 1 339 ? 6.176   -24.792 -65.874  1.00 14.54 ? 317  THR A C     1 
ATOM   2360  O O     . THR A 1 339 ? 7.049   -25.535 -66.339  1.00 15.63 ? 317  THR A O     1 
ATOM   2361  C CB    . THR A 1 339 ? 4.413   -25.523 -64.303  1.00 14.93 ? 317  THR A CB    1 
ATOM   2362  O OG1   . THR A 1 339 ? 3.965   -25.439 -62.952  1.00 20.47 ? 317  THR A OG1   1 
ATOM   2363  C CG2   . THR A 1 339 ? 4.487   -26.982 -64.682  1.00 17.25 ? 317  THR A CG2   1 
ATOM   2364  N N     . TYR A 1 340 ? 5.554   -23.859 -66.590  1.00 13.75 ? 318  TYR A N     1 
ATOM   2365  C CA    . TYR A 1 340 ? 5.670   -23.772 -68.037  1.00 12.99 ? 318  TYR A CA    1 
ATOM   2366  C C     . TYR A 1 340 ? 7.033   -23.268 -68.492  1.00 14.86 ? 318  TYR A C     1 
ATOM   2367  O O     . TYR A 1 340 ? 7.429   -23.543 -69.625  1.00 15.65 ? 318  TYR A O     1 
ATOM   2368  C CB    . TYR A 1 340 ? 4.541   -22.921 -68.616  1.00 10.43 ? 318  TYR A CB    1 
ATOM   2369  C CG    . TYR A 1 340 ? 3.154   -23.413 -68.246  1.00 8.72  ? 318  TYR A CG    1 
ATOM   2370  C CD1   . TYR A 1 340 ? 2.915   -24.768 -67.968  1.00 9.22  ? 318  TYR A CD1   1 
ATOM   2371  C CD2   . TYR A 1 340 ? 2.074   -22.542 -68.205  1.00 10.85 ? 318  TYR A CD2   1 
ATOM   2372  C CE1   . TYR A 1 340 ? 1.664   -25.225 -67.640  1.00 10.33 ? 318  TYR A CE1   1 
ATOM   2373  C CE2   . TYR A 1 340 ? 0.791   -23.005 -67.860  1.00 11.73 ? 318  TYR A CE2   1 
ATOM   2374  C CZ    . TYR A 1 340 ? 0.599   -24.344 -67.581  1.00 8.85  ? 318  TYR A CZ    1 
ATOM   2375  O OH    . TYR A 1 340 ? -0.629  -24.836 -67.247  1.00 4.09  ? 318  TYR A OH    1 
ATOM   2376  N N     . VAL A 1 341 ? 7.748   -22.546 -67.628  1.00 16.45 ? 319  VAL A N     1 
ATOM   2377  C CA    . VAL A 1 341 ? 9.123   -22.080 -67.949  1.00 17.62 ? 319  VAL A CA    1 
ATOM   2378  C C     . VAL A 1 341 ? 10.184  -22.973 -67.327  1.00 17.75 ? 319  VAL A C     1 
ATOM   2379  O O     . VAL A 1 341 ? 11.366  -22.787 -67.581  1.00 17.98 ? 319  VAL A O     1 
ATOM   2380  C CB    . VAL A 1 341 ? 9.434   -20.594 -67.505  1.00 16.06 ? 319  VAL A CB    1 
ATOM   2381  C CG1   . VAL A 1 341 ? 8.661   -19.579 -68.354  1.00 19.26 ? 319  VAL A CG1   1 
ATOM   2382  C CG2   . VAL A 1 341 ? 9.195   -20.353 -65.995  1.00 16.87 ? 319  VAL A CG2   1 
ATOM   2383  N N     . GLY A 1 342 ? 9.753   -23.921 -66.499  1.00 18.76 ? 320  GLY A N     1 
ATOM   2384  C CA    . GLY A 1 342 ? 10.655  -24.879 -65.871  1.00 18.18 ? 320  GLY A CA    1 
ATOM   2385  C C     . GLY A 1 342 ? 11.240  -24.444 -64.536  1.00 18.77 ? 320  GLY A C     1 
ATOM   2386  O O     . GLY A 1 342 ? 12.347  -24.875 -64.171  1.00 19.19 ? 320  GLY A O     1 
ATOM   2387  N N     . ALA A 1 343 ? 10.502  -23.610 -63.801  1.00 17.65 ? 321  ALA A N     1 
ATOM   2388  C CA    . ALA A 1 343 ? 10.977  -23.102 -62.509  1.00 17.65 ? 321  ALA A CA    1 
ATOM   2389  C C     . ALA A 1 343 ? 10.237  -23.799 -61.351  1.00 18.96 ? 321  ALA A C     1 
ATOM   2390  O O     . ALA A 1 343 ? 9.044   -23.613 -61.157  1.00 18.76 ? 321  ALA A O     1 
ATOM   2391  C CB    . ALA A 1 343 ? 10.840  -21.578 -62.430  1.00 17.15 ? 321  ALA A CB    1 
ATOM   2392  N N     . ALA A 1 344 ? 10.948  -24.636 -60.602  1.00 20.68 ? 322  ALA A N     1 
ATOM   2393  C CA    . ALA A 1 344 ? 10.334  -25.392 -59.497  1.00 20.17 ? 322  ALA A CA    1 
ATOM   2394  C C     . ALA A 1 344 ? 10.158  -24.515 -58.260  1.00 19.84 ? 322  ALA A C     1 
ATOM   2395  O O     . ALA A 1 344 ? 9.420   -24.856 -57.335  1.00 19.39 ? 322  ALA A O     1 
ATOM   2396  C CB    . ALA A 1 344 ? 11.169  -26.576 -59.154  1.00 20.30 ? 322  ALA A CB    1 
ATOM   2397  N N     . LYS A 1 345 ? 10.883  -23.398 -58.258  1.00 19.78 ? 323  LYS A N     1 
ATOM   2398  C CA    . LYS A 1 345 ? 10.851  -22.395 -57.211  1.00 19.62 ? 323  LYS A CA    1 
ATOM   2399  C C     . LYS A 1 345 ? 10.694  -21.034 -57.869  1.00 19.23 ? 323  LYS A C     1 
ATOM   2400  O O     . LYS A 1 345 ? 11.334  -20.788 -58.898  1.00 18.59 ? 323  LYS A O     1 
ATOM   2401  C CB    . LYS A 1 345 ? 12.177  -22.383 -56.433  1.00 18.61 ? 323  LYS A CB    1 
ATOM   2402  C CG    . LYS A 1 345 ? 12.409  -23.595 -55.521  1.00 23.45 ? 323  LYS A CG    1 
ATOM   2403  C CD    . LYS A 1 345 ? 13.707  -23.493 -54.682  1.00 22.15 ? 323  LYS A CD    1 
ATOM   2404  N N     . LEU A 1 346 ? 9.867   -20.157 -57.274  1.00 18.64 ? 324  LEU A N     1 
ATOM   2405  C CA    . LEU A 1 346 ? 9.739   -18.753 -57.728  1.00 18.90 ? 324  LEU A CA    1 
ATOM   2406  C C     . LEU A 1 346 ? 11.086  -18.034 -57.902  1.00 18.99 ? 324  LEU A C     1 
ATOM   2407  O O     . LEU A 1 346 ? 11.215  -17.110 -58.687  1.00 20.58 ? 324  LEU A O     1 
ATOM   2408  C CB    . LEU A 1 346 ? 8.891   -17.964 -56.734  1.00 18.69 ? 324  LEU A CB    1 
ATOM   2409  C CG    . LEU A 1 346 ? 8.470   -16.535 -57.101  1.00 18.24 ? 324  LEU A CG    1 
ATOM   2410  C CD1   . LEU A 1 346 ? 7.565   -16.545 -58.308  1.00 15.77 ? 324  LEU A CD1   1 
ATOM   2411  C CD2   . LEU A 1 346 ? 7.741   -15.865 -55.940  1.00 25.06 ? 324  LEU A CD2   1 
ATOM   2412  N N     . LYS A 1 347 ? 12.052  -18.448 -57.104  1.00 19.66 ? 325  LYS A N     1 
ATOM   2413  C CA    . LYS A 1 347 ? 13.442  -18.033 -57.209  1.00 20.44 ? 325  LYS A CA    1 
ATOM   2414  C C     . LYS A 1 347 ? 13.988  -18.207 -58.650  1.00 19.97 ? 325  LYS A C     1 
ATOM   2415  O O     . LYS A 1 347 ? 14.660  -17.320 -59.180  1.00 22.03 ? 325  LYS A O     1 
ATOM   2416  C CB    . LYS A 1 347 ? 14.237  -18.843 -56.150  1.00 21.19 ? 325  LYS A CB    1 
ATOM   2417  C CG    . LYS A 1 347 ? 15.795  -18.738 -56.154  1.00 25.53 ? 325  LYS A CG    1 
ATOM   2418  C CD    . LYS A 1 347 ? 16.438  -19.827 -55.270  1.00 9.03  ? 325  LYS A CD    1 
ATOM   2419  N N     . GLU A 1 348 ? 13.653  -19.329 -59.285  1.00 20.33 ? 326  GLU A N     1 
ATOM   2420  C CA    . GLU A 1 348 ? 14.186  -19.695 -60.589  1.00 20.12 ? 326  GLU A CA    1 
ATOM   2421  C C     . GLU A 1 348 ? 13.505  -18.960 -61.748  1.00 19.19 ? 326  GLU A C     1 
ATOM   2422  O O     . GLU A 1 348 ? 13.955  -19.022 -62.870  1.00 19.38 ? 326  GLU A O     1 
ATOM   2423  C CB    . GLU A 1 348 ? 14.067  -21.225 -60.801  1.00 22.26 ? 326  GLU A CB    1 
ATOM   2424  C CG    . GLU A 1 348 ? 14.848  -22.149 -59.814  1.00 23.04 ? 326  GLU A CG    1 
ATOM   2425  C CD    . GLU A 1 348 ? 14.374  -23.652 -59.844  1.00 37.60 ? 326  GLU A CD    1 
ATOM   2426  O OE1   . GLU A 1 348 ? 13.886  -24.151 -60.905  1.00 38.23 ? 326  GLU A OE1   1 
ATOM   2427  O OE2   . GLU A 1 348 ? 14.496  -24.343 -58.786  1.00 42.87 ? 326  GLU A OE2   1 
ATOM   2428  N N     . LEU A 1 349 ? 12.426  -18.248 -61.491  1.00 19.18 ? 327  LEU A N     1 
ATOM   2429  C CA    . LEU A 1 349 ? 11.620  -17.701 -62.578  1.00 18.88 ? 327  LEU A CA    1 
ATOM   2430  C C     . LEU A 1 349 ? 12.418  -16.778 -63.501  1.00 19.89 ? 327  LEU A C     1 
ATOM   2431  O O     . LEU A 1 349 ? 12.480  -17.005 -64.702  1.00 19.93 ? 327  LEU A O     1 
ATOM   2432  C CB    . LEU A 1 349 ? 10.371  -17.021 -62.021  1.00 17.06 ? 327  LEU A CB    1 
ATOM   2433  C CG    . LEU A 1 349 ? 9.411   -16.374 -63.012  1.00 18.54 ? 327  LEU A CG    1 
ATOM   2434  C CD1   . LEU A 1 349 ? 9.150   -17.249 -64.197  1.00 11.30 ? 327  LEU A CD1   1 
ATOM   2435  C CD2   . LEU A 1 349 ? 8.073   -15.999 -62.319  1.00 16.81 ? 327  LEU A CD2   1 
ATOM   2436  N N     . SER A 1 350 ? 13.058  -15.772 -62.926  1.00 21.19 ? 328  SER A N     1 
ATOM   2437  C CA    . SER A 1 350 ? 13.776  -14.769 -63.693  1.00 22.89 ? 328  SER A CA    1 
ATOM   2438  C C     . SER A 1 350 ? 14.923  -15.362 -64.469  1.00 23.58 ? 328  SER A C     1 
ATOM   2439  O O     . SER A 1 350 ? 15.135  -15.008 -65.632  1.00 26.38 ? 328  SER A O     1 
ATOM   2440  C CB    . SER A 1 350 ? 14.254  -13.691 -62.752  1.00 24.84 ? 328  SER A CB    1 
ATOM   2441  O OG    . SER A 1 350 ? 14.079  -14.159 -61.425  1.00 28.58 ? 328  SER A OG    1 
ATOM   2442  N N     . ARG A 1 351 ? 15.613  -16.312 -63.848  1.00 23.98 ? 329  ARG A N     1 
ATOM   2443  C CA    . ARG A 1 351 ? 16.675  -17.076 -64.504  1.00 23.63 ? 329  ARG A CA    1 
ATOM   2444  C C     . ARG A 1 351 ? 16.134  -17.810 -65.741  1.00 21.98 ? 329  ARG A C     1 
ATOM   2445  O O     . ARG A 1 351 ? 16.827  -17.892 -66.755  1.00 21.41 ? 329  ARG A O     1 
ATOM   2446  C CB    . ARG A 1 351 ? 17.331  -18.032 -63.491  1.00 23.92 ? 329  ARG A CB    1 
ATOM   2447  C CG    . ARG A 1 351 ? 17.849  -17.290 -62.198  1.00 28.08 ? 329  ARG A CG    1 
ATOM   2448  C CD    . ARG A 1 351 ? 17.734  -18.127 -60.910  1.00 30.95 ? 329  ARG A CD    1 
ATOM   2449  N N     . ARG A 1 352 ? 14.879  -18.290 -65.665  1.00 20.30 ? 330  ARG A N     1 
ATOM   2450  C CA    . ARG A 1 352 ? 14.252  -19.087 -66.729  1.00 19.17 ? 330  ARG A CA    1 
ATOM   2451  C C     . ARG A 1 352 ? 13.234  -18.315 -67.582  1.00 18.59 ? 330  ARG A C     1 
ATOM   2452  O O     . ARG A 1 352 ? 12.640  -18.859 -68.505  1.00 17.66 ? 330  ARG A O     1 
ATOM   2453  C CB    . ARG A 1 352 ? 13.658  -20.349 -66.111  1.00 19.33 ? 330  ARG A CB    1 
ATOM   2454  C CG    . ARG A 1 352 ? 14.761  -21.312 -65.604  1.00 24.07 ? 330  ARG A CG    1 
ATOM   2455  C CD    . ARG A 1 352 ? 14.275  -22.209 -64.472  1.00 31.83 ? 330  ARG A CD    1 
ATOM   2456  N NE    . ARG A 1 352 ? 15.349  -22.992 -63.841  1.00 34.67 ? 330  ARG A NE    1 
ATOM   2457  C CZ    . ARG A 1 352 ? 15.759  -24.196 -64.240  1.00 36.17 ? 330  ARG A CZ    1 
ATOM   2458  N NH1   . ARG A 1 352 ? 15.211  -24.798 -65.293  1.00 38.22 ? 330  ARG A NH1   1 
ATOM   2459  N NH2   . ARG A 1 352 ? 16.736  -24.802 -63.582  1.00 37.04 ? 330  ARG A NH2   1 
ATOM   2460  N N     . ALA A 1 353 ? 13.077  -17.031 -67.281  1.00 19.33 ? 331  ALA A N     1 
ATOM   2461  C CA    . ALA A 1 353 ? 12.252  -16.144 -68.068  1.00 18.80 ? 331  ALA A CA    1 
ATOM   2462  C C     . ALA A 1 353 ? 12.988  -15.675 -69.323  1.00 20.18 ? 331  ALA A C     1 
ATOM   2463  O O     . ALA A 1 353 ? 14.044  -15.013 -69.243  1.00 19.80 ? 331  ALA A O     1 
ATOM   2464  C CB    . ALA A 1 353 ? 11.832  -14.979 -67.241  1.00 19.94 ? 331  ALA A CB    1 
ATOM   2465  N N     . THR A 1 354 ? 12.432  -16.053 -70.477  1.00 21.09 ? 332  THR A N     1 
ATOM   2466  C CA    . THR A 1 354 ? 12.770  -15.437 -71.763  1.00 20.98 ? 332  THR A CA    1 
ATOM   2467  C C     . THR A 1 354 ? 11.485  -14.831 -72.295  1.00 20.73 ? 332  THR A C     1 
ATOM   2468  O O     . THR A 1 354 ? 10.461  -15.514 -72.365  1.00 20.91 ? 332  THR A O     1 
ATOM   2469  C CB    . THR A 1 354 ? 13.360  -16.417 -72.801  1.00 22.64 ? 332  THR A CB    1 
ATOM   2470  O OG1   . THR A 1 354 ? 14.775  -16.625 -72.561  1.00 24.94 ? 332  THR A OG1   1 
ATOM   2471  C CG2   . THR A 1 354 ? 13.218  -15.831 -74.203  1.00 25.18 ? 332  THR A CG2   1 
ATOM   2472  N N     . PHE A 1 355 ? 11.530  -13.533 -72.612  1.00 20.81 ? 333  PHE A N     1 
ATOM   2473  C CA    . PHE A 1 355 ? 10.356  -12.813 -73.150  1.00 19.03 ? 333  PHE A CA    1 
ATOM   2474  C C     . PHE A 1 355 ? 10.416  -12.776 -74.670  1.00 18.79 ? 333  PHE A C     1 
ATOM   2475  O O     . PHE A 1 355 ? 11.510  -12.751 -75.262  1.00 15.86 ? 333  PHE A O     1 
ATOM   2476  C CB    . PHE A 1 355 ? 10.301  -11.379 -72.628  1.00 17.80 ? 333  PHE A CB    1 
ATOM   2477  C CG    . PHE A 1 355 ? 10.090  -11.291 -71.165  1.00 20.23 ? 333  PHE A CG    1 
ATOM   2478  C CD1   . PHE A 1 355 ? 8.809   -11.367 -70.634  1.00 10.28 ? 333  PHE A CD1   1 
ATOM   2479  C CD2   . PHE A 1 355 ? 11.178  -11.136 -70.301  1.00 22.73 ? 333  PHE A CD2   1 
ATOM   2480  C CE1   . PHE A 1 355 ? 8.609   -11.273 -69.282  1.00 14.43 ? 333  PHE A CE1   1 
ATOM   2481  C CE2   . PHE A 1 355 ? 10.981  -11.058 -68.933  1.00 20.07 ? 333  PHE A CE2   1 
ATOM   2482  C CZ    . PHE A 1 355 ? 9.691   -11.136 -68.425  1.00 16.91 ? 333  PHE A CZ    1 
ATOM   2483  N N     . ILE A 1 356 ? 9.235   -12.792 -75.280  1.00 19.84 ? 334  ILE A N     1 
ATOM   2484  C CA    . ILE A 1 356 ? 9.097   -12.497 -76.691  1.00 20.58 ? 334  ILE A CA    1 
ATOM   2485  C C     . ILE A 1 356 ? 8.269   -11.226 -76.839  1.00 20.79 ? 334  ILE A C     1 
ATOM   2486  O O     . ILE A 1 356 ? 7.361   -10.970 -76.054  1.00 18.80 ? 334  ILE A O     1 
ATOM   2487  C CB    . ILE A 1 356 ? 8.503   -13.685 -77.510  1.00 19.85 ? 334  ILE A CB    1 
ATOM   2488  C CG1   . ILE A 1 356 ? 7.243   -14.225 -76.879  1.00 20.02 ? 334  ILE A CG1   1 
ATOM   2489  C CG2   . ILE A 1 356 ? 9.531   -14.824 -77.637  1.00 21.71 ? 334  ILE A CG2   1 
ATOM   2490  C CD1   . ILE A 1 356 ? 6.357   -14.884 -77.843  1.00 20.90 ? 334  ILE A CD1   1 
ATOM   2491  N N     . ARG A 1 357 ? 8.623   -10.415 -77.829  1.00 23.14 ? 335  ARG A N     1 
ATOM   2492  C CA    . ARG A 1 357 ? 7.913   -9.186  -78.137  1.00 23.40 ? 335  ARG A CA    1 
ATOM   2493  C C     . ARG A 1 357 ? 6.710   -9.602  -78.958  1.00 21.90 ? 335  ARG A C     1 
ATOM   2494  O O     . ARG A 1 357 ? 6.844   -10.393 -79.879  1.00 18.40 ? 335  ARG A O     1 
ATOM   2495  C CB    . ARG A 1 357 ? 8.825   -8.234  -78.939  1.00 25.03 ? 335  ARG A CB    1 
ATOM   2496  C CG    . ARG A 1 357 ? 10.068  -7.750  -78.157  1.00 31.56 ? 335  ARG A CG    1 
ATOM   2497  C CD    . ARG A 1 357 ? 11.174  -7.117  -79.022  1.00 41.25 ? 335  ARG A CD    1 
ATOM   2498  N NE    . ARG A 1 357 ? 12.504  -7.266  -78.388  1.00 46.86 ? 335  ARG A NE    1 
ATOM   2499  C CZ    . ARG A 1 357 ? 13.243  -6.308  -77.801  1.00 41.93 ? 335  ARG A CZ    1 
ATOM   2500  N NH1   . ARG A 1 357 ? 12.853  -5.028  -77.736  1.00 38.51 ? 335  ARG A NH1   1 
ATOM   2501  N NH2   . ARG A 1 357 ? 14.409  -6.654  -77.254  1.00 29.88 ? 335  ARG A NH2   1 
ATOM   2502  N N     . VAL A 1 358 ? 5.530   -9.096  -78.611  1.00 23.28 ? 336  VAL A N     1 
ATOM   2503  C CA    . VAL A 1 358 ? 4.314   -9.396  -79.394  1.00 25.09 ? 336  VAL A CA    1 
ATOM   2504  C C     . VAL A 1 358 ? 3.595   -8.106  -79.791  1.00 27.77 ? 336  VAL A C     1 
ATOM   2505  O O     . VAL A 1 358 ? 4.026   -7.008  -79.411  1.00 29.06 ? 336  VAL A O     1 
ATOM   2506  C CB    . VAL A 1 358 ? 3.332   -10.319 -78.659  1.00 24.08 ? 336  VAL A CB    1 
ATOM   2507  C CG1   . VAL A 1 358 ? 4.055   -11.577 -78.154  1.00 25.64 ? 336  VAL A CG1   1 
ATOM   2508  C CG2   . VAL A 1 358 ? 2.642   -9.588  -77.530  1.00 23.84 ? 336  VAL A CG2   1 
ATOM   2509  N N     . THR A 1 359 ? 2.527   -8.255  -80.574  1.00 29.55 ? 337  THR A N     1 
ATOM   2510  C CA    . THR A 1 359 ? 1.721   -7.148  -81.078  1.00 30.29 ? 337  THR A CA    1 
ATOM   2511  C C     . THR A 1 359 ? 0.368   -6.998  -80.381  1.00 31.26 ? 337  THR A C     1 
ATOM   2512  O O     . THR A 1 359 ? -0.164  -5.892  -80.357  1.00 31.78 ? 337  THR A O     1 
ATOM   2513  C CB    . THR A 1 359 ? 1.435   -7.304  -82.606  1.00 31.02 ? 337  THR A CB    1 
ATOM   2514  O OG1   . THR A 1 359 ? 1.004   -8.642  -82.885  1.00 32.03 ? 337  THR A OG1   1 
ATOM   2515  C CG2   . THR A 1 359 ? 2.680   -6.986  -83.442  1.00 29.89 ? 337  THR A CG2   1 
ATOM   2516  N N     . GLN A 1 360 ? -0.234  -8.073  -79.852  1.00 36.06 ? 338  GLN A N     1 
ATOM   2517  C CA    . GLN A 1 360 ? -1.527  -7.949  -79.093  1.00 37.19 ? 338  GLN A CA    1 
ATOM   2518  C C     . GLN A 1 360 ? -2.005  -9.228  -78.365  1.00 37.36 ? 338  GLN A C     1 
ATOM   2519  O O     . GLN A 1 360 ? -1.296  -9.804  -77.514  1.00 37.05 ? 338  GLN A O     1 
ATOM   2520  C CB    . GLN A 1 360 ? -2.664  -7.467  -80.015  1.00 37.50 ? 338  GLN A CB    1 
ATOM   2521  N N     . PRO B 1 24  ? 16.872  -12.311 -67.380  1.00 65.44 ? 2    PRO B N     1 
ATOM   2522  C CA    . PRO B 1 24  ? 15.607  -11.947 -68.027  1.00 63.69 ? 2    PRO B CA    1 
ATOM   2523  C C     . PRO B 1 24  ? 15.797  -11.253 -69.384  1.00 60.22 ? 2    PRO B C     1 
ATOM   2524  O O     . PRO B 1 24  ? 15.788  -10.019 -69.457  1.00 61.62 ? 2    PRO B O     1 
ATOM   2525  C CB    . PRO B 1 24  ? 14.950  -11.016 -66.999  1.00 63.15 ? 2    PRO B CB    1 
ATOM   2526  C CG    . PRO B 1 24  ? 15.424  -11.528 -65.694  1.00 64.21 ? 2    PRO B CG    1 
ATOM   2527  C CD    . PRO B 1 24  ? 16.845  -12.012 -65.935  1.00 66.30 ? 2    PRO B CD    1 
ATOM   2528  N N     . ARG B 1 25  ? 15.954  -12.061 -70.440  1.00 54.49 ? 3    ARG B N     1 
ATOM   2529  C CA    . ARG B 1 25  ? 16.205  -11.565 -71.799  1.00 51.50 ? 3    ARG B CA    1 
ATOM   2530  C C     . ARG B 1 25  ? 14.896  -11.326 -72.584  1.00 51.41 ? 3    ARG B C     1 
ATOM   2531  O O     . ARG B 1 25  ? 13.901  -12.050 -72.418  1.00 50.95 ? 3    ARG B O     1 
ATOM   2532  C CB    . ARG B 1 25  ? 17.176  -12.505 -72.547  1.00 51.21 ? 3    ARG B CB    1 
ATOM   2533  C CG    . ARG B 1 25  ? 16.560  -13.573 -73.452  1.00 50.21 ? 3    ARG B CG    1 
ATOM   2534  C CD    . ARG B 1 25  ? 16.559  -13.104 -74.915  1.00 50.14 ? 3    ARG B CD    1 
ATOM   2535  N NE    . ARG B 1 25  ? 15.786  -13.972 -75.803  1.00 47.98 ? 3    ARG B NE    1 
ATOM   2536  N N     . ILE B 1 26  ? 14.912  -10.274 -73.407  1.00 52.64 ? 4    ILE B N     1 
ATOM   2537  C CA    . ILE B 1 26  ? 13.842  -9.990  -74.348  1.00 52.56 ? 4    ILE B CA    1 
ATOM   2538  C C     . ILE B 1 26  ? 14.309  -10.399 -75.742  1.00 52.49 ? 4    ILE B C     1 
ATOM   2539  O O     . ILE B 1 26  ? 15.379  -9.986  -76.194  1.00 51.88 ? 4    ILE B O     1 
ATOM   2540  C CB    . ILE B 1 26  ? 13.439  -8.489  -74.337  1.00 52.97 ? 4    ILE B CB    1 
ATOM   2541  C CG1   . ILE B 1 26  ? 13.161  -8.015  -72.903  1.00 51.32 ? 4    ILE B CG1   1 
ATOM   2542  C CG2   . ILE B 1 26  ? 12.198  -8.265  -75.214  1.00 52.65 ? 4    ILE B CG2   1 
ATOM   2543  C CD1   . ILE B 1 26  ? 12.396  -6.692  -72.809  1.00 50.78 ? 4    ILE B CD1   1 
ATOM   2544  N N     . ASP B 1 27  ? 13.505  -11.239 -76.396  1.00 53.01 ? 5    ASP B N     1 
ATOM   2545  C CA    . ASP B 1 27  ? 13.743  -11.690 -77.775  1.00 52.48 ? 5    ASP B CA    1 
ATOM   2546  C C     . ASP B 1 27  ? 13.561  -10.492 -78.714  1.00 49.99 ? 5    ASP B C     1 
ATOM   2547  O O     . ASP B 1 27  ? 12.477  -9.890  -78.747  1.00 47.35 ? 5    ASP B O     1 
ATOM   2548  C CB    . ASP B 1 27  ? 12.759  -12.847 -78.124  1.00 53.30 ? 5    ASP B CB    1 
ATOM   2549  C CG    . ASP B 1 27  ? 13.150  -13.644 -79.395  1.00 55.83 ? 5    ASP B CG    1 
ATOM   2550  O OD1   . ASP B 1 27  ? 13.233  -13.045 -80.493  1.00 58.08 ? 5    ASP B OD1   1 
ATOM   2551  O OD2   . ASP B 1 27  ? 13.319  -14.887 -79.297  1.00 52.24 ? 5    ASP B OD2   1 
ATOM   2552  N N     . ALA B 1 28  ? 14.634  -10.156 -79.446  1.00 48.98 ? 6    ALA B N     1 
ATOM   2553  C CA    . ALA B 1 28  ? 14.686  -8.995  -80.359  1.00 48.79 ? 6    ALA B CA    1 
ATOM   2554  C C     . ALA B 1 28  ? 13.676  -9.098  -81.522  1.00 47.53 ? 6    ALA B C     1 
ATOM   2555  O O     . ALA B 1 28  ? 13.062  -8.099  -81.930  1.00 46.08 ? 6    ALA B O     1 
ATOM   2556  C CB    . ALA B 1 28  ? 16.110  -8.836  -80.903  1.00 49.15 ? 6    ALA B CB    1 
ATOM   2557  N N     . ASP B 1 29  ? 13.527  -10.320 -82.036  1.00 45.84 ? 7    ASP B N     1 
ATOM   2558  C CA    . ASP B 1 29  ? 12.522  -10.657 -83.049  1.00 44.06 ? 7    ASP B CA    1 
ATOM   2559  C C     . ASP B 1 29  ? 11.088  -10.449 -82.511  1.00 40.17 ? 7    ASP B C     1 
ATOM   2560  O O     . ASP B 1 29  ? 10.700  -11.041 -81.491  1.00 40.54 ? 7    ASP B O     1 
ATOM   2561  C CB    . ASP B 1 29  ? 12.741  -12.117 -83.507  1.00 44.96 ? 7    ASP B CB    1 
ATOM   2562  C CG    . ASP B 1 29  ? 11.825  -12.545 -84.664  1.00 49.73 ? 7    ASP B CG    1 
ATOM   2563  O OD1   . ASP B 1 29  ? 11.107  -11.696 -85.237  1.00 57.32 ? 7    ASP B OD1   1 
ATOM   2564  O OD2   . ASP B 1 29  ? 11.827  -13.753 -85.003  1.00 49.72 ? 7    ASP B OD2   1 
ATOM   2565  N N     . LEU B 1 30  ? 10.329  -9.577  -83.183  1.00 36.24 ? 8    LEU B N     1 
ATOM   2566  C CA    . LEU B 1 30  ? 8.896   -9.421  -82.915  1.00 32.83 ? 8    LEU B CA    1 
ATOM   2567  C C     . LEU B 1 30  ? 8.176   -10.640 -83.481  1.00 30.61 ? 8    LEU B C     1 
ATOM   2568  O O     . LEU B 1 30  ? 8.439   -11.064 -84.598  1.00 32.18 ? 8    LEU B O     1 
ATOM   2569  C CB    . LEU B 1 30  ? 8.343   -8.149  -83.549  1.00 31.67 ? 8    LEU B CB    1 
ATOM   2570  C CG    . LEU B 1 30  ? 6.816   -7.964  -83.481  1.00 32.92 ? 8    LEU B CG    1 
ATOM   2571  C CD1   . LEU B 1 30  ? 6.317   -7.649  -82.069  1.00 29.34 ? 8    LEU B CD1   1 
ATOM   2572  C CD2   . LEU B 1 30  ? 6.373   -6.863  -84.424  1.00 34.98 ? 8    LEU B CD2   1 
ATOM   2573  N N     . LYS B 1 31  ? 7.281   -11.212 -82.701  1.00 26.82 ? 9    LYS B N     1 
ATOM   2574  C CA    . LYS B 1 31  ? 6.539   -12.386 -83.127  1.00 23.57 ? 9    LYS B CA    1 
ATOM   2575  C C     . LYS B 1 31  ? 5.150   -11.949 -83.545  1.00 22.71 ? 9    LYS B C     1 
ATOM   2576  O O     . LYS B 1 31  ? 4.447   -11.234 -82.818  1.00 19.81 ? 9    LYS B O     1 
ATOM   2577  C CB    . LYS B 1 31  ? 6.451   -13.417 -81.995  1.00 22.02 ? 9    LYS B CB    1 
ATOM   2578  C CG    . LYS B 1 31  ? 7.756   -13.798 -81.398  1.00 20.58 ? 9    LYS B CG    1 
ATOM   2579  C CD    . LYS B 1 31  ? 8.576   -14.625 -82.357  1.00 24.43 ? 9    LYS B CD    1 
ATOM   2580  C CE    . LYS B 1 31  ? 9.945   -14.857 -81.797  1.00 23.67 ? 9    LYS B CE    1 
ATOM   2581  N NZ    . LYS B 1 31  ? 10.769  -15.672 -82.693  1.00 25.31 ? 9    LYS B NZ    1 
ATOM   2582  N N     . LEU B 1 32  ? 4.752   -12.401 -84.722  1.00 24.06 ? 10   LEU B N     1 
ATOM   2583  C CA    . LEU B 1 32  ? 3.517   -11.959 -85.353  1.00 23.02 ? 10   LEU B CA    1 
ATOM   2584  C C     . LEU B 1 32  ? 2.376   -12.948 -85.176  1.00 20.56 ? 10   LEU B C     1 
ATOM   2585  O O     . LEU B 1 32  ? 2.601   -14.137 -85.060  1.00 19.74 ? 10   LEU B O     1 
ATOM   2586  C CB    . LEU B 1 32  ? 3.810   -11.752 -86.835  1.00 23.77 ? 10   LEU B CB    1 
ATOM   2587  C CG    . LEU B 1 32  ? 4.938   -10.762 -87.148  1.00 24.64 ? 10   LEU B CG    1 
ATOM   2588  C CD1   . LEU B 1 32  ? 5.339   -10.913 -88.594  1.00 27.58 ? 10   LEU B CD1   1 
ATOM   2589  C CD2   . LEU B 1 32  ? 4.516   -9.316  -86.856  1.00 24.27 ? 10   LEU B CD2   1 
ATOM   2590  N N     . ASP B 1 33  ? 1.149   -12.435 -85.134  1.00 20.71 ? 11   ASP B N     1 
ATOM   2591  C CA    . ASP B 1 33  ? -0.039  -13.276 -85.258  1.00 23.51 ? 11   ASP B CA    1 
ATOM   2592  C C     . ASP B 1 33  ? -0.686  -13.076 -86.635  1.00 23.16 ? 11   ASP B C     1 
ATOM   2593  O O     . ASP B 1 33  ? -0.098  -12.433 -87.515  1.00 24.17 ? 11   ASP B O     1 
ATOM   2594  C CB    . ASP B 1 33  ? -1.023  -13.018 -84.112  1.00 23.43 ? 11   ASP B CB    1 
ATOM   2595  C CG    . ASP B 1 33  ? -1.474  -14.321 -83.447  1.00 29.77 ? 11   ASP B CG    1 
ATOM   2596  O OD1   . ASP B 1 33  ? -1.977  -15.232 -84.165  1.00 27.99 ? 11   ASP B OD1   1 
ATOM   2597  O OD2   . ASP B 1 33  ? -1.288  -14.448 -82.214  1.00 29.62 ? 11   ASP B OD2   1 
ATOM   2598  N N     . PHE B 1 34  ? -1.871  -13.637 -86.835  1.00 21.81 ? 12   PHE B N     1 
ATOM   2599  C CA    . PHE B 1 34  ? -2.464  -13.671 -88.161  1.00 20.26 ? 12   PHE B CA    1 
ATOM   2600  C C     . PHE B 1 34  ? -2.887  -12.293 -88.624  1.00 19.07 ? 12   PHE B C     1 
ATOM   2601  O O     . PHE B 1 34  ? -2.850  -11.996 -89.814  1.00 19.00 ? 12   PHE B O     1 
ATOM   2602  C CB    . PHE B 1 34  ? -3.670  -14.617 -88.183  1.00 20.17 ? 12   PHE B CB    1 
ATOM   2603  C CG    . PHE B 1 34  ? -3.324  -16.067 -87.979  1.00 18.03 ? 12   PHE B CG    1 
ATOM   2604  C CD1   . PHE B 1 34  ? -2.182  -16.626 -88.551  1.00 19.57 ? 12   PHE B CD1   1 
ATOM   2605  C CD2   . PHE B 1 34  ? -4.162  -16.879 -87.234  1.00 14.12 ? 12   PHE B CD2   1 
ATOM   2606  C CE1   . PHE B 1 34  ? -1.880  -17.979 -88.364  1.00 19.30 ? 12   PHE B CE1   1 
ATOM   2607  C CE2   . PHE B 1 34  ? -3.879  -18.219 -87.040  1.00 15.00 ? 12   PHE B CE2   1 
ATOM   2608  C CZ    . PHE B 1 34  ? -2.744  -18.783 -87.613  1.00 18.68 ? 12   PHE B CZ    1 
ATOM   2609  N N     . LYS B 1 35  ? -3.291  -11.462 -87.672  1.00 19.25 ? 13   LYS B N     1 
ATOM   2610  C CA    . LYS B 1 35  ? -3.802  -10.118 -87.952  1.00 19.49 ? 13   LYS B CA    1 
ATOM   2611  C C     . LYS B 1 35  ? -2.718  -9.220  -88.438  1.00 18.13 ? 13   LYS B C     1 
ATOM   2612  O O     . LYS B 1 35  ? -3.004  -8.185  -89.028  1.00 19.24 ? 13   LYS B O     1 
ATOM   2613  C CB    . LYS B 1 35  ? -4.381  -9.495  -86.676  1.00 20.48 ? 13   LYS B CB    1 
ATOM   2614  C CG    . LYS B 1 35  ? -3.320  -9.130  -85.584  1.00 26.36 ? 13   LYS B CG    1 
ATOM   2615  C CD    . LYS B 1 35  ? -3.952  -8.338  -84.410  1.00 34.54 ? 13   LYS B CD    1 
ATOM   2616  C CE    . LYS B 1 35  ? -2.944  -7.862  -83.373  1.00 27.78 ? 13   LYS B CE    1 
ATOM   2617  N NZ    . LYS B 1 35  ? -2.070  -6.820  -83.952  1.00 26.79 ? 13   LYS B NZ    1 
ATOM   2618  N N     . ASP B 1 36  ? -1.475  -9.597  -88.136  1.00 16.46 ? 14   ASP B N     1 
ATOM   2619  C CA    . ASP B 1 36  ? -0.307  -8.792  -88.486  1.00 15.56 ? 14   ASP B CA    1 
ATOM   2620  C C     . ASP B 1 36  ? 0.141   -8.971  -89.918  1.00 14.55 ? 14   ASP B C     1 
ATOM   2621  O O     . ASP B 1 36  ? 0.966   -8.212  -90.383  1.00 15.66 ? 14   ASP B O     1 
ATOM   2622  C CB    . ASP B 1 36  ? 0.859   -9.150  -87.580  1.00 15.91 ? 14   ASP B CB    1 
ATOM   2623  C CG    . ASP B 1 36  ? 0.613   -8.767  -86.149  1.00 14.91 ? 14   ASP B CG    1 
ATOM   2624  O OD1   . ASP B 1 36  ? 0.380   -7.568  -85.878  1.00 17.70 ? 14   ASP B OD1   1 
ATOM   2625  O OD2   . ASP B 1 36  ? 0.667   -9.659  -85.298  1.00 12.27 ? 14   ASP B OD2   1 
ATOM   2626  N N     . VAL B 1 37  ? -0.391  -9.974  -90.617  1.00 15.03 ? 15   VAL B N     1 
ATOM   2627  C CA    . VAL B 1 37  ? 0.039   -10.242 -91.991  1.00 14.04 ? 15   VAL B CA    1 
ATOM   2628  C C     . VAL B 1 37  ? -1.113  -10.415 -92.950  1.00 13.17 ? 15   VAL B C     1 
ATOM   2629  O O     . VAL B 1 37  ? -2.262  -10.586 -92.532  1.00 14.03 ? 15   VAL B O     1 
ATOM   2630  C CB    . VAL B 1 37  ? 1.016   -11.441 -92.080  1.00 14.15 ? 15   VAL B CB    1 
ATOM   2631  C CG1   . VAL B 1 37  ? 2.203   -11.211 -91.171  1.00 17.96 ? 15   VAL B CG1   1 
ATOM   2632  C CG2   . VAL B 1 37  ? 0.356   -12.739 -91.739  1.00 13.12 ? 15   VAL B CG2   1 
ATOM   2633  N N     . LEU B 1 38  ? -0.787  -10.315 -94.238  1.00 12.33 ? 16   LEU B N     1 
ATOM   2634  C CA    . LEU B 1 38  ? -1.665  -10.723 -95.344  1.00 11.51 ? 16   LEU B CA    1 
ATOM   2635  C C     . LEU B 1 38  ? -0.860  -11.591 -96.278  1.00 12.22 ? 16   LEU B C     1 
ATOM   2636  O O     . LEU B 1 38  ? 0.374   -11.489 -96.321  1.00 11.54 ? 16   LEU B O     1 
ATOM   2637  C CB    . LEU B 1 38  ? -2.171  -9.510  -96.129  1.00 10.94 ? 16   LEU B CB    1 
ATOM   2638  C CG    . LEU B 1 38  ? -3.199  -8.635  -95.393  1.00 14.54 ? 16   LEU B CG    1 
ATOM   2639  C CD1   . LEU B 1 38  ? -3.305  -7.220  -95.985  1.00 16.48 ? 16   LEU B CD1   1 
ATOM   2640  C CD2   . LEU B 1 38  ? -4.569  -9.334  -95.371  1.00 7.24  ? 16   LEU B CD2   1 
ATOM   2641  N N     . LEU B 1 39  ? -1.565  -12.457 -97.007  1.00 12.80 ? 17   LEU B N     1 
ATOM   2642  C CA    . LEU B 1 39  ? -0.977  -13.200 -98.116  1.00 13.44 ? 17   LEU B CA    1 
ATOM   2643  C C     . LEU B 1 39  ? -1.044  -12.376 -99.398  1.00 14.53 ? 17   LEU B C     1 
ATOM   2644  O O     . LEU B 1 39  ? -2.056  -11.760 -99.736  1.00 14.73 ? 17   LEU B O     1 
ATOM   2645  C CB    . LEU B 1 39  ? -1.695  -14.521 -98.336  1.00 14.55 ? 17   LEU B CB    1 
ATOM   2646  C CG    . LEU B 1 39  ? -1.510  -15.629 -97.287  1.00 12.93 ? 17   LEU B CG    1 
ATOM   2647  C CD1   . LEU B 1 39  ? -2.767  -16.482 -97.204  1.00 10.94 ? 17   LEU B CD1   1 
ATOM   2648  C CD2   . LEU B 1 39  ? -0.298  -16.505 -97.594  1.00 9.15  ? 17   LEU B CD2   1 
ATOM   2649  N N     . ARG B 1 40  ? 0.082   -12.353 -100.090 1.00 15.31 ? 18   ARG B N     1 
ATOM   2650  C CA    . ARG B 1 40  ? 0.232   -11.651 -101.354 1.00 16.48 ? 18   ARG B CA    1 
ATOM   2651  C C     . ARG B 1 40  ? -0.346  -12.516 -102.477 1.00 17.54 ? 18   ARG B C     1 
ATOM   2652  O O     . ARG B 1 40  ? -0.092  -13.729 -102.533 1.00 17.60 ? 18   ARG B O     1 
ATOM   2653  C CB    . ARG B 1 40  ? 1.717   -11.395 -101.583 1.00 17.55 ? 18   ARG B CB    1 
ATOM   2654  C CG    . ARG B 1 40  ? 2.061   -10.632 -102.831 1.00 19.12 ? 18   ARG B CG    1 
ATOM   2655  C CD    . ARG B 1 40  ? 3.481   -10.917 -103.193 1.00 22.66 ? 18   ARG B CD    1 
ATOM   2656  N NE    . ARG B 1 40  ? 3.926   -10.078 -104.292 1.00 28.14 ? 18   ARG B NE    1 
ATOM   2657  C CZ    . ARG B 1 40  ? 3.658   -10.280 -105.585 1.00 35.03 ? 18   ARG B CZ    1 
ATOM   2658  N NH1   . ARG B 1 40  ? 2.932   -11.315 -105.994 1.00 32.87 ? 18   ARG B NH1   1 
ATOM   2659  N NH2   . ARG B 1 40  ? 4.137   -9.428  -106.483 1.00 38.09 ? 18   ARG B NH2   1 
ATOM   2660  N N     . PRO B 1 41  ? -1.131  -11.906 -103.368 1.00 17.22 ? 19   PRO B N     1 
ATOM   2661  C CA    . PRO B 1 41  ? -1.587  -12.647 -104.529 1.00 17.37 ? 19   PRO B CA    1 
ATOM   2662  C C     . PRO B 1 41  ? -0.459  -12.806 -105.544 1.00 17.59 ? 19   PRO B C     1 
ATOM   2663  O O     . PRO B 1 41  ? 0.425   -11.964 -105.601 1.00 17.08 ? 19   PRO B O     1 
ATOM   2664  C CB    . PRO B 1 41  ? -2.726  -11.782 -105.068 1.00 17.31 ? 19   PRO B CB    1 
ATOM   2665  C CG    . PRO B 1 41  ? -2.407  -10.418 -104.614 1.00 17.67 ? 19   PRO B CG    1 
ATOM   2666  C CD    . PRO B 1 41  ? -1.646  -10.530 -103.349 1.00 17.79 ? 19   PRO B CD    1 
ATOM   2667  N N     . LYS B 1 42  ? -0.490  -13.887 -106.312 1.00 18.40 ? 20   LYS B N     1 
ATOM   2668  C CA    . LYS B 1 42  ? 0.544   -14.163 -107.273 1.00 19.37 ? 20   LYS B CA    1 
ATOM   2669  C C     . LYS B 1 42  ? -0.048  -14.658 -108.606 1.00 20.59 ? 20   LYS B C     1 
ATOM   2670  O O     . LYS B 1 42  ? -1.195  -15.160 -108.666 1.00 18.60 ? 20   LYS B O     1 
ATOM   2671  C CB    . LYS B 1 42  ? 1.500   -15.197 -106.686 1.00 20.37 ? 20   LYS B CB    1 
ATOM   2672  C CG    . LYS B 1 42  ? 2.351   -14.691 -105.522 1.00 21.39 ? 20   LYS B CG    1 
ATOM   2673  C CD    . LYS B 1 42  ? 3.135   -15.837 -104.923 1.00 20.34 ? 20   LYS B CD    1 
ATOM   2674  C CE    . LYS B 1 42  ? 4.092   -15.390 -103.811 1.00 20.42 ? 20   LYS B CE    1 
ATOM   2675  N NZ    . LYS B 1 42  ? 4.820   -16.616 -103.248 1.00 18.73 ? 20   LYS B NZ    1 
ATOM   2676  N N     . ARG B 1 43  ? 0.754   -14.510 -109.669 1.00 22.54 ? 21   ARG B N     1 
ATOM   2677  C CA    . ARG B 1 43  ? 0.359   -14.930 -111.011 1.00 25.14 ? 21   ARG B CA    1 
ATOM   2678  C C     . ARG B 1 43  ? 0.168   -16.442 -111.086 1.00 26.27 ? 21   ARG B C     1 
ATOM   2679  O O     . ARG B 1 43  ? 0.959   -17.223 -110.543 1.00 26.39 ? 21   ARG B O     1 
ATOM   2680  C CB    . ARG B 1 43  ? 1.406   -14.507 -112.032 1.00 26.10 ? 21   ARG B CB    1 
ATOM   2681  C CG    . ARG B 1 43  ? 1.446   -13.033 -112.257 1.00 31.50 ? 21   ARG B CG    1 
ATOM   2682  C CD    . ARG B 1 43  ? 2.197   -12.726 -113.519 1.00 38.65 ? 21   ARG B CD    1 
ATOM   2683  N NE    . ARG B 1 43  ? 1.472   -13.170 -114.712 1.00 40.77 ? 21   ARG B NE    1 
ATOM   2684  C CZ    . ARG B 1 43  ? 1.978   -13.170 -115.942 1.00 37.88 ? 21   ARG B CZ    1 
ATOM   2685  N NH1   . ARG B 1 43  ? 3.227   -12.762 -116.161 1.00 38.81 ? 21   ARG B NH1   1 
ATOM   2686  N NH2   . ARG B 1 43  ? 1.231   -13.574 -116.961 1.00 36.13 ? 21   ARG B NH2   1 
ATOM   2687  N N     . SER B 1 44  ? -0.891  -16.848 -111.764 1.00 27.91 ? 22   SER B N     1 
ATOM   2688  C CA    . SER B 1 44  ? -1.166  -18.263 -111.965 1.00 29.00 ? 22   SER B CA    1 
ATOM   2689  C C     . SER B 1 44  ? -2.059  -18.458 -113.175 1.00 31.26 ? 22   SER B C     1 
ATOM   2690  O O     . SER B 1 44  ? -2.517  -17.476 -113.799 1.00 31.49 ? 22   SER B O     1 
ATOM   2691  C CB    . SER B 1 44  ? -1.905  -18.804 -110.747 1.00 29.08 ? 22   SER B CB    1 
ATOM   2692  O OG    . SER B 1 44  ? -3.266  -18.362 -110.729 1.00 28.42 ? 22   SER B OG    1 
ATOM   2693  N N     . SER B 1 45  ? -2.340  -19.726 -113.480 1.00 33.28 ? 23   SER B N     1 
ATOM   2694  C CA    . SER B 1 45  ? -3.274  -20.055 -114.545 1.00 34.26 ? 23   SER B CA    1 
ATOM   2695  C C     . SER B 1 45  ? -4.632  -20.512 -113.984 1.00 35.09 ? 23   SER B C     1 
ATOM   2696  O O     . SER B 1 45  ? -5.481  -21.016 -114.714 1.00 35.94 ? 23   SER B O     1 
ATOM   2697  C CB    . SER B 1 45  ? -2.634  -21.059 -115.495 1.00 34.49 ? 23   SER B CB    1 
ATOM   2698  O OG    . SER B 1 45  ? -1.685  -20.387 -116.312 1.00 34.28 ? 23   SER B OG    1 
ATOM   2699  N N     . LEU B 1 46  ? -4.834  -20.300 -112.685 1.00 36.27 ? 24   LEU B N     1 
ATOM   2700  C CA    . LEU B 1 46  ? -6.075  -20.703 -111.995 1.00 37.50 ? 24   LEU B CA    1 
ATOM   2701  C C     . LEU B 1 46  ? -7.110  -19.584 -112.056 1.00 38.13 ? 24   LEU B C     1 
ATOM   2702  O O     . LEU B 1 46  ? -6.922  -18.518 -111.447 1.00 39.28 ? 24   LEU B O     1 
ATOM   2703  C CB    . LEU B 1 46  ? -5.803  -21.006 -110.507 1.00 37.71 ? 24   LEU B CB    1 
ATOM   2704  C CG    . LEU B 1 46  ? -5.286  -22.391 -110.095 1.00 36.98 ? 24   LEU B CG    1 
ATOM   2705  C CD1   . LEU B 1 46  ? -4.301  -23.007 -111.109 1.00 37.59 ? 24   LEU B CD1   1 
ATOM   2706  C CD2   . LEU B 1 46  ? -4.662  -22.296 -108.714 1.00 35.98 ? 24   LEU B CD2   1 
ATOM   2707  N N     . LYS B 1 47  ? -8.198  -19.804 -112.784 1.00 38.30 ? 25   LYS B N     1 
ATOM   2708  C CA    . LYS B 1 47  ? -9.252  -18.795 -112.843 1.00 37.52 ? 25   LYS B CA    1 
ATOM   2709  C C     . LYS B 1 47  ? -10.126 -18.919 -111.596 1.00 36.10 ? 25   LYS B C     1 
ATOM   2710  O O     . LYS B 1 47  ? -10.222 -17.984 -110.785 1.00 35.44 ? 25   LYS B O     1 
ATOM   2711  C CB    . LYS B 1 47  ? -10.111 -18.953 -114.102 1.00 37.16 ? 25   LYS B CB    1 
ATOM   2712  N N     . SER B 1 48  ? -10.728 -20.101 -111.444 1.00 34.40 ? 26   SER B N     1 
ATOM   2713  C CA    . SER B 1 48  ? -11.813 -20.327 -110.487 1.00 32.19 ? 26   SER B CA    1 
ATOM   2714  C C     . SER B 1 48  ? -11.391 -21.210 -109.316 1.00 29.74 ? 26   SER B C     1 
ATOM   2715  O O     . SER B 1 48  ? -10.521 -22.084 -109.454 1.00 28.80 ? 26   SER B O     1 
ATOM   2716  C CB    . SER B 1 48  ? -13.003 -20.964 -111.213 1.00 32.71 ? 26   SER B CB    1 
ATOM   2717  O OG    . SER B 1 48  ? -12.675 -22.273 -111.672 1.00 34.49 ? 26   SER B OG    1 
ATOM   2718  N N     . ARG B 1 49  ? -12.040 -20.968 -108.175 1.00 27.81 ? 27   ARG B N     1 
ATOM   2719  C CA    . ARG B 1 49  ? -11.739 -21.627 -106.909 1.00 25.79 ? 27   ARG B CA    1 
ATOM   2720  C C     . ARG B 1 49  ? -12.160 -23.093 -106.902 1.00 24.08 ? 27   ARG B C     1 
ATOM   2721  O O     . ARG B 1 49  ? -11.590 -23.899 -106.176 1.00 21.29 ? 27   ARG B O     1 
ATOM   2722  C CB    . ARG B 1 49  ? -12.423 -20.866 -105.751 1.00 26.53 ? 27   ARG B CB    1 
ATOM   2723  C CG    . ARG B 1 49  ? -13.878 -21.291 -105.462 1.00 29.44 ? 27   ARG B CG    1 
ATOM   2724  C CD    . ARG B 1 49  ? -14.810 -20.134 -105.045 1.00 31.23 ? 27   ARG B CD    1 
ATOM   2725  N NE    . ARG B 1 49  ? -15.087 -20.044 -103.603 1.00 33.63 ? 27   ARG B NE    1 
ATOM   2726  C CZ    . ARG B 1 49  ? -16.120 -19.377 -103.071 1.00 38.56 ? 27   ARG B CZ    1 
ATOM   2727  N NH1   . ARG B 1 49  ? -17.008 -18.745 -103.841 1.00 40.48 ? 27   ARG B NH1   1 
ATOM   2728  N NH2   . ARG B 1 49  ? -16.282 -19.339 -101.758 1.00 38.37 ? 27   ARG B NH2   1 
ATOM   2729  N N     . ALA B 1 50  ? -13.146 -23.444 -107.713 1.00 24.10 ? 28   ALA B N     1 
ATOM   2730  C CA    . ALA B 1 50  ? -13.604 -24.831 -107.778 1.00 25.28 ? 28   ALA B CA    1 
ATOM   2731  C C     . ALA B 1 50  ? -12.521 -25.768 -108.311 1.00 25.64 ? 28   ALA B C     1 
ATOM   2732  O O     . ALA B 1 50  ? -12.489 -26.937 -107.958 1.00 26.10 ? 28   ALA B O     1 
ATOM   2733  C CB    . ALA B 1 50  ? -14.866 -24.936 -108.628 1.00 25.65 ? 28   ALA B CB    1 
ATOM   2734  N N     . GLU B 1 51  ? -11.632 -25.234 -109.147 1.00 26.17 ? 29   GLU B N     1 
ATOM   2735  C CA    . GLU B 1 51  ? -10.462 -25.967 -109.651 1.00 26.72 ? 29   GLU B CA    1 
ATOM   2736  C C     . GLU B 1 51  ? -9.545  -26.518 -108.532 1.00 26.07 ? 29   GLU B C     1 
ATOM   2737  O O     . GLU B 1 51  ? -8.835  -27.511 -108.743 1.00 28.14 ? 29   GLU B O     1 
ATOM   2738  C CB    . GLU B 1 51  ? -9.645  -25.063 -110.591 1.00 27.49 ? 29   GLU B CB    1 
ATOM   2739  N N     . VAL B 1 52  ? -9.576  -25.897 -107.350 1.00 23.23 ? 30   VAL B N     1 
ATOM   2740  C CA    . VAL B 1 52  ? -8.627  -26.211 -106.277 1.00 20.37 ? 30   VAL B CA    1 
ATOM   2741  C C     . VAL B 1 52  ? -8.949  -27.482 -105.460 1.00 19.08 ? 30   VAL B C     1 
ATOM   2742  O O     . VAL B 1 52  ? -10.051 -27.649 -104.951 1.00 18.31 ? 30   VAL B O     1 
ATOM   2743  C CB    . VAL B 1 52  ? -8.479  -24.994 -105.329 1.00 19.66 ? 30   VAL B CB    1 
ATOM   2744  C CG1   . VAL B 1 52  ? -7.577  -25.325 -104.160 1.00 17.33 ? 30   VAL B CG1   1 
ATOM   2745  C CG2   . VAL B 1 52  ? -7.941  -23.811 -106.097 1.00 18.02 ? 30   VAL B CG2   1 
ATOM   2746  N N     . ASP B 1 53  ? -7.945  -28.348 -105.324 1.00 18.80 ? 31   ASP B N     1 
ATOM   2747  C CA    . ASP B 1 53  ? -8.031  -29.581 -104.540 1.00 19.69 ? 31   ASP B CA    1 
ATOM   2748  C C     . ASP B 1 53  ? -7.522  -29.338 -103.117 1.00 19.11 ? 31   ASP B C     1 
ATOM   2749  O O     . ASP B 1 53  ? -6.324  -29.074 -102.906 1.00 17.32 ? 31   ASP B O     1 
ATOM   2750  C CB    . ASP B 1 53  ? -7.183  -30.671 -105.205 1.00 20.89 ? 31   ASP B CB    1 
ATOM   2751  C CG    . ASP B 1 53  ? -7.297  -32.040 -104.514 1.00 26.93 ? 31   ASP B CG    1 
ATOM   2752  O OD1   . ASP B 1 53  ? -8.328  -32.341 -103.861 1.00 33.87 ? 31   ASP B OD1   1 
ATOM   2753  O OD2   . ASP B 1 53  ? -6.344  -32.834 -104.649 1.00 30.91 ? 31   ASP B OD2   1 
ATOM   2754  N N     . LEU B 1 54  ? -8.422  -29.436 -102.138 1.00 18.72 ? 32   LEU B N     1 
ATOM   2755  C CA    . LEU B 1 54  ? -8.059  -29.223 -100.735 1.00 19.02 ? 32   LEU B CA    1 
ATOM   2756  C C     . LEU B 1 54  ? -7.582  -30.494 -100.030 1.00 20.58 ? 32   LEU B C     1 
ATOM   2757  O O     . LEU B 1 54  ? -6.931  -30.422 -98.986  1.00 20.46 ? 32   LEU B O     1 
ATOM   2758  C CB    . LEU B 1 54  ? -9.237  -28.632 -99.960  1.00 18.97 ? 32   LEU B CB    1 
ATOM   2759  C CG    . LEU B 1 54  ? -9.601  -27.181 -100.260 1.00 17.74 ? 32   LEU B CG    1 
ATOM   2760  C CD1   . LEU B 1 54  ? -10.608 -26.683 -99.233  1.00 21.10 ? 32   LEU B CD1   1 
ATOM   2761  C CD2   . LEU B 1 54  ? -8.357  -26.266 -100.297 1.00 15.27 ? 32   LEU B CD2   1 
ATOM   2762  N N     . GLU B 1 55  ? -7.930  -31.651 -100.583 1.00 22.77 ? 33   GLU B N     1 
ATOM   2763  C CA    . GLU B 1 55  ? -7.400  -32.926 -100.122 1.00 23.92 ? 33   GLU B CA    1 
ATOM   2764  C C     . GLU B 1 55  ? -5.849  -32.945 -100.062 1.00 23.18 ? 33   GLU B C     1 
ATOM   2765  O O     . GLU B 1 55  ? -5.167  -32.464 -100.964 1.00 22.65 ? 33   GLU B O     1 
ATOM   2766  C CB    . GLU B 1 55  ? -7.873  -34.071 -101.032 1.00 24.45 ? 33   GLU B CB    1 
ATOM   2767  C CG    . GLU B 1 55  ? -9.048  -34.898 -100.500 1.00 31.25 ? 33   GLU B CG    1 
ATOM   2768  C CD    . GLU B 1 55  ? -8.830  -36.423 -100.641 1.00 40.60 ? 33   GLU B CD    1 
ATOM   2769  O OE1   . GLU B 1 55  ? -9.787  -37.179 -100.361 1.00 45.59 ? 33   GLU B OE1   1 
ATOM   2770  O OE2   . GLU B 1 55  ? -7.712  -36.875 -101.009 1.00 42.35 ? 33   GLU B OE2   1 
ATOM   2771  N N     . ARG B 1 56  ? -5.334  -33.495 -98.966  1.00 23.70 ? 34   ARG B N     1 
ATOM   2772  C CA    A ARG B 1 56  ? -3.896  -33.687 -98.729  0.50 23.32 ? 34   ARG B CA    1 
ATOM   2773  C CA    B ARG B 1 56  ? -3.900  -33.696 -98.779  0.50 23.69 ? 34   ARG B CA    1 
ATOM   2774  C C     . ARG B 1 56  ? -3.666  -35.151 -98.387  1.00 23.54 ? 34   ARG B C     1 
ATOM   2775  O O     . ARG B 1 56  ? -4.513  -35.781 -97.738  1.00 22.69 ? 34   ARG B O     1 
ATOM   2776  C CB    A ARG B 1 56  ? -3.399  -32.856 -97.532  0.50 23.37 ? 34   ARG B CB    1 
ATOM   2777  C CB    B ARG B 1 56  ? -3.344  -32.772 -97.686  0.50 23.97 ? 34   ARG B CB    1 
ATOM   2778  C CG    A ARG B 1 56  ? -3.236  -31.352 -97.752  0.50 20.90 ? 34   ARG B CG    1 
ATOM   2779  C CG    B ARG B 1 56  ? -2.500  -31.568 -98.175  0.50 23.91 ? 34   ARG B CG    1 
ATOM   2780  C CD    A ARG B 1 56  ? -2.150  -31.008 -98.775  0.50 18.97 ? 34   ARG B CD    1 
ATOM   2781  C CD    B ARG B 1 56  ? -1.142  -31.550 -97.470  0.50 20.68 ? 34   ARG B CD    1 
ATOM   2782  N NE    A ARG B 1 56  ? -0.847  -30.626 -98.214  0.50 11.27 ? 34   ARG B NE    1 
ATOM   2783  N NE    B ARG B 1 56  ? -0.538  -30.233 -97.252  0.50 19.97 ? 34   ARG B NE    1 
ATOM   2784  C CZ    A ARG B 1 56  ? 0.249   -31.387 -98.200  0.50 4.32  ? 34   ARG B CZ    1 
ATOM   2785  C CZ    B ARG B 1 56  ? -0.957  -29.317 -96.374  0.50 20.74 ? 34   ARG B CZ    1 
ATOM   2786  N NH1   A ARG B 1 56  ? 0.233   -32.620 -98.679  0.50 8.16  ? 34   ARG B NH1   1 
ATOM   2787  N NH1   B ARG B 1 56  ? -2.040  -29.503 -95.625  0.50 14.92 ? 34   ARG B NH1   1 
ATOM   2788  N NH2   A ARG B 1 56  ? 1.380   -30.910 -97.692  0.50 2.00  ? 34   ARG B NH2   1 
ATOM   2789  N NH2   B ARG B 1 56  ? -0.294  -28.174 -96.261  0.50 27.39 ? 34   ARG B NH2   1 
ATOM   2790  N N     . THR B 1 57  ? -2.524  -35.685 -98.808  1.00 23.06 ? 35   THR B N     1 
ATOM   2791  C CA    . THR B 1 57  ? -2.141  -37.042 -98.474  1.00 22.95 ? 35   THR B CA    1 
ATOM   2792  C C     . THR B 1 57  ? -0.856  -36.992 -97.667  1.00 22.59 ? 35   THR B C     1 
ATOM   2793  O O     . THR B 1 57  ? 0.179   -36.522 -98.155  1.00 22.23 ? 35   THR B O     1 
ATOM   2794  C CB    . THR B 1 57  ? -1.989  -37.946 -99.744  1.00 23.37 ? 35   THR B CB    1 
ATOM   2795  O OG1   . THR B 1 57  ? -3.254  -38.087 -100.391 1.00 19.25 ? 35   THR B OG1   1 
ATOM   2796  C CG2   . THR B 1 57  ? -1.480  -39.369 -99.381  1.00 24.02 ? 35   THR B CG2   1 
ATOM   2797  N N     . PHE B 1 58  ? -0.927  -37.493 -96.435  1.00 22.50 ? 36   PHE B N     1 
ATOM   2798  C CA    . PHE B 1 58  ? 0.213   -37.513 -95.514  1.00 22.14 ? 36   PHE B CA    1 
ATOM   2799  C C     . PHE B 1 58  ? 0.611   -38.938 -95.164  1.00 21.44 ? 36   PHE B C     1 
ATOM   2800  O O     . PHE B 1 58  ? -0.240  -39.775 -94.912  1.00 20.11 ? 36   PHE B O     1 
ATOM   2801  C CB    . PHE B 1 58  ? -0.129  -36.783 -94.203  1.00 21.85 ? 36   PHE B CB    1 
ATOM   2802  C CG    . PHE B 1 58  ? -0.252  -35.300 -94.345  1.00 19.75 ? 36   PHE B CG    1 
ATOM   2803  C CD1   . PHE B 1 58  ? 0.800   -34.544 -94.841  1.00 22.78 ? 36   PHE B CD1   1 
ATOM   2804  C CD2   . PHE B 1 58  ? -1.409  -34.657 -93.977  1.00 20.89 ? 36   PHE B CD2   1 
ATOM   2805  C CE1   . PHE B 1 58  ? 0.701   -33.172 -94.959  1.00 19.18 ? 36   PHE B CE1   1 
ATOM   2806  C CE2   . PHE B 1 58  ? -1.524  -33.281 -94.102  1.00 24.03 ? 36   PHE B CE2   1 
ATOM   2807  C CZ    . PHE B 1 58  ? -0.457  -32.544 -94.585  1.00 22.46 ? 36   PHE B CZ    1 
ATOM   2808  N N     . THR B 1 59  ? 1.910   -39.188 -95.140  1.00 22.01 ? 37   THR B N     1 
ATOM   2809  C CA    . THR B 1 59  ? 2.459   -40.424 -94.593  1.00 23.40 ? 37   THR B CA    1 
ATOM   2810  C C     . THR B 1 59  ? 3.240   -40.076 -93.329  1.00 23.78 ? 37   THR B C     1 
ATOM   2811  O O     . THR B 1 59  ? 4.304   -39.443 -93.401  1.00 25.14 ? 37   THR B O     1 
ATOM   2812  C CB    . THR B 1 59  ? 3.405   -41.129 -95.606  1.00 23.81 ? 37   THR B CB    1 
ATOM   2813  O OG1   . THR B 1 59  ? 2.632   -41.718 -96.663  1.00 24.89 ? 37   THR B OG1   1 
ATOM   2814  C CG2   . THR B 1 59  ? 4.221   -42.224 -94.934  1.00 25.66 ? 37   THR B CG2   1 
ATOM   2815  N N     . PHE B 1 60  ? 2.733   -40.513 -92.178  1.00 22.11 ? 38   PHE B N     1 
ATOM   2816  C CA    . PHE B 1 60  ? 3.308   -40.120 -90.895  1.00 20.80 ? 38   PHE B CA    1 
ATOM   2817  C C     . PHE B 1 60  ? 4.638   -40.811 -90.550  1.00 20.74 ? 38   PHE B C     1 
ATOM   2818  O O     . PHE B 1 60  ? 4.923   -41.946 -90.968  1.00 20.45 ? 38   PHE B O     1 
ATOM   2819  C CB    . PHE B 1 60  ? 2.280   -40.331 -89.806  1.00 20.18 ? 38   PHE B CB    1 
ATOM   2820  C CG    . PHE B 1 60  ? 0.979   -39.698 -90.135  1.00 19.43 ? 38   PHE B CG    1 
ATOM   2821  C CD1   . PHE B 1 60  ? 0.879   -38.326 -90.187  1.00 20.16 ? 38   PHE B CD1   1 
ATOM   2822  C CD2   . PHE B 1 60  ? -0.127  -40.471 -90.476  1.00 20.74 ? 38   PHE B CD2   1 
ATOM   2823  C CE1   . PHE B 1 60  ? -0.305  -37.727 -90.533  1.00 20.88 ? 38   PHE B CE1   1 
ATOM   2824  C CE2   . PHE B 1 60  ? -1.327  -39.876 -90.814  1.00 15.37 ? 38   PHE B CE2   1 
ATOM   2825  C CZ    . PHE B 1 60  ? -1.414  -38.500 -90.836  1.00 16.14 ? 38   PHE B CZ    1 
ATOM   2826  N N     . ARG B 1 61  ? 5.449   -40.103 -89.769  1.00 20.46 ? 39   ARG B N     1 
ATOM   2827  C CA    . ARG B 1 61  ? 6.846   -40.471 -89.570  1.00 20.25 ? 39   ARG B CA    1 
ATOM   2828  C C     . ARG B 1 61  ? 7.016   -41.701 -88.707  1.00 19.48 ? 39   ARG B C     1 
ATOM   2829  O O     . ARG B 1 61  ? 7.844   -42.559 -88.999  1.00 20.86 ? 39   ARG B O     1 
ATOM   2830  C CB    . ARG B 1 61  ? 7.591   -39.312 -88.909  1.00 19.78 ? 39   ARG B CB    1 
ATOM   2831  C CG    . ARG B 1 61  ? 9.074   -39.535 -88.713  1.00 20.69 ? 39   ARG B CG    1 
ATOM   2832  C CD    . ARG B 1 61  ? 9.566   -38.554 -87.698  1.00 22.19 ? 39   ARG B CD    1 
ATOM   2833  N NE    . ARG B 1 61  ? 11.017  -38.569 -87.577  1.00 24.37 ? 39   ARG B NE    1 
ATOM   2834  C CZ    . ARG B 1 61  ? 11.710  -39.241 -86.660  1.00 24.29 ? 39   ARG B CZ    1 
ATOM   2835  N NH1   . ARG B 1 61  ? 11.118  -40.028 -85.753  1.00 21.36 ? 39   ARG B NH1   1 
ATOM   2836  N NH2   . ARG B 1 61  ? 13.031  -39.133 -86.677  1.00 22.46 ? 39   ARG B NH2   1 
ATOM   2837  N N     . ASN B 1 62  ? 6.267   -41.746 -87.614  1.00 18.60 ? 40   ASN B N     1 
ATOM   2838  C CA    . ASN B 1 62  ? 6.455   -42.757 -86.595  1.00 17.13 ? 40   ASN B CA    1 
ATOM   2839  C C     . ASN B 1 62  ? 5.449   -43.880 -86.733  1.00 16.28 ? 40   ASN B C     1 
ATOM   2840  O O     . ASN B 1 62  ? 5.834   -45.039 -86.651  1.00 16.80 ? 40   ASN B O     1 
ATOM   2841  C CB    . ASN B 1 62  ? 6.422   -42.098 -85.204  1.00 16.35 ? 40   ASN B CB    1 
ATOM   2842  C CG    . ASN B 1 62  ? 7.535   -41.083 -85.029  1.00 16.87 ? 40   ASN B CG    1 
ATOM   2843  O OD1   . ASN B 1 62  ? 8.691   -41.444 -85.116  1.00 15.17 ? 40   ASN B OD1   1 
ATOM   2844  N ND2   . ASN B 1 62  ? 7.196   -39.811 -84.813  1.00 15.22 ? 40   ASN B ND2   1 
ATOM   2845  N N     . SER B 1 63  ? 4.179   -43.544 -86.966  1.00 16.38 ? 41   SER B N     1 
ATOM   2846  C CA    . SER B 1 63  ? 3.123   -44.548 -87.149  1.00 16.62 ? 41   SER B CA    1 
ATOM   2847  C C     . SER B 1 63  ? 3.270   -45.243 -88.509  1.00 17.38 ? 41   SER B C     1 
ATOM   2848  O O     . SER B 1 63  ? 2.852   -46.394 -88.681  1.00 18.03 ? 41   SER B O     1 
ATOM   2849  C CB    . SER B 1 63  ? 1.738   -43.912 -87.018  1.00 16.09 ? 41   SER B CB    1 
ATOM   2850  O OG    . SER B 1 63  ? 1.410   -43.157 -88.173  1.00 14.76 ? 41   SER B OG    1 
ATOM   2851  N N     . LYS B 1 64  ? 3.870   -44.533 -89.468  1.00 19.08 ? 42   LYS B N     1 
ATOM   2852  C CA    . LYS B 1 64  ? 4.023   -45.007 -90.845  1.00 19.25 ? 42   LYS B CA    1 
ATOM   2853  C C     . LYS B 1 64  ? 2.696   -45.168 -91.572  1.00 19.28 ? 42   LYS B C     1 
ATOM   2854  O O     . LYS B 1 64  ? 2.665   -45.741 -92.660  1.00 20.40 ? 42   LYS B O     1 
ATOM   2855  C CB    . LYS B 1 64  ? 4.793   -46.317 -90.872  1.00 20.33 ? 42   LYS B CB    1 
ATOM   2856  C CG    . LYS B 1 64  ? 6.117   -46.293 -90.100  1.00 24.48 ? 42   LYS B CG    1 
ATOM   2857  C CD    . LYS B 1 64  ? 7.158   -45.401 -90.777  1.00 27.63 ? 42   LYS B CD    1 
ATOM   2858  C CE    . LYS B 1 64  ? 8.488   -45.490 -90.067  1.00 30.56 ? 42   LYS B CE    1 
ATOM   2859  N NZ    . LYS B 1 64  ? 8.985   -46.893 -89.975  1.00 32.88 ? 42   LYS B NZ    1 
ATOM   2860  N N     . GLN B 1 65  ? 1.609   -44.644 -90.998  1.00 19.86 ? 43   GLN B N     1 
ATOM   2861  C CA    . GLN B 1 65  ? 0.283   -44.701 -91.623  1.00 19.80 ? 43   GLN B CA    1 
ATOM   2862  C C     . GLN B 1 65  ? 0.192   -43.633 -92.700  1.00 19.89 ? 43   GLN B C     1 
ATOM   2863  O O     . GLN B 1 65  ? 1.012   -42.714 -92.741  1.00 19.81 ? 43   GLN B O     1 
ATOM   2864  C CB    . GLN B 1 65  ? -0.819  -44.471 -90.588  1.00 19.31 ? 43   GLN B CB    1 
ATOM   2865  C CG    . GLN B 1 65  ? -0.764  -45.374 -89.394  1.00 21.92 ? 43   GLN B CG    1 
ATOM   2866  C CD    . GLN B 1 65  ? -0.961  -46.816 -89.754  1.00 25.43 ? 43   GLN B CD    1 
ATOM   2867  O OE1   . GLN B 1 65  ? -0.006  -47.595 -89.762  1.00 19.57 ? 43   GLN B OE1   1 
ATOM   2868  N NE2   . GLN B 1 65  ? -2.210  -47.194 -90.040  1.00 23.43 ? 43   GLN B NE2   1 
ATOM   2869  N N     . THR B 1 66  ? -0.805  -43.762 -93.570  1.00 19.60 ? 44   THR B N     1 
ATOM   2870  C CA    . THR B 1 66  ? -1.093  -42.729 -94.546  1.00 19.18 ? 44   THR B CA    1 
ATOM   2871  C C     . THR B 1 66  ? -2.489  -42.174 -94.264  1.00 19.07 ? 44   THR B C     1 
ATOM   2872  O O     . THR B 1 66  ? -3.386  -42.916 -93.901  1.00 16.44 ? 44   THR B O     1 
ATOM   2873  C CB    . THR B 1 66  ? -0.927  -43.240 -95.995  1.00 20.04 ? 44   THR B CB    1 
ATOM   2874  O OG1   . THR B 1 66  ? 0.313   -43.950 -96.102  1.00 23.32 ? 44   THR B OG1   1 
ATOM   2875  C CG2   . THR B 1 66  ? -0.890  -42.076 -96.978  1.00 19.50 ? 44   THR B CG2   1 
ATOM   2876  N N     . TYR B 1 67  ? -2.627  -40.853 -94.405  1.00 20.43 ? 45   TYR B N     1 
ATOM   2877  C CA    . TYR B 1 67  ? -3.896  -40.136 -94.249  1.00 20.23 ? 45   TYR B CA    1 
ATOM   2878  C C     . TYR B 1 67  ? -4.221  -39.457 -95.566  1.00 20.32 ? 45   TYR B C     1 
ATOM   2879  O O     . TYR B 1 67  ? -3.316  -38.962 -96.234  1.00 20.63 ? 45   TYR B O     1 
ATOM   2880  C CB    . TYR B 1 67  ? -3.806  -39.064 -93.125  1.00 19.71 ? 45   TYR B CB    1 
ATOM   2881  C CG    . TYR B 1 67  ? -4.877  -37.951 -93.167  1.00 20.99 ? 45   TYR B CG    1 
ATOM   2882  C CD1   . TYR B 1 67  ? -6.187  -38.181 -92.704  1.00 23.06 ? 45   TYR B CD1   1 
ATOM   2883  C CD2   . TYR B 1 67  ? -4.582  -36.682 -93.689  1.00 20.17 ? 45   TYR B CD2   1 
ATOM   2884  C CE1   . TYR B 1 67  ? -7.192  -37.165 -92.775  1.00 22.87 ? 45   TYR B CE1   1 
ATOM   2885  C CE2   . TYR B 1 67  ? -5.556  -35.673 -93.771  1.00 21.09 ? 45   TYR B CE2   1 
ATOM   2886  C CZ    . TYR B 1 67  ? -6.870  -35.913 -93.306  1.00 24.37 ? 45   TYR B CZ    1 
ATOM   2887  O OH    . TYR B 1 67  ? -7.849  -34.919 -93.367  1.00 17.04 ? 45   TYR B OH    1 
ATOM   2888  N N     . SER B 1 68  ? -5.503  -39.444 -95.940  1.00 19.20 ? 46   SER B N     1 
ATOM   2889  C CA    . SER B 1 68  ? -5.981  -38.570 -97.010  1.00 19.73 ? 46   SER B CA    1 
ATOM   2890  C C     . SER B 1 68  ? -7.269  -37.860 -96.607  1.00 18.36 ? 46   SER B C     1 
ATOM   2891  O O     . SER B 1 68  ? -8.217  -38.483 -96.140  1.00 17.11 ? 46   SER B O     1 
ATOM   2892  C CB    . SER B 1 68  ? -6.195  -39.354 -98.309  1.00 20.54 ? 46   SER B CB    1 
ATOM   2893  O OG    . SER B 1 68  ? -4.987  -39.408 -99.060  1.00 26.23 ? 46   SER B OG    1 
ATOM   2894  N N     . GLY B 1 69  ? -7.295  -36.548 -96.793  1.00 17.57 ? 47   GLY B N     1 
ATOM   2895  C CA    . GLY B 1 69  ? -8.496  -35.779 -96.518  1.00 16.64 ? 47   GLY B CA    1 
ATOM   2896  C C     . GLY B 1 69  ? -8.185  -34.305 -96.548  1.00 16.30 ? 47   GLY B C     1 
ATOM   2897  O O     . GLY B 1 69  ? -7.061  -33.897 -96.863  1.00 12.78 ? 47   GLY B O     1 
ATOM   2898  N N     . ILE B 1 70  ? -9.205  -33.513 -96.243  1.00 17.78 ? 48   ILE B N     1 
ATOM   2899  C CA    . ILE B 1 70  ? -9.059  -32.092 -96.052  1.00 18.99 ? 48   ILE B CA    1 
ATOM   2900  C C     . ILE B 1 70  ? -8.598  -31.921 -94.601  1.00 19.26 ? 48   ILE B C     1 
ATOM   2901  O O     . ILE B 1 70  ? -9.357  -32.198 -93.670  1.00 20.83 ? 48   ILE B O     1 
ATOM   2902  C CB    . ILE B 1 70  ? -10.366 -31.329 -96.325  1.00 18.44 ? 48   ILE B CB    1 
ATOM   2903  C CG1   . ILE B 1 70  ? -10.765 -31.499 -97.793  1.00 19.80 ? 48   ILE B CG1   1 
ATOM   2904  C CG2   . ILE B 1 70  ? -10.193 -29.845 -95.995  1.00 20.39 ? 48   ILE B CG2   1 
ATOM   2905  C CD1   . ILE B 1 70  ? -12.080 -30.807 -98.187  1.00 16.08 ? 48   ILE B CD1   1 
ATOM   2906  N N     . PRO B 1 71  ? -7.349  -31.476 -94.412  1.00 17.50 ? 49   PRO B N     1 
ATOM   2907  C CA    . PRO B 1 71  ? -6.656  -31.475 -93.130  1.00 16.68 ? 49   PRO B CA    1 
ATOM   2908  C C     . PRO B 1 71  ? -7.079  -30.355 -92.186  1.00 17.09 ? 49   PRO B C     1 
ATOM   2909  O O     . PRO B 1 71  ? -6.245  -29.622 -91.663  1.00 17.45 ? 49   PRO B O     1 
ATOM   2910  C CB    . PRO B 1 71  ? -5.206  -31.309 -93.550  1.00 18.22 ? 49   PRO B CB    1 
ATOM   2911  C CG    . PRO B 1 71  ? -5.299  -30.466 -94.773  1.00 19.47 ? 49   PRO B CG    1 
ATOM   2912  C CD    . PRO B 1 71  ? -6.515  -30.911 -95.484  1.00 16.84 ? 49   PRO B CD    1 
ATOM   2913  N N     . ILE B 1 72  ? -8.379  -30.217 -92.006  1.00 18.51 ? 50   ILE B N     1 
ATOM   2914  C CA    . ILE B 1 72  ? -8.944  -29.285 -91.079  1.00 18.94 ? 50   ILE B CA    1 
ATOM   2915  C C     . ILE B 1 72  ? -9.622  -30.133 -90.032  1.00 18.93 ? 50   ILE B C     1 
ATOM   2916  O O     . ILE B 1 72  ? -10.399 -31.036 -90.366  1.00 18.45 ? 50   ILE B O     1 
ATOM   2917  C CB    . ILE B 1 72  ? -9.906  -28.340 -91.803  1.00 19.54 ? 50   ILE B CB    1 
ATOM   2918  C CG1   . ILE B 1 72  ? -9.109  -27.552 -92.849  1.00 19.86 ? 50   ILE B CG1   1 
ATOM   2919  C CG2   . ILE B 1 72  ? -10.601 -27.421 -90.808  1.00 23.18 ? 50   ILE B CG2   1 
ATOM   2920  C CD1   . ILE B 1 72  ? -9.758  -26.307 -93.374  1.00 25.10 ? 50   ILE B CD1   1 
ATOM   2921  N N     . ILE B 1 73  ? -9.292  -29.866 -88.770  1.00 19.17 ? 51   ILE B N     1 
ATOM   2922  C CA    . ILE B 1 73  ? -9.700  -30.716 -87.638  1.00 17.99 ? 51   ILE B CA    1 
ATOM   2923  C C     . ILE B 1 73  ? -10.612 -29.950 -86.685  1.00 17.99 ? 51   ILE B C     1 
ATOM   2924  O O     . ILE B 1 73  ? -10.316 -28.826 -86.292  1.00 19.68 ? 51   ILE B O     1 
ATOM   2925  C CB    . ILE B 1 73  ? -8.477  -31.190 -86.821  1.00 17.60 ? 51   ILE B CB    1 
ATOM   2926  C CG1   . ILE B 1 73  ? -7.419  -31.843 -87.717  1.00 20.01 ? 51   ILE B CG1   1 
ATOM   2927  C CG2   . ILE B 1 73  ? -8.907  -32.154 -85.718  1.00 15.86 ? 51   ILE B CG2   1 
ATOM   2928  C CD1   . ILE B 1 73  ? -6.038  -31.948 -87.041  1.00 17.94 ? 51   ILE B CD1   1 
ATOM   2929  N N     . VAL B 1 74  ? -11.718 -30.551 -86.289  1.00 15.32 ? 52   VAL B N     1 
ATOM   2930  C CA    . VAL B 1 74  ? -12.496 -29.943 -85.214  1.00 14.42 ? 52   VAL B CA    1 
ATOM   2931  C C     . VAL B 1 74  ? -11.756 -30.262 -83.913  1.00 14.43 ? 52   VAL B C     1 
ATOM   2932  O O     . VAL B 1 74  ? -11.409 -31.398 -83.659  1.00 14.03 ? 52   VAL B O     1 
ATOM   2933  C CB    . VAL B 1 74  ? -13.977 -30.452 -85.116  1.00 14.40 ? 52   VAL B CB    1 
ATOM   2934  C CG1   . VAL B 1 74  ? -14.769 -29.569 -84.142  1.00 12.89 ? 52   VAL B CG1   1 
ATOM   2935  C CG2   . VAL B 1 74  ? -14.639 -30.490 -86.476  1.00 11.55 ? 52   VAL B CG2   1 
ATOM   2936  N N     . ALA B 1 75  ? -11.534 -29.257 -83.081  1.00 15.99 ? 53   ALA B N     1 
ATOM   2937  C CA    . ALA B 1 75  ? -10.816 -29.465 -81.814  1.00 16.31 ? 53   ALA B CA    1 
ATOM   2938  C C     . ALA B 1 75  ? -11.619 -30.383 -80.869  1.00 17.78 ? 53   ALA B C     1 
ATOM   2939  O O     . ALA B 1 75  ? -12.853 -30.398 -80.873  1.00 17.04 ? 53   ALA B O     1 
ATOM   2940  C CB    . ALA B 1 75  ? -10.485 -28.132 -81.125  1.00 13.26 ? 53   ALA B CB    1 
ATOM   2941  N N     . ASN B 1 76  ? -10.873 -31.110 -80.039  1.00 19.14 ? 54   ASN B N     1 
ATOM   2942  C CA    . ASN B 1 76  ? -11.402 -32.043 -79.062  1.00 17.93 ? 54   ASN B CA    1 
ATOM   2943  C C     . ASN B 1 76  ? -11.988 -31.376 -77.846  1.00 16.71 ? 54   ASN B C     1 
ATOM   2944  O O     . ASN B 1 76  ? -11.698 -31.781 -76.726  1.00 18.79 ? 54   ASN B O     1 
ATOM   2945  C CB    . ASN B 1 76  ? -10.318 -33.059 -78.610  1.00 19.83 ? 54   ASN B CB    1 
ATOM   2946  C CG    . ASN B 1 76  ? -8.857  -32.457 -78.485  1.00 21.27 ? 54   ASN B CG    1 
ATOM   2947  O OD1   . ASN B 1 76  ? -8.569  -31.301 -78.839  1.00 14.72 ? 54   ASN B OD1   1 
ATOM   2948  N ND2   . ASN B 1 76  ? -7.934  -33.302 -78.011  1.00 16.16 ? 54   ASN B ND2   1 
ATOM   2949  N N     . MET B 1 77  ? -12.847 -30.390 -78.070  1.00 15.73 ? 55   MET B N     1 
ATOM   2950  C CA    . MET B 1 77  ? -13.556 -29.720 -77.019  1.00 16.39 ? 55   MET B CA    1 
ATOM   2951  C C     . MET B 1 77  ? -14.974 -30.345 -76.837  1.00 17.11 ? 55   MET B C     1 
ATOM   2952  O O     . MET B 1 77  ? -15.501 -31.023 -77.727  1.00 17.10 ? 55   MET B O     1 
ATOM   2953  C CB    . MET B 1 77  ? -13.642 -28.239 -77.353  1.00 16.92 ? 55   MET B CB    1 
ATOM   2954  C CG    . MET B 1 77  ? -12.296 -27.603 -77.669  1.00 16.72 ? 55   MET B CG    1 
ATOM   2955  S SD    . MET B 1 77  ? -12.406 -25.830 -77.976  1.00 23.33 ? 55   MET B SD    1 
ATOM   2956  C CE    . MET B 1 77  ? -12.884 -25.235 -76.348  1.00 23.53 ? 55   MET B CE    1 
ATOM   2957  N N     . ASP B 1 78  ? -15.578 -30.094 -75.679  1.00 19.68 ? 56   ASP B N     1 
ATOM   2958  C CA    . ASP B 1 78  ? -16.839 -30.735 -75.286  1.00 22.23 ? 56   ASP B CA    1 
ATOM   2959  C C     . ASP B 1 78  ? -17.993 -30.466 -76.229  1.00 21.79 ? 56   ASP B C     1 
ATOM   2960  O O     . ASP B 1 78  ? -18.833 -31.347 -76.454  1.00 23.64 ? 56   ASP B O     1 
ATOM   2961  C CB    . ASP B 1 78  ? -17.282 -30.284 -73.889  1.00 24.29 ? 56   ASP B CB    1 
ATOM   2962  C CG    . ASP B 1 78  ? -16.627 -31.083 -72.773  1.00 29.56 ? 56   ASP B CG    1 
ATOM   2963  O OD1   . ASP B 1 78  ? -16.810 -32.324 -72.747  1.00 31.88 ? 56   ASP B OD1   1 
ATOM   2964  O OD2   . ASP B 1 78  ? -15.937 -30.459 -71.927  1.00 36.19 ? 56   ASP B OD2   1 
ATOM   2965  N N     . THR B 1 79  ? -18.050 -29.251 -76.758  1.00 20.53 ? 57   THR B N     1 
ATOM   2966  C CA    . THR B 1 79  ? -19.206 -28.831 -77.534  1.00 21.58 ? 57   THR B CA    1 
ATOM   2967  C C     . THR B 1 79  ? -19.029 -29.083 -79.039  1.00 20.26 ? 57   THR B C     1 
ATOM   2968  O O     . THR B 1 79  ? -20.007 -29.337 -79.744  1.00 17.51 ? 57   THR B O     1 
ATOM   2969  C CB    . THR B 1 79  ? -19.570 -27.347 -77.234  1.00 22.76 ? 57   THR B CB    1 
ATOM   2970  O OG1   . THR B 1 79  ? -18.390 -26.540 -77.274  1.00 29.38 ? 57   THR B OG1   1 
ATOM   2971  C CG2   . THR B 1 79  ? -20.209 -27.212 -75.838  1.00 21.78 ? 57   THR B CG2   1 
ATOM   2972  N N     . VAL B 1 80  ? -17.790 -29.021 -79.524  1.00 18.03 ? 58   VAL B N     1 
ATOM   2973  C CA    . VAL B 1 80  ? -17.524 -29.121 -80.950  1.00 17.69 ? 58   VAL B CA    1 
ATOM   2974  C C     . VAL B 1 80  ? -16.978 -30.493 -81.368  1.00 16.60 ? 58   VAL B C     1 
ATOM   2975  O O     . VAL B 1 80  ? -17.231 -30.930 -82.491  1.00 15.81 ? 58   VAL B O     1 
ATOM   2976  C CB    . VAL B 1 80  ? -16.549 -27.977 -81.443  1.00 18.76 ? 58   VAL B CB    1 
ATOM   2977  C CG1   . VAL B 1 80  ? -17.081 -26.620 -81.038  1.00 20.72 ? 58   VAL B CG1   1 
ATOM   2978  C CG2   . VAL B 1 80  ? -15.100 -28.175 -80.946  1.00 16.65 ? 58   VAL B CG2   1 
ATOM   2979  N N     . GLY B 1 81  ? -16.227 -31.159 -80.494  1.00 15.59 ? 59   GLY B N     1 
ATOM   2980  C CA    . GLY B 1 81  ? -15.630 -32.435 -80.846  1.00 15.31 ? 59   GLY B CA    1 
ATOM   2981  C C     . GLY B 1 81  ? -16.557 -33.594 -80.580  1.00 14.13 ? 59   GLY B C     1 
ATOM   2982  O O     . GLY B 1 81  ? -16.203 -34.501 -79.847  1.00 13.80 ? 59   GLY B O     1 
ATOM   2983  N N     . THR B 1 82  ? -17.732 -33.572 -81.199  1.00 14.20 ? 60   THR B N     1 
ATOM   2984  C CA    . THR B 1 82  ? -18.813 -34.524 -80.930  1.00 13.57 ? 60   THR B CA    1 
ATOM   2985  C C     . THR B 1 82  ? -18.991 -35.484 -82.102  1.00 14.01 ? 60   THR B C     1 
ATOM   2986  O O     . THR B 1 82  ? -18.470 -35.248 -83.194  1.00 14.13 ? 60   THR B O     1 
ATOM   2987  C CB    . THR B 1 82  ? -20.155 -33.799 -80.692  1.00 12.15 ? 60   THR B CB    1 
ATOM   2988  O OG1   . THR B 1 82  ? -20.540 -33.079 -81.863  1.00 8.48  ? 60   THR B OG1   1 
ATOM   2989  C CG2   . THR B 1 82  ? -20.061 -32.856 -79.522  1.00 10.28 ? 60   THR B CG2   1 
ATOM   2990  N N     . PHE B 1 83  ? -19.714 -36.579 -81.870  1.00 12.97 ? 61   PHE B N     1 
ATOM   2991  C CA    . PHE B 1 83  ? -19.978 -37.543 -82.932  1.00 13.82 ? 61   PHE B CA    1 
ATOM   2992  C C     . PHE B 1 83  ? -20.887 -36.952 -84.016  1.00 15.51 ? 61   PHE B C     1 
ATOM   2993  O O     . PHE B 1 83  ? -20.719 -37.248 -85.208  1.00 15.84 ? 61   PHE B O     1 
ATOM   2994  C CB    . PHE B 1 83  ? -20.561 -38.830 -82.367  1.00 12.82 ? 61   PHE B CB    1 
ATOM   2995  C CG    . PHE B 1 83  ? -19.596 -39.604 -81.529  1.00 11.56 ? 61   PHE B CG    1 
ATOM   2996  C CD1   . PHE B 1 83  ? -18.285 -39.818 -81.961  1.00 12.88 ? 61   PHE B CD1   1 
ATOM   2997  C CD2   . PHE B 1 83  ? -19.985 -40.115 -80.299  1.00 9.22  ? 61   PHE B CD2   1 
ATOM   2998  C CE1   . PHE B 1 83  ? -17.388 -40.552 -81.180  1.00 9.52  ? 61   PHE B CE1   1 
ATOM   2999  C CE2   . PHE B 1 83  ? -19.093 -40.834 -79.520  1.00 7.75  ? 61   PHE B CE2   1 
ATOM   3000  C CZ    . PHE B 1 83  ? -17.790 -41.043 -79.961  1.00 6.95  ? 61   PHE B CZ    1 
ATOM   3001  N N     . GLU B 1 84  ? -21.825 -36.101 -83.604  1.00 16.41 ? 62   GLU B N     1 
ATOM   3002  C CA    . GLU B 1 84  ? -22.767 -35.497 -84.549  1.00 17.91 ? 62   GLU B CA    1 
ATOM   3003  C C     . GLU B 1 84  ? -22.018 -34.573 -85.487  1.00 17.77 ? 62   GLU B C     1 
ATOM   3004  O O     . GLU B 1 84  ? -22.295 -34.539 -86.687  1.00 18.33 ? 62   GLU B O     1 
ATOM   3005  C CB    . GLU B 1 84  ? -23.889 -34.734 -83.834  1.00 18.48 ? 62   GLU B CB    1 
ATOM   3006  C CG    . GLU B 1 84  ? -24.871 -35.650 -83.080  1.00 21.18 ? 62   GLU B CG    1 
ATOM   3007  C CD    . GLU B 1 84  ? -24.346 -36.124 -81.710  1.00 28.80 ? 62   GLU B CD    1 
ATOM   3008  O OE1   . GLU B 1 84  ? -23.182 -35.784 -81.335  1.00 26.55 ? 62   GLU B OE1   1 
ATOM   3009  O OE2   . GLU B 1 84  ? -25.107 -36.834 -81.009  1.00 28.78 ? 62   GLU B OE2   1 
ATOM   3010  N N     . MET B 1 85  ? -21.050 -33.849 -84.932  1.00 17.97 ? 63   MET B N     1 
ATOM   3011  C CA    . MET B 1 85  ? -20.196 -33.002 -85.725  1.00 18.98 ? 63   MET B CA    1 
ATOM   3012  C C     . MET B 1 85  ? -19.340 -33.824 -86.678  1.00 19.09 ? 63   MET B C     1 
ATOM   3013  O O     . MET B 1 85  ? -19.194 -33.460 -87.839  1.00 20.11 ? 63   MET B O     1 
ATOM   3014  C CB    . MET B 1 85  ? -19.301 -32.176 -84.821  1.00 18.82 ? 63   MET B CB    1 
ATOM   3015  C CG    . MET B 1 85  ? -18.878 -30.838 -85.428  1.00 26.85 ? 63   MET B CG    1 
ATOM   3016  S SD    . MET B 1 85  ? -20.159 -29.545 -85.319  1.00 28.26 ? 63   MET B SD    1 
ATOM   3017  C CE    . MET B 1 85  ? -19.103 -28.149 -85.055  1.00 23.27 ? 63   MET B CE    1 
ATOM   3018  N N     . ALA B 1 86  ? -18.779 -34.932 -86.183  1.00 18.78 ? 64   ALA B N     1 
ATOM   3019  C CA    . ALA B 1 86  ? -17.917 -35.804 -86.996  1.00 17.37 ? 64   ALA B CA    1 
ATOM   3020  C C     . ALA B 1 86  ? -18.636 -36.375 -88.213  1.00 16.81 ? 64   ALA B C     1 
ATOM   3021  O O     . ALA B 1 86  ? -18.014 -36.527 -89.273  1.00 17.62 ? 64   ALA B O     1 
ATOM   3022  C CB    . ALA B 1 86  ? -17.341 -36.919 -86.162  1.00 16.26 ? 64   ALA B CB    1 
ATOM   3023  N N     . ALA B 1 87  ? -19.933 -36.673 -88.054  1.00 15.04 ? 65   ALA B N     1 
ATOM   3024  C CA    . ALA B 1 87  ? -20.723 -37.263 -89.099  1.00 14.78 ? 65   ALA B CA    1 
ATOM   3025  C C     . ALA B 1 87  ? -20.890 -36.310 -90.273  1.00 15.52 ? 65   ALA B C     1 
ATOM   3026  O O     . ALA B 1 87  ? -20.976 -36.748 -91.421  1.00 15.89 ? 65   ALA B O     1 
ATOM   3027  C CB    . ALA B 1 87  ? -22.069 -37.668 -88.557  1.00 16.34 ? 65   ALA B CB    1 
ATOM   3028  N N     . VAL B 1 88  ? -20.945 -35.011 -89.982  1.00 17.23 ? 66   VAL B N     1 
ATOM   3029  C CA    . VAL B 1 88  ? -20.977 -33.974 -91.023  1.00 17.11 ? 66   VAL B CA    1 
ATOM   3030  C C     . VAL B 1 88  ? -19.579 -33.702 -91.582  1.00 16.28 ? 66   VAL B C     1 
ATOM   3031  O O     . VAL B 1 88  ? -19.397 -33.571 -92.784  1.00 16.83 ? 66   VAL B O     1 
ATOM   3032  C CB    . VAL B 1 88  ? -21.593 -32.656 -90.519  1.00 16.80 ? 66   VAL B CB    1 
ATOM   3033  C CG1   . VAL B 1 88  ? -21.310 -31.497 -91.493  1.00 20.07 ? 66   VAL B CG1   1 
ATOM   3034  C CG2   . VAL B 1 88  ? -23.108 -32.820 -90.320  1.00 18.58 ? 66   VAL B CG2   1 
ATOM   3035  N N     . MET B 1 89  ? -18.590 -33.612 -90.708  1.00 16.87 ? 67   MET B N     1 
ATOM   3036  C CA    . MET B 1 89  ? -17.236 -33.298 -91.145  1.00 17.41 ? 67   MET B CA    1 
ATOM   3037  C C     . MET B 1 89  ? -16.693 -34.349 -92.089  1.00 17.52 ? 67   MET B C     1 
ATOM   3038  O O     . MET B 1 89  ? -16.016 -34.020 -93.039  1.00 17.65 ? 67   MET B O     1 
ATOM   3039  C CB    . MET B 1 89  ? -16.317 -33.187 -89.949  1.00 19.05 ? 67   MET B CB    1 
ATOM   3040  C CG    . MET B 1 89  ? -16.641 -32.013 -89.051  1.00 21.75 ? 67   MET B CG    1 
ATOM   3041  S SD    . MET B 1 89  ? -16.209 -30.412 -89.743  1.00 22.88 ? 67   MET B SD    1 
ATOM   3042  C CE    . MET B 1 89  ? -17.519 -29.416 -89.016  1.00 29.07 ? 67   MET B CE    1 
ATOM   3043  N N     . SER B 1 90  ? -17.009 -35.610 -91.811  1.00 19.55 ? 68   SER B N     1 
ATOM   3044  C CA    . SER B 1 90  ? -16.565 -36.746 -92.614  1.00 19.60 ? 68   SER B CA    1 
ATOM   3045  C C     . SER B 1 90  ? -17.114 -36.729 -94.050  1.00 20.99 ? 68   SER B C     1 
ATOM   3046  O O     . SER B 1 90  ? -16.431 -37.131 -95.000  1.00 21.46 ? 68   SER B O     1 
ATOM   3047  C CB    . SER B 1 90  ? -16.984 -38.030 -91.909  1.00 18.71 ? 68   SER B CB    1 
ATOM   3048  O OG    . SER B 1 90  ? -16.559 -39.160 -92.622  1.00 20.93 ? 68   SER B OG    1 
ATOM   3049  N N     . GLN B 1 91  ? -18.349 -36.258 -94.202  1.00 21.43 ? 69   GLN B N     1 
ATOM   3050  C CA    . GLN B 1 91  ? -18.934 -36.037 -95.514  1.00 21.42 ? 69   GLN B CA    1 
ATOM   3051  C C     . GLN B 1 91  ? -18.099 -35.097 -96.386  1.00 21.57 ? 69   GLN B C     1 
ATOM   3052  O O     . GLN B 1 91  ? -18.117 -35.217 -97.622  1.00 21.94 ? 69   GLN B O     1 
ATOM   3053  C CB    . GLN B 1 91  ? -20.320 -35.415 -95.384  1.00 22.20 ? 69   GLN B CB    1 
ATOM   3054  C CG    . GLN B 1 91  ? -21.393 -36.331 -94.844  1.00 26.42 ? 69   GLN B CG    1 
ATOM   3055  C CD    . GLN B 1 91  ? -22.642 -35.566 -94.383  1.00 33.53 ? 69   GLN B CD    1 
ATOM   3056  O OE1   . GLN B 1 91  ? -22.886 -34.418 -94.789  1.00 35.26 ? 69   GLN B OE1   1 
ATOM   3057  N NE2   . GLN B 1 91  ? -23.431 -36.201 -93.520  1.00 35.58 ? 69   GLN B NE2   1 
ATOM   3058  N N     . HIS B 1 92  ? -17.405 -34.146 -95.749  1.00 19.72 ? 70   HIS B N     1 
ATOM   3059  C CA    . HIS B 1 92  ? -16.547 -33.196 -96.447  1.00 18.86 ? 70   HIS B CA    1 
ATOM   3060  C C     . HIS B 1 92  ? -15.083 -33.599 -96.420  1.00 19.55 ? 70   HIS B C     1 
ATOM   3061  O O     . HIS B 1 92  ? -14.202 -32.777 -96.717  1.00 20.40 ? 70   HIS B O     1 
ATOM   3062  C CB    . HIS B 1 92  ? -16.714 -31.817 -95.818  1.00 18.76 ? 70   HIS B CB    1 
ATOM   3063  C CG    . HIS B 1 92  ? -18.092 -31.272 -95.954  1.00 19.02 ? 70   HIS B CG    1 
ATOM   3064  N ND1   . HIS B 1 92  ? -18.422 -30.324 -96.898  1.00 21.99 ? 70   HIS B ND1   1 
ATOM   3065  C CD2   . HIS B 1 92  ? -19.236 -31.574 -95.302  1.00 20.84 ? 70   HIS B CD2   1 
ATOM   3066  C CE1   . HIS B 1 92  ? -19.710 -30.048 -96.805  1.00 22.24 ? 70   HIS B CE1   1 
ATOM   3067  N NE2   . HIS B 1 92  ? -20.228 -30.796 -95.846  1.00 21.22 ? 70   HIS B NE2   1 
ATOM   3068  N N     . SER B 1 93  ? -14.831 -34.864 -96.085  1.00 20.22 ? 71   SER B N     1 
ATOM   3069  C CA    . SER B 1 93  ? -13.481 -35.420 -95.951  1.00 21.41 ? 71   SER B CA    1 
ATOM   3070  C C     . SER B 1 93  ? -12.671 -34.679 -94.920  1.00 20.58 ? 71   SER B C     1 
ATOM   3071  O O     . SER B 1 93  ? -11.469 -34.611 -95.033  1.00 20.14 ? 71   SER B O     1 
ATOM   3072  C CB    . SER B 1 93  ? -12.773 -35.421 -97.309  1.00 21.98 ? 71   SER B CB    1 
ATOM   3073  O OG    . SER B 1 93  ? -13.557 -36.138 -98.262  1.00 24.87 ? 71   SER B OG    1 
ATOM   3074  N N     . MET B 1 94  ? -13.344 -34.132 -93.910  1.00 20.81 ? 72   MET B N     1 
ATOM   3075  C CA    . MET B 1 94  ? -12.679 -33.398 -92.831  1.00 21.58 ? 72   MET B CA    1 
ATOM   3076  C C     . MET B 1 94  ? -12.618 -34.228 -91.558  1.00 21.31 ? 72   MET B C     1 
ATOM   3077  O O     . MET B 1 94  ? -13.344 -35.226 -91.414  1.00 21.80 ? 72   MET B O     1 
ATOM   3078  C CB    . MET B 1 94  ? -13.375 -32.066 -92.582  1.00 20.70 ? 72   MET B CB    1 
ATOM   3079  C CG    . MET B 1 94  ? -13.046 -31.052 -93.637  1.00 21.02 ? 72   MET B CG    1 
ATOM   3080  S SD    . MET B 1 94  ? -14.281 -29.773 -93.750  1.00 21.12 ? 72   MET B SD    1 
ATOM   3081  C CE    . MET B 1 94  ? -13.629 -28.498 -92.650  1.00 21.42 ? 72   MET B CE    1 
ATOM   3082  N N     . PHE B 1 95  ? -11.759 -33.782 -90.643  1.00 19.62 ? 73   PHE B N     1 
ATOM   3083  C CA    . PHE B 1 95  ? -11.383 -34.539 -89.464  1.00 18.65 ? 73   PHE B CA    1 
ATOM   3084  C C     . PHE B 1 95  ? -12.065 -34.014 -88.200  1.00 17.49 ? 73   PHE B C     1 
ATOM   3085  O O     . PHE B 1 95  ? -12.360 -32.824 -88.078  1.00 18.30 ? 73   PHE B O     1 
ATOM   3086  C CB    . PHE B 1 95  ? -9.853  -34.488 -89.273  1.00 18.95 ? 73   PHE B CB    1 
ATOM   3087  C CG    . PHE B 1 95  ? -9.298  -35.688 -88.557  1.00 21.41 ? 73   PHE B CG    1 
ATOM   3088  C CD1   . PHE B 1 95  ? -8.899  -36.832 -89.272  1.00 15.82 ? 73   PHE B CD1   1 
ATOM   3089  C CD2   . PHE B 1 95  ? -9.205  -35.698 -87.160  1.00 24.22 ? 73   PHE B CD2   1 
ATOM   3090  C CE1   . PHE B 1 95  ? -8.397  -37.960 -88.603  1.00 20.20 ? 73   PHE B CE1   1 
ATOM   3091  C CE2   . PHE B 1 95  ? -8.703  -36.824 -86.477  1.00 21.29 ? 73   PHE B CE2   1 
ATOM   3092  C CZ    . PHE B 1 95  ? -8.296  -37.956 -87.198  1.00 19.86 ? 73   PHE B CZ    1 
ATOM   3093  N N     . THR B 1 96  ? -12.301 -34.913 -87.255  1.00 16.37 ? 74   THR B N     1 
ATOM   3094  C CA    . THR B 1 96  ? -12.852 -34.543 -85.965  1.00 15.77 ? 74   THR B CA    1 
ATOM   3095  C C     . THR B 1 96  ? -12.040 -35.191 -84.848  1.00 15.81 ? 74   THR B C     1 
ATOM   3096  O O     . THR B 1 96  ? -11.895 -36.405 -84.807  1.00 15.47 ? 74   THR B O     1 
ATOM   3097  C CB    . THR B 1 96  ? -14.306 -35.029 -85.884  1.00 16.28 ? 74   THR B CB    1 
ATOM   3098  O OG1   . THR B 1 96  ? -14.992 -34.622 -87.076  1.00 15.60 ? 74   THR B OG1   1 
ATOM   3099  C CG2   . THR B 1 96  ? -15.026 -34.492 -84.637  1.00 14.18 ? 74   THR B CG2   1 
ATOM   3100  N N     . ALA B 1 97  ? -11.503 -34.375 -83.949  1.00 15.89 ? 75   ALA B N     1 
ATOM   3101  C CA    . ALA B 1 97  ? -10.881 -34.893 -82.724  1.00 15.53 ? 75   ALA B CA    1 
ATOM   3102  C C     . ALA B 1 97  ? -11.967 -34.912 -81.684  1.00 16.32 ? 75   ALA B C     1 
ATOM   3103  O O     . ALA B 1 97  ? -12.464 -33.862 -81.286  1.00 14.75 ? 75   ALA B O     1 
ATOM   3104  C CB    . ALA B 1 97  ? -9.712  -34.058 -82.276  1.00 14.30 ? 75   ALA B CB    1 
ATOM   3105  N N     . ILE B 1 98  ? -12.355 -36.129 -81.298  1.00 17.30 ? 76   ILE B N     1 
ATOM   3106  C CA    . ILE B 1 98  ? -13.486 -36.367 -80.413  1.00 15.64 ? 76   ILE B CA    1 
ATOM   3107  C C     . ILE B 1 98  ? -13.097 -36.116 -78.957  1.00 16.43 ? 76   ILE B C     1 
ATOM   3108  O O     . ILE B 1 98  ? -12.078 -36.612 -78.483  1.00 16.27 ? 76   ILE B O     1 
ATOM   3109  C CB    . ILE B 1 98  ? -13.997 -37.834 -80.551  1.00 16.06 ? 76   ILE B CB    1 
ATOM   3110  C CG1   . ILE B 1 98  ? -14.579 -38.095 -81.955  1.00 14.68 ? 76   ILE B CG1   1 
ATOM   3111  C CG2   . ILE B 1 98  ? -15.004 -38.155 -79.455  1.00 11.65 ? 76   ILE B CG2   1 
ATOM   3112  C CD1   . ILE B 1 98  ? -15.868 -37.364 -82.260  1.00 13.14 ? 76   ILE B CD1   1 
ATOM   3113  N N     . HIS B 1 99  ? -13.921 -35.369 -78.230  1.00 17.64 ? 77   HIS B N     1 
ATOM   3114  C CA    . HIS B 1 99  ? -13.602 -35.055 -76.826  1.00 17.45 ? 77   HIS B CA    1 
ATOM   3115  C C     . HIS B 1 99  ? -13.486 -36.313 -75.981  1.00 17.63 ? 77   HIS B C     1 
ATOM   3116  O O     . HIS B 1 99  ? -14.052 -37.355 -76.316  1.00 17.88 ? 77   HIS B O     1 
ATOM   3117  C CB    . HIS B 1 99  ? -14.602 -34.069 -76.214  1.00 16.96 ? 77   HIS B CB    1 
ATOM   3118  C CG    . HIS B 1 99  ? -15.992 -34.604 -76.073  1.00 14.92 ? 77   HIS B CG    1 
ATOM   3119  N ND1   . HIS B 1 99  ? -16.324 -35.602 -75.183  1.00 21.44 ? 77   HIS B ND1   1 
ATOM   3120  C CD2   . HIS B 1 99  ? -17.149 -34.245 -76.680  1.00 14.48 ? 77   HIS B CD2   1 
ATOM   3121  C CE1   . HIS B 1 99  ? -17.620 -35.848 -75.266  1.00 17.72 ? 77   HIS B CE1   1 
ATOM   3122  N NE2   . HIS B 1 99  ? -18.145 -35.031 -76.161  1.00 10.63 ? 77   HIS B NE2   1 
ATOM   3123  N N     . LYS B 1 100 ? -12.714 -36.241 -74.903  1.00 18.78 ? 78   LYS B N     1 
ATOM   3124  C CA    . LYS B 1 100 ? -12.347 -37.476 -74.165  1.00 18.36 ? 78   LYS B CA    1 
ATOM   3125  C C     . LYS B 1 100 ? -13.387 -37.959 -73.162  1.00 16.82 ? 78   LYS B C     1 
ATOM   3126  O O     . LYS B 1 100 ? -13.119 -38.886 -72.408  1.00 17.30 ? 78   LYS B O     1 
ATOM   3127  C CB    . LYS B 1 100 ? -10.975 -37.339 -73.477  1.00 19.56 ? 78   LYS B CB    1 
ATOM   3128  C CG    . LYS B 1 100 ? -10.959 -36.549 -72.170  1.00 23.28 ? 78   LYS B CG    1 
ATOM   3129  C CD    . LYS B 1 100 ? -9.522  -36.386 -71.624  1.00 22.92 ? 78   LYS B CD    1 
ATOM   3130  C CE    . LYS B 1 100 ? -9.535  -35.587 -70.312  1.00 26.37 ? 78   LYS B CE    1 
ATOM   3131  N NZ    . LYS B 1 100 ? -8.175  -35.475 -69.686  1.00 24.80 ? 78   LYS B NZ    1 
ATOM   3132  N N     . HIS B 1 101 ? -14.577 -37.367 -73.168  1.00 16.95 ? 79   HIS B N     1 
ATOM   3133  C CA    . HIS B 1 101 ? -15.587 -37.649 -72.137  1.00 17.55 ? 79   HIS B CA    1 
ATOM   3134  C C     . HIS B 1 101 ? -16.706 -38.526 -72.613  1.00 17.64 ? 79   HIS B C     1 
ATOM   3135  O O     . HIS B 1 101 ? -17.646 -38.785 -71.880  1.00 21.04 ? 79   HIS B O     1 
ATOM   3136  C CB    . HIS B 1 101 ? -16.145 -36.339 -71.576  1.00 18.36 ? 79   HIS B CB    1 
ATOM   3137  C CG    . HIS B 1 101 ? -15.074 -35.452 -71.023  1.00 20.58 ? 79   HIS B CG    1 
ATOM   3138  N ND1   . HIS B 1 101 ? -14.745 -34.234 -71.582  1.00 18.10 ? 79   HIS B ND1   1 
ATOM   3139  C CD2   . HIS B 1 101 ? -14.188 -35.660 -70.021  1.00 18.80 ? 79   HIS B CD2   1 
ATOM   3140  C CE1   . HIS B 1 101 ? -13.729 -33.711 -70.916  1.00 22.08 ? 79   HIS B CE1   1 
ATOM   3141  N NE2   . HIS B 1 101 ? -13.367 -34.561 -69.971  1.00 19.93 ? 79   HIS B NE2   1 
ATOM   3142  N N     . TYR B 1 102 ? -16.617 -38.992 -73.849  1.00 17.30 ? 80   TYR B N     1 
ATOM   3143  C CA    . TYR B 1 102 ? -17.518 -40.015 -74.328  1.00 15.67 ? 80   TYR B CA    1 
ATOM   3144  C C     . TYR B 1 102 ? -17.155 -41.347 -73.700  1.00 15.92 ? 80   TYR B C     1 
ATOM   3145  O O     . TYR B 1 102 ? -15.979 -41.660 -73.539  1.00 16.64 ? 80   TYR B O     1 
ATOM   3146  C CB    . TYR B 1 102 ? -17.410 -40.151 -75.830  1.00 15.01 ? 80   TYR B CB    1 
ATOM   3147  C CG    . TYR B 1 102 ? -18.229 -39.164 -76.605  1.00 15.67 ? 80   TYR B CG    1 
ATOM   3148  C CD1   . TYR B 1 102 ? -19.610 -39.047 -76.397  1.00 17.52 ? 80   TYR B CD1   1 
ATOM   3149  C CD2   . TYR B 1 102 ? -17.651 -38.396 -77.581  1.00 10.73 ? 80   TYR B CD2   1 
ATOM   3150  C CE1   . TYR B 1 102 ? -20.371 -38.156 -77.124  1.00 14.39 ? 80   TYR B CE1   1 
ATOM   3151  C CE2   . TYR B 1 102 ? -18.398 -37.514 -78.324  1.00 16.68 ? 80   TYR B CE2   1 
ATOM   3152  C CZ    . TYR B 1 102 ? -19.756 -37.391 -78.086  1.00 13.16 ? 80   TYR B CZ    1 
ATOM   3153  O OH    . TYR B 1 102 ? -20.489 -36.522 -78.833  1.00 10.41 ? 80   TYR B OH    1 
ATOM   3154  N N     . SER B 1 103 ? -18.180 -42.141 -73.388  1.00 16.62 ? 81   SER B N     1 
ATOM   3155  C CA    . SER B 1 103 ? -18.002 -43.475 -72.834  1.00 15.46 ? 81   SER B CA    1 
ATOM   3156  C C     . SER B 1 103 ? -17.615 -44.465 -73.911  1.00 15.74 ? 81   SER B C     1 
ATOM   3157  O O     . SER B 1 103 ? -17.819 -44.214 -75.106  1.00 16.91 ? 81   SER B O     1 
ATOM   3158  C CB    . SER B 1 103 ? -19.300 -43.939 -72.173  1.00 16.30 ? 81   SER B CB    1 
ATOM   3159  O OG    . SER B 1 103 ? -20.245 -44.446 -73.114  1.00 16.15 ? 81   SER B OG    1 
ATOM   3160  N N     . LEU B 1 104 ? -17.060 -45.590 -73.479  1.00 16.22 ? 82   LEU B N     1 
ATOM   3161  C CA    . LEU B 1 104 ? -16.775 -46.717 -74.374  1.00 16.35 ? 82   LEU B CA    1 
ATOM   3162  C C     . LEU B 1 104 ? -18.015 -47.152 -75.152  1.00 15.04 ? 82   LEU B C     1 
ATOM   3163  O O     . LEU B 1 104 ? -17.938 -47.427 -76.353  1.00 14.60 ? 82   LEU B O     1 
ATOM   3164  C CB    . LEU B 1 104 ? -16.219 -47.902 -73.572  1.00 16.64 ? 82   LEU B CB    1 
ATOM   3165  C CG    . LEU B 1 104 ? -16.006 -49.226 -74.300  1.00 18.03 ? 82   LEU B CG    1 
ATOM   3166  C CD1   . LEU B 1 104 ? -15.060 -49.075 -75.483  1.00 18.70 ? 82   LEU B CD1   1 
ATOM   3167  C CD2   . LEU B 1 104 ? -15.485 -50.255 -73.305  1.00 18.62 ? 82   LEU B CD2   1 
ATOM   3168  N N     . ASP B 1 105 ? -19.156 -47.214 -74.468  1.00 14.62 ? 83   ASP B N     1 
ATOM   3169  C CA    . ASP B 1 105 ? -20.422 -47.523 -75.125  1.00 14.57 ? 83   ASP B CA    1 
ATOM   3170  C C     . ASP B 1 105 ? -20.804 -46.503 -76.205  1.00 14.54 ? 83   ASP B C     1 
ATOM   3171  O O     . ASP B 1 105 ? -21.347 -46.879 -77.257  1.00 13.76 ? 83   ASP B O     1 
ATOM   3172  C CB    . ASP B 1 105 ? -21.534 -47.623 -74.092  1.00 14.48 ? 83   ASP B CB    1 
ATOM   3173  C CG    . ASP B 1 105 ? -21.446 -48.894 -73.265  1.00 20.68 ? 83   ASP B CG    1 
ATOM   3174  O OD1   . ASP B 1 105 ? -21.550 -49.998 -73.842  1.00 19.77 ? 83   ASP B OD1   1 
ATOM   3175  O OD2   . ASP B 1 105 ? -21.279 -48.782 -72.029  1.00 32.46 ? 83   ASP B OD2   1 
ATOM   3176  N N     . ASP B 1 106 ? -20.550 -45.217 -75.935  1.00 15.69 ? 84   ASP B N     1 
ATOM   3177  C CA    . ASP B 1 106 ? -20.853 -44.155 -76.898  1.00 14.77 ? 84   ASP B CA    1 
ATOM   3178  C C     . ASP B 1 106 ? -20.057 -44.363 -78.174  1.00 14.60 ? 84   ASP B C     1 
ATOM   3179  O O     . ASP B 1 106 ? -20.564 -44.146 -79.272  1.00 14.75 ? 84   ASP B O     1 
ATOM   3180  C CB    . ASP B 1 106 ? -20.576 -42.754 -76.319  1.00 16.18 ? 84   ASP B CB    1 
ATOM   3181  C CG    . ASP B 1 106 ? -21.519 -42.373 -75.157  1.00 16.32 ? 84   ASP B CG    1 
ATOM   3182  O OD1   . ASP B 1 106 ? -22.634 -42.936 -75.035  1.00 16.68 ? 84   ASP B OD1   1 
ATOM   3183  O OD2   . ASP B 1 106 ? -21.115 -41.490 -74.358  1.00 16.46 ? 84   ASP B OD2   1 
ATOM   3184  N N     . TRP B 1 107 ? -18.801 -44.760 -78.021  1.00 14.93 ? 85   TRP B N     1 
ATOM   3185  C CA    . TRP B 1 107 ? -17.932 -45.050 -79.183  1.00 16.01 ? 85   TRP B CA    1 
ATOM   3186  C C     . TRP B 1 107 ? -18.398 -46.288 -79.924  1.00 16.32 ? 85   TRP B C     1 
ATOM   3187  O O     . TRP B 1 107 ? -18.454 -46.297 -81.149  1.00 17.24 ? 85   TRP B O     1 
ATOM   3188  C CB    . TRP B 1 107 ? -16.468 -45.233 -78.775  1.00 15.36 ? 85   TRP B CB    1 
ATOM   3189  C CG    . TRP B 1 107 ? -15.772 -43.963 -78.623  1.00 16.56 ? 85   TRP B CG    1 
ATOM   3190  C CD1   . TRP B 1 107 ? -15.729 -43.189 -77.510  1.00 18.33 ? 85   TRP B CD1   1 
ATOM   3191  C CD2   . TRP B 1 107 ? -15.020 -43.267 -79.629  1.00 20.88 ? 85   TRP B CD2   1 
ATOM   3192  N NE1   . TRP B 1 107 ? -14.980 -42.063 -77.747  1.00 17.21 ? 85   TRP B NE1   1 
ATOM   3193  C CE2   . TRP B 1 107 ? -14.534 -42.085 -79.041  1.00 19.09 ? 85   TRP B CE2   1 
ATOM   3194  C CE3   . TRP B 1 107 ? -14.693 -43.539 -80.964  1.00 20.91 ? 85   TRP B CE3   1 
ATOM   3195  C CZ2   . TRP B 1 107 ? -13.732 -41.171 -79.738  1.00 22.92 ? 85   TRP B CZ2   1 
ATOM   3196  C CZ3   . TRP B 1 107 ? -13.905 -42.621 -81.661  1.00 20.97 ? 85   TRP B CZ3   1 
ATOM   3197  C CH2   . TRP B 1 107 ? -13.441 -41.452 -81.045  1.00 19.78 ? 85   TRP B CH2   1 
ATOM   3198  N N     . LYS B 1 108 ? -18.722 -47.334 -79.182  1.00 15.99 ? 86   LYS B N     1 
ATOM   3199  C CA    . LYS B 1 108 ? -19.239 -48.560 -79.799  1.00 15.90 ? 86   LYS B CA    1 
ATOM   3200  C C     . LYS B 1 108 ? -20.436 -48.215 -80.679  1.00 15.96 ? 86   LYS B C     1 
ATOM   3201  O O     . LYS B 1 108 ? -20.508 -48.638 -81.842  1.00 17.53 ? 86   LYS B O     1 
ATOM   3202  C CB    . LYS B 1 108 ? -19.651 -49.586 -78.731  1.00 15.48 ? 86   LYS B CB    1 
ATOM   3203  C CG    . LYS B 1 108 ? -18.483 -50.286 -77.990  1.00 16.91 ? 86   LYS B CG    1 
ATOM   3204  C CD    . LYS B 1 108 ? -19.019 -51.040 -76.763  1.00 18.56 ? 86   LYS B CD    1 
ATOM   3205  C CE    . LYS B 1 108 ? -17.973 -51.889 -76.042  1.00 20.27 ? 86   LYS B CE    1 
ATOM   3206  N NZ    . LYS B 1 108 ? -18.393 -52.195 -74.616  1.00 17.68 ? 86   LYS B NZ    1 
ATOM   3207  N N     . LEU B 1 109 ? -21.354 -47.415 -80.139  1.00 15.19 ? 87   LEU B N     1 
ATOM   3208  C CA    . LEU B 1 109 ? -22.562 -47.028 -80.872  1.00 14.56 ? 87   LEU B CA    1 
ATOM   3209  C C     . LEU B 1 109 ? -22.231 -46.199 -82.104  1.00 14.93 ? 87   LEU B C     1 
ATOM   3210  O O     . LEU B 1 109 ? -22.862 -46.344 -83.152  1.00 16.25 ? 87   LEU B O     1 
ATOM   3211  C CB    . LEU B 1 109 ? -23.519 -46.229 -79.992  1.00 13.55 ? 87   LEU B CB    1 
ATOM   3212  C CG    . LEU B 1 109 ? -24.884 -46.026 -80.658  1.00 15.71 ? 87   LEU B CG    1 
ATOM   3213  C CD1   . LEU B 1 109 ? -25.640 -47.372 -80.804  1.00 11.91 ? 87   LEU B CD1   1 
ATOM   3214  C CD2   . LEU B 1 109 ? -25.700 -45.015 -79.884  1.00 14.43 ? 87   LEU B CD2   1 
ATOM   3215  N N     . PHE B 1 110 ? -21.255 -45.313 -81.975  1.00 15.50 ? 88   PHE B N     1 
ATOM   3216  C CA    . PHE B 1 110 ? -20.837 -44.499 -83.101  1.00 15.74 ? 88   PHE B CA    1 
ATOM   3217  C C     . PHE B 1 110 ? -20.148 -45.330 -84.201  1.00 16.58 ? 88   PHE B C     1 
ATOM   3218  O O     . PHE B 1 110 ? -20.313 -45.071 -85.378  1.00 16.91 ? 88   PHE B O     1 
ATOM   3219  C CB    . PHE B 1 110 ? -19.928 -43.398 -82.613  1.00 14.64 ? 88   PHE B CB    1 
ATOM   3220  C CG    . PHE B 1 110 ? -19.485 -42.484 -83.692  1.00 14.94 ? 88   PHE B CG    1 
ATOM   3221  C CD1   . PHE B 1 110 ? -20.406 -41.624 -84.304  1.00 15.05 ? 88   PHE B CD1   1 
ATOM   3222  C CD2   . PHE B 1 110 ? -18.156 -42.486 -84.124  1.00 11.97 ? 88   PHE B CD2   1 
ATOM   3223  C CE1   . PHE B 1 110 ? -19.999 -40.752 -85.316  1.00 15.29 ? 88   PHE B CE1   1 
ATOM   3224  C CE2   . PHE B 1 110 ? -17.733 -41.622 -85.151  1.00 12.70 ? 88   PHE B CE2   1 
ATOM   3225  C CZ    . PHE B 1 110 ? -18.653 -40.753 -85.745  1.00 14.75 ? 88   PHE B CZ    1 
ATOM   3226  N N     . ALA B 1 111 ? -19.383 -46.339 -83.809  1.00 17.91 ? 89   ALA B N     1 
ATOM   3227  C CA    . ALA B 1 111 ? -18.801 -47.276 -84.768  1.00 18.06 ? 89   ALA B CA    1 
ATOM   3228  C C     . ALA B 1 111 ? -19.884 -48.099 -85.455  1.00 17.77 ? 89   ALA B C     1 
ATOM   3229  O O     . ALA B 1 111 ? -19.802 -48.372 -86.656  1.00 18.79 ? 89   ALA B O     1 
ATOM   3230  C CB    . ALA B 1 111 ? -17.821 -48.196 -84.066  1.00 18.91 ? 89   ALA B CB    1 
ATOM   3231  N N     . THR B 1 112 ? -20.888 -48.506 -84.681  1.00 17.64 ? 90   THR B N     1 
ATOM   3232  C CA    . THR B 1 112 ? -22.031 -49.269 -85.223  1.00 17.42 ? 90   THR B CA    1 
ATOM   3233  C C     . THR B 1 112 ? -22.765 -48.448 -86.284  1.00 16.84 ? 90   THR B C     1 
ATOM   3234  O O     . THR B 1 112 ? -23.097 -48.945 -87.371  1.00 16.96 ? 90   THR B O     1 
ATOM   3235  C CB    . THR B 1 112 ? -23.093 -49.612 -84.125  1.00 17.59 ? 90   THR B CB    1 
ATOM   3236  O OG1   . THR B 1 112 ? -22.657 -50.710 -83.310  1.00 17.90 ? 90   THR B OG1   1 
ATOM   3237  C CG2   . THR B 1 112 ? -24.431 -49.956 -84.753  1.00 17.39 ? 90   THR B CG2   1 
ATOM   3238  N N     . ASN B 1 113 ? -23.044 -47.195 -85.942  1.00 15.85 ? 91   ASN B N     1 
ATOM   3239  C CA    . ASN B 1 113 ? -23.924 -46.376 -86.754  1.00 15.82 ? 91   ASN B CA    1 
ATOM   3240  C C     . ASN B 1 113 ? -23.207 -45.524 -87.805  1.00 15.74 ? 91   ASN B C     1 
ATOM   3241  O O     . ASN B 1 113 ? -23.805 -45.196 -88.835  1.00 16.14 ? 91   ASN B O     1 
ATOM   3242  C CB    . ASN B 1 113 ? -24.834 -45.518 -85.866  1.00 16.28 ? 91   ASN B CB    1 
ATOM   3243  C CG    . ASN B 1 113 ? -25.958 -46.342 -85.195  1.00 19.62 ? 91   ASN B CG    1 
ATOM   3244  O OD1   . ASN B 1 113 ? -26.311 -47.441 -85.638  1.00 16.17 ? 91   ASN B OD1   1 
ATOM   3245  N ND2   . ASN B 1 113 ? -26.509 -45.806 -84.114  1.00 27.23 ? 91   ASN B ND2   1 
ATOM   3246  N N     . HIS B 1 114 ? -21.937 -45.188 -87.575  1.00 14.52 ? 92   HIS B N     1 
ATOM   3247  C CA    . HIS B 1 114 ? -21.187 -44.333 -88.489  1.00 15.88 ? 92   HIS B CA    1 
ATOM   3248  C C     . HIS B 1 114 ? -19.783 -44.878 -88.810  1.00 16.77 ? 92   HIS B C     1 
ATOM   3249  O O     . HIS B 1 114 ? -18.771 -44.194 -88.577  1.00 14.85 ? 92   HIS B O     1 
ATOM   3250  C CB    . HIS B 1 114 ? -21.080 -42.925 -87.883  1.00 16.93 ? 92   HIS B CB    1 
ATOM   3251  C CG    . HIS B 1 114 ? -22.398 -42.229 -87.729  1.00 20.35 ? 92   HIS B CG    1 
ATOM   3252  N ND1   . HIS B 1 114 ? -22.839 -41.267 -88.611  1.00 24.52 ? 92   HIS B ND1   1 
ATOM   3253  C CD2   . HIS B 1 114 ? -23.376 -42.367 -86.803  1.00 26.18 ? 92   HIS B CD2   1 
ATOM   3254  C CE1   . HIS B 1 114 ? -24.030 -40.838 -88.233  1.00 25.54 ? 92   HIS B CE1   1 
ATOM   3255  N NE2   . HIS B 1 114 ? -24.380 -41.490 -87.139  1.00 24.65 ? 92   HIS B NE2   1 
ATOM   3256  N N     . PRO B 1 115 ? -19.715 -46.103 -89.374  1.00 18.47 ? 93   PRO B N     1 
ATOM   3257  C CA    . PRO B 1 115 ? -18.424 -46.733 -89.658  1.00 19.82 ? 93   PRO B CA    1 
ATOM   3258  C C     . PRO B 1 115 ? -17.607 -45.957 -90.685  1.00 21.43 ? 93   PRO B C     1 
ATOM   3259  O O     . PRO B 1 115 ? -16.382 -45.967 -90.636  1.00 21.34 ? 93   PRO B O     1 
ATOM   3260  C CB    . PRO B 1 115 ? -18.788 -48.120 -90.194  1.00 20.34 ? 93   PRO B CB    1 
ATOM   3261  C CG    . PRO B 1 115 ? -20.256 -48.215 -90.191  1.00 20.50 ? 93   PRO B CG    1 
ATOM   3262  C CD    . PRO B 1 115 ? -20.857 -46.927 -89.801  1.00 19.27 ? 93   PRO B CD    1 
ATOM   3263  N N     . GLU B 1 116 ? -18.296 -45.288 -91.602  1.00 24.28 ? 94   GLU B N     1 
ATOM   3264  C CA    . GLU B 1 116 ? -17.654 -44.459 -92.625  1.00 26.02 ? 94   GLU B CA    1 
ATOM   3265  C C     . GLU B 1 116 ? -16.855 -43.251 -92.064  1.00 26.31 ? 94   GLU B C     1 
ATOM   3266  O O     . GLU B 1 116 ? -15.990 -42.695 -92.768  1.00 26.40 ? 94   GLU B O     1 
ATOM   3267  C CB    . GLU B 1 116 ? -18.689 -44.018 -93.681  1.00 25.71 ? 94   GLU B CB    1 
ATOM   3268  C CG    . GLU B 1 116 ? -19.689 -42.937 -93.231  1.00 28.44 ? 94   GLU B CG    1 
ATOM   3269  C CD    . GLU B 1 116 ? -20.907 -43.463 -92.486  1.00 30.55 ? 94   GLU B CD    1 
ATOM   3270  O OE1   . GLU B 1 116 ? -21.178 -44.683 -92.525  1.00 27.75 ? 94   GLU B OE1   1 
ATOM   3271  O OE2   . GLU B 1 116 ? -21.604 -42.631 -91.861  1.00 31.50 ? 94   GLU B OE2   1 
ATOM   3272  N N     . CYS B 1 117 ? -17.134 -42.870 -90.811  1.00 26.39 ? 95   CYS B N     1 
ATOM   3273  C CA    . CYS B 1 117 ? -16.435 -41.765 -90.132  1.00 25.18 ? 95   CYS B CA    1 
ATOM   3274  C C     . CYS B 1 117 ? -15.161 -42.117 -89.392  1.00 23.58 ? 95   CYS B C     1 
ATOM   3275  O O     . CYS B 1 117 ? -14.339 -41.239 -89.132  1.00 21.80 ? 95   CYS B O     1 
ATOM   3276  C CB    . CYS B 1 117 ? -17.354 -41.139 -89.107  1.00 24.91 ? 95   CYS B CB    1 
ATOM   3277  S SG    . CYS B 1 117 ? -18.772 -40.465 -89.858  1.00 28.90 ? 95   CYS B SG    1 
ATOM   3278  N N     . LEU B 1 118 ? -15.000 -43.392 -89.056  1.00 22.75 ? 96   LEU B N     1 
ATOM   3279  C CA    . LEU B 1 118 ? -13.986 -43.814 -88.101  1.00 22.46 ? 96   LEU B CA    1 
ATOM   3280  C C     . LEU B 1 118 ? -12.571 -43.469 -88.557  1.00 23.61 ? 96   LEU B C     1 
ATOM   3281  O O     . LEU B 1 118 ? -11.677 -43.279 -87.734  1.00 24.36 ? 96   LEU B O     1 
ATOM   3282  C CB    . LEU B 1 118 ? -14.117 -45.311 -87.846  1.00 22.40 ? 96   LEU B CB    1 
ATOM   3283  C CG    . LEU B 1 118 ? -15.459 -45.740 -87.236  1.00 22.09 ? 96   LEU B CG    1 
ATOM   3284  C CD1   . LEU B 1 118 ? -15.611 -47.273 -87.171  1.00 19.11 ? 96   LEU B CD1   1 
ATOM   3285  C CD2   . LEU B 1 118 ? -15.637 -45.114 -85.843  1.00 22.44 ? 96   LEU B CD2   1 
ATOM   3286  N N     . GLN B 1 119 ? -12.389 -43.378 -89.874  1.00 23.56 ? 97   GLN B N     1 
ATOM   3287  C CA    . GLN B 1 119 ? -11.113 -42.977 -90.488  1.00 24.10 ? 97   GLN B CA    1 
ATOM   3288  C C     . GLN B 1 119 ? -10.835 -41.482 -90.318  1.00 22.56 ? 97   GLN B C     1 
ATOM   3289  O O     . GLN B 1 119 ? -9.695  -41.044 -90.464  1.00 22.60 ? 97   GLN B O     1 
ATOM   3290  C CB    . GLN B 1 119 ? -11.090 -43.353 -91.993  1.00 25.27 ? 97   GLN B CB    1 
ATOM   3291  C CG    . GLN B 1 119 ? -12.244 -42.749 -92.830  1.00 29.64 ? 97   GLN B CG    1 
ATOM   3292  C CD    . GLN B 1 119 ? -12.082 -42.964 -94.325  1.00 28.31 ? 97   GLN B CD    1 
ATOM   3293  O OE1   . GLN B 1 119 ? -11.753 -42.036 -95.061  1.00 25.95 ? 97   GLN B OE1   1 
ATOM   3294  N NE2   . GLN B 1 119 ? -12.319 -44.193 -94.780  1.00 28.41 ? 97   GLN B NE2   1 
ATOM   3295  N N     . ASN B 1 120 ? -11.886 -40.712 -90.022  1.00 20.88 ? 98   ASN B N     1 
ATOM   3296  C CA    . ASN B 1 120 ? -11.792 -39.250 -89.878  1.00 19.56 ? 98   ASN B CA    1 
ATOM   3297  C C     . ASN B 1 120 ? -11.961 -38.703 -88.444  1.00 17.25 ? 98   ASN B C     1 
ATOM   3298  O O     . ASN B 1 120 ? -12.270 -37.519 -88.247  1.00 16.66 ? 98   ASN B O     1 
ATOM   3299  C CB    . ASN B 1 120 ? -12.824 -38.568 -90.771  1.00 20.46 ? 98   ASN B CB    1 
ATOM   3300  C CG    . ASN B 1 120 ? -12.523 -38.741 -92.218  1.00 20.62 ? 98   ASN B CG    1 
ATOM   3301  O OD1   . ASN B 1 120 ? -11.498 -38.274 -92.700  1.00 28.78 ? 98   ASN B OD1   1 
ATOM   3302  N ND2   . ASN B 1 120 ? -13.405 -39.431 -92.927  1.00 20.32 ? 98   ASN B ND2   1 
ATOM   3303  N N     . VAL B 1 121 ? -11.761 -39.569 -87.455  1.00 15.73 ? 99   VAL B N     1 
ATOM   3304  C CA    . VAL B 1 121 ? -11.854 -39.190 -86.057  1.00 14.75 ? 99   VAL B CA    1 
ATOM   3305  C C     . VAL B 1 121 ? -10.631 -39.632 -85.303  1.00 15.37 ? 99   VAL B C     1 
ATOM   3306  O O     . VAL B 1 121 ? -9.952  -40.604 -85.677  1.00 14.02 ? 99   VAL B O     1 
ATOM   3307  C CB    . VAL B 1 121 ? -13.103 -39.795 -85.344  1.00 14.87 ? 99   VAL B CB    1 
ATOM   3308  C CG1   . VAL B 1 121 ? -14.399 -39.216 -85.914  1.00 14.46 ? 99   VAL B CG1   1 
ATOM   3309  C CG2   . VAL B 1 121 ? -13.121 -41.325 -85.428  1.00 16.81 ? 99   VAL B CG2   1 
ATOM   3310  N N     . ALA B 1 122 ? -10.351 -38.896 -84.229  1.00 16.26 ? 100  ALA B N     1 
ATOM   3311  C CA    . ALA B 1 122 ? -9.288  -39.276 -83.304  1.00 16.45 ? 100  ALA B CA    1 
ATOM   3312  C C     . ALA B 1 122 ? -9.915  -39.380 -81.941  1.00 17.13 ? 100  ALA B C     1 
ATOM   3313  O O     . ALA B 1 122 ? -10.832 -38.627 -81.605  1.00 16.94 ? 100  ALA B O     1 
ATOM   3314  C CB    . ALA B 1 122 ? -8.096  -38.274 -83.305  1.00 15.26 ? 100  ALA B CB    1 
ATOM   3315  N N     . VAL B 1 123 ? -9.423  -40.361 -81.187  1.00 18.66 ? 101  VAL B N     1 
ATOM   3316  C CA    . VAL B 1 123 ? -9.782  -40.526 -79.793  1.00 18.54 ? 101  VAL B CA    1 
ATOM   3317  C C     . VAL B 1 123 ? -8.815  -39.694 -78.967  1.00 17.98 ? 101  VAL B C     1 
ATOM   3318  O O     . VAL B 1 123 ? -7.621  -39.595 -79.297  1.00 17.01 ? 101  VAL B O     1 
ATOM   3319  C CB    . VAL B 1 123 ? -9.747  -41.994 -79.368  1.00 18.65 ? 101  VAL B CB    1 
ATOM   3320  C CG1   . VAL B 1 123 ? -8.297  -42.487 -79.200  1.00 16.94 ? 101  VAL B CG1   1 
ATOM   3321  C CG2   . VAL B 1 123 ? -10.602 -42.188 -78.093  1.00 19.33 ? 101  VAL B CG2   1 
ATOM   3322  N N     . SER B 1 124 ? -9.347  -39.081 -77.913  1.00 17.09 ? 102  SER B N     1 
ATOM   3323  C CA    . SER B 1 124 ? -8.599  -38.118 -77.133  1.00 17.55 ? 102  SER B CA    1 
ATOM   3324  C C     . SER B 1 124 ? -8.338  -38.617 -75.722  1.00 18.21 ? 102  SER B C     1 
ATOM   3325  O O     . SER B 1 124 ? -9.184  -39.238 -75.127  1.00 15.28 ? 102  SER B O     1 
ATOM   3326  C CB    . SER B 1 124 ? -9.363  -36.781 -77.100  1.00 18.66 ? 102  SER B CB    1 
ATOM   3327  O OG    . SER B 1 124 ? -9.501  -36.264 -78.422  1.00 14.66 ? 102  SER B OG    1 
ATOM   3328  N N     . SER B 1 125 ? -7.142  -38.312 -75.210  1.00 21.15 ? 103  SER B N     1 
ATOM   3329  C CA    . SER B 1 125 ? -6.709  -38.702 -73.870  1.00 22.03 ? 103  SER B CA    1 
ATOM   3330  C C     . SER B 1 125 ? -5.789  -37.639 -73.259  1.00 22.97 ? 103  SER B C     1 
ATOM   3331  O O     . SER B 1 125 ? -4.976  -37.042 -73.961  1.00 21.49 ? 103  SER B O     1 
ATOM   3332  C CB    . SER B 1 125 ? -5.952  -40.049 -73.910  1.00 23.13 ? 103  SER B CB    1 
ATOM   3333  O OG    . SER B 1 125 ? -5.642  -40.545 -72.604  1.00 18.57 ? 103  SER B OG    1 
ATOM   3334  N N     . GLY B 1 126 ? -5.947  -37.430 -71.948  1.00 24.11 ? 104  GLY B N     1 
ATOM   3335  C CA    . GLY B 1 126 ? -4.933  -36.797 -71.107  1.00 24.68 ? 104  GLY B CA    1 
ATOM   3336  C C     . GLY B 1 126 ? -3.803  -37.756 -70.761  1.00 25.76 ? 104  GLY B C     1 
ATOM   3337  O O     . GLY B 1 126 ? -3.747  -38.879 -71.247  1.00 25.70 ? 104  GLY B O     1 
ATOM   3338  N N     . SER B 1 127 ? -2.864  -37.304 -69.944  1.00 27.79 ? 105  SER B N     1 
ATOM   3339  C CA    . SER B 1 127 ? -1.704  -38.141 -69.605  1.00 28.47 ? 105  SER B CA    1 
ATOM   3340  C C     . SER B 1 127 ? -1.939  -38.932 -68.311  1.00 27.81 ? 105  SER B C     1 
ATOM   3341  O O     . SER B 1 127 ? -1.030  -39.581 -67.813  1.00 27.28 ? 105  SER B O     1 
ATOM   3342  C CB    . SER B 1 127 ? -0.371  -37.354 -69.606  1.00 27.10 ? 105  SER B CB    1 
ATOM   3343  O OG    . SER B 1 127 ? -0.093  -36.733 -68.369  1.00 29.40 ? 105  SER B OG    1 
ATOM   3344  N N     . GLY B 1 128 ? -3.171  -38.902 -67.807  1.00 28.36 ? 106  GLY B N     1 
ATOM   3345  C CA    . GLY B 1 128 ? -3.554  -39.713 -66.656  1.00 29.34 ? 106  GLY B CA    1 
ATOM   3346  C C     . GLY B 1 128 ? -3.725  -41.202 -66.945  1.00 30.51 ? 106  GLY B C     1 
ATOM   3347  O O     . GLY B 1 128 ? -3.979  -41.613 -68.080  1.00 30.72 ? 106  GLY B O     1 
ATOM   3348  N N     . GLN B 1 129 ? -3.587  -42.011 -65.892  1.00 32.03 ? 107  GLN B N     1 
ATOM   3349  C CA    . GLN B 1 129 ? -3.679  -43.464 -65.997  1.00 31.62 ? 107  GLN B CA    1 
ATOM   3350  C C     . GLN B 1 129 ? -5.053  -43.874 -66.469  1.00 30.60 ? 107  GLN B C     1 
ATOM   3351  O O     . GLN B 1 129 ? -5.162  -44.743 -67.314  1.00 31.27 ? 107  GLN B O     1 
ATOM   3352  C CB    . GLN B 1 129 ? -3.384  -44.118 -64.642  1.00 32.55 ? 107  GLN B CB    1 
ATOM   3353  C CG    . GLN B 1 129 ? -3.306  -45.659 -64.678  1.00 35.56 ? 107  GLN B CG    1 
ATOM   3354  C CD    . GLN B 1 129 ? -3.068  -46.298 -63.302  1.00 36.53 ? 107  GLN B CD    1 
ATOM   3355  O OE1   . GLN B 1 129 ? -2.897  -45.611 -62.281  1.00 32.65 ? 107  GLN B OE1   1 
ATOM   3356  N NE2   . GLN B 1 129 ? -3.055  -47.624 -63.278  1.00 35.49 ? 107  GLN B NE2   1 
ATOM   3357  N N     . ASN B 1 130 ? -6.092  -43.253 -65.915  1.00 30.22 ? 108  ASN B N     1 
ATOM   3358  C CA    . ASN B 1 130 ? -7.490  -43.587 -66.246  1.00 29.60 ? 108  ASN B CA    1 
ATOM   3359  C C     . ASN B 1 130 ? -7.857  -43.233 -67.671  1.00 29.85 ? 108  ASN B C     1 
ATOM   3360  O O     . ASN B 1 130 ? -8.569  -43.988 -68.328  1.00 29.85 ? 108  ASN B O     1 
ATOM   3361  C CB    . ASN B 1 130 ? -8.414  -42.897 -65.274  1.00 28.90 ? 108  ASN B CB    1 
ATOM   3362  C CG    . ASN B 1 130 ? -8.109  -43.288 -63.867  1.00 31.50 ? 108  ASN B CG    1 
ATOM   3363  O OD1   . ASN B 1 130 ? -8.166  -44.466 -63.524  1.00 33.13 ? 108  ASN B OD1   1 
ATOM   3364  N ND2   . ASN B 1 130 ? -7.706  -42.325 -63.056  1.00 33.28 ? 108  ASN B ND2   1 
ATOM   3365  N N     . ASP B 1 131 ? -7.343  -42.094 -68.143  1.00 29.05 ? 109  ASP B N     1 
ATOM   3366  C CA    . ASP B 1 131 ? -7.509  -41.660 -69.525  1.00 28.17 ? 109  ASP B CA    1 
ATOM   3367  C C     . ASP B 1 131 ? -6.887  -42.670 -70.470  1.00 26.98 ? 109  ASP B C     1 
ATOM   3368  O O     . ASP B 1 131 ? -7.483  -43.010 -71.493  1.00 27.95 ? 109  ASP B O     1 
ATOM   3369  C CB    . ASP B 1 131 ? -6.865  -40.271 -69.749  1.00 27.64 ? 109  ASP B CB    1 
ATOM   3370  C CG    . ASP B 1 131 ? -7.744  -39.116 -69.263  1.00 27.98 ? 109  ASP B CG    1 
ATOM   3371  O OD1   . ASP B 1 131 ? -8.675  -39.344 -68.477  1.00 35.80 ? 109  ASP B OD1   1 
ATOM   3372  O OD2   . ASP B 1 131 ? -7.520  -37.967 -69.672  1.00 23.32 ? 109  ASP B OD2   1 
ATOM   3373  N N     . LEU B 1 132 ? -5.688  -43.142 -70.128  1.00 25.64 ? 110  LEU B N     1 
ATOM   3374  C CA    . LEU B 1 132 ? -4.953  -44.090 -70.978  1.00 25.20 ? 110  LEU B CA    1 
ATOM   3375  C C     . LEU B 1 132 ? -5.694  -45.408 -71.092  1.00 25.19 ? 110  LEU B C     1 
ATOM   3376  O O     . LEU B 1 132 ? -5.803  -45.959 -72.187  1.00 26.28 ? 110  LEU B O     1 
ATOM   3377  C CB    . LEU B 1 132 ? -3.543  -44.319 -70.421  1.00 25.59 ? 110  LEU B CB    1 
ATOM   3378  C CG    . LEU B 1 132 ? -2.543  -45.159 -71.231  1.00 24.05 ? 110  LEU B CG    1 
ATOM   3379  C CD1   . LEU B 1 132 ? -2.242  -44.514 -72.572  1.00 26.83 ? 110  LEU B CD1   1 
ATOM   3380  C CD2   . LEU B 1 132 ? -1.244  -45.379 -70.457  1.00 20.60 ? 110  LEU B CD2   1 
ATOM   3381  N N     . GLU B 1 133 ? -6.208  -45.893 -69.961  1.00 24.45 ? 111  GLU B N     1 
ATOM   3382  C CA    . GLU B 1 133 ? -7.008  -47.119 -69.912  1.00 24.47 ? 111  GLU B CA    1 
ATOM   3383  C C     . GLU B 1 133 ? -8.259  -46.997 -70.748  1.00 22.19 ? 111  GLU B C     1 
ATOM   3384  O O     . GLU B 1 133 ? -8.583  -47.914 -71.512  1.00 22.66 ? 111  GLU B O     1 
ATOM   3385  C CB    . GLU B 1 133 ? -7.455  -47.445 -68.485  1.00 24.71 ? 111  GLU B CB    1 
ATOM   3386  C CG    . GLU B 1 133 ? -6.387  -47.932 -67.532  1.00 30.79 ? 111  GLU B CG    1 
ATOM   3387  C CD    . GLU B 1 133 ? -6.951  -48.122 -66.133  1.00 38.63 ? 111  GLU B CD    1 
ATOM   3388  O OE1   . GLU B 1 133 ? -6.464  -47.478 -65.169  1.00 40.91 ? 111  GLU B OE1   1 
ATOM   3389  O OE2   . GLU B 1 133 ? -7.919  -48.900 -66.002  1.00 41.14 ? 111  GLU B OE2   1 
ATOM   3390  N N     . LYS B 1 134 ? -8.978  -45.885 -70.582  1.00 20.56 ? 112  LYS B N     1 
ATOM   3391  C CA    . LYS B 1 134 ? -10.244 -45.683 -71.302  1.00 20.71 ? 112  LYS B CA    1 
ATOM   3392  C C     . LYS B 1 134 ? -10.028 -45.617 -72.809  1.00 17.97 ? 112  LYS B C     1 
ATOM   3393  O O     . LYS B 1 134 ? -10.749 -46.228 -73.583  1.00 16.28 ? 112  LYS B O     1 
ATOM   3394  C CB    . LYS B 1 134 ? -10.990 -44.416 -70.822  1.00 22.94 ? 112  LYS B CB    1 
ATOM   3395  C CG    . LYS B 1 134 ? -12.527 -44.654 -70.675  1.00 26.04 ? 112  LYS B CG    1 
ATOM   3396  C CD    . LYS B 1 134 ? -13.314 -43.364 -70.536  1.00 26.47 ? 112  LYS B CD    1 
ATOM   3397  C CE    . LYS B 1 134 ? -13.643 -42.803 -71.897  1.00 25.97 ? 112  LYS B CE    1 
ATOM   3398  N NZ    . LYS B 1 134 ? -14.102 -41.380 -71.826  1.00 30.01 ? 112  LYS B NZ    1 
ATOM   3399  N N     . MET B 1 135 ? -8.997  -44.898 -73.207  1.00 17.56 ? 113  MET B N     1 
ATOM   3400  C CA    . MET B 1 135 ? -8.626  -44.811 -74.605  1.00 18.66 ? 113  MET B CA    1 
ATOM   3401  C C     . MET B 1 135 ? -8.252  -46.176 -75.174  1.00 18.58 ? 113  MET B C     1 
ATOM   3402  O O     . MET B 1 135 ? -8.677  -46.547 -76.271  1.00 18.76 ? 113  MET B O     1 
ATOM   3403  C CB    . MET B 1 135 ? -7.439  -43.859 -74.779  1.00 19.63 ? 113  MET B CB    1 
ATOM   3404  C CG    . MET B 1 135 ? -7.033  -43.715 -76.221  1.00 20.06 ? 113  MET B CG    1 
ATOM   3405  S SD    . MET B 1 135 ? -5.639  -42.646 -76.416  1.00 34.87 ? 113  MET B SD    1 
ATOM   3406  C CE    . MET B 1 135 ? -4.214  -43.598 -75.898  1.00 28.24 ? 113  MET B CE    1 
ATOM   3407  N N     . THR B 1 136 ? -7.422  -46.895 -74.426  1.00 18.83 ? 114  THR B N     1 
ATOM   3408  C CA    . THR B 1 136 ? -7.021  -48.257 -74.761  1.00 18.01 ? 114  THR B CA    1 
ATOM   3409  C C     . THR B 1 136 ? -8.228  -49.121 -75.044  1.00 17.03 ? 114  THR B C     1 
ATOM   3410  O O     . THR B 1 136 ? -8.265  -49.826 -76.062  1.00 15.89 ? 114  THR B O     1 
ATOM   3411  C CB    . THR B 1 136 ? -6.179  -48.860 -73.618  1.00 18.51 ? 114  THR B CB    1 
ATOM   3412  O OG1   . THR B 1 136 ? -4.912  -48.167 -73.550  1.00 17.04 ? 114  THR B OG1   1 
ATOM   3413  C CG2   . THR B 1 136 ? -5.954  -50.345 -73.820  1.00 17.18 ? 114  THR B CG2   1 
ATOM   3414  N N     . SER B 1 137 ? -9.220  -49.053 -74.155  1.00 16.74 ? 115  SER B N     1 
ATOM   3415  C CA    . SER B 1 137 ? -10.449 -49.862 -74.309  1.00 17.68 ? 115  SER B CA    1 
ATOM   3416  C C     . SER B 1 137 ? -11.261 -49.475 -75.547  1.00 18.47 ? 115  SER B C     1 
ATOM   3417  O O     . SER B 1 137 ? -11.833 -50.328 -76.213  1.00 20.90 ? 115  SER B O     1 
ATOM   3418  C CB    . SER B 1 137 ? -11.334 -49.776 -73.057  1.00 16.78 ? 115  SER B CB    1 
ATOM   3419  O OG    . SER B 1 137 ? -11.871 -48.478 -72.896  1.00 19.46 ? 115  SER B OG    1 
ATOM   3420  N N     . ILE B 1 138 ? -11.306 -48.185 -75.842  1.00 18.82 ? 116  ILE B N     1 
ATOM   3421  C CA    . ILE B 1 138 ? -11.938 -47.677 -77.054  1.00 18.58 ? 116  ILE B CA    1 
ATOM   3422  C C     . ILE B 1 138 ? -11.235 -48.162 -78.340  1.00 18.65 ? 116  ILE B C     1 
ATOM   3423  O O     . ILE B 1 138 ? -11.884 -48.622 -79.274  1.00 18.06 ? 116  ILE B O     1 
ATOM   3424  C CB    . ILE B 1 138 ? -11.947 -46.107 -77.049  1.00 20.22 ? 116  ILE B CB    1 
ATOM   3425  C CG1   . ILE B 1 138 ? -12.968 -45.575 -76.046  1.00 19.80 ? 116  ILE B CG1   1 
ATOM   3426  C CG2   . ILE B 1 138 ? -12.230 -45.506 -78.452  1.00 21.83 ? 116  ILE B CG2   1 
ATOM   3427  C CD1   . ILE B 1 138 ? -12.679 -44.181 -75.615  1.00 16.19 ? 116  ILE B CD1   1 
ATOM   3428  N N     . LEU B 1 139 ? -9.913  -48.037 -78.377  1.00 18.80 ? 117  LEU B N     1 
ATOM   3429  C CA    . LEU B 1 139 ? -9.127  -48.432 -79.539  1.00 19.45 ? 117  LEU B CA    1 
ATOM   3430  C C     . LEU B 1 139 ? -9.146  -49.927 -79.804  1.00 20.88 ? 117  LEU B C     1 
ATOM   3431  O O     . LEU B 1 139 ? -9.140  -50.353 -80.959  1.00 20.68 ? 117  LEU B O     1 
ATOM   3432  C CB    . LEU B 1 139 ? -7.681  -47.973 -79.374  1.00 20.76 ? 117  LEU B CB    1 
ATOM   3433  C CG    . LEU B 1 139 ? -7.421  -46.461 -79.423  1.00 21.08 ? 117  LEU B CG    1 
ATOM   3434  C CD1   . LEU B 1 139 ? -5.970  -46.203 -79.097  1.00 22.54 ? 117  LEU B CD1   1 
ATOM   3435  C CD2   . LEU B 1 139 ? -7.758  -45.878 -80.797  1.00 20.39 ? 117  LEU B CD2   1 
ATOM   3436  N N     . GLU B 1 140 ? -9.144  -50.725 -78.741  1.00 23.15 ? 118  GLU B N     1 
ATOM   3437  C CA    . GLU B 1 140 ? -9.259  -52.174 -78.878  1.00 24.00 ? 118  GLU B CA    1 
ATOM   3438  C C     . GLU B 1 140 ? -10.663 -52.555 -79.327  1.00 21.97 ? 118  GLU B C     1 
ATOM   3439  O O     . GLU B 1 140 ? -10.832 -53.499 -80.094  1.00 21.82 ? 118  GLU B O     1 
ATOM   3440  C CB    . GLU B 1 140 ? -8.875  -52.870 -77.564  1.00 26.15 ? 118  GLU B CB    1 
ATOM   3441  C CG    . GLU B 1 140 ? -7.363  -52.715 -77.220  1.00 32.33 ? 118  GLU B CG    1 
ATOM   3442  C CD    . GLU B 1 140 ? -6.983  -53.148 -75.782  1.00 38.68 ? 118  GLU B CD    1 
ATOM   3443  O OE1   . GLU B 1 140 ? -7.883  -53.498 -74.972  1.00 42.14 ? 118  GLU B OE1   1 
ATOM   3444  O OE2   . GLU B 1 140 ? -5.763  -53.129 -75.467  1.00 36.52 ? 118  GLU B OE2   1 
ATOM   3445  N N     . ALA B 1 141 ? -11.670 -51.827 -78.850  1.00 21.10 ? 119  ALA B N     1 
ATOM   3446  C CA    . ALA B 1 141 ? -13.071 -52.091 -79.246  1.00 20.21 ? 119  ALA B CA    1 
ATOM   3447  C C     . ALA B 1 141 ? -13.406 -51.565 -80.628  1.00 18.85 ? 119  ALA B C     1 
ATOM   3448  O O     . ALA B 1 141 ? -14.327 -52.041 -81.251  1.00 18.60 ? 119  ALA B O     1 
ATOM   3449  C CB    . ALA B 1 141 ? -14.040 -51.487 -78.245  1.00 20.35 ? 119  ALA B CB    1 
ATOM   3450  N N     . VAL B 1 142 ? -12.682 -50.546 -81.076  1.00 18.98 ? 120  VAL B N     1 
ATOM   3451  C CA    . VAL B 1 142 ? -12.931 -49.884 -82.373  1.00 18.29 ? 120  VAL B CA    1 
ATOM   3452  C C     . VAL B 1 142 ? -11.596 -49.761 -83.144  1.00 18.64 ? 120  VAL B C     1 
ATOM   3453  O O     . VAL B 1 142 ? -10.970 -48.680 -83.199  1.00 16.43 ? 120  VAL B O     1 
ATOM   3454  C CB    . VAL B 1 142 ? -13.631 -48.476 -82.215  1.00 17.66 ? 120  VAL B CB    1 
ATOM   3455  C CG1   . VAL B 1 142 ? -14.228 -48.017 -83.532  1.00 19.37 ? 120  VAL B CG1   1 
ATOM   3456  C CG2   . VAL B 1 142 ? -14.728 -48.509 -81.182  1.00 16.48 ? 120  VAL B CG2   1 
ATOM   3457  N N     . PRO B 1 143 ? -11.167 -50.886 -83.754  1.00 19.66 ? 121  PRO B N     1 
ATOM   3458  C CA    . PRO B 1 143 ? -9.855  -50.954 -84.429  1.00 21.19 ? 121  PRO B CA    1 
ATOM   3459  C C     . PRO B 1 143 ? -9.763  -50.027 -85.644  1.00 22.53 ? 121  PRO B C     1 
ATOM   3460  O O     . PRO B 1 143 ? -8.676  -49.808 -86.158  1.00 23.10 ? 121  PRO B O     1 
ATOM   3461  C CB    . PRO B 1 143 ? -9.744  -52.429 -84.875  1.00 21.30 ? 121  PRO B CB    1 
ATOM   3462  C CG    . PRO B 1 143 ? -10.857 -53.165 -84.187  1.00 20.54 ? 121  PRO B CG    1 
ATOM   3463  C CD    . PRO B 1 143 ? -11.920 -52.148 -83.871  1.00 19.29 ? 121  PRO B CD    1 
ATOM   3464  N N     . GLN B 1 144 ? -10.905 -49.503 -86.089  1.00 22.95 ? 122  GLN B N     1 
ATOM   3465  C CA    . GLN B 1 144 ? -10.964 -48.599 -87.235  1.00 23.38 ? 122  GLN B CA    1 
ATOM   3466  C C     . GLN B 1 144 ? -10.486 -47.192 -86.902  1.00 22.68 ? 122  GLN B C     1 
ATOM   3467  O O     . GLN B 1 144 ? -10.146 -46.443 -87.807  1.00 22.76 ? 122  GLN B O     1 
ATOM   3468  C CB    . GLN B 1 144 ? -12.387 -48.519 -87.809  1.00 24.27 ? 122  GLN B CB    1 
ATOM   3469  C CG    . GLN B 1 144 ? -12.901 -49.824 -88.401  1.00 25.92 ? 122  GLN B CG    1 
ATOM   3470  C CD    . GLN B 1 144 ? -13.679 -50.687 -87.409  1.00 31.64 ? 122  GLN B CD    1 
ATOM   3471  O OE1   . GLN B 1 144 ? -13.504 -50.596 -86.195  1.00 28.41 ? 122  GLN B OE1   1 
ATOM   3472  N NE2   . GLN B 1 144 ? -14.544 -51.537 -87.940  1.00 35.49 ? 122  GLN B NE2   1 
ATOM   3473  N N     . VAL B 1 145 ? -10.468 -46.831 -85.619  1.00 22.83 ? 123  VAL B N     1 
ATOM   3474  C CA    . VAL B 1 145 ? -9.929  -45.534 -85.187  1.00 21.89 ? 123  VAL B CA    1 
ATOM   3475  C C     . VAL B 1 145 ? -8.417  -45.626 -85.114  1.00 21.79 ? 123  VAL B C     1 
ATOM   3476  O O     . VAL B 1 145 ? -7.867  -46.352 -84.269  1.00 23.11 ? 123  VAL B O     1 
ATOM   3477  C CB    . VAL B 1 145 ? -10.443 -45.108 -83.805  1.00 21.48 ? 123  VAL B CB    1 
ATOM   3478  C CG1   . VAL B 1 145 ? -9.912  -43.720 -83.446  1.00 25.11 ? 123  VAL B CG1   1 
ATOM   3479  C CG2   . VAL B 1 145 ? -11.959 -45.122 -83.763  1.00 24.03 ? 123  VAL B CG2   1 
ATOM   3480  N N     . LYS B 1 146 ? -7.745  -44.867 -85.970  1.00 21.98 ? 124  LYS B N     1 
ATOM   3481  C CA    . LYS B 1 146 ? -6.303  -44.971 -86.168  1.00 21.57 ? 124  LYS B CA    1 
ATOM   3482  C C     . LYS B 1 146 ? -5.527  -43.703 -85.779  1.00 20.66 ? 124  LYS B C     1 
ATOM   3483  O O     . LYS B 1 146 ? -4.352  -43.549 -86.120  1.00 19.02 ? 124  LYS B O     1 
ATOM   3484  C CB    . LYS B 1 146 ? -6.056  -45.263 -87.655  1.00 23.24 ? 124  LYS B CB    1 
ATOM   3485  C CG    . LYS B 1 146 ? -6.728  -46.544 -88.211  1.00 25.64 ? 124  LYS B CG    1 
ATOM   3486  C CD    . LYS B 1 146 ? -6.263  -47.832 -87.500  1.00 30.00 ? 124  LYS B CD    1 
ATOM   3487  C CE    . LYS B 1 146 ? -4.754  -48.095 -87.616  1.00 31.49 ? 124  LYS B CE    1 
ATOM   3488  N NZ    . LYS B 1 146 ? -4.354  -49.097 -86.600  1.00 35.35 ? 124  LYS B NZ    1 
ATOM   3489  N N     . PHE B 1 147 ? -6.193  -42.796 -85.069  1.00 20.07 ? 125  PHE B N     1 
ATOM   3490  C CA    . PHE B 1 147 ? -5.586  -41.558 -84.622  1.00 18.14 ? 125  PHE B CA    1 
ATOM   3491  C C     . PHE B 1 147 ? -5.836  -41.359 -83.139  1.00 17.14 ? 125  PHE B C     1 
ATOM   3492  O O     . PHE B 1 147 ? -6.954  -41.534 -82.635  1.00 15.45 ? 125  PHE B O     1 
ATOM   3493  C CB    . PHE B 1 147 ? -6.171  -40.379 -85.361  1.00 19.31 ? 125  PHE B CB    1 
ATOM   3494  C CG    . PHE B 1 147 ? -5.629  -40.186 -86.752  1.00 20.45 ? 125  PHE B CG    1 
ATOM   3495  C CD1   . PHE B 1 147 ? -4.631  -39.251 -86.994  1.00 17.53 ? 125  PHE B CD1   1 
ATOM   3496  C CD2   . PHE B 1 147 ? -6.145  -40.903 -87.817  1.00 19.33 ? 125  PHE B CD2   1 
ATOM   3497  C CE1   . PHE B 1 147 ? -4.157  -39.046 -88.271  1.00 19.53 ? 125  PHE B CE1   1 
ATOM   3498  C CE2   . PHE B 1 147 ? -5.673  -40.704 -89.085  1.00 18.40 ? 125  PHE B CE2   1 
ATOM   3499  C CZ    . PHE B 1 147 ? -4.677  -39.768 -89.316  1.00 19.59 ? 125  PHE B CZ    1 
ATOM   3500  N N     . ILE B 1 148 ? -4.776  -40.988 -82.436  1.00 17.29 ? 126  ILE B N     1 
ATOM   3501  C CA    . ILE B 1 148 ? -4.860  -40.678 -81.017  1.00 16.75 ? 126  ILE B CA    1 
ATOM   3502  C C     . ILE B 1 148 ? -4.499  -39.212 -80.819  1.00 16.85 ? 126  ILE B C     1 
ATOM   3503  O O     . ILE B 1 148 ? -3.537  -38.703 -81.441  1.00 15.95 ? 126  ILE B O     1 
ATOM   3504  C CB    . ILE B 1 148 ? -3.928  -41.584 -80.192  1.00 17.53 ? 126  ILE B CB    1 
ATOM   3505  C CG1   . ILE B 1 148 ? -4.391  -43.043 -80.288  1.00 17.35 ? 126  ILE B CG1   1 
ATOM   3506  C CG2   . ILE B 1 148 ? -3.910  -41.144 -78.753  1.00 18.33 ? 126  ILE B CG2   1 
ATOM   3507  C CD1   . ILE B 1 148 ? -3.371  -44.062 -79.844  1.00 20.16 ? 126  ILE B CD1   1 
ATOM   3508  N N     . CYS B 1 149 ? -5.271  -38.536 -79.967  1.00 17.16 ? 127  CYS B N     1 
ATOM   3509  C CA    . CYS B 1 149 ? -4.967  -37.162 -79.606  1.00 18.21 ? 127  CYS B CA    1 
ATOM   3510  C C     . CYS B 1 149 ? -4.595  -36.977 -78.126  1.00 18.45 ? 127  CYS B C     1 
ATOM   3511  O O     . CYS B 1 149 ? -5.427  -37.158 -77.229  1.00 17.52 ? 127  CYS B O     1 
ATOM   3512  C CB    . CYS B 1 149 ? -6.116  -36.238 -79.968  1.00 17.81 ? 127  CYS B CB    1 
ATOM   3513  S SG    . CYS B 1 149 ? -5.488  -34.573 -80.083  1.00 19.55 ? 127  CYS B SG    1 
ATOM   3514  N N     . LEU B 1 150 ? -3.340  -36.582 -77.887  1.00 19.15 ? 128  LEU B N     1 
ATOM   3515  C CA    . LEU B 1 150 ? -2.815  -36.433 -76.530  1.00 19.20 ? 128  LEU B CA    1 
ATOM   3516  C C     . LEU B 1 150 ? -2.656  -34.980 -76.165  1.00 20.96 ? 128  LEU B C     1 
ATOM   3517  O O     . LEU B 1 150 ? -2.145  -34.190 -76.956  1.00 22.72 ? 128  LEU B O     1 
ATOM   3518  C CB    . LEU B 1 150 ? -1.471  -37.117 -76.402  1.00 17.84 ? 128  LEU B CB    1 
ATOM   3519  C CG    . LEU B 1 150 ? -1.470  -38.557 -76.860  1.00 13.28 ? 128  LEU B CG    1 
ATOM   3520  C CD1   . LEU B 1 150 ? -0.082  -39.130 -76.641  1.00 11.85 ? 128  LEU B CD1   1 
ATOM   3521  C CD2   . LEU B 1 150 ? -2.594  -39.358 -76.136  1.00 7.59  ? 128  LEU B CD2   1 
ATOM   3522  N N     . ASP B 1 151 ? -3.095  -34.620 -74.967  1.00 23.26 ? 129  ASP B N     1 
ATOM   3523  C CA    . ASP B 1 151 ? -3.052  -33.229 -74.541  1.00 23.91 ? 129  ASP B CA    1 
ATOM   3524  C C     . ASP B 1 151 ? -2.764  -33.137 -73.065  1.00 22.88 ? 129  ASP B C     1 
ATOM   3525  O O     . ASP B 1 151 ? -3.318  -33.876 -72.262  1.00 22.42 ? 129  ASP B O     1 
ATOM   3526  C CB    . ASP B 1 151 ? -4.351  -32.497 -74.857  1.00 26.36 ? 129  ASP B CB    1 
ATOM   3527  C CG    . ASP B 1 151 ? -4.566  -32.267 -76.353  1.00 28.95 ? 129  ASP B CG    1 
ATOM   3528  O OD1   . ASP B 1 151 ? -3.602  -31.931 -77.080  1.00 29.29 ? 129  ASP B OD1   1 
ATOM   3529  O OD2   . ASP B 1 151 ? -5.741  -32.418 -76.783  1.00 36.76 ? 129  ASP B OD2   1 
ATOM   3530  N N     . VAL B 1 152 ? -1.882  -32.211 -72.732  1.00 22.29 ? 130  VAL B N     1 
ATOM   3531  C CA    . VAL B 1 152 ? -1.485  -31.933 -71.375  1.00 20.96 ? 130  VAL B CA    1 
ATOM   3532  C C     . VAL B 1 152 ? -1.474  -30.438 -71.135  1.00 20.44 ? 130  VAL B C     1 
ATOM   3533  O O     . VAL B 1 152 ? -1.575  -29.641 -72.073  1.00 21.36 ? 130  VAL B O     1 
ATOM   3534  C CB    . VAL B 1 152 ? -0.101  -32.497 -71.095  1.00 22.49 ? 130  VAL B CB    1 
ATOM   3535  C CG1   . VAL B 1 152 ? -0.183  -34.028 -71.106  1.00 24.27 ? 130  VAL B CG1   1 
ATOM   3536  C CG2   . VAL B 1 152 ? 0.943   -31.971 -72.116  1.00 19.51 ? 130  VAL B CG2   1 
ATOM   3537  N N     . ALA B 1 153 ? -1.385  -30.056 -69.870  1.00 19.25 ? 131  ALA B N     1 
ATOM   3538  C CA    . ALA B 1 153 ? -1.230  -28.653 -69.505  1.00 18.95 ? 131  ALA B CA    1 
ATOM   3539  C C     . ALA B 1 153 ? 0.142   -28.163 -69.953  1.00 17.21 ? 131  ALA B C     1 
ATOM   3540  O O     . ALA B 1 153 ? 0.234   -27.101 -70.538  1.00 15.66 ? 131  ALA B O     1 
ATOM   3541  C CB    . ALA B 1 153 ? -1.411  -28.465 -67.996  1.00 19.19 ? 131  ALA B CB    1 
ATOM   3542  N N     . ASN B 1 154 ? 1.173   -28.982 -69.703  1.00 17.41 ? 132  ASN B N     1 
ATOM   3543  C CA    . ASN B 1 154 ? 2.559   -28.647 -70.029  1.00 17.96 ? 132  ASN B CA    1 
ATOM   3544  C C     . ASN B 1 154 ? 3.236   -29.587 -71.053  1.00 16.33 ? 132  ASN B C     1 
ATOM   3545  O O     . ASN B 1 154 ? 3.957   -30.533 -70.682  1.00 15.47 ? 132  ASN B O     1 
ATOM   3546  C CB    . ASN B 1 154 ? 3.402   -28.575 -68.745  1.00 19.70 ? 132  ASN B CB    1 
ATOM   3547  C CG    . ASN B 1 154 ? 4.818   -28.148 -69.026  1.00 16.29 ? 132  ASN B CG    1 
ATOM   3548  O OD1   . ASN B 1 154 ? 5.112   -27.794 -70.147  1.00 17.60 ? 132  ASN B OD1   1 
ATOM   3549  N ND2   . ASN B 1 154 ? 5.704   -28.238 -68.040  1.00 12.59 ? 132  ASN B ND2   1 
ATOM   3550  N N     . GLY B 1 155 ? 3.042   -29.286 -72.337  1.00 14.99 ? 133  GLY B N     1 
ATOM   3551  C CA    . GLY B 1 155 ? 3.602   -30.062 -73.421  1.00 13.73 ? 133  GLY B CA    1 
ATOM   3552  C C     . GLY B 1 155 ? 5.108   -30.003 -73.481  1.00 15.39 ? 133  GLY B C     1 
ATOM   3553  O O     . GLY B 1 155 ? 5.687   -30.749 -74.264  1.00 16.19 ? 133  GLY B O     1 
ATOM   3554  N N     . TYR B 1 156 ? 5.744   -29.127 -72.680  1.00 15.16 ? 134  TYR B N     1 
ATOM   3555  C CA    . TYR B 1 156 ? 7.235   -29.053 -72.562  1.00 15.28 ? 134  TYR B CA    1 
ATOM   3556  C C     . TYR B 1 156 ? 7.819   -29.955 -71.452  1.00 16.45 ? 134  TYR B C     1 
ATOM   3557  O O     . TYR B 1 156 ? 9.031   -29.950 -71.223  1.00 16.33 ? 134  TYR B O     1 
ATOM   3558  C CB    . TYR B 1 156 ? 7.712   -27.600 -72.349  1.00 12.33 ? 134  TYR B CB    1 
ATOM   3559  C CG    . TYR B 1 156 ? 7.600   -26.753 -73.604  1.00 10.57 ? 134  TYR B CG    1 
ATOM   3560  C CD1   . TYR B 1 156 ? 8.733   -26.427 -74.363  1.00 10.61 ? 134  TYR B CD1   1 
ATOM   3561  C CD2   . TYR B 1 156 ? 6.369   -26.285 -74.033  1.00 8.57  ? 134  TYR B CD2   1 
ATOM   3562  C CE1   . TYR B 1 156 ? 8.624   -25.678 -75.515  1.00 11.77 ? 134  TYR B CE1   1 
ATOM   3563  C CE2   . TYR B 1 156 ? 6.243   -25.512 -75.174  1.00 12.14 ? 134  TYR B CE2   1 
ATOM   3564  C CZ    . TYR B 1 156 ? 7.371   -25.214 -75.925  1.00 16.60 ? 134  TYR B CZ    1 
ATOM   3565  O OH    . TYR B 1 156 ? 7.239   -24.443 -77.066  1.00 11.91 ? 134  TYR B OH    1 
ATOM   3566  N N     . SER B 1 157 ? 6.953   -30.740 -70.799  1.00 17.25 ? 135  SER B N     1 
ATOM   3567  C CA    A SER B 1 157 ? 7.334   -31.575 -69.658  0.60 17.79 ? 135  SER B CA    1 
ATOM   3568  C CA    B SER B 1 157 ? 7.367   -31.559 -69.654  0.40 17.92 ? 135  SER B CA    1 
ATOM   3569  C C     . SER B 1 157 ? 8.023   -32.870 -70.079  1.00 18.74 ? 135  SER B C     1 
ATOM   3570  O O     . SER B 1 157 ? 7.629   -33.482 -71.062  1.00 20.38 ? 135  SER B O     1 
ATOM   3571  C CB    A SER B 1 157 ? 6.093   -31.928 -68.844  0.60 15.76 ? 135  SER B CB    1 
ATOM   3572  C CB    B SER B 1 157 ? 6.166   -31.864 -68.770  0.40 16.67 ? 135  SER B CB    1 
ATOM   3573  O OG    A SER B 1 157 ? 6.468   -32.538 -67.633  0.60 11.45 ? 135  SER B OG    1 
ATOM   3574  O OG    B SER B 1 157 ? 5.082   -32.249 -69.577  0.40 13.41 ? 135  SER B OG    1 
ATOM   3575  N N     . GLU B 1 158 ? 9.021   -33.314 -69.314  1.00 20.07 ? 136  GLU B N     1 
ATOM   3576  C CA    . GLU B 1 158 ? 9.644   -34.626 -69.574  1.00 21.25 ? 136  GLU B CA    1 
ATOM   3577  C C     . GLU B 1 158 ? 8.612   -35.719 -69.316  1.00 21.08 ? 136  GLU B C     1 
ATOM   3578  O O     . GLU B 1 158 ? 8.682   -36.808 -69.895  1.00 22.17 ? 136  GLU B O     1 
ATOM   3579  C CB    . GLU B 1 158 ? 10.869  -34.902 -68.698  1.00 18.81 ? 136  GLU B CB    1 
ATOM   3580  C CG    . GLU B 1 158 ? 12.086  -34.060 -68.987  1.00 27.31 ? 136  GLU B CG    1 
ATOM   3581  C CD    . GLU B 1 158 ? 12.553  -34.093 -70.452  1.00 34.59 ? 136  GLU B CD    1 
ATOM   3582  O OE1   . GLU B 1 158 ? 12.838  -33.003 -71.001  1.00 40.33 ? 136  GLU B OE1   1 
ATOM   3583  O OE2   . GLU B 1 158 ? 12.646  -35.194 -71.046  1.00 37.57 ? 136  GLU B OE2   1 
ATOM   3584  N N     . HIS B 1 159 ? 7.658   -35.431 -68.432  1.00 20.31 ? 137  HIS B N     1 
ATOM   3585  C CA    . HIS B 1 159 ? 6.596   -36.369 -68.152  1.00 21.07 ? 137  HIS B CA    1 
ATOM   3586  C C     . HIS B 1 159 ? 5.751   -36.610 -69.387  1.00 20.05 ? 137  HIS B C     1 
ATOM   3587  O O     . HIS B 1 159 ? 5.212   -37.703 -69.558  1.00 22.47 ? 137  HIS B O     1 
ATOM   3588  C CB    . HIS B 1 159 ? 5.691   -35.876 -67.024  1.00 22.27 ? 137  HIS B CB    1 
ATOM   3589  C CG    . HIS B 1 159 ? 4.603   -36.839 -66.687  1.00 31.64 ? 137  HIS B CG    1 
ATOM   3590  N ND1   . HIS B 1 159 ? 4.719   -37.763 -65.670  1.00 40.10 ? 137  HIS B ND1   1 
ATOM   3591  C CD2   . HIS B 1 159 ? 3.405   -37.073 -67.274  1.00 42.85 ? 137  HIS B CD2   1 
ATOM   3592  C CE1   . HIS B 1 159 ? 3.629   -38.511 -65.630  1.00 45.25 ? 137  HIS B CE1   1 
ATOM   3593  N NE2   . HIS B 1 159 ? 2.815   -38.112 -66.591  1.00 48.77 ? 137  HIS B NE2   1 
ATOM   3594  N N     . PHE B 1 160 ? 5.606   -35.594 -70.233  1.00 20.14 ? 138  PHE B N     1 
ATOM   3595  C CA    . PHE B 1 160 ? 4.782   -35.722 -71.436  1.00 19.66 ? 138  PHE B CA    1 
ATOM   3596  C C     . PHE B 1 160 ? 5.555   -36.458 -72.499  1.00 18.97 ? 138  PHE B C     1 
ATOM   3597  O O     . PHE B 1 160 ? 5.012   -37.334 -73.161  1.00 17.69 ? 138  PHE B O     1 
ATOM   3598  C CB    . PHE B 1 160 ? 4.312   -34.359 -71.955  1.00 18.61 ? 138  PHE B CB    1 
ATOM   3599  C CG    . PHE B 1 160 ? 3.306   -34.449 -73.073  1.00 20.96 ? 138  PHE B CG    1 
ATOM   3600  C CD1   . PHE B 1 160 ? 2.229   -35.328 -73.002  1.00 21.55 ? 138  PHE B CD1   1 
ATOM   3601  C CD2   . PHE B 1 160 ? 3.428   -33.666 -74.206  1.00 22.92 ? 138  PHE B CD2   1 
ATOM   3602  C CE1   . PHE B 1 160 ? 1.319   -35.430 -74.042  1.00 17.94 ? 138  PHE B CE1   1 
ATOM   3603  C CE2   . PHE B 1 160 ? 2.489   -33.767 -75.244  1.00 19.16 ? 138  PHE B CE2   1 
ATOM   3604  C CZ    . PHE B 1 160 ? 1.447   -34.655 -75.154  1.00 16.40 ? 138  PHE B CZ    1 
ATOM   3605  N N     . VAL B 1 161 ? 6.836   -36.122 -72.620  1.00 18.62 ? 139  VAL B N     1 
ATOM   3606  C CA    . VAL B 1 161 ? 7.767   -36.864 -73.481  1.00 19.10 ? 139  VAL B CA    1 
ATOM   3607  C C     . VAL B 1 161 ? 7.667   -38.381 -73.259  1.00 20.09 ? 139  VAL B C     1 
ATOM   3608  O O     . VAL B 1 161 ? 7.552   -39.153 -74.209  1.00 19.17 ? 139  VAL B O     1 
ATOM   3609  C CB    . VAL B 1 161 ? 9.244   -36.400 -73.231  1.00 18.55 ? 139  VAL B CB    1 
ATOM   3610  C CG1   . VAL B 1 161 ? 10.240  -37.412 -73.774  1.00 20.09 ? 139  VAL B CG1   1 
ATOM   3611  C CG2   . VAL B 1 161 ? 9.480   -35.005 -73.834  1.00 18.02 ? 139  VAL B CG2   1 
ATOM   3612  N N     . GLU B 1 162 ? 7.716   -38.786 -71.994  1.00 21.65 ? 140  GLU B N     1 
ATOM   3613  C CA    . GLU B 1 162 ? 7.666   -40.196 -71.616  1.00 21.57 ? 140  GLU B CA    1 
ATOM   3614  C C     . GLU B 1 162 ? 6.269   -40.813 -71.797  1.00 19.38 ? 140  GLU B C     1 
ATOM   3615  O O     . GLU B 1 162 ? 6.143   -42.022 -71.989  1.00 19.06 ? 140  GLU B O     1 
ATOM   3616  C CB    . GLU B 1 162 ? 8.108   -40.366 -70.161  1.00 22.31 ? 140  GLU B CB    1 
ATOM   3617  C CG    . GLU B 1 162 ? 9.541   -40.017 -69.938  1.00 27.33 ? 140  GLU B CG    1 
ATOM   3618  C CD    . GLU B 1 162 ? 10.475  -40.927 -70.681  1.00 33.83 ? 140  GLU B CD    1 
ATOM   3619  O OE1   . GLU B 1 162 ? 10.157  -42.147 -70.746  1.00 37.03 ? 140  GLU B OE1   1 
ATOM   3620  O OE2   . GLU B 1 162 ? 11.526  -40.425 -71.171  1.00 33.59 ? 140  GLU B OE2   1 
ATOM   3621  N N     . PHE B 1 163 ? 5.228   -40.002 -71.698  1.00 17.81 ? 141  PHE B N     1 
ATOM   3622  C CA    . PHE B 1 163 ? 3.902   -40.500 -71.945  1.00 18.82 ? 141  PHE B CA    1 
ATOM   3623  C C     . PHE B 1 163 ? 3.730   -40.777 -73.437  1.00 19.43 ? 141  PHE B C     1 
ATOM   3624  O O     . PHE B 1 163 ? 3.148   -41.782 -73.843  1.00 20.12 ? 141  PHE B O     1 
ATOM   3625  C CB    . PHE B 1 163 ? 2.867   -39.499 -71.444  1.00 19.95 ? 141  PHE B CB    1 
ATOM   3626  C CG    . PHE B 1 163 ? 1.454   -39.945 -71.632  1.00 16.80 ? 141  PHE B CG    1 
ATOM   3627  C CD1   . PHE B 1 163 ? 0.967   -41.037 -70.951  1.00 19.78 ? 141  PHE B CD1   1 
ATOM   3628  C CD2   . PHE B 1 163 ? 0.623   -39.279 -72.486  1.00 17.36 ? 141  PHE B CD2   1 
ATOM   3629  C CE1   . PHE B 1 163 ? -0.342  -41.454 -71.124  1.00 20.74 ? 141  PHE B CE1   1 
ATOM   3630  C CE2   . PHE B 1 163 ? -0.692  -39.690 -72.668  1.00 22.26 ? 141  PHE B CE2   1 
ATOM   3631  C CZ    . PHE B 1 163 ? -1.175  -40.775 -71.983  1.00 19.93 ? 141  PHE B CZ    1 
ATOM   3632  N N     . VAL B 1 164 ? 4.253   -39.888 -74.260  1.00 19.74 ? 142  VAL B N     1 
ATOM   3633  C CA    . VAL B 1 164 ? 4.277   -40.107 -75.701  1.00 21.17 ? 142  VAL B CA    1 
ATOM   3634  C C     . VAL B 1 164 ? 5.006   -41.425 -76.039  1.00 20.45 ? 142  VAL B C     1 
ATOM   3635  O O     . VAL B 1 164 ? 4.476   -42.260 -76.771  1.00 22.00 ? 142  VAL B O     1 
ATOM   3636  C CB    . VAL B 1 164 ? 4.915   -38.876 -76.438  1.00 20.61 ? 142  VAL B CB    1 
ATOM   3637  C CG1   . VAL B 1 164 ? 5.225   -39.172 -77.881  1.00 21.36 ? 142  VAL B CG1   1 
ATOM   3638  C CG2   . VAL B 1 164 ? 3.985   -37.707 -76.350  1.00 21.22 ? 142  VAL B CG2   1 
ATOM   3639  N N     . LYS B 1 165 ? 6.203   -41.602 -75.497  1.00 19.20 ? 143  LYS B N     1 
ATOM   3640  C CA    . LYS B 1 165 ? 6.961   -42.838 -75.690  1.00 18.89 ? 143  LYS B CA    1 
ATOM   3641  C C     . LYS B 1 165 ? 6.143   -44.085 -75.384  1.00 19.50 ? 143  LYS B C     1 
ATOM   3642  O O     . LYS B 1 165 ? 6.239   -45.094 -76.102  1.00 19.90 ? 143  LYS B O     1 
ATOM   3643  C CB    . LYS B 1 165 ? 8.186   -42.863 -74.791  1.00 16.81 ? 143  LYS B CB    1 
ATOM   3644  C CG    . LYS B 1 165 ? 9.178   -41.788 -75.135  1.00 21.60 ? 143  LYS B CG    1 
ATOM   3645  C CD    . LYS B 1 165 ? 10.599  -42.172 -74.840  1.00 18.07 ? 143  LYS B CD    1 
ATOM   3646  C CE    . LYS B 1 165 ? 11.444  -40.916 -74.779  1.00 19.08 ? 143  LYS B CE    1 
ATOM   3647  N NZ    . LYS B 1 165 ? 12.561  -41.063 -73.849  1.00 17.70 ? 143  LYS B NZ    1 
ATOM   3648  N N     . LEU B 1 166 ? 5.358   -44.002 -74.307  1.00 18.99 ? 144  LEU B N     1 
ATOM   3649  C CA    . LEU B 1 166 ? 4.522   -45.104 -73.841  1.00 18.97 ? 144  LEU B CA    1 
ATOM   3650  C C     . LEU B 1 166 ? 3.364   -45.406 -74.783  1.00 18.08 ? 144  LEU B C     1 
ATOM   3651  O O     . LEU B 1 166 ? 3.104   -46.554 -75.117  1.00 19.61 ? 144  LEU B O     1 
ATOM   3652  C CB    . LEU B 1 166 ? 3.955   -44.787 -72.453  1.00 17.62 ? 144  LEU B CB    1 
ATOM   3653  C CG    . LEU B 1 166 ? 3.018   -45.830 -71.841  1.00 16.43 ? 144  LEU B CG    1 
ATOM   3654  C CD1   . LEU B 1 166 ? 3.647   -47.224 -71.821  1.00 14.40 ? 144  LEU B CD1   1 
ATOM   3655  C CD2   . LEU B 1 166 ? 2.673   -45.411 -70.441  1.00 16.13 ? 144  LEU B CD2   1 
ATOM   3656  N N     . VAL B 1 167 ? 2.672   -44.364 -75.197  1.00 17.90 ? 145  VAL B N     1 
ATOM   3657  C CA    . VAL B 1 167 ? 1.560   -44.488 -76.129  1.00 17.55 ? 145  VAL B CA    1 
ATOM   3658  C C     . VAL B 1 167 ? 2.046   -45.028 -77.481  1.00 15.87 ? 145  VAL B C     1 
ATOM   3659  O O     . VAL B 1 167 ? 1.399   -45.899 -78.080  1.00 15.31 ? 145  VAL B O     1 
ATOM   3660  C CB    . VAL B 1 167 ? 0.833   -43.117 -76.304  1.00 16.10 ? 145  VAL B CB    1 
ATOM   3661  C CG1   . VAL B 1 167 ? -0.172  -43.172 -77.395  1.00 19.19 ? 145  VAL B CG1   1 
ATOM   3662  C CG2   . VAL B 1 167 ? 0.158   -42.710 -75.009  1.00 18.03 ? 145  VAL B CG2   1 
ATOM   3663  N N     . ARG B 1 168 ? 3.182   -44.511 -77.950  1.00 14.83 ? 146  ARG B N     1 
ATOM   3664  C CA    . ARG B 1 168 ? 3.819   -45.012 -79.159  1.00 14.46 ? 146  ARG B CA    1 
ATOM   3665  C C     . ARG B 1 168 ? 4.056   -46.530 -79.053  1.00 14.36 ? 146  ARG B C     1 
ATOM   3666  O O     . ARG B 1 168 ? 3.737   -47.287 -79.965  1.00 16.94 ? 146  ARG B O     1 
ATOM   3667  C CB    . ARG B 1 168 ? 5.136   -44.264 -79.379  1.00 14.15 ? 146  ARG B CB    1 
ATOM   3668  C CG    . ARG B 1 168 ? 6.070   -44.830 -80.455  1.00 17.48 ? 146  ARG B CG    1 
ATOM   3669  C CD    . ARG B 1 168 ? 5.350   -45.146 -81.767  1.00 20.43 ? 146  ARG B CD    1 
ATOM   3670  N NE    . ARG B 1 168 ? 4.718   -43.975 -82.369  1.00 17.25 ? 146  ARG B NE    1 
ATOM   3671  C CZ    . ARG B 1 168 ? 3.580   -43.990 -83.069  1.00 17.83 ? 146  ARG B CZ    1 
ATOM   3672  N NH1   . ARG B 1 168 ? 2.885   -45.114 -83.249  1.00 25.17 ? 146  ARG B NH1   1 
ATOM   3673  N NH2   . ARG B 1 168 ? 3.115   -42.863 -83.578  1.00 18.81 ? 146  ARG B NH2   1 
ATOM   3674  N N     . ALA B 1 169 ? 4.630   -46.956 -77.938  1.00 13.58 ? 147  ALA B N     1 
ATOM   3675  C CA    . ALA B 1 169 ? 4.985   -48.345 -77.739  1.00 11.59 ? 147  ALA B CA    1 
ATOM   3676  C C     . ALA B 1 169 ? 3.733   -49.208 -77.621  1.00 12.04 ? 147  ALA B C     1 
ATOM   3677  O O     . ALA B 1 169 ? 3.700   -50.292 -78.184  1.00 12.88 ? 147  ALA B O     1 
ATOM   3678  C CB    . ALA B 1 169 ? 5.862   -48.494 -76.533  1.00 10.68 ? 147  ALA B CB    1 
ATOM   3679  N N     . LYS B 1 170 ? 2.710   -48.706 -76.924  1.00 12.39 ? 148  LYS B N     1 
ATOM   3680  C CA    . LYS B 1 170 ? 1.430   -49.402 -76.777  1.00 13.41 ? 148  LYS B CA    1 
ATOM   3681  C C     . LYS B 1 170 ? 0.684   -49.516 -78.089  1.00 15.45 ? 148  LYS B C     1 
ATOM   3682  O O     . LYS B 1 170 ? 0.045   -50.528 -78.344  1.00 16.63 ? 148  LYS B O     1 
ATOM   3683  C CB    . LYS B 1 170 ? 0.530   -48.702 -75.755  1.00 14.10 ? 148  LYS B CB    1 
ATOM   3684  C CG    . LYS B 1 170 ? 0.897   -48.974 -74.262  1.00 19.80 ? 148  LYS B CG    1 
ATOM   3685  C CD    . LYS B 1 170 ? 0.029   -48.196 -73.254  1.00 19.57 ? 148  LYS B CD    1 
ATOM   3686  C CE    . LYS B 1 170 ? -1.425  -48.664 -73.245  1.00 22.44 ? 148  LYS B CE    1 
ATOM   3687  N NZ    . LYS B 1 170 ? -1.702  -49.837 -72.365  1.00 22.06 ? 148  LYS B NZ    1 
ATOM   3688  N N     . PHE B 1 171 ? 0.764   -48.476 -78.918  1.00 17.20 ? 149  PHE B N     1 
ATOM   3689  C CA    . PHE B 1 171 ? 0.016   -48.403 -80.179  1.00 17.52 ? 149  PHE B CA    1 
ATOM   3690  C C     . PHE B 1 171 ? 0.941   -48.032 -81.342  1.00 17.47 ? 149  PHE B C     1 
ATOM   3691  O O     . PHE B 1 171 ? 0.894   -46.918 -81.829  1.00 18.37 ? 149  PHE B O     1 
ATOM   3692  C CB    . PHE B 1 171 ? -1.087  -47.350 -80.024  1.00 17.82 ? 149  PHE B CB    1 
ATOM   3693  C CG    . PHE B 1 171 ? -1.905  -47.526 -78.785  1.00 20.87 ? 149  PHE B CG    1 
ATOM   3694  C CD1   . PHE B 1 171 ? -2.774  -48.605 -78.668  1.00 19.67 ? 149  PHE B CD1   1 
ATOM   3695  C CD2   . PHE B 1 171 ? -1.791  -46.635 -77.729  1.00 20.31 ? 149  PHE B CD2   1 
ATOM   3696  C CE1   . PHE B 1 171 ? -3.527  -48.784 -77.518  1.00 22.83 ? 149  PHE B CE1   1 
ATOM   3697  C CE2   . PHE B 1 171 ? -2.543  -46.799 -76.581  1.00 21.60 ? 149  PHE B CE2   1 
ATOM   3698  C CZ    . PHE B 1 171 ? -3.417  -47.875 -76.468  1.00 22.62 ? 149  PHE B CZ    1 
ATOM   3699  N N     . PRO B 1 172 ? 1.783   -48.971 -81.797  1.00 17.83 ? 150  PRO B N     1 
ATOM   3700  C CA    . PRO B 1 172 ? 2.816   -48.676 -82.795  1.00 18.22 ? 150  PRO B CA    1 
ATOM   3701  C C     . PRO B 1 172 ? 2.318   -48.220 -84.168  1.00 18.38 ? 150  PRO B C     1 
ATOM   3702  O O     . PRO B 1 172 ? 3.063   -47.586 -84.905  1.00 16.61 ? 150  PRO B O     1 
ATOM   3703  C CB    . PRO B 1 172 ? 3.524   -50.017 -82.972  1.00 17.09 ? 150  PRO B CB    1 
ATOM   3704  C CG    . PRO B 1 172 ? 3.053   -50.876 -81.905  1.00 18.58 ? 150  PRO B CG    1 
ATOM   3705  C CD    . PRO B 1 172 ? 1.775   -50.387 -81.411  1.00 16.88 ? 150  PRO B CD    1 
ATOM   3706  N N     . GLU B 1 173 ? 1.076   -48.559 -84.495  1.00 20.72 ? 151  GLU B N     1 
ATOM   3707  C CA    . GLU B 1 173 ? 0.494   -48.319 -85.819  1.00 22.72 ? 151  GLU B CA    1 
ATOM   3708  C C     . GLU B 1 173 ? -0.589  -47.251 -85.784  1.00 22.75 ? 151  GLU B C     1 
ATOM   3709  O O     . GLU B 1 173 ? -1.213  -46.955 -86.807  1.00 22.59 ? 151  GLU B O     1 
ATOM   3710  C CB    . GLU B 1 173 ? -0.184  -49.581 -86.350  1.00 23.93 ? 151  GLU B CB    1 
ATOM   3711  C CG    . GLU B 1 173 ? 0.620   -50.841 -86.237  1.00 28.74 ? 151  GLU B CG    1 
ATOM   3712  C CD    . GLU B 1 173 ? -0.235  -52.060 -86.438  1.00 35.97 ? 151  GLU B CD    1 
ATOM   3713  O OE1   . GLU B 1 173 ? -0.725  -52.269 -87.573  1.00 39.69 ? 151  GLU B OE1   1 
ATOM   3714  O OE2   . GLU B 1 173 ? -0.416  -52.807 -85.451  1.00 42.64 ? 151  GLU B OE2   1 
ATOM   3715  N N     . HIS B 1 174 ? -0.855  -46.699 -84.608  1.00 22.02 ? 152  HIS B N     1 
ATOM   3716  C CA    . HIS B 1 174 ? -1.746  -45.556 -84.509  1.00 20.77 ? 152  HIS B CA    1 
ATOM   3717  C C     . HIS B 1 174 ? -0.977  -44.259 -84.719  1.00 20.03 ? 152  HIS B C     1 
ATOM   3718  O O     . HIS B 1 174 ? 0.167   -44.133 -84.272  1.00 19.29 ? 152  HIS B O     1 
ATOM   3719  C CB    . HIS B 1 174 ? -2.448  -45.549 -83.155  1.00 20.81 ? 152  HIS B CB    1 
ATOM   3720  C CG    . HIS B 1 174 ? -3.526  -46.579 -83.034  1.00 15.64 ? 152  HIS B CG    1 
ATOM   3721  N ND1   . HIS B 1 174 ? -3.257  -47.922 -82.888  1.00 14.85 ? 152  HIS B ND1   1 
ATOM   3722  C CD2   . HIS B 1 174 ? -4.877  -46.463 -83.056  1.00 11.53 ? 152  HIS B CD2   1 
ATOM   3723  C CE1   . HIS B 1 174 ? -4.397  -48.589 -82.814  1.00 15.31 ? 152  HIS B CE1   1 
ATOM   3724  N NE2   . HIS B 1 174 ? -5.396  -47.727 -82.920  1.00 16.77 ? 152  HIS B NE2   1 
ATOM   3725  N N     . THR B 1 175 ? -1.616  -43.300 -85.395  1.00 19.45 ? 153  THR B N     1 
ATOM   3726  C CA    . THR B 1 175 ? -1.027  -41.978 -85.624  1.00 16.82 ? 153  THR B CA    1 
ATOM   3727  C C     . THR B 1 175 ? -1.301  -41.112 -84.404  1.00 16.00 ? 153  THR B C     1 
ATOM   3728  O O     . THR B 1 175 ? -2.443  -41.024 -83.932  1.00 12.79 ? 153  THR B O     1 
ATOM   3729  C CB    . THR B 1 175 ? -1.582  -41.311 -86.888  1.00 15.49 ? 153  THR B CB    1 
ATOM   3730  O OG1   . THR B 1 175 ? -1.396  -42.178 -88.008  1.00 8.40  ? 153  THR B OG1   1 
ATOM   3731  C CG2   . THR B 1 175 ? -0.909  -39.964 -87.146  1.00 13.30 ? 153  THR B CG2   1 
ATOM   3732  N N     . ILE B 1 176 ? -0.243  -40.478 -83.892  1.00 17.88 ? 154  ILE B N     1 
ATOM   3733  C CA    . ILE B 1 176 ? -0.321  -39.739 -82.611  1.00 17.83 ? 154  ILE B CA    1 
ATOM   3734  C C     . ILE B 1 176 ? -0.163  -38.244 -82.773  1.00 17.83 ? 154  ILE B C     1 
ATOM   3735  O O     . ILE B 1 176 ? 0.883   -37.781 -83.221  1.00 13.97 ? 154  ILE B O     1 
ATOM   3736  C CB    . ILE B 1 176 ? 0.678   -40.274 -81.570  1.00 17.29 ? 154  ILE B CB    1 
ATOM   3737  C CG1   . ILE B 1 176 ? 0.240   -41.695 -81.152  1.00 18.01 ? 154  ILE B CG1   1 
ATOM   3738  C CG2   . ILE B 1 176 ? 0.784   -39.320 -80.361  1.00 15.55 ? 154  ILE B CG2   1 
ATOM   3739  C CD1   . ILE B 1 176 ? 1.316   -42.525 -80.520  1.00 15.27 ? 154  ILE B CD1   1 
ATOM   3740  N N     . MET B 1 177 ? -1.244  -37.527 -82.416  1.00 20.43 ? 155  MET B N     1 
ATOM   3741  C CA    . MET B 1 177 ? -1.235  -36.087 -82.228  1.00 21.62 ? 155  MET B CA    1 
ATOM   3742  C C     . MET B 1 177 ? -0.918  -35.807 -80.772  1.00 22.12 ? 155  MET B C     1 
ATOM   3743  O O     . MET B 1 177 ? -1.494  -36.416 -79.863  1.00 23.04 ? 155  MET B O     1 
ATOM   3744  C CB    . MET B 1 177 ? -2.590  -35.457 -82.509  1.00 23.34 ? 155  MET B CB    1 
ATOM   3745  C CG    . MET B 1 177 ? -3.102  -35.591 -83.910  1.00 24.60 ? 155  MET B CG    1 
ATOM   3746  S SD    . MET B 1 177 ? -4.893  -35.316 -83.917  1.00 24.93 ? 155  MET B SD    1 
ATOM   3747  C CE    . MET B 1 177 ? -5.252  -35.595 -85.657  1.00 26.01 ? 155  MET B CE    1 
ATOM   3748  N N     . ALA B 1 178 ? -0.042  -34.840 -80.548  1.00 22.14 ? 156  ALA B N     1 
ATOM   3749  C CA    . ALA B 1 178 ? 0.410   -34.517 -79.198  1.00 21.55 ? 156  ALA B CA    1 
ATOM   3750  C C     . ALA B 1 178 ? 0.584   -33.020 -79.040  1.00 20.66 ? 156  ALA B C     1 
ATOM   3751  O O     . ALA B 1 178 ? 1.187   -32.373 -79.871  1.00 20.53 ? 156  ALA B O     1 
ATOM   3752  C CB    . ALA B 1 178 ? 1.711   -35.214 -78.914  1.00 21.13 ? 156  ALA B CB    1 
ATOM   3753  N N     . GLY B 1 179 ? 0.072   -32.448 -77.971  1.00 20.35 ? 157  GLY B N     1 
ATOM   3754  C CA    . GLY B 1 179 ? 0.324   -31.043 -77.741  1.00 19.04 ? 157  GLY B CA    1 
ATOM   3755  C C     . GLY B 1 179 ? 0.080   -30.568 -76.332  1.00 17.16 ? 157  GLY B C     1 
ATOM   3756  O O     . GLY B 1 179 ? -0.221  -31.368 -75.475  1.00 16.04 ? 157  GLY B O     1 
ATOM   3757  N N     . ASN B 1 180 ? 0.221   -29.260 -76.089  1.00 18.70 ? 158  ASN B N     1 
ATOM   3758  C CA    . ASN B 1 180 ? 0.598   -28.283 -77.132  1.00 18.82 ? 158  ASN B CA    1 
ATOM   3759  C C     . ASN B 1 180 ? 1.974   -27.672 -76.928  1.00 18.18 ? 158  ASN B C     1 
ATOM   3760  O O     . ASN B 1 180 ? 2.457   -27.582 -75.823  1.00 17.38 ? 158  ASN B O     1 
ATOM   3761  C CB    . ASN B 1 180 ? -0.443  -27.181 -77.216  1.00 18.23 ? 158  ASN B CB    1 
ATOM   3762  C CG    . ASN B 1 180 ? -1.662  -27.620 -77.966  1.00 17.27 ? 158  ASN B CG    1 
ATOM   3763  O OD1   . ASN B 1 180 ? -1.980  -28.808 -77.972  1.00 21.92 ? 158  ASN B OD1   1 
ATOM   3764  N ND2   . ASN B 1 180 ? -2.372  -26.674 -78.602  1.00 14.50 ? 158  ASN B ND2   1 
ATOM   3765  N N     . VAL B 1 181 ? 2.612   -27.264 -78.016  1.00 18.80 ? 159  VAL B N     1 
ATOM   3766  C CA    . VAL B 1 181 ? 3.857   -26.469 -77.921  1.00 18.84 ? 159  VAL B CA    1 
ATOM   3767  C C     . VAL B 1 181 ? 3.776   -25.262 -78.841  1.00 18.55 ? 159  VAL B C     1 
ATOM   3768  O O     . VAL B 1 181 ? 2.773   -25.031 -79.490  1.00 18.53 ? 159  VAL B O     1 
ATOM   3769  C CB    . VAL B 1 181 ? 5.169   -27.252 -78.224  1.00 15.71 ? 159  VAL B CB    1 
ATOM   3770  C CG1   . VAL B 1 181 ? 5.361   -28.389 -77.238  1.00 15.01 ? 159  VAL B CG1   1 
ATOM   3771  C CG2   . VAL B 1 181 ? 5.210   -27.740 -79.668  1.00 21.83 ? 159  VAL B CG2   1 
ATOM   3772  N N     . VAL B 1 182 ? 4.820   -24.458 -78.825  1.00 18.02 ? 160  VAL B N     1 
ATOM   3773  C CA    . VAL B 1 182 ? 4.894   -23.275 -79.666  1.00 17.47 ? 160  VAL B CA    1 
ATOM   3774  C C     . VAL B 1 182 ? 6.329   -23.051 -80.202  1.00 18.24 ? 160  VAL B C     1 
ATOM   3775  O O     . VAL B 1 182 ? 6.590   -22.073 -80.917  1.00 16.40 ? 160  VAL B O     1 
ATOM   3776  C CB    . VAL B 1 182 ? 4.390   -22.056 -78.893  1.00 15.42 ? 160  VAL B CB    1 
ATOM   3777  C CG1   . VAL B 1 182 ? 2.935   -21.974 -78.964  1.00 19.98 ? 160  VAL B CG1   1 
ATOM   3778  C CG2   . VAL B 1 182 ? 4.783   -22.128 -77.438  1.00 15.72 ? 160  VAL B CG2   1 
ATOM   3779  N N     . THR B 1 183 ? 7.238   -23.982 -79.903  1.00 18.35 ? 161  THR B N     1 
ATOM   3780  C CA    . THR B 1 183 ? 8.641   -23.824 -80.282  1.00 20.47 ? 161  THR B CA    1 
ATOM   3781  C C     . THR B 1 183 ? 9.267   -25.126 -80.825  1.00 20.18 ? 161  THR B C     1 
ATOM   3782  O O     . THR B 1 183 ? 8.927   -26.229 -80.417  1.00 20.72 ? 161  THR B O     1 
ATOM   3783  C CB    . THR B 1 183 ? 9.459   -23.310 -79.099  1.00 21.94 ? 161  THR B CB    1 
ATOM   3784  O OG1   . THR B 1 183 ? 9.505   -24.321 -78.086  1.00 21.28 ? 161  THR B OG1   1 
ATOM   3785  C CG2   . THR B 1 183 ? 8.843   -22.005 -78.536  1.00 22.32 ? 161  THR B CG2   1 
ATOM   3786  N N     . GLY B 1 184 ? 10.196  -24.962 -81.760  1.00 19.96 ? 162  GLY B N     1 
ATOM   3787  C CA    . GLY B 1 184 ? 10.710  -26.068 -82.571  1.00 21.12 ? 162  GLY B CA    1 
ATOM   3788  C C     . GLY B 1 184 ? 11.558  -27.123 -81.867  1.00 21.10 ? 162  GLY B C     1 
ATOM   3789  O O     . GLY B 1 184 ? 11.612  -28.270 -82.301  1.00 21.93 ? 162  GLY B O     1 
ATOM   3790  N N     . GLU B 1 185 ? 12.232  -26.747 -80.787  1.00 20.38 ? 163  GLU B N     1 
ATOM   3791  C CA    . GLU B 1 185 ? 13.014  -27.717 -80.026  1.00 19.22 ? 163  GLU B CA    1 
ATOM   3792  C C     . GLU B 1 185 ? 12.125  -28.741 -79.341  1.00 18.27 ? 163  GLU B C     1 
ATOM   3793  O O     . GLU B 1 185 ? 12.517  -29.894 -79.264  1.00 18.69 ? 163  GLU B O     1 
ATOM   3794  C CB    . GLU B 1 185 ? 13.970  -27.044 -79.028  1.00 20.81 ? 163  GLU B CB    1 
ATOM   3795  C CG    . GLU B 1 185 ? 13.425  -26.748 -77.614  1.00 25.23 ? 163  GLU B CG    1 
ATOM   3796  C CD    . GLU B 1 185 ? 12.381  -25.646 -77.600  1.00 26.88 ? 163  GLU B CD    1 
ATOM   3797  O OE1   . GLU B 1 185 ? 12.297  -24.888 -78.598  1.00 31.35 ? 163  GLU B OE1   1 
ATOM   3798  O OE2   . GLU B 1 185 ? 11.661  -25.527 -76.590  1.00 25.63 ? 163  GLU B OE2   1 
ATOM   3799  N N     . MET B 1 186 ? 10.928  -28.335 -78.894  1.00 16.86 ? 164  MET B N     1 
ATOM   3800  C CA    . MET B 1 186 ? 9.962   -29.269 -78.320  1.00 16.76 ? 164  MET B CA    1 
ATOM   3801  C C     . MET B 1 186 ? 9.217   -30.074 -79.381  1.00 16.56 ? 164  MET B C     1 
ATOM   3802  O O     . MET B 1 186 ? 8.817   -31.221 -79.136  1.00 17.34 ? 164  MET B O     1 
ATOM   3803  C CB    . MET B 1 186 ? 8.981   -28.516 -77.426  1.00 16.68 ? 164  MET B CB    1 
ATOM   3804  C CG    . MET B 1 186 ? 8.453   -29.335 -76.253  1.00 19.85 ? 164  MET B CG    1 
ATOM   3805  S SD    . MET B 1 186 ? 9.749   -30.081 -75.214  1.00 22.69 ? 164  MET B SD    1 
ATOM   3806  C CE    . MET B 1 186 ? 8.892   -31.571 -74.701  1.00 19.46 ? 164  MET B CE    1 
ATOM   3807  N N     . VAL B 1 187 ? 9.024   -29.474 -80.549  1.00 16.03 ? 165  VAL B N     1 
ATOM   3808  C CA    . VAL B 1 187 ? 8.472   -30.168 -81.699  1.00 15.74 ? 165  VAL B CA    1 
ATOM   3809  C C     . VAL B 1 187 ? 9.339   -31.350 -82.019  1.00 15.91 ? 165  VAL B C     1 
ATOM   3810  O O     . VAL B 1 187 ? 8.835   -32.462 -82.106  1.00 16.54 ? 165  VAL B O     1 
ATOM   3811  C CB    . VAL B 1 187 ? 8.413   -29.241 -82.933  1.00 15.86 ? 165  VAL B CB    1 
ATOM   3812  C CG1   . VAL B 1 187 ? 8.097   -30.017 -84.194  1.00 16.24 ? 165  VAL B CG1   1 
ATOM   3813  C CG2   . VAL B 1 187 ? 7.379   -28.142 -82.719  1.00 21.19 ? 165  VAL B CG2   1 
ATOM   3814  N N     . GLU B 1 188 ? 10.638  -31.104 -82.182  1.00 16.45 ? 166  GLU B N     1 
ATOM   3815  C CA    . GLU B 1 188 ? 11.600  -32.162 -82.461  1.00 17.95 ? 166  GLU B CA    1 
ATOM   3816  C C     . GLU B 1 188 ? 11.593  -33.238 -81.390  1.00 18.74 ? 166  GLU B C     1 
ATOM   3817  O O     . GLU B 1 188 ? 11.560  -34.414 -81.700  1.00 19.96 ? 166  GLU B O     1 
ATOM   3818  C CB    . GLU B 1 188 ? 13.013  -31.598 -82.581  1.00 18.64 ? 166  GLU B CB    1 
ATOM   3819  C CG    . GLU B 1 188 ? 13.202  -30.609 -83.706  1.00 23.47 ? 166  GLU B CG    1 
ATOM   3820  C CD    . GLU B 1 188 ? 14.674  -30.365 -84.053  1.00 34.09 ? 166  GLU B CD    1 
ATOM   3821  O OE1   . GLU B 1 188 ? 15.500  -31.301 -83.847  1.00 33.17 ? 166  GLU B OE1   1 
ATOM   3822  O OE2   . GLU B 1 188 ? 14.983  -29.243 -84.546  1.00 28.32 ? 166  GLU B OE2   1 
ATOM   3823  N N     . GLU B 1 189 ? 11.606  -32.837 -80.128  1.00 18.26 ? 167  GLU B N     1 
ATOM   3824  C CA    . GLU B 1 189 ? 11.688  -33.797 -79.045  1.00 18.65 ? 167  GLU B CA    1 
ATOM   3825  C C     . GLU B 1 189 ? 10.460  -34.691 -79.021  1.00 18.69 ? 167  GLU B C     1 
ATOM   3826  O O     . GLU B 1 189 ? 10.571  -35.896 -78.798  1.00 18.76 ? 167  GLU B O     1 
ATOM   3827  C CB    . GLU B 1 189 ? 11.848  -33.107 -77.686  1.00 19.73 ? 167  GLU B CB    1 
ATOM   3828  C CG    . GLU B 1 189 ? 12.249  -34.066 -76.538  1.00 24.13 ? 167  GLU B CG    1 
ATOM   3829  C CD    . GLU B 1 189 ? 13.683  -34.608 -76.679  1.00 33.35 ? 167  GLU B CD    1 
ATOM   3830  O OE1   . GLU B 1 189 ? 14.393  -34.207 -77.628  1.00 32.46 ? 167  GLU B OE1   1 
ATOM   3831  O OE2   . GLU B 1 189 ? 14.110  -35.422 -75.825  1.00 37.89 ? 167  GLU B OE2   1 
ATOM   3832  N N     . LEU B 1 190 ? 9.293   -34.103 -79.238  1.00 19.57 ? 168  LEU B N     1 
ATOM   3833  C CA    . LEU B 1 190 ? 8.047   -34.856 -79.228  1.00 20.45 ? 168  LEU B CA    1 
ATOM   3834  C C     . LEU B 1 190 ? 7.914   -35.785 -80.425  1.00 20.03 ? 168  LEU B C     1 
ATOM   3835  O O     . LEU B 1 190 ? 7.312   -36.847 -80.313  1.00 19.09 ? 168  LEU B O     1 
ATOM   3836  C CB    . LEU B 1 190 ? 6.846   -33.902 -79.183  1.00 21.94 ? 168  LEU B CB    1 
ATOM   3837  C CG    . LEU B 1 190 ? 6.547   -33.254 -77.829  1.00 24.42 ? 168  LEU B CG    1 
ATOM   3838  C CD1   . LEU B 1 190 ? 5.604   -32.058 -77.972  1.00 25.89 ? 168  LEU B CD1   1 
ATOM   3839  C CD2   . LEU B 1 190 ? 5.955   -34.285 -76.840  1.00 24.32 ? 168  LEU B CD2   1 
ATOM   3840  N N     . ILE B 1 191 ? 8.450   -35.376 -81.567  1.00 19.69 ? 169  ILE B N     1 
ATOM   3841  C CA    . ILE B 1 191 ? 8.440   -36.230 -82.744  1.00 20.13 ? 169  ILE B CA    1 
ATOM   3842  C C     . ILE B 1 191 ? 9.417   -37.392 -82.560  1.00 20.93 ? 169  ILE B C     1 
ATOM   3843  O O     . ILE B 1 191 ? 9.067   -38.532 -82.799  1.00 21.59 ? 169  ILE B O     1 
ATOM   3844  C CB    . ILE B 1 191 ? 8.788   -35.435 -84.004  1.00 20.08 ? 169  ILE B CB    1 
ATOM   3845  C CG1   . ILE B 1 191 ? 7.650   -34.473 -84.322  1.00 19.87 ? 169  ILE B CG1   1 
ATOM   3846  C CG2   . ILE B 1 191 ? 9.015   -36.365 -85.194  1.00 22.73 ? 169  ILE B CG2   1 
ATOM   3847  C CD1   . ILE B 1 191 ? 8.039   -33.415 -85.317  1.00 22.25 ? 169  ILE B CD1   1 
ATOM   3848  N N     . LEU B 1 192 ? 10.629  -37.087 -82.112  1.00 21.75 ? 170  LEU B N     1 
ATOM   3849  C CA    . LEU B 1 192 ? 11.629  -38.105 -81.841  1.00 21.55 ? 170  LEU B CA    1 
ATOM   3850  C C     . LEU B 1 192 ? 11.156  -39.060 -80.752  1.00 21.39 ? 170  LEU B C     1 
ATOM   3851  O O     . LEU B 1 192 ? 11.571  -40.219 -80.703  1.00 21.77 ? 170  LEU B O     1 
ATOM   3852  C CB    . LEU B 1 192 ? 12.949  -37.468 -81.423  1.00 20.76 ? 170  LEU B CB    1 
ATOM   3853  C CG    . LEU B 1 192 ? 13.584  -36.588 -82.493  1.00 21.40 ? 170  LEU B CG    1 
ATOM   3854  C CD1   . LEU B 1 192 ? 14.590  -35.666 -81.867  1.00 22.45 ? 170  LEU B CD1   1 
ATOM   3855  C CD2   . LEU B 1 192 ? 14.221  -37.434 -83.568  1.00 27.44 ? 170  LEU B CD2   1 
ATOM   3856  N N     . SER B 1 193 ? 10.282  -38.577 -79.872  1.00 21.21 ? 171  SER B N     1 
ATOM   3857  C CA    . SER B 1 193 ? 9.711   -39.425 -78.806  1.00 19.95 ? 171  SER B CA    1 
ATOM   3858  C C     . SER B 1 193 ? 8.547   -40.315 -79.268  1.00 18.69 ? 171  SER B C     1 
ATOM   3859  O O     . SER B 1 193 ? 8.132   -41.193 -78.518  1.00 19.24 ? 171  SER B O     1 
ATOM   3860  C CB    . SER B 1 193 ? 9.241   -38.569 -77.625  1.00 19.82 ? 171  SER B CB    1 
ATOM   3861  O OG    . SER B 1 193 ? 10.309  -37.851 -77.036  1.00 16.79 ? 171  SER B OG    1 
ATOM   3862  N N     . GLY B 1 194 ? 8.028   -40.086 -80.478  1.00 17.47 ? 172  GLY B N     1 
ATOM   3863  C CA    . GLY B 1 194 ? 7.004   -40.943 -81.095  1.00 17.05 ? 172  GLY B CA    1 
ATOM   3864  C C     . GLY B 1 194 ? 5.688   -40.288 -81.535  1.00 18.08 ? 172  GLY B C     1 
ATOM   3865  O O     . GLY B 1 194 ? 4.792   -40.966 -82.046  1.00 17.98 ? 172  GLY B O     1 
ATOM   3866  N N     . ALA B 1 195 ? 5.540   -38.983 -81.334  1.00 17.10 ? 173  ALA B N     1 
ATOM   3867  C CA    . ALA B 1 195 ? 4.379   -38.286 -81.844  1.00 17.22 ? 173  ALA B CA    1 
ATOM   3868  C C     . ALA B 1 195 ? 4.564   -38.057 -83.321  1.00 16.35 ? 173  ALA B C     1 
ATOM   3869  O O     . ALA B 1 195 ? 5.654   -37.788 -83.772  1.00 17.42 ? 173  ALA B O     1 
ATOM   3870  C CB    . ALA B 1 195 ? 4.184   -36.946 -81.120  1.00 18.17 ? 173  ALA B CB    1 
ATOM   3871  N N     . ASP B 1 196 ? 3.491   -38.180 -84.083  1.00 17.28 ? 174  ASP B N     1 
ATOM   3872  C CA    . ASP B 1 196 ? 3.538   -37.989 -85.545  1.00 17.02 ? 174  ASP B CA    1 
ATOM   3873  C C     . ASP B 1 196 ? 3.204   -36.563 -85.929  1.00 17.58 ? 174  ASP B C     1 
ATOM   3874  O O     . ASP B 1 196 ? 3.753   -36.028 -86.884  1.00 16.77 ? 174  ASP B O     1 
ATOM   3875  C CB    . ASP B 1 196 ? 2.548   -38.934 -86.208  1.00 16.54 ? 174  ASP B CB    1 
ATOM   3876  C CG    . ASP B 1 196 ? 2.888   -40.379 -85.973  1.00 15.66 ? 174  ASP B CG    1 
ATOM   3877  O OD1   . ASP B 1 196 ? 3.818   -40.871 -86.613  1.00 11.76 ? 174  ASP B OD1   1 
ATOM   3878  O OD2   . ASP B 1 196 ? 2.221   -41.022 -85.153  1.00 17.18 ? 174  ASP B OD2   1 
ATOM   3879  N N     . ILE B 1 197 ? 2.261   -35.988 -85.189  1.00 18.79 ? 175  ILE B N     1 
ATOM   3880  C CA    . ILE B 1 197 ? 1.708   -34.688 -85.466  1.00 19.06 ? 175  ILE B CA    1 
ATOM   3881  C C     . ILE B 1 197 ? 1.681   -33.912 -84.159  1.00 20.21 ? 175  ILE B C     1 
ATOM   3882  O O     . ILE B 1 197 ? 1.093   -34.359 -83.170  1.00 19.70 ? 175  ILE B O     1 
ATOM   3883  C CB    . ILE B 1 197 ? 0.225   -34.773 -85.968  1.00 20.02 ? 175  ILE B CB    1 
ATOM   3884  C CG1   . ILE B 1 197 ? 0.024   -35.880 -87.012  1.00 18.55 ? 175  ILE B CG1   1 
ATOM   3885  C CG2   . ILE B 1 197 ? -0.263  -33.378 -86.509  1.00 20.76 ? 175  ILE B CG2   1 
ATOM   3886  C CD1   . ILE B 1 197 ? -1.430  -36.028 -87.426  1.00 19.05 ? 175  ILE B CD1   1 
ATOM   3887  N N     . ILE B 1 198 ? 2.280   -32.727 -84.184  1.00 20.53 ? 176  ILE B N     1 
ATOM   3888  C CA    . ILE B 1 198 ? 2.425   -31.892 -83.015  1.00 19.26 ? 176  ILE B CA    1 
ATOM   3889  C C     . ILE B 1 198 ? 1.401   -30.770 -83.065  1.00 16.87 ? 176  ILE B C     1 
ATOM   3890  O O     . ILE B 1 198 ? 1.293   -30.044 -84.057  1.00 16.46 ? 176  ILE B O     1 
ATOM   3891  C CB    . ILE B 1 198 ? 3.874   -31.341 -82.952  1.00 18.56 ? 176  ILE B CB    1 
ATOM   3892  C CG1   . ILE B 1 198 ? 4.851   -32.502 -83.140  1.00 18.83 ? 176  ILE B CG1   1 
ATOM   3893  C CG2   . ILE B 1 198 ? 4.141   -30.608 -81.625  1.00 22.65 ? 176  ILE B CG2   1 
ATOM   3894  C CD1   . ILE B 1 198 ? 4.573   -33.742 -82.251  1.00 18.44 ? 176  ILE B CD1   1 
ATOM   3895  N N     . LYS B 1 199 ? 0.630   -30.639 -81.990  1.00 15.81 ? 177  LYS B N     1 
ATOM   3896  C CA    . LYS B 1 199 ? -0.342  -29.574 -81.899  1.00 15.42 ? 177  LYS B CA    1 
ATOM   3897  C C     . LYS B 1 199 ? 0.401   -28.319 -81.434  1.00 15.35 ? 177  LYS B C     1 
ATOM   3898  O O     . LYS B 1 199 ? 1.039   -28.310 -80.380  1.00 15.03 ? 177  LYS B O     1 
ATOM   3899  C CB    . LYS B 1 199 ? -1.535  -29.945 -80.987  1.00 15.22 ? 177  LYS B CB    1 
ATOM   3900  C CG    . LYS B 1 199 ? -2.406  -31.059 -81.553  1.00 15.09 ? 177  LYS B CG    1 
ATOM   3901  C CD    . LYS B 1 199 ? -3.312  -31.767 -80.505  1.00 20.96 ? 177  LYS B CD    1 
ATOM   3902  C CE    . LYS B 1 199 ? -4.572  -30.974 -80.157  1.00 19.97 ? 177  LYS B CE    1 
ATOM   3903  N NZ    . LYS B 1 199 ? -4.526  -30.396 -78.793  1.00 20.54 ? 177  LYS B NZ    1 
ATOM   3904  N N     . VAL B 1 200 ? 0.318   -27.271 -82.252  1.00 15.57 ? 178  VAL B N     1 
ATOM   3905  C CA    . VAL B 1 200 ? 1.009   -26.018 -82.012  1.00 16.41 ? 178  VAL B CA    1 
ATOM   3906  C C     . VAL B 1 200 ? 0.030   -24.878 -81.696  1.00 16.41 ? 178  VAL B C     1 
ATOM   3907  O O     . VAL B 1 200 ? -0.846  -24.535 -82.490  1.00 13.78 ? 178  VAL B O     1 
ATOM   3908  C CB    . VAL B 1 200 ? 1.957   -25.648 -83.215  1.00 16.82 ? 178  VAL B CB    1 
ATOM   3909  C CG1   . VAL B 1 200 ? 2.598   -24.316 -83.024  1.00 13.01 ? 178  VAL B CG1   1 
ATOM   3910  C CG2   . VAL B 1 200 ? 3.046   -26.681 -83.341  1.00 17.29 ? 178  VAL B CG2   1 
ATOM   3911  N N     . GLY B 1 201 ? 0.217   -24.305 -80.512  1.00 17.56 ? 179  GLY B N     1 
ATOM   3912  C CA    . GLY B 1 201 ? -0.477  -23.107 -80.110  1.00 19.72 ? 179  GLY B CA    1 
ATOM   3913  C C     . GLY B 1 201 ? -0.651  -23.076 -78.611  1.00 20.49 ? 179  GLY B C     1 
ATOM   3914  O O     . GLY B 1 201 ? -1.169  -24.019 -78.026  1.00 23.29 ? 179  GLY B O     1 
ATOM   3915  N N     . VAL B 1 202 ? -0.204  -21.990 -77.997  1.00 20.32 ? 180  VAL B N     1 
ATOM   3916  C CA    . VAL B 1 202 ? -0.407  -21.723 -76.575  1.00 20.08 ? 180  VAL B CA    1 
ATOM   3917  C C     . VAL B 1 202 ? -0.713  -20.219 -76.395  1.00 20.39 ? 180  VAL B C     1 
ATOM   3918  O O     . VAL B 1 202 ? 0.160   -19.391 -76.560  1.00 20.93 ? 180  VAL B O     1 
ATOM   3919  C CB    . VAL B 1 202 ? 0.823   -22.161 -75.705  1.00 20.14 ? 180  VAL B CB    1 
ATOM   3920  C CG1   . VAL B 1 202 ? 0.585   -21.850 -74.222  1.00 20.54 ? 180  VAL B CG1   1 
ATOM   3921  C CG2   . VAL B 1 202 ? 1.110   -23.661 -75.845  1.00 16.19 ? 180  VAL B CG2   1 
ATOM   3922  N N     . GLY B 1 203 ? -1.968  -19.887 -76.078  1.00 20.74 ? 181  GLY B N     1 
ATOM   3923  C CA    . GLY B 1 203 ? -2.408  -18.502 -75.909  1.00 20.22 ? 181  GLY B CA    1 
ATOM   3924  C C     . GLY B 1 203 ? -3.561  -18.038 -76.808  1.00 20.17 ? 181  GLY B C     1 
ATOM   3925  O O     . GLY B 1 203 ? -4.609  -17.560 -76.311  1.00 19.37 ? 181  GLY B O     1 
ATOM   3926  N N     . PRO B 1 204 ? -3.350  -18.094 -78.144  1.00 19.44 ? 182  PRO B N     1 
ATOM   3927  C CA    . PRO B 1 204 ? -4.341  -17.617 -79.125  1.00 18.73 ? 182  PRO B CA    1 
ATOM   3928  C C     . PRO B 1 204 ? -5.760  -18.216 -79.080  1.00 18.34 ? 182  PRO B C     1 
ATOM   3929  O O     . PRO B 1 204 ? -6.698  -17.584 -79.562  1.00 19.31 ? 182  PRO B O     1 
ATOM   3930  C CB    . PRO B 1 204 ? -3.649  -17.869 -80.464  1.00 17.94 ? 182  PRO B CB    1 
ATOM   3931  C CG    . PRO B 1 204 ? -2.199  -17.855 -80.130  1.00 20.62 ? 182  PRO B CG    1 
ATOM   3932  C CD    . PRO B 1 204 ? -2.093  -18.496 -78.802  1.00 18.80 ? 182  PRO B CD    1 
ATOM   3933  N N     . GLY B 1 205 ? -5.930  -19.401 -78.515  1.00 16.53 ? 183  GLY B N     1 
ATOM   3934  C CA    . GLY B 1 205 ? -7.270  -20.047 -78.487  1.00 16.35 ? 183  GLY B CA    1 
ATOM   3935  C C     . GLY B 1 205 ? -8.424  -19.160 -78.018  1.00 13.88 ? 183  GLY B C     1 
ATOM   3936  O O     . GLY B 1 205 ? -8.302  -18.443 -77.037  1.00 11.98 ? 183  GLY B O     1 
ATOM   3937  N N     . SER B 1 206 ? -9.548  -19.196 -78.710  1.00 14.30 ? 184  SER B N     1 
ATOM   3938  C CA    . SER B 1 206 ? -10.661 -18.307 -78.378  1.00 14.39 ? 184  SER B CA    1 
ATOM   3939  C C     . SER B 1 206 ? -11.044 -18.274 -76.864  1.00 13.78 ? 184  SER B C     1 
ATOM   3940  O O     . SER B 1 206 ? -11.295 -17.194 -76.286  1.00 12.51 ? 184  SER B O     1 
ATOM   3941  C CB    . SER B 1 206 ? -11.888 -18.616 -79.254  1.00 14.91 ? 184  SER B CB    1 
ATOM   3942  O OG    . SER B 1 206 ? -12.540 -19.832 -78.912  1.00 16.01 ? 184  SER B OG    1 
ATOM   3943  N N     . VAL B 1 207 ? -11.046 -19.440 -76.224  1.00 14.59 ? 185  VAL B N     1 
ATOM   3944  C CA    . VAL B 1 207 ? -11.314 -19.532 -74.780  1.00 14.39 ? 185  VAL B CA    1 
ATOM   3945  C C     . VAL B 1 207 ? -10.088 -19.948 -73.909  1.00 13.91 ? 185  VAL B C     1 
ATOM   3946  O O     . VAL B 1 207 ? -10.222 -20.134 -72.696  1.00 14.93 ? 185  VAL B O     1 
ATOM   3947  C CB    . VAL B 1 207 ? -12.543 -20.408 -74.524  1.00 13.35 ? 185  VAL B CB    1 
ATOM   3948  C CG1   . VAL B 1 207 ? -13.759 -19.766 -75.167  1.00 10.19 ? 185  VAL B CG1   1 
ATOM   3949  C CG2   . VAL B 1 207 ? -12.328 -21.785 -75.069  1.00 16.15 ? 185  VAL B CG2   1 
ATOM   3950  N N     . CYS B 1 208 ? -8.908  -20.044 -74.519  1.00 13.23 ? 186  CYS B N     1 
ATOM   3951  C CA    . CYS B 1 208 ? -7.668  -20.132 -73.788  1.00 12.72 ? 186  CYS B CA    1 
ATOM   3952  C C     . CYS B 1 208 ? -7.427  -18.829 -73.019  1.00 14.28 ? 186  CYS B C     1 
ATOM   3953  O O     . CYS B 1 208 ? -7.775  -17.748 -73.510  1.00 17.04 ? 186  CYS B O     1 
ATOM   3954  C CB    . CYS B 1 208 ? -6.530  -20.401 -74.758  1.00 13.33 ? 186  CYS B CB    1 
ATOM   3955  S SG    . CYS B 1 208 ? -4.837  -20.298 -74.081  1.00 18.89 ? 186  CYS B SG    1 
ATOM   3956  N N     . THR B 1 209 ? -6.841  -18.931 -71.820  1.00 13.56 ? 187  THR B N     1 
ATOM   3957  C CA    . THR B 1 209 ? -6.519  -17.772 -70.968  1.00 11.75 ? 187  THR B CA    1 
ATOM   3958  C C     . THR B 1 209 ? -5.074  -17.765 -70.407  1.00 11.25 ? 187  THR B C     1 
ATOM   3959  O O     . THR B 1 209 ? -4.819  -17.166 -69.381  1.00 10.53 ? 187  THR B O     1 
ATOM   3960  C CB    . THR B 1 209 ? -7.478  -17.741 -69.788  1.00 10.74 ? 187  THR B CB    1 
ATOM   3961  O OG1   . THR B 1 209 ? -7.436  -19.006 -69.131  1.00 16.22 ? 187  THR B OG1   1 
ATOM   3962  C CG2   . THR B 1 209 ? -8.880  -17.457 -70.240  1.00 13.20 ? 187  THR B CG2   1 
ATOM   3963  N N     . THR B 1 210 ? -4.126  -18.431 -71.080  1.00 12.68 ? 188  THR B N     1 
ATOM   3964  C CA    . THR B 1 210 ? -2.775  -18.565 -70.525  1.00 14.08 ? 188  THR B CA    1 
ATOM   3965  C C     . THR B 1 210 ? -2.101  -17.198 -70.377  1.00 15.00 ? 188  THR B C     1 
ATOM   3966  O O     . THR B 1 210 ? -1.365  -16.929 -69.425  1.00 16.19 ? 188  THR B O     1 
ATOM   3967  C CB    . THR B 1 210 ? -1.847  -19.460 -71.381  1.00 14.58 ? 188  THR B CB    1 
ATOM   3968  O OG1   . THR B 1 210 ? -1.760  -18.942 -72.709  1.00 19.26 ? 188  THR B OG1   1 
ATOM   3969  C CG2   . THR B 1 210 ? -2.345  -20.889 -71.439  1.00 14.42 ? 188  THR B CG2   1 
ATOM   3970  N N     . ARG B 1 211 ? -2.373  -16.319 -71.322  1.00 16.65 ? 189  ARG B N     1 
ATOM   3971  C CA    . ARG B 1 211 ? -1.736  -15.012 -71.353  1.00 17.78 ? 189  ARG B CA    1 
ATOM   3972  C C     . ARG B 1 211 ? -2.148  -14.168 -70.144  1.00 16.89 ? 189  ARG B C     1 
ATOM   3973  O O     . ARG B 1 211 ? -1.342  -13.528 -69.476  1.00 17.07 ? 189  ARG B O     1 
ATOM   3974  C CB    . ARG B 1 211 ? -2.115  -14.344 -72.670  1.00 17.70 ? 189  ARG B CB    1 
ATOM   3975  C CG    . ARG B 1 211 ? -1.860  -15.281 -73.874  1.00 19.12 ? 189  ARG B CG    1 
ATOM   3976  C CD    . ARG B 1 211 ? -1.680  -14.538 -75.179  1.00 21.28 ? 189  ARG B CD    1 
ATOM   3977  N NE    . ARG B 1 211 ? -2.942  -13.978 -75.648  1.00 25.59 ? 189  ARG B NE    1 
ATOM   3978  C CZ    . ARG B 1 211 ? -3.378  -14.041 -76.909  1.00 27.97 ? 189  ARG B CZ    1 
ATOM   3979  N NH1   . ARG B 1 211 ? -2.657  -14.630 -77.864  1.00 30.14 ? 189  ARG B NH1   1 
ATOM   3980  N NH2   . ARG B 1 211 ? -4.550  -13.523 -77.220  1.00 26.83 ? 189  ARG B NH2   1 
ATOM   3981  N N     . THR B 1 212 ? -3.430  -14.220 -69.860  1.00 17.63 ? 190  THR B N     1 
ATOM   3982  C CA    . THR B 1 212 ? -4.025  -13.488 -68.765  1.00 16.72 ? 190  THR B CA    1 
ATOM   3983  C C     . THR B 1 212 ? -3.685  -14.112 -67.414  1.00 17.49 ? 190  THR B C     1 
ATOM   3984  O O     . THR B 1 212 ? -3.474  -13.406 -66.430  1.00 16.64 ? 190  THR B O     1 
ATOM   3985  C CB    . THR B 1 212 ? -5.536  -13.384 -69.028  1.00 16.22 ? 190  THR B CB    1 
ATOM   3986  O OG1   . THR B 1 212 ? -5.769  -12.168 -69.732  1.00 18.06 ? 190  THR B OG1   1 
ATOM   3987  C CG2   . THR B 1 212 ? -6.386  -13.403 -67.749  1.00 23.46 ? 190  THR B CG2   1 
ATOM   3988  N N     . LYS B 1 213 ? -3.620  -15.437 -67.372  1.00 17.69 ? 191  LYS B N     1 
ATOM   3989  C CA    . LYS B 1 213 ? -3.476  -16.153 -66.108  1.00 17.85 ? 191  LYS B CA    1 
ATOM   3990  C C     . LYS B 1 213 ? -2.043  -16.551 -65.785  1.00 16.45 ? 191  LYS B C     1 
ATOM   3991  O O     . LYS B 1 213 ? -1.695  -16.735 -64.621  1.00 16.72 ? 191  LYS B O     1 
ATOM   3992  C CB    . LYS B 1 213 ? -4.416  -17.352 -66.107  1.00 16.88 ? 191  LYS B CB    1 
ATOM   3993  C CG    . LYS B 1 213 ? -5.859  -16.881 -66.178  1.00 18.19 ? 191  LYS B CG    1 
ATOM   3994  C CD    . LYS B 1 213 ? -6.870  -17.996 -65.909  1.00 27.17 ? 191  LYS B CD    1 
ATOM   3995  C CE    . LYS B 1 213 ? -8.295  -17.435 -65.822  1.00 27.57 ? 191  LYS B CE    1 
ATOM   3996  N NZ    . LYS B 1 213 ? -9.307  -18.515 -65.731  1.00 31.79 ? 191  LYS B NZ    1 
ATOM   3997  N N     . THR B 1 214 ? -1.205  -16.656 -66.808  1.00 15.97 ? 192  THR B N     1 
ATOM   3998  C CA    . THR B 1 214 ? 0.186   -17.094 -66.624  1.00 16.00 ? 192  THR B CA    1 
ATOM   3999  C C     . THR B 1 214 ? 1.189   -16.186 -67.325  1.00 16.68 ? 192  THR B C     1 
ATOM   4000  O O     . THR B 1 214 ? 2.380   -16.233 -67.016  1.00 17.69 ? 192  THR B O     1 
ATOM   4001  C CB    . THR B 1 214 ? 0.409   -18.576 -67.109  1.00 16.35 ? 192  THR B CB    1 
ATOM   4002  O OG1   . THR B 1 214 ? 0.683   -18.618 -68.518  1.00 13.67 ? 192  THR B OG1   1 
ATOM   4003  C CG2   . THR B 1 214 ? -0.831  -19.473 -66.803  1.00 14.90 ? 192  THR B CG2   1 
ATOM   4004  N N     . GLY B 1 215 ? 0.730   -15.387 -68.289  1.00 16.64 ? 193  GLY B N     1 
ATOM   4005  C CA    . GLY B 1 215 ? 1.637   -14.549 -69.087  1.00 16.38 ? 193  GLY B CA    1 
ATOM   4006  C C     . GLY B 1 215 ? 2.544   -15.317 -70.011  1.00 15.93 ? 193  GLY B C     1 
ATOM   4007  O O     . GLY B 1 215 ? 3.474   -14.762 -70.558  1.00 14.17 ? 193  GLY B O     1 
ATOM   4008  N N     . VAL B 1 216 ? 2.253   -16.600 -70.179  1.00 17.98 ? 194  VAL B N     1 
ATOM   4009  C CA    . VAL B 1 216 ? 2.997   -17.487 -71.067  1.00 17.91 ? 194  VAL B CA    1 
ATOM   4010  C C     . VAL B 1 216 ? 2.137   -17.662 -72.300  1.00 18.71 ? 194  VAL B C     1 
ATOM   4011  O O     . VAL B 1 216 ? 0.904   -17.797 -72.204  1.00 20.58 ? 194  VAL B O     1 
ATOM   4012  C CB    . VAL B 1 216 ? 3.276   -18.885 -70.393  1.00 16.01 ? 194  VAL B CB    1 
ATOM   4013  C CG1   . VAL B 1 216 ? 3.923   -19.871 -71.357  1.00 15.34 ? 194  VAL B CG1   1 
ATOM   4014  C CG2   . VAL B 1 216 ? 4.126   -18.698 -69.144  1.00 11.76 ? 194  VAL B CG2   1 
ATOM   4015  N N     . GLY B 1 217 ? 2.783   -17.667 -73.453  1.00 17.83 ? 195  GLY B N     1 
ATOM   4016  C CA    . GLY B 1 217 ? 2.078   -17.811 -74.703  1.00 18.49 ? 195  GLY B CA    1 
ATOM   4017  C C     . GLY B 1 217 ? 2.983   -17.548 -75.877  1.00 18.01 ? 195  GLY B C     1 
ATOM   4018  O O     . GLY B 1 217 ? 4.148   -17.288 -75.689  1.00 19.38 ? 195  GLY B O     1 
ATOM   4019  N N     . TYR B 1 218 ? 2.427   -17.587 -77.087  1.00 17.71 ? 196  TYR B N     1 
ATOM   4020  C CA    . TYR B 1 218 ? 3.174   -17.331 -78.310  1.00 17.27 ? 196  TYR B CA    1 
ATOM   4021  C C     . TYR B 1 218 ? 2.197   -16.985 -79.399  1.00 17.37 ? 196  TYR B C     1 
ATOM   4022  O O     . TYR B 1 218 ? 1.199   -17.659 -79.525  1.00 19.05 ? 196  TYR B O     1 
ATOM   4023  C CB    . TYR B 1 218 ? 3.909   -18.597 -78.719  1.00 17.51 ? 196  TYR B CB    1 
ATOM   4024  C CG    . TYR B 1 218 ? 5.290   -18.393 -79.268  1.00 15.08 ? 196  TYR B CG    1 
ATOM   4025  C CD1   . TYR B 1 218 ? 6.373   -18.311 -78.414  1.00 16.50 ? 196  TYR B CD1   1 
ATOM   4026  C CD2   . TYR B 1 218 ? 5.522   -18.339 -80.638  1.00 12.88 ? 196  TYR B CD2   1 
ATOM   4027  C CE1   . TYR B 1 218 ? 7.645   -18.165 -78.897  1.00 19.67 ? 196  TYR B CE1   1 
ATOM   4028  C CE2   . TYR B 1 218 ? 6.786   -18.183 -81.128  1.00 17.17 ? 196  TYR B CE2   1 
ATOM   4029  C CZ    . TYR B 1 218 ? 7.848   -18.098 -80.249  1.00 19.52 ? 196  TYR B CZ    1 
ATOM   4030  O OH    . TYR B 1 218 ? 9.123   -17.923 -80.699  1.00 21.38 ? 196  TYR B OH    1 
ATOM   4031  N N     . PRO B 1 219 ? 2.454   -15.900 -80.164  1.00 18.44 ? 197  PRO B N     1 
ATOM   4032  C CA    . PRO B 1 219 ? 1.642   -15.568 -81.345  1.00 17.82 ? 197  PRO B CA    1 
ATOM   4033  C C     . PRO B 1 219 ? 1.491   -16.748 -82.298  1.00 17.78 ? 197  PRO B C     1 
ATOM   4034  O O     . PRO B 1 219 ? 2.466   -17.454 -82.559  1.00 20.17 ? 197  PRO B O     1 
ATOM   4035  C CB    . PRO B 1 219 ? 2.446   -14.438 -81.987  1.00 17.51 ? 197  PRO B CB    1 
ATOM   4036  C CG    . PRO B 1 219 ? 3.059   -13.762 -80.833  1.00 16.37 ? 197  PRO B CG    1 
ATOM   4037  C CD    . PRO B 1 219 ? 3.484   -14.865 -79.929  1.00 17.68 ? 197  PRO B CD    1 
ATOM   4038  N N     . GLN B 1 220 ? 0.298   -16.960 -82.827  1.00 16.40 ? 198  GLN B N     1 
ATOM   4039  C CA    . GLN B 1 220 ? 0.032   -18.196 -83.576  1.00 17.45 ? 198  GLN B CA    1 
ATOM   4040  C C     . GLN B 1 220 ? 0.761   -18.322 -84.910  1.00 16.79 ? 198  GLN B C     1 
ATOM   4041  O O     . GLN B 1 220 ? 1.204   -19.415 -85.264  1.00 17.80 ? 198  GLN B O     1 
ATOM   4042  C CB    . GLN B 1 220 ? -1.470  -18.437 -83.811  1.00 18.92 ? 198  GLN B CB    1 
ATOM   4043  C CG    . GLN B 1 220 ? -1.785  -19.877 -84.253  1.00 17.23 ? 198  GLN B CG    1 
ATOM   4044  C CD    . GLN B 1 220 ? -1.292  -20.904 -83.279  1.00 14.66 ? 198  GLN B CD    1 
ATOM   4045  O OE1   . GLN B 1 220 ? -1.149  -20.630 -82.081  1.00 10.27 ? 198  GLN B OE1   1 
ATOM   4046  N NE2   . GLN B 1 220 ? -1.063  -22.117 -83.773  1.00 13.07 ? 198  GLN B NE2   1 
ATOM   4047  N N     . LEU B 1 221 ? 0.874   -17.238 -85.660  1.00 16.80 ? 199  LEU B N     1 
ATOM   4048  C CA    . LEU B 1 221 ? 1.580   -17.323 -86.940  1.00 18.71 ? 199  LEU B CA    1 
ATOM   4049  C C     . LEU B 1 221 ? 3.067   -17.672 -86.740  1.00 18.07 ? 199  LEU B C     1 
ATOM   4050  O O     . LEU B 1 221 ? 3.607   -18.526 -87.432  1.00 18.44 ? 199  LEU B O     1 
ATOM   4051  C CB    . LEU B 1 221 ? 1.432   -16.036 -87.767  1.00 19.47 ? 199  LEU B CB    1 
ATOM   4052  C CG    . LEU B 1 221 ? 2.188   -16.013 -89.099  1.00 19.71 ? 199  LEU B CG    1 
ATOM   4053  C CD1   . LEU B 1 221 ? 1.374   -16.706 -90.167  1.00 24.84 ? 199  LEU B CD1   1 
ATOM   4054  C CD2   . LEU B 1 221 ? 2.507   -14.619 -89.490  1.00 21.25 ? 199  LEU B CD2   1 
ATOM   4055  N N     . SER B 1 222 ? 3.723   -16.999 -85.813  1.00 18.25 ? 200  SER B N     1 
ATOM   4056  C CA    . SER B 1 222 ? 5.145   -17.213 -85.595  1.00 19.33 ? 200  SER B CA    1 
ATOM   4057  C C     . SER B 1 222 ? 5.368   -18.596 -84.996  1.00 19.96 ? 200  SER B C     1 
ATOM   4058  O O     . SER B 1 222 ? 6.400   -19.239 -85.234  1.00 21.10 ? 200  SER B O     1 
ATOM   4059  C CB    . SER B 1 222 ? 5.712   -16.101 -84.713  1.00 19.17 ? 200  SER B CB    1 
ATOM   4060  O OG    . SER B 1 222 ? 5.654   -14.835 -85.386  1.00 16.93 ? 200  SER B OG    1 
ATOM   4061  N N     . ALA B 1 223 ? 4.392   -19.073 -84.235  1.00 19.11 ? 201  ALA B N     1 
ATOM   4062  C CA    . ALA B 1 223 ? 4.471   -20.425 -83.693  1.00 19.36 ? 201  ALA B CA    1 
ATOM   4063  C C     . ALA B 1 223 ? 4.558   -21.383 -84.881  1.00 19.62 ? 201  ALA B C     1 
ATOM   4064  O O     . ALA B 1 223 ? 5.558   -22.118 -85.067  1.00 17.30 ? 201  ALA B O     1 
ATOM   4065  C CB    . ALA B 1 223 ? 3.232   -20.757 -82.795  1.00 18.54 ? 201  ALA B CB    1 
ATOM   4066  N N     . VAL B 1 224 ? 3.525   -21.310 -85.717  1.00 20.85 ? 202  VAL B N     1 
ATOM   4067  C CA    . VAL B 1 224 ? 3.391   -22.204 -86.883  1.00 20.06 ? 202  VAL B CA    1 
ATOM   4068  C C     . VAL B 1 224 ? 4.597   -22.116 -87.829  1.00 20.76 ? 202  VAL B C     1 
ATOM   4069  O O     . VAL B 1 224 ? 5.042   -23.119 -88.339  1.00 22.05 ? 202  VAL B O     1 
ATOM   4070  C CB    . VAL B 1 224 ? 2.083   -21.918 -87.635  1.00 19.27 ? 202  VAL B CB    1 
ATOM   4071  C CG1   . VAL B 1 224 ? 2.036   -22.648 -88.944  1.00 23.65 ? 202  VAL B CG1   1 
ATOM   4072  C CG2   . VAL B 1 224 ? 0.918   -22.330 -86.788  1.00 15.15 ? 202  VAL B CG2   1 
ATOM   4073  N N     . ILE B 1 225 ? 5.118   -20.923 -88.066  1.00 22.56 ? 203  ILE B N     1 
ATOM   4074  C CA    . ILE B 1 225 ? 6.281   -20.770 -88.945  1.00 25.28 ? 203  ILE B CA    1 
ATOM   4075  C C     . ILE B 1 225 ? 7.489   -21.581 -88.431  1.00 25.84 ? 203  ILE B C     1 
ATOM   4076  O O     . ILE B 1 225 ? 8.119   -22.349 -89.170  1.00 23.75 ? 203  ILE B O     1 
ATOM   4077  C CB    . ILE B 1 225 ? 6.767   -19.314 -89.057  1.00 25.87 ? 203  ILE B CB    1 
ATOM   4078  C CG1   . ILE B 1 225 ? 5.709   -18.395 -89.704  1.00 30.62 ? 203  ILE B CG1   1 
ATOM   4079  C CG2   . ILE B 1 225 ? 8.103   -19.282 -89.800  1.00 27.48 ? 203  ILE B CG2   1 
ATOM   4080  C CD1   . ILE B 1 225 ? 5.949   -18.006 -91.138  1.00 31.15 ? 203  ILE B CD1   1 
ATOM   4081  N N     . GLU B 1 226 ? 7.817   -21.377 -87.157  1.00 27.89 ? 204  GLU B N     1 
ATOM   4082  C CA    . GLU B 1 226 ? 9.043   -21.929 -86.571  1.00 28.40 ? 204  GLU B CA    1 
ATOM   4083  C C     . GLU B 1 226 ? 8.892   -23.425 -86.312  1.00 26.70 ? 204  GLU B C     1 
ATOM   4084  O O     . GLU B 1 226 ? 9.809   -24.208 -86.546  1.00 27.24 ? 204  GLU B O     1 
ATOM   4085  C CB    . GLU B 1 226 ? 9.411   -21.157 -85.302  1.00 29.16 ? 204  GLU B CB    1 
ATOM   4086  C CG    . GLU B 1 226 ? 9.617   -19.625 -85.565  1.00 36.37 ? 204  GLU B CG    1 
ATOM   4087  C CD    . GLU B 1 226 ? 9.385   -18.731 -84.327  1.00 41.45 ? 204  GLU B CD    1 
ATOM   4088  O OE1   . GLU B 1 226 ? 9.669   -19.189 -83.194  1.00 42.58 ? 204  GLU B OE1   1 
ATOM   4089  O OE2   . GLU B 1 226 ? 8.922   -17.572 -84.499  1.00 37.13 ? 204  GLU B OE2   1 
ATOM   4090  N N     . CYS B 1 227 ? 7.707   -23.813 -85.858  1.00 25.62 ? 205  CYS B N     1 
ATOM   4091  C CA    . CYS B 1 227 ? 7.391   -25.201 -85.581  1.00 24.67 ? 205  CYS B CA    1 
ATOM   4092  C C     . CYS B 1 227 ? 7.249   -26.052 -86.802  1.00 23.78 ? 205  CYS B C     1 
ATOM   4093  O O     . CYS B 1 227 ? 7.648   -27.215 -86.777  1.00 23.84 ? 205  CYS B O     1 
ATOM   4094  C CB    . CYS B 1 227 ? 6.091   -25.271 -84.795  1.00 25.81 ? 205  CYS B CB    1 
ATOM   4095  S SG    . CYS B 1 227 ? 6.338   -24.671 -83.165  1.00 26.41 ? 205  CYS B SG    1 
ATOM   4096  N N     . ALA B 1 228 ? 6.638   -25.497 -87.851  1.00 23.84 ? 206  ALA B N     1 
ATOM   4097  C CA    . ALA B 1 228 ? 6.486   -26.208 -89.127  1.00 22.61 ? 206  ALA B CA    1 
ATOM   4098  C C     . ALA B 1 228 ? 7.816   -26.603 -89.675  1.00 22.57 ? 206  ALA B C     1 
ATOM   4099  O O     . ALA B 1 228 ? 8.008   -27.753 -90.027  1.00 22.09 ? 206  ALA B O     1 
ATOM   4100  C CB    . ALA B 1 228 ? 5.784   -25.361 -90.148  1.00 23.01 ? 206  ALA B CB    1 
ATOM   4101  N N     . ASP B 1 229 ? 8.737   -25.648 -89.755  1.00 24.56 ? 207  ASP B N     1 
ATOM   4102  C CA    . ASP B 1 229 ? 10.113  -25.946 -90.218  1.00 26.43 ? 207  ASP B CA    1 
ATOM   4103  C C     . ASP B 1 229 ? 10.720  -27.117 -89.468  1.00 25.41 ? 207  ASP B C     1 
ATOM   4104  O O     . ASP B 1 229 ? 11.278  -28.029 -90.057  1.00 26.46 ? 207  ASP B O     1 
ATOM   4105  C CB    . ASP B 1 229 ? 11.036  -24.738 -90.051  1.00 27.71 ? 207  ASP B CB    1 
ATOM   4106  C CG    . ASP B 1 229 ? 10.848  -23.697 -91.146  1.00 33.52 ? 207  ASP B CG    1 
ATOM   4107  O OD1   . ASP B 1 229 ? 10.639  -24.084 -92.319  1.00 36.35 ? 207  ASP B OD1   1 
ATOM   4108  O OD2   . ASP B 1 229 ? 10.928  -22.487 -90.836  1.00 39.79 ? 207  ASP B OD2   1 
ATOM   4109  N N     . SER B 1 230 ? 10.576  -27.074 -88.152  1.00 24.73 ? 208  SER B N     1 
ATOM   4110  C CA    . SER B 1 230 ? 11.220  -28.016 -87.262  1.00 23.82 ? 208  SER B CA    1 
ATOM   4111  C C     . SER B 1 230 ? 10.646  -29.421 -87.436  1.00 22.63 ? 208  SER B C     1 
ATOM   4112  O O     . SER B 1 230 ? 11.390  -30.399 -87.496  1.00 23.23 ? 208  SER B O     1 
ATOM   4113  C CB    . SER B 1 230 ? 11.090  -27.501 -85.825  1.00 23.43 ? 208  SER B CB    1 
ATOM   4114  O OG    . SER B 1 230 ? 11.709  -28.371 -84.905  1.00 29.82 ? 208  SER B OG    1 
ATOM   4115  N N     . ALA B 1 231 ? 9.324   -29.502 -87.536  1.00 21.39 ? 209  ALA B N     1 
ATOM   4116  C CA    . ALA B 1 231 ? 8.625   -30.756 -87.800  1.00 19.96 ? 209  ALA B CA    1 
ATOM   4117  C C     . ALA B 1 231 ? 9.020   -31.358 -89.155  1.00 19.71 ? 209  ALA B C     1 
ATOM   4118  O O     . ALA B 1 231 ? 9.369   -32.536 -89.259  1.00 19.75 ? 209  ALA B O     1 
ATOM   4119  C CB    . ALA B 1 231 ? 7.130   -30.522 -87.755  1.00 19.39 ? 209  ALA B CB    1 
ATOM   4120  N N     . HIS B 1 232 ? 8.977   -30.536 -90.193  1.00 19.42 ? 210  HIS B N     1 
ATOM   4121  C CA    . HIS B 1 232 ? 9.207   -31.008 -91.546  1.00 19.24 ? 210  HIS B CA    1 
ATOM   4122  C C     . HIS B 1 232 ? 10.636  -31.443 -91.780  1.00 19.25 ? 210  HIS B C     1 
ATOM   4123  O O     . HIS B 1 232 ? 10.896  -32.301 -92.616  1.00 18.87 ? 210  HIS B O     1 
ATOM   4124  C CB    . HIS B 1 232 ? 8.794   -29.936 -92.548  1.00 17.68 ? 210  HIS B CB    1 
ATOM   4125  C CG    . HIS B 1 232 ? 7.338   -29.601 -92.468  1.00 17.86 ? 210  HIS B CG    1 
ATOM   4126  N ND1   . HIS B 1 232 ? 6.820   -28.405 -92.906  1.00 13.76 ? 210  HIS B ND1   1 
ATOM   4127  C CD2   . HIS B 1 232 ? 6.299   -30.293 -91.944  1.00 13.57 ? 210  HIS B CD2   1 
ATOM   4128  C CE1   . HIS B 1 232 ? 5.518   -28.393 -92.696  1.00 21.27 ? 210  HIS B CE1   1 
ATOM   4129  N NE2   . HIS B 1 232 ? 5.179   -29.527 -92.108  1.00 18.05 ? 210  HIS B NE2   1 
ATOM   4130  N N     . GLY B 1 233 ? 11.558  -30.853 -91.036  1.00 20.85 ? 211  GLY B N     1 
ATOM   4131  C CA    . GLY B 1 233 ? 12.953  -31.260 -91.078  1.00 21.57 ? 211  GLY B CA    1 
ATOM   4132  C C     . GLY B 1 233 ? 13.124  -32.712 -90.660  1.00 21.81 ? 211  GLY B C     1 
ATOM   4133  O O     . GLY B 1 233 ? 14.103  -33.376 -91.036  1.00 22.00 ? 211  GLY B O     1 
ATOM   4134  N N     . LEU B 1 234 ? 12.180  -33.202 -89.878  1.00 21.36 ? 212  LEU B N     1 
ATOM   4135  C CA    . LEU B 1 234 ? 12.214  -34.588 -89.437  1.00 22.45 ? 212  LEU B CA    1 
ATOM   4136  C C     . LEU B 1 234 ? 11.278  -35.459 -90.249  1.00 22.28 ? 212  LEU B C     1 
ATOM   4137  O O     . LEU B 1 234 ? 11.101  -36.623 -89.921  1.00 24.08 ? 212  LEU B O     1 
ATOM   4138  C CB    . LEU B 1 234 ? 11.819  -34.679 -87.959  1.00 23.28 ? 212  LEU B CB    1 
ATOM   4139  C CG    . LEU B 1 234 ? 12.807  -34.033 -86.994  1.00 23.92 ? 212  LEU B CG    1 
ATOM   4140  C CD1   . LEU B 1 234 ? 12.125  -33.615 -85.712  1.00 25.11 ? 212  LEU B CD1   1 
ATOM   4141  C CD2   . LEU B 1 234 ? 13.942  -34.980 -86.705  1.00 24.55 ? 212  LEU B CD2   1 
ATOM   4142  N N     . LYS B 1 235 ? 10.677  -34.898 -91.296  1.00 21.88 ? 213  LYS B N     1 
ATOM   4143  C CA    . LYS B 1 235 ? 9.568   -35.543 -92.008  1.00 21.45 ? 213  LYS B CA    1 
ATOM   4144  C C     . LYS B 1 235 ? 8.313   -35.776 -91.100  1.00 19.46 ? 213  LYS B C     1 
ATOM   4145  O O     . LYS B 1 235 ? 7.493   -36.661 -91.353  1.00 19.10 ? 213  LYS B O     1 
ATOM   4146  C CB    . LYS B 1 235 ? 10.083  -36.822 -92.682  1.00 22.19 ? 213  LYS B CB    1 
ATOM   4147  C CG    . LYS B 1 235 ? 11.368  -36.605 -93.507  1.00 26.59 ? 213  LYS B CG    1 
ATOM   4148  C CD    . LYS B 1 235 ? 11.810  -37.918 -94.213  1.00 34.66 ? 213  LYS B CD    1 
ATOM   4149  C CE    . LYS B 1 235 ? 13.334  -38.020 -94.417  1.00 33.76 ? 213  LYS B CE    1 
ATOM   4150  N N     . GLY B 1 236 ? 8.185   -34.948 -90.065  1.00 17.76 ? 214  GLY B N     1 
ATOM   4151  C CA    . GLY B 1 236 ? 6.994   -34.918 -89.209  1.00 17.02 ? 214  GLY B CA    1 
ATOM   4152  C C     . GLY B 1 236 ? 5.916   -33.915 -89.665  1.00 14.95 ? 214  GLY B C     1 
ATOM   4153  O O     . GLY B 1 236 ? 5.986   -33.349 -90.744  1.00 12.75 ? 214  GLY B O     1 
ATOM   4154  N N     . HIS B 1 237 ? 4.909   -33.709 -88.835  1.00 15.87 ? 215  HIS B N     1 
ATOM   4155  C CA    . HIS B 1 237 ? 3.756   -32.893 -89.189  1.00 16.40 ? 215  HIS B CA    1 
ATOM   4156  C C     . HIS B 1 237 ? 3.266   -32.059 -87.998  1.00 16.74 ? 215  HIS B C     1 
ATOM   4157  O O     . HIS B 1 237 ? 3.493   -32.420 -86.862  1.00 15.94 ? 215  HIS B O     1 
ATOM   4158  C CB    . HIS B 1 237 ? 2.609   -33.804 -89.679  1.00 17.07 ? 215  HIS B CB    1 
ATOM   4159  C CG    . HIS B 1 237 ? 2.935   -34.586 -90.921  1.00 12.37 ? 215  HIS B CG    1 
ATOM   4160  N ND1   . HIS B 1 237 ? 3.672   -35.748 -90.901  1.00 12.03 ? 215  HIS B ND1   1 
ATOM   4161  C CD2   . HIS B 1 237 ? 2.614   -34.372 -92.214  1.00 11.16 ? 215  HIS B CD2   1 
ATOM   4162  C CE1   . HIS B 1 237 ? 3.788   -36.216 -92.128  1.00 12.77 ? 215  HIS B CE1   1 
ATOM   4163  N NE2   . HIS B 1 237 ? 3.166   -35.391 -92.946  1.00 7.27  ? 215  HIS B NE2   1 
ATOM   4164  N N     . ILE B 1 238 ? 2.595   -30.939 -88.279  1.00 17.39 ? 216  ILE B N     1 
ATOM   4165  C CA    . ILE B 1 238 ? 2.017   -30.120 -87.230  1.00 17.17 ? 216  ILE B CA    1 
ATOM   4166  C C     . ILE B 1 238 ? 0.550   -29.727 -87.474  1.00 16.32 ? 216  ILE B C     1 
ATOM   4167  O O     . ILE B 1 238 ? 0.085   -29.645 -88.614  1.00 16.84 ? 216  ILE B O     1 
ATOM   4168  C CB    . ILE B 1 238 ? 2.876   -28.848 -86.974  1.00 17.78 ? 216  ILE B CB    1 
ATOM   4169  C CG1   . ILE B 1 238 ? 2.858   -27.879 -88.161  1.00 17.55 ? 216  ILE B CG1   1 
ATOM   4170  C CG2   . ILE B 1 238 ? 4.309   -29.229 -86.646  1.00 20.86 ? 216  ILE B CG2   1 
ATOM   4171  C CD1   . ILE B 1 238 ? 3.219   -26.454 -87.747  1.00 16.66 ? 216  ILE B CD1   1 
ATOM   4172  N N     . ILE B 1 239 ? -0.166  -29.519 -86.376  1.00 14.94 ? 217  ILE B N     1 
ATOM   4173  C CA    . ILE B 1 239 ? -1.480  -28.920 -86.405  1.00 13.22 ? 217  ILE B CA    1 
ATOM   4174  C C     . ILE B 1 239 ? -1.301  -27.518 -85.838  1.00 13.74 ? 217  ILE B C     1 
ATOM   4175  O O     . ILE B 1 239 ? -0.719  -27.357 -84.753  1.00 15.22 ? 217  ILE B O     1 
ATOM   4176  C CB    . ILE B 1 239 ? -2.462  -29.698 -85.495  1.00 14.36 ? 217  ILE B CB    1 
ATOM   4177  C CG1   . ILE B 1 239 ? -2.693  -31.114 -86.046  1.00 15.43 ? 217  ILE B CG1   1 
ATOM   4178  C CG2   . ILE B 1 239 ? -3.753  -28.931 -85.321  1.00 7.59  ? 217  ILE B CG2   1 
ATOM   4179  C CD1   . ILE B 1 239 ? -2.928  -32.131 -84.994  1.00 13.15 ? 217  ILE B CD1   1 
ATOM   4180  N N     . SER B 1 240 ? -1.785  -26.513 -86.564  1.00 12.92 ? 218  SER B N     1 
ATOM   4181  C CA    . SER B 1 240 ? -2.004  -25.197 -85.985  1.00 12.90 ? 218  SER B CA    1 
ATOM   4182  C C     . SER B 1 240 ? -3.307  -25.228 -85.134  1.00 14.38 ? 218  SER B C     1 
ATOM   4183  O O     . SER B 1 240 ? -4.419  -25.168 -85.679  1.00 12.09 ? 218  SER B O     1 
ATOM   4184  C CB    . SER B 1 240 ? -2.043  -24.127 -87.074  1.00 12.65 ? 218  SER B CB    1 
ATOM   4185  O OG    . SER B 1 240 ? -2.038  -22.810 -86.525  1.00 8.48  ? 218  SER B OG    1 
ATOM   4186  N N     . ASP B 1 241 ? -3.123  -25.278 -83.805  1.00 16.04 ? 219  ASP B N     1 
ATOM   4187  C CA    . ASP B 1 241 ? -4.202  -25.443 -82.829  1.00 17.99 ? 219  ASP B CA    1 
ATOM   4188  C C     . ASP B 1 241 ? -4.608  -24.149 -82.148  1.00 17.78 ? 219  ASP B C     1 
ATOM   4189  O O     . ASP B 1 241 ? -4.026  -23.745 -81.137  1.00 19.77 ? 219  ASP B O     1 
ATOM   4190  C CB    . ASP B 1 241 ? -3.826  -26.469 -81.726  1.00 18.60 ? 219  ASP B CB    1 
ATOM   4191  C CG    . ASP B 1 241 ? -5.040  -26.821 -80.801  1.00 17.93 ? 219  ASP B CG    1 
ATOM   4192  O OD1   . ASP B 1 241 ? -6.186  -26.782 -81.306  1.00 13.38 ? 219  ASP B OD1   1 
ATOM   4193  O OD2   . ASP B 1 241 ? -4.854  -27.131 -79.583  1.00 17.58 ? 219  ASP B OD2   1 
ATOM   4194  N N     . GLY B 1 242 ? -5.663  -23.537 -82.661  1.00 18.42 ? 220  GLY B N     1 
ATOM   4195  C CA    . GLY B 1 242 ? -6.232  -22.339 -82.048  1.00 17.67 ? 220  GLY B CA    1 
ATOM   4196  C C     . GLY B 1 242 ? -5.819  -21.042 -82.684  1.00 16.92 ? 220  GLY B C     1 
ATOM   4197  O O     . GLY B 1 242 ? -4.825  -20.985 -83.375  1.00 17.64 ? 220  GLY B O     1 
ATOM   4198  N N     . GLY B 1 243 ? -6.622  -20.010 -82.466  1.00 16.22 ? 221  GLY B N     1 
ATOM   4199  C CA    . GLY B 1 243 ? -6.333  -18.680 -82.955  1.00 16.33 ? 221  GLY B CA    1 
ATOM   4200  C C     . GLY B 1 243 ? -7.087  -18.219 -84.197  1.00 16.02 ? 221  GLY B C     1 
ATOM   4201  O O     . GLY B 1 243 ? -7.224  -17.018 -84.421  1.00 18.33 ? 221  GLY B O     1 
ATOM   4202  N N     . CYS B 1 244 ? -7.562  -19.151 -85.018  1.00 16.82 ? 222  CYS B N     1 
ATOM   4203  C CA    . CYS B 1 244 ? -8.279  -18.787 -86.227  1.00 16.60 ? 222  CYS B CA    1 
ATOM   4204  C C     . CYS B 1 244 ? -9.673  -18.289 -85.880  1.00 18.02 ? 222  CYS B C     1 
ATOM   4205  O O     . CYS B 1 244 ? -10.421 -18.943 -85.180  1.00 17.97 ? 222  CYS B O     1 
ATOM   4206  C CB    . CYS B 1 244 ? -8.396  -19.978 -87.156  1.00 17.43 ? 222  CYS B CB    1 
ATOM   4207  S SG    . CYS B 1 244 ? -6.866  -20.535 -87.832  1.00 19.43 ? 222  CYS B SG    1 
ATOM   4208  N N     . THR B 1 245 ? -9.979  -17.087 -86.344  1.00 18.70 ? 223  THR B N     1 
ATOM   4209  C CA    . THR B 1 245 ? -11.257 -16.427 -86.104  1.00 18.22 ? 223  THR B CA    1 
ATOM   4210  C C     . THR B 1 245 ? -12.059 -16.347 -87.373  1.00 17.69 ? 223  THR B C     1 
ATOM   4211  O O     . THR B 1 245 ? -13.217 -15.960 -87.341  1.00 17.54 ? 223  THR B O     1 
ATOM   4212  C CB    . THR B 1 245 ? -11.020 -14.976 -85.641  1.00 19.82 ? 223  THR B CB    1 
ATOM   4213  O OG1   . THR B 1 245 ? -10.082 -14.347 -86.534  1.00 18.89 ? 223  THR B OG1   1 
ATOM   4214  C CG2   . THR B 1 245 ? -10.487 -14.934 -84.184  1.00 20.40 ? 223  THR B CG2   1 
ATOM   4215  N N     . CYS B 1 246 ? -11.427 -16.682 -88.488  1.00 16.84 ? 224  CYS B N     1 
ATOM   4216  C CA    . CYS B 1 246 ? -12.044 -16.580 -89.785  1.00 15.97 ? 224  CYS B CA    1 
ATOM   4217  C C     . CYS B 1 246 ? -11.273 -17.434 -90.793  1.00 15.47 ? 224  CYS B C     1 
ATOM   4218  O O     . CYS B 1 246 ? -10.122 -17.867 -90.527  1.00 14.24 ? 224  CYS B O     1 
ATOM   4219  C CB    . CYS B 1 246 ? -12.100 -15.115 -90.238  1.00 17.43 ? 224  CYS B CB    1 
ATOM   4220  S SG    . CYS B 1 246 ? -10.492 -14.365 -90.582  1.00 16.07 ? 224  CYS B SG    1 
ATOM   4221  N N     . PRO B 1 247 ? -11.900 -17.690 -91.961  1.00 14.09 ? 225  PRO B N     1 
ATOM   4222  C CA    . PRO B 1 247 ? -11.251 -18.589 -92.900  1.00 14.18 ? 225  PRO B CA    1 
ATOM   4223  C C     . PRO B 1 247 ? -9.917  -18.043 -93.437  1.00 14.35 ? 225  PRO B C     1 
ATOM   4224  O O     . PRO B 1 247 ? -9.071  -18.824 -93.848  1.00 16.64 ? 225  PRO B O     1 
ATOM   4225  C CB    . PRO B 1 247 ? -12.315 -18.791 -93.982  1.00 14.63 ? 225  PRO B CB    1 
ATOM   4226  C CG    . PRO B 1 247 ? -13.607 -18.325 -93.360  1.00 12.05 ? 225  PRO B CG    1 
ATOM   4227  C CD    . PRO B 1 247 ? -13.189 -17.211 -92.485  1.00 12.27 ? 225  PRO B CD    1 
ATOM   4228  N N     . GLY B 1 248 ? -9.731  -16.726 -93.399  1.00 14.88 ? 226  GLY B N     1 
ATOM   4229  C CA    . GLY B 1 248 ? -8.463  -16.106 -93.778  1.00 15.98 ? 226  GLY B CA    1 
ATOM   4230  C C     . GLY B 1 248 ? -7.331  -16.586 -92.890  1.00 17.88 ? 226  GLY B C     1 
ATOM   4231  O O     . GLY B 1 248 ? -6.248  -16.929 -93.373  1.00 18.46 ? 226  GLY B O     1 
ATOM   4232  N N     . ASP B 1 249 ? -7.599  -16.623 -91.582  1.00 19.53 ? 227  ASP B N     1 
ATOM   4233  C CA    . ASP B 1 249 ? -6.616  -17.106 -90.612  1.00 18.84 ? 227  ASP B CA    1 
ATOM   4234  C C     . ASP B 1 249 ? -6.263  -18.553 -90.923  1.00 17.72 ? 227  ASP B C     1 
ATOM   4235  O O     . ASP B 1 249 ? -5.084  -18.929 -90.877  1.00 18.00 ? 227  ASP B O     1 
ATOM   4236  C CB    . ASP B 1 249 ? -7.152  -17.033 -89.180  1.00 19.60 ? 227  ASP B CB    1 
ATOM   4237  C CG    . ASP B 1 249 ? -7.237  -15.623 -88.623  1.00 20.31 ? 227  ASP B CG    1 
ATOM   4238  O OD1   . ASP B 1 249 ? -6.726  -14.658 -89.234  1.00 23.54 ? 227  ASP B OD1   1 
ATOM   4239  O OD2   . ASP B 1 249 ? -7.833  -15.503 -87.530  1.00 20.08 ? 227  ASP B OD2   1 
ATOM   4240  N N     . VAL B 1 250 ? -7.289  -19.355 -91.238  1.00 17.42 ? 228  VAL B N     1 
ATOM   4241  C CA    . VAL B 1 250 ? -7.075  -20.757 -91.607  1.00 16.56 ? 228  VAL B CA    1 
ATOM   4242  C C     . VAL B 1 250 ? -6.125  -20.840 -92.792  1.00 16.47 ? 228  VAL B C     1 
ATOM   4243  O O     . VAL B 1 250 ? -5.241  -21.695 -92.823  1.00 17.19 ? 228  VAL B O     1 
ATOM   4244  C CB    . VAL B 1 250 ? -8.333  -21.479 -92.059  1.00 15.97 ? 228  VAL B CB    1 
ATOM   4245  C CG1   . VAL B 1 250 ? -7.986  -22.904 -92.483  1.00 20.61 ? 228  VAL B CG1   1 
ATOM   4246  C CG2   . VAL B 1 250 ? -9.371  -21.508 -90.958  1.00 19.26 ? 228  VAL B CG2   1 
ATOM   4247  N N     . ALA B 1 251 ? -6.325  -19.954 -93.773  1.00 15.70 ? 229  ALA B N     1 
ATOM   4248  C CA    . ALA B 1 251 ? -5.469  -19.892 -94.943  1.00 14.89 ? 229  ALA B CA    1 
ATOM   4249  C C     . ALA B 1 251 ? -4.037  -19.510 -94.594  1.00 15.02 ? 229  ALA B C     1 
ATOM   4250  O O     . ALA B 1 251 ? -3.076  -20.064 -95.133  1.00 12.53 ? 229  ALA B O     1 
ATOM   4251  C CB    . ALA B 1 251 ? -6.027  -18.901 -95.946  1.00 15.67 ? 229  ALA B CB    1 
ATOM   4252  N N     . LYS B 1 252 ? -3.900  -18.538 -93.694  1.00 17.99 ? 230  LYS B N     1 
ATOM   4253  C CA    . LYS B 1 252 ? -2.577  -18.090 -93.237  1.00 17.72 ? 230  LYS B CA    1 
ATOM   4254  C C     . LYS B 1 252 ? -1.895  -19.187 -92.473  1.00 18.59 ? 230  LYS B C     1 
ATOM   4255  O O     . LYS B 1 252 ? -0.711  -19.383 -92.647  1.00 20.34 ? 230  LYS B O     1 
ATOM   4256  C CB    . LYS B 1 252 ? -2.652  -16.845 -92.372  1.00 16.66 ? 230  LYS B CB    1 
ATOM   4257  C CG    . LYS B 1 252 ? -3.063  -15.613 -93.129  1.00 14.54 ? 230  LYS B CG    1 
ATOM   4258  C CD    . LYS B 1 252 ? -2.980  -14.386 -92.260  1.00 18.31 ? 230  LYS B CD    1 
ATOM   4259  C CE    . LYS B 1 252 ? -4.128  -13.421 -92.539  1.00 19.12 ? 230  LYS B CE    1 
ATOM   4260  N NZ    . LYS B 1 252 ? -3.790  -12.010 -92.256  1.00 9.89  ? 230  LYS B NZ    1 
ATOM   4261  N N     . ALA B 1 253 ? -2.631  -19.918 -91.639  1.00 18.55 ? 231  ALA B N     1 
ATOM   4262  C CA    . ALA B 1 253 ? -2.041  -21.063 -90.936  1.00 18.93 ? 231  ALA B CA    1 
ATOM   4263  C C     . ALA B 1 253 ? -1.375  -22.023 -91.922  1.00 19.13 ? 231  ALA B C     1 
ATOM   4264  O O     . ALA B 1 253 ? -0.181  -22.358 -91.805  1.00 18.39 ? 231  ALA B O     1 
ATOM   4265  C CB    . ALA B 1 253 ? -3.074  -21.791 -90.128  1.00 18.98 ? 231  ALA B CB    1 
ATOM   4266  N N     . PHE B 1 254 ? -2.151  -22.445 -92.907  1.00 18.28 ? 232  PHE B N     1 
ATOM   4267  C CA    . PHE B 1 254 ? -1.641  -23.318 -93.964  1.00 18.11 ? 232  PHE B CA    1 
ATOM   4268  C C     . PHE B 1 254 ? -0.475  -22.702 -94.747  1.00 17.09 ? 232  PHE B C     1 
ATOM   4269  O O     . PHE B 1 254 ? 0.472   -23.402 -95.103  1.00 15.24 ? 232  PHE B O     1 
ATOM   4270  C CB    . PHE B 1 254 ? -2.763  -23.702 -94.926  1.00 17.07 ? 232  PHE B CB    1 
ATOM   4271  C CG    . PHE B 1 254 ? -3.714  -24.727 -94.388  1.00 15.32 ? 232  PHE B CG    1 
ATOM   4272  C CD1   . PHE B 1 254 ? -3.271  -25.998 -94.066  1.00 16.50 ? 232  PHE B CD1   1 
ATOM   4273  C CD2   . PHE B 1 254 ? -5.061  -24.449 -94.243  1.00 13.50 ? 232  PHE B CD2   1 
ATOM   4274  C CE1   . PHE B 1 254 ? -4.173  -26.978 -93.591  1.00 15.05 ? 232  PHE B CE1   1 
ATOM   4275  C CE2   . PHE B 1 254 ? -5.939  -25.420 -93.775  1.00 16.54 ? 232  PHE B CE2   1 
ATOM   4276  C CZ    . PHE B 1 254 ? -5.489  -26.680 -93.453  1.00 10.38 ? 232  PHE B CZ    1 
ATOM   4277  N N     . GLY B 1 255 ? -0.560  -21.398 -95.010  1.00 17.15 ? 233  GLY B N     1 
ATOM   4278  C CA    . GLY B 1 255 ? 0.490   -20.673 -95.708  1.00 16.42 ? 233  GLY B CA    1 
ATOM   4279  C C     . GLY B 1 255 ? 1.807   -20.653 -94.961  1.00 16.54 ? 233  GLY B C     1 
ATOM   4280  O O     . GLY B 1 255 ? 2.871   -20.683 -95.567  1.00 17.26 ? 233  GLY B O     1 
ATOM   4281  N N     . ALA B 1 256 ? 1.716   -20.595 -93.635  1.00 17.52 ? 234  ALA B N     1 
ATOM   4282  C CA    . ALA B 1 256 ? 2.871   -20.586 -92.745  1.00 17.74 ? 234  ALA B CA    1 
ATOM   4283  C C     . ALA B 1 256 ? 3.510   -21.977 -92.579  1.00 18.01 ? 234  ALA B C     1 
ATOM   4284  O O     . ALA B 1 256 ? 4.597   -22.086 -92.018  1.00 20.16 ? 234  ALA B O     1 
ATOM   4285  C CB    . ALA B 1 256 ? 2.464   -20.048 -91.383  1.00 17.79 ? 234  ALA B CB    1 
ATOM   4286  N N     . GLY B 1 257 ? 2.821   -23.033 -93.017  1.00 16.83 ? 235  GLY B N     1 
ATOM   4287  C CA    . GLY B 1 257 ? 3.384   -24.384 -93.044  1.00 16.33 ? 235  GLY B CA    1 
ATOM   4288  C C     . GLY B 1 257 ? 2.593   -25.454 -92.316  1.00 17.38 ? 235  GLY B C     1 
ATOM   4289  O O     . GLY B 1 257 ? 2.956   -26.632 -92.373  1.00 17.34 ? 235  GLY B O     1 
ATOM   4290  N N     . ALA B 1 258 ? 1.508   -25.049 -91.638  1.00 18.55 ? 236  ALA B N     1 
ATOM   4291  C CA    . ALA B 1 258 ? 0.608   -25.978 -90.930  1.00 17.48 ? 236  ALA B CA    1 
ATOM   4292  C C     . ALA B 1 258 ? 0.117   -27.092 -91.825  1.00 18.68 ? 236  ALA B C     1 
ATOM   4293  O O     . ALA B 1 258 ? -0.476  -26.838 -92.884  1.00 19.04 ? 236  ALA B O     1 
ATOM   4294  C CB    . ALA B 1 258 ? -0.588  -25.254 -90.401  1.00 17.44 ? 236  ALA B CB    1 
ATOM   4295  N N     . ASP B 1 259 ? 0.323   -28.329 -91.374  1.00 19.31 ? 237  ASP B N     1 
ATOM   4296  C CA    . ASP B 1 259 ? -0.084  -29.490 -92.138  1.00 17.02 ? 237  ASP B CA    1 
ATOM   4297  C C     . ASP B 1 259 ? -1.553  -29.669 -91.981  1.00 15.65 ? 237  ASP B C     1 
ATOM   4298  O O     . ASP B 1 259 ? -2.234  -29.928 -92.959  1.00 14.89 ? 237  ASP B O     1 
ATOM   4299  C CB    . ASP B 1 259 ? 0.682   -30.710 -91.690  1.00 17.28 ? 237  ASP B CB    1 
ATOM   4300  C CG    . ASP B 1 259 ? 2.133   -30.601 -92.017  1.00 14.07 ? 237  ASP B CG    1 
ATOM   4301  O OD1   . ASP B 1 259 ? 2.495   -30.821 -93.179  1.00 15.74 ? 237  ASP B OD1   1 
ATOM   4302  O OD2   . ASP B 1 259 ? 2.904   -30.250 -91.129  1.00 13.09 ? 237  ASP B OD2   1 
ATOM   4303  N N     . PHE B 1 260 ? -2.028  -29.514 -90.748  1.00 15.86 ? 238  PHE B N     1 
ATOM   4304  C CA    . PHE B 1 260 ? -3.476  -29.429 -90.437  1.00 16.28 ? 238  PHE B CA    1 
ATOM   4305  C C     . PHE B 1 260 ? -3.755  -28.141 -89.701  1.00 14.90 ? 238  PHE B C     1 
ATOM   4306  O O     . PHE B 1 260 ? -2.850  -27.506 -89.201  1.00 15.45 ? 238  PHE B O     1 
ATOM   4307  C CB    . PHE B 1 260 ? -3.966  -30.538 -89.499  1.00 16.12 ? 238  PHE B CB    1 
ATOM   4308  C CG    . PHE B 1 260 ? -3.612  -31.915 -89.927  1.00 15.61 ? 238  PHE B CG    1 
ATOM   4309  C CD1   . PHE B 1 260 ? -4.602  -32.813 -90.283  1.00 15.70 ? 238  PHE B CD1   1 
ATOM   4310  C CD2   . PHE B 1 260 ? -2.291  -32.342 -89.924  1.00 19.79 ? 238  PHE B CD2   1 
ATOM   4311  C CE1   . PHE B 1 260 ? -4.278  -34.093 -90.645  1.00 13.03 ? 238  PHE B CE1   1 
ATOM   4312  C CE2   . PHE B 1 260 ? -1.974  -33.617 -90.302  1.00 18.31 ? 238  PHE B CE2   1 
ATOM   4313  C CZ    . PHE B 1 260 ? -2.970  -34.487 -90.660  1.00 14.69 ? 238  PHE B CZ    1 
ATOM   4314  N N     . VAL B 1 261 ? -5.024  -27.796 -89.601  1.00 13.87 ? 239  VAL B N     1 
ATOM   4315  C CA    . VAL B 1 261 ? -5.446  -26.653 -88.847  1.00 14.48 ? 239  VAL B CA    1 
ATOM   4316  C C     . VAL B 1 261 ? -6.619  -27.120 -87.989  1.00 14.86 ? 239  VAL B C     1 
ATOM   4317  O O     . VAL B 1 261 ? -7.573  -27.715 -88.499  1.00 12.89 ? 239  VAL B O     1 
ATOM   4318  C CB    . VAL B 1 261 ? -5.726  -25.482 -89.853  1.00 16.09 ? 239  VAL B CB    1 
ATOM   4319  C CG1   . VAL B 1 261 ? -6.614  -24.363 -89.251  1.00 14.75 ? 239  VAL B CG1   1 
ATOM   4320  C CG2   . VAL B 1 261 ? -4.376  -24.923 -90.354  1.00 11.48 ? 239  VAL B CG2   1 
ATOM   4321  N N     . MET B 1 262 ? -6.505  -26.901 -86.674  1.00 16.46 ? 240  MET B N     1 
ATOM   4322  C CA    . MET B 1 262 ? -7.532  -27.315 -85.708  1.00 16.86 ? 240  MET B CA    1 
ATOM   4323  C C     . MET B 1 262 ? -8.347  -26.127 -85.160  1.00 17.27 ? 240  MET B C     1 
ATOM   4324  O O     . MET B 1 262 ? -7.805  -25.144 -84.648  1.00 17.29 ? 240  MET B O     1 
ATOM   4325  C CB    . MET B 1 262 ? -6.886  -28.126 -84.590  1.00 16.66 ? 240  MET B CB    1 
ATOM   4326  C CG    . MET B 1 262 ? -7.763  -28.457 -83.428  1.00 12.85 ? 240  MET B CG    1 
ATOM   4327  S SD    . MET B 1 262 ? -6.964  -29.505 -82.211  1.00 18.61 ? 240  MET B SD    1 
ATOM   4328  C CE    . MET B 1 262 ? -7.279  -31.196 -82.765  1.00 13.71 ? 240  MET B CE    1 
ATOM   4329  N N     . LEU B 1 263 ? -9.665  -26.271 -85.244  1.00 16.43 ? 241  LEU B N     1 
ATOM   4330  C CA    . LEU B 1 263 ? -10.613 -25.185 -84.986  1.00 17.25 ? 241  LEU B CA    1 
ATOM   4331  C C     . LEU B 1 263 ? -11.631 -25.553 -83.932  1.00 15.55 ? 241  LEU B C     1 
ATOM   4332  O O     . LEU B 1 263 ? -12.255 -26.580 -84.070  1.00 15.41 ? 241  LEU B O     1 
ATOM   4333  C CB    . LEU B 1 263 ? -11.391 -24.894 -86.267  1.00 15.71 ? 241  LEU B CB    1 
ATOM   4334  C CG    . LEU B 1 263 ? -10.541 -24.507 -87.467  1.00 16.74 ? 241  LEU B CG    1 
ATOM   4335  C CD1   . LEU B 1 263 ? -11.373 -24.497 -88.725  1.00 17.50 ? 241  LEU B CD1   1 
ATOM   4336  C CD2   . LEU B 1 263 ? -9.885  -23.150 -87.237  1.00 16.18 ? 241  LEU B CD2   1 
ATOM   4337  N N     . GLY B 1 264 ? -11.821 -24.691 -82.932  1.00 14.82 ? 242  GLY B N     1 
ATOM   4338  C CA    . GLY B 1 264 ? -12.883 -24.844 -81.947  1.00 15.67 ? 242  GLY B CA    1 
ATOM   4339  C C     . GLY B 1 264 ? -13.924 -23.728 -82.047  1.00 16.52 ? 242  GLY B C     1 
ATOM   4340  O O     . GLY B 1 264 ? -15.118 -23.967 -82.283  1.00 16.41 ? 242  GLY B O     1 
ATOM   4341  N N     . GLY B 1 265 ? -13.470 -22.497 -81.853  1.00 18.61 ? 243  GLY B N     1 
ATOM   4342  C CA    . GLY B 1 265 ? -14.373 -21.342 -81.820  1.00 18.35 ? 243  GLY B CA    1 
ATOM   4343  C C     . GLY B 1 265 ? -15.196 -21.204 -83.082  1.00 18.28 ? 243  GLY B C     1 
ATOM   4344  O O     . GLY B 1 265 ? -16.415 -20.964 -83.017  1.00 18.34 ? 243  GLY B O     1 
ATOM   4345  N N     . MET B 1 266 ? -14.530 -21.377 -84.231  1.00 18.12 ? 244  MET B N     1 
ATOM   4346  C CA    . MET B 1 266 ? -15.196 -21.296 -85.553  1.00 18.99 ? 244  MET B CA    1 
ATOM   4347  C C     . MET B 1 266 ? -16.273 -22.354 -85.749  1.00 18.03 ? 244  MET B C     1 
ATOM   4348  O O     . MET B 1 266 ? -17.183 -22.157 -86.545  1.00 17.30 ? 244  MET B O     1 
ATOM   4349  C CB    . MET B 1 266 ? -14.177 -21.411 -86.715  1.00 19.66 ? 244  MET B CB    1 
ATOM   4350  C CG    . MET B 1 266 ? -13.411 -20.104 -87.020  1.00 21.62 ? 244  MET B CG    1 
ATOM   4351  S SD    . MET B 1 266 ? -11.828 -20.308 -87.927  1.00 22.19 ? 244  MET B SD    1 
ATOM   4352  C CE    . MET B 1 266 ? -12.471 -20.288 -89.609  1.00 21.20 ? 244  MET B CE    1 
ATOM   4353  N N     . PHE B 1 267 ? -16.135 -23.487 -85.059  1.00 16.66 ? 245  PHE B N     1 
ATOM   4354  C CA    . PHE B 1 267 ? -17.119 -24.559 -85.150  1.00 16.59 ? 245  PHE B CA    1 
ATOM   4355  C C     . PHE B 1 267 ? -18.166 -24.471 -84.038  1.00 17.13 ? 245  PHE B C     1 
ATOM   4356  O O     . PHE B 1 267 ? -19.245 -25.063 -84.157  1.00 16.60 ? 245  PHE B O     1 
ATOM   4357  C CB    . PHE B 1 267 ? -16.429 -25.932 -85.194  1.00 14.05 ? 245  PHE B CB    1 
ATOM   4358  C CG    . PHE B 1 267 ? -15.848 -26.265 -86.540  1.00 15.38 ? 245  PHE B CG    1 
ATOM   4359  C CD1   . PHE B 1 267 ? -16.613 -26.121 -87.710  1.00 15.96 ? 245  PHE B CD1   1 
ATOM   4360  C CD2   . PHE B 1 267 ? -14.533 -26.701 -86.660  1.00 15.10 ? 245  PHE B CD2   1 
ATOM   4361  C CE1   . PHE B 1 267 ? -16.074 -26.403 -88.959  1.00 16.67 ? 245  PHE B CE1   1 
ATOM   4362  C CE2   . PHE B 1 267 ? -13.973 -26.985 -87.916  1.00 14.61 ? 245  PHE B CE2   1 
ATOM   4363  C CZ    . PHE B 1 267 ? -14.740 -26.844 -89.061  1.00 19.24 ? 245  PHE B CZ    1 
ATOM   4364  N N     . SER B 1 268 ? -17.868 -23.695 -82.996  1.00 17.56 ? 246  SER B N     1 
ATOM   4365  C CA    . SER B 1 268 ? -18.820 -23.465 -81.912  1.00 16.66 ? 246  SER B CA    1 
ATOM   4366  C C     . SER B 1 268 ? -20.134 -22.865 -82.420  1.00 16.40 ? 246  SER B C     1 
ATOM   4367  O O     . SER B 1 268 ? -20.170 -22.224 -83.454  1.00 17.00 ? 246  SER B O     1 
ATOM   4368  C CB    . SER B 1 268 ? -18.199 -22.548 -80.851  1.00 17.55 ? 246  SER B CB    1 
ATOM   4369  O OG    . SER B 1 268 ? -18.236 -21.182 -81.246  1.00 14.66 ? 246  SER B OG    1 
ATOM   4370  N N     . GLY B 1 269 ? -21.220 -23.101 -81.702  1.00 18.14 ? 247  GLY B N     1 
ATOM   4371  C CA    . GLY B 1 269 ? -22.465 -22.376 -81.948  1.00 18.98 ? 247  GLY B CA    1 
ATOM   4372  C C     . GLY B 1 269 ? -23.417 -22.989 -82.951  1.00 20.39 ? 247  GLY B C     1 
ATOM   4373  O O     . GLY B 1 269 ? -24.500 -22.439 -83.212  1.00 21.25 ? 247  GLY B O     1 
ATOM   4374  N N     . HIS B 1 270 ? -23.040 -24.145 -83.496  1.00 20.42 ? 248  HIS B N     1 
ATOM   4375  C CA    . HIS B 1 270 ? -23.858 -24.807 -84.515  1.00 19.32 ? 248  HIS B CA    1 
ATOM   4376  C C     . HIS B 1 270 ? -24.848 -25.798 -83.953  1.00 19.44 ? 248  HIS B C     1 
ATOM   4377  O O     . HIS B 1 270 ? -24.718 -26.230 -82.822  1.00 19.23 ? 248  HIS B O     1 
ATOM   4378  C CB    . HIS B 1 270 ? -22.965 -25.514 -85.526  1.00 18.97 ? 248  HIS B CB    1 
ATOM   4379  C CG    . HIS B 1 270 ? -22.119 -24.567 -86.303  1.00 17.29 ? 248  HIS B CG    1 
ATOM   4380  N ND1   . HIS B 1 270 ? -20.767 -24.412 -86.071  1.00 15.51 ? 248  HIS B ND1   1 
ATOM   4381  C CD2   . HIS B 1 270 ? -22.447 -23.668 -87.263  1.00 14.83 ? 248  HIS B CD2   1 
ATOM   4382  C CE1   . HIS B 1 270 ? -20.294 -23.484 -86.884  1.00 19.02 ? 248  HIS B CE1   1 
ATOM   4383  N NE2   . HIS B 1 270 ? -21.291 -23.020 -87.618  1.00 18.12 ? 248  HIS B NE2   1 
ATOM   4384  N N     . THR B 1 271 ? -25.834 -26.162 -84.772  1.00 20.78 ? 249  THR B N     1 
ATOM   4385  C CA    . THR B 1 271 ? -26.872 -27.157 -84.403  1.00 21.05 ? 249  THR B CA    1 
ATOM   4386  C C     . THR B 1 271 ? -26.285 -28.523 -84.045  1.00 21.79 ? 249  THR B C     1 
ATOM   4387  O O     . THR B 1 271 ? -26.845 -29.254 -83.220  1.00 21.47 ? 249  THR B O     1 
ATOM   4388  C CB    . THR B 1 271 ? -27.861 -27.339 -85.547  1.00 20.93 ? 249  THR B CB    1 
ATOM   4389  O OG1   . THR B 1 271 ? -28.502 -26.084 -85.792  1.00 23.55 ? 249  THR B OG1   1 
ATOM   4390  C CG2   . THR B 1 271 ? -28.907 -28.369 -85.227  1.00 23.11 ? 249  THR B CG2   1 
ATOM   4391  N N     . GLU B 1 272 ? -25.142 -28.842 -84.655  1.00 23.59 ? 250  GLU B N     1 
ATOM   4392  C CA    . GLU B 1 272 ? -24.455 -30.113 -84.433  1.00 24.40 ? 250  GLU B CA    1 
ATOM   4393  C C     . GLU B 1 272 ? -23.679 -30.103 -83.116  1.00 25.61 ? 250  GLU B C     1 
ATOM   4394  O O     . GLU B 1 272 ? -23.274 -31.153 -82.607  1.00 26.80 ? 250  GLU B O     1 
ATOM   4395  C CB    . GLU B 1 272 ? -23.503 -30.410 -85.608  1.00 25.22 ? 250  GLU B CB    1 
ATOM   4396  C CG    . GLU B 1 272 ? -24.226 -30.741 -86.946  1.00 27.41 ? 250  GLU B CG    1 
ATOM   4397  C CD    . GLU B 1 272 ? -24.890 -29.527 -87.602  1.00 28.29 ? 250  GLU B CD    1 
ATOM   4398  O OE1   . GLU B 1 272 ? -24.228 -28.478 -87.718  1.00 25.89 ? 250  GLU B OE1   1 
ATOM   4399  O OE2   . GLU B 1 272 ? -26.068 -29.624 -88.007  1.00 22.04 ? 250  GLU B OE2   1 
ATOM   4400  N N     . CYS B 1 273 ? -23.467 -28.912 -82.565  1.00 26.74 ? 251  CYS B N     1 
ATOM   4401  C CA    . CYS B 1 273 ? -22.710 -28.765 -81.330  1.00 26.59 ? 251  CYS B CA    1 
ATOM   4402  C C     . CYS B 1 273 ? -23.494 -29.248 -80.133  1.00 26.15 ? 251  CYS B C     1 
ATOM   4403  O O     . CYS B 1 273 ? -24.715 -29.077 -80.072  1.00 25.59 ? 251  CYS B O     1 
ATOM   4404  C CB    . CYS B 1 273 ? -22.312 -27.312 -81.098  1.00 26.72 ? 251  CYS B CB    1 
ATOM   4405  S SG    . CYS B 1 273 ? -20.835 -26.811 -81.995  1.00 29.17 ? 251  CYS B SG    1 
ATOM   4406  N N     . ALA B 1 274 ? -22.779 -29.835 -79.179  1.00 25.93 ? 252  ALA B N     1 
ATOM   4407  C CA    . ALA B 1 274 ? -23.365 -30.269 -77.929  1.00 26.69 ? 252  ALA B CA    1 
ATOM   4408  C C     . ALA B 1 274 ? -23.962 -29.071 -77.208  1.00 26.88 ? 252  ALA B C     1 
ATOM   4409  O O     . ALA B 1 274 ? -23.351 -28.007 -77.177  1.00 27.41 ? 252  ALA B O     1 
ATOM   4410  C CB    . ALA B 1 274 ? -22.317 -30.917 -77.057  1.00 26.95 ? 252  ALA B CB    1 
ATOM   4411  N N     . GLY B 1 275 ? -25.163 -29.253 -76.652  1.00 26.48 ? 253  GLY B N     1 
ATOM   4412  C CA    . GLY B 1 275 ? -25.859 -28.206 -75.910  1.00 26.51 ? 253  GLY B CA    1 
ATOM   4413  C C     . GLY B 1 275 ? -27.137 -27.797 -76.612  1.00 27.45 ? 253  GLY B C     1 
ATOM   4414  O O     . GLY B 1 275 ? -27.303 -28.040 -77.810  1.00 27.17 ? 253  GLY B O     1 
ATOM   4415  N N     . GLU B 1 276 ? -28.049 -27.193 -75.853  1.00 28.87 ? 254  GLU B N     1 
ATOM   4416  C CA    . GLU B 1 276 ? -29.283 -26.629 -76.406  1.00 29.16 ? 254  GLU B CA    1 
ATOM   4417  C C     . GLU B 1 276 ? -29.098 -25.129 -76.646  1.00 29.04 ? 254  GLU B C     1 
ATOM   4418  O O     . GLU B 1 276 ? -28.113 -24.514 -76.190  1.00 28.02 ? 254  GLU B O     1 
ATOM   4419  C CB    . GLU B 1 276 ? -30.472 -26.884 -75.468  1.00 29.28 ? 254  GLU B CB    1 
ATOM   4420  N N     . VAL B 1 277 ? -30.047 -24.547 -77.373  1.00 29.41 ? 255  VAL B N     1 
ATOM   4421  C CA    . VAL B 1 277 ? -30.035 -23.109 -77.663  1.00 29.98 ? 255  VAL B CA    1 
ATOM   4422  C C     . VAL B 1 277 ? -30.536 -22.304 -76.443  1.00 29.73 ? 255  VAL B C     1 
ATOM   4423  O O     . VAL B 1 277 ? -31.484 -22.712 -75.775  1.00 29.46 ? 255  VAL B O     1 
ATOM   4424  C CB    . VAL B 1 277 ? -30.842 -22.814 -78.964  1.00 30.05 ? 255  VAL B CB    1 
ATOM   4425  C CG1   . VAL B 1 277 ? -31.044 -21.310 -79.176  1.00 30.03 ? 255  VAL B CG1   1 
ATOM   4426  C CG2   . VAL B 1 277 ? -30.113 -23.446 -80.165  1.00 30.42 ? 255  VAL B CG2   1 
ATOM   4427  N N     . ILE B 1 278 ? -29.860 -21.189 -76.150  1.00 29.14 ? 256  ILE B N     1 
ATOM   4428  C CA    . ILE B 1 278 ? -30.207 -20.318 -75.022  1.00 28.63 ? 256  ILE B CA    1 
ATOM   4429  C C     . ILE B 1 278 ? -30.946 -19.074 -75.516  1.00 27.79 ? 256  ILE B C     1 
ATOM   4430  O O     . ILE B 1 278 ? -30.736 -18.628 -76.639  1.00 26.91 ? 256  ILE B O     1 
ATOM   4431  C CB    . ILE B 1 278 ? -28.964 -19.852 -74.245  1.00 28.83 ? 256  ILE B CB    1 
ATOM   4432  C CG1   . ILE B 1 278 ? -28.058 -21.040 -73.900  1.00 35.33 ? 256  ILE B CG1   1 
ATOM   4433  C CG2   . ILE B 1 278 ? -29.376 -19.111 -72.974  1.00 25.68 ? 256  ILE B CG2   1 
ATOM   4434  C CD1   . ILE B 1 278 ? -26.556 -20.669 -73.821  1.00 39.65 ? 256  ILE B CD1   1 
ATOM   4435  N N     . ARG B 1 283 ? -32.045 -12.936 -78.738  1.00 25.11 ? 261  ARG B N     1 
ATOM   4436  C CA    . ARG B 1 283 ? -30.756 -13.506 -79.153  1.00 24.73 ? 261  ARG B CA    1 
ATOM   4437  C C     . ARG B 1 283 ? -30.710 -15.021 -78.898  1.00 23.23 ? 261  ARG B C     1 
ATOM   4438  O O     . ARG B 1 283 ? -30.968 -15.477 -77.780  1.00 23.13 ? 261  ARG B O     1 
ATOM   4439  C CB    . ARG B 1 283 ? -29.576 -12.830 -78.432  1.00 25.52 ? 261  ARG B CB    1 
ATOM   4440  N N     . LYS B 1 284 ? -30.406 -15.795 -79.936  1.00 21.81 ? 262  LYS B N     1 
ATOM   4441  C CA    . LYS B 1 284 ? -30.217 -17.242 -79.787  1.00 20.97 ? 262  LYS B CA    1 
ATOM   4442  C C     . LYS B 1 284 ? -28.718 -17.551 -79.652  1.00 20.36 ? 262  LYS B C     1 
ATOM   4443  O O     . LYS B 1 284 ? -27.894 -17.094 -80.457  1.00 18.28 ? 262  LYS B O     1 
ATOM   4444  C CB    . LYS B 1 284 ? -30.877 -18.016 -80.942  1.00 21.12 ? 262  LYS B CB    1 
ATOM   4445  C CG    . LYS B 1 284 ? -32.407 -17.810 -81.026  1.00 19.90 ? 262  LYS B CG    1 
ATOM   4446  N N     . LEU B 1 285 ? -28.374 -18.310 -78.609  1.00 20.47 ? 263  LEU B N     1 
ATOM   4447  C CA    . LEU B 1 285 ? -26.982 -18.605 -78.291  1.00 19.97 ? 263  LEU B CA    1 
ATOM   4448  C C     . LEU B 1 285 ? -26.746 -20.072 -77.912  1.00 18.90 ? 263  LEU B C     1 
ATOM   4449  O O     . LEU B 1 285 ? -27.670 -20.806 -77.540  1.00 15.82 ? 263  LEU B O     1 
ATOM   4450  C CB    . LEU B 1 285 ? -26.531 -17.695 -77.152  1.00 20.76 ? 263  LEU B CB    1 
ATOM   4451  C CG    . LEU B 1 285 ? -26.690 -16.189 -77.422  1.00 25.57 ? 263  LEU B CG    1 
ATOM   4452  C CD1   . LEU B 1 285 ? -27.673 -15.543 -76.419  1.00 23.02 ? 263  LEU B CD1   1 
ATOM   4453  C CD2   . LEU B 1 285 ? -25.321 -15.459 -77.473  1.00 25.67 ? 263  LEU B CD2   1 
ATOM   4454  N N     . LYS B 1 286 ? -25.491 -20.487 -78.034  1.00 19.50 ? 264  LYS B N     1 
ATOM   4455  C CA    . LYS B 1 286 ? -25.031 -21.782 -77.536  1.00 21.33 ? 264  LYS B CA    1 
ATOM   4456  C C     . LYS B 1 286 ? -23.825 -21.542 -76.634  1.00 21.50 ? 264  LYS B C     1 
ATOM   4457  O O     . LYS B 1 286 ? -23.017 -20.650 -76.895  1.00 22.70 ? 264  LYS B O     1 
ATOM   4458  C CB    . LYS B 1 286 ? -24.632 -22.707 -78.695  1.00 22.48 ? 264  LYS B CB    1 
ATOM   4459  C CG    . LYS B 1 286 ? -25.783 -23.411 -79.438  1.00 23.66 ? 264  LYS B CG    1 
ATOM   4460  C CD    . LYS B 1 286 ? -25.964 -24.887 -79.024  1.00 27.14 ? 264  LYS B CD    1 
ATOM   4461  C CE    . LYS B 1 286 ? -26.009 -25.827 -80.243  1.00 28.66 ? 264  LYS B CE    1 
ATOM   4462  N NZ    . LYS B 1 286 ? -26.877 -27.052 -80.122  1.00 26.48 ? 264  LYS B NZ    1 
ATOM   4463  N N     . LEU B 1 287 ? -23.707 -22.349 -75.583  1.00 21.68 ? 265  LEU B N     1 
ATOM   4464  C CA    . LEU B 1 287 ? -22.597 -22.247 -74.646  1.00 21.35 ? 265  LEU B CA    1 
ATOM   4465  C C     . LEU B 1 287 ? -21.375 -22.910 -75.242  1.00 20.74 ? 265  LEU B C     1 
ATOM   4466  O O     . LEU B 1 287 ? -21.473 -23.989 -75.800  1.00 22.88 ? 265  LEU B O     1 
ATOM   4467  C CB    . LEU B 1 287 ? -22.949 -22.945 -73.325  1.00 21.63 ? 265  LEU B CB    1 
ATOM   4468  C CG    . LEU B 1 287 ? -22.090 -22.596 -72.107  1.00 20.31 ? 265  LEU B CG    1 
ATOM   4469  C CD1   . LEU B 1 287 ? -22.258 -21.126 -71.736  1.00 19.16 ? 265  LEU B CD1   1 
ATOM   4470  C CD2   . LEU B 1 287 ? -22.443 -23.493 -70.933  1.00 20.00 ? 265  LEU B CD2   1 
ATOM   4471  N N     . PHE B 1 288 ? -20.223 -22.275 -75.094  1.00 19.99 ? 266  PHE B N     1 
ATOM   4472  C CA    . PHE B 1 288 ? -18.959 -22.824 -75.584  1.00 18.96 ? 266  PHE B CA    1 
ATOM   4473  C C     . PHE B 1 288 ? -17.935 -22.594 -74.463  1.00 19.71 ? 266  PHE B C     1 
ATOM   4474  O O     . PHE B 1 288 ? -17.750 -21.466 -74.006  1.00 19.24 ? 266  PHE B O     1 
ATOM   4475  C CB    . PHE B 1 288 ? -18.589 -22.146 -76.919  1.00 17.75 ? 266  PHE B CB    1 
ATOM   4476  C CG    . PHE B 1 288 ? -17.248 -22.538 -77.468  1.00 14.21 ? 266  PHE B CG    1 
ATOM   4477  C CD1   . PHE B 1 288 ? -16.248 -21.588 -77.635  1.00 12.16 ? 266  PHE B CD1   1 
ATOM   4478  C CD2   . PHE B 1 288 ? -16.986 -23.854 -77.828  1.00 11.88 ? 266  PHE B CD2   1 
ATOM   4479  C CE1   . PHE B 1 288 ? -14.996 -21.945 -78.131  1.00 11.57 ? 266  PHE B CE1   1 
ATOM   4480  C CE2   . PHE B 1 288 ? -15.742 -24.233 -78.320  1.00 15.27 ? 266  PHE B CE2   1 
ATOM   4481  C CZ    . PHE B 1 288 ? -14.738 -23.268 -78.472  1.00 15.50 ? 266  PHE B CZ    1 
ATOM   4482  N N     . TYR B 1 289 ? -17.300 -23.669 -73.998  1.00 20.74 ? 267  TYR B N     1 
ATOM   4483  C CA    . TYR B 1 289 ? -16.430 -23.580 -72.824  1.00 22.06 ? 267  TYR B CA    1 
ATOM   4484  C C     . TYR B 1 289 ? -15.096 -24.326 -72.960  1.00 23.10 ? 267  TYR B C     1 
ATOM   4485  O O     . TYR B 1 289 ? -15.021 -25.369 -73.626  1.00 23.54 ? 267  TYR B O     1 
ATOM   4486  C CB    . TYR B 1 289 ? -17.197 -24.055 -71.593  1.00 22.22 ? 267  TYR B CB    1 
ATOM   4487  C CG    . TYR B 1 289 ? -17.803 -25.433 -71.702  1.00 21.06 ? 267  TYR B CG    1 
ATOM   4488  C CD1   . TYR B 1 289 ? -19.164 -25.602 -71.963  1.00 20.21 ? 267  TYR B CD1   1 
ATOM   4489  C CD2   . TYR B 1 289 ? -17.036 -26.563 -71.485  1.00 21.83 ? 267  TYR B CD2   1 
ATOM   4490  C CE1   . TYR B 1 289 ? -19.736 -26.873 -72.030  1.00 20.02 ? 267  TYR B CE1   1 
ATOM   4491  C CE2   . TYR B 1 289 ? -17.593 -27.828 -71.551  1.00 23.54 ? 267  TYR B CE2   1 
ATOM   4492  C CZ    . TYR B 1 289 ? -18.939 -27.983 -71.828  1.00 23.90 ? 267  TYR B CZ    1 
ATOM   4493  O OH    . TYR B 1 289 ? -19.478 -29.252 -71.892  1.00 23.78 ? 267  TYR B OH    1 
ATOM   4494  N N     . GLY B 1 290 ? -14.057 -23.781 -72.326  1.00 22.48 ? 268  GLY B N     1 
ATOM   4495  C CA    . GLY B 1 290 ? -12.725 -24.365 -72.362  1.00 22.17 ? 268  GLY B CA    1 
ATOM   4496  C C     . GLY B 1 290 ? -12.685 -25.790 -71.840  1.00 22.06 ? 268  GLY B C     1 
ATOM   4497  O O     . GLY B 1 290 ? -13.494 -26.185 -70.981  1.00 22.83 ? 268  GLY B O     1 
ATOM   4498  N N     . MET B 1 291 ? -11.749 -26.562 -72.375  1.00 20.81 ? 269  MET B N     1 
ATOM   4499  C CA    . MET B 1 291 ? -11.534 -27.956 -71.984  1.00 20.49 ? 269  MET B CA    1 
ATOM   4500  C C     . MET B 1 291 ? -11.169 -28.079 -70.483  1.00 20.90 ? 269  MET B C     1 
ATOM   4501  O O     . MET B 1 291 ? -11.540 -29.051 -69.814  1.00 21.16 ? 269  MET B O     1 
ATOM   4502  C CB    . MET B 1 291 ? -10.420 -28.581 -72.855  1.00 21.45 ? 269  MET B CB    1 
ATOM   4503  C CG    . MET B 1 291 ? -10.769 -28.769 -74.369  1.00 19.47 ? 269  MET B CG    1 
ATOM   4504  S SD    . MET B 1 291 ? -9.313  -28.910 -75.481  1.00 21.00 ? 269  MET B SD    1 
ATOM   4505  C CE    . MET B 1 291 ? -8.611  -30.490 -75.068  1.00 18.37 ? 269  MET B CE    1 
ATOM   4506  N N     . SER B 1 292 ? -10.451 -27.091 -69.957  1.00 20.58 ? 270  SER B N     1 
ATOM   4507  C CA    . SER B 1 292 ? -10.091 -27.068 -68.536  1.00 19.47 ? 270  SER B CA    1 
ATOM   4508  C C     . SER B 1 292 ? -10.813 -25.928 -67.823  1.00 19.53 ? 270  SER B C     1 
ATOM   4509  O O     . SER B 1 292 ? -10.315 -25.411 -66.826  1.00 19.81 ? 270  SER B O     1 
ATOM   4510  C CB    . SER B 1 292 ? -8.576  -26.921 -68.377  1.00 20.80 ? 270  SER B CB    1 
ATOM   4511  O OG    . SER B 1 292 ? -7.877  -27.946 -69.088  1.00 19.47 ? 270  SER B OG    1 
ATOM   4512  N N     . SER B 1 293 ? -11.998 -25.553 -68.328  1.00 18.77 ? 271  SER B N     1 
ATOM   4513  C CA    . SER B 1 293 ? -12.774 -24.455 -67.763  1.00 18.44 ? 271  SER B CA    1 
ATOM   4514  C C     . SER B 1 293 ? -13.418 -24.923 -66.480  1.00 18.21 ? 271  SER B C     1 
ATOM   4515  O O     . SER B 1 293 ? -13.457 -26.114 -66.212  1.00 16.86 ? 271  SER B O     1 
ATOM   4516  C CB    . SER B 1 293 ? -13.842 -23.956 -68.744  1.00 17.83 ? 271  SER B CB    1 
ATOM   4517  O OG    . SER B 1 293 ? -14.923 -24.868 -68.821  1.00 17.14 ? 271  SER B OG    1 
ATOM   4518  N N     . ASP B 1 294 ? -13.908 -23.971 -65.693  1.00 20.25 ? 272  ASP B N     1 
ATOM   4519  C CA    . ASP B 1 294 ? -14.756 -24.243 -64.513  1.00 22.93 ? 272  ASP B CA    1 
ATOM   4520  C C     . ASP B 1 294 ? -15.994 -25.096 -64.862  1.00 21.02 ? 272  ASP B C     1 
ATOM   4521  O O     . ASP B 1 294 ? -16.404 -25.972 -64.090  1.00 21.34 ? 272  ASP B O     1 
ATOM   4522  C CB    . ASP B 1 294 ? -15.250 -22.900 -63.923  1.00 23.65 ? 272  ASP B CB    1 
ATOM   4523  C CG    . ASP B 1 294 ? -15.000 -22.772 -62.425  1.00 32.60 ? 272  ASP B CG    1 
ATOM   4524  O OD1   . ASP B 1 294 ? -15.417 -23.685 -61.654  1.00 37.62 ? 272  ASP B OD1   1 
ATOM   4525  O OD2   . ASP B 1 294 ? -14.403 -21.732 -62.025  1.00 40.96 ? 272  ASP B OD2   1 
ATOM   4526  N N     . THR B 1 295 ? -16.590 -24.790 -66.014  1.00 20.05 ? 273  THR B N     1 
ATOM   4527  C CA    . THR B 1 295 ? -17.734 -25.505 -66.548  1.00 19.90 ? 273  THR B CA    1 
ATOM   4528  C C     . THR B 1 295 ? -17.414 -26.958 -66.778  1.00 20.15 ? 273  THR B C     1 
ATOM   4529  O O     . THR B 1 295 ? -18.192 -27.826 -66.394  1.00 18.57 ? 273  THR B O     1 
ATOM   4530  C CB    . THR B 1 295 ? -18.170 -24.905 -67.893  1.00 19.37 ? 273  THR B CB    1 
ATOM   4531  O OG1   . THR B 1 295 ? -18.303 -23.490 -67.756  1.00 17.44 ? 273  THR B OG1   1 
ATOM   4532  C CG2   . THR B 1 295 ? -19.484 -25.513 -68.363  1.00 19.95 ? 273  THR B CG2   1 
ATOM   4533  N N     . ALA B 1 296 ? -16.267 -27.211 -67.415  1.00 22.67 ? 274  ALA B N     1 
ATOM   4534  C CA    . ALA B 1 296 ? -15.808 -28.580 -67.684  1.00 24.54 ? 274  ALA B CA    1 
ATOM   4535  C C     . ALA B 1 296 ? -15.431 -29.315 -66.392  1.00 25.76 ? 274  ALA B C     1 
ATOM   4536  O O     . ALA B 1 296 ? -15.756 -30.478 -66.228  1.00 26.00 ? 274  ALA B O     1 
ATOM   4537  C CB    . ALA B 1 296 ? -14.660 -28.570 -68.660  1.00 25.36 ? 274  ALA B CB    1 
ATOM   4538  N N     . MET B 1 297 ? -14.778 -28.609 -65.472  1.00 27.34 ? 275  MET B N     1 
ATOM   4539  C CA    . MET B 1 297 ? -14.442 -29.138 -64.146  1.00 26.36 ? 275  MET B CA    1 
ATOM   4540  C C     . MET B 1 297 ? -15.701 -29.595 -63.364  1.00 28.25 ? 275  MET B C     1 
ATOM   4541  O O     . MET B 1 297 ? -15.710 -30.687 -62.765  1.00 29.07 ? 275  MET B O     1 
ATOM   4542  C CB    . MET B 1 297 ? -13.653 -28.088 -63.346  1.00 23.98 ? 275  MET B CB    1 
ATOM   4543  C CG    . MET B 1 297 ? -12.804 -28.675 -62.226  1.00 25.56 ? 275  MET B CG    1 
ATOM   4544  N N     . ASN B 1 298 ? -16.757 -28.778 -63.381  1.00 28.08 ? 276  ASN B N     1 
ATOM   4545  C CA    . ASN B 1 298 ? -18.011 -29.131 -62.714  1.00 28.76 ? 276  ASN B CA    1 
ATOM   4546  C C     . ASN B 1 298 ? -18.783 -30.230 -63.445  1.00 28.52 ? 276  ASN B C     1 
ATOM   4547  O O     . ASN B 1 298 ? -19.401 -31.076 -62.807  1.00 27.77 ? 276  ASN B O     1 
ATOM   4548  C CB    . ASN B 1 298 ? -18.863 -27.882 -62.518  1.00 29.75 ? 276  ASN B CB    1 
ATOM   4549  C CG    . ASN B 1 298 ? -18.235 -26.908 -61.526  1.00 32.62 ? 276  ASN B CG    1 
ATOM   4550  O OD1   . ASN B 1 298 ? -17.915 -27.279 -60.392  1.00 32.88 ? 276  ASN B OD1   1 
ATOM   4551  N ND2   . ASN B 1 298 ? -18.052 -25.661 -61.949  1.00 33.34 ? 276  ASN B ND2   1 
ATOM   4552  N N     . LYS B 1 299 ? -18.711 -30.222 -64.776  1.00 29.57 ? 277  LYS B N     1 
ATOM   4553  C CA    . LYS B 1 299 ? -19.372 -31.211 -65.626  1.00 29.69 ? 277  LYS B CA    1 
ATOM   4554  C C     . LYS B 1 299 ? -18.691 -32.584 -65.562  1.00 29.84 ? 277  LYS B C     1 
ATOM   4555  O O     . LYS B 1 299 ? -19.367 -33.619 -65.613  1.00 28.60 ? 277  LYS B O     1 
ATOM   4556  C CB    . LYS B 1 299 ? -19.401 -30.670 -67.069  1.00 29.41 ? 277  LYS B CB    1 
ATOM   4557  C CG    . LYS B 1 299 ? -20.162 -31.509 -68.067  1.00 30.36 ? 277  LYS B CG    1 
ATOM   4558  C CD    . LYS B 1 299 ? -20.307 -30.772 -69.378  1.00 34.86 ? 277  LYS B CD    1 
ATOM   4559  N N     . HIS B 1 300 ? -17.364 -32.586 -65.436  1.00 30.36 ? 278  HIS B N     1 
ATOM   4560  C CA    . HIS B 1 300 ? -16.572 -33.820 -65.385  1.00 30.36 ? 278  HIS B CA    1 
ATOM   4561  C C     . HIS B 1 300 ? -15.684 -33.838 -64.146  1.00 30.12 ? 278  HIS B C     1 
ATOM   4562  O O     . HIS B 1 300 ? -15.922 -34.607 -63.227  1.00 30.37 ? 278  HIS B O     1 
ATOM   4563  C CB    . HIS B 1 300 ? -15.705 -33.948 -66.643  1.00 30.92 ? 278  HIS B CB    1 
ATOM   4564  C CG    . HIS B 1 300 ? -16.412 -33.575 -67.911  1.00 30.87 ? 278  HIS B CG    1 
ATOM   4565  N ND1   . HIS B 1 300 ? -17.333 -34.401 -68.521  1.00 30.23 ? 278  HIS B ND1   1 
ATOM   4566  C CD2   . HIS B 1 300 ? -16.325 -32.468 -68.688  1.00 28.25 ? 278  HIS B CD2   1 
ATOM   4567  C CE1   . HIS B 1 300 ? -17.780 -33.818 -69.620  1.00 31.01 ? 278  HIS B CE1   1 
ATOM   4568  N NE2   . HIS B 1 300 ? -17.190 -32.642 -69.741  1.00 24.92 ? 278  HIS B NE2   1 
ATOM   4569  N N     . VAL B 1 304 ? -9.857  -32.927 -66.155  1.00 39.33 ? 282  VAL B N     1 
ATOM   4570  C CA    . VAL B 1 304 ? -9.701  -31.623 -66.809  1.00 39.77 ? 282  VAL B CA    1 
ATOM   4571  C C     . VAL B 1 304 ? -8.623  -30.722 -66.175  1.00 40.05 ? 282  VAL B C     1 
ATOM   4572  O O     . VAL B 1 304 ? -8.106  -29.819 -66.844  1.00 40.52 ? 282  VAL B O     1 
ATOM   4573  C CB    . VAL B 1 304 ? -11.042 -30.803 -66.845  1.00 39.58 ? 282  VAL B CB    1 
ATOM   4574  C CG1   . VAL B 1 304 ? -12.268 -31.720 -66.902  1.00 38.61 ? 282  VAL B CG1   1 
ATOM   4575  C CG2   . VAL B 1 304 ? -11.139 -29.832 -65.661  1.00 40.02 ? 282  VAL B CG2   1 
ATOM   4576  N N     . ALA B 1 305 ? -8.271  -30.977 -64.912  1.00 39.63 ? 283  ALA B N     1 
ATOM   4577  C CA    . ALA B 1 305 ? -7.526  -30.012 -64.096  1.00 39.43 ? 283  ALA B CA    1 
ATOM   4578  C C     . ALA B 1 305 ? -6.361  -29.397 -64.853  1.00 38.31 ? 283  ALA B C     1 
ATOM   4579  O O     . ALA B 1 305 ? -6.298  -28.173 -65.029  1.00 39.01 ? 283  ALA B O     1 
ATOM   4580  C CB    . ALA B 1 305 ? -7.012  -30.669 -62.813  1.00 40.43 ? 283  ALA B CB    1 
ATOM   4581  N N     . GLU B 1 306 ? -5.439  -30.249 -65.288  1.00 35.15 ? 284  GLU B N     1 
ATOM   4582  C CA    . GLU B 1 306 ? -4.293  -29.787 -66.069  1.00 33.09 ? 284  GLU B CA    1 
ATOM   4583  C C     . GLU B 1 306 ? -4.249  -30.508 -67.412  1.00 30.80 ? 284  GLU B C     1 
ATOM   4584  O O     . GLU B 1 306 ? -3.210  -31.022 -67.854  1.00 29.35 ? 284  GLU B O     1 
ATOM   4585  C CB    . GLU B 1 306 ? -2.983  -29.928 -65.260  1.00 34.06 ? 284  GLU B CB    1 
ATOM   4586  C CG    . GLU B 1 306 ? -2.361  -28.579 -64.847  1.00 29.87 ? 284  GLU B CG    1 
ATOM   4587  C CD    . GLU B 1 306 ? -1.801  -28.557 -63.445  1.00 31.17 ? 284  GLU B CD    1 
ATOM   4588  O OE1   . GLU B 1 306 ? -1.767  -29.596 -62.748  1.00 29.07 ? 284  GLU B OE1   1 
ATOM   4589  O OE2   . GLU B 1 306 ? -1.402  -27.461 -63.030  1.00 37.21 ? 284  GLU B OE2   1 
ATOM   4590  N N     . TYR B 1 307 ? -5.407  -30.526 -68.061  1.00 28.71 ? 285  TYR B N     1 
ATOM   4591  C CA    . TYR B 1 307 ? -5.548  -31.082 -69.409  1.00 27.02 ? 285  TYR B CA    1 
ATOM   4592  C C     . TYR B 1 307 ? -4.951  -30.094 -70.401  1.00 25.04 ? 285  TYR B C     1 
ATOM   4593  O O     . TYR B 1 307 ? -4.223  -30.471 -71.319  1.00 22.52 ? 285  TYR B O     1 
ATOM   4594  C CB    . TYR B 1 307 ? -7.030  -31.303 -69.713  1.00 26.95 ? 285  TYR B CB    1 
ATOM   4595  C CG    . TYR B 1 307 ? -7.369  -32.137 -70.940  1.00 29.00 ? 285  TYR B CG    1 
ATOM   4596  C CD1   . TYR B 1 307 ? -6.411  -32.925 -71.606  1.00 27.16 ? 285  TYR B CD1   1 
ATOM   4597  C CD2   . TYR B 1 307 ? -8.694  -32.193 -71.389  1.00 28.52 ? 285  TYR B CD2   1 
ATOM   4598  C CE1   . TYR B 1 307 ? -6.768  -33.707 -72.718  1.00 29.21 ? 285  TYR B CE1   1 
ATOM   4599  C CE2   . TYR B 1 307 ? -9.058  -32.967 -72.495  1.00 30.80 ? 285  TYR B CE2   1 
ATOM   4600  C CZ    . TYR B 1 307 ? -8.097  -33.720 -73.164  1.00 31.43 ? 285  TYR B CZ    1 
ATOM   4601  O OH    . TYR B 1 307 ? -8.505  -34.476 -74.259  1.00 24.17 ? 285  TYR B OH    1 
ATOM   4602  N N     . ARG B 1 308 ? -5.274  -28.820 -70.182  1.00 24.11 ? 286  ARG B N     1 
ATOM   4603  C CA    . ARG B 1 308 ? -4.796  -27.718 -70.996  1.00 22.60 ? 286  ARG B CA    1 
ATOM   4604  C C     . ARG B 1 308 ? -4.040  -26.730 -70.133  1.00 21.11 ? 286  ARG B C     1 
ATOM   4605  O O     . ARG B 1 308 ? -4.216  -26.701 -68.913  1.00 21.12 ? 286  ARG B O     1 
ATOM   4606  C CB    . ARG B 1 308 ? -5.985  -26.985 -71.629  1.00 23.73 ? 286  ARG B CB    1 
ATOM   4607  C CG    . ARG B 1 308 ? -6.839  -27.799 -72.587  1.00 19.66 ? 286  ARG B CG    1 
ATOM   4608  C CD    . ARG B 1 308 ? -6.178  -27.862 -73.952  1.00 21.93 ? 286  ARG B CD    1 
ATOM   4609  N NE    . ARG B 1 308 ? -4.927  -28.624 -73.953  1.00 19.79 ? 286  ARG B NE    1 
ATOM   4610  C CZ    . ARG B 1 308 ? -4.189  -28.830 -75.029  1.00 17.94 ? 286  ARG B CZ    1 
ATOM   4611  N NH1   . ARG B 1 308 ? -4.570  -28.353 -76.208  1.00 18.17 ? 286  ARG B NH1   1 
ATOM   4612  N NH2   . ARG B 1 308 ? -3.072  -29.543 -74.922  1.00 18.25 ? 286  ARG B NH2   1 
ATOM   4613  N N     . ALA B 1 309 ? -3.245  -25.886 -70.791  1.00 19.96 ? 287  ALA B N     1 
ATOM   4614  C CA    . ALA B 1 309 ? -2.312  -24.953 -70.121  1.00 20.11 ? 287  ALA B CA    1 
ATOM   4615  C C     . ALA B 1 309 ? -2.960  -23.892 -69.209  1.00 20.55 ? 287  ALA B C     1 
ATOM   4616  O O     . ALA B 1 309 ? -2.265  -23.285 -68.391  1.00 19.59 ? 287  ALA B O     1 
ATOM   4617  C CB    . ALA B 1 309 ? -1.427  -24.251 -71.160  1.00 19.37 ? 287  ALA B CB    1 
ATOM   4618  N N     . SER B 1 310 ? -4.264  -23.660 -69.371  1.00 20.42 ? 288  SER B N     1 
ATOM   4619  C CA    . SER B 1 310 ? -4.985  -22.649 -68.612  1.00 20.30 ? 288  SER B CA    1 
ATOM   4620  C C     . SER B 1 310 ? -6.388  -23.119 -68.372  1.00 20.46 ? 288  SER B C     1 
ATOM   4621  O O     . SER B 1 310 ? -6.923  -23.902 -69.143  1.00 20.87 ? 288  SER B O     1 
ATOM   4622  C CB    . SER B 1 310 ? -5.061  -21.309 -69.362  1.00 21.98 ? 288  SER B CB    1 
ATOM   4623  O OG    . SER B 1 310 ? -5.907  -21.357 -70.511  1.00 19.71 ? 288  SER B OG    1 
ATOM   4624  N N     . GLU B 1 311 ? -6.998  -22.620 -67.307  1.00 22.60 ? 289  GLU B N     1 
ATOM   4625  C CA    . GLU B 1 311 ? -8.404  -22.908 -67.061  1.00 23.21 ? 289  GLU B CA    1 
ATOM   4626  C C     . GLU B 1 311 ? -9.206  -21.955 -67.950  1.00 22.88 ? 289  GLU B C     1 
ATOM   4627  O O     . GLU B 1 311 ? -9.166  -20.741 -67.793  1.00 23.63 ? 289  GLU B O     1 
ATOM   4628  C CB    . GLU B 1 311 ? -8.749  -22.902 -65.562  1.00 23.74 ? 289  GLU B CB    1 
ATOM   4629  C CG    . GLU B 1 311 ? -8.863  -21.585 -64.837  1.00 29.82 ? 289  GLU B CG    1 
ATOM   4630  C CD    . GLU B 1 311 ? -8.965  -21.785 -63.309  1.00 34.96 ? 289  GLU B CD    1 
ATOM   4631  O OE1   . GLU B 1 311 ? -9.790  -21.088 -62.674  1.00 39.23 ? 289  GLU B OE1   1 
ATOM   4632  O OE2   . GLU B 1 311 ? -8.235  -22.654 -62.754  1.00 27.31 ? 289  GLU B OE2   1 
ATOM   4633  N N     . GLY B 1 312 ? -9.872  -22.538 -68.947  1.00 22.44 ? 290  GLY B N     1 
ATOM   4634  C CA    . GLY B 1 312 ? -10.371 -21.777 -70.089  1.00 21.68 ? 290  GLY B CA    1 
ATOM   4635  C C     . GLY B 1 312 ? -11.637 -21.021 -69.780  1.00 22.00 ? 290  GLY B C     1 
ATOM   4636  O O     . GLY B 1 312 ? -12.277 -21.256 -68.739  1.00 21.92 ? 290  GLY B O     1 
ATOM   4637  N N     . LYS B 1 313 ? -11.997 -20.119 -70.694  1.00 22.46 ? 291  LYS B N     1 
ATOM   4638  C CA    . LYS B 1 313 ? -13.218 -19.318 -70.571  1.00 23.43 ? 291  LYS B CA    1 
ATOM   4639  C C     . LYS B 1 313 ? -14.473 -20.162 -70.806  1.00 21.89 ? 291  LYS B C     1 
ATOM   4640  O O     . LYS B 1 313 ? -14.414 -21.191 -71.460  1.00 22.08 ? 291  LYS B O     1 
ATOM   4641  C CB    . LYS B 1 313 ? -13.237 -18.182 -71.601  1.00 24.52 ? 291  LYS B CB    1 
ATOM   4642  C CG    . LYS B 1 313 ? -12.349 -17.002 -71.335  1.00 25.44 ? 291  LYS B CG    1 
ATOM   4643  C CD    . LYS B 1 313 ? -12.384 -16.058 -72.555  1.00 25.12 ? 291  LYS B CD    1 
ATOM   4644  N N     . THR B 1 314 ? -15.602 -19.706 -70.275  1.00 21.70 ? 292  THR B N     1 
ATOM   4645  C CA    . THR B 1 314 ? -16.921 -20.162 -70.727  1.00 22.12 ? 292  THR B CA    1 
ATOM   4646  C C     . THR B 1 314 ? -17.553 -18.936 -71.385  1.00 22.29 ? 292  THR B C     1 
ATOM   4647  O O     . THR B 1 314 ? -17.634 -17.874 -70.765  1.00 20.86 ? 292  THR B O     1 
ATOM   4648  C CB    . THR B 1 314 ? -17.874 -20.700 -69.577  1.00 22.80 ? 292  THR B CB    1 
ATOM   4649  O OG1   . THR B 1 314 ? -17.473 -22.012 -69.151  1.00 22.11 ? 292  THR B OG1   1 
ATOM   4650  C CG2   . THR B 1 314 ? -19.320 -20.773 -70.050  1.00 20.12 ? 292  THR B CG2   1 
ATOM   4651  N N     . VAL B 1 315 ? -17.974 -19.084 -72.643  1.00 23.20 ? 293  VAL B N     1 
ATOM   4652  C CA    . VAL B 1 315 ? -18.659 -18.016 -73.374  1.00 23.13 ? 293  VAL B CA    1 
ATOM   4653  C C     . VAL B 1 315 ? -20.008 -18.456 -73.963  1.00 23.11 ? 293  VAL B C     1 
ATOM   4654  O O     . VAL B 1 315 ? -20.222 -19.639 -74.237  1.00 22.87 ? 293  VAL B O     1 
ATOM   4655  C CB    . VAL B 1 315 ? -17.780 -17.463 -74.507  1.00 22.96 ? 293  VAL B CB    1 
ATOM   4656  C CG1   . VAL B 1 315 ? -16.521 -16.826 -73.925  1.00 22.70 ? 293  VAL B CG1   1 
ATOM   4657  C CG2   . VAL B 1 315 ? -17.432 -18.552 -75.531  1.00 21.85 ? 293  VAL B CG2   1 
ATOM   4658  N N     . GLU B 1 316 ? -20.920 -17.492 -74.125  1.00 23.02 ? 294  GLU B N     1 
ATOM   4659  C CA    . GLU B 1 316 ? -22.136 -17.692 -74.906  1.00 23.50 ? 294  GLU B CA    1 
ATOM   4660  C C     . GLU B 1 316 ? -21.840 -17.192 -76.309  1.00 24.33 ? 294  GLU B C     1 
ATOM   4661  O O     . GLU B 1 316 ? -21.515 -16.027 -76.495  1.00 24.28 ? 294  GLU B O     1 
ATOM   4662  C CB    . GLU B 1 316 ? -23.327 -16.925 -74.313  1.00 23.77 ? 294  GLU B CB    1 
ATOM   4663  C CG    . GLU B 1 316 ? -24.012 -17.591 -73.109  1.00 25.83 ? 294  GLU B CG    1 
ATOM   4664  N N     . VAL B 1 317 ? -21.919 -18.078 -77.295  1.00 24.81 ? 295  VAL B N     1 
ATOM   4665  C CA    . VAL B 1 317 ? -21.637 -17.706 -78.689  1.00 24.92 ? 295  VAL B CA    1 
ATOM   4666  C C     . VAL B 1 317 ? -22.978 -17.601 -79.419  1.00 25.24 ? 295  VAL B C     1 
ATOM   4667  O O     . VAL B 1 317 ? -23.911 -18.344 -79.089  1.00 24.09 ? 295  VAL B O     1 
ATOM   4668  C CB    . VAL B 1 317 ? -20.646 -18.691 -79.419  1.00 24.65 ? 295  VAL B CB    1 
ATOM   4669  C CG1   . VAL B 1 317 ? -20.226 -19.833 -78.544  1.00 25.28 ? 295  VAL B CG1   1 
ATOM   4670  C CG2   . VAL B 1 317 ? -21.227 -19.236 -80.724  1.00 25.54 ? 295  VAL B CG2   1 
ATOM   4671  N N     . PRO B 1 318 ? -23.080 -16.678 -80.405  1.00 26.19 ? 296  PRO B N     1 
ATOM   4672  C CA    . PRO B 1 318 ? -24.303 -16.561 -81.196  1.00 26.17 ? 296  PRO B CA    1 
ATOM   4673  C C     . PRO B 1 318 ? -24.572 -17.863 -81.960  1.00 25.72 ? 296  PRO B C     1 
ATOM   4674  O O     . PRO B 1 318 ? -23.639 -18.497 -82.493  1.00 24.92 ? 296  PRO B O     1 
ATOM   4675  C CB    . PRO B 1 318 ? -24.024 -15.393 -82.154  1.00 26.03 ? 296  PRO B CB    1 
ATOM   4676  C CG    . PRO B 1 318 ? -22.546 -15.242 -82.185  1.00 27.82 ? 296  PRO B CG    1 
ATOM   4677  C CD    . PRO B 1 318 ? -22.034 -15.737 -80.857  1.00 27.90 ? 296  PRO B CD    1 
ATOM   4678  N N     . TYR B 1 319 ? -25.838 -18.269 -81.962  1.00 25.38 ? 297  TYR B N     1 
ATOM   4679  C CA    . TYR B 1 319 ? -26.274 -19.473 -82.661  1.00 25.72 ? 297  TYR B CA    1 
ATOM   4680  C C     . TYR B 1 319 ? -26.097 -19.311 -84.183  1.00 26.44 ? 297  TYR B C     1 
ATOM   4681  O O     . TYR B 1 319 ? -26.755 -18.468 -84.811  1.00 26.56 ? 297  TYR B O     1 
ATOM   4682  C CB    . TYR B 1 319 ? -27.738 -19.748 -82.316  1.00 25.63 ? 297  TYR B CB    1 
ATOM   4683  C CG    . TYR B 1 319 ? -28.330 -20.991 -82.937  1.00 25.41 ? 297  TYR B CG    1 
ATOM   4684  C CD1   . TYR B 1 319 ? -27.608 -22.179 -83.011  1.00 25.99 ? 297  TYR B CD1   1 
ATOM   4685  C CD2   . TYR B 1 319 ? -29.633 -20.985 -83.413  1.00 25.51 ? 297  TYR B CD2   1 
ATOM   4686  C CE1   . TYR B 1 319 ? -28.167 -23.321 -83.565  1.00 29.13 ? 297  TYR B CE1   1 
ATOM   4687  C CE2   . TYR B 1 319 ? -30.203 -22.123 -83.969  1.00 26.14 ? 297  TYR B CE2   1 
ATOM   4688  C CZ    . TYR B 1 319 ? -29.472 -23.288 -84.040  1.00 27.74 ? 297  TYR B CZ    1 
ATOM   4689  O OH    . TYR B 1 319 ? -30.053 -24.403 -84.592  1.00 25.19 ? 297  TYR B OH    1 
ATOM   4690  N N     . LYS B 1 320 ? -25.204 -20.106 -84.770  1.00 26.17 ? 298  LYS B N     1 
ATOM   4691  C CA    . LYS B 1 320 ? -24.851 -19.946 -86.182  1.00 25.67 ? 298  LYS B CA    1 
ATOM   4692  C C     . LYS B 1 320 ? -25.736 -20.773 -87.123  1.00 24.76 ? 298  LYS B C     1 
ATOM   4693  O O     . LYS B 1 320 ? -25.730 -20.548 -88.330  1.00 25.25 ? 298  LYS B O     1 
ATOM   4694  C CB    . LYS B 1 320 ? -23.378 -20.312 -86.432  1.00 27.15 ? 298  LYS B CB    1 
ATOM   4695  C CG    . LYS B 1 320 ? -22.342 -19.636 -85.525  1.00 27.95 ? 298  LYS B CG    1 
ATOM   4696  C CD    . LYS B 1 320 ? -20.932 -19.727 -86.135  1.00 30.48 ? 298  LYS B CD    1 
ATOM   4697  C CE    . LYS B 1 320 ? -19.812 -19.938 -85.109  1.00 27.52 ? 298  LYS B CE    1 
ATOM   4698  N NZ    . LYS B 1 320 ? -20.092 -19.323 -83.777  1.00 22.10 ? 298  LYS B NZ    1 
ATOM   4699  N N     . GLY B 1 321 ? -26.487 -21.730 -86.579  1.00 23.48 ? 299  GLY B N     1 
ATOM   4700  C CA    . GLY B 1 321 ? -27.309 -22.638 -87.391  1.00 21.74 ? 299  GLY B CA    1 
ATOM   4701  C C     . GLY B 1 321 ? -26.596 -23.950 -87.699  1.00 20.79 ? 299  GLY B C     1 
ATOM   4702  O O     . GLY B 1 321 ? -25.827 -24.448 -86.886  1.00 19.71 ? 299  GLY B O     1 
ATOM   4703  N N     . ASP B 1 322 ? -26.860 -24.520 -88.873  1.00 19.98 ? 300  ASP B N     1 
ATOM   4704  C CA    . ASP B 1 322 ? -26.207 -25.771 -89.290  1.00 20.29 ? 300  ASP B CA    1 
ATOM   4705  C C     . ASP B 1 322 ? -24.773 -25.549 -89.768  1.00 18.39 ? 300  ASP B C     1 
ATOM   4706  O O     . ASP B 1 322 ? -24.491 -24.586 -90.469  1.00 18.04 ? 300  ASP B O     1 
ATOM   4707  C CB    . ASP B 1 322 ? -27.021 -26.490 -90.368  1.00 20.89 ? 300  ASP B CB    1 
ATOM   4708  C CG    . ASP B 1 322 ? -28.227 -27.219 -89.796  1.00 25.20 ? 300  ASP B CG    1 
ATOM   4709  O OD1   . ASP B 1 322 ? -28.160 -27.719 -88.658  1.00 30.06 ? 300  ASP B OD1   1 
ATOM   4710  O OD2   . ASP B 1 322 ? -29.253 -27.302 -90.485  1.00 28.36 ? 300  ASP B OD2   1 
ATOM   4711  N N     . VAL B 1 323 ? -23.880 -26.455 -89.382  1.00 17.93 ? 301  VAL B N     1 
ATOM   4712  C CA    . VAL B 1 323 ? -22.427 -26.296 -89.590  1.00 18.17 ? 301  VAL B CA    1 
ATOM   4713  C C     . VAL B 1 323 ? -22.031 -26.442 -91.053  1.00 18.95 ? 301  VAL B C     1 
ATOM   4714  O O     . VAL B 1 323 ? -20.955 -26.032 -91.447  1.00 19.58 ? 301  VAL B O     1 
ATOM   4715  C CB    . VAL B 1 323 ? -21.603 -27.321 -88.725  1.00 17.03 ? 301  VAL B CB    1 
ATOM   4716  C CG1   . VAL B 1 323 ? -21.563 -28.717 -89.365  1.00 19.93 ? 301  VAL B CG1   1 
ATOM   4717  C CG2   . VAL B 1 323 ? -20.189 -26.846 -88.467  1.00 15.73 ? 301  VAL B CG2   1 
ATOM   4718  N N     . GLU B 1 324 ? -22.897 -27.061 -91.847  1.00 20.61 ? 302  GLU B N     1 
ATOM   4719  C CA    . GLU B 1 324 ? -22.658 -27.213 -93.281  1.00 21.00 ? 302  GLU B CA    1 
ATOM   4720  C C     . GLU B 1 324 ? -22.226 -25.876 -93.878  1.00 20.18 ? 302  GLU B C     1 
ATOM   4721  O O     . GLU B 1 324 ? -21.173 -25.780 -94.510  1.00 18.29 ? 302  GLU B O     1 
ATOM   4722  C CB    . GLU B 1 324 ? -23.922 -27.742 -93.958  1.00 22.55 ? 302  GLU B CB    1 
ATOM   4723  C CG    . GLU B 1 324 ? -23.807 -28.016 -95.448  1.00 28.74 ? 302  GLU B CG    1 
ATOM   4724  C CD    . GLU B 1 324 ? -22.932 -29.205 -95.796  1.00 34.87 ? 302  GLU B CD    1 
ATOM   4725  O OE1   . GLU B 1 324 ? -22.370 -29.866 -94.888  1.00 37.61 ? 302  GLU B OE1   1 
ATOM   4726  O OE2   . GLU B 1 324 ? -22.805 -29.476 -97.010  1.00 40.60 ? 302  GLU B OE2   1 
ATOM   4727  N N     . ASN B 1 325 ? -23.022 -24.845 -93.612  1.00 20.19 ? 303  ASN B N     1 
ATOM   4728  C CA    . ASN B 1 325 ? -22.806 -23.514 -94.152  1.00 19.68 ? 303  ASN B CA    1 
ATOM   4729  C C     . ASN B 1 325 ? -21.438 -22.979 -93.778  1.00 18.02 ? 303  ASN B C     1 
ATOM   4730  O O     . ASN B 1 325 ? -20.719 -22.468 -94.628  1.00 18.24 ? 303  ASN B O     1 
ATOM   4731  C CB    . ASN B 1 325 ? -23.934 -22.596 -93.677  1.00 20.50 ? 303  ASN B CB    1 
ATOM   4732  C CG    . ASN B 1 325 ? -25.313 -23.285 -93.764  1.00 26.65 ? 303  ASN B CG    1 
ATOM   4733  O OD1   . ASN B 1 325 ? -25.594 -23.998 -94.734  1.00 27.28 ? 303  ASN B OD1   1 
ATOM   4734  N ND2   . ASN B 1 325 ? -26.149 -23.110 -92.730  1.00 30.36 ? 303  ASN B ND2   1 
ATOM   4735  N N     . THR B 1 326 ? -21.067 -23.135 -92.518  1.00 16.71 ? 304  THR B N     1 
ATOM   4736  C CA    . THR B 1 326 ? -19.747 -22.722 -92.025  1.00 15.60 ? 304  THR B CA    1 
ATOM   4737  C C     . THR B 1 326 ? -18.611 -23.464 -92.734  1.00 16.50 ? 304  THR B C     1 
ATOM   4738  O O     . THR B 1 326 ? -17.646 -22.852 -93.163  1.00 16.74 ? 304  THR B O     1 
ATOM   4739  C CB    . THR B 1 326 ? -19.670 -22.968 -90.486  1.00 16.40 ? 304  THR B CB    1 
ATOM   4740  O OG1   . THR B 1 326 ? -20.625 -22.125 -89.832  1.00 11.22 ? 304  THR B OG1   1 
ATOM   4741  C CG2   . THR B 1 326 ? -18.258 -22.718 -89.903  1.00 15.10 ? 304  THR B CG2   1 
ATOM   4742  N N     . ILE B 1 327 ? -18.733 -24.780 -92.848  1.00 17.60 ? 305  ILE B N     1 
ATOM   4743  C CA    . ILE B 1 327 ? -17.769 -25.593 -93.586  1.00 17.32 ? 305  ILE B CA    1 
ATOM   4744  C C     . ILE B 1 327 ? -17.573 -25.068 -95.002  1.00 18.23 ? 305  ILE B C     1 
ATOM   4745  O O     . ILE B 1 327 ? -16.432 -24.924 -95.472  1.00 19.05 ? 305  ILE B O     1 
ATOM   4746  C CB    . ILE B 1 327 ? -18.204 -27.077 -93.654  1.00 17.44 ? 305  ILE B CB    1 
ATOM   4747  C CG1   . ILE B 1 327 ? -17.991 -27.752 -92.304  1.00 15.36 ? 305  ILE B CG1   1 
ATOM   4748  C CG2   . ILE B 1 327 ? -17.415 -27.856 -94.738  1.00 17.32 ? 305  ILE B CG2   1 
ATOM   4749  C CD1   . ILE B 1 327 ? -18.515 -29.163 -92.248  1.00 13.74 ? 305  ILE B CD1   1 
ATOM   4750  N N     . LEU B 1 328 ? -18.683 -24.781 -95.674  1.00 18.50 ? 306  LEU B N     1 
ATOM   4751  C CA    . LEU B 1 328 ? -18.638 -24.304 -97.062  1.00 19.41 ? 306  LEU B CA    1 
ATOM   4752  C C     . LEU B 1 328 ? -17.918 -22.963 -97.168  1.00 19.47 ? 306  LEU B C     1 
ATOM   4753  O O     . LEU B 1 328 ? -17.192 -22.731 -98.128  1.00 18.99 ? 306  LEU B O     1 
ATOM   4754  C CB    . LEU B 1 328 ? -20.051 -24.209 -97.657  1.00 18.51 ? 306  LEU B CB    1 
ATOM   4755  C CG    . LEU B 1 328 ? -20.894 -25.494 -97.787  1.00 20.08 ? 306  LEU B CG    1 
ATOM   4756  C CD1   . LEU B 1 328 ? -22.279 -25.186 -98.330  1.00 19.01 ? 306  LEU B CD1   1 
ATOM   4757  C CD2   . LEU B 1 328 ? -20.228 -26.548 -98.659  1.00 18.94 ? 306  LEU B CD2   1 
ATOM   4758  N N     . ASP B 1 329 ? -18.107 -22.099 -96.172  1.00 19.94 ? 307  ASP B N     1 
ATOM   4759  C CA    . ASP B 1 329 ? -17.430 -20.800 -96.128  1.00 20.41 ? 307  ASP B CA    1 
ATOM   4760  C C     . ASP B 1 329 ? -15.922 -20.978 -95.898  1.00 18.84 ? 307  ASP B C     1 
ATOM   4761  O O     . ASP B 1 329 ? -15.096 -20.273 -96.500  1.00 19.31 ? 307  ASP B O     1 
ATOM   4762  C CB    . ASP B 1 329 ? -18.033 -19.873 -95.042  1.00 21.18 ? 307  ASP B CB    1 
ATOM   4763  C CG    . ASP B 1 329 ? -19.573 -19.684 -95.172  1.00 30.47 ? 307  ASP B CG    1 
ATOM   4764  O OD1   . ASP B 1 329 ? -20.117 -19.674 -96.308  1.00 39.82 ? 307  ASP B OD1   1 
ATOM   4765  O OD2   . ASP B 1 329 ? -20.255 -19.534 -94.122  1.00 37.80 ? 307  ASP B OD2   1 
ATOM   4766  N N     . ILE B 1 330 ? -15.561 -21.928 -95.042  1.00 17.28 ? 308  ILE B N     1 
ATOM   4767  C CA    . ILE B 1 330 ? -14.153 -22.180 -94.730  1.00 16.73 ? 308  ILE B CA    1 
ATOM   4768  C C     . ILE B 1 330 ? -13.406 -22.737 -95.946  1.00 16.57 ? 308  ILE B C     1 
ATOM   4769  O O     . ILE B 1 330 ? -12.375 -22.197 -96.353  1.00 16.43 ? 308  ILE B O     1 
ATOM   4770  C CB    . ILE B 1 330 ? -13.990 -23.166 -93.525  1.00 16.70 ? 308  ILE B CB    1 
ATOM   4771  C CG1   . ILE B 1 330 ? -14.626 -22.597 -92.254  1.00 13.78 ? 308  ILE B CG1   1 
ATOM   4772  C CG2   . ILE B 1 330 ? -12.485 -23.457 -93.265  1.00 19.26 ? 308  ILE B CG2   1 
ATOM   4773  C CD1   . ILE B 1 330 ? -14.520 -23.511 -91.055  1.00 14.05 ? 308  ILE B CD1   1 
ATOM   4774  N N     . LEU B 1 331 ? -13.950 -23.821 -96.504  1.00 17.09 ? 309  LEU B N     1 
ATOM   4775  C CA    . LEU B 1 331 ? -13.409 -24.478 -97.689  1.00 16.21 ? 309  LEU B CA    1 
ATOM   4776  C C     . LEU B 1 331 ? -13.410 -23.543 -98.886  1.00 15.39 ? 309  LEU B C     1 
ATOM   4777  O O     . LEU B 1 331 ? -12.413 -23.422 -99.599  1.00 15.52 ? 309  LEU B O     1 
ATOM   4778  C CB    . LEU B 1 331 ? -14.198 -25.762 -98.001  1.00 15.91 ? 309  LEU B CB    1 
ATOM   4779  C CG    . LEU B 1 331 ? -14.180 -26.863 -96.908  1.00 14.74 ? 309  LEU B CG    1 
ATOM   4780  C CD1   . LEU B 1 331 ? -14.681 -28.185 -97.449  1.00 11.49 ? 309  LEU B CD1   1 
ATOM   4781  C CD2   . LEU B 1 331 ? -12.824 -27.104 -96.308  1.00 13.09 ? 309  LEU B CD2   1 
ATOM   4782  N N     . GLY B 1 332 ? -14.521 -22.855 -99.087  1.00 14.92 ? 310  GLY B N     1 
ATOM   4783  C CA    . GLY B 1 332 ? -14.632 -21.894 -100.173 1.00 16.58 ? 310  GLY B CA    1 
ATOM   4784  C C     . GLY B 1 332 ? -13.581 -20.797 -100.135 1.00 17.89 ? 310  GLY B C     1 
ATOM   4785  O O     . GLY B 1 332 ? -12.973 -20.469 -101.168 1.00 19.36 ? 310  GLY B O     1 
ATOM   4786  N N     . GLY B 1 333 ? -13.367 -20.226 -98.950  1.00 18.40 ? 311  GLY B N     1 
ATOM   4787  C CA    . GLY B 1 333 ? -12.367 -19.175 -98.764  1.00 18.34 ? 311  GLY B CA    1 
ATOM   4788  C C     . GLY B 1 333 ? -10.938 -19.658 -98.935  1.00 17.90 ? 311  GLY B C     1 
ATOM   4789  O O     . GLY B 1 333 ? -10.063 -18.900 -99.330  1.00 18.30 ? 311  GLY B O     1 
ATOM   4790  N N     . LEU B 1 334 ? -10.701 -20.922 -98.607  1.00 17.79 ? 312  LEU B N     1 
ATOM   4791  C CA    . LEU B 1 334 ? -9.379  -21.505 -98.680  1.00 17.40 ? 312  LEU B CA    1 
ATOM   4792  C C     . LEU B 1 334 ? -9.077  -21.890 -100.140 1.00 16.62 ? 312  LEU B C     1 
ATOM   4793  O O     . LEU B 1 334 ? -7.940  -21.818 -100.602 1.00 15.69 ? 312  LEU B O     1 
ATOM   4794  C CB    . LEU B 1 334 ? -9.305  -22.690 -97.703  1.00 17.64 ? 312  LEU B CB    1 
ATOM   4795  C CG    . LEU B 1 334 ? -7.992  -23.482 -97.620  1.00 21.11 ? 312  LEU B CG    1 
ATOM   4796  C CD1   . LEU B 1 334 ? -6.829  -22.615 -97.084  1.00 22.64 ? 312  LEU B CD1   1 
ATOM   4797  C CD2   . LEU B 1 334 ? -8.186  -24.724 -96.780  1.00 19.52 ? 312  LEU B CD2   1 
ATOM   4798  N N     . ARG B 1 335 ? -10.109 -22.263 -100.876 1.00 15.90 ? 313  ARG B N     1 
ATOM   4799  C CA    . ARG B 1 335 ? -9.968  -22.491 -102.305 1.00 14.28 ? 313  ARG B CA    1 
ATOM   4800  C C     . ARG B 1 335 ? -9.607  -21.185 -102.992 1.00 12.64 ? 313  ARG B C     1 
ATOM   4801  O O     . ARG B 1 335 ? -8.714  -21.141 -103.845 1.00 13.43 ? 313  ARG B O     1 
ATOM   4802  C CB    . ARG B 1 335 ? -11.261 -23.093 -102.889 1.00 14.94 ? 313  ARG B CB    1 
ATOM   4803  C CG    . ARG B 1 335 ? -11.443 -24.571 -102.532 1.00 15.46 ? 313  ARG B CG    1 
ATOM   4804  C CD    . ARG B 1 335 ? -12.628 -25.246 -103.236 1.00 19.61 ? 313  ARG B CD    1 
ATOM   4805  N NE    . ARG B 1 335 ? -12.666 -26.665 -102.865 1.00 20.76 ? 313  ARG B NE    1 
ATOM   4806  C CZ    . ARG B 1 335 ? -13.493 -27.215 -101.973 1.00 24.56 ? 313  ARG B CZ    1 
ATOM   4807  N NH1   . ARG B 1 335 ? -14.432 -26.501 -101.349 1.00 24.73 ? 313  ARG B NH1   1 
ATOM   4808  N NH2   . ARG B 1 335 ? -13.393 -28.514 -101.708 1.00 27.30 ? 313  ARG B NH2   1 
ATOM   4809  N N     . SER B 1 336 ? -10.294 -20.117 -102.601 1.00 11.51 ? 314  SER B N     1 
ATOM   4810  C CA    . SER B 1 336 ? -10.052 -18.780 -103.149 1.00 10.20 ? 314  SER B CA    1 
ATOM   4811  C C     . SER B 1 336 ? -8.623  -18.297 -102.866 1.00 9.87  ? 314  SER B C     1 
ATOM   4812  O O     . SER B 1 336 ? -7.932  -17.838 -103.758 1.00 10.11 ? 314  SER B O     1 
ATOM   4813  C CB    . SER B 1 336 ? -11.097 -17.802 -102.582 1.00 11.30 ? 314  SER B CB    1 
ATOM   4814  O OG    . SER B 1 336 ? -12.436 -18.186 -102.917 1.00 11.81 ? 314  SER B OG    1 
ATOM   4815  N N     . THR B 1 337 ? -8.173  -18.442 -101.630 1.00 8.87  ? 315  THR B N     1 
ATOM   4816  C CA    . THR B 1 337 ? -6.784  -18.174 -101.277 1.00 10.65 ? 315  THR B CA    1 
ATOM   4817  C C     . THR B 1 337 ? -5.799  -18.903 -102.185 1.00 11.89 ? 315  THR B C     1 
ATOM   4818  O O     . THR B 1 337 ? -4.850  -18.311 -102.660 1.00 12.36 ? 315  THR B O     1 
ATOM   4819  C CB    . THR B 1 337 ? -6.455  -18.614 -99.840  1.00 10.74 ? 315  THR B CB    1 
ATOM   4820  O OG1   . THR B 1 337 ? -7.471  -18.149 -98.957  1.00 14.00 ? 315  THR B OG1   1 
ATOM   4821  C CG2   . THR B 1 337 ? -5.085  -18.058 -99.418  1.00 11.00 ? 315  THR B CG2   1 
ATOM   4822  N N     . CYS B 1 338 ? -6.008  -20.202 -102.370 1.00 13.80 ? 316  CYS B N     1 
ATOM   4823  C CA    . CYS B 1 338 ? -5.113  -21.011 -103.194 1.00 14.06 ? 316  CYS B CA    1 
ATOM   4824  C C     . CYS B 1 338 ? -5.115  -20.519 -104.628 1.00 14.24 ? 316  CYS B C     1 
ATOM   4825  O O     . CYS B 1 338 ? -4.061  -20.411 -105.249 1.00 14.40 ? 316  CYS B O     1 
ATOM   4826  C CB    . CYS B 1 338 ? -5.508  -22.484 -103.153 1.00 15.24 ? 316  CYS B CB    1 
ATOM   4827  S SG    . CYS B 1 338 ? -5.325  -23.218 -101.524 1.00 13.70 ? 316  CYS B SG    1 
ATOM   4828  N N     . THR B 1 339 ? -6.301  -20.212 -105.146 1.00 14.80 ? 317  THR B N     1 
ATOM   4829  C CA    . THR B 1 339 ? -6.428  -19.601 -106.472 1.00 15.12 ? 317  THR B CA    1 
ATOM   4830  C C     . THR B 1 339 ? -5.555  -18.348 -106.576 1.00 14.60 ? 317  THR B C     1 
ATOM   4831  O O     . THR B 1 339 ? -4.820  -18.167 -107.558 1.00 15.62 ? 317  THR B O     1 
ATOM   4832  C CB    . THR B 1 339 ? -7.902  -19.117 -106.763 1.00 15.11 ? 317  THR B CB    1 
ATOM   4833  O OG1   . THR B 1 339 ? -8.834  -20.199 -106.672 1.00 18.97 ? 317  THR B OG1   1 
ATOM   4834  C CG2   . THR B 1 339 ? -8.004  -18.545 -108.120 1.00 17.14 ? 317  THR B CG2   1 
ATOM   4835  N N     . TYR B 1 340 ? -5.654  -17.488 -105.563 1.00 13.49 ? 318  TYR B N     1 
ATOM   4836  C CA    . TYR B 1 340 ? -5.075  -16.157 -105.630 1.00 13.30 ? 318  TYR B CA    1 
ATOM   4837  C C     . TYR B 1 340 ? -3.559  -16.147 -105.474 1.00 14.77 ? 318  TYR B C     1 
ATOM   4838  O O     . TYR B 1 340 ? -2.908  -15.207 -105.918 1.00 15.39 ? 318  TYR B O     1 
ATOM   4839  C CB    . TYR B 1 340 ? -5.744  -15.207 -104.616 1.00 12.86 ? 318  TYR B CB    1 
ATOM   4840  C CG    . TYR B 1 340 ? -7.255  -15.046 -104.765 1.00 8.83  ? 318  TYR B CG    1 
ATOM   4841  C CD1   . TYR B 1 340 ? -7.883  -15.176 -105.989 1.00 10.82 ? 318  TYR B CD1   1 
ATOM   4842  C CD2   . TYR B 1 340 ? -8.045  -14.729 -103.672 1.00 12.56 ? 318  TYR B CD2   1 
ATOM   4843  C CE1   . TYR B 1 340 ? -9.265  -15.014 -106.110 1.00 13.08 ? 318  TYR B CE1   1 
ATOM   4844  C CE2   . TYR B 1 340 ? -9.419  -14.573 -103.780 1.00 8.76  ? 318  TYR B CE2   1 
ATOM   4845  C CZ    . TYR B 1 340 ? -10.021 -14.715 -104.992 1.00 9.82  ? 318  TYR B CZ    1 
ATOM   4846  O OH    . TYR B 1 340 ? -11.379 -14.554 -105.113 1.00 6.83  ? 318  TYR B OH    1 
ATOM   4847  N N     . VAL B 1 341 ? -3.009  -17.194 -104.866 1.00 16.48 ? 319  VAL B N     1 
ATOM   4848  C CA    . VAL B 1 341 ? -1.551  -17.362 -104.738 1.00 17.69 ? 319  VAL B CA    1 
ATOM   4849  C C     . VAL B 1 341 ? -0.966  -18.312 -105.780 1.00 17.79 ? 319  VAL B C     1 
ATOM   4850  O O     . VAL B 1 341 ? 0.253   -18.423 -105.900 1.00 17.94 ? 319  VAL B O     1 
ATOM   4851  C CB    . VAL B 1 341 ? -1.133  -17.864 -103.338 1.00 16.67 ? 319  VAL B CB    1 
ATOM   4852  C CG1   . VAL B 1 341 ? -1.586  -16.881 -102.275 1.00 19.98 ? 319  VAL B CG1   1 
ATOM   4853  C CG2   . VAL B 1 341 ? -1.675  -19.276 -103.050 1.00 18.94 ? 319  VAL B CG2   1 
ATOM   4854  N N     . GLY B 1 342 ? -1.843  -18.993 -106.515 1.00 18.82 ? 320  GLY B N     1 
ATOM   4855  C CA    . GLY B 1 342 ? -1.458  -19.874 -107.616 1.00 17.94 ? 320  GLY B CA    1 
ATOM   4856  C C     . GLY B 1 342 ? -1.292  -21.324 -107.237 1.00 18.53 ? 320  GLY B C     1 
ATOM   4857  O O     . GLY B 1 342 ? -0.569  -22.060 -107.899 1.00 19.12 ? 320  GLY B O     1 
ATOM   4858  N N     . ALA B 1 343 ? -1.969  -21.740 -106.170 1.00 18.00 ? 321  ALA B N     1 
ATOM   4859  C CA    . ALA B 1 343 ? -1.859  -23.087 -105.650 1.00 17.54 ? 321  ALA B CA    1 
ATOM   4860  C C     . ALA B 1 343 ? -3.075  -23.894 -106.122 1.00 19.05 ? 321  ALA B C     1 
ATOM   4861  O O     . ALA B 1 343 ? -4.215  -23.603 -105.745 1.00 18.86 ? 321  ALA B O     1 
ATOM   4862  C CB    . ALA B 1 343 ? -1.790  -23.042 -104.149 1.00 17.67 ? 321  ALA B CB    1 
ATOM   4863  N N     . ALA B 1 344 ? -2.837  -24.888 -106.975 1.00 20.67 ? 322  ALA B N     1 
ATOM   4864  C CA    . ALA B 1 344 ? -3.918  -25.731 -107.489 1.00 20.17 ? 322  ALA B CA    1 
ATOM   4865  C C     . ALA B 1 344 ? -4.308  -26.786 -106.463 1.00 19.94 ? 322  ALA B C     1 
ATOM   4866  O O     . ALA B 1 344 ? -5.396  -27.357 -106.549 1.00 19.50 ? 322  ALA B O     1 
ATOM   4867  C CB    . ALA B 1 344 ? -3.512  -26.384 -108.787 1.00 19.24 ? 322  ALA B CB    1 
ATOM   4868  N N     . LYS B 1 345 ? -3.400  -27.048 -105.522 1.00 19.78 ? 323  LYS B N     1 
ATOM   4869  C CA    . LYS B 1 345 ? -3.605  -28.014 -104.452 1.00 19.55 ? 323  LYS B CA    1 
ATOM   4870  C C     . LYS B 1 345 ? -3.236  -27.300 -103.169 1.00 19.14 ? 323  LYS B C     1 
ATOM   4871  O O     . LYS B 1 345 ? -2.303  -26.481 -103.166 1.00 18.91 ? 323  LYS B O     1 
ATOM   4872  C CB    . LYS B 1 345 ? -2.663  -29.219 -104.611 1.00 20.30 ? 323  LYS B CB    1 
ATOM   4873  C CG    . LYS B 1 345 ? -2.665  -29.954 -105.958 1.00 23.96 ? 323  LYS B CG    1 
ATOM   4874  C CD    . LYS B 1 345 ? -1.518  -31.006 -106.028 1.00 23.16 ? 323  LYS B CD    1 
ATOM   4875  N N     . LEU B 1 346 ? -3.929  -27.631 -102.080 1.00 18.61 ? 324  LEU B N     1 
ATOM   4876  C CA    . LEU B 1 346 ? -3.570  -27.145 -100.745 1.00 18.77 ? 324  LEU B CA    1 
ATOM   4877  C C     . LEU B 1 346 ? -2.112  -27.413 -100.376 1.00 19.20 ? 324  LEU B C     1 
ATOM   4878  O O     . LEU B 1 346 ? -1.486  -26.625 -99.654  1.00 21.05 ? 324  LEU B O     1 
ATOM   4879  C CB    . LEU B 1 346 ? -4.462  -27.792 -99.692  1.00 18.46 ? 324  LEU B CB    1 
ATOM   4880  C CG    . LEU B 1 346 ? -4.256  -27.287 -98.262  1.00 18.29 ? 324  LEU B CG    1 
ATOM   4881  C CD1   . LEU B 1 346 ? -4.423  -25.771 -98.168  1.00 15.29 ? 324  LEU B CD1   1 
ATOM   4882  C CD2   . LEU B 1 346 ? -5.230  -27.997 -97.312  1.00 26.66 ? 324  LEU B CD2   1 
ATOM   4883  N N     . LYS B 1 347 ? -1.599  -28.543 -100.845 1.00 19.78 ? 325  LYS B N     1 
ATOM   4884  C CA    . LYS B 1 347 ? -0.189  -28.903 -100.743 1.00 20.40 ? 325  LYS B CA    1 
ATOM   4885  C C     . LYS B 1 347 ? 0.712   -27.733 -101.139 1.00 19.81 ? 325  LYS B C     1 
ATOM   4886  O O     . LYS B 1 347 ? 1.663   -27.428 -100.439 1.00 22.15 ? 325  LYS B O     1 
ATOM   4887  C CB    . LYS B 1 347 ? 0.063   -30.155 -101.614 1.00 20.14 ? 325  LYS B CB    1 
ATOM   4888  C CG    . LYS B 1 347 ? 1.373   -30.894 -101.350 1.00 25.31 ? 325  LYS B CG    1 
ATOM   4889  C CD    . LYS B 1 347 ? 2.342   -30.850 -102.533 1.00 26.11 ? 325  LYS B CD    1 
ATOM   4890  N N     . GLU B 1 348 ? 0.363   -27.044 -102.221 1.00 20.27 ? 326  GLU B N     1 
ATOM   4891  C CA    . GLU B 1 348 ? 1.194   -25.981 -102.807 1.00 20.39 ? 326  GLU B CA    1 
ATOM   4892  C C     . GLU B 1 348 ? 1.124   -24.616 -102.092 1.00 19.51 ? 326  GLU B C     1 
ATOM   4893  O O     . GLU B 1 348 ? 1.896   -23.711 -102.407 1.00 19.39 ? 326  GLU B O     1 
ATOM   4894  C CB    . GLU B 1 348 ? 0.815   -25.798 -104.289 1.00 20.46 ? 326  GLU B CB    1 
ATOM   4895  C CG    . GLU B 1 348 ? 1.024   -27.051 -105.155 1.00 23.32 ? 326  GLU B CG    1 
ATOM   4896  C CD    . GLU B 1 348 ? 0.596   -26.869 -106.614 1.00 34.86 ? 326  GLU B CD    1 
ATOM   4897  O OE1   . GLU B 1 348 ? 0.106   -25.777 -106.979 1.00 38.04 ? 326  GLU B OE1   1 
ATOM   4898  O OE2   . GLU B 1 348 ? 0.760   -27.825 -107.413 1.00 42.26 ? 326  GLU B OE2   1 
ATOM   4899  N N     . LEU B 1 349 ? 0.224   -24.476 -101.129 1.00 19.19 ? 327  LEU B N     1 
ATOM   4900  C CA    . LEU B 1 349 ? -0.037  -23.189 -100.503 1.00 18.73 ? 327  LEU B CA    1 
ATOM   4901  C C     . LEU B 1 349 ? 1.206   -22.608 -99.833  1.00 19.96 ? 327  LEU B C     1 
ATOM   4902  O O     . LEU B 1 349 ? 1.606   -21.496 -100.155 1.00 20.05 ? 327  LEU B O     1 
ATOM   4903  C CB    . LEU B 1 349 ? -1.193  -23.315 -99.499  1.00 18.68 ? 327  LEU B CB    1 
ATOM   4904  C CG    . LEU B 1 349 ? -1.744  -22.060 -98.819  1.00 18.00 ? 327  LEU B CG    1 
ATOM   4905  C CD1   . LEU B 1 349 ? -1.809  -20.888 -99.747  1.00 16.21 ? 327  LEU B CD1   1 
ATOM   4906  C CD2   . LEU B 1 349 ? -3.114  -22.336 -98.279  1.00 17.70 ? 327  LEU B CD2   1 
ATOM   4907  N N     . SER B 1 350 ? 1.821   -23.360 -98.920  1.00 21.24 ? 328  SER B N     1 
ATOM   4908  C CA    . SER B 1 350 ? 2.964   -22.840 -98.149  1.00 23.13 ? 328  SER B CA    1 
ATOM   4909  C C     . SER B 1 350 ? 4.095   -22.467 -99.071  1.00 23.60 ? 328  SER B C     1 
ATOM   4910  O O     . SER B 1 350 ? 4.714   -21.425 -98.894  1.00 26.17 ? 328  SER B O     1 
ATOM   4911  C CB    . SER B 1 350 ? 3.463   -23.848 -97.098  1.00 24.17 ? 328  SER B CB    1 
ATOM   4912  O OG    . SER B 1 350 ? 3.902   -25.065 -97.685  1.00 27.91 ? 328  SER B OG    1 
ATOM   4913  N N     . ARG B 1 351 ? 4.323   -23.328 -100.061 1.00 24.07 ? 329  ARG B N     1 
ATOM   4914  C CA    . ARG B 1 351 ? 5.317   -23.132 -101.120 1.00 23.72 ? 329  ARG B CA    1 
ATOM   4915  C C     . ARG B 1 351 ? 5.091   -21.802 -101.859 1.00 21.87 ? 329  ARG B C     1 
ATOM   4916  O O     . ARG B 1 351 ? 6.044   -21.131 -102.241 1.00 21.34 ? 329  ARG B O     1 
ATOM   4917  C CB    . ARG B 1 351 ? 5.263   -24.326 -102.102 1.00 22.99 ? 329  ARG B CB    1 
ATOM   4918  C CG    . ARG B 1 351 ? 5.045   -25.727 -101.416 1.00 27.38 ? 329  ARG B CG    1 
ATOM   4919  C CD    . ARG B 1 351 ? 5.306   -26.933 -102.355 1.00 26.88 ? 329  ARG B CD    1 
ATOM   4920  N N     . ARG B 1 352 ? 3.824   -21.422 -102.019 1.00 20.26 ? 330  ARG B N     1 
ATOM   4921  C CA    . ARG B 1 352 ? 3.435   -20.205 -102.735 1.00 19.26 ? 330  ARG B CA    1 
ATOM   4922  C C     . ARG B 1 352 ? 2.983   -19.055 -101.827 1.00 18.58 ? 330  ARG B C     1 
ATOM   4923  O O     . ARG B 1 352 ? 2.619   -17.982 -102.314 1.00 18.01 ? 330  ARG B O     1 
ATOM   4924  C CB    . ARG B 1 352 ? 2.322   -20.545 -103.740 1.00 19.74 ? 330  ARG B CB    1 
ATOM   4925  C CG    . ARG B 1 352 ? 2.789   -21.414 -104.909 1.00 24.34 ? 330  ARG B CG    1 
ATOM   4926  C CD    . ARG B 1 352 ? 1.632   -22.140 -105.589 1.00 29.16 ? 330  ARG B CD    1 
ATOM   4927  N NE    . ARG B 1 352 ? 2.094   -23.130 -106.567 1.00 32.51 ? 330  ARG B NE    1 
ATOM   4928  C CZ    . ARG B 1 352 ? 2.493   -22.851 -107.809 1.00 36.17 ? 330  ARG B CZ    1 
ATOM   4929  N NH1   . ARG B 1 352 ? 2.515   -21.600 -108.267 1.00 37.77 ? 330  ARG B NH1   1 
ATOM   4930  N NH2   . ARG B 1 352 ? 2.886   -23.834 -108.602 1.00 35.71 ? 330  ARG B NH2   1 
ATOM   4931  N N     . ALA B 1 353 ? 3.015   -19.277 -100.518 1.00 19.38 ? 331  ALA B N     1 
ATOM   4932  C CA    . ALA B 1 353 ? 2.672   -18.248 -99.534  1.00 18.99 ? 331  ALA B CA    1 
ATOM   4933  C C     . ALA B 1 353 ? 3.820   -17.278 -99.349  1.00 20.26 ? 331  ALA B C     1 
ATOM   4934  O O     . ALA B 1 353 ? 4.916   -17.684 -98.940  1.00 19.95 ? 331  ALA B O     1 
ATOM   4935  C CB    . ALA B 1 353 ? 2.341   -18.873 -98.206  1.00 19.23 ? 331  ALA B CB    1 
ATOM   4936  N N     . THR B 1 354 ? 3.567   -16.009 -99.679  1.00 21.11 ? 332  THR B N     1 
ATOM   4937  C CA    . THR B 1 354 ? 4.425   -14.900 -99.256  1.00 21.10 ? 332  THR B CA    1 
ATOM   4938  C C     . THR B 1 354 ? 3.551   -13.982 -98.425  1.00 20.55 ? 332  THR B C     1 
ATOM   4939  O O     . THR B 1 354 ? 2.493   -13.564 -98.877  1.00 20.69 ? 332  THR B O     1 
ATOM   4940  C CB    . THR B 1 354 ? 5.054   -14.105 -100.436 1.00 21.77 ? 332  THR B CB    1 
ATOM   4941  O OG1   . THR B 1 354 ? 5.988   -14.925 -101.155 1.00 21.64 ? 332  THR B OG1   1 
ATOM   4942  C CG2   . THR B 1 354 ? 5.794   -12.851 -99.932  1.00 24.75 ? 332  THR B CG2   1 
ATOM   4943  N N     . PHE B 1 355 ? 3.995   -13.688 -97.205  1.00 20.39 ? 333  PHE B N     1 
ATOM   4944  C CA    . PHE B 1 355 ? 3.279   -12.779 -96.321  1.00 18.64 ? 333  PHE B CA    1 
ATOM   4945  C C     . PHE B 1 355 ? 3.849   -11.385 -96.431  1.00 18.73 ? 333  PHE B C     1 
ATOM   4946  O O     . PHE B 1 355 ? 5.062   -11.187 -96.630  1.00 16.09 ? 333  PHE B O     1 
ATOM   4947  C CB    . PHE B 1 355 ? 3.370   -13.217 -94.856  1.00 17.97 ? 333  PHE B CB    1 
ATOM   4948  C CG    . PHE B 1 355 ? 2.798   -14.561 -94.593  1.00 17.46 ? 333  PHE B CG    1 
ATOM   4949  C CD1   . PHE B 1 355 ? 1.434   -14.721 -94.395  1.00 14.22 ? 333  PHE B CD1   1 
ATOM   4950  C CD2   . PHE B 1 355 ? 3.611   -15.675 -94.559  1.00 18.55 ? 333  PHE B CD2   1 
ATOM   4951  C CE1   . PHE B 1 355 ? 0.893   -15.965 -94.170  1.00 13.23 ? 333  PHE B CE1   1 
ATOM   4952  C CE2   . PHE B 1 355 ? 3.072   -16.920 -94.328  1.00 19.46 ? 333  PHE B CE2   1 
ATOM   4953  C CZ    . PHE B 1 355 ? 1.707   -17.064 -94.123  1.00 15.29 ? 333  PHE B CZ    1 
ATOM   4954  N N     . ILE B 1 356 ? 2.961   -10.412 -96.284  1.00 19.95 ? 334  ILE B N     1 
ATOM   4955  C CA    . ILE B 1 356 ? 3.379   -9.034  -96.091  1.00 20.72 ? 334  ILE B CA    1 
ATOM   4956  C C     . ILE B 1 356 ? 2.919   -8.593  -94.695  1.00 20.92 ? 334  ILE B C     1 
ATOM   4957  O O     . ILE B 1 356 ? 1.868   -9.024  -94.217  1.00 18.51 ? 334  ILE B O     1 
ATOM   4958  C CB    . ILE B 1 356 ? 2.856   -8.111  -97.195  1.00 20.87 ? 334  ILE B CB    1 
ATOM   4959  C CG1   . ILE B 1 356 ? 1.360   -8.345  -97.435  1.00 22.07 ? 334  ILE B CG1   1 
ATOM   4960  C CG2   . ILE B 1 356 ? 3.644   -8.350  -98.478  1.00 20.92 ? 334  ILE B CG2   1 
ATOM   4961  C CD1   . ILE B 1 356 ? 0.643   -7.119  -97.873  1.00 21.56 ? 334  ILE B CD1   1 
ATOM   4962  N N     . ARG B 1 357 ? 3.744   -7.770  -94.043  1.00 23.12 ? 335  ARG B N     1 
ATOM   4963  C CA    . ARG B 1 357 ? 3.434   -7.242  -92.715  1.00 23.45 ? 335  ARG B CA    1 
ATOM   4964  C C     . ARG B 1 357 ? 2.522   -6.062  -92.950  1.00 21.86 ? 335  ARG B C     1 
ATOM   4965  O O     . ARG B 1 357 ? 2.753   -5.278  -93.847  1.00 18.67 ? 335  ARG B O     1 
ATOM   4966  C CB    . ARG B 1 357 ? 4.698   -6.797  -91.960  1.00 24.90 ? 335  ARG B CB    1 
ATOM   4967  C CG    . ARG B 1 357 ? 5.817   -7.848  -91.873  1.00 30.96 ? 335  ARG B CG    1 
ATOM   4968  C CD    . ARG B 1 357 ? 7.148   -7.285  -91.331  1.00 34.25 ? 335  ARG B CD    1 
ATOM   4969  N NE    . ARG B 1 357 ? 8.028   -8.372  -90.896  1.00 41.84 ? 335  ARG B NE    1 
ATOM   4970  C CZ    . ARG B 1 357 ? 8.257   -8.741  -89.626  1.00 48.89 ? 335  ARG B CZ    1 
ATOM   4971  N NH1   . ARG B 1 357 ? 7.708   -8.099  -88.592  1.00 50.82 ? 335  ARG B NH1   1 
ATOM   4972  N NH2   . ARG B 1 357 ? 9.063   -9.770  -89.377  1.00 49.45 ? 335  ARG B NH2   1 
ATOM   4973  N N     . VAL B 1 358 ? 1.464   -5.966  -92.162  1.00 23.29 ? 336  VAL B N     1 
ATOM   4974  C CA    . VAL B 1 358 ? 0.506   -4.889  -92.274  1.00 25.06 ? 336  VAL B CA    1 
ATOM   4975  C C     . VAL B 1 358 ? 0.342   -4.187  -90.931  1.00 27.62 ? 336  VAL B C     1 
ATOM   4976  O O     . VAL B 1 358 ? 0.878   -4.613  -89.911  1.00 28.45 ? 336  VAL B O     1 
ATOM   4977  C CB    . VAL B 1 358 ? -0.866  -5.457  -92.727  1.00 25.42 ? 336  VAL B CB    1 
ATOM   4978  C CG1   . VAL B 1 358 ? -0.772  -6.077  -94.115  1.00 24.78 ? 336  VAL B CG1   1 
ATOM   4979  C CG2   . VAL B 1 358 ? -1.387  -6.506  -91.745  1.00 24.85 ? 336  VAL B CG2   1 
ATOM   4980  N N     . THR B 1 359 ? -0.428  -3.112  -90.955  1.00 29.74 ? 337  THR B N     1 
ATOM   4981  C CA    . THR B 1 359 ? -0.754  -2.323  -89.790  1.00 30.42 ? 337  THR B CA    1 
ATOM   4982  C C     . THR B 1 359 ? -2.244  -2.482  -89.444  1.00 30.88 ? 337  THR B C     1 
ATOM   4983  O O     . THR B 1 359 ? -2.644  -2.319  -88.292  1.00 31.61 ? 337  THR B O     1 
ATOM   4984  C CB    . THR B 1 359 ? -0.409  -0.869  -90.129  1.00 31.41 ? 337  THR B CB    1 
ATOM   4985  O OG1   . THR B 1 359 ? -0.520  -0.694  -91.556  1.00 32.64 ? 337  THR B OG1   1 
ATOM   4986  C CG2   . THR B 1 359 ? 1.018   -0.559  -89.733  1.00 29.97 ? 337  THR B CG2   1 
ATOM   4987  N N     . PRO C 1 24  ? 6.893   10.361  -105.044 1.00 65.32 ? 2    PRO C N     1 
ATOM   4988  C CA    . PRO C 1 24  ? 6.108   9.996   -103.863 1.00 63.67 ? 2    PRO C CA    1 
ATOM   4989  C C     . PRO C 1 24  ? 6.910   9.207   -102.789 1.00 60.21 ? 2    PRO C C     1 
ATOM   4990  O O     . PRO C 1 24  ? 6.757   7.986   -102.637 1.00 61.65 ? 2    PRO C O     1 
ATOM   4991  C CB    . PRO C 1 24  ? 4.965   9.162   -104.459 1.00 64.11 ? 2    PRO C CB    1 
ATOM   4992  C CG    . PRO C 1 24  ? 4.794   9.687   -105.851 1.00 64.69 ? 2    PRO C CG    1 
ATOM   4993  C CD    . PRO C 1 24  ? 6.149   10.165  -106.303 1.00 65.53 ? 2    PRO C CD    1 
ATOM   4994  N N     . ARG C 1 25  ? 7.740   9.932   -102.041 1.00 54.49 ? 3    ARG C N     1 
ATOM   4995  C CA    . ARG C 1 25  ? 8.637   9.346   -101.027 1.00 51.55 ? 3    ARG C CA    1 
ATOM   4996  C C     . ARG C 1 25  ? 7.963   9.236   -99.645  1.00 51.42 ? 3    ARG C C     1 
ATOM   4997  O O     . ARG C 1 25  ? 7.170   10.103  -99.253  1.00 50.99 ? 3    ARG C O     1 
ATOM   4998  C CB    . ARG C 1 25  ? 9.952   10.159  -100.909 1.00 51.28 ? 3    ARG C CB    1 
ATOM   4999  C CG    . ARG C 1 25  ? 9.781   11.672  -100.624 1.00 49.62 ? 3    ARG C CG    1 
ATOM   5000  C CD    . ARG C 1 25  ? 11.108  12.350  -100.288 1.00 49.38 ? 3    ARG C CD    1 
ATOM   5001  N N     . ILE C 1 26  ? 8.283   8.151   -98.934  1.00 52.54 ? 4    ILE C N     1 
ATOM   5002  C CA    . ILE C 1 26  ? 7.906   7.989   -97.534  1.00 52.58 ? 4    ILE C CA    1 
ATOM   5003  C C     . ILE C 1 26  ? 9.133   8.298   -96.690  1.00 52.60 ? 4    ILE C C     1 
ATOM   5004  O O     . ILE C 1 26  ? 10.211  7.738   -96.916  1.00 51.92 ? 4    ILE C O     1 
ATOM   5005  C CB    . ILE C 1 26  ? 7.394   6.560   -97.200  1.00 52.80 ? 4    ILE C CB    1 
ATOM   5006  C CG1   . ILE C 1 26  ? 6.173   6.218   -98.059  1.00 51.68 ? 4    ILE C CG1   1 
ATOM   5007  C CG2   . ILE C 1 26  ? 7.043   6.451   -95.699  1.00 52.07 ? 4    ILE C CG2   1 
ATOM   5008  C CD1   . ILE C 1 26  ? 5.691   4.781   -97.929  1.00 50.90 ? 4    ILE C CD1   1 
ATOM   5009  N N     . ASP C 1 27  ? 8.961   9.198   -95.725  1.00 53.09 ? 5    ASP C N     1 
ATOM   5010  C CA    . ASP C 1 27  ? 10.013  9.503   -94.758  1.00 52.44 ? 5    ASP C CA    1 
ATOM   5011  C C     . ASP C 1 27  ? 10.195  8.281   -93.831  1.00 50.04 ? 5    ASP C C     1 
ATOM   5012  O O     . ASP C 1 27  ? 9.229   7.762   -93.230  1.00 47.31 ? 5    ASP C O     1 
ATOM   5013  C CB    . ASP C 1 27  ? 9.698   10.788  -93.976  1.00 53.39 ? 5    ASP C CB    1 
ATOM   5014  C CG    . ASP C 1 27  ? 10.879  11.283  -93.142  1.00 55.54 ? 5    ASP C CG    1 
ATOM   5015  O OD1   . ASP C 1 27  ? 11.617  10.439  -92.587  1.00 57.51 ? 5    ASP C OD1   1 
ATOM   5016  O OD2   . ASP C 1 27  ? 11.055  12.521  -93.029  1.00 53.89 ? 5    ASP C OD2   1 
ATOM   5017  N N     . ALA C 1 28  ? 11.446  7.819   -93.770  1.00 48.97 ? 6    ALA C N     1 
ATOM   5018  C CA    . ALA C 1 28  ? 11.843  6.633   -92.988  1.00 48.81 ? 6    ALA C CA    1 
ATOM   5019  C C     . ALA C 1 28  ? 11.655  6.837   -91.471  1.00 47.63 ? 6    ALA C C     1 
ATOM   5020  O O     . ALA C 1 28  ? 11.247  5.909   -90.749  1.00 46.31 ? 6    ALA C O     1 
ATOM   5021  C CB    . ALA C 1 28  ? 13.310  6.263   -93.303  1.00 49.07 ? 6    ALA C CB    1 
ATOM   5022  N N     . ASP C 1 29  ? 11.970  8.054   -91.018  1.00 45.75 ? 7    ASP C N     1 
ATOM   5023  C CA    . ASP C 1 29  ? 11.766  8.499   -89.643  1.00 43.95 ? 7    ASP C CA    1 
ATOM   5024  C C     . ASP C 1 29  ? 10.269  8.468   -89.245  1.00 40.14 ? 7    ASP C C     1 
ATOM   5025  O O     . ASP C 1 29  ? 9.428   9.103   -89.875  1.00 40.52 ? 7    ASP C O     1 
ATOM   5026  C CB    . ASP C 1 29  ? 12.358  9.925   -89.514  1.00 44.26 ? 7    ASP C CB    1 
ATOM   5027  C CG    . ASP C 1 29  ? 12.297  10.497  -88.093  1.00 49.50 ? 7    ASP C CG    1 
ATOM   5028  O OD1   . ASP C 1 29  ? 12.014  9.757   -87.120  1.00 57.51 ? 7    ASP C OD1   1 
ATOM   5029  O OD2   . ASP C 1 29  ? 12.547  11.717  -87.953  1.00 50.37 ? 7    ASP C OD2   1 
ATOM   5030  N N     . LEU C 1 30  ? 9.951   7.698   -88.211  1.00 36.12 ? 8    LEU C N     1 
ATOM   5031  C CA    . LEU C 1 30  ? 8.639   7.741   -87.597  1.00 32.93 ? 8    LEU C CA    1 
ATOM   5032  C C     . LEU C 1 30  ? 8.493   9.046   -86.822  1.00 30.65 ? 8    LEU C C     1 
ATOM   5033  O O     . LEU C 1 30  ? 9.380   9.443   -86.068  1.00 31.99 ? 8    LEU C O     1 
ATOM   5034  C CB    . LEU C 1 30  ? 8.473   6.583   -86.623  1.00 32.16 ? 8    LEU C CB    1 
ATOM   5035  C CG    . LEU C 1 30  ? 7.058   6.417   -86.103  1.00 31.79 ? 8    LEU C CG    1 
ATOM   5036  C CD1   . LEU C 1 30  ? 6.153   6.002   -87.229  1.00 26.91 ? 8    LEU C CD1   1 
ATOM   5037  C CD2   . LEU C 1 30  ? 7.033   5.401   -84.976  1.00 34.19 ? 8    LEU C CD2   1 
ATOM   5038  N N     . LYS C 1 31  ? 7.365   9.709   -87.000  1.00 26.92 ? 9    LYS C N     1 
ATOM   5039  C CA    . LYS C 1 31  ? 7.106   10.940  -86.290  1.00 23.74 ? 9    LYS C CA    1 
ATOM   5040  C C     . LYS C 1 31  ? 6.152   10.646  -85.119  1.00 22.84 ? 9    LYS C C     1 
ATOM   5041  O O     . LYS C 1 31  ? 5.083   10.029  -85.278  1.00 19.69 ? 9    LYS C O     1 
ATOM   5042  C CB    . LYS C 1 31  ? 6.524   11.984  -87.250  1.00 22.65 ? 9    LYS C CB    1 
ATOM   5043  C CG    . LYS C 1 31  ? 7.349   12.234  -88.507  1.00 22.58 ? 9    LYS C CG    1 
ATOM   5044  C CD    . LYS C 1 31  ? 8.709   12.837  -88.179  1.00 24.99 ? 9    LYS C CD    1 
ATOM   5045  C CE    . LYS C 1 31  ? 9.587   12.986  -89.425  1.00 24.85 ? 9    LYS C CE    1 
ATOM   5046  N NZ    . LYS C 1 31  ? 10.925  13.577  -89.097  1.00 24.85 ? 9    LYS C NZ    1 
ATOM   5047  N N     . LEU C 1 32  ? 6.555   11.107  -83.938  1.00 24.16 ? 10   LEU C N     1 
ATOM   5048  C CA    . LEU C 1 32  ? 5.844   10.813  -82.689  1.00 23.14 ? 10   LEU C CA    1 
ATOM   5049  C C     . LEU C 1 32  ? 4.967   11.968  -82.221  1.00 20.61 ? 10   LEU C C     1 
ATOM   5050  O O     . LEU C 1 32  ? 5.283   13.114  -82.447  1.00 20.16 ? 10   LEU C O     1 
ATOM   5051  C CB    . LEU C 1 32  ? 6.874   10.496  -81.622  1.00 23.36 ? 10   LEU C CB    1 
ATOM   5052  C CG    . LEU C 1 32  ? 7.913   9.475   -82.099  1.00 26.38 ? 10   LEU C CG    1 
ATOM   5053  C CD1   . LEU C 1 32  ? 9.200   9.587   -81.298  1.00 27.98 ? 10   LEU C CD1   1 
ATOM   5054  C CD2   . LEU C 1 32  ? 7.308   8.068   -82.036  1.00 24.88 ? 10   LEU C CD2   1 
ATOM   5055  N N     . ASP C 1 33  ? 3.845   11.648  -81.596  1.00 20.89 ? 11   ASP C N     1 
ATOM   5056  C CA    . ASP C 1 33  ? 3.050   12.646  -80.885  1.00 23.67 ? 11   ASP C CA    1 
ATOM   5057  C C     . ASP C 1 33  ? 3.281   12.477  -79.358  1.00 23.30 ? 11   ASP C C     1 
ATOM   5058  O O     . ASP C 1 33  ? 4.201   11.764  -78.917  1.00 24.19 ? 11   ASP C O     1 
ATOM   5059  C CB    . ASP C 1 33  ? 1.555   12.565  -81.278  1.00 24.21 ? 11   ASP C CB    1 
ATOM   5060  C CG    . ASP C 1 33  ? 0.886   13.979  -81.408  1.00 31.51 ? 11   ASP C CG    1 
ATOM   5061  O OD1   . ASP C 1 33  ? 0.883   14.774  -80.428  1.00 29.84 ? 11   ASP C OD1   1 
ATOM   5062  O OD2   . ASP C 1 33  ? 0.348   14.293  -82.497  1.00 30.12 ? 11   ASP C OD2   1 
ATOM   5063  N N     . PHE C 1 34  ? 2.472   13.147  -78.557  1.00 21.87 ? 12   PHE C N     1 
ATOM   5064  C CA    . PHE C 1 34  ? 2.714   13.193  -77.139  1.00 20.33 ? 12   PHE C CA    1 
ATOM   5065  C C     . PHE C 1 34  ? 2.476   11.852  -76.476  1.00 18.91 ? 12   PHE C C     1 
ATOM   5066  O O     . PHE C 1 34  ? 3.146   11.516  -75.509  1.00 18.81 ? 12   PHE C O     1 
ATOM   5067  C CB    . PHE C 1 34  ? 1.826   14.273  -76.495  1.00 20.20 ? 12   PHE C CB    1 
ATOM   5068  C CG    . PHE C 1 34  ? 2.124   15.677  -76.955  1.00 19.38 ? 12   PHE C CG    1 
ATOM   5069  C CD1   . PHE C 1 34  ? 3.464   16.134  -77.083  1.00 18.51 ? 12   PHE C CD1   1 
ATOM   5070  C CD2   . PHE C 1 34  ? 1.077   16.554  -77.238  1.00 12.78 ? 12   PHE C CD2   1 
ATOM   5071  C CE1   . PHE C 1 34  ? 3.747   17.421  -77.497  1.00 14.82 ? 12   PHE C CE1   1 
ATOM   5072  C CE2   . PHE C 1 34  ? 1.352   17.867  -77.638  1.00 15.29 ? 12   PHE C CE2   1 
ATOM   5073  C CZ    . PHE C 1 34  ? 2.698   18.302  -77.775  1.00 18.24 ? 12   PHE C CZ    1 
ATOM   5074  N N     . LYS C 1 35  ? 1.515   11.105  -77.006  1.00 19.13 ? 13   LYS C N     1 
ATOM   5075  C CA    . LYS C 1 35  ? 1.072   9.838   -76.407  1.00 19.44 ? 13   LYS C CA    1 
ATOM   5076  C C     . LYS C 1 35  ? 2.128   8.753   -76.615  1.00 18.25 ? 13   LYS C C     1 
ATOM   5077  O O     . LYS C 1 35  ? 2.141   7.727   -75.938  1.00 19.56 ? 13   LYS C O     1 
ATOM   5078  C CB    . LYS C 1 35  ? -0.326  9.430   -76.933  1.00 18.85 ? 13   LYS C CB    1 
ATOM   5079  C CG    . LYS C 1 35  ? -0.348  8.366   -78.028  1.00 24.62 ? 13   LYS C CG    1 
ATOM   5080  C CD    . LYS C 1 35  ? -0.667  8.890   -79.439  1.00 25.09 ? 13   LYS C CD    1 
ATOM   5081  C CE    . LYS C 1 35  ? -0.192  7.905   -80.525  1.00 16.88 ? 13   LYS C CE    1 
ATOM   5082  N NZ    . LYS C 1 35  ? -0.134  6.507   -79.999  1.00 7.59  ? 13   LYS C NZ    1 
ATOM   5083  N N     . ASP C 1 36  ? 3.025   8.998   -77.554  1.00 16.55 ? 14   ASP C N     1 
ATOM   5084  C CA    . ASP C 1 36  ? 4.077   8.068   -77.878  1.00 15.50 ? 14   ASP C CA    1 
ATOM   5085  C C     . ASP C 1 36  ? 5.259   8.138   -76.934  1.00 14.59 ? 14   ASP C C     1 
ATOM   5086  O O     . ASP C 1 36  ? 6.150   7.286   -76.993  1.00 16.01 ? 14   ASP C O     1 
ATOM   5087  C CB    . ASP C 1 36  ? 4.595   8.406   -79.281  1.00 15.99 ? 14   ASP C CB    1 
ATOM   5088  C CG    . ASP C 1 36  ? 3.607   8.079   -80.365  1.00 13.85 ? 14   ASP C CG    1 
ATOM   5089  O OD1   . ASP C 1 36  ? 3.185   6.912   -80.428  1.00 12.61 ? 14   ASP C OD1   1 
ATOM   5090  O OD2   . ASP C 1 36  ? 3.278   8.975   -81.165  1.00 11.59 ? 14   ASP C OD2   1 
ATOM   5091  N N     . VAL C 1 37  ? 5.316   9.169   -76.104  1.00 14.64 ? 15   VAL C N     1 
ATOM   5092  C CA    . VAL C 1 37  ? 6.460   9.364   -75.223  1.00 14.02 ? 15   VAL C CA    1 
ATOM   5093  C C     . VAL C 1 37  ? 6.084   9.641   -73.767  1.00 13.37 ? 15   VAL C C     1 
ATOM   5094  O O     . VAL C 1 37  ? 4.907   9.919   -73.431  1.00 13.70 ? 15   VAL C O     1 
ATOM   5095  C CB    . VAL C 1 37  ? 7.370   10.512  -75.725  1.00 14.08 ? 15   VAL C CB    1 
ATOM   5096  C CG1   . VAL C 1 37  ? 8.050   10.124  -77.023  1.00 15.98 ? 15   VAL C CG1   1 
ATOM   5097  C CG2   . VAL C 1 37  ? 6.587   11.809  -75.883  1.00 13.79 ? 15   VAL C CG2   1 
ATOM   5098  N N     . LEU C 1 38  ? 7.096   9.504   -72.912  1.00 12.23 ? 16   LEU C N     1 
ATOM   5099  C CA    . LEU C 1 38  ? 7.033   9.964   -71.547  1.00 11.44 ? 16   LEU C CA    1 
ATOM   5100  C C     . LEU C 1 38  ? 8.324   10.647  -71.208  1.00 12.29 ? 16   LEU C C     1 
ATOM   5101  O O     . LEU C 1 38  ? 9.364   10.349  -71.795  1.00 12.10 ? 16   LEU C O     1 
ATOM   5102  C CB    . LEU C 1 38  ? 6.843   8.795   -70.594  1.00 10.54 ? 16   LEU C CB    1 
ATOM   5103  C CG    . LEU C 1 38  ? 5.438   8.221   -70.535  1.00 13.15 ? 16   LEU C CG    1 
ATOM   5104  C CD1   . LEU C 1 38  ? 5.440   7.052   -69.596  1.00 15.39 ? 16   LEU C CD1   1 
ATOM   5105  C CD2   . LEU C 1 38  ? 4.420   9.288   -70.114  1.00 7.36  ? 16   LEU C CD2   1 
ATOM   5106  N N     . LEU C 1 39  ? 8.271   11.537  -70.225  1.00 12.66 ? 17   LEU C N     1 
ATOM   5107  C CA    . LEU C 1 39  ? 9.480   12.119  -69.693  1.00 13.47 ? 17   LEU C CA    1 
ATOM   5108  C C     . LEU C 1 39  ? 10.048  11.246  -68.574  1.00 14.90 ? 17   LEU C C     1 
ATOM   5109  O O     . LEU C 1 39  ? 9.306   10.769  -67.695  1.00 15.02 ? 17   LEU C O     1 
ATOM   5110  C CB    . LEU C 1 39  ? 9.241   13.537  -69.193  1.00 13.50 ? 17   LEU C CB    1 
ATOM   5111  C CG    . LEU C 1 39  ? 9.047   14.596  -70.280  1.00 12.60 ? 17   LEU C CG    1 
ATOM   5112  C CD1   . LEU C 1 39  ? 8.212   15.737  -69.742  1.00 15.18 ? 17   LEU C CD1   1 
ATOM   5113  C CD2   . LEU C 1 39  ? 10.382  15.116  -70.791  1.00 9.11  ? 17   LEU C CD2   1 
ATOM   5114  N N     . ARG C 1 40  ? 11.374  11.063  -68.628  1.00 15.13 ? 18   ARG C N     1 
ATOM   5115  C CA    . ARG C 1 40  ? 12.115  10.314  -67.645  1.00 16.38 ? 18   ARG C CA    1 
ATOM   5116  C C     . ARG C 1 40  ? 12.389  11.205  -66.431  1.00 17.64 ? 18   ARG C C     1 
ATOM   5117  O O     . ARG C 1 40  ? 12.806  12.362  -66.576  1.00 17.39 ? 18   ARG C O     1 
ATOM   5118  C CB    . ARG C 1 40  ? 13.421  9.858   -68.282  1.00 17.48 ? 18   ARG C CB    1 
ATOM   5119  C CG    . ARG C 1 40  ? 14.349  8.975   -67.447  1.00 20.22 ? 18   ARG C CG    1 
ATOM   5120  C CD    . ARG C 1 40  ? 15.816  9.130   -68.002  1.00 23.74 ? 18   ARG C CD    1 
ATOM   5121  N NE    . ARG C 1 40  ? 16.782  8.170   -67.454  1.00 24.69 ? 18   ARG C NE    1 
ATOM   5122  C CZ    . ARG C 1 40  ? 17.273  8.195   -66.205  1.00 35.64 ? 18   ARG C CZ    1 
ATOM   5123  N NH1   . ARG C 1 40  ? 16.885  9.124   -65.321  1.00 32.63 ? 18   ARG C NH1   1 
ATOM   5124  N NH2   . ARG C 1 40  ? 18.142  7.260   -65.814  1.00 38.31 ? 18   ARG C NH2   1 
ATOM   5125  N N     . PRO C 1 41  ? 12.160  10.667  -65.220  1.00 17.50 ? 19   PRO C N     1 
ATOM   5126  C CA    . PRO C 1 41  ? 12.513  11.402  -64.017  1.00 17.19 ? 19   PRO C CA    1 
ATOM   5127  C C     . PRO C 1 41  ? 14.016  11.338  -63.785  1.00 17.46 ? 19   PRO C C     1 
ATOM   5128  O O     . PRO C 1 41  ? 14.652  10.355  -64.152  1.00 17.12 ? 19   PRO C O     1 
ATOM   5129  C CB    . PRO C 1 41  ? 11.763  10.643  -62.924  1.00 17.03 ? 19   PRO C CB    1 
ATOM   5130  C CG    . PRO C 1 41  ? 11.720  9.248   -63.412  1.00 17.38 ? 19   PRO C CG    1 
ATOM   5131  C CD    . PRO C 1 41  ? 11.590  9.343   -64.907  1.00 17.91 ? 19   PRO C CD    1 
ATOM   5132  N N     . LYS C 1 42  ? 14.577  12.388  -63.198  1.00 18.64 ? 20   LYS C N     1 
ATOM   5133  C CA    . LYS C 1 42  ? 16.018  12.479  -62.995  1.00 19.22 ? 20   LYS C CA    1 
ATOM   5134  C C     . LYS C 1 42  ? 16.374  13.015  -61.603  1.00 20.32 ? 20   LYS C C     1 
ATOM   5135  O O     . LYS C 1 42  ? 15.573  13.704  -60.958  1.00 18.73 ? 20   LYS C O     1 
ATOM   5136  C CB    . LYS C 1 42  ? 16.615  13.334  -64.085  1.00 18.36 ? 20   LYS C CB    1 
ATOM   5137  C CG    . LYS C 1 42  ? 16.542  12.676  -65.416  1.00 17.13 ? 20   LYS C CG    1 
ATOM   5138  C CD    . LYS C 1 42  ? 16.954  13.623  -66.469  1.00 18.36 ? 20   LYS C CD    1 
ATOM   5139  C CE    . LYS C 1 42  ? 16.809  13.030  -67.824  1.00 16.42 ? 20   LYS C CE    1 
ATOM   5140  N NZ    . LYS C 1 42  ? 16.931  14.123  -68.776  1.00 16.23 ? 20   LYS C NZ    1 
ATOM   5141  N N     . ARG C 1 43  ? 17.580  12.681  -61.151  1.00 22.31 ? 21   ARG C N     1 
ATOM   5142  C CA    . ARG C 1 43  ? 18.053  13.084  -59.823  1.00 25.13 ? 21   ARG C CA    1 
ATOM   5143  C C     . ARG C 1 43  ? 18.166  14.607  -59.717  1.00 26.32 ? 21   ARG C C     1 
ATOM   5144  O O     . ARG C 1 43  ? 18.687  15.265  -60.633  1.00 26.45 ? 21   ARG C O     1 
ATOM   5145  C CB    . ARG C 1 43  ? 19.427  12.478  -59.501  1.00 25.87 ? 21   ARG C CB    1 
ATOM   5146  C CG    . ARG C 1 43  ? 19.481  10.949  -59.314  1.00 32.27 ? 21   ARG C CG    1 
ATOM   5147  C CD    . ARG C 1 43  ? 20.850  10.473  -58.696  1.00 36.02 ? 21   ARG C CD    1 
ATOM   5148  N NE    . ARG C 1 43  ? 21.017  10.913  -57.296  1.00 41.85 ? 21   ARG C NE    1 
ATOM   5149  C CZ    . ARG C 1 43  ? 22.161  10.905  -56.598  1.00 38.28 ? 21   ARG C CZ    1 
ATOM   5150  N NH1   . ARG C 1 43  ? 23.290  10.472  -57.146  1.00 39.47 ? 21   ARG C NH1   1 
ATOM   5151  N NH2   . ARG C 1 43  ? 22.183  11.339  -55.340  1.00 34.73 ? 21   ARG C NH2   1 
ATOM   5152  N N     . SER C 1 44  ? 17.682  15.151  -58.598  1.00 27.95 ? 22   SER C N     1 
ATOM   5153  C CA    . SER C 1 44  ? 17.756  16.586  -58.316  1.00 29.00 ? 22   SER C CA    1 
ATOM   5154  C C     . SER C 1 44  ? 17.702  16.850  -56.808  1.00 31.08 ? 22   SER C C     1 
ATOM   5155  O O     . SER C 1 44  ? 17.563  15.938  -56.000  1.00 31.26 ? 22   SER C O     1 
ATOM   5156  C CB    . SER C 1 44  ? 16.595  17.313  -58.986  1.00 28.21 ? 22   SER C CB    1 
ATOM   5157  O OG    . SER C 1 44  ? 15.552  17.585  -58.068  1.00 26.11 ? 22   SER C OG    1 
ATOM   5158  N N     . SER C 1 45  ? 17.798  18.121  -56.453  1.00 33.32 ? 23   SER C N     1 
ATOM   5159  C CA    . SER C 1 45  ? 17.704  18.549  -55.075  1.00 34.25 ? 23   SER C CA    1 
ATOM   5160  C C     . SER C 1 45  ? 16.339  19.192  -54.801  1.00 35.12 ? 23   SER C C     1 
ATOM   5161  O O     . SER C 1 45  ? 16.121  19.748  -53.732  1.00 36.31 ? 23   SER C O     1 
ATOM   5162  C CB    . SER C 1 45  ? 18.860  19.509  -54.783  1.00 33.92 ? 23   SER C CB    1 
ATOM   5163  O OG    . SER C 1 45  ? 19.248  20.161  -55.981  1.00 35.85 ? 23   SER C OG    1 
ATOM   5164  N N     . LEU C 1 46  ? 15.414  19.084  -55.752  1.00 36.24 ? 24   LEU C N     1 
ATOM   5165  C CA    . LEU C 1 46  ? 14.088  19.692  -55.623  1.00 37.39 ? 24   LEU C CA    1 
ATOM   5166  C C     . LEU C 1 46  ? 13.134  18.712  -54.975  1.00 37.97 ? 24   LEU C C     1 
ATOM   5167  O O     . LEU C 1 46  ? 12.846  17.654  -55.545  1.00 39.18 ? 24   LEU C O     1 
ATOM   5168  C CB    . LEU C 1 46  ? 13.537  20.055  -57.006  1.00 38.06 ? 24   LEU C CB    1 
ATOM   5169  C CG    . LEU C 1 46  ? 14.422  20.896  -57.908  1.00 35.60 ? 24   LEU C CG    1 
ATOM   5170  C CD1   . LEU C 1 46  ? 13.871  20.924  -59.312  1.00 34.01 ? 24   LEU C CD1   1 
ATOM   5171  C CD2   . LEU C 1 46  ? 14.542  22.284  -57.324  1.00 37.04 ? 24   LEU C CD2   1 
ATOM   5172  N N     . LYS C 1 47  ? 12.639  19.038  -53.789  1.00 38.27 ? 25   LYS C N     1 
ATOM   5173  C CA    . LYS C 1 47  ? 11.675  18.147  -53.123  1.00 37.60 ? 25   LYS C CA    1 
ATOM   5174  C C     . LYS C 1 47  ? 10.278  18.422  -53.663  1.00 35.98 ? 25   LYS C C     1 
ATOM   5175  O O     . LYS C 1 47  ? 9.643   17.532  -54.255  1.00 35.36 ? 25   LYS C O     1 
ATOM   5176  C CB    . LYS C 1 47  ? 11.706  18.285  -51.590  1.00 36.70 ? 25   LYS C CB    1 
ATOM   5177  N N     . SER C 1 48  ? 9.834   19.667  -53.481  1.00 34.18 ? 26   SER C N     1 
ATOM   5178  C CA    . SER C 1 48  ? 8.439   20.044  -53.698  1.00 32.03 ? 26   SER C CA    1 
ATOM   5179  C C     . SER C 1 48  ? 8.236   20.922  -54.928  1.00 29.72 ? 26   SER C C     1 
ATOM   5180  O O     . SER C 1 48  ? 9.108   21.713  -55.308  1.00 28.90 ? 26   SER C O     1 
ATOM   5181  C CB    . SER C 1 48  ? 7.864   20.746  -52.475  1.00 31.91 ? 26   SER C CB    1 
ATOM   5182  O OG    . SER C 1 48  ? 6.489   21.007  -52.689  1.00 32.66 ? 26   SER C OG    1 
ATOM   5183  N N     . ARG C 1 49  ? 7.051   20.783  -55.513  1.00 27.59 ? 27   ARG C N     1 
ATOM   5184  C CA    . ARG C 1 49  ? 6.685   21.465  -56.737  1.00 25.71 ? 27   ARG C CA    1 
ATOM   5185  C C     . ARG C 1 49  ? 6.536   22.990  -56.547  1.00 24.05 ? 27   ARG C C     1 
ATOM   5186  O O     . ARG C 1 49  ? 6.693   23.738  -57.498  1.00 20.98 ? 27   ARG C O     1 
ATOM   5187  C CB    . ARG C 1 49  ? 5.394   20.849  -57.314  1.00 25.91 ? 27   ARG C CB    1 
ATOM   5188  C CG    . ARG C 1 49  ? 4.084   21.679  -57.067  1.00 29.05 ? 27   ARG C CG    1 
ATOM   5189  C CD    . ARG C 1 49  ? 2.941   20.876  -56.467  1.00 28.66 ? 27   ARG C CD    1 
ATOM   5190  N NE    . ARG C 1 49  ? 1.950   20.443  -57.447  1.00 32.91 ? 27   ARG C NE    1 
ATOM   5191  C CZ    . ARG C 1 49  ? 0.633   20.681  -57.389  1.00 39.58 ? 27   ARG C CZ    1 
ATOM   5192  N NH1   . ARG C 1 49  ? 0.087   21.385  -56.393  1.00 39.82 ? 27   ARG C NH1   1 
ATOM   5193  N NH2   . ARG C 1 49  ? -0.164  20.195  -58.346  1.00 40.94 ? 27   ARG C NH2   1 
ATOM   5194  N N     . ALA C 1 50  ? 6.233   23.444  -55.332  1.00 24.16 ? 28   ALA C N     1 
ATOM   5195  C CA    . ALA C 1 50  ? 6.058   24.875  -55.072  1.00 25.14 ? 28   ALA C CA    1 
ATOM   5196  C C     . ALA C 1 50  ? 7.367   25.658  -55.284  1.00 25.78 ? 28   ALA C C     1 
ATOM   5197  O O     . ALA C 1 50  ? 7.350   26.847  -55.638  1.00 26.02 ? 28   ALA C O     1 
ATOM   5198  C CB    . ALA C 1 50  ? 5.543   25.073  -53.673  1.00 24.60 ? 28   ALA C CB    1 
ATOM   5199  N N     . GLU C 1 51  ? 8.492   24.969  -55.084  1.00 26.05 ? 29   GLU C N     1 
ATOM   5200  C CA    . GLU C 1 51  ? 9.814   25.514  -55.347  1.00 26.63 ? 29   GLU C CA    1 
ATOM   5201  C C     . GLU C 1 51  ? 10.011  25.962  -56.797  1.00 26.04 ? 29   GLU C C     1 
ATOM   5202  O O     . GLU C 1 51  ? 10.870  26.816  -57.058  1.00 28.26 ? 29   GLU C O     1 
ATOM   5203  C CB    . GLU C 1 51  ? 10.867  24.459  -55.041  1.00 28.58 ? 29   GLU C CB    1 
ATOM   5204  C CG    . GLU C 1 51  ? 10.837  23.898  -53.621  1.00 32.21 ? 29   GLU C CG    1 
ATOM   5205  C CD    . GLU C 1 51  ? 11.722  22.682  -53.491  1.00 37.36 ? 29   GLU C CD    1 
ATOM   5206  O OE1   . GLU C 1 51  ? 12.705  22.587  -54.270  1.00 40.36 ? 29   GLU C OE1   1 
ATOM   5207  O OE2   . GLU C 1 51  ? 11.438  21.826  -52.613  1.00 36.73 ? 29   GLU C OE2   1 
ATOM   5208  N N     . VAL C 1 52  ? 9.239   25.396  -57.732  1.00 23.15 ? 30   VAL C N     1 
ATOM   5209  C CA    . VAL C 1 52  ? 9.427   25.634  -59.174  1.00 20.34 ? 30   VAL C CA    1 
ATOM   5210  C C     . VAL C 1 52  ? 8.871   26.971  -59.701  1.00 19.00 ? 30   VAL C C     1 
ATOM   5211  O O     . VAL C 1 52  ? 7.711   27.293  -59.506  1.00 17.77 ? 30   VAL C O     1 
ATOM   5212  C CB    . VAL C 1 52  ? 8.834   24.457  -59.986  1.00 20.00 ? 30   VAL C CB    1 
ATOM   5213  C CG1   . VAL C 1 52  ? 8.950   24.709  -61.482  1.00 17.67 ? 30   VAL C CG1   1 
ATOM   5214  C CG2   . VAL C 1 52  ? 9.546   23.138  -59.595  1.00 19.05 ? 30   VAL C CG2   1 
ATOM   5215  N N     . ASP C 1 53  ? 9.737   27.714  -60.389  1.00 18.75 ? 31   ASP C N     1 
ATOM   5216  C CA    . ASP C 1 53  ? 9.396   28.979  -61.034  1.00 19.81 ? 31   ASP C CA    1 
ATOM   5217  C C     . ASP C 1 53  ? 8.993   28.721  -62.489  1.00 18.91 ? 31   ASP C C     1 
ATOM   5218  O O     . ASP C 1 53  ? 9.811   28.282  -63.296  1.00 17.13 ? 31   ASP C O     1 
ATOM   5219  C CB    . ASP C 1 53  ? 10.612  29.921  -60.955  1.00 21.70 ? 31   ASP C CB    1 
ATOM   5220  C CG    . ASP C 1 53  ? 10.310  31.334  -61.440  1.00 27.45 ? 31   ASP C CG    1 
ATOM   5221  O OD1   . ASP C 1 53  ? 9.127   31.742  -61.467  1.00 33.38 ? 31   ASP C OD1   1 
ATOM   5222  O OD2   . ASP C 1 53  ? 11.282  32.043  -61.786  1.00 31.58 ? 31   ASP C OD2   1 
ATOM   5223  N N     . LEU C 1 54  ? 7.734   28.987  -62.815  1.00 18.73 ? 32   LEU C N     1 
ATOM   5224  C CA    . LEU C 1 54  ? 7.232   28.778  -64.169  1.00 19.15 ? 32   LEU C CA    1 
ATOM   5225  C C     . LEU C 1 54  ? 7.376   29.992  -65.070  1.00 20.36 ? 32   LEU C C     1 
ATOM   5226  O O     . LEU C 1 54  ? 7.312   29.864  -66.281  1.00 20.18 ? 32   LEU C O     1 
ATOM   5227  C CB    . LEU C 1 54  ? 5.761   28.356  -64.120  1.00 19.79 ? 32   LEU C CB    1 
ATOM   5228  C CG    . LEU C 1 54  ? 5.456   26.991  -63.530  1.00 17.38 ? 32   LEU C CG    1 
ATOM   5229  C CD1   . LEU C 1 54  ? 3.976   26.655  -63.770  1.00 21.18 ? 32   LEU C CD1   1 
ATOM   5230  C CD2   . LEU C 1 54  ? 6.390   25.930  -64.093  1.00 11.46 ? 32   LEU C CD2   1 
ATOM   5231  N N     . GLU C 1 55  ? 7.557   31.162  -64.466  1.00 22.83 ? 33   GLU C N     1 
ATOM   5232  C CA    . GLU C 1 55  ? 7.883   32.390  -65.186  1.00 23.96 ? 33   GLU C CA    1 
ATOM   5233  C C     . GLU C 1 55  ? 9.092   32.221  -66.080  1.00 23.17 ? 33   GLU C C     1 
ATOM   5234  O O     . GLU C 1 55  ? 10.088  31.621  -65.682  1.00 22.53 ? 33   GLU C O     1 
ATOM   5235  C CB    . GLU C 1 55  ? 8.154   33.545  -64.214  1.00 24.20 ? 33   GLU C CB    1 
ATOM   5236  C CG    . GLU C 1 55  ? 6.958   34.460  -63.947  1.00 31.82 ? 33   GLU C CG    1 
ATOM   5237  C CD    . GLU C 1 55  ? 7.259   35.961  -64.232  1.00 44.45 ? 33   GLU C CD    1 
ATOM   5238  O OE1   . GLU C 1 55  ? 6.298   36.697  -64.570  1.00 49.72 ? 33   GLU C OE1   1 
ATOM   5239  O OE2   . GLU C 1 55  ? 8.440   36.407  -64.130  1.00 47.28 ? 33   GLU C OE2   1 
ATOM   5240  N N     . ARG C 1 56  ? 8.967   32.784  -67.282  1.00 23.80 ? 34   ARG C N     1 
ATOM   5241  C CA    . ARG C 1 56  ? 9.985   32.799  -68.296  1.00 24.60 ? 34   ARG C CA    1 
ATOM   5242  C C     . ARG C 1 56  ? 10.237  34.230  -68.783  1.00 23.62 ? 34   ARG C C     1 
ATOM   5243  O O     . ARG C 1 56  ? 9.288   35.012  -68.878  1.00 22.87 ? 34   ARG C O     1 
ATOM   5244  C CB    . ARG C 1 56  ? 9.479   31.967  -69.461  1.00 26.48 ? 34   ARG C CB    1 
ATOM   5245  C CG    . ARG C 1 56  ? 9.978   30.557  -69.447  1.00 29.03 ? 34   ARG C CG    1 
ATOM   5246  C CD    . ARG C 1 56  ? 11.318  30.485  -70.099  1.00 27.49 ? 34   ARG C CD    1 
ATOM   5247  N NE    . ARG C 1 56  ? 11.375  29.352  -71.013  1.00 28.48 ? 34   ARG C NE    1 
ATOM   5248  C CZ    . ARG C 1 56  ? 12.448  29.022  -71.717  1.00 18.64 ? 34   ARG C CZ    1 
ATOM   5249  N NH1   . ARG C 1 56  ? 13.563  29.743  -71.630  1.00 18.81 ? 34   ARG C NH1   1 
ATOM   5250  N NH2   . ARG C 1 56  ? 12.406  27.961  -72.496  1.00 9.56  ? 34   ARG C NH2   1 
ATOM   5251  N N     . THR C 1 57  ? 11.495  34.549  -69.105  1.00 22.97 ? 35   THR C N     1 
ATOM   5252  C CA    . THR C 1 57  ? 11.847  35.812  -69.722  1.00 23.22 ? 35   THR C CA    1 
ATOM   5253  C C     . THR C 1 57  ? 12.403  35.587  -71.127  1.00 22.75 ? 35   THR C C     1 
ATOM   5254  O O     . THR C 1 57  ? 13.425  34.917  -71.307  1.00 21.86 ? 35   THR C O     1 
ATOM   5255  C CB    . THR C 1 57  ? 12.918  36.577  -68.924  1.00 23.80 ? 35   THR C CB    1 
ATOM   5256  O OG1   . THR C 1 57  ? 12.368  36.993  -67.671  1.00 24.69 ? 35   THR C OG1   1 
ATOM   5257  C CG2   . THR C 1 57  ? 13.414  37.802  -69.709  1.00 21.58 ? 35   THR C CG2   1 
ATOM   5258  N N     . PHE C 1 58  ? 11.744  36.191  -72.112  1.00 22.58 ? 36   PHE C N     1 
ATOM   5259  C CA    . PHE C 1 58  ? 12.186  36.110  -73.494  1.00 21.94 ? 36   PHE C CA    1 
ATOM   5260  C C     . PHE C 1 58  ? 12.483  37.501  -74.024  1.00 21.34 ? 36   PHE C C     1 
ATOM   5261  O O     . PHE C 1 58  ? 11.759  38.442  -73.755  1.00 20.15 ? 36   PHE C O     1 
ATOM   5262  C CB    . PHE C 1 58  ? 11.113  35.462  -74.380  1.00 22.02 ? 36   PHE C CB    1 
ATOM   5263  C CG    . PHE C 1 58  ? 10.764  34.036  -74.014  1.00 19.81 ? 36   PHE C CG    1 
ATOM   5264  C CD1   . PHE C 1 58  ? 11.720  33.036  -74.032  1.00 21.52 ? 36   PHE C CD1   1 
ATOM   5265  C CD2   . PHE C 1 58  ? 9.463   33.691  -73.691  1.00 21.93 ? 36   PHE C CD2   1 
ATOM   5266  C CE1   . PHE C 1 58  ? 11.391  31.717  -73.708  1.00 18.94 ? 36   PHE C CE1   1 
ATOM   5267  C CE2   . PHE C 1 58  ? 9.129   32.371  -73.376  1.00 22.20 ? 36   PHE C CE2   1 
ATOM   5268  C CZ    . PHE C 1 58  ? 10.101  31.385  -73.394  1.00 20.46 ? 36   PHE C CZ    1 
ATOM   5269  N N     . THR C 1 59  ? 13.561  37.613  -74.779  1.00 22.06 ? 37   THR C N     1 
ATOM   5270  C CA    . THR C 1 59  ? 13.821  38.783  -75.596  1.00 23.34 ? 37   THR C CA    1 
ATOM   5271  C C     . THR C 1 59  ? 13.709  38.364  -77.063  1.00 23.57 ? 37   THR C C     1 
ATOM   5272  O O     . THR C 1 59  ? 14.526  37.592  -77.569  1.00 25.02 ? 37   THR C O     1 
ATOM   5273  C CB    . THR C 1 59  ? 15.209  39.399  -75.321  1.00 23.32 ? 37   THR C CB    1 
ATOM   5274  O OG1   . THR C 1 59  ? 15.357  39.660  -73.917  1.00 21.83 ? 37   THR C OG1   1 
ATOM   5275  C CG2   . THR C 1 59  ? 15.370  40.695  -76.102  1.00 23.56 ? 37   THR C CG2   1 
ATOM   5276  N N     . PHE C 1 60  ? 12.712  38.903  -77.748  1.00 22.13 ? 38   PHE C N     1 
ATOM   5277  C CA    . PHE C 1 60  ? 12.400  38.490  -79.109  1.00 20.83 ? 38   PHE C CA    1 
ATOM   5278  C C     . PHE C 1 60  ? 13.373  39.031  -80.149  1.00 20.12 ? 38   PHE C C     1 
ATOM   5279  O O     . PHE C 1 60  ? 13.943  40.089  -79.974  1.00 20.06 ? 38   PHE C O     1 
ATOM   5280  C CB    . PHE C 1 60  ? 10.958  38.860  -79.425  1.00 19.92 ? 38   PHE C CB    1 
ATOM   5281  C CG    . PHE C 1 60  ? 10.000  38.329  -78.430  1.00 19.25 ? 38   PHE C CG    1 
ATOM   5282  C CD1   . PHE C 1 60  ? 9.729   36.954  -78.373  1.00 24.00 ? 38   PHE C CD1   1 
ATOM   5283  C CD2   . PHE C 1 60  ? 9.400   39.171  -77.505  1.00 18.62 ? 38   PHE C CD2   1 
ATOM   5284  C CE1   . PHE C 1 60  ? 8.832   36.432  -77.423  1.00 19.46 ? 38   PHE C CE1   1 
ATOM   5285  C CE2   . PHE C 1 60  ? 8.514   38.663  -76.564  1.00 16.59 ? 38   PHE C CE2   1 
ATOM   5286  C CZ    . PHE C 1 60  ? 8.236   37.281  -76.517  1.00 15.40 ? 38   PHE C CZ    1 
ATOM   5287  N N     . ARG C 1 61  ? 13.533  38.276  -81.231  1.00 20.25 ? 39   ARG C N     1 
ATOM   5288  C CA    . ARG C 1 61  ? 14.613  38.469  -82.212  1.00 20.30 ? 39   ARG C CA    1 
ATOM   5289  C C     . ARG C 1 61  ? 14.440  39.711  -83.058  1.00 19.44 ? 39   ARG C C     1 
ATOM   5290  O O     . ARG C 1 61  ? 15.402  40.475  -83.294  1.00 20.51 ? 39   ARG C O     1 
ATOM   5291  C CB    . ARG C 1 61  ? 14.674  37.265  -83.160  1.00 20.20 ? 39   ARG C CB    1 
ATOM   5292  C CG    . ARG C 1 61  ? 15.856  37.275  -84.118  1.00 21.29 ? 39   ARG C CG    1 
ATOM   5293  C CD    . ARG C 1 61  ? 15.743  36.180  -85.138  1.00 21.96 ? 39   ARG C CD    1 
ATOM   5294  N NE    . ARG C 1 61  ? 16.915  36.097  -86.021  1.00 23.00 ? 39   ARG C NE    1 
ATOM   5295  C CZ    . ARG C 1 61  ? 17.038  36.723  -87.194  1.00 21.39 ? 39   ARG C CZ    1 
ATOM   5296  N NH1   . ARG C 1 61  ? 16.091  37.519  -87.646  1.00 21.06 ? 39   ARG C NH1   1 
ATOM   5297  N NH2   . ARG C 1 61  ? 18.130  36.557  -87.920  1.00 20.28 ? 39   ARG C NH2   1 
ATOM   5298  N N     . ASN C 1 62  ? 13.216  39.877  -83.550  1.00 18.52 ? 40   ASN C N     1 
ATOM   5299  C CA    . ASN C 1 62  ? 12.924  40.899  -84.545  1.00 17.18 ? 40   ASN C CA    1 
ATOM   5300  C C     . ASN C 1 62  ? 12.322  42.151  -83.899  1.00 16.44 ? 40   ASN C C     1 
ATOM   5301  O O     . ASN C 1 62  ? 12.710  43.268  -84.223  1.00 16.53 ? 40   ASN C O     1 
ATOM   5302  C CB    . ASN C 1 62  ? 12.038  40.298  -85.667  1.00 16.66 ? 40   ASN C CB    1 
ATOM   5303  C CG    . ASN C 1 62  ? 12.748  39.156  -86.440  1.00 15.04 ? 40   ASN C CG    1 
ATOM   5304  O OD1   . ASN C 1 62  ? 13.818  39.357  -86.965  1.00 11.90 ? 40   ASN C OD1   1 
ATOM   5305  N ND2   . ASN C 1 62  ? 12.145  37.978  -86.502  1.00 14.68 ? 40   ASN C ND2   1 
ATOM   5306  N N     . SER C 1 63  ? 11.393  41.959  -82.961  1.00 16.72 ? 41   SER C N     1 
ATOM   5307  C CA    . SER C 1 63  ? 10.752  43.079  -82.248  1.00 16.64 ? 41   SER C CA    1 
ATOM   5308  C C     . SER C 1 63  ? 11.709  43.695  -81.250  1.00 17.12 ? 41   SER C C     1 
ATOM   5309  O O     . SER C 1 63  ? 11.579  44.863  -80.911  1.00 17.76 ? 41   SER C O     1 
ATOM   5310  C CB    . SER C 1 63  ? 9.476   42.613  -81.501  1.00 16.54 ? 41   SER C CB    1 
ATOM   5311  O OG    . SER C 1 63  ? 9.767   41.915  -80.280  1.00 11.86 ? 41   SER C OG    1 
ATOM   5312  N N     . LYS C 1 64  ? 12.645  42.882  -80.771  1.00 18.72 ? 42   LYS C N     1 
ATOM   5313  C CA    . LYS C 1 64  ? 13.609  43.251  -79.720  1.00 19.39 ? 42   LYS C CA    1 
ATOM   5314  C C     . LYS C 1 64  ? 12.972  43.510  -78.353  1.00 19.40 ? 42   LYS C C     1 
ATOM   5315  O O     . LYS C 1 64  ? 13.645  43.992  -77.450  1.00 20.17 ? 42   LYS C O     1 
ATOM   5316  C CB    . LYS C 1 64  ? 14.441  44.471  -80.119  1.00 19.90 ? 42   LYS C CB    1 
ATOM   5317  C CG    . LYS C 1 64  ? 14.986  44.440  -81.520  1.00 22.26 ? 42   LYS C CG    1 
ATOM   5318  C CD    . LYS C 1 64  ? 16.001  43.355  -81.707  1.00 24.92 ? 42   LYS C CD    1 
ATOM   5319  C CE    . LYS C 1 64  ? 16.638  43.478  -83.078  1.00 32.17 ? 42   LYS C CE    1 
ATOM   5320  N NZ    . LYS C 1 64  ? 15.744  44.125  -84.107  1.00 34.20 ? 42   LYS C NZ    1 
ATOM   5321  N N     . GLN C 1 65  ? 11.686  43.201  -78.213  1.00 19.71 ? 43   GLN C N     1 
ATOM   5322  C CA    . GLN C 1 65  ? 10.966  43.399  -76.964  1.00 19.70 ? 43   GLN C CA    1 
ATOM   5323  C C     . GLN C 1 65  ? 11.320  42.295  -75.981  1.00 20.01 ? 43   GLN C C     1 
ATOM   5324  O O     . GLN C 1 65  ? 11.818  41.234  -76.366  1.00 19.87 ? 43   GLN C O     1 
ATOM   5325  C CB    . GLN C 1 65  ? 9.448   43.382  -77.179  1.00 19.87 ? 43   GLN C CB    1 
ATOM   5326  C CG    . GLN C 1 65  ? 8.919   44.522  -78.044  1.00 25.28 ? 43   GLN C CG    1 
ATOM   5327  C CD    . GLN C 1 65  ? 8.883   45.842  -77.311  1.00 27.32 ? 43   GLN C CD    1 
ATOM   5328  O OE1   . GLN C 1 65  ? 9.658   46.759  -77.622  1.00 26.38 ? 43   GLN C OE1   1 
ATOM   5329  N NE2   . GLN C 1 65  ? 7.999   45.942  -76.306  1.00 24.72 ? 43   GLN C NE2   1 
ATOM   5330  N N     . THR C 1 66  ? 11.032  42.551  -74.705  1.00 19.81 ? 44   THR C N     1 
ATOM   5331  C CA    . THR C 1 66  ? 11.231  41.579  -73.644  1.00 18.96 ? 44   THR C CA    1 
ATOM   5332  C C     . THR C 1 66  ? 9.888   41.222  -73.069  1.00 19.19 ? 44   THR C C     1 
ATOM   5333  O O     . THR C 1 66  ? 9.069   42.097  -72.824  1.00 16.72 ? 44   THR C O     1 
ATOM   5334  C CB    . THR C 1 66  ? 12.075  42.129  -72.473  1.00 18.64 ? 44   THR C CB    1 
ATOM   5335  O OG1   . THR C 1 66  ? 13.432  42.349  -72.891  1.00 20.52 ? 44   THR C OG1   1 
ATOM   5336  C CG2   . THR C 1 66  ? 12.071  41.145  -71.276  1.00 19.33 ? 44   THR C CG2   1 
ATOM   5337  N N     . TYR C 1 67  ? 9.683   39.922  -72.855  1.00 20.61 ? 45   TYR C N     1 
ATOM   5338  C CA    . TYR C 1 67  ? 8.465   39.383  -72.282  1.00 20.42 ? 45   TYR C CA    1 
ATOM   5339  C C     . TYR C 1 67  ? 8.837   38.698  -70.991  1.00 20.39 ? 45   TYR C C     1 
ATOM   5340  O O     . TYR C 1 67  ? 9.888   38.065  -70.915  1.00 20.46 ? 45   TYR C O     1 
ATOM   5341  C CB    . TYR C 1 67  ? 7.875   38.339  -73.237  1.00 20.37 ? 45   TYR C CB    1 
ATOM   5342  C CG    . TYR C 1 67  ? 6.929   37.318  -72.584  1.00 22.03 ? 45   TYR C CG    1 
ATOM   5343  C CD1   . TYR C 1 67  ? 5.549   37.564  -72.493  1.00 17.83 ? 45   TYR C CD1   1 
ATOM   5344  C CD2   . TYR C 1 67  ? 7.423   36.097  -72.078  1.00 23.23 ? 45   TYR C CD2   1 
ATOM   5345  C CE1   . TYR C 1 67  ? 4.705   36.644  -71.902  1.00 21.08 ? 45   TYR C CE1   1 
ATOM   5346  C CE2   . TYR C 1 67  ? 6.567   35.155  -71.482  1.00 20.13 ? 45   TYR C CE2   1 
ATOM   5347  C CZ    . TYR C 1 67  ? 5.219   35.442  -71.398  1.00 22.93 ? 45   TYR C CZ    1 
ATOM   5348  O OH    . TYR C 1 67  ? 4.377   34.530  -70.823  1.00 20.82 ? 45   TYR C OH    1 
ATOM   5349  N N     . SER C 1 68  ? 7.981   38.813  -69.981  1.00 19.08 ? 46   SER C N     1 
ATOM   5350  C CA    . SER C 1 68  ? 8.080   37.911  -68.847  1.00 19.56 ? 46   SER C CA    1 
ATOM   5351  C C     . SER C 1 68  ? 6.706   37.402  -68.361  1.00 18.38 ? 46   SER C C     1 
ATOM   5352  O O     . SER C 1 68  ? 5.741   38.153  -68.225  1.00 16.91 ? 46   SER C O     1 
ATOM   5353  C CB    . SER C 1 68  ? 8.904   38.504  -67.721  1.00 21.42 ? 46   SER C CB    1 
ATOM   5354  O OG    . SER C 1 68  ? 9.669   37.462  -67.130  1.00 23.87 ? 46   SER C OG    1 
ATOM   5355  N N     . GLY C 1 69  ? 6.626   36.093  -68.149  1.00 17.54 ? 47   GLY C N     1 
ATOM   5356  C CA    . GLY C 1 69  ? 5.398   35.502  -67.667  1.00 16.77 ? 47   GLY C CA    1 
ATOM   5357  C C     . GLY C 1 69  ? 5.483   34.013  -67.755  1.00 16.49 ? 47   GLY C C     1 
ATOM   5358  O O     . GLY C 1 69  ? 6.541   33.471  -68.086  1.00 13.03 ? 47   GLY C O     1 
ATOM   5359  N N     . ILE C 1 70  ? 4.360   33.366  -67.451  1.00 17.84 ? 48   ILE C N     1 
ATOM   5360  C CA    . ILE C 1 70  ? 4.212   31.945  -67.639  1.00 18.91 ? 48   ILE C CA    1 
ATOM   5361  C C     . ILE C 1 70  ? 3.761   31.764  -69.094  1.00 19.36 ? 48   ILE C C     1 
ATOM   5362  O O     . ILE C 1 70  ? 2.653   32.151  -69.457  1.00 21.08 ? 48   ILE C O     1 
ATOM   5363  C CB    . ILE C 1 70  ? 3.228   31.357  -66.611  1.00 19.72 ? 48   ILE C CB    1 
ATOM   5364  C CG1   . ILE C 1 70  ? 3.844   31.465  -65.198  1.00 18.90 ? 48   ILE C CG1   1 
ATOM   5365  C CG2   . ILE C 1 70  ? 2.852   29.893  -66.963  1.00 21.43 ? 48   ILE C CG2   1 
ATOM   5366  C CD1   . ILE C 1 70  ? 3.004   30.800  -64.070  1.00 14.94 ? 48   ILE C CD1   1 
ATOM   5367  N N     . PRO C 1 71  ? 4.638   31.213  -69.944  1.00 17.72 ? 49   PRO C N     1 
ATOM   5368  C CA    . PRO C 1 71  ? 4.416   31.113  -71.377  1.00 16.46 ? 49   PRO C CA    1 
ATOM   5369  C C     . PRO C 1 71  ? 3.361   30.082  -71.811  1.00 17.11 ? 49   PRO C C     1 
ATOM   5370  O O     . PRO C 1 71  ? 3.594   29.227  -72.665  1.00 17.15 ? 49   PRO C O     1 
ATOM   5371  C CB    . PRO C 1 71  ? 5.808   30.764  -71.913  1.00 17.22 ? 49   PRO C CB    1 
ATOM   5372  C CG    . PRO C 1 71  ? 6.509   30.118  -70.812  1.00 18.67 ? 49   PRO C CG    1 
ATOM   5373  C CD    . PRO C 1 71  ? 5.945   30.659  -69.548  1.00 18.48 ? 49   PRO C CD    1 
ATOM   5374  N N     . ILE C 1 72  ? 2.185   30.169  -71.219  1.00 18.68 ? 50   ILE C N     1 
ATOM   5375  C CA    . ILE C 1 72  ? 1.066   29.367  -71.647  1.00 19.17 ? 50   ILE C CA    1 
ATOM   5376  C C     . ILE C 1 72  ? 0.050   30.356  -72.197  1.00 19.11 ? 50   ILE C C     1 
ATOM   5377  O O     . ILE C 1 72  ? -0.249  31.343  -71.554  1.00 18.08 ? 50   ILE C O     1 
ATOM   5378  C CB    . ILE C 1 72  ? 0.500   28.512  -70.477  1.00 20.33 ? 50   ILE C CB    1 
ATOM   5379  C CG1   . ILE C 1 72  ? 1.430   27.326  -70.199  1.00 19.49 ? 50   ILE C CG1   1 
ATOM   5380  C CG2   . ILE C 1 72  ? -0.900  27.984  -70.786  1.00 23.51 ? 50   ILE C CG2   1 
ATOM   5381  C CD1   . ILE C 1 72  ? 1.490   26.925  -68.731  1.00 25.41 ? 50   ILE C CD1   1 
ATOM   5382  N N     . ILE C 1 73  ? -0.418  30.087  -73.421  1.00 19.39 ? 51   ILE C N     1 
ATOM   5383  C CA    . ILE C 1 73  ? -1.249  30.997  -74.178  1.00 17.84 ? 51   ILE C CA    1 
ATOM   5384  C C     . ILE C 1 73  ? -2.624  30.367  -74.429  1.00 18.12 ? 51   ILE C C     1 
ATOM   5385  O O     . ILE C 1 73  ? -2.718  29.215  -74.836  1.00 19.48 ? 51   ILE C O     1 
ATOM   5386  C CB    . ILE C 1 73  ? -0.615  31.321  -75.546  1.00 17.75 ? 51   ILE C CB    1 
ATOM   5387  C CG1   . ILE C 1 73  ? 0.823   31.869  -75.392  1.00 19.45 ? 51   ILE C CG1   1 
ATOM   5388  C CG2   . ILE C 1 73  ? -1.498  32.337  -76.307  1.00 15.35 ? 51   ILE C CG2   1 
ATOM   5389  C CD1   . ILE C 1 73  ? 1.697   31.760  -76.695  1.00 18.36 ? 51   ILE C CD1   1 
ATOM   5390  N N     . VAL C 1 74  ? -3.686  31.127  -74.186  1.00 15.30 ? 52   VAL C N     1 
ATOM   5391  C CA    . VAL C 1 74  ? -5.013  30.710  -74.579  1.00 13.89 ? 52   VAL C CA    1 
ATOM   5392  C C     . VAL C 1 74  ? -5.135  30.972  -76.068  1.00 14.63 ? 52   VAL C C     1 
ATOM   5393  O O     . VAL C 1 74  ? -4.830  32.072  -76.530  1.00 14.23 ? 52   VAL C O     1 
ATOM   5394  C CB    . VAL C 1 74  ? -6.069  31.511  -73.829  1.00 11.79 ? 52   VAL C CB    1 
ATOM   5395  C CG1   . VAL C 1 74  ? -7.431  30.884  -73.969  1.00 10.77 ? 52   VAL C CG1   1 
ATOM   5396  C CG2   . VAL C 1 74  ? -5.697  31.596  -72.384  1.00 10.64 ? 52   VAL C CG2   1 
ATOM   5397  N N     . ALA C 1 75  ? -5.573  29.979  -76.842  1.00 15.90 ? 53   ALA C N     1 
ATOM   5398  C CA    . ALA C 1 75  ? -5.632  30.152  -78.306  1.00 16.17 ? 53   ALA C CA    1 
ATOM   5399  C C     . ALA C 1 75  ? -6.671  31.200  -78.677  1.00 17.89 ? 53   ALA C C     1 
ATOM   5400  O O     . ALA C 1 75  ? -7.670  31.396  -77.954  1.00 17.14 ? 53   ALA C O     1 
ATOM   5401  C CB    . ALA C 1 75  ? -5.940  28.852  -78.996  1.00 15.20 ? 53   ALA C CB    1 
ATOM   5402  N N     . ASN C 1 76  ? -6.443  31.860  -79.815  1.00 19.11 ? 54   ASN C N     1 
ATOM   5403  C CA    . ASN C 1 76  ? -7.343  32.937  -80.283  1.00 18.17 ? 54   ASN C CA    1 
ATOM   5404  C C     . ASN C 1 76  ? -8.576  32.406  -80.980  1.00 16.73 ? 54   ASN C C     1 
ATOM   5405  O O     . ASN C 1 76  ? -8.917  32.806  -82.091  1.00 18.56 ? 54   ASN C O     1 
ATOM   5406  C CB    . ASN C 1 76  ? -6.617  33.939  -81.181  1.00 19.28 ? 54   ASN C CB    1 
ATOM   5407  C CG    . ASN C 1 76  ? -5.769  33.277  -82.225  1.00 18.79 ? 54   ASN C CG    1 
ATOM   5408  O OD1   . ASN C 1 76  ? -5.699  32.041  -82.296  1.00 15.63 ? 54   ASN C OD1   1 
ATOM   5409  N ND2   . ASN C 1 76  ? -5.102  34.091  -83.038  1.00 11.46 ? 54   ASN C ND2   1 
ATOM   5410  N N     . MET C 1 77  ? -9.252  31.503  -80.302  1.00 15.97 ? 55   MET C N     1 
ATOM   5411  C CA    . MET C 1 77  ? -10.480 30.928  -80.802  1.00 16.62 ? 55   MET C CA    1 
ATOM   5412  C C     . MET C 1 77  ? -11.638 31.702  -80.173  1.00 16.85 ? 55   MET C C     1 
ATOM   5413  O O     . MET C 1 77  ? -11.454 32.390  -79.180  1.00 17.46 ? 55   MET C O     1 
ATOM   5414  C CB    . MET C 1 77  ? -10.520 29.428  -80.481  1.00 16.39 ? 55   MET C CB    1 
ATOM   5415  C CG    . MET C 1 77  ? -9.245  28.691  -80.906  1.00 17.09 ? 55   MET C CG    1 
ATOM   5416  S SD    . MET C 1 77  ? -9.185  26.900  -80.657  1.00 17.45 ? 55   MET C SD    1 
ATOM   5417  C CE    . MET C 1 77  ? -10.828 26.410  -81.173  1.00 23.76 ? 55   MET C CE    1 
ATOM   5418  N N     . ASP C 1 78  ? -12.818 31.591  -80.767  1.00 19.85 ? 56   ASP C N     1 
ATOM   5419  C CA    . ASP C 1 78  ? -13.984 32.428  -80.420  1.00 22.38 ? 56   ASP C CA    1 
ATOM   5420  C C     . ASP C 1 78  ? -14.433 32.298  -78.976  1.00 21.75 ? 56   ASP C C     1 
ATOM   5421  O O     . ASP C 1 78  ? -14.872 33.281  -78.351  1.00 23.76 ? 56   ASP C O     1 
ATOM   5422  C CB    . ASP C 1 78  ? -15.151 32.108  -81.357  1.00 23.24 ? 56   ASP C CB    1 
ATOM   5423  C CG    . ASP C 1 78  ? -14.893 32.580  -82.791  1.00 30.97 ? 56   ASP C CG    1 
ATOM   5424  O OD1   . ASP C 1 78  ? -15.175 33.774  -83.069  1.00 34.48 ? 56   ASP C OD1   1 
ATOM   5425  O OD2   . ASP C 1 78  ? -14.422 31.763  -83.637  1.00 36.39 ? 56   ASP C OD2   1 
ATOM   5426  N N     . THR C 1 79  ? -14.318 31.092  -78.448  1.00 20.49 ? 57   THR C N     1 
ATOM   5427  C CA    . THR C 1 79  ? -14.902 30.777  -77.145  1.00 21.77 ? 57   THR C CA    1 
ATOM   5428  C C     . THR C 1 79  ? -13.916 30.990  -76.005  1.00 20.27 ? 57   THR C C     1 
ATOM   5429  O O     . THR C 1 79  ? -14.307 31.390  -74.913  1.00 17.35 ? 57   THR C O     1 
ATOM   5430  C CB    . THR C 1 79  ? -15.390 29.314  -77.147  1.00 23.27 ? 57   THR C CB    1 
ATOM   5431  O OG1   . THR C 1 79  ? -14.461 28.529  -77.925  1.00 28.00 ? 57   THR C OG1   1 
ATOM   5432  C CG2   . THR C 1 79  ? -16.811 29.215  -77.765  1.00 20.22 ? 57   THR C CG2   1 
ATOM   5433  N N     . VAL C 1 80  ? -12.638 30.729  -76.277  1.00 18.11 ? 58   VAL C N     1 
ATOM   5434  C CA    . VAL C 1 80  ? -11.608 30.756  -75.246  1.00 17.62 ? 58   VAL C CA    1 
ATOM   5435  C C     . VAL C 1 80  ? -10.753 32.042  -75.281  1.00 16.52 ? 58   VAL C C     1 
ATOM   5436  O O     . VAL C 1 80  ? -10.317 32.530  -74.231  1.00 15.54 ? 58   VAL C O     1 
ATOM   5437  C CB    . VAL C 1 80  ? -10.710 29.474  -75.314  1.00 17.45 ? 58   VAL C CB    1 
ATOM   5438  C CG1   . VAL C 1 80  ? -11.575 28.216  -75.136  1.00 21.07 ? 58   VAL C CG1   1 
ATOM   5439  C CG2   . VAL C 1 80  ? -9.884  29.399  -76.647  1.00 16.66 ? 58   VAL C CG2   1 
ATOM   5440  N N     . GLY C 1 81  ? -10.517 32.587  -76.476  1.00 15.63 ? 59   GLY C N     1 
ATOM   5441  C CA    . GLY C 1 81  ? -9.720  33.800  -76.622  1.00 15.68 ? 59   GLY C CA    1 
ATOM   5442  C C     . GLY C 1 81  ? -10.505 35.074  -76.323  1.00 14.29 ? 59   GLY C C     1 
ATOM   5443  O O     . GLY C 1 81  ? -10.544 35.982  -77.157  1.00 13.35 ? 59   GLY C O     1 
ATOM   5444  N N     . THR C 1 82  ? -11.084 35.144  -75.121  1.00 13.91 ? 60   THR C N     1 
ATOM   5445  C CA    . THR C 1 82  ? -11.980 36.227  -74.733  1.00 14.07 ? 60   THR C CA    1 
ATOM   5446  C C     . THR C 1 82  ? -11.327 37.165  -73.718  1.00 13.95 ? 60   THR C C     1 
ATOM   5447  O O     . THR C 1 82  ? -10.363 36.797  -73.073  1.00 14.14 ? 60   THR C O     1 
ATOM   5448  C CB    . THR C 1 82  ? -13.327 35.680  -74.078  1.00 15.33 ? 60   THR C CB    1 
ATOM   5449  O OG1   . THR C 1 82  ? -13.042 34.988  -72.850  1.00 14.00 ? 60   THR C OG1   1 
ATOM   5450  C CG2   . THR C 1 82  ? -14.108 34.747  -75.024  1.00 12.06 ? 60   THR C CG2   1 
ATOM   5451  N N     . PHE C 1 83  ? -11.879 38.365  -73.574  1.00 12.85 ? 61   PHE C N     1 
ATOM   5452  C CA    . PHE C 1 83  ? -11.408 39.317  -72.554  1.00 13.92 ? 61   PHE C CA    1 
ATOM   5453  C C     . PHE C 1 83  ? -11.667 38.830  -71.139  1.00 15.49 ? 61   PHE C C     1 
ATOM   5454  O O     . PHE C 1 83  ? -10.896 39.121  -70.226  1.00 16.23 ? 61   PHE C O     1 
ATOM   5455  C CB    . PHE C 1 83  ? -12.082 40.697  -72.671  1.00 12.49 ? 61   PHE C CB    1 
ATOM   5456  C CG    . PHE C 1 83  ? -11.760 41.417  -73.928  1.00 10.97 ? 61   PHE C CG    1 
ATOM   5457  C CD1   . PHE C 1 83  ? -10.456 41.489  -74.386  1.00 9.95  ? 61   PHE C CD1   1 
ATOM   5458  C CD2   . PHE C 1 83  ? -12.754 42.021  -74.663  1.00 11.04 ? 61   PHE C CD2   1 
ATOM   5459  C CE1   . PHE C 1 83  ? -10.159 42.151  -75.547  1.00 8.73  ? 61   PHE C CE1   1 
ATOM   5460  C CE2   . PHE C 1 83  ? -12.444 42.675  -75.830  1.00 9.80  ? 61   PHE C CE2   1 
ATOM   5461  C CZ    . PHE C 1 83  ? -11.137 42.723  -76.267  1.00 5.75  ? 61   PHE C CZ    1 
ATOM   5462  N N     . GLU C 1 84  ? -12.766 38.121  -70.936  1.00 16.19 ? 62   GLU C N     1 
ATOM   5463  C CA    . GLU C 1 84  ? -13.049 37.618  -69.599  1.00 17.95 ? 62   GLU C CA    1 
ATOM   5464  C C     . GLU C 1 84  ? -12.003 36.549  -69.248  1.00 17.49 ? 62   GLU C C     1 
ATOM   5465  O O     . GLU C 1 84  ? -11.509 36.503  -68.134  1.00 18.43 ? 62   GLU C O     1 
ATOM   5466  C CB    . GLU C 1 84  ? -14.501 37.094  -69.426  1.00 18.61 ? 62   GLU C CB    1 
ATOM   5467  C CG    . GLU C 1 84  ? -15.583 38.079  -69.821  1.00 21.06 ? 62   GLU C CG    1 
ATOM   5468  C CD    . GLU C 1 84  ? -15.727 38.216  -71.338  1.00 27.88 ? 62   GLU C CD    1 
ATOM   5469  O OE1   . GLU C 1 84  ? -15.873 37.156  -71.993  1.00 24.29 ? 62   GLU C OE1   1 
ATOM   5470  O OE2   . GLU C 1 84  ? -15.681 39.367  -71.867  1.00 30.77 ? 62   GLU C OE2   1 
ATOM   5471  N N     . MET C 1 85  ? -11.649 35.711  -70.205  1.00 17.87 ? 63   MET C N     1 
ATOM   5472  C CA    . MET C 1 85  ? -10.603 34.715  -69.969  1.00 19.27 ? 63   MET C CA    1 
ATOM   5473  C C     . MET C 1 85  ? -9.280  35.422  -69.691  1.00 19.21 ? 63   MET C C     1 
ATOM   5474  O O     . MET C 1 85  ? -8.585  35.049  -68.768  1.00 20.84 ? 63   MET C O     1 
ATOM   5475  C CB    . MET C 1 85  ? -10.450 33.723  -71.133  1.00 18.66 ? 63   MET C CB    1 
ATOM   5476  C CG    . MET C 1 85  ? -9.766  32.415  -70.724  1.00 24.59 ? 63   MET C CG    1 
ATOM   5477  S SD    . MET C 1 85  ? -10.933 31.116  -70.236  1.00 25.95 ? 63   MET C SD    1 
ATOM   5478  C CE    . MET C 1 85  ? -11.237 30.296  -71.785  1.00 26.61 ? 63   MET C CE    1 
ATOM   5479  N N     . ALA C 1 86  ? -8.961  36.461  -70.455  1.00 18.73 ? 64   ALA C N     1 
ATOM   5480  C CA    . ALA C 1 86  ? -7.689  37.193  -70.293  1.00 17.59 ? 64   ALA C CA    1 
ATOM   5481  C C     . ALA C 1 86  ? -7.515  37.770  -68.899  1.00 16.75 ? 64   ALA C C     1 
ATOM   5482  O O     . ALA C 1 86  ? -6.414  37.840  -68.363  1.00 17.77 ? 64   ALA C O     1 
ATOM   5483  C CB    . ALA C 1 86  ? -7.602  38.312  -71.303  1.00 17.12 ? 64   ALA C CB    1 
ATOM   5484  N N     . ALA C 1 87  ? -8.614  38.210  -68.327  1.00 15.31 ? 65   ALA C N     1 
ATOM   5485  C CA    . ALA C 1 87  ? -8.591  38.873  -67.042  1.00 15.09 ? 65   ALA C CA    1 
ATOM   5486  C C     . ALA C 1 87  ? -8.152  37.910  -65.950  1.00 15.46 ? 65   ALA C C     1 
ATOM   5487  O O     . ALA C 1 87  ? -7.514  38.305  -64.975  1.00 15.65 ? 65   ALA C O     1 
ATOM   5488  C CB    . ALA C 1 87  ? -9.980  39.466  -66.744  1.00 14.06 ? 65   ALA C CB    1 
ATOM   5489  N N     . VAL C 1 88  ? -8.539  36.648  -66.114  1.00 17.49 ? 66   VAL C N     1 
ATOM   5490  C CA    . VAL C 1 88  ? -8.162  35.569  -65.184  1.00 17.27 ? 66   VAL C CA    1 
ATOM   5491  C C     . VAL C 1 88  ? -6.741  35.079  -65.474  1.00 16.26 ? 66   VAL C C     1 
ATOM   5492  O O     . VAL C 1 88  ? -5.953  34.856  -64.582  1.00 16.84 ? 66   VAL C O     1 
ATOM   5493  C CB    . VAL C 1 88  ? -9.133  34.378  -65.284  1.00 16.44 ? 66   VAL C CB    1 
ATOM   5494  C CG1   . VAL C 1 88  ? -8.747  33.297  -64.312  1.00 18.21 ? 66   VAL C CG1   1 
ATOM   5495  C CG2   . VAL C 1 88  ? -10.541 34.839  -65.009  1.00 20.53 ? 66   VAL C CG2   1 
ATOM   5496  N N     . MET C 1 89  ? -6.429  34.910  -66.739  1.00 16.80 ? 67   MET C N     1 
ATOM   5497  C CA    . MET C 1 89  ? -5.120  34.435  -67.144  1.00 17.29 ? 67   MET C CA    1 
ATOM   5498  C C     . MET C 1 89  ? -4.007  35.366  -66.691  1.00 17.41 ? 67   MET C C     1 
ATOM   5499  O O     . MET C 1 89  ? -2.954  34.941  -66.230  1.00 17.81 ? 67   MET C O     1 
ATOM   5500  C CB    . MET C 1 89  ? -5.103  34.316  -68.660  1.00 16.71 ? 67   MET C CB    1 
ATOM   5501  C CG    . MET C 1 89  ? -6.033  33.247  -69.193  1.00 20.17 ? 67   MET C CG    1 
ATOM   5502  S SD    . MET C 1 89  ? -5.565  31.566  -68.741  1.00 22.57 ? 67   MET C SD    1 
ATOM   5503  C CE    . MET C 1 89  ? -7.173  30.798  -68.723  1.00 28.18 ? 67   MET C CE    1 
ATOM   5504  N N     . SER C 1 90  ? -4.248  36.651  -66.859  1.00 19.62 ? 68   SER C N     1 
ATOM   5505  C CA    . SER C 1 90  ? -3.281  37.680  -66.528  1.00 19.83 ? 68   SER C CA    1 
ATOM   5506  C C     . SER C 1 90  ? -2.956  37.663  -65.034  1.00 20.94 ? 68   SER C C     1 
ATOM   5507  O O     . SER C 1 90  ? -1.811  37.915  -64.671  1.00 21.72 ? 68   SER C O     1 
ATOM   5508  C CB    . SER C 1 90  ? -3.796  39.052  -67.009  1.00 18.29 ? 68   SER C CB    1 
ATOM   5509  O OG    . SER C 1 90  ? -3.026  40.108  -66.492  1.00 19.47 ? 68   SER C OG    1 
ATOM   5510  N N     . GLN C 1 91  ? -3.944  37.350  -64.186  1.00 21.45 ? 69   GLN C N     1 
ATOM   5511  C CA    . GLN C 1 91  ? -3.720  37.166  -62.738  1.00 21.61 ? 69   GLN C CA    1 
ATOM   5512  C C     . GLN C 1 91  ? -2.661  36.095  -62.443  1.00 21.48 ? 69   GLN C C     1 
ATOM   5513  O O     . GLN C 1 91  ? -1.938  36.195  -61.445  1.00 22.04 ? 69   GLN C O     1 
ATOM   5514  C CB    . GLN C 1 91  ? -5.022  36.784  -62.022  1.00 22.30 ? 69   GLN C CB    1 
ATOM   5515  C CG    . GLN C 1 91  ? -6.068  37.884  -61.937  1.00 26.11 ? 69   GLN C CG    1 
ATOM   5516  C CD    . GLN C 1 91  ? -7.396  37.381  -61.341  1.00 32.54 ? 69   GLN C CD    1 
ATOM   5517  O OE1   . GLN C 1 91  ? -7.433  36.919  -60.210  1.00 36.27 ? 69   GLN C OE1   1 
ATOM   5518  N NE2   . GLN C 1 91  ? -8.485  37.488  -62.101  1.00 33.69 ? 69   GLN C NE2   1 
ATOM   5519  N N     . HIS C 1 92  ? -2.576  35.080  -63.307  1.00 19.64 ? 70   HIS C N     1 
ATOM   5520  C CA    . HIS C 1 92  ? -1.592  34.005  -63.157  1.00 18.83 ? 70   HIS C CA    1 
ATOM   5521  C C     . HIS C 1 92  ? -0.346  34.225  -64.007  1.00 19.65 ? 70   HIS C C     1 
ATOM   5522  O O     . HIS C 1 92  ? 0.432   33.284  -64.221  1.00 20.44 ? 70   HIS C O     1 
ATOM   5523  C CB    . HIS C 1 92  ? -2.228  32.665  -63.484  1.00 16.47 ? 70   HIS C CB    1 
ATOM   5524  C CG    . HIS C 1 92  ? -3.331  32.302  -62.553  1.00 18.19 ? 70   HIS C CG    1 
ATOM   5525  N ND1   . HIS C 1 92  ? -3.131  31.523  -61.435  1.00 21.33 ? 70   HIS C ND1   1 
ATOM   5526  C CD2   . HIS C 1 92  ? -4.636  32.646  -62.544  1.00 17.83 ? 70   HIS C CD2   1 
ATOM   5527  C CE1   . HIS C 1 92  ? -4.270  31.397  -60.781  1.00 22.10 ? 70   HIS C CE1   1 
ATOM   5528  N NE2   . HIS C 1 92  ? -5.197  32.076  -61.428  1.00 20.49 ? 70   HIS C NE2   1 
ATOM   5529  N N     . SER C 1 93  ? -0.151  35.460  -64.467  1.00 20.04 ? 71   SER C N     1 
ATOM   5530  C CA    . SER C 1 93  ? 0.952   35.803  -65.382  1.00 21.59 ? 71   SER C CA    1 
ATOM   5531  C C     . SER C 1 93  ? 0.879   35.021  -66.699  1.00 20.71 ? 71   SER C C     1 
ATOM   5532  O O     . SER C 1 93  ? 1.910   34.852  -67.369  1.00 19.92 ? 71   SER C O     1 
ATOM   5533  C CB    . SER C 1 93  ? 2.346   35.559  -64.736  1.00 22.16 ? 71   SER C CB    1 
ATOM   5534  O OG    . SER C 1 93  ? 2.607   36.421  -63.646  1.00 27.53 ? 71   SER C OG    1 
ATOM   5535  N N     . MET C 1 94  ? -0.320  34.555  -67.071  1.00 20.62 ? 72   MET C N     1 
ATOM   5536  C CA    . MET C 1 94  ? -0.469  33.798  -68.331  1.00 21.64 ? 72   MET C CA    1 
ATOM   5537  C C     . MET C 1 94  ? -1.058  34.667  -69.442  1.00 21.27 ? 72   MET C C     1 
ATOM   5538  O O     . MET C 1 94  ? -1.639  35.728  -69.192  1.00 21.72 ? 72   MET C O     1 
ATOM   5539  C CB    . MET C 1 94  ? -1.284  32.518  -68.163  1.00 22.25 ? 72   MET C CB    1 
ATOM   5540  C CG    . MET C 1 94  ? -0.523  31.410  -67.445  1.00 23.97 ? 72   MET C CG    1 
ATOM   5541  S SD    . MET C 1 94  ? -1.631  30.388  -66.468  1.00 21.16 ? 72   MET C SD    1 
ATOM   5542  C CE    . MET C 1 94  ? -2.101  29.251  -67.758  1.00 23.26 ? 72   MET C CE    1 
ATOM   5543  N N     . PHE C 1 95  ? -0.881  34.179  -70.667  1.00 19.61 ? 73   PHE C N     1 
ATOM   5544  C CA    . PHE C 1 95  ? -1.078  34.948  -71.891  1.00 18.52 ? 73   PHE C CA    1 
ATOM   5545  C C     . PHE C 1 95  ? -2.347  34.562  -72.623  1.00 17.32 ? 73   PHE C C     1 
ATOM   5546  O O     . PHE C 1 95  ? -2.741  33.398  -72.630  1.00 18.10 ? 73   PHE C O     1 
ATOM   5547  C CB    . PHE C 1 95  ? 0.134   34.718  -72.812  1.00 19.41 ? 73   PHE C CB    1 
ATOM   5548  C CG    . PHE C 1 95  ? 0.316   35.775  -73.829  1.00 19.12 ? 73   PHE C CG    1 
ATOM   5549  C CD1   . PHE C 1 95  ? 0.880   36.982  -73.478  1.00 13.71 ? 73   PHE C CD1   1 
ATOM   5550  C CD2   . PHE C 1 95  ? -0.117  35.583  -75.127  1.00 23.20 ? 73   PHE C CD2   1 
ATOM   5551  C CE1   . PHE C 1 95  ? 1.025   37.970  -74.416  1.00 20.18 ? 73   PHE C CE1   1 
ATOM   5552  C CE2   . PHE C 1 95  ? 0.027   36.574  -76.076  1.00 20.00 ? 73   PHE C CE2   1 
ATOM   5553  C CZ    . PHE C 1 95  ? 0.593   37.768  -75.724  1.00 18.43 ? 73   PHE C CZ    1 
ATOM   5554  N N     . THR C 1 96  ? -3.004  35.541  -73.236  1.00 16.33 ? 74   THR C N     1 
ATOM   5555  C CA    . THR C 1 96  ? -4.227  35.257  -73.982  1.00 15.65 ? 74   THR C CA    1 
ATOM   5556  C C     . THR C 1 96  ? -4.067  35.872  -75.347  1.00 15.98 ? 74   THR C C     1 
ATOM   5557  O O     . THR C 1 96  ? -3.698  37.053  -75.483  1.00 15.37 ? 74   THR C O     1 
ATOM   5558  C CB    . THR C 1 96  ? -5.523  35.737  -73.259  1.00 15.60 ? 74   THR C CB    1 
ATOM   5559  O OG1   . THR C 1 96  ? -5.592  35.142  -71.957  1.00 14.70 ? 74   THR C OG1   1 
ATOM   5560  C CG2   . THR C 1 96  ? -6.757  35.327  -74.024  1.00 11.28 ? 74   THR C CG2   1 
ATOM   5561  N N     . ALA C 1 97  ? -4.276  35.036  -76.362  1.00 16.12 ? 75   ALA C N     1 
ATOM   5562  C CA    . ALA C 1 97  ? -4.421  35.499  -77.742  1.00 15.33 ? 75   ALA C CA    1 
ATOM   5563  C C     . ALA C 1 97  ? -5.932  35.720  -77.947  1.00 16.59 ? 75   ALA C C     1 
ATOM   5564  O O     . ALA C 1 97  ? -6.761  34.788  -77.830  1.00 14.91 ? 75   ALA C O     1 
ATOM   5565  C CB    . ALA C 1 97  ? -3.873  34.493  -78.692  1.00 13.90 ? 75   ALA C CB    1 
ATOM   5566  N N     . ILE C 1 98  ? -6.281  36.989  -78.166  1.00 17.36 ? 76   ILE C N     1 
ATOM   5567  C CA    . ILE C 1 98  ? -7.656  37.405  -78.258  1.00 15.42 ? 76   ILE C CA    1 
ATOM   5568  C C     . ILE C 1 98  ? -8.156  37.177  -79.679  1.00 16.45 ? 76   ILE C C     1 
ATOM   5569  O O     . ILE C 1 98  ? -7.482  37.510  -80.649  1.00 16.41 ? 76   ILE C O     1 
ATOM   5570  C CB    . ILE C 1 98  ? -7.804  38.879  -77.829  1.00 15.47 ? 76   ILE C CB    1 
ATOM   5571  C CG1   . ILE C 1 98  ? -7.238  39.065  -76.415  1.00 15.80 ? 76   ILE C CG1   1 
ATOM   5572  C CG2   . ILE C 1 98  ? -9.286  39.350  -77.907  1.00 11.93 ? 76   ILE C CG2   1 
ATOM   5573  C CD1   . ILE C 1 98  ? -7.975  38.287  -75.319  1.00 16.79 ? 76   ILE C CD1   1 
ATOM   5574  N N     . HIS C 1 99  ? -9.335  36.585  -79.798  1.00 17.58 ? 77   HIS C N     1 
ATOM   5575  C CA    . HIS C 1 99  ? -9.889  36.273  -81.086  1.00 17.42 ? 77   HIS C CA    1 
ATOM   5576  C C     . HIS C 1 99  ? -10.098 37.548  -81.897  1.00 17.80 ? 77   HIS C C     1 
ATOM   5577  O O     . HIS C 1 99  ? -10.287 38.616  -81.329  1.00 17.77 ? 77   HIS C O     1 
ATOM   5578  C CB    . HIS C 1 99  ? -11.190 35.453  -80.913  1.00 17.99 ? 77   HIS C CB    1 
ATOM   5579  C CG    . HIS C 1 99  ? -12.359 36.231  -80.389  1.00 14.69 ? 77   HIS C CG    1 
ATOM   5580  N ND1   . HIS C 1 99  ? -12.926 37.280  -81.077  1.00 22.40 ? 77   HIS C ND1   1 
ATOM   5581  C CD2   . HIS C 1 99  ? -13.125 36.055  -79.287  1.00 16.94 ? 77   HIS C CD2   1 
ATOM   5582  C CE1   . HIS C 1 99  ? -13.958 37.752  -80.395  1.00 15.63 ? 77   HIS C CE1   1 
ATOM   5583  N NE2   . HIS C 1 99  ? -14.102 37.024  -79.306  1.00 9.77  ? 77   HIS C NE2   1 
ATOM   5584  N N     . LYS C 1 100 ? -10.073 37.428  -83.224  1.00 18.72 ? 78   LYS C N     1 
ATOM   5585  C CA    . LYS C 1 100 ? -10.063 38.593  -84.099  1.00 17.97 ? 78   LYS C CA    1 
ATOM   5586  C C     . LYS C 1 100 ? -11.414 39.276  -84.349  1.00 16.60 ? 78   LYS C C     1 
ATOM   5587  O O     . LYS C 1 100 ? -11.495 40.209  -85.142  1.00 16.92 ? 78   LYS C O     1 
ATOM   5588  C CB    . LYS C 1 100 ? -9.451  38.196  -85.430  1.00 18.08 ? 78   LYS C CB    1 
ATOM   5589  C CG    . LYS C 1 100 ? -10.280 37.228  -86.270  1.00 20.51 ? 78   LYS C CG    1 
ATOM   5590  C CD    . LYS C 1 100 ? -9.753  37.207  -87.699  1.00 22.98 ? 78   LYS C CD    1 
ATOM   5591  C CE    . LYS C 1 100 ? -10.645 36.398  -88.597  1.00 23.36 ? 78   LYS C CE    1 
ATOM   5592  N NZ    . LYS C 1 100 ? -10.119 36.430  -89.966  1.00 24.21 ? 78   LYS C NZ    1 
ATOM   5593  N N     . HIS C 1 101 ? -12.465 38.835  -83.666  1.00 16.82 ? 79   HIS C N     1 
ATOM   5594  C CA    . HIS C 1 101 ? -13.829 39.291  -83.957  1.00 17.54 ? 79   HIS C CA    1 
ATOM   5595  C C     . HIS C 1 101 ? -14.370 40.276  -82.966  1.00 17.46 ? 79   HIS C C     1 
ATOM   5596  O O     . HIS C 1 101 ? -15.499 40.687  -83.082  1.00 20.79 ? 79   HIS C O     1 
ATOM   5597  C CB    . HIS C 1 101 ? -14.770 38.099  -84.045  1.00 18.26 ? 79   HIS C CB    1 
ATOM   5598  C CG    . HIS C 1 101 ? -14.393 37.149  -85.132  1.00 19.45 ? 79   HIS C CG    1 
ATOM   5599  N ND1   . HIS C 1 101 ? -14.573 37.442  -86.469  1.00 13.50 ? 79   HIS C ND1   1 
ATOM   5600  C CD2   . HIS C 1 101 ? -13.802 35.934  -85.084  1.00 17.06 ? 79   HIS C CD2   1 
ATOM   5601  C CE1   . HIS C 1 101 ? -14.130 36.432  -87.196  1.00 20.42 ? 79   HIS C CE1   1 
ATOM   5602  N NE2   . HIS C 1 101 ? -13.649 35.509  -86.381  1.00 18.04 ? 79   HIS C NE2   1 
ATOM   5603  N N     . TYR C 1 102 ? -13.567 40.662  -81.989  1.00 17.03 ? 80   TYR C N     1 
ATOM   5604  C CA    . TYR C 1 102 ? -13.923 41.785  -81.134  1.00 15.73 ? 80   TYR C CA    1 
ATOM   5605  C C     . TYR C 1 102 ? -13.762 43.077  -81.907  1.00 15.80 ? 80   TYR C C     1 
ATOM   5606  O O     . TYR C 1 102 ? -12.817 43.234  -82.669  1.00 16.67 ? 80   TYR C O     1 
ATOM   5607  C CB    . TYR C 1 102 ? -13.048 41.881  -79.885  1.00 15.58 ? 80   TYR C CB    1 
ATOM   5608  C CG    . TYR C 1 102 ? -13.385 40.948  -78.745  1.00 14.74 ? 80   TYR C CG    1 
ATOM   5609  C CD1   . TYR C 1 102 ? -14.622 41.006  -78.103  1.00 16.68 ? 80   TYR C CD1   1 
ATOM   5610  C CD2   . TYR C 1 102 ? -12.434 40.056  -78.259  1.00 13.28 ? 80   TYR C CD2   1 
ATOM   5611  C CE1   . TYR C 1 102 ? -14.908 40.167  -77.019  1.00 16.96 ? 80   TYR C CE1   1 
ATOM   5612  C CE2   . TYR C 1 102 ? -12.696 39.215  -77.181  1.00 15.99 ? 80   TYR C CE2   1 
ATOM   5613  C CZ    . TYR C 1 102 ? -13.934 39.263  -76.571  1.00 15.42 ? 80   TYR C CZ    1 
ATOM   5614  O OH    . TYR C 1 102 ? -14.186 38.442  -75.512  1.00 13.41 ? 80   TYR C OH    1 
ATOM   5615  N N     . SER C 1 103 ? -14.683 44.004  -81.672  1.00 16.47 ? 81   SER C N     1 
ATOM   5616  C CA    . SER C 1 103 ? -14.657 45.326  -82.284  1.00 15.43 ? 81   SER C CA    1 
ATOM   5617  C C     . SER C 1 103 ? -13.606 46.214  -81.645  1.00 15.67 ? 81   SER C C     1 
ATOM   5618  O O     . SER C 1 103 ? -13.108 45.952  -80.548  1.00 16.75 ? 81   SER C O     1 
ATOM   5619  C CB    . SER C 1 103 ? -16.030 46.015  -82.166  1.00 16.72 ? 81   SER C CB    1 
ATOM   5620  O OG    . SER C 1 103 ? -16.414 46.263  -80.805  1.00 14.46 ? 81   SER C OG    1 
ATOM   5621  N N     . LEU C 1 104 ? -13.283 47.282  -82.351  1.00 16.49 ? 82   LEU C N     1 
ATOM   5622  C CA    . LEU C 1 104 ? -12.423 48.329  -81.824  1.00 16.51 ? 82   LEU C CA    1 
ATOM   5623  C C     . LEU C 1 104 ? -12.975 48.866  -80.489  1.00 15.12 ? 82   LEU C C     1 
ATOM   5624  O O     . LEU C 1 104 ? -12.232 49.065  -79.539  1.00 14.75 ? 82   LEU C O     1 
ATOM   5625  C CB    . LEU C 1 104 ? -12.309 49.464  -82.848  1.00 16.39 ? 82   LEU C CB    1 
ATOM   5626  C CG    . LEU C 1 104 ? -11.419 50.640  -82.451  1.00 17.92 ? 82   LEU C CG    1 
ATOM   5627  C CD1   . LEU C 1 104 ? -9.993  50.153  -82.215  1.00 17.64 ? 82   LEU C CD1   1 
ATOM   5628  C CD2   . LEU C 1 104 ? -11.486 51.751  -83.511  1.00 18.22 ? 82   LEU C CD2   1 
ATOM   5629  N N     . ASP C 1 105 ? -14.275 49.105  -80.424  1.00 14.51 ? 83   ASP C N     1 
ATOM   5630  C CA    . ASP C 1 105 ? -14.903 49.532  -79.171  1.00 14.61 ? 83   ASP C CA    1 
ATOM   5631  C C     . ASP C 1 105 ? -14.727 48.539  -78.028  1.00 14.33 ? 83   ASP C C     1 
ATOM   5632  O O     . ASP C 1 105 ? -14.489 48.922  -76.889  1.00 13.62 ? 83   ASP C O     1 
ATOM   5633  C CB    . ASP C 1 105 ? -16.392 49.803  -79.356  1.00 13.21 ? 83   ASP C CB    1 
ATOM   5634  C CG    . ASP C 1 105 ? -16.661 51.129  -80.040  1.00 20.27 ? 83   ASP C CG    1 
ATOM   5635  O OD1   . ASP C 1 105 ? -16.174 52.181  -79.551  1.00 21.15 ? 83   ASP C OD1   1 
ATOM   5636  O OD2   . ASP C 1 105 ? -17.372 51.119  -81.078  1.00 32.47 ? 83   ASP C OD2   1 
ATOM   5637  N N     . ASP C 1 106 ? -14.843 47.256  -78.338  1.00 15.76 ? 84   ASP C N     1 
ATOM   5638  C CA    . ASP C 1 106 ? -14.666 46.214  -77.335  1.00 14.66 ? 84   ASP C CA    1 
ATOM   5639  C C     . ASP C 1 106 ? -13.262 46.274  -76.763  1.00 14.81 ? 84   ASP C C     1 
ATOM   5640  O O     . ASP C 1 106 ? -13.088 46.147  -75.547  1.00 15.01 ? 84   ASP C O     1 
ATOM   5641  C CB    . ASP C 1 106 ? -14.932 44.817  -77.900  1.00 14.37 ? 84   ASP C CB    1 
ATOM   5642  C CG    . ASP C 1 106 ? -16.329 44.646  -78.431  1.00 14.68 ? 84   ASP C CG    1 
ATOM   5643  O OD1   . ASP C 1 106 ? -17.265 45.311  -77.931  1.00 21.14 ? 84   ASP C OD1   1 
ATOM   5644  O OD2   . ASP C 1 106 ? -16.495 43.828  -79.360  1.00 15.58 ? 84   ASP C OD2   1 
ATOM   5645  N N     . TRP C 1 107 ? -12.268 46.458  -77.629  1.00 14.66 ? 85   TRP C N     1 
ATOM   5646  C CA    . TRP C 1 107 ? -10.878 46.598  -77.176  1.00 15.79 ? 85   TRP C CA    1 
ATOM   5647  C C     . TRP C 1 107 ? -10.649 47.872  -76.351  1.00 16.28 ? 85   TRP C C     1 
ATOM   5648  O O     . TRP C 1 107 ? -9.951  47.845  -75.337  1.00 17.00 ? 85   TRP C O     1 
ATOM   5649  C CB    . TRP C 1 107 ? -9.918  46.610  -78.373  1.00 16.66 ? 85   TRP C CB    1 
ATOM   5650  C CG    . TRP C 1 107 ? -9.497  45.280  -78.809  1.00 14.69 ? 85   TRP C CG    1 
ATOM   5651  C CD1   . TRP C 1 107 ? -10.046 44.524  -79.796  1.00 16.75 ? 85   TRP C CD1   1 
ATOM   5652  C CD2   . TRP C 1 107 ? -8.416  44.527  -78.273  1.00 20.49 ? 85   TRP C CD2   1 
ATOM   5653  N NE1   . TRP C 1 107 ? -9.367  43.326  -79.907  1.00 18.40 ? 85   TRP C NE1   1 
ATOM   5654  C CE2   . TRP C 1 107 ? -8.363  43.304  -78.981  1.00 19.55 ? 85   TRP C CE2   1 
ATOM   5655  C CE3   . TRP C 1 107 ? -7.479  44.764  -77.262  1.00 21.02 ? 85   TRP C CE3   1 
ATOM   5656  C CZ2   . TRP C 1 107 ? -7.406  42.324  -78.714  1.00 24.31 ? 85   TRP C CZ2   1 
ATOM   5657  C CZ3   . TRP C 1 107 ? -6.531  43.771  -76.986  1.00 22.61 ? 85   TRP C CZ3   1 
ATOM   5658  C CH2   . TRP C 1 107 ? -6.505  42.572  -77.713  1.00 20.37 ? 85   TRP C CH2   1 
ATOM   5659  N N     . LYS C 1 108 ? -11.214 48.988  -76.807  1.00 15.88 ? 86   LYS C N     1 
ATOM   5660  C CA    . LYS C 1 108 ? -11.147 50.236  -76.065  1.00 15.88 ? 86   LYS C CA    1 
ATOM   5661  C C     . LYS C 1 108 ? -11.702 50.063  -74.650  1.00 15.89 ? 86   LYS C C     1 
ATOM   5662  O O     . LYS C 1 108 ? -11.114 50.567  -73.696  1.00 17.32 ? 86   LYS C O     1 
ATOM   5663  C CB    . LYS C 1 108 ? -11.913 51.348  -76.794  1.00 15.91 ? 86   LYS C CB    1 
ATOM   5664  C CG    . LYS C 1 108 ? -11.244 51.869  -78.066  1.00 14.78 ? 86   LYS C CG    1 
ATOM   5665  C CD    . LYS C 1 108 ? -11.896 53.159  -78.532  1.00 5.54  ? 86   LYS C CD    1 
ATOM   5666  C CE    . LYS C 1 108 ? -11.753 53.345  -80.040  1.00 14.95 ? 86   LYS C CE    1 
ATOM   5667  N NZ    . LYS C 1 108 ? -11.936 54.747  -80.546  1.00 3.41  ? 86   LYS C NZ    1 
ATOM   5668  N N     . LEU C 1 109 ? -12.831 49.357  -74.531  1.00 15.04 ? 87   LEU C N     1 
ATOM   5669  C CA    . LEU C 1 109 ? -13.467 49.114  -73.234  1.00 14.50 ? 87   LEU C CA    1 
ATOM   5670  C C     . LEU C 1 109 ? -12.587 48.257  -72.373  1.00 14.84 ? 87   LEU C C     1 
ATOM   5671  O O     . LEU C 1 109 ? -12.456 48.506  -71.196  1.00 16.27 ? 87   LEU C O     1 
ATOM   5672  C CB    . LEU C 1 109 ? -14.828 48.420  -73.384  1.00 12.91 ? 87   LEU C CB    1 
ATOM   5673  C CG    . LEU C 1 109 ? -15.663 48.259  -72.099  1.00 14.15 ? 87   LEU C CG    1 
ATOM   5674  C CD1   . LEU C 1 109 ? -16.066 49.615  -71.526  1.00 13.28 ? 87   LEU C CD1   1 
ATOM   5675  C CD2   . LEU C 1 109 ? -16.904 47.430  -72.333  1.00 12.26 ? 87   LEU C CD2   1 
ATOM   5676  N N     . PHE C 1 110 ? -11.993 47.236  -72.973  1.00 15.66 ? 88   PHE C N     1 
ATOM   5677  C CA    . PHE C 1 110 ? -11.100 46.340  -72.255  1.00 16.00 ? 88   PHE C CA    1 
ATOM   5678  C C     . PHE C 1 110 ? -9.871  47.077  -71.720  1.00 16.65 ? 88   PHE C C     1 
ATOM   5679  O O     . PHE C 1 110 ? -9.431  46.856  -70.599  1.00 17.03 ? 88   PHE C O     1 
ATOM   5680  C CB    . PHE C 1 110 ? -10.645 45.205  -73.173  1.00 13.83 ? 88   PHE C CB    1 
ATOM   5681  C CG    . PHE C 1 110 ? -9.791  44.207  -72.486  1.00 13.63 ? 88   PHE C CG    1 
ATOM   5682  C CD1   . PHE C 1 110 ? -10.290 43.500  -71.394  1.00 12.46 ? 88   PHE C CD1   1 
ATOM   5683  C CD2   . PHE C 1 110 ? -8.477  43.975  -72.910  1.00 15.11 ? 88   PHE C CD2   1 
ATOM   5684  C CE1   . PHE C 1 110 ? -9.524  42.570  -70.743  1.00 12.01 ? 88   PHE C CE1   1 
ATOM   5685  C CE2   . PHE C 1 110 ? -7.679  43.041  -72.254  1.00 12.31 ? 88   PHE C CE2   1 
ATOM   5686  C CZ    . PHE C 1 110 ? -8.206  42.331  -71.172  1.00 13.85 ? 88   PHE C CZ    1 
ATOM   5687  N N     . ALA C 1 111 ? -9.313  47.941  -72.545  1.00 17.68 ? 89   ALA C N     1 
ATOM   5688  C CA    . ALA C 1 111 ? -8.178  48.732  -72.144  1.00 17.93 ? 89   ALA C CA    1 
ATOM   5689  C C     . ALA C 1 111 ? -8.553  49.676  -71.003  1.00 18.01 ? 89   ALA C C     1 
ATOM   5690  O O     . ALA C 1 111 ? -7.771  49.872  -70.072  1.00 19.25 ? 89   ALA C O     1 
ATOM   5691  C CB    . ALA C 1 111 ? -7.666  49.505  -73.331  1.00 18.76 ? 89   ALA C CB    1 
ATOM   5692  N N     . THR C 1 112 ? -9.749  50.257  -71.078  1.00 17.61 ? 90   THR C N     1 
ATOM   5693  C CA    . THR C 1 112 ? -10.221 51.186  -70.065  1.00 17.28 ? 90   THR C CA    1 
ATOM   5694  C C     . THR C 1 112 ? -10.405 50.457  -68.741  1.00 16.76 ? 90   THR C C     1 
ATOM   5695  O O     . THR C 1 112 ? -9.953  50.946  -67.712  1.00 16.91 ? 90   THR C O     1 
ATOM   5696  C CB    . THR C 1 112 ? -11.509 51.912  -70.530  1.00 18.52 ? 90   THR C CB    1 
ATOM   5697  O OG1   . THR C 1 112 ? -11.206 52.712  -71.681  1.00 19.58 ? 90   THR C OG1   1 
ATOM   5698  C CG2   . THR C 1 112 ? -12.086 52.819  -69.444  1.00 17.06 ? 90   THR C CG2   1 
ATOM   5699  N N     . ASN C 1 113 ? -10.997 49.268  -68.791  1.00 16.03 ? 91   ASN C N     1 
ATOM   5700  C CA    . ASN C 1 113 ? -11.334 48.507  -67.597  1.00 15.94 ? 91   ASN C CA    1 
ATOM   5701  C C     . ASN C 1 113 ? -10.254 47.545  -67.102  1.00 15.50 ? 91   ASN C C     1 
ATOM   5702  O O     . ASN C 1 113 ? -10.189 47.310  -65.903  1.00 16.37 ? 91   ASN C O     1 
ATOM   5703  C CB    . ASN C 1 113 ? -12.666 47.800  -67.833  1.00 17.14 ? 91   ASN C CB    1 
ATOM   5704  C CG    . ASN C 1 113 ? -13.821 48.783  -67.925  1.00 20.50 ? 91   ASN C CG    1 
ATOM   5705  O OD1   . ASN C 1 113 ? -13.631 50.006  -67.829  1.00 17.80 ? 91   ASN C OD1   1 
ATOM   5706  N ND2   . ASN C 1 113 ? -15.032 48.253  -68.091  1.00 29.88 ? 91   ASN C ND2   1 
ATOM   5707  N N     . HIS C 1 114 ? -9.411  47.008  -67.987  1.00 14.42 ? 92   HIS C N     1 
ATOM   5708  C CA    . HIS C 1 114 ? -8.403  46.001  -67.591  1.00 15.97 ? 92   HIS C CA    1 
ATOM   5709  C C     . HIS C 1 114 ? -7.008  46.303  -68.110  1.00 16.54 ? 92   HIS C C     1 
ATOM   5710  O O     . HIS C 1 114 ? -6.382  45.469  -68.763  1.00 14.83 ? 92   HIS C O     1 
ATOM   5711  C CB    . HIS C 1 114 ? -8.860  44.606  -68.017  1.00 16.72 ? 92   HIS C CB    1 
ATOM   5712  C CG    . HIS C 1 114 ? -10.194 44.240  -67.457  1.00 19.67 ? 92   HIS C CG    1 
ATOM   5713  N ND1   . HIS C 1 114 ? -10.341 43.414  -66.369  1.00 25.41 ? 92   HIS C ND1   1 
ATOM   5714  C CD2   . HIS C 1 114 ? -11.441 44.656  -67.788  1.00 24.71 ? 92   HIS C CD2   1 
ATOM   5715  C CE1   . HIS C 1 114 ? -11.624 43.319  -66.065  1.00 27.59 ? 92   HIS C CE1   1 
ATOM   5716  N NE2   . HIS C 1 114 ? -12.314 44.058  -66.916  1.00 24.91 ? 92   HIS C NE2   1 
ATOM   5717  N N     . PRO C 1 115 ? -6.499  47.499  -67.782  1.00 18.57 ? 93   PRO C N     1 
ATOM   5718  C CA    . PRO C 1 115 ? -5.174  47.936  -68.245  1.00 19.82 ? 93   PRO C CA    1 
ATOM   5719  C C     . PRO C 1 115 ? -4.071  46.962  -67.861  1.00 21.39 ? 93   PRO C C     1 
ATOM   5720  O O     . PRO C 1 115 ? -3.149  46.732  -68.640  1.00 21.15 ? 93   PRO C O     1 
ATOM   5721  C CB    . PRO C 1 115 ? -4.961  49.283  -67.527  1.00 19.62 ? 93   PRO C CB    1 
ATOM   5722  C CG    . PRO C 1 115 ? -5.994  49.336  -66.444  1.00 20.70 ? 93   PRO C CG    1 
ATOM   5723  C CD    . PRO C 1 115 ? -7.149  48.513  -66.929  1.00 19.89 ? 93   PRO C CD    1 
ATOM   5724  N N     . GLU C 1 116 ? -4.182  46.393  -66.661  1.00 24.42 ? 94   GLU C N     1 
ATOM   5725  C CA    . GLU C 1 116 ? -3.208  45.390  -66.155  1.00 26.20 ? 94   GLU C CA    1 
ATOM   5726  C C     . GLU C 1 116 ? -3.017  44.145  -67.040  1.00 26.22 ? 94   GLU C C     1 
ATOM   5727  O O     . GLU C 1 116 ? -1.985  43.473  -66.972  1.00 26.18 ? 94   GLU C O     1 
ATOM   5728  C CB    . GLU C 1 116 ? -3.572  44.905  -64.739  1.00 26.18 ? 94   GLU C CB    1 
ATOM   5729  C CG    . GLU C 1 116 ? -4.874  44.073  -64.622  1.00 29.18 ? 94   GLU C CG    1 
ATOM   5730  C CD    . GLU C 1 116 ? -6.123  44.942  -64.486  1.00 30.56 ? 94   GLU C CD    1 
ATOM   5731  O OE1   . GLU C 1 116 ? -6.016  46.184  -64.611  1.00 28.39 ? 94   GLU C OE1   1 
ATOM   5732  O OE2   . GLU C 1 116 ? -7.212  44.377  -64.266  1.00 31.32 ? 94   GLU C OE2   1 
ATOM   5733  N N     . CYS C 1 117 ? -4.019  43.842  -67.863  1.00 26.52 ? 95   CYS C N     1 
ATOM   5734  C CA    . CYS C 1 117 ? -3.965  42.688  -68.780  1.00 25.22 ? 95   CYS C CA    1 
ATOM   5735  C C     . CYS C 1 117 ? -3.292  42.932  -70.132  1.00 23.71 ? 95   CYS C C     1 
ATOM   5736  O O     . CYS C 1 117 ? -2.961  41.980  -70.819  1.00 22.29 ? 95   CYS C O     1 
ATOM   5737  C CB    . CYS C 1 117 ? -5.380  42.211  -69.121  1.00 25.10 ? 95   CYS C CB    1 
ATOM   5738  S SG    . CYS C 1 117 ? -6.403  41.754  -67.743  1.00 27.99 ? 95   CYS C SG    1 
ATOM   5739  N N     . LEU C 1 118 ? -3.145  44.188  -70.538  1.00 22.96 ? 96   LEU C N     1 
ATOM   5740  C CA    . LEU C 1 118 ? -2.813  44.512  -71.916  1.00 22.44 ? 96   LEU C CA    1 
ATOM   5741  C C     . LEU C 1 118 ? -1.431  44.001  -72.298  1.00 23.57 ? 96   LEU C C     1 
ATOM   5742  O O     . LEU C 1 118 ? -1.160  43.766  -73.476  1.00 24.75 ? 96   LEU C O     1 
ATOM   5743  C CB    . LEU C 1 118 ? -2.937  46.022  -72.149  1.00 21.82 ? 96   LEU C CB    1 
ATOM   5744  C CG    . LEU C 1 118 ? -4.366  46.577  -71.939  1.00 21.78 ? 96   LEU C CG    1 
ATOM   5745  C CD1   . LEU C 1 118 ? -4.437  48.094  -72.163  1.00 20.05 ? 96   LEU C CD1   1 
ATOM   5746  C CD2   . LEU C 1 118 ? -5.411  45.864  -72.822  1.00 21.29 ? 96   LEU C CD2   1 
ATOM   5747  N N     . GLN C 1 119 ? -0.567  43.840  -71.296  1.00 23.08 ? 97   GLN C N     1 
ATOM   5748  C CA    A GLN C 1 119 ? 0.775   43.272  -71.448  0.50 21.56 ? 97   GLN C CA    1 
ATOM   5749  C CA    B GLN C 1 119 ? 0.768   43.295  -71.530  0.50 21.16 ? 97   GLN C CA    1 
ATOM   5750  C C     . GLN C 1 119 ? 0.735   41.773  -71.757  1.00 22.42 ? 97   GLN C C     1 
ATOM   5751  O O     . GLN C 1 119 ? 1.713   41.193  -72.259  1.00 22.86 ? 97   GLN C O     1 
ATOM   5752  C CB    A GLN C 1 119 ? 1.589   43.499  -70.159  0.50 21.39 ? 97   GLN C CB    1 
ATOM   5753  C CB    B GLN C 1 119 ? 1.714   43.665  -70.380  0.50 20.71 ? 97   GLN C CB    1 
ATOM   5754  C CG    A GLN C 1 119 ? 0.911   42.993  -68.851  0.50 18.21 ? 97   GLN C CG    1 
ATOM   5755  C CG    B GLN C 1 119 ? 2.331   45.068  -70.484  0.50 15.10 ? 97   GLN C CG    1 
ATOM   5756  C CD    A GLN C 1 119 ? 1.861   42.932  -67.657  0.50 13.19 ? 97   GLN C CD    1 
ATOM   5757  C CD    B GLN C 1 119 ? 1.316   46.185  -70.369  0.50 15.49 ? 97   GLN C CD    1 
ATOM   5758  O OE1   A GLN C 1 119 ? 2.789   42.119  -67.611  0.50 8.65  ? 97   GLN C OE1   1 
ATOM   5759  O OE1   B GLN C 1 119 ? 0.483   46.204  -69.459  0.50 4.31  ? 97   GLN C OE1   1 
ATOM   5760  N NE2   A GLN C 1 119 ? 1.627   43.795  -66.687  0.50 2.67  ? 97   GLN C NE2   1 
ATOM   5761  N NE2   B GLN C 1 119 ? 1.379   47.128  -71.297  0.50 19.87 ? 97   GLN C NE2   1 
ATOM   5762  N N     . ASN C 1 120 ? -0.392  41.140  -71.411  1.00 21.00 ? 98   ASN C N     1 
ATOM   5763  C CA    . ASN C 1 120 ? -0.567  39.698  -71.509  1.00 19.46 ? 98   ASN C CA    1 
ATOM   5764  C C     . ASN C 1 120 ? -1.576  39.251  -72.560  1.00 17.26 ? 98   ASN C C     1 
ATOM   5765  O O     . ASN C 1 120 ? -2.075  38.123  -72.503  1.00 17.22 ? 98   ASN C O     1 
ATOM   5766  C CB    . ASN C 1 120 ? -0.975  39.156  -70.144  1.00 21.13 ? 98   ASN C CB    1 
ATOM   5767  C CG    . ASN C 1 120 ? 0.138   39.268  -69.129  1.00 21.23 ? 98   ASN C CG    1 
ATOM   5768  O OD1   . ASN C 1 120 ? 1.218   38.674  -69.283  1.00 30.90 ? 98   ASN C OD1   1 
ATOM   5769  N ND2   . ASN C 1 120 ? -0.112  40.031  -68.086  1.00 23.80 ? 98   ASN C ND2   1 
ATOM   5770  N N     . VAL C 1 121 ? -1.874  40.126  -73.519  1.00 15.64 ? 99   VAL C N     1 
ATOM   5771  C CA    . VAL C 1 121 ? -2.749  39.782  -74.639  1.00 14.98 ? 99   VAL C CA    1 
ATOM   5772  C C     . VAL C 1 121 ? -2.065  40.054  -75.965  1.00 15.59 ? 99   VAL C C     1 
ATOM   5773  O O     . VAL C 1 121 ? -1.105  40.857  -76.056  1.00 14.30 ? 99   VAL C O     1 
ATOM   5774  C CB    . VAL C 1 121 ? -4.098  40.546  -74.643  1.00 14.75 ? 99   VAL C CB    1 
ATOM   5775  C CG1   . VAL C 1 121 ? -4.899  40.215  -73.413  1.00 16.08 ? 99   VAL C CG1   1 
ATOM   5776  C CG2   . VAL C 1 121 ? -3.885  42.077  -74.758  1.00 18.51 ? 99   VAL C CG2   1 
ATOM   5777  N N     . ALA C 1 122 ? -2.578  39.365  -76.983  1.00 16.22 ? 100  ALA C N     1 
ATOM   5778  C CA    . ALA C 1 122 ? -2.222  39.615  -78.369  1.00 16.33 ? 100  ALA C CA    1 
ATOM   5779  C C     . ALA C 1 122 ? -3.477  39.869  -79.161  1.00 17.12 ? 100  ALA C C     1 
ATOM   5780  O O     . ALA C 1 122 ? -4.526  39.236  -78.931  1.00 17.22 ? 100  ALA C O     1 
ATOM   5781  C CB    . ALA C 1 122 ? -1.483  38.433  -78.971  1.00 16.32 ? 100  ALA C CB    1 
ATOM   5782  N N     . VAL C 1 123 ? -3.362  40.807  -80.094  1.00 18.49 ? 101  VAL C N     1 
ATOM   5783  C CA    . VAL C 1 123 ? -4.440  41.087  -81.048  1.00 18.51 ? 101  VAL C CA    1 
ATOM   5784  C C     . VAL C 1 123 ? -4.223  40.186  -82.256  1.00 18.06 ? 101  VAL C C     1 
ATOM   5785  O O     . VAL C 1 123 ? -3.068  40.038  -82.728  1.00 16.80 ? 101  VAL C O     1 
ATOM   5786  C CB    . VAL C 1 123 ? -4.487  42.579  -81.473  1.00 19.01 ? 101  VAL C CB    1 
ATOM   5787  C CG1   . VAL C 1 123 ? -3.267  42.956  -82.339  1.00 17.43 ? 101  VAL C CG1   1 
ATOM   5788  C CG2   . VAL C 1 123 ? -5.809  42.899  -82.174  1.00 20.00 ? 101  VAL C CG2   1 
ATOM   5789  N N     . SER C 1 124 ? -5.327  39.590  -82.730  1.00 16.91 ? 102  SER C N     1 
ATOM   5790  C CA    . SER C 1 124 ? -5.275  38.578  -83.792  1.00 17.58 ? 102  SER C CA    1 
ATOM   5791  C C     . SER C 1 124 ? -5.827  39.087  -85.136  1.00 18.46 ? 102  SER C C     1 
ATOM   5792  O O     . SER C 1 124 ? -6.805  39.837  -85.196  1.00 15.44 ? 102  SER C O     1 
ATOM   5793  C CB    . SER C 1 124 ? -5.981  37.276  -83.405  1.00 17.35 ? 102  SER C CB    1 
ATOM   5794  O OG    . SER C 1 124 ? -5.314  36.628  -82.339  1.00 13.77 ? 102  SER C OG    1 
ATOM   5795  N N     . SER C 1 125 ? -5.155  38.658  -86.204  1.00 21.08 ? 103  SER C N     1 
ATOM   5796  C CA    . SER C 1 125 ? -5.470  39.060  -87.562  1.00 22.08 ? 103  SER C CA    1 
ATOM   5797  C C     . SER C 1 125 ? -5.209  37.934  -88.539  1.00 22.92 ? 103  SER C C     1 
ATOM   5798  O O     . SER C 1 125 ? -4.198  37.244  -88.429  1.00 21.98 ? 103  SER C O     1 
ATOM   5799  C CB    . SER C 1 125 ? -4.597  40.254  -87.969  1.00 22.74 ? 103  SER C CB    1 
ATOM   5800  O OG    . SER C 1 125 ? -5.019  40.830  -89.203  1.00 22.07 ? 103  SER C OG    1 
ATOM   5801  N N     . GLY C 1 126 ? -6.122  37.774  -89.496  1.00 24.20 ? 104  GLY C N     1 
ATOM   5802  C CA    . GLY C 1 126 ? -5.846  37.052  -90.730  1.00 24.87 ? 104  GLY C CA    1 
ATOM   5803  C C     . GLY C 1 126 ? -4.966  37.889  -91.663  1.00 25.86 ? 104  GLY C C     1 
ATOM   5804  O O     . GLY C 1 126 ? -4.564  39.008  -91.314  1.00 25.65 ? 104  GLY C O     1 
ATOM   5805  N N     . SER C 1 127 ? -4.698  37.360  -92.860  1.00 27.72 ? 105  SER C N     1 
ATOM   5806  C CA    . SER C 1 127 ? -3.847  38.039  -93.850  1.00 28.39 ? 105  SER C CA    1 
ATOM   5807  C C     . SER C 1 127 ? -4.629  38.933  -94.810  1.00 27.81 ? 105  SER C C     1 
ATOM   5808  O O     . SER C 1 127 ? -4.052  39.474  -95.757  1.00 27.30 ? 105  SER C O     1 
ATOM   5809  C CB    . SER C 1 127 ? -2.990  37.015  -94.620  1.00 28.70 ? 105  SER C CB    1 
ATOM   5810  O OG    . SER C 1 127 ? -3.780  36.017  -95.258  1.00 29.14 ? 105  SER C OG    1 
ATOM   5811  N N     . GLY C 1 128 ? -5.928  39.101  -94.558  1.00 28.38 ? 106  GLY C N     1 
ATOM   5812  C CA    . GLY C 1 128 ? -6.761  39.981  -95.382  1.00 29.37 ? 106  GLY C CA    1 
ATOM   5813  C C     . GLY C 1 128 ? -6.574  41.462  -95.102  1.00 30.42 ? 106  GLY C C     1 
ATOM   5814  O O     . GLY C 1 128 ? -6.132  41.852  -94.022  1.00 30.74 ? 106  GLY C O     1 
ATOM   5815  N N     . GLN C 1 129 ? -6.943  42.285  -96.079  1.00 31.82 ? 107  GLN C N     1 
ATOM   5816  C CA    . GLN C 1 129 ? -6.799  43.737  -95.997  1.00 31.73 ? 107  GLN C CA    1 
ATOM   5817  C C     . GLN C 1 129 ? -7.608  44.306  -94.824  1.00 30.59 ? 107  GLN C C     1 
ATOM   5818  O O     . GLN C 1 129 ? -7.112  45.140  -94.062  1.00 31.03 ? 107  GLN C O     1 
ATOM   5819  C CB    . GLN C 1 129 ? -7.247  44.357  -97.340  1.00 32.68 ? 107  GLN C CB    1 
ATOM   5820  C CG    . GLN C 1 129 ? -6.580  45.693  -97.742  1.00 35.75 ? 107  GLN C CG    1 
ATOM   5821  C CD    . GLN C 1 129 ? -6.539  45.935  -99.288  1.00 42.97 ? 107  GLN C CD    1 
ATOM   5822  O OE1   . GLN C 1 129 ? -6.961  45.084  -100.095 1.00 41.20 ? 107  GLN C OE1   1 
ATOM   5823  N NE2   . GLN C 1 129 ? -6.016  47.105  -99.689  1.00 38.20 ? 107  GLN C NE2   1 
ATOM   5824  N N     . ASN C 1 130 ? -8.843  43.833  -94.673  1.00 30.15 ? 108  ASN C N     1 
ATOM   5825  C CA    . ASN C 1 130 ? -9.749  44.311  -93.609  1.00 29.69 ? 108  ASN C CA    1 
ATOM   5826  C C     . ASN C 1 130 ? -9.272  43.988  -92.211  1.00 29.99 ? 108  ASN C C     1 
ATOM   5827  O O     . ASN C 1 130 ? -9.402  44.818  -91.311  1.00 30.15 ? 108  ASN C O     1 
ATOM   5828  C CB    . ASN C 1 130 ? -11.120 43.683  -93.752  1.00 29.22 ? 108  ASN C CB    1 
ATOM   5829  C CG    . ASN C 1 130 ? -11.789 44.099  -94.989  1.00 31.25 ? 108  ASN C CG    1 
ATOM   5830  O OD1   . ASN C 1 130 ? -12.087 45.275  -95.164  1.00 34.21 ? 108  ASN C OD1   1 
ATOM   5831  N ND2   . ASN C 1 130 ? -12.010 43.153  -95.890  1.00 31.91 ? 108  ASN C ND2   1 
ATOM   5832  N N     . ASP C 1 131 ? -8.772  42.763  -92.028  1.00 28.99 ? 109  ASP C N     1 
ATOM   5833  C CA    . ASP C 1 131 ? -8.207  42.348  -90.757  1.00 28.07 ? 109  ASP C CA    1 
ATOM   5834  C C     . ASP C 1 131 ? -7.032  43.258  -90.417  1.00 26.83 ? 109  ASP C C     1 
ATOM   5835  O O     . ASP C 1 131 ? -6.889  43.699  -89.281  1.00 27.75 ? 109  ASP C O     1 
ATOM   5836  C CB    . ASP C 1 131 ? -7.736  40.880  -90.785  1.00 28.72 ? 109  ASP C CB    1 
ATOM   5837  C CG    . ASP C 1 131 ? -8.877  39.889  -90.771  1.00 29.71 ? 109  ASP C CG    1 
ATOM   5838  O OD1   . ASP C 1 131 ? -10.046 40.320  -90.728  1.00 37.64 ? 109  ASP C OD1   1 
ATOM   5839  O OD2   . ASP C 1 131 ? -8.606  38.670  -90.787  1.00 26.58 ? 109  ASP C OD2   1 
ATOM   5840  N N     . LEU C 1 132 ? -6.182  43.529  -91.398  1.00 25.32 ? 110  LEU C N     1 
ATOM   5841  C CA    . LEU C 1 132 ? -5.000  44.293  -91.139  1.00 25.08 ? 110  LEU C CA    1 
ATOM   5842  C C     . LEU C 1 132 ? -5.436  45.678  -90.690  1.00 25.22 ? 110  LEU C C     1 
ATOM   5843  O O     . LEU C 1 132 ? -4.929  46.195  -89.690  1.00 26.44 ? 110  LEU C O     1 
ATOM   5844  C CB    . LEU C 1 132 ? -4.113  44.327  -92.377  1.00 24.93 ? 110  LEU C CB    1 
ATOM   5845  C CG    . LEU C 1 132 ? -2.723  44.928  -92.175  1.00 24.87 ? 110  LEU C CG    1 
ATOM   5846  C CD1   . LEU C 1 132 ? -2.003  44.286  -90.980  1.00 25.62 ? 110  LEU C CD1   1 
ATOM   5847  C CD2   . LEU C 1 132 ? -1.895  44.797  -93.463  1.00 22.14 ? 110  LEU C CD2   1 
ATOM   5848  N N     . GLU C 1 133 ? -6.408  46.252  -91.395  1.00 24.28 ? 111  GLU C N     1 
ATOM   5849  C CA    . GLU C 1 133 ? -6.944  47.584  -91.053  1.00 24.63 ? 111  GLU C CA    1 
ATOM   5850  C C     . GLU C 1 133 ? -7.500  47.640  -89.639  1.00 22.28 ? 111  GLU C C     1 
ATOM   5851  O O     . GLU C 1 133 ? -7.172  48.541  -88.859  1.00 22.78 ? 111  GLU C O     1 
ATOM   5852  C CB    . GLU C 1 133 ? -8.049  48.006  -92.046  1.00 24.18 ? 111  GLU C CB    1 
ATOM   5853  C CG    . GLU C 1 133 ? -7.528  48.315  -93.451  1.00 32.03 ? 111  GLU C CG    1 
ATOM   5854  C CD    . GLU C 1 133 ? -8.608  48.714  -94.453  1.00 37.70 ? 111  GLU C CD    1 
ATOM   5855  O OE1   . GLU C 1 133 ? -9.438  49.581  -94.108  1.00 39.22 ? 111  GLU C OE1   1 
ATOM   5856  O OE2   . GLU C 1 133 ? -8.601  48.178  -95.591  1.00 38.62 ? 111  GLU C OE2   1 
ATOM   5857  N N     . LYS C 1 134 ? -8.330  46.661  -89.312  1.00 20.71 ? 112  LYS C N     1 
ATOM   5858  C CA    . LYS C 1 134 ? -8.956  46.600  -87.995  1.00 20.51 ? 112  LYS C CA    1 
ATOM   5859  C C     . LYS C 1 134 ? -7.915  46.474  -86.893  1.00 18.11 ? 112  LYS C C     1 
ATOM   5860  O O     . LYS C 1 134 ? -8.022  47.130  -85.856  1.00 16.43 ? 112  LYS C O     1 
ATOM   5861  C CB    . LYS C 1 134 ? -9.961  45.438  -87.877  1.00 19.28 ? 112  LYS C CB    1 
ATOM   5862  C CG    . LYS C 1 134 ? -10.599 45.427  -86.472  1.00 25.48 ? 112  LYS C CG    1 
ATOM   5863  C CD    . LYS C 1 134 ? -11.992 44.769  -86.384  1.00 29.06 ? 112  LYS C CD    1 
ATOM   5864  C CE    . LYS C 1 134 ? -11.952 43.440  -85.630  1.00 27.12 ? 112  LYS C CE    1 
ATOM   5865  N NZ    . LYS C 1 134 ? -13.323 42.914  -85.384  1.00 29.97 ? 112  LYS C NZ    1 
ATOM   5866  N N     . MET C 1 135 ? -6.925  45.621  -87.123  1.00 17.43 ? 113  MET C N     1 
ATOM   5867  C CA    . MET C 1 135 ? -5.881  45.404  -86.157  1.00 18.69 ? 113  MET C CA    1 
ATOM   5868  C C     . MET C 1 135 ? -5.061  46.652  -85.944  1.00 18.34 ? 113  MET C C     1 
ATOM   5869  O O     . MET C 1 135 ? -4.758  47.009  -84.813  1.00 18.53 ? 113  MET C O     1 
ATOM   5870  C CB    . MET C 1 135 ? -4.978  44.289  -86.637  1.00 19.19 ? 113  MET C CB    1 
ATOM   5871  C CG    . MET C 1 135 ? -4.091  43.794  -85.552  1.00 21.01 ? 113  MET C CG    1 
ATOM   5872  S SD    . MET C 1 135 ? -2.889  42.723  -86.252  1.00 30.11 ? 113  MET C SD    1 
ATOM   5873  C CE    . MET C 1 135 ? -1.860  43.925  -87.106  1.00 30.01 ? 113  MET C CE    1 
ATOM   5874  N N     . THR C 1 136 ? -4.680  47.275  -87.056  1.00 18.72 ? 114  THR C N     1 
ATOM   5875  C CA    . THR C 1 136 ? -3.985  48.561  -87.083  1.00 18.07 ? 114  THR C CA    1 
ATOM   5876  C C     . THR C 1 136 ? -4.692  49.584  -86.199  1.00 16.86 ? 114  THR C C     1 
ATOM   5877  O O     . THR C 1 136 ? -4.043  50.271  -85.420  1.00 15.67 ? 114  THR C O     1 
ATOM   5878  C CB    . THR C 1 136 ? -3.945  49.102  -88.557  1.00 18.81 ? 114  THR C CB    1 
ATOM   5879  O OG1   . THR C 1 136 ? -3.324  48.133  -89.419  1.00 14.91 ? 114  THR C OG1   1 
ATOM   5880  C CG2   . THR C 1 136 ? -3.215  50.438  -88.656  1.00 17.72 ? 114  THR C CG2   1 
ATOM   5881  N N     . SER C 1 137 ? -6.016  49.663  -86.330  1.00 16.48 ? 115  SER C N     1 
ATOM   5882  C CA    . SER C 1 137 ? -6.830  50.616  -85.558  1.00 17.73 ? 115  SER C CA    1 
ATOM   5883  C C     . SER C 1 137 ? -6.835  50.329  -84.059  1.00 18.58 ? 115  SER C C     1 
ATOM   5884  O O     . SER C 1 137 ? -6.796  51.244  -83.227  1.00 20.79 ? 115  SER C O     1 
ATOM   5885  C CB    . SER C 1 137 ? -8.268  50.622  -86.068  1.00 17.17 ? 115  SER C CB    1 
ATOM   5886  O OG    . SER C 1 137 ? -8.883  49.397  -85.775  1.00 18.51 ? 115  SER C OG    1 
ATOM   5887  N N     . ILE C 1 138 ? -6.892  49.047  -83.725  1.00 19.14 ? 116  ILE C N     1 
ATOM   5888  C CA    . ILE C 1 138 ? -6.832  48.598  -82.345  1.00 18.39 ? 116  ILE C CA    1 
ATOM   5889  C C     . ILE C 1 138 ? -5.486  48.945  -81.734  1.00 18.52 ? 116  ILE C C     1 
ATOM   5890  O O     . ILE C 1 138 ? -5.443  49.495  -80.637  1.00 18.03 ? 116  ILE C O     1 
ATOM   5891  C CB    . ILE C 1 138 ? -7.054  47.091  -82.266  1.00 18.49 ? 116  ILE C CB    1 
ATOM   5892  C CG1   . ILE C 1 138 ? -8.524  46.752  -82.521  1.00 19.69 ? 116  ILE C CG1   1 
ATOM   5893  C CG2   . ILE C 1 138 ? -6.607  46.536  -80.901  1.00 23.70 ? 116  ILE C CG2   1 
ATOM   5894  C CD1   . ILE C 1 138 ? -8.730  45.313  -83.028  1.00 18.65 ? 116  ILE C CD1   1 
ATOM   5895  N N     . LEU C 1 139 ? -4.403  48.611  -82.449  1.00 18.73 ? 117  LEU C N     1 
ATOM   5896  C CA    . LEU C 1 139 ? -3.042  48.836  -81.978  1.00 19.54 ? 117  LEU C CA    1 
ATOM   5897  C C     . LEU C 1 139 ? -2.742  50.335  -81.787  1.00 20.78 ? 117  LEU C C     1 
ATOM   5898  O O     . LEU C 1 139 ? -2.109  50.735  -80.814  1.00 20.63 ? 117  LEU C O     1 
ATOM   5899  C CB    . LEU C 1 139 ? -2.041  48.186  -82.947  1.00 19.41 ? 117  LEU C CB    1 
ATOM   5900  C CG    . LEU C 1 139 ? -1.926  46.646  -82.925  1.00 20.09 ? 117  LEU C CG    1 
ATOM   5901  C CD1   . LEU C 1 139 ? -1.156  46.096  -84.130  1.00 19.90 ? 117  LEU C CD1   1 
ATOM   5902  C CD2   . LEU C 1 139 ? -1.299  46.126  -81.614  1.00 17.82 ? 117  LEU C CD2   1 
ATOM   5903  N N     . GLU C 1 140 ? -3.213  51.163  -82.706  1.00 22.92 ? 118  GLU C N     1 
ATOM   5904  C CA    . GLU C 1 140 ? -3.045  52.611  -82.570  1.00 23.96 ? 118  GLU C CA    1 
ATOM   5905  C C     . GLU C 1 140 ? -3.846  53.144  -81.414  1.00 21.95 ? 118  GLU C C     1 
ATOM   5906  O O     . GLU C 1 140 ? -3.376  54.039  -80.719  1.00 21.40 ? 118  GLU C O     1 
ATOM   5907  C CB    . GLU C 1 140 ? -3.449  53.339  -83.845  1.00 24.86 ? 118  GLU C CB    1 
ATOM   5908  C CG    . GLU C 1 140 ? -2.441  53.150  -84.977  1.00 32.44 ? 118  GLU C CG    1 
ATOM   5909  C CD    . GLU C 1 140 ? -2.886  53.775  -86.301  1.00 37.97 ? 118  GLU C CD    1 
ATOM   5910  O OE1   . GLU C 1 140 ? -3.974  54.397  -86.330  1.00 40.88 ? 118  GLU C OE1   1 
ATOM   5911  O OE2   . GLU C 1 140 ? -2.137  53.640  -87.303  1.00 35.59 ? 118  GLU C OE2   1 
ATOM   5912  N N     . ALA C 1 141 ? -5.044  52.586  -81.209  1.00 21.13 ? 119  ALA C N     1 
ATOM   5913  C CA    . ALA C 1 141 ? -5.925  53.008  -80.107  1.00 20.16 ? 119  ALA C CA    1 
ATOM   5914  C C     . ALA C 1 141 ? -5.462  52.475  -78.758  1.00 18.85 ? 119  ALA C C     1 
ATOM   5915  O O     . ALA C 1 141 ? -5.702  53.099  -77.736  1.00 18.56 ? 119  ALA C O     1 
ATOM   5916  C CB    . ALA C 1 141 ? -7.349  52.575  -80.377  1.00 20.48 ? 119  ALA C CB    1 
ATOM   5917  N N     . VAL C 1 142 ? -4.791  51.322  -78.768  1.00 18.77 ? 120  VAL C N     1 
ATOM   5918  C CA    . VAL C 1 142 ? -4.342  50.663  -77.555  1.00 18.06 ? 120  VAL C CA    1 
ATOM   5919  C C     . VAL C 1 142 ? -2.833  50.365  -77.653  1.00 18.41 ? 120  VAL C C     1 
ATOM   5920  O O     . VAL C 1 142 ? -2.410  49.214  -77.838  1.00 16.85 ? 120  VAL C O     1 
ATOM   5921  C CB    . VAL C 1 142 ? -5.185  49.402  -77.290  1.00 17.74 ? 120  VAL C CB    1 
ATOM   5922  C CG1   . VAL C 1 142 ? -4.938  48.875  -75.880  1.00 21.02 ? 120  VAL C CG1   1 
ATOM   5923  C CG2   . VAL C 1 142 ? -6.662  49.720  -77.431  1.00 16.43 ? 120  VAL C CG2   1 
ATOM   5924  N N     . PRO C 1 143 ? -2.000  51.410  -77.510  1.00 19.43 ? 121  PRO C N     1 
ATOM   5925  C CA    . PRO C 1 143 ? -0.541  51.226  -77.618  1.00 21.06 ? 121  PRO C CA    1 
ATOM   5926  C C     . PRO C 1 143 ? 0.101   50.246  -76.603  1.00 22.67 ? 121  PRO C C     1 
ATOM   5927  O O     . PRO C 1 143 ? 1.269   49.842  -76.785  1.00 23.04 ? 121  PRO C O     1 
ATOM   5928  C CB    . PRO C 1 143 ? 0.026   52.644  -77.463  1.00 20.43 ? 121  PRO C CB    1 
ATOM   5929  C CG    . PRO C 1 143 ? -1.079  53.475  -76.938  1.00 21.37 ? 121  PRO C CG    1 
ATOM   5930  C CD    . PRO C 1 143 ? -2.373  52.813  -77.262  1.00 19.72 ? 121  PRO C CD    1 
ATOM   5931  N N     . GLN C 1 144 ? -0.657  49.872  -75.566  1.00 23.03 ? 122  GLN C N     1 
ATOM   5932  C CA    . GLN C 1 144 ? -0.193  48.955  -74.533  1.00 23.40 ? 122  GLN C CA    1 
ATOM   5933  C C     . GLN C 1 144 ? -0.176  47.491  -75.019  1.00 22.75 ? 122  GLN C C     1 
ATOM   5934  O O     . GLN C 1 144 ? 0.500   46.643  -74.427  1.00 22.69 ? 122  GLN C O     1 
ATOM   5935  C CB    . GLN C 1 144 ? -1.059  49.113  -73.274  1.00 24.41 ? 122  GLN C CB    1 
ATOM   5936  C CG    . GLN C 1 144 ? -1.007  50.515  -72.658  1.00 26.87 ? 122  GLN C CG    1 
ATOM   5937  C CD    . GLN C 1 144 ? -1.975  51.526  -73.290  1.00 34.10 ? 122  GLN C CD    1 
ATOM   5938  O OE1   . GLN C 1 144 ? -3.033  51.163  -73.840  1.00 31.75 ? 122  GLN C OE1   1 
ATOM   5939  N NE2   . GLN C 1 144 ? -1.621  52.813  -73.192  1.00 35.61 ? 122  GLN C NE2   1 
ATOM   5940  N N     . VAL C 1 145 ? -0.916  47.202  -76.091  1.00 22.89 ? 123  VAL C N     1 
ATOM   5941  C CA    . VAL C 1 145 ? -0.909  45.869  -76.701  1.00 22.07 ? 123  VAL C CA    1 
ATOM   5942  C C     . VAL C 1 145 ? 0.299   45.779  -77.602  1.00 21.72 ? 123  VAL C C     1 
ATOM   5943  O O     . VAL C 1 145 ? 0.349   46.463  -78.613  1.00 22.67 ? 123  VAL C O     1 
ATOM   5944  C CB    . VAL C 1 145 ? -2.198  45.596  -77.518  1.00 21.72 ? 123  VAL C CB    1 
ATOM   5945  C CG1   . VAL C 1 145 ? -2.167  44.200  -78.156  1.00 24.91 ? 123  VAL C CG1   1 
ATOM   5946  C CG2   . VAL C 1 145 ? -3.421  45.714  -76.629  1.00 22.53 ? 123  VAL C CG2   1 
ATOM   5947  N N     . LYS C 1 146 ? 1.253   44.916  -77.246  1.00 22.23 ? 124  LYS C N     1 
ATOM   5948  C CA    . LYS C 1 146 ? 2.541   44.826  -77.947  1.00 21.83 ? 124  LYS C CA    1 
ATOM   5949  C C     . LYS C 1 146 ? 2.767   43.467  -78.605  1.00 20.82 ? 124  LYS C C     1 
ATOM   5950  O O     . LYS C 1 146 ? 3.905   43.145  -78.992  1.00 19.43 ? 124  LYS C O     1 
ATOM   5951  C CB    . LYS C 1 146 ? 3.711   45.137  -77.002  1.00 22.76 ? 124  LYS C CB    1 
ATOM   5952  C CG    . LYS C 1 146 ? 3.730   46.556  -76.452  1.00 28.30 ? 124  LYS C CG    1 
ATOM   5953  C CD    . LYS C 1 146 ? 3.633   47.662  -77.517  1.00 29.75 ? 124  LYS C CD    1 
ATOM   5954  C CE    . LYS C 1 146 ? 4.828   47.685  -78.454  1.00 34.36 ? 124  LYS C CE    1 
ATOM   5955  N NZ    . LYS C 1 146 ? 4.987   49.024  -79.157  1.00 36.82 ? 124  LYS C NZ    1 
ATOM   5956  N N     . PHE C 1 147 ? 1.697   42.680  -78.741  1.00 19.86 ? 125  PHE C N     1 
ATOM   5957  C CA    . PHE C 1 147 ? 1.789   41.360  -79.367  1.00 18.40 ? 125  PHE C CA    1 
ATOM   5958  C C     . PHE C 1 147 ? 0.768   41.252  -80.450  1.00 17.07 ? 125  PHE C C     1 
ATOM   5959  O O     . PHE C 1 147 ? -0.404  41.563  -80.210  1.00 15.36 ? 125  PHE C O     1 
ATOM   5960  C CB    . PHE C 1 147 ? 1.528   40.252  -78.340  1.00 18.72 ? 125  PHE C CB    1 
ATOM   5961  C CG    . PHE C 1 147 ? 2.692   39.970  -77.459  1.00 18.98 ? 125  PHE C CG    1 
ATOM   5962  C CD1   . PHE C 1 147 ? 3.634   39.025  -77.827  1.00 18.80 ? 125  PHE C CD1   1 
ATOM   5963  C CD2   . PHE C 1 147 ? 2.860   40.665  -76.264  1.00 23.07 ? 125  PHE C CD2   1 
ATOM   5964  C CE1   . PHE C 1 147 ? 4.727   38.759  -77.025  1.00 23.50 ? 125  PHE C CE1   1 
ATOM   5965  C CE2   . PHE C 1 147 ? 3.967   40.418  -75.448  1.00 21.28 ? 125  PHE C CE2   1 
ATOM   5966  C CZ    . PHE C 1 147 ? 4.903   39.459  -75.837  1.00 24.17 ? 125  PHE C CZ    1 
ATOM   5967  N N     . ILE C 1 148 ? 1.207   40.786  -81.621  1.00 16.74 ? 126  ILE C N     1 
ATOM   5968  C CA    . ILE C 1 148 ? 0.314   40.546  -82.753  1.00 16.54 ? 126  ILE C CA    1 
ATOM   5969  C C     . ILE C 1 148 ? 0.311   39.065  -83.113  1.00 16.75 ? 126  ILE C C     1 
ATOM   5970  O O     . ILE C 1 148 ? 1.371   38.450  -83.188  1.00 16.13 ? 126  ILE C O     1 
ATOM   5971  C CB    . ILE C 1 148 ? 0.743   41.371  -83.950  1.00 16.60 ? 126  ILE C CB    1 
ATOM   5972  C CG1   . ILE C 1 148 ? 0.571   42.851  -83.621  1.00 15.26 ? 126  ILE C CG1   1 
ATOM   5973  C CG2   . ILE C 1 148 ? -0.028  40.968  -85.214  1.00 16.61 ? 126  ILE C CG2   1 
ATOM   5974  C CD1   . ILE C 1 148 ? 1.195   43.745  -84.649  1.00 21.28 ? 126  ILE C CD1   1 
ATOM   5975  N N     . CYS C 1 149 ? -0.879  38.496  -83.319  1.00 17.45 ? 127  CYS C N     1 
ATOM   5976  C CA    . CYS C 1 149 ? -0.995  37.087  -83.733  1.00 18.22 ? 127  CYS C CA    1 
ATOM   5977  C C     . CYS C 1 149 ? -1.576  36.913  -85.140  1.00 18.25 ? 127  CYS C C     1 
ATOM   5978  O O     . CYS C 1 149 ? -2.732  37.219  -85.414  1.00 17.45 ? 127  CYS C O     1 
ATOM   5979  C CB    . CYS C 1 149 ? -1.799  36.300  -82.729  1.00 18.48 ? 127  CYS C CB    1 
ATOM   5980  S SG    . CYS C 1 149 ? -1.610  34.535  -82.921  1.00 22.61 ? 127  CYS C SG    1 
ATOM   5981  N N     . LEU C 1 150 ? -0.740  36.418  -86.035  1.00 19.15 ? 128  LEU C N     1 
ATOM   5982  C CA    . LEU C 1 150 ? -1.093  36.271  -87.445  1.00 19.40 ? 128  LEU C CA    1 
ATOM   5983  C C     . LEU C 1 150 ? -1.340  34.799  -87.794  1.00 21.10 ? 128  LEU C C     1 
ATOM   5984  O O     . LEU C 1 150 ? -0.547  33.907  -87.451  1.00 22.43 ? 128  LEU C O     1 
ATOM   5985  C CB    . LEU C 1 150 ? 0.029   36.818  -88.323  1.00 19.45 ? 128  LEU C CB    1 
ATOM   5986  C CG    . LEU C 1 150 ? 0.610   38.226  -88.077  1.00 15.43 ? 128  LEU C CG    1 
ATOM   5987  C CD1   . LEU C 1 150 ? 1.682   38.444  -89.136  1.00 12.21 ? 128  LEU C CD1   1 
ATOM   5988  C CD2   . LEU C 1 150 ? -0.421  39.395  -88.080  1.00 7.83  ? 128  LEU C CD2   1 
ATOM   5989  N N     . ASP C 1 151 ? -2.438  34.563  -88.504  1.00 23.43 ? 129  ASP C N     1 
ATOM   5990  C CA    . ASP C 1 151 ? -2.875  33.214  -88.815  1.00 24.03 ? 129  ASP C CA    1 
ATOM   5991  C C     . ASP C 1 151 ? -3.386  33.117  -90.232  1.00 23.14 ? 129  ASP C C     1 
ATOM   5992  O O     . ASP C 1 151 ? -4.180  33.942  -90.667  1.00 22.53 ? 129  ASP C O     1 
ATOM   5993  C CB    . ASP C 1 151 ? -3.993  32.804  -87.864  1.00 23.10 ? 129  ASP C CB    1 
ATOM   5994  C CG    . ASP C 1 151 ? -3.525  32.702  -86.453  1.00 27.86 ? 129  ASP C CG    1 
ATOM   5995  O OD1   . ASP C 1 151 ? -2.624  31.872  -86.196  1.00 31.61 ? 129  ASP C OD1   1 
ATOM   5996  O OD2   . ASP C 1 151 ? -4.038  33.459  -85.607  1.00 33.15 ? 129  ASP C OD2   1 
ATOM   5997  N N     . VAL C 1 152 ? -2.941  32.079  -90.935  1.00 22.45 ? 130  VAL C N     1 
ATOM   5998  C CA    . VAL C 1 152 ? -3.432  31.773  -92.263  1.00 21.14 ? 130  VAL C CA    1 
ATOM   5999  C C     . VAL C 1 152 ? -3.795  30.296  -92.403  1.00 20.36 ? 130  VAL C C     1 
ATOM   6000  O O     . VAL C 1 152 ? -3.515  29.484  -91.523  1.00 20.64 ? 130  VAL C O     1 
ATOM   6001  C CB    . VAL C 1 152 ? -2.396  32.147  -93.311  1.00 21.28 ? 130  VAL C CB    1 
ATOM   6002  C CG1   . VAL C 1 152 ? -2.285  33.664  -93.379  1.00 23.43 ? 130  VAL C CG1   1 
ATOM   6003  C CG2   . VAL C 1 152 ? -1.057  31.494  -92.996  1.00 19.91 ? 130  VAL C CG2   1 
ATOM   6004  N N     . ALA C 1 153 ? -4.445  29.970  -93.516  1.00 19.16 ? 131  ALA C N     1 
ATOM   6005  C CA    . ALA C 1 153 ? -4.703  28.582  -93.869  1.00 18.60 ? 131  ALA C CA    1 
ATOM   6006  C C     . ALA C 1 153 ? -3.397  27.917  -94.200  1.00 17.42 ? 131  ALA C C     1 
ATOM   6007  O O     . ALA C 1 153 ? -3.120  26.828  -93.737  1.00 16.30 ? 131  ALA C O     1 
ATOM   6008  C CB    . ALA C 1 153 ? -5.631  28.482  -95.067  1.00 17.72 ? 131  ALA C CB    1 
ATOM   6009  N N     . ASN C 1 154 ? -2.591  28.600  -95.003  1.00 17.87 ? 132  ASN C N     1 
ATOM   6010  C CA    . ASN C 1 154 ? -1.343  28.043  -95.510  1.00 18.11 ? 132  ASN C CA    1 
ATOM   6011  C C     . ASN C 1 154 ? -0.133  28.869  -95.086  1.00 16.17 ? 132  ASN C C     1 
ATOM   6012  O O     . ASN C 1 154 ? 0.289   29.785  -95.805  1.00 15.25 ? 132  ASN C O     1 
ATOM   6013  C CB    . ASN C 1 154 ? -1.447  27.969  -97.045  1.00 19.00 ? 132  ASN C CB    1 
ATOM   6014  C CG    . ASN C 1 154 ? -0.377  27.140  -97.650  1.00 18.37 ? 132  ASN C CG    1 
ATOM   6015  O OD1   . ASN C 1 154 ? 0.483   26.603  -96.934  1.00 23.14 ? 132  ASN C OD1   1 
ATOM   6016  N ND2   . ASN C 1 154 ? -0.406  27.012  -98.978  1.00 11.74 ? 132  ASN C ND2   1 
ATOM   6017  N N     . GLY C 1 155 ? 0.426   28.521  -93.929  1.00 14.79 ? 133  GLY C N     1 
ATOM   6018  C CA    . GLY C 1 155 ? 1.620   29.186  -93.398  1.00 14.05 ? 133  GLY C CA    1 
ATOM   6019  C C     . GLY C 1 155 ? 2.906   28.936  -94.179  1.00 15.28 ? 133  GLY C C     1 
ATOM   6020  O O     . GLY C 1 155 ? 3.939   29.543  -93.916  1.00 15.59 ? 133  GLY C O     1 
ATOM   6021  N N     . TYR C 1 156 ? 2.829   28.043  -95.150  1.00 15.22 ? 134  TYR C N     1 
ATOM   6022  C CA    . TYR C 1 156 ? 3.920   27.788  -96.070  1.00 15.21 ? 134  TYR C CA    1 
ATOM   6023  C C     . TYR C 1 156 ? 3.856   28.633  -97.352  1.00 16.34 ? 134  TYR C C     1 
ATOM   6024  O O     . TYR C 1 156 ? 4.708   28.498  -98.223  1.00 16.72 ? 134  TYR C O     1 
ATOM   6025  C CB    . TYR C 1 156 ? 3.924   26.307  -96.408  1.00 13.67 ? 134  TYR C CB    1 
ATOM   6026  C CG    . TYR C 1 156 ? 4.440   25.433  -95.277  1.00 11.66 ? 134  TYR C CG    1 
ATOM   6027  C CD1   . TYR C 1 156 ? 5.768   25.000  -95.270  1.00 13.19 ? 134  TYR C CD1   1 
ATOM   6028  C CD2   . TYR C 1 156 ? 3.614   25.032  -94.221  1.00 10.17 ? 134  TYR C CD2   1 
ATOM   6029  C CE1   . TYR C 1 156 ? 6.271   24.188  -94.255  1.00 11.20 ? 134  TYR C CE1   1 
ATOM   6030  C CE2   . TYR C 1 156 ? 4.119   24.216  -93.174  1.00 11.14 ? 134  TYR C CE2   1 
ATOM   6031  C CZ    . TYR C 1 156 ? 5.461   23.799  -93.211  1.00 13.15 ? 134  TYR C CZ    1 
ATOM   6032  O OH    . TYR C 1 156 ? 6.021   22.986  -92.227  1.00 11.14 ? 134  TYR C OH    1 
ATOM   6033  N N     . SER C 1 157 ? 2.890   29.541  -97.449  1.00 17.07 ? 135  SER C N     1 
ATOM   6034  C CA    A SER C 1 157 ? 2.717   30.354  -98.658  0.60 17.31 ? 135  SER C CA    1 
ATOM   6035  C CA    B SER C 1 157 ? 2.721   30.350  -98.661  0.40 16.63 ? 135  SER C CA    1 
ATOM   6036  C C     . SER C 1 157 ? 3.716   31.512  -98.708  1.00 18.73 ? 135  SER C C     1 
ATOM   6037  O O     . SER C 1 157 ? 4.111   32.076  -97.665  1.00 20.09 ? 135  SER C O     1 
ATOM   6038  C CB    A SER C 1 157 ? 1.292   30.910  -98.729  0.60 16.73 ? 135  SER C CB    1 
ATOM   6039  C CB    B SER C 1 157 ? 1.284   30.880  -98.776  0.40 16.03 ? 135  SER C CB    1 
ATOM   6040  O OG    A SER C 1 157 ? 1.081   31.619  -99.935  0.60 14.64 ? 135  SER C OG    1 
ATOM   6041  O OG    B SER C 1 157 ? 0.874   31.558  -97.600  0.40 7.75  ? 135  SER C OG    1 
ATOM   6042  N N     . GLU C 1 158 ? 4.114   31.878  -99.921  1.00 20.02 ? 136  GLU C N     1 
ATOM   6043  C CA    . GLU C 1 158 ? 4.963   33.036  -100.132 1.00 21.41 ? 136  GLU C CA    1 
ATOM   6044  C C     . GLU C 1 158 ? 4.165   34.301  -99.830  1.00 20.80 ? 136  GLU C C     1 
ATOM   6045  O O     . GLU C 1 158 ? 4.734   35.337  -99.479  1.00 21.97 ? 136  GLU C O     1 
ATOM   6046  C CB    . GLU C 1 158 ? 5.493   33.022  -101.571 1.00 22.29 ? 136  GLU C CB    1 
ATOM   6047  C CG    . GLU C 1 158 ? 6.986   33.360  -101.719 1.00 27.92 ? 136  GLU C CG    1 
ATOM   6048  C CD    . GLU C 1 158 ? 7.882   32.531  -100.812 1.00 35.42 ? 136  GLU C CD    1 
ATOM   6049  O OE1   . GLU C 1 158 ? 8.025   31.310  -101.066 1.00 41.40 ? 136  GLU C OE1   1 
ATOM   6050  O OE2   . GLU C 1 158 ? 8.442   33.108  -99.843  1.00 38.49 ? 136  GLU C OE2   1 
ATOM   6051  N N     . HIS C 1 159 ? 2.846   34.194  -99.955  1.00 20.00 ? 137  HIS C N     1 
ATOM   6052  C CA    A HIS C 1 159 ? 1.984   35.316  -99.661  0.50 19.20 ? 137  HIS C CA    1 
ATOM   6053  C CA    B HIS C 1 159 ? 1.913   35.279  -99.631  0.50 19.10 ? 137  HIS C CA    1 
ATOM   6054  C C     . HIS C 1 159 ? 1.936   35.597  -98.155  1.00 19.93 ? 137  HIS C C     1 
ATOM   6055  O O     . HIS C 1 159 ? 1.779   36.754  -97.747  1.00 22.18 ? 137  HIS C O     1 
ATOM   6056  C CB    A HIS C 1 159 ? 0.607   35.102  -100.299 0.50 18.81 ? 137  HIS C CB    1 
ATOM   6057  C CB    B HIS C 1 159 ? 0.475   34.910  -100.018 0.50 18.61 ? 137  HIS C CB    1 
ATOM   6058  C CG    A HIS C 1 159 ? 0.642   35.121  -101.803 0.50 14.82 ? 137  HIS C CG    1 
ATOM   6059  C CG    B HIS C 1 159 ? -0.528  35.981  -99.701  0.50 14.70 ? 137  HIS C CG    1 
ATOM   6060  N ND1   A HIS C 1 159 ? 0.388   34.005  -102.579 0.50 10.97 ? 137  HIS C ND1   1 
ATOM   6061  N ND1   B HIS C 1 159 ? -0.923  36.929  -100.620 0.50 8.85  ? 137  HIS C ND1   1 
ATOM   6062  C CD2   A HIS C 1 159 ? 0.943   36.117  -102.668 0.50 3.35  ? 137  HIS C CD2   1 
ATOM   6063  C CD2   B HIS C 1 159 ? -1.202  36.259  -98.561  0.50 8.18  ? 137  HIS C CD2   1 
ATOM   6064  C CE1   A HIS C 1 159 ? 0.503   34.326  -103.855 0.50 7.67  ? 137  HIS C CE1   1 
ATOM   6065  C CE1   B HIS C 1 159 ? -1.795  37.744  -100.059 0.50 7.71  ? 137  HIS C CE1   1 
ATOM   6066  N NE2   A HIS C 1 159 ? 0.842   35.598  -103.936 0.50 7.44  ? 137  HIS C NE2   1 
ATOM   6067  N NE2   B HIS C 1 159 ? -1.980  37.360  -98.810  0.50 4.80  ? 137  HIS C NE2   1 
ATOM   6068  N N     . PHE C 1 160 ? 2.122   34.563  -97.340  1.00 20.11 ? 138  PHE C N     1 
ATOM   6069  C CA    . PHE C 1 160 ? 2.179   34.760  -95.903  1.00 19.65 ? 138  PHE C CA    1 
ATOM   6070  C C     . PHE C 1 160 ? 3.527   35.345  -95.479  1.00 19.17 ? 138  PHE C C     1 
ATOM   6071  O O     . PHE C 1 160 ? 3.576   36.241  -94.620  1.00 18.03 ? 138  PHE C O     1 
ATOM   6072  C CB    . PHE C 1 160 ? 1.900   33.474  -95.161  1.00 19.50 ? 138  PHE C CB    1 
ATOM   6073  C CG    . PHE C 1 160 ? 1.715   33.665  -93.679  1.00 21.26 ? 138  PHE C CG    1 
ATOM   6074  C CD1   . PHE C 1 160 ? 0.918   34.699  -93.188  1.00 19.86 ? 138  PHE C CD1   1 
ATOM   6075  C CD2   . PHE C 1 160 ? 2.324   32.806  -92.779  1.00 19.20 ? 138  PHE C CD2   1 
ATOM   6076  C CE1   . PHE C 1 160 ? 0.761   34.875  -91.827  1.00 19.40 ? 138  PHE C CE1   1 
ATOM   6077  C CE2   . PHE C 1 160 ? 2.169   32.975  -91.436  1.00 15.29 ? 138  PHE C CE2   1 
ATOM   6078  C CZ    . PHE C 1 160 ? 1.388   34.007  -90.950  1.00 20.49 ? 138  PHE C CZ    1 
ATOM   6079  N N     . VAL C 1 161 ? 4.605   34.856  -96.091  1.00 18.48 ? 139  VAL C N     1 
ATOM   6080  C CA    . VAL C 1 161 ? 5.931   35.416  -95.868  1.00 18.91 ? 139  VAL C CA    1 
ATOM   6081  C C     . VAL C 1 161 ? 5.930   36.944  -96.089  1.00 20.24 ? 139  VAL C C     1 
ATOM   6082  O O     . VAL C 1 161 ? 6.507   37.700  -95.297  1.00 19.04 ? 139  VAL C O     1 
ATOM   6083  C CB    . VAL C 1 161 ? 6.976   34.732  -96.784  1.00 19.74 ? 139  VAL C CB    1 
ATOM   6084  C CG1   . VAL C 1 161 ? 8.321   35.516  -96.819  1.00 20.89 ? 139  VAL C CG1   1 
ATOM   6085  C CG2   . VAL C 1 161 ? 7.209   33.295  -96.359  1.00 18.73 ? 139  VAL C CG2   1 
ATOM   6086  N N     . GLU C 1 162 ? 5.293   37.385  -97.179  1.00 21.98 ? 140  GLU C N     1 
ATOM   6087  C CA    . GLU C 1 162 ? 5.254   38.807  -97.542  1.00 21.64 ? 140  GLU C CA    1 
ATOM   6088  C C     . GLU C 1 162 ? 4.310   39.589  -96.660  1.00 19.23 ? 140  GLU C C     1 
ATOM   6089  O O     . GLU C 1 162 ? 4.534   40.784  -96.453  1.00 19.13 ? 140  GLU C O     1 
ATOM   6090  C CB    . GLU C 1 162 ? 4.915   39.021  -99.032  1.00 23.14 ? 140  GLU C CB    1 
ATOM   6091  C CG    . GLU C 1 162 ? 6.081   38.675  -99.987  1.00 27.53 ? 140  GLU C CG    1 
ATOM   6092  C CD    . GLU C 1 162 ? 7.348   39.550  -99.788  1.00 33.10 ? 140  GLU C CD    1 
ATOM   6093  O OE1   . GLU C 1 162 ? 7.273   40.801  -99.899  1.00 35.79 ? 140  GLU C OE1   1 
ATOM   6094  O OE2   . GLU C 1 162 ? 8.436   38.978  -99.538  1.00 35.81 ? 140  GLU C OE2   1 
ATOM   6095  N N     . PHE C 1 163 ? 3.275   38.934  -96.135  1.00 18.21 ? 141  PHE C N     1 
ATOM   6096  C CA    . PHE C 1 163 ? 2.357   39.577  -95.177  1.00 19.13 ? 141  PHE C CA    1 
ATOM   6097  C C     . PHE C 1 163 ? 3.082   39.842  -93.847  1.00 19.33 ? 141  PHE C C     1 
ATOM   6098  O O     . PHE C 1 163 ? 2.965   40.904  -93.267  1.00 20.09 ? 141  PHE C O     1 
ATOM   6099  C CB    . PHE C 1 163 ? 1.090   38.717  -94.975  1.00 20.19 ? 141  PHE C CB    1 
ATOM   6100  C CG    . PHE C 1 163 ? 0.082   39.321  -94.035  1.00 19.28 ? 141  PHE C CG    1 
ATOM   6101  C CD1   . PHE C 1 163 ? -0.764  40.349  -94.462  1.00 20.47 ? 141  PHE C CD1   1 
ATOM   6102  C CD2   . PHE C 1 163 ? -0.026  38.867  -92.720  1.00 19.00 ? 141  PHE C CD2   1 
ATOM   6103  C CE1   . PHE C 1 163 ? -1.699  40.923  -93.589  1.00 18.62 ? 141  PHE C CE1   1 
ATOM   6104  C CE2   . PHE C 1 163 ? -0.953  39.426  -91.851  1.00 18.20 ? 141  PHE C CE2   1 
ATOM   6105  C CZ    . PHE C 1 163 ? -1.784  40.459  -92.283  1.00 18.51 ? 141  PHE C CZ    1 
ATOM   6106  N N     . VAL C 1 164 ? 3.864   38.881  -93.402  1.00 19.71 ? 142  VAL C N     1 
ATOM   6107  C CA    . VAL C 1 164 ? 4.716   39.059  -92.230  1.00 20.92 ? 142  VAL C CA    1 
ATOM   6108  C C     . VAL C 1 164 ? 5.715   40.219  -92.399  1.00 20.45 ? 142  VAL C C     1 
ATOM   6109  O O     . VAL C 1 164 ? 5.890   41.042  -91.495  1.00 21.87 ? 142  VAL C O     1 
ATOM   6110  C CB    . VAL C 1 164 ? 5.448   37.744  -91.924  1.00 21.04 ? 142  VAL C CB    1 
ATOM   6111  C CG1   . VAL C 1 164 ? 6.667   37.959  -91.030  1.00 22.44 ? 142  VAL C CG1   1 
ATOM   6112  C CG2   . VAL C 1 164 ? 4.467   36.764  -91.317  1.00 17.57 ? 142  VAL C CG2   1 
ATOM   6113  N N     . LYS C 1 165 ? 6.377   40.273  -93.553  1.00 19.63 ? 143  LYS C N     1 
ATOM   6114  C CA    . LYS C 1 165 ? 7.301   41.362  -93.870  1.00 19.16 ? 143  LYS C CA    1 
ATOM   6115  C C     . LYS C 1 165 ? 6.616   42.732  -93.742  1.00 19.55 ? 143  LYS C C     1 
ATOM   6116  O O     . LYS C 1 165 ? 7.242   43.725  -93.313  1.00 19.91 ? 143  LYS C O     1 
ATOM   6117  C CB    . LYS C 1 165 ? 7.880   41.225  -95.293  1.00 19.19 ? 143  LYS C CB    1 
ATOM   6118  C CG    . LYS C 1 165 ? 8.959   40.158  -95.471  1.00 24.30 ? 143  LYS C CG    1 
ATOM   6119  C CD    . LYS C 1 165 ? 10.037  40.577  -96.484  1.00 21.66 ? 143  LYS C CD    1 
ATOM   6120  N N     . LEU C 1 166 ? 5.349   42.774  -94.155  1.00 19.14 ? 144  LEU C N     1 
ATOM   6121  C CA    . LEU C 1 166 ? 4.539   43.998  -94.142  1.00 18.96 ? 144  LEU C CA    1 
ATOM   6122  C C     . LEU C 1 166 ? 4.154   44.420  -92.728  1.00 18.10 ? 144  LEU C C     1 
ATOM   6123  O O     . LEU C 1 166 ? 4.267   45.592  -92.348  1.00 19.79 ? 144  LEU C O     1 
ATOM   6124  C CB    . LEU C 1 166 ? 3.284   43.783  -95.000  1.00 17.84 ? 144  LEU C CB    1 
ATOM   6125  C CG    . LEU C 1 166 ? 2.251   44.901  -95.114  1.00 19.30 ? 144  LEU C CG    1 
ATOM   6126  C CD1   . LEU C 1 166 ? 2.880   46.160  -95.714  1.00 15.59 ? 144  LEU C CD1   1 
ATOM   6127  C CD2   . LEU C 1 166 ? 1.042   44.452  -95.920  1.00 15.83 ? 144  LEU C CD2   1 
ATOM   6128  N N     . VAL C 1 167 ? 3.699   43.457  -91.949  1.00 18.35 ? 145  VAL C N     1 
ATOM   6129  C CA    . VAL C 1 167 ? 3.311   43.701  -90.557  1.00 17.62 ? 145  VAL C CA    1 
ATOM   6130  C C     . VAL C 1 167 ? 4.532   44.118  -89.738  1.00 15.71 ? 145  VAL C C     1 
ATOM   6131  O O     . VAL C 1 167 ? 4.450   45.048  -88.962  1.00 15.02 ? 145  VAL C O     1 
ATOM   6132  C CB    . VAL C 1 167 ? 2.637   42.481  -89.963  1.00 15.78 ? 145  VAL C CB    1 
ATOM   6133  C CG1   . VAL C 1 167 ? 2.129   42.780  -88.571  1.00 20.25 ? 145  VAL C CG1   1 
ATOM   6134  C CG2   . VAL C 1 167 ? 1.490   42.093  -90.818  1.00 16.37 ? 145  VAL C CG2   1 
ATOM   6135  N N     . ARG C 1 168 ? 5.659   43.449  -89.962  1.00 14.85 ? 146  ARG C N     1 
ATOM   6136  C CA    . ARG C 1 168 ? 6.914   43.810  -89.333  1.00 14.32 ? 146  ARG C CA    1 
ATOM   6137  C C     . ARG C 1 168 ? 7.254   45.262  -89.612  1.00 14.42 ? 146  ARG C C     1 
ATOM   6138  O O     . ARG C 1 168 ? 7.605   46.027  -88.716  1.00 17.03 ? 146  ARG C O     1 
ATOM   6139  C CB    . ARG C 1 168 ? 8.022   42.899  -89.866  1.00 15.23 ? 146  ARG C CB    1 
ATOM   6140  C CG    . ARG C 1 168 ? 9.457   43.248  -89.410  1.00 19.11 ? 146  ARG C CG    1 
ATOM   6141  C CD    . ARG C 1 168 ? 9.566   43.553  -87.885  1.00 21.55 ? 146  ARG C CD    1 
ATOM   6142  N NE    . ARG C 1 168 ? 9.268   42.389  -87.058  1.00 19.82 ? 146  ARG C NE    1 
ATOM   6143  C CZ    . ARG C 1 168 ? 8.587   42.398  -85.911  1.00 18.66 ? 146  ARG C CZ    1 
ATOM   6144  N NH1   . ARG C 1 168 ? 8.086   43.514  -85.417  1.00 23.21 ? 146  ARG C NH1   1 
ATOM   6145  N NH2   . ARG C 1 168 ? 8.412   41.262  -85.248  1.00 18.56 ? 146  ARG C NH2   1 
ATOM   6146  N N     . ALA C 1 169 ? 7.169   45.640  -90.881  1.00 14.14 ? 147  ALA C N     1 
ATOM   6147  C CA    . ALA C 1 169 ? 7.506   46.989  -91.324  1.00 11.66 ? 147  ALA C CA    1 
ATOM   6148  C C     . ALA C 1 169 ? 6.522   48.031  -90.768  1.00 12.29 ? 147  ALA C C     1 
ATOM   6149  O O     . ALA C 1 169 ? 6.948   49.145  -90.411  1.00 13.04 ? 147  ALA C O     1 
ATOM   6150  C CB    . ALA C 1 169 ? 7.521   47.025  -92.821  1.00 11.16 ? 147  ALA C CB    1 
ATOM   6151  N N     . LYS C 1 170 ? 5.226   47.673  -90.714  1.00 12.43 ? 148  LYS C N     1 
ATOM   6152  C CA    . LYS C 1 170 ? 4.178   48.528  -90.129  1.00 13.47 ? 148  LYS C CA    1 
ATOM   6153  C C     . LYS C 1 170 ? 4.280   48.667  -88.599  1.00 15.70 ? 148  LYS C C     1 
ATOM   6154  O O     . LYS C 1 170 ? 3.936   49.713  -88.038  1.00 16.91 ? 148  LYS C O     1 
ATOM   6155  C CB    . LYS C 1 170 ? 2.795   47.966  -90.410  1.00 13.93 ? 148  LYS C CB    1 
ATOM   6156  C CG    . LYS C 1 170 ? 2.216   48.178  -91.788  1.00 19.04 ? 148  LYS C CG    1 
ATOM   6157  C CD    . LYS C 1 170 ? 0.897   47.352  -91.980  1.00 22.04 ? 148  LYS C CD    1 
ATOM   6158  C CE    . LYS C 1 170 ? -0.272  47.786  -91.086  1.00 19.43 ? 148  LYS C CE    1 
ATOM   6159  N NZ    . LYS C 1 170 ? -1.050  48.910  -91.700  1.00 22.62 ? 148  LYS C NZ    1 
ATOM   6160  N N     . PHE C 1 171 ? 4.705   47.606  -87.923  1.00 16.72 ? 149  PHE C N     1 
ATOM   6161  C CA    . PHE C 1 171 ? 4.805   47.601  -86.477  1.00 17.14 ? 149  PHE C CA    1 
ATOM   6162  C C     . PHE C 1 171 ? 6.166   47.044  -86.064  1.00 17.53 ? 149  PHE C C     1 
ATOM   6163  O O     . PHE C 1 171 ? 6.248   45.922  -85.585  1.00 17.81 ? 149  PHE C O     1 
ATOM   6164  C CB    . PHE C 1 171 ? 3.685   46.731  -85.880  1.00 18.34 ? 149  PHE C CB    1 
ATOM   6165  C CG    . PHE C 1 171 ? 2.322   47.064  -86.403  1.00 20.77 ? 149  PHE C CG    1 
ATOM   6166  C CD1   . PHE C 1 171 ? 1.742   48.306  -86.128  1.00 20.16 ? 149  PHE C CD1   1 
ATOM   6167  C CD2   . PHE C 1 171 ? 1.629   46.157  -87.203  1.00 22.38 ? 149  PHE C CD2   1 
ATOM   6168  C CE1   . PHE C 1 171 ? 0.491   48.639  -86.626  1.00 20.99 ? 149  PHE C CE1   1 
ATOM   6169  C CE2   . PHE C 1 171 ? 0.350   46.474  -87.704  1.00 23.90 ? 149  PHE C CE2   1 
ATOM   6170  C CZ    . PHE C 1 171 ? -0.218  47.716  -87.404  1.00 23.89 ? 149  PHE C CZ    1 
ATOM   6171  N N     . PRO C 1 172 ? 7.247   47.835  -86.243  1.00 17.97 ? 150  PRO C N     1 
ATOM   6172  C CA    . PRO C 1 172 ? 8.611   47.342  -85.974  1.00 18.38 ? 150  PRO C CA    1 
ATOM   6173  C C     . PRO C 1 172 ? 8.932   46.956  -84.516  1.00 18.51 ? 150  PRO C C     1 
ATOM   6174  O O     . PRO C 1 172 ? 9.908   46.261  -84.277  1.00 16.67 ? 150  PRO C O     1 
ATOM   6175  C CB    . PRO C 1 172 ? 9.508   48.484  -86.463  1.00 17.20 ? 150  PRO C CB    1 
ATOM   6176  C CG    . PRO C 1 172 ? 8.646   49.671  -86.513  1.00 18.84 ? 150  PRO C CG    1 
ATOM   6177  C CD    . PRO C 1 172 ? 7.246   49.224  -86.730  1.00 17.18 ? 150  PRO C CD    1 
ATOM   6178  N N     . GLU C 1 173 ? 8.110   47.407  -83.572  1.00 21.14 ? 151  GLU C N     1 
ATOM   6179  C CA    . GLU C 1 173 ? 8.356   47.240  -82.144  1.00 23.00 ? 151  GLU C CA    1 
ATOM   6180  C C     . GLU C 1 173 ? 7.362   46.287  -81.505  1.00 22.60 ? 151  GLU C C     1 
ATOM   6181  O O     . GLU C 1 173 ? 7.434   46.010  -80.294  1.00 22.40 ? 151  GLU C O     1 
ATOM   6182  C CB    . GLU C 1 173 ? 8.241   48.615  -81.478  1.00 25.22 ? 151  GLU C CB    1 
ATOM   6183  C CG    . GLU C 1 173 ? 9.157   49.702  -82.097  1.00 30.16 ? 151  GLU C CG    1 
ATOM   6184  C CD    . GLU C 1 173 ? 10.518  49.789  -81.424  1.00 37.30 ? 151  GLU C CD    1 
ATOM   6185  O OE1   . GLU C 1 173 ? 10.604  49.556  -80.193  1.00 40.75 ? 151  GLU C OE1   1 
ATOM   6186  O OE2   . GLU C 1 173 ? 11.505  50.112  -82.126  1.00 44.07 ? 151  GLU C OE2   1 
ATOM   6187  N N     . HIS C 1 174 ? 6.423   45.807  -82.310  1.00 21.97 ? 152  HIS C N     1 
ATOM   6188  C CA    . HIS C 1 174 ? 5.466   44.789  -81.848  1.00 20.86 ? 152  HIS C CA    1 
ATOM   6189  C C     . HIS C 1 174 ? 6.043   43.412  -82.012  1.00 19.97 ? 152  HIS C C     1 
ATOM   6190  O O     . HIS C 1 174 ? 6.800   43.154  -82.954  1.00 19.26 ? 152  HIS C O     1 
ATOM   6191  C CB    . HIS C 1 174 ? 4.150   44.871  -82.623  1.00 20.34 ? 152  HIS C CB    1 
ATOM   6192  C CG    . HIS C 1 174 ? 3.278   45.991  -82.174  1.00 14.15 ? 152  HIS C CG    1 
ATOM   6193  N ND1   . HIS C 1 174 ? 3.640   47.309  -82.318  1.00 14.31 ? 152  HIS C ND1   1 
ATOM   6194  C CD2   . HIS C 1 174 ? 2.087   45.992  -81.535  1.00 12.54 ? 152  HIS C CD2   1 
ATOM   6195  C CE1   . HIS C 1 174 ? 2.694   48.079  -81.810  1.00 16.36 ? 152  HIS C CE1   1 
ATOM   6196  N NE2   . HIS C 1 174 ? 1.748   47.306  -81.317  1.00 19.21 ? 152  HIS C NE2   1 
ATOM   6197  N N     . THR C 1 175 ? 5.691   42.534  -81.086  1.00 19.16 ? 153  THR C N     1 
ATOM   6198  C CA    . THR C 1 175 ? 6.131   41.157  -81.156  1.00 17.23 ? 153  THR C CA    1 
ATOM   6199  C C     . THR C 1 175 ? 5.140   40.370  -81.986  1.00 16.03 ? 153  THR C C     1 
ATOM   6200  O O     . THR C 1 175 ? 3.940   40.468  -81.781  1.00 13.22 ? 153  THR C O     1 
ATOM   6201  C CB    . THR C 1 175 ? 6.326   40.603  -79.763  1.00 17.91 ? 153  THR C CB    1 
ATOM   6202  O OG1   . THR C 1 175 ? 7.407   41.331  -79.166  1.00 11.70 ? 153  THR C OG1   1 
ATOM   6203  C CG2   . THR C 1 175 ? 6.616   39.050  -79.788  1.00 16.06 ? 153  THR C CG2   1 
ATOM   6204  N N     . ILE C 1 176 ? 5.650   39.623  -82.958  1.00 17.78 ? 154  ILE C N     1 
ATOM   6205  C CA    . ILE C 1 176 ? 4.783   38.963  -83.943  1.00 17.74 ? 154  ILE C CA    1 
ATOM   6206  C C     . ILE C 1 176 ? 4.791   37.442  -83.839  1.00 17.65 ? 154  ILE C C     1 
ATOM   6207  O O     . ILE C 1 176 ? 5.825   36.777  -84.040  1.00 14.37 ? 154  ILE C O     1 
ATOM   6208  C CB    . ILE C 1 176 ? 5.097   39.460  -85.378  1.00 16.97 ? 154  ILE C CB    1 
ATOM   6209  C CG1   . ILE C 1 176 ? 4.683   40.920  -85.480  1.00 13.25 ? 154  ILE C CG1   1 
ATOM   6210  C CG2   . ILE C 1 176 ? 4.391   38.596  -86.446  1.00 19.00 ? 154  ILE C CG2   1 
ATOM   6211  C CD1   . ILE C 1 176 ? 4.626   41.439  -86.825  1.00 16.31 ? 154  ILE C CD1   1 
ATOM   6212  N N     . MET C 1 177 ? 3.612   36.924  -83.494  1.00 20.27 ? 155  MET C N     1 
ATOM   6213  C CA    . MET C 1 177 ? 3.293   35.513  -83.566  1.00 21.65 ? 155  MET C CA    1 
ATOM   6214  C C     . MET C 1 177 ? 2.707   35.241  -84.942  1.00 21.99 ? 155  MET C C     1 
ATOM   6215  O O     . MET C 1 177 ? 1.869   35.987  -85.413  1.00 23.05 ? 155  MET C O     1 
ATOM   6216  C CB    . MET C 1 177 ? 2.303   35.155  -82.469  1.00 22.67 ? 155  MET C CB    1 
ATOM   6217  C CG    . MET C 1 177 ? 2.945   35.093  -81.111  1.00 21.80 ? 155  MET C CG    1 
ATOM   6218  S SD    . MET C 1 177 ? 1.889   35.338  -79.663  1.00 33.90 ? 155  MET C SD    1 
ATOM   6219  C CE    . MET C 1 177 ? 0.272   34.771  -80.163  1.00 27.80 ? 155  MET C CE    1 
ATOM   6220  N N     . ALA C 1 178 ? 3.180   34.184  -85.596  1.00 22.55 ? 156  ALA C N     1 
ATOM   6221  C CA    . ALA C 1 178 ? 2.789   33.857  -86.978  1.00 21.63 ? 156  ALA C CA    1 
ATOM   6222  C C     . ALA C 1 178 ? 2.703   32.367  -87.166  1.00 20.66 ? 156  ALA C C     1 
ATOM   6223  O O     . ALA C 1 178 ? 3.649   31.653  -86.864  1.00 19.93 ? 156  ALA C O     1 
ATOM   6224  C CB    . ALA C 1 178 ? 3.809   34.407  -87.947  1.00 21.89 ? 156  ALA C CB    1 
ATOM   6225  N N     . GLY C 1 179 ? 1.579   31.890  -87.689  1.00 20.69 ? 157  GLY C N     1 
ATOM   6226  C CA    . GLY C 1 179 ? 1.468   30.458  -87.996  1.00 19.44 ? 157  GLY C CA    1 
ATOM   6227  C C     . GLY C 1 179 ? 0.403   30.064  -88.997  1.00 17.17 ? 157  GLY C C     1 
ATOM   6228  O O     . GLY C 1 179 ? -0.295  30.915  -89.531  1.00 16.17 ? 157  GLY C O     1 
ATOM   6229  N N     . ASN C 1 180 ? 0.243   28.760  -89.217  1.00 18.81 ? 158  ASN C N     1 
ATOM   6230  C CA    . ASN C 1 180 ? 1.000   27.693  -88.486  1.00 19.03 ? 158  ASN C CA    1 
ATOM   6231  C C     . ASN C 1 180 ? 1.859   26.894  -89.435  1.00 18.32 ? 158  ASN C C     1 
ATOM   6232  O O     . ASN C 1 180 ? 1.527   26.761  -90.611  1.00 17.38 ? 158  ASN C O     1 
ATOM   6233  C CB    . ASN C 1 180 ? 0.072   26.706  -87.750  1.00 19.87 ? 158  ASN C CB    1 
ATOM   6234  C CG    . ASN C 1 180 ? -0.573  27.306  -86.516  1.00 17.01 ? 158  ASN C CG    1 
ATOM   6235  O OD1   . ASN C 1 180 ? -0.773  28.505  -86.437  1.00 18.86 ? 158  ASN C OD1   1 
ATOM   6236  N ND2   . ASN C 1 180 ? -0.875  26.471  -85.544  1.00 12.09 ? 158  ASN C ND2   1 
ATOM   6237  N N     . VAL C 1 181 ? 2.962   26.371  -88.908  1.00 18.81 ? 159  VAL C N     1 
ATOM   6238  C CA    . VAL C 1 181 ? 3.837   25.462  -89.667  1.00 18.86 ? 159  VAL C CA    1 
ATOM   6239  C C     . VAL C 1 181 ? 4.124   24.241  -88.824  1.00 18.71 ? 159  VAL C C     1 
ATOM   6240  O O     . VAL C 1 181 ? 3.614   24.126  -87.704  1.00 18.45 ? 159  VAL C O     1 
ATOM   6241  C CB    . VAL C 1 181 ? 5.171   26.114  -90.088  1.00 16.56 ? 159  VAL C CB    1 
ATOM   6242  C CG1   . VAL C 1 181 ? 4.909   27.333  -90.981  1.00 15.98 ? 159  VAL C CG1   1 
ATOM   6243  C CG2   . VAL C 1 181 ? 5.998   26.482  -88.863  1.00 18.99 ? 159  VAL C CG2   1 
ATOM   6244  N N     . VAL C 1 182 ? 4.890   23.310  -89.392  1.00 18.05 ? 160  VAL C N     1 
ATOM   6245  C CA    . VAL C 1 182 ? 5.308   22.091  -88.669  1.00 17.53 ? 160  VAL C CA    1 
ATOM   6246  C C     . VAL C 1 182 ? 6.732   21.669  -88.987  1.00 18.14 ? 160  VAL C C     1 
ATOM   6247  O O     . VAL C 1 182 ? 7.189   20.629  -88.499  1.00 16.19 ? 160  VAL C O     1 
ATOM   6248  C CB    . VAL C 1 182 ? 4.371   20.904  -88.976  1.00 15.75 ? 160  VAL C CB    1 
ATOM   6249  C CG1   . VAL C 1 182 ? 3.032   21.137  -88.373  1.00 17.24 ? 160  VAL C CG1   1 
ATOM   6250  C CG2   . VAL C 1 182 ? 4.238   20.689  -90.469  1.00 15.82 ? 160  VAL C CG2   1 
ATOM   6251  N N     . THR C 1 183 ? 7.422   22.470  -89.807  1.00 18.45 ? 161  THR C N     1 
ATOM   6252  C CA    . THR C 1 183 ? 8.773   22.130  -90.270  1.00 20.62 ? 161  THR C CA    1 
ATOM   6253  C C     . THR C 1 183 ? 9.742   23.317  -90.214  1.00 20.07 ? 161  THR C C     1 
ATOM   6254  O O     . THR C 1 183 ? 9.383   24.459  -90.440  1.00 20.85 ? 161  THR C O     1 
ATOM   6255  C CB    . THR C 1 183 ? 8.777   21.497  -91.696  1.00 22.12 ? 161  THR C CB    1 
ATOM   6256  O OG1   . THR C 1 183 ? 8.181   22.387  -92.644  1.00 20.79 ? 161  THR C OG1   1 
ATOM   6257  C CG2   . THR C 1 183 ? 8.023   20.164  -91.691  1.00 23.78 ? 161  THR C CG2   1 
ATOM   6258  N N     . GLY C 1 184 ? 10.987  23.007  -89.921  1.00 19.68 ? 162  GLY C N     1 
ATOM   6259  C CA    . GLY C 1 184 ? 11.979  24.015  -89.595  1.00 21.07 ? 162  GLY C CA    1 
ATOM   6260  C C     . GLY C 1 184 ? 12.389  24.985  -90.691  1.00 21.17 ? 162  GLY C C     1 
ATOM   6261  O O     . GLY C 1 184 ? 12.806  26.109  -90.390  1.00 22.10 ? 162  GLY C O     1 
ATOM   6262  N N     . GLU C 1 185 ? 12.293  24.578  -91.957  1.00 20.12 ? 163  GLU C N     1 
ATOM   6263  C CA    . GLU C 1 185 ? 12.643  25.485  -93.051  1.00 19.19 ? 163  GLU C CA    1 
ATOM   6264  C C     . GLU C 1 185 ? 11.698  26.685  -93.105  1.00 18.25 ? 163  GLU C C     1 
ATOM   6265  O O     . GLU C 1 185 ? 12.113  27.819  -93.369  1.00 18.41 ? 163  GLU C O     1 
ATOM   6266  C CB    . GLU C 1 185 ? 12.665  24.774  -94.408  1.00 20.25 ? 163  GLU C CB    1 
ATOM   6267  C CG    . GLU C 1 185 ? 11.364  24.822  -95.211  1.00 21.73 ? 163  GLU C CG    1 
ATOM   6268  C CD    . GLU C 1 185 ? 10.391  23.739  -94.809  1.00 24.06 ? 163  GLU C CD    1 
ATOM   6269  O OE1   . GLU C 1 185 ? 10.262  23.442  -93.602  1.00 28.17 ? 163  GLU C OE1   1 
ATOM   6270  O OE2   . GLU C 1 185 ? 9.757   23.170  -95.720  1.00 26.88 ? 163  GLU C OE2   1 
ATOM   6271  N N     . MET C 1 186 ? 10.424  26.419  -92.838  1.00 17.13 ? 164  MET C N     1 
ATOM   6272  C CA    . MET C 1 186 ? 9.416   27.465  -92.808  1.00 17.03 ? 164  MET C CA    1 
ATOM   6273  C C     . MET C 1 186 ? 9.482   28.286  -91.520  1.00 17.11 ? 164  MET C C     1 
ATOM   6274  O O     . MET C 1 186 ? 9.093   29.471  -91.500  1.00 17.30 ? 164  MET C O     1 
ATOM   6275  C CB    . MET C 1 186 ? 8.012   26.889  -92.957  1.00 16.78 ? 164  MET C CB    1 
ATOM   6276  C CG    . MET C 1 186 ? 7.068   27.883  -93.605  1.00 18.43 ? 164  MET C CG    1 
ATOM   6277  S SD    . MET C 1 186 ? 7.644   28.378  -95.257  1.00 21.52 ? 164  MET C SD    1 
ATOM   6278  C CE    . MET C 1 186 ? 7.102   30.083  -95.253  1.00 20.13 ? 164  MET C CE    1 
ATOM   6279  N N     . VAL C 1 187 ? 9.952   27.663  -90.443  1.00 16.27 ? 165  VAL C N     1 
ATOM   6280  C CA    . VAL C 1 187 ? 10.224  28.433  -89.237  1.00 16.10 ? 165  VAL C CA    1 
ATOM   6281  C C     . VAL C 1 187 ? 11.288  29.472  -89.544  1.00 15.91 ? 165  VAL C C     1 
ATOM   6282  O O     . VAL C 1 187 ? 11.081  30.659  -89.335  1.00 16.21 ? 165  VAL C O     1 
ATOM   6283  C CB    . VAL C 1 187 ? 10.635  27.547  -88.057  1.00 15.82 ? 165  VAL C CB    1 
ATOM   6284  C CG1   . VAL C 1 187 ? 11.193  28.393  -86.930  1.00 18.19 ? 165  VAL C CG1   1 
ATOM   6285  C CG2   . VAL C 1 187 ? 9.436   26.798  -87.577  1.00 16.16 ? 165  VAL C CG2   1 
ATOM   6286  N N     . GLU C 1 188 ? 12.410  29.023  -90.084  1.00 16.67 ? 166  GLU C N     1 
ATOM   6287  C CA    . GLU C 1 188 ? 13.496  29.933  -90.412  1.00 17.92 ? 166  GLU C CA    1 
ATOM   6288  C C     . GLU C 1 188 ? 13.018  31.056  -91.363  1.00 19.13 ? 166  GLU C C     1 
ATOM   6289  O O     . GLU C 1 188 ? 13.329  32.248  -91.154  1.00 19.82 ? 166  GLU C O     1 
ATOM   6290  C CB    . GLU C 1 188 ? 14.675  29.166  -91.020  1.00 17.58 ? 166  GLU C CB    1 
ATOM   6291  C CG    . GLU C 1 188 ? 15.379  28.251  -90.051  1.00 22.55 ? 166  GLU C CG    1 
ATOM   6292  C CD    . GLU C 1 188 ? 16.452  27.391  -90.720  1.00 34.70 ? 166  GLU C CD    1 
ATOM   6293  O OE1   . GLU C 1 188 ? 17.179  27.948  -91.586  1.00 33.95 ? 166  GLU C OE1   1 
ATOM   6294  O OE2   . GLU C 1 188 ? 16.564  26.173  -90.376  1.00 31.38 ? 166  GLU C OE2   1 
ATOM   6295  N N     . GLU C 1 189 ? 12.247  30.684  -92.390  1.00 18.45 ? 167  GLU C N     1 
ATOM   6296  C CA    . GLU C 1 189 ? 11.853  31.661  -93.393  1.00 18.88 ? 167  GLU C CA    1 
ATOM   6297  C C     . GLU C 1 189 ? 10.986  32.719  -92.764  1.00 18.75 ? 167  GLU C C     1 
ATOM   6298  O O     . GLU C 1 189 ? 11.201  33.900  -93.012  1.00 18.18 ? 167  GLU C O     1 
ATOM   6299  C CB    . GLU C 1 189 ? 11.146  31.017  -94.604  1.00 20.88 ? 167  GLU C CB    1 
ATOM   6300  C CG    . GLU C 1 189 ? 11.011  31.941  -95.815  1.00 23.01 ? 167  GLU C CG    1 
ATOM   6301  C CD    . GLU C 1 189 ? 12.344  32.594  -96.258  1.00 35.37 ? 167  GLU C CD    1 
ATOM   6302  O OE1   . GLU C 1 189 ? 13.353  31.880  -96.536  1.00 31.61 ? 167  GLU C OE1   1 
ATOM   6303  O OE2   . GLU C 1 189 ? 12.376  33.848  -96.325  1.00 38.52 ? 167  GLU C OE2   1 
ATOM   6304  N N     . LEU C 1 190 ? 10.036  32.287  -91.930  1.00 19.71 ? 168  LEU C N     1 
ATOM   6305  C CA    . LEU C 1 190 ? 9.116   33.219  -91.266  1.00 20.40 ? 168  LEU C CA    1 
ATOM   6306  C C     . LEU C 1 190 ? 9.826   34.127  -90.243  1.00 20.11 ? 168  LEU C C     1 
ATOM   6307  O O     . LEU C 1 190 ? 9.454   35.291  -90.070  1.00 19.03 ? 168  LEU C O     1 
ATOM   6308  C CB    . LEU C 1 190 ? 7.957   32.475  -90.613  1.00 19.77 ? 168  LEU C CB    1 
ATOM   6309  C CG    . LEU C 1 190 ? 6.973   31.908  -91.625  1.00 22.16 ? 168  LEU C CG    1 
ATOM   6310  C CD1   . LEU C 1 190 ? 6.041   30.944  -90.930  1.00 25.48 ? 168  LEU C CD1   1 
ATOM   6311  C CD2   . LEU C 1 190 ? 6.189   33.035  -92.318  1.00 24.06 ? 168  LEU C CD2   1 
ATOM   6312  N N     . ILE C 1 191 ? 10.840  33.592  -89.577  1.00 19.81 ? 169  ILE C N     1 
ATOM   6313  C CA    . ILE C 1 191 ? 11.583  34.377  -88.613  1.00 20.25 ? 169  ILE C CA    1 
ATOM   6314  C C     . ILE C 1 191 ? 12.439  35.395  -89.323  1.00 21.07 ? 169  ILE C C     1 
ATOM   6315  O O     . ILE C 1 191 ? 12.455  36.572  -88.935  1.00 21.54 ? 169  ILE C O     1 
ATOM   6316  C CB    . ILE C 1 191 ? 12.429  33.501  -87.700  1.00 20.10 ? 169  ILE C CB    1 
ATOM   6317  C CG1   . ILE C 1 191 ? 11.499  32.804  -86.714  1.00 18.84 ? 169  ILE C CG1   1 
ATOM   6318  C CG2   . ILE C 1 191 ? 13.459  34.338  -86.940  1.00 20.49 ? 169  ILE C CG2   1 
ATOM   6319  C CD1   . ILE C 1 191 ? 12.156  31.659  -86.029  1.00 22.23 ? 169  ILE C CD1   1 
ATOM   6320  N N     . LEU C 1 192 ? 13.140  34.937  -90.366  1.00 21.99 ? 170  LEU C N     1 
ATOM   6321  C CA    . LEU C 1 192 ? 13.931  35.825  -91.207  1.00 21.61 ? 170  LEU C CA    1 
ATOM   6322  C C     . LEU C 1 192 ? 13.056  36.907  -91.842  1.00 21.22 ? 170  LEU C C     1 
ATOM   6323  O O     . LEU C 1 192 ? 13.496  38.035  -92.040  1.00 21.91 ? 170  LEU C O     1 
ATOM   6324  C CB    . LEU C 1 192 ? 14.665  35.035  -92.289  1.00 20.57 ? 170  LEU C CB    1 
ATOM   6325  C CG    . LEU C 1 192 ? 15.774  34.146  -91.720  1.00 22.77 ? 170  LEU C CG    1 
ATOM   6326  C CD1   . LEU C 1 192 ? 16.178  33.046  -92.703  1.00 23.58 ? 170  LEU C CD1   1 
ATOM   6327  C CD2   . LEU C 1 192 ? 16.992  34.964  -91.314  1.00 26.65 ? 170  LEU C CD2   1 
ATOM   6328  N N     . SER C 1 193 ? 11.804  36.571  -92.116  1.00 20.92 ? 171  SER C N     1 
ATOM   6329  C CA    . SER C 1 193 ? 10.854  37.519  -92.700  1.00 20.00 ? 171  SER C CA    1 
ATOM   6330  C C     . SER C 1 193 ? 10.209  38.509  -91.707  1.00 18.61 ? 171  SER C C     1 
ATOM   6331  O O     . SER C 1 193 ? 9.497   39.418  -92.122  1.00 18.71 ? 171  SER C O     1 
ATOM   6332  C CB    . SER C 1 193 ? 9.755   36.742  -93.425  1.00 20.97 ? 171  SER C CB    1 
ATOM   6333  O OG    . SER C 1 193 ? 10.343  35.921  -94.420  1.00 21.87 ? 171  SER C OG    1 
ATOM   6334  N N     . GLY C 1 194 ? 10.438  38.320  -90.411  1.00 17.43 ? 172  GLY C N     1 
ATOM   6335  C CA    . GLY C 1 194 ? 10.033  39.295  -89.407  1.00 17.06 ? 172  GLY C CA    1 
ATOM   6336  C C     . GLY C 1 194 ? 9.226   38.780  -88.228  1.00 17.90 ? 172  GLY C C     1 
ATOM   6337  O O     . GLY C 1 194 ? 9.029   39.509  -87.274  1.00 17.86 ? 172  GLY C O     1 
ATOM   6338  N N     . ALA C 1 195 ? 8.773   37.532  -88.263  1.00 17.23 ? 173  ALA C N     1 
ATOM   6339  C CA    . ALA C 1 195 ? 8.011   36.992  -87.136  1.00 17.31 ? 173  ALA C CA    1 
ATOM   6340  C C     . ALA C 1 195 ? 8.966   36.675  -86.015  1.00 16.52 ? 173  ALA C C     1 
ATOM   6341  O O     . ALA C 1 195 ? 10.066  36.201  -86.258  1.00 17.16 ? 173  ALA C O     1 
ATOM   6342  C CB    . ALA C 1 195 ? 7.204   35.726  -87.542  1.00 18.87 ? 173  ALA C CB    1 
ATOM   6343  N N     . ASP C 1 196 ? 8.525   36.924  -84.783  1.00 17.04 ? 174  ASP C N     1 
ATOM   6344  C CA    . ASP C 1 196 ? 9.329   36.669  -83.595  1.00 16.84 ? 174  ASP C CA    1 
ATOM   6345  C C     . ASP C 1 196 ? 9.098   35.258  -83.081  1.00 17.84 ? 174  ASP C C     1 
ATOM   6346  O O     . ASP C 1 196 ? 10.042  34.581  -82.634  1.00 16.99 ? 174  ASP C O     1 
ATOM   6347  C CB    . ASP C 1 196 ? 8.954   37.680  -82.513  1.00 15.88 ? 174  ASP C CB    1 
ATOM   6348  C CG    . ASP C 1 196 ? 9.408   39.079  -82.849  1.00 15.35 ? 174  ASP C CG    1 
ATOM   6349  O OD1   . ASP C 1 196 ? 10.638  39.291  -82.953  1.00 11.99 ? 174  ASP C OD1   1 
ATOM   6350  O OD2   . ASP C 1 196 ? 8.546   39.970  -83.005  1.00 15.30 ? 174  ASP C OD2   1 
ATOM   6351  N N     . ILE C 1 197 ? 7.825   34.845  -83.124  1.00 18.84 ? 175  ILE C N     1 
ATOM   6352  C CA    . ILE C 1 197 ? 7.385   33.594  -82.539  1.00 19.27 ? 175  ILE C CA    1 
ATOM   6353  C C     . ILE C 1 197 ? 6.552   32.879  -83.577  1.00 20.21 ? 175  ILE C C     1 
ATOM   6354  O O     . ILE C 1 197 ? 5.579   33.452  -84.095  1.00 19.70 ? 175  ILE C O     1 
ATOM   6355  C CB    . ILE C 1 197 ? 6.508   33.840  -81.287  1.00 19.43 ? 175  ILE C CB    1 
ATOM   6356  C CG1   . ILE C 1 197 ? 7.190   34.806  -80.307  1.00 18.25 ? 175  ILE C CG1   1 
ATOM   6357  C CG2   . ILE C 1 197 ? 6.135   32.519  -80.585  1.00 19.96 ? 175  ILE C CG2   1 
ATOM   6358  C CD1   . ILE C 1 197 ? 6.238   35.295  -79.211  1.00 18.60 ? 175  ILE C CD1   1 
ATOM   6359  N N     . ILE C 1 198 ? 6.917   31.627  -83.860  1.00 20.36 ? 176  ILE C N     1 
ATOM   6360  C CA    . ILE C 1 198 ? 6.235   30.825  -84.882  1.00 19.41 ? 176  ILE C CA    1 
ATOM   6361  C C     . ILE C 1 198 ? 5.315   29.820  -84.235  1.00 16.85 ? 176  ILE C C     1 
ATOM   6362  O O     . ILE C 1 198 ? 5.757   29.035  -83.406  1.00 16.72 ? 176  ILE C O     1 
ATOM   6363  C CB    . ILE C 1 198 ? 7.232   30.097  -85.794  1.00 19.68 ? 176  ILE C CB    1 
ATOM   6364  C CG1   . ILE C 1 198 ? 8.252   31.104  -86.368  1.00 18.99 ? 176  ILE C CG1   1 
ATOM   6365  C CG2   . ILE C 1 198 ? 6.491   29.361  -86.901  1.00 23.13 ? 176  ILE C CG2   1 
ATOM   6366  C CD1   . ILE C 1 198 ? 7.637   32.337  -86.991  1.00 17.90 ? 176  ILE C CD1   1 
ATOM   6367  N N     . LYS C 1 199 ? 4.042   29.859  -84.619  1.00 15.70 ? 177  LYS C N     1 
ATOM   6368  C CA    . LYS C 1 199 ? 3.041   28.916  -84.096  1.00 15.51 ? 177  LYS C CA    1 
ATOM   6369  C C     . LYS C 1 199 ? 3.141   27.580  -84.829  1.00 15.41 ? 177  LYS C C     1 
ATOM   6370  O O     . LYS C 1 199 ? 2.990   27.512  -86.058  1.00 15.12 ? 177  LYS C O     1 
ATOM   6371  C CB    . LYS C 1 199 ? 1.636   29.458  -84.231  1.00 12.09 ? 177  LYS C CB    1 
ATOM   6372  C CG    . LYS C 1 199 ? 1.419   30.693  -83.478  1.00 13.61 ? 177  LYS C CG    1 
ATOM   6373  C CD    . LYS C 1 199 ? 0.095   31.320  -83.848  1.00 21.52 ? 177  LYS C CD    1 
ATOM   6374  C CE    . LYS C 1 199 ? -1.080  30.494  -83.333  1.00 19.95 ? 177  LYS C CE    1 
ATOM   6375  N NZ    . LYS C 1 199 ? -2.112  30.333  -84.367  1.00 16.39 ? 177  LYS C NZ    1 
ATOM   6376  N N     . VAL C 1 200 ? 3.402   26.533  -84.058  1.00 15.24 ? 178  VAL C N     1 
ATOM   6377  C CA    . VAL C 1 200 ? 3.736   25.236  -84.607  1.00 16.39 ? 178  VAL C CA    1 
ATOM   6378  C C     . VAL C 1 200 ? 2.641   24.225  -84.302  1.00 16.50 ? 178  VAL C C     1 
ATOM   6379  O O     . VAL C 1 200 ? 2.305   23.956  -83.133  1.00 14.19 ? 178  VAL C O     1 
ATOM   6380  C CB    . VAL C 1 200 ? 5.114   24.779  -84.053  1.00 16.45 ? 178  VAL C CB    1 
ATOM   6381  C CG1   . VAL C 1 200 ? 5.434   23.326  -84.429  1.00 14.98 ? 178  VAL C CG1   1 
ATOM   6382  C CG2   . VAL C 1 200 ? 6.208   25.750  -84.555  1.00 15.53 ? 178  VAL C CG2   1 
ATOM   6383  N N     . GLY C 1 201 ? 2.068   23.695  -85.370  1.00 17.68 ? 179  GLY C N     1 
ATOM   6384  C CA    . GLY C 1 201 ? 1.076   22.620  -85.263  1.00 19.99 ? 179  GLY C CA    1 
ATOM   6385  C C     . GLY C 1 201 ? 0.084   22.639  -86.405  1.00 20.59 ? 179  GLY C C     1 
ATOM   6386  O O     . GLY C 1 201 ? -0.573  23.661  -86.647  1.00 23.28 ? 179  GLY C O     1 
ATOM   6387  N N     . VAL C 1 202 ? -0.011  21.522  -87.114  1.00 20.22 ? 180  VAL C N     1 
ATOM   6388  C CA    . VAL C 1 202 ? -1.008  21.353  -88.176  1.00 20.02 ? 180  VAL C CA    1 
ATOM   6389  C C     . VAL C 1 202 ? -1.547  19.921  -88.110  1.00 20.54 ? 180  VAL C C     1 
ATOM   6390  O O     . VAL C 1 202 ? -0.822  18.979  -88.426  1.00 21.14 ? 180  VAL C O     1 
ATOM   6391  C CB    . VAL C 1 202 ? -0.425  21.651  -89.572  1.00 19.47 ? 180  VAL C CB    1 
ATOM   6392  C CG1   . VAL C 1 202 ? -1.392  21.271  -90.662  1.00 20.72 ? 180  VAL C CG1   1 
ATOM   6393  C CG2   . VAL C 1 202 ? -0.107  23.135  -89.711  1.00 19.31 ? 180  VAL C CG2   1 
ATOM   6394  N N     . GLY C 1 203 ? -2.801  19.766  -87.661  1.00 20.64 ? 181  GLY C N     1 
ATOM   6395  C CA    . GLY C 1 203 ? -3.432  18.449  -87.509  1.00 20.10 ? 181  GLY C CA    1 
ATOM   6396  C C     . GLY C 1 203 ? -3.916  18.105  -86.098  1.00 20.19 ? 181  GLY C C     1 
ATOM   6397  O O     . GLY C 1 203 ? -5.093  17.745  -85.907  1.00 19.95 ? 181  GLY C O     1 
ATOM   6398  N N     . PRO C 1 204 ? -3.002  18.127  -85.109  1.00 19.31 ? 182  PRO C N     1 
ATOM   6399  C CA    . PRO C 1 204 ? -3.294  17.783  -83.703  1.00 19.04 ? 182  PRO C CA    1 
ATOM   6400  C C     . PRO C 1 204 ? -4.433  18.503  -82.963  1.00 18.62 ? 182  PRO C C     1 
ATOM   6401  O O     . PRO C 1 204 ? -5.009  17.923  -82.036  1.00 19.56 ? 182  PRO C O     1 
ATOM   6402  C CB    . PRO C 1 204 ? -1.964  18.087  -82.999  1.00 18.87 ? 182  PRO C CB    1 
ATOM   6403  C CG    . PRO C 1 204 ? -0.948  17.785  -84.067  1.00 21.76 ? 182  PRO C CG    1 
ATOM   6404  C CD    . PRO C 1 204 ? -1.560  18.363  -85.308  1.00 19.95 ? 182  PRO C CD    1 
ATOM   6405  N N     . GLY C 1 205 ? -4.737  19.743  -83.353  1.00 16.91 ? 183  GLY C N     1 
ATOM   6406  C CA    . GLY C 1 205 ? -5.727  20.559  -82.663  1.00 15.79 ? 183  GLY C CA    1 
ATOM   6407  C C     . GLY C 1 205 ? -7.027  19.825  -82.417  1.00 14.03 ? 183  GLY C C     1 
ATOM   6408  O O     . GLY C 1 205 ? -7.528  19.151  -83.300  1.00 12.32 ? 183  GLY C O     1 
ATOM   6409  N N     . SER C 1 206 ? -7.581  19.957  -81.215  1.00 14.67 ? 184  SER C N     1 
ATOM   6410  C CA    . SER C 1 206 ? -8.810  19.245  -80.827  1.00 14.44 ? 184  SER C CA    1 
ATOM   6411  C C     . SER C 1 206 ? -9.935  19.324  -81.884  1.00 13.77 ? 184  SER C C     1 
ATOM   6412  O O     . SER C 1 206 ? -10.535 18.314  -82.189  1.00 12.78 ? 184  SER C O     1 
ATOM   6413  C CB    . SER C 1 206 ? -9.289  19.720  -79.432  1.00 13.97 ? 184  SER C CB    1 
ATOM   6414  O OG    . SER C 1 206 ? -9.558  21.118  -79.359  1.00 15.01 ? 184  SER C OG    1 
ATOM   6415  N N     . VAL C 1 207 ? -10.187 20.508  -82.451  1.00 14.54 ? 185  VAL C N     1 
ATOM   6416  C CA    . VAL C 1 207 ? -11.212 20.667  -83.495  1.00 14.28 ? 185  VAL C CA    1 
ATOM   6417  C C     . VAL C 1 207 ? -10.684 20.855  -84.934  1.00 13.71 ? 185  VAL C C     1 
ATOM   6418  O O     . VAL C 1 207 ? -11.450 20.964  -85.893  1.00 14.56 ? 185  VAL C O     1 
ATOM   6419  C CB    . VAL C 1 207 ? -12.223 21.779  -83.138  1.00 15.61 ? 185  VAL C CB    1 
ATOM   6420  C CG1   . VAL C 1 207 ? -13.027 21.372  -81.909  1.00 15.24 ? 185  VAL C CG1   1 
ATOM   6421  C CG2   . VAL C 1 207 ? -11.541 23.131  -82.928  1.00 17.39 ? 185  VAL C CG2   1 
ATOM   6422  N N     . CYS C 1 208 ? -9.372  20.842  -85.078  1.00 13.80 ? 186  CYS C N     1 
ATOM   6423  C CA    . CYS C 1 208 ? -8.718  20.812  -86.384  1.00 12.99 ? 186  CYS C CA    1 
ATOM   6424  C C     . CYS C 1 208 ? -9.060  19.526  -87.078  1.00 14.07 ? 186  CYS C C     1 
ATOM   6425  O O     . CYS C 1 208 ? -9.134  18.492  -86.421  1.00 16.82 ? 186  CYS C O     1 
ATOM   6426  C CB    . CYS C 1 208 ? -7.202  20.915  -86.187  1.00 13.71 ? 186  CYS C CB    1 
ATOM   6427  S SG    . CYS C 1 208 ? -6.211  20.431  -87.582  1.00 18.59 ? 186  CYS C SG    1 
ATOM   6428  N N     . THR C 1 209 ? -9.259  19.589  -88.401  1.00 13.81 ? 187  THR C N     1 
ATOM   6429  C CA    . THR C 1 209 ? -9.636  18.431  -89.244  1.00 11.80 ? 187  THR C CA    1 
ATOM   6430  C C     . THR C 1 209 ? -8.769  18.290  -90.514  1.00 11.33 ? 187  THR C C     1 
ATOM   6431  O O     . THR C 1 209 ? -9.214  17.702  -91.499  1.00 11.38 ? 187  THR C O     1 
ATOM   6432  C CB    . THR C 1 209 ? -11.086 18.576  -89.718  1.00 10.82 ? 187  THR C CB    1 
ATOM   6433  O OG1   . THR C 1 209 ? -11.266 19.895  -90.251  1.00 15.99 ? 187  THR C OG1   1 
ATOM   6434  C CG2   . THR C 1 209 ? -12.054 18.374  -88.584  1.00 15.17 ? 187  THR C CG2   1 
ATOM   6435  N N     . THR C 1 210 ? -7.545  18.806  -90.511  1.00 12.34 ? 188  THR C N     1 
ATOM   6436  C CA    . THR C 1 210 ? -6.719  18.764  -91.730  1.00 14.19 ? 188  THR C CA    1 
ATOM   6437  C C     . THR C 1 210 ? -6.491  17.343  -92.178  1.00 14.85 ? 188  THR C C     1 
ATOM   6438  O O     . THR C 1 210 ? -6.528  17.048  -93.368  1.00 16.06 ? 188  THR C O     1 
ATOM   6439  C CB    . THR C 1 210 ? -5.293  19.377  -91.599  1.00 14.14 ? 188  THR C CB    1 
ATOM   6440  O OG1   . THR C 1 210 ? -4.534  18.633  -90.636  1.00 15.09 ? 188  THR C OG1   1 
ATOM   6441  C CG2   . THR C 1 210 ? -5.335  20.873  -91.254  1.00 11.77 ? 188  THR C CG2   1 
ATOM   6442  N N     . ARG C 1 211 ? -6.256  16.470  -91.216  1.00 16.39 ? 189  ARG C N     1 
ATOM   6443  C CA    . ARG C 1 211 ? -5.865  15.098  -91.517  1.00 17.71 ? 189  ARG C CA    1 
ATOM   6444  C C     . ARG C 1 211 ? -6.983  14.375  -92.231  1.00 16.93 ? 189  ARG C C     1 
ATOM   6445  O O     . ARG C 1 211 ? -6.750  13.703  -93.221  1.00 17.32 ? 189  ARG C O     1 
ATOM   6446  C CB    . ARG C 1 211 ? -5.481  14.372  -90.238  1.00 17.63 ? 189  ARG C CB    1 
ATOM   6447  C CG    . ARG C 1 211 ? -4.391  15.103  -89.470  1.00 19.74 ? 189  ARG C CG    1 
ATOM   6448  C CD    . ARG C 1 211 ? -3.796  14.222  -88.411  1.00 23.80 ? 189  ARG C CD    1 
ATOM   6449  N NE    . ARG C 1 211 ? -4.728  13.982  -87.313  1.00 26.67 ? 189  ARG C NE    1 
ATOM   6450  C CZ    . ARG C 1 211 ? -4.509  14.302  -86.043  1.00 27.46 ? 189  ARG C CZ    1 
ATOM   6451  N NH1   . ARG C 1 211 ? -3.376  14.875  -85.666  1.00 31.33 ? 189  ARG C NH1   1 
ATOM   6452  N NH2   . ARG C 1 211 ? -5.428  14.038  -85.137  1.00 26.53 ? 189  ARG C NH2   1 
ATOM   6453  N N     . THR C 1 212 ? -8.201  14.574  -91.744  1.00 17.60 ? 190  THR C N     1 
ATOM   6454  C CA    . THR C 1 212 ? -9.397  13.947  -92.309  1.00 16.97 ? 190  THR C CA    1 
ATOM   6455  C C     . THR C 1 212 ? -9.841  14.570  -93.631  1.00 17.71 ? 190  THR C C     1 
ATOM   6456  O O     . THR C 1 212 ? -10.335 13.864  -94.509  1.00 16.77 ? 190  THR C O     1 
ATOM   6457  C CB    . THR C 1 212 ? -10.532 13.965  -91.280  1.00 17.76 ? 190  THR C CB    1 
ATOM   6458  O OG1   . THR C 1 212 ? -10.380 12.812  -90.456  1.00 23.54 ? 190  THR C OG1   1 
ATOM   6459  C CG2   . THR C 1 212 ? -11.908 13.899  -91.913  1.00 22.07 ? 190  THR C CG2   1 
ATOM   6460  N N     . LYS C 1 213 ? -9.651  15.883  -93.771  1.00 18.03 ? 191  LYS C N     1 
ATOM   6461  C CA    . LYS C 1 213 ? -10.149 16.614  -94.925  1.00 17.84 ? 191  LYS C CA    1 
ATOM   6462  C C     . LYS C 1 213 ? -9.068  16.868  -95.996  1.00 16.63 ? 191  LYS C C     1 
ATOM   6463  O O     . LYS C 1 213 ? -9.401  17.054  -97.157  1.00 16.93 ? 191  LYS C O     1 
ATOM   6464  C CB    . LYS C 1 213 ? -10.869 17.872  -94.449  1.00 18.25 ? 191  LYS C CB    1 
ATOM   6465  C CG    . LYS C 1 213 ? -12.129 17.499  -93.623  1.00 21.86 ? 191  LYS C CG    1 
ATOM   6466  C CD    . LYS C 1 213 ? -12.924 18.718  -93.127  1.00 28.54 ? 191  LYS C CD    1 
ATOM   6467  C CE    . LYS C 1 213 ? -14.090 18.316  -92.212  1.00 28.78 ? 191  LYS C CE    1 
ATOM   6468  N NZ    . LYS C 1 213 ? -14.640 19.467  -91.405  1.00 31.76 ? 191  LYS C NZ    1 
ATOM   6469  N N     . THR C 1 214 ? -7.791  16.833  -95.619  1.00 16.05 ? 192  THR C N     1 
ATOM   6470  C CA    . THR C 1 214 ? -6.691  17.061  -96.567  1.00 16.05 ? 192  THR C CA    1 
ATOM   6471  C C     . THR C 1 214 ? -5.571  16.018  -96.516  1.00 16.53 ? 192  THR C C     1 
ATOM   6472  O O     . THR C 1 214 ? -4.760  15.949  -97.431  1.00 17.52 ? 192  THR C O     1 
ATOM   6473  C CB    . THR C 1 214 ? -6.054  18.456  -96.354  1.00 17.15 ? 192  THR C CB    1 
ATOM   6474  O OG1   . THR C 1 214 ? -5.047  18.408  -95.326  1.00 14.44 ? 192  THR C OG1   1 
ATOM   6475  C CG2   . THR C 1 214 ? -7.122  19.466  -95.975  1.00 16.44 ? 192  THR C CG2   1 
ATOM   6476  N N     . GLY C 1 215 ? -5.499  15.244  -95.434  1.00 16.56 ? 193  GLY C N     1 
ATOM   6477  C CA    . GLY C 1 215 ? -4.430  14.269  -95.239  1.00 16.18 ? 193  GLY C CA    1 
ATOM   6478  C C     . GLY C 1 215 ? -3.076  14.894  -95.008  1.00 15.97 ? 193  GLY C C     1 
ATOM   6479  O O     . GLY C 1 215 ? -2.051  14.210  -95.053  1.00 14.05 ? 193  GLY C O     1 
ATOM   6480  N N     . VAL C 1 216 ? -3.079  16.202  -94.759  1.00 17.86 ? 194  VAL C N     1 
ATOM   6481  C CA    . VAL C 1 216 ? -1.873  16.959  -94.481  1.00 17.94 ? 194  VAL C CA    1 
ATOM   6482  C C     . VAL C 1 216 ? -1.849  17.199  -92.974  1.00 18.96 ? 194  VAL C C     1 
ATOM   6483  O O     . VAL C 1 216 ? -2.905  17.412  -92.336  1.00 20.28 ? 194  VAL C O     1 
ATOM   6484  C CB    . VAL C 1 216 ? -1.841  18.314  -95.256  1.00 17.33 ? 194  VAL C CB    1 
ATOM   6485  C CG1   . VAL C 1 216 ? -0.789  19.255  -94.679  1.00 19.11 ? 194  VAL C CG1   1 
ATOM   6486  C CG2   . VAL C 1 216 ? -1.600  18.081  -96.762  1.00 15.25 ? 194  VAL C CG2   1 
ATOM   6487  N N     . GLY C 1 217 ? -0.642  17.144  -92.411  1.00 18.02 ? 195  GLY C N     1 
ATOM   6488  C CA    . GLY C 1 217 ? -0.469  17.338  -90.987  1.00 18.62 ? 195  GLY C CA    1 
ATOM   6489  C C     . GLY C 1 217 ? 0.861   16.785  -90.532  1.00 18.19 ? 195  GLY C C     1 
ATOM   6490  O O     . GLY C 1 217 ? 1.647   16.314  -91.352  1.00 18.93 ? 195  GLY C O     1 
ATOM   6491  N N     . TYR C 1 218 ? 1.085   16.826  -89.216  1.00 17.72 ? 196  TYR C N     1 
ATOM   6492  C CA    . TYR C 1 218 ? 2.348   16.399  -88.605  1.00 17.25 ? 196  TYR C CA    1 
ATOM   6493  C C     . TYR C 1 218 ? 2.113   16.132  -87.123  1.00 17.60 ? 196  TYR C C     1 
ATOM   6494  O O     . TYR C 1 218 ? 1.396   16.908  -86.470  1.00 19.31 ? 196  TYR C O     1 
ATOM   6495  C CB    . TYR C 1 218 ? 3.371   17.528  -88.732  1.00 17.78 ? 196  TYR C CB    1 
ATOM   6496  C CG    . TYR C 1 218 ? 4.781   17.125  -89.070  1.00 14.02 ? 196  TYR C CG    1 
ATOM   6497  C CD1   . TYR C 1 218 ? 5.197   17.049  -90.391  1.00 13.95 ? 196  TYR C CD1   1 
ATOM   6498  C CD2   . TYR C 1 218 ? 5.714   16.883  -88.067  1.00 13.25 ? 196  TYR C CD2   1 
ATOM   6499  C CE1   . TYR C 1 218 ? 6.498   16.706  -90.703  1.00 20.08 ? 196  TYR C CE1   1 
ATOM   6500  C CE2   . TYR C 1 218 ? 7.020   16.541  -88.366  1.00 17.82 ? 196  TYR C CE2   1 
ATOM   6501  C CZ    . TYR C 1 218 ? 7.413   16.452  -89.688  1.00 18.82 ? 196  TYR C CZ    1 
ATOM   6502  O OH    . TYR C 1 218 ? 8.721   16.120  -90.009  1.00 20.61 ? 196  TYR C OH    1 
ATOM   6503  N N     . PRO C 1 219 ? 2.690   15.044  -86.582  1.00 18.00 ? 197  PRO C N     1 
ATOM   6504  C CA    . PRO C 1 219 ? 2.641   14.801  -85.144  1.00 17.76 ? 197  PRO C CA    1 
ATOM   6505  C C     . PRO C 1 219 ? 3.173   15.976  -84.347  1.00 17.87 ? 197  PRO C C     1 
ATOM   6506  O O     . PRO C 1 219 ? 4.213   16.543  -84.713  1.00 19.82 ? 197  PRO C O     1 
ATOM   6507  C CB    . PRO C 1 219 ? 3.575   13.598  -84.966  1.00 16.36 ? 197  PRO C CB    1 
ATOM   6508  C CG    . PRO C 1 219 ? 3.482   12.885  -86.211  1.00 17.57 ? 197  PRO C CG    1 
ATOM   6509  C CD    . PRO C 1 219 ? 3.376   13.943  -87.278  1.00 17.32 ? 197  PRO C CD    1 
ATOM   6510  N N     . GLN C 1 220 ? 2.496   16.313  -83.251  1.00 16.45 ? 198  GLN C N     1 
ATOM   6511  C CA    . GLN C 1 220 ? 2.817   17.531  -82.513  1.00 17.19 ? 198  GLN C CA    1 
ATOM   6512  C C     . GLN C 1 220 ? 4.187   17.523  -81.829  1.00 16.54 ? 198  GLN C C     1 
ATOM   6513  O O     . GLN C 1 220 ? 4.885   18.543  -81.822  1.00 17.53 ? 198  GLN C O     1 
ATOM   6514  C CB    . GLN C 1 220 ? 1.723   17.826  -81.482  1.00 15.86 ? 198  GLN C CB    1 
ATOM   6515  C CG    . GLN C 1 220 ? 1.793   19.203  -80.860  1.00 17.89 ? 198  GLN C CG    1 
ATOM   6516  C CD    . GLN C 1 220 ? 1.745   20.337  -81.873  1.00 18.04 ? 198  GLN C CD    1 
ATOM   6517  O OE1   . GLN C 1 220 ? 1.504   20.123  -83.071  1.00 12.55 ? 198  GLN C OE1   1 
ATOM   6518  N NE2   . GLN C 1 220 ? 2.001   21.557  -81.394  1.00 15.21 ? 198  GLN C NE2   1 
ATOM   6519  N N     . LEU C 1 221 ? 4.570   16.399  -81.235  1.00 16.80 ? 199  LEU C N     1 
ATOM   6520  C CA    . LEU C 1 221 ? 5.888   16.319  -80.602  1.00 18.59 ? 199  LEU C CA    1 
ATOM   6521  C C     . LEU C 1 221 ? 7.004   16.516  -81.620  1.00 17.91 ? 199  LEU C C     1 
ATOM   6522  O O     . LEU C 1 221 ? 7.913   17.307  -81.413  1.00 17.97 ? 199  LEU C O     1 
ATOM   6523  C CB    . LEU C 1 221 ? 6.132   14.983  -79.871  1.00 19.18 ? 199  LEU C CB    1 
ATOM   6524  C CG    . LEU C 1 221 ? 7.553   14.948  -79.274  1.00 19.83 ? 199  LEU C CG    1 
ATOM   6525  C CD1   . LEU C 1 221 ? 7.606   15.847  -78.026  1.00 26.19 ? 199  LEU C CD1   1 
ATOM   6526  C CD2   . LEU C 1 221 ? 8.011   13.582  -78.952  1.00 21.62 ? 199  LEU C CD2   1 
ATOM   6527  N N     . SER C 1 222 ? 6.959   15.764  -82.708  1.00 18.31 ? 200  SER C N     1 
ATOM   6528  C CA    . SER C 1 222 ? 8.055   15.830  -83.670  1.00 19.27 ? 200  SER C CA    1 
ATOM   6529  C C     . SER C 1 222 ? 8.075   17.208  -84.306  1.00 19.95 ? 200  SER C C     1 
ATOM   6530  O O     . SER C 1 222 ? 9.144   17.732  -84.644  1.00 20.91 ? 200  SER C O     1 
ATOM   6531  C CB    . SER C 1 222 ? 7.978   14.723  -84.710  1.00 18.04 ? 200  SER C CB    1 
ATOM   6532  O OG    . SER C 1 222 ? 8.266   13.473  -84.103  1.00 18.14 ? 200  SER C OG    1 
ATOM   6533  N N     . ALA C 1 223 ? 6.896   17.814  -84.436  1.00 19.16 ? 201  ALA C N     1 
ATOM   6534  C CA    . ALA C 1 223 ? 6.805   19.165  -84.993  1.00 19.01 ? 201  ALA C CA    1 
ATOM   6535  C C     . ALA C 1 223 ? 7.598   20.112  -84.098  1.00 19.39 ? 201  ALA C C     1 
ATOM   6536  O O     . ALA C 1 223 ? 8.557   20.749  -84.535  1.00 17.07 ? 201  ALA C O     1 
ATOM   6537  C CB    . ALA C 1 223 ? 5.361   19.600  -85.098  1.00 17.73 ? 201  ALA C CB    1 
ATOM   6538  N N     . VAL C 1 224 ? 7.231   20.128  -82.819  1.00 20.71 ? 202  VAL C N     1 
ATOM   6539  C CA    . VAL C 1 224 ? 7.901   20.957  -81.820  1.00 19.83 ? 202  VAL C CA    1 
ATOM   6540  C C     . VAL C 1 224 ? 9.413   20.662  -81.737  1.00 20.74 ? 202  VAL C C     1 
ATOM   6541  O O     . VAL C 1 224 ? 10.203  21.568  -81.684  1.00 21.95 ? 202  VAL C O     1 
ATOM   6542  C CB    . VAL C 1 224 ? 7.222   20.767  -80.447  1.00 19.39 ? 202  VAL C CB    1 
ATOM   6543  C CG1   . VAL C 1 224 ? 7.997   21.463  -79.373  1.00 23.66 ? 202  VAL C CG1   1 
ATOM   6544  C CG2   . VAL C 1 224 ? 5.776   21.287  -80.474  1.00 18.61 ? 202  VAL C CG2   1 
ATOM   6545  N N     . ILE C 1 225 ? 9.806   19.397  -81.718  1.00 22.38 ? 203  ILE C N     1 
ATOM   6546  C CA    . ILE C 1 225 ? 11.211  19.022  -81.631  1.00 25.29 ? 203  ILE C CA    1 
ATOM   6547  C C     . ILE C 1 225 ? 12.036  19.688  -82.742  1.00 25.67 ? 203  ILE C C     1 
ATOM   6548  O O     . ILE C 1 225 ? 13.055  20.325  -82.483  1.00 23.55 ? 203  ILE C O     1 
ATOM   6549  C CB    . ILE C 1 225 ? 11.356  17.469  -81.751  1.00 27.01 ? 203  ILE C CB    1 
ATOM   6550  C CG1   . ILE C 1 225 ? 10.904  16.767  -80.467  1.00 30.20 ? 203  ILE C CG1   1 
ATOM   6551  C CG2   . ILE C 1 225 ? 12.774  17.068  -82.097  1.00 28.59 ? 203  ILE C CG2   1 
ATOM   6552  C CD1   . ILE C 1 225 ? 11.874  16.912  -79.285  1.00 33.98 ? 203  ILE C CD1   1 
ATOM   6553  N N     . GLU C 1 226 ? 11.570  19.527  -83.977  1.00 27.59 ? 204  GLU C N     1 
ATOM   6554  C CA    . GLU C 1 226 ? 12.309  19.978  -85.160  1.00 28.61 ? 204  GLU C CA    1 
ATOM   6555  C C     . GLU C 1 226 ? 12.257  21.486  -85.313  1.00 26.81 ? 204  GLU C C     1 
ATOM   6556  O O     . GLU C 1 226 ? 13.254  22.130  -85.617  1.00 27.37 ? 204  GLU C O     1 
ATOM   6557  C CB    . GLU C 1 226 ? 11.733  19.339  -86.427  1.00 30.74 ? 204  GLU C CB    1 
ATOM   6558  C CG    . GLU C 1 226 ? 11.724  17.789  -86.419  1.00 37.23 ? 204  GLU C CG    1 
ATOM   6559  C CD    . GLU C 1 226 ? 10.890  17.207  -87.552  1.00 40.92 ? 204  GLU C CD    1 
ATOM   6560  O OE1   . GLU C 1 226 ? 10.766  17.878  -88.598  1.00 43.30 ? 204  GLU C OE1   1 
ATOM   6561  O OE2   . GLU C 1 226 ? 10.366  16.084  -87.399  1.00 38.14 ? 204  GLU C OE2   1 
ATOM   6562  N N     . CYS C 1 227 ? 11.073  22.042  -85.114  1.00 25.33 ? 205  CYS C N     1 
ATOM   6563  C CA    . CYS C 1 227 ? 10.875  23.467  -85.266  1.00 24.43 ? 205  CYS C CA    1 
ATOM   6564  C C     . CYS C 1 227 ? 11.553  24.278  -84.181  1.00 23.89 ? 205  CYS C C     1 
ATOM   6565  O O     . CYS C 1 227 ? 12.028  25.365  -84.464  1.00 24.04 ? 205  CYS C O     1 
ATOM   6566  C CB    . CYS C 1 227 ? 9.392   23.805  -85.302  1.00 25.17 ? 205  CYS C CB    1 
ATOM   6567  S SG    . CYS C 1 227 ? 8.669   23.411  -86.884  1.00 24.87 ? 205  CYS C SG    1 
ATOM   6568  N N     . ALA C 1 228 ? 11.578  23.768  -82.948  1.00 23.95 ? 206  ALA C N     1 
ATOM   6569  C CA    . ALA C 1 228 ? 12.248  24.443  -81.832  1.00 22.77 ? 206  ALA C CA    1 
ATOM   6570  C C     . ALA C 1 228 ? 13.742  24.610  -82.121  1.00 22.82 ? 206  ALA C C     1 
ATOM   6571  O O     . ALA C 1 228 ? 14.309  25.702  -81.952  1.00 22.11 ? 206  ALA C O     1 
ATOM   6572  C CB    . ALA C 1 228 ? 12.062  23.675  -80.538  1.00 23.30 ? 206  ALA C CB    1 
ATOM   6573  N N     . ASP C 1 229 ? 14.380  23.533  -82.562  1.00 24.65 ? 207  ASP C N     1 
ATOM   6574  C CA    . ASP C 1 229 ? 15.803  23.596  -82.973  1.00 26.46 ? 207  ASP C CA    1 
ATOM   6575  C C     . ASP C 1 229 ? 16.016  24.711  -83.970  1.00 25.55 ? 207  ASP C C     1 
ATOM   6576  O O     . ASP C 1 229 ? 16.938  25.511  -83.831  1.00 27.03 ? 207  ASP C O     1 
ATOM   6577  C CB    . ASP C 1 229 ? 16.292  22.300  -83.659  1.00 27.54 ? 207  ASP C CB    1 
ATOM   6578  C CG    . ASP C 1 229 ? 16.445  21.114  -82.695  1.00 34.41 ? 207  ASP C CG    1 
ATOM   6579  O OD1   . ASP C 1 229 ? 16.788  21.335  -81.508  1.00 38.50 ? 207  ASP C OD1   1 
ATOM   6580  O OD2   . ASP C 1 229 ? 16.240  19.945  -83.134  1.00 40.20 ? 207  ASP C OD2   1 
ATOM   6581  N N     . SER C 1 230 ? 15.151  24.744  -84.978  1.00 24.72 ? 208  SER C N     1 
ATOM   6582  C CA    . SER C 1 230 ? 15.287  25.668  -86.106  1.00 24.05 ? 208  SER C CA    1 
ATOM   6583  C C     . SER C 1 230 ? 15.086  27.130  -85.674  1.00 22.82 ? 208  SER C C     1 
ATOM   6584  O O     . SER C 1 230 ? 15.848  28.029  -86.061  1.00 23.53 ? 208  SER C O     1 
ATOM   6585  C CB    . SER C 1 230 ? 14.320  25.280  -87.231  1.00 23.68 ? 208  SER C CB    1 
ATOM   6586  O OG    . SER C 1 230 ? 13.952  26.407  -87.983  1.00 28.70 ? 208  SER C OG    1 
ATOM   6587  N N     . ALA C 1 231 ? 14.072  27.350  -84.849  1.00 21.64 ? 209  ALA C N     1 
ATOM   6588  C CA    . ALA C 1 231 ? 13.807  28.672  -84.284  1.00 20.08 ? 209  ALA C CA    1 
ATOM   6589  C C     . ALA C 1 231 ? 14.974  29.145  -83.428  1.00 19.63 ? 209  ALA C C     1 
ATOM   6590  O O     . ALA C 1 231 ? 15.457  30.251  -83.606  1.00 19.81 ? 209  ALA C O     1 
ATOM   6591  C CB    . ALA C 1 231 ? 12.516  28.652  -83.447  1.00 18.13 ? 209  ALA C CB    1 
ATOM   6592  N N     . HIS C 1 232 ? 15.429  28.307  -82.507  1.00 19.40 ? 210  HIS C N     1 
ATOM   6593  C CA    . HIS C 1 232 ? 16.433  28.751  -81.536  1.00 19.35 ? 210  HIS C CA    1 
ATOM   6594  C C     . HIS C 1 232 ? 17.804  28.964  -82.163  1.00 19.35 ? 210  HIS C C     1 
ATOM   6595  O O     . HIS C 1 232 ? 18.600  29.757  -81.667  1.00 18.94 ? 210  HIS C O     1 
ATOM   6596  C CB    . HIS C 1 232 ? 16.538  27.799  -80.352  1.00 19.06 ? 210  HIS C CB    1 
ATOM   6597  C CG    . HIS C 1 232 ? 15.237  27.557  -79.660  1.00 16.23 ? 210  HIS C CG    1 
ATOM   6598  N ND1   . HIS C 1 232 ? 14.987  26.406  -78.952  1.00 15.31 ? 210  HIS C ND1   1 
ATOM   6599  C CD2   . HIS C 1 232 ? 14.103  28.295  -79.597  1.00 15.06 ? 210  HIS C CD2   1 
ATOM   6600  C CE1   . HIS C 1 232 ? 13.757  26.449  -78.462  1.00 22.22 ? 210  HIS C CE1   1 
ATOM   6601  N NE2   . HIS C 1 232 ? 13.198  27.587  -78.836  1.00 18.42 ? 210  HIS C NE2   1 
ATOM   6602  N N     . GLY C 1 233 ? 18.077  28.277  -83.261  1.00 20.86 ? 211  GLY C N     1 
ATOM   6603  C CA    . GLY C 1 233 ? 19.302  28.524  -84.019  1.00 21.56 ? 211  GLY C CA    1 
ATOM   6604  C C     . GLY C 1 233 ? 19.364  29.961  -84.520  1.00 21.72 ? 211  GLY C C     1 
ATOM   6605  O O     . GLY C 1 233 ? 20.443  30.506  -84.770  1.00 21.90 ? 211  GLY C O     1 
ATOM   6606  N N     . LEU C 1 234 ? 18.199  30.584  -84.664  1.00 21.66 ? 212  LEU C N     1 
ATOM   6607  C CA    . LEU C 1 234 ? 18.125  31.985  -85.083  1.00 22.35 ? 212  LEU C CA    1 
ATOM   6608  C C     . LEU C 1 234 ? 17.905  32.915  -83.914  1.00 22.10 ? 212  LEU C C     1 
ATOM   6609  O O     . LEU C 1 234 ? 17.688  34.106  -84.113  1.00 23.73 ? 212  LEU C O     1 
ATOM   6610  C CB    . LEU C 1 234 ? 17.015  32.209  -86.127  1.00 22.08 ? 212  LEU C CB    1 
ATOM   6611  C CG    . LEU C 1 234 ? 17.518  32.127  -87.582  1.00 24.67 ? 212  LEU C CG    1 
ATOM   6612  C CD1   . LEU C 1 234 ? 17.844  30.701  -87.977  1.00 25.58 ? 212  LEU C CD1   1 
ATOM   6613  C CD2   . LEU C 1 234 ? 16.517  32.724  -88.545  1.00 24.17 ? 212  LEU C CD2   1 
ATOM   6614  N N     . LYS C 1 235 ? 17.971  32.387  -82.694  1.00 21.57 ? 213  LYS C N     1 
ATOM   6615  C CA    . LYS C 1 235 ? 17.569  33.147  -81.505  1.00 21.25 ? 213  LYS C CA    1 
ATOM   6616  C C     . LYS C 1 235 ? 16.075  33.574  -81.561  1.00 19.59 ? 213  LYS C C     1 
ATOM   6617  O O     . LYS C 1 235 ? 15.662  34.571  -80.943  1.00 19.23 ? 213  LYS C O     1 
ATOM   6618  C CB    . LYS C 1 235 ? 18.537  34.329  -81.255  1.00 18.80 ? 213  LYS C CB    1 
ATOM   6619  C CG    . LYS C 1 235 ? 19.872  33.825  -80.680  1.00 24.88 ? 213  LYS C CG    1 
ATOM   6620  C CD    . LYS C 1 235 ? 21.088  34.685  -81.037  1.00 32.46 ? 213  LYS C CD    1 
ATOM   6621  C CE    . LYS C 1 235 ? 22.267  33.829  -81.474  1.00 31.86 ? 213  LYS C CE    1 
ATOM   6622  N N     . GLY C 1 236 ? 15.281  32.791  -82.303  1.00 17.95 ? 214  GLY C N     1 
ATOM   6623  C CA    . GLY C 1 236 ? 13.826  32.955  -82.370  1.00 17.15 ? 214  GLY C CA    1 
ATOM   6624  C C     . GLY C 1 236 ? 13.099  32.060  -81.388  1.00 14.90 ? 214  GLY C C     1 
ATOM   6625  O O     . GLY C 1 236 ? 13.710  31.413  -80.541  1.00 12.10 ? 214  GLY C O     1 
ATOM   6626  N N     . HIS C 1 237 ? 11.774  32.061  -81.484  1.00 16.21 ? 215  HIS C N     1 
ATOM   6627  C CA    . HIS C 1 237 ? 10.907  31.358  -80.498  1.00 16.53 ? 215  HIS C CA    1 
ATOM   6628  C C     . HIS C 1 237 ? 9.723   30.658  -81.142  1.00 16.49 ? 215  HIS C C     1 
ATOM   6629  O O     . HIS C 1 237 ? 9.275   31.059  -82.190  1.00 15.90 ? 215  HIS C O     1 
ATOM   6630  C CB    . HIS C 1 237 ? 10.377  32.322  -79.441  1.00 15.74 ? 215  HIS C CB    1 
ATOM   6631  C CG    . HIS C 1 237 ? 11.439  33.043  -78.666  1.00 10.85 ? 215  HIS C CG    1 
ATOM   6632  N ND1   . HIS C 1 237 ? 11.844  34.328  -78.969  1.00 15.89 ? 215  HIS C ND1   1 
ATOM   6633  C CD2   . HIS C 1 237 ? 12.129  32.683  -77.560  1.00 13.07 ? 215  HIS C CD2   1 
ATOM   6634  C CE1   . HIS C 1 237 ? 12.758  34.713  -78.100  1.00 12.74 ? 215  HIS C CE1   1 
ATOM   6635  N NE2   . HIS C 1 237 ? 12.955  33.730  -77.240  1.00 9.63  ? 215  HIS C NE2   1 
ATOM   6636  N N     . ILE C 1 238 ? 9.221   29.600  -80.514  1.00 17.28 ? 216  ILE C N     1 
ATOM   6637  C CA    . ILE C 1 238 ? 8.015   28.928  -81.027  1.00 17.07 ? 216  ILE C CA    1 
ATOM   6638  C C     . ILE C 1 238 ? 6.915   28.763  -79.981  1.00 16.06 ? 216  ILE C C     1 
ATOM   6639  O O     . ILE C 1 238 ? 7.179   28.690  -78.767  1.00 16.40 ? 216  ILE C O     1 
ATOM   6640  C CB    . ILE C 1 238 ? 8.309   27.536  -81.668  1.00 17.59 ? 216  ILE C CB    1 
ATOM   6641  C CG1   . ILE C 1 238 ? 8.656   26.478  -80.617  1.00 19.09 ? 216  ILE C CG1   1 
ATOM   6642  C CG2   . ILE C 1 238 ? 9.426   27.615  -82.695  1.00 22.85 ? 216  ILE C CG2   1 
ATOM   6643  C CD1   . ILE C 1 238 ? 8.540   25.023  -81.114  1.00 17.75 ? 216  ILE C CD1   1 
ATOM   6644  N N     . ILE C 1 239 ? 5.686   28.699  -80.488  1.00 15.09 ? 217  ILE C N     1 
ATOM   6645  C CA    . ILE C 1 239 ? 4.502   28.256  -79.735  1.00 13.01 ? 217  ILE C CA    1 
ATOM   6646  C C     . ILE C 1 239 ? 4.113   26.875  -80.238  1.00 13.64 ? 217  ILE C C     1 
ATOM   6647  O O     . ILE C 1 239 ? 3.896   26.707  -81.449  1.00 15.32 ? 217  ILE C O     1 
ATOM   6648  C CB    . ILE C 1 239 ? 3.286   29.157  -80.013  1.00 12.27 ? 217  ILE C CB    1 
ATOM   6649  C CG1   . ILE C 1 239 ? 3.630   30.609  -79.678  1.00 15.70 ? 217  ILE C CG1   1 
ATOM   6650  C CG2   . ILE C 1 239 ? 2.023   28.666  -79.246  1.00 10.08 ? 217  ILE C CG2   1 
ATOM   6651  C CD1   . ILE C 1 239 ? 2.490   31.671  -79.929  1.00 15.42 ? 217  ILE C CD1   1 
ATOM   6652  N N     . SER C 1 240 ? 4.023   25.898  -79.334  1.00 13.34 ? 218  SER C N     1 
ATOM   6653  C CA    . SER C 1 240 ? 3.349   24.632  -79.632  1.00 12.97 ? 218  SER C CA    1 
ATOM   6654  C C     . SER C 1 240 ? 1.857   24.894  -79.630  1.00 14.37 ? 218  SER C C     1 
ATOM   6655  O O     . SER C 1 240 ? 1.227   25.090  -78.576  1.00 12.38 ? 218  SER C O     1 
ATOM   6656  C CB    . SER C 1 240 ? 3.672   23.520  -78.621  1.00 13.99 ? 218  SER C CB    1 
ATOM   6657  O OG    . SER C 1 240 ? 2.821   22.377  -78.796  1.00 8.84  ? 218  SER C OG    1 
ATOM   6658  N N     . ASP C 1 241 ? 1.288   24.863  -80.823  1.00 15.99 ? 219  ASP C N     1 
ATOM   6659  C CA    . ASP C 1 241 ? -0.085  25.237  -81.022  1.00 18.03 ? 219  ASP C CA    1 
ATOM   6660  C C     . ASP C 1 241 ? -1.005  24.051  -81.286  1.00 17.58 ? 219  ASP C C     1 
ATOM   6661  O O     . ASP C 1 241 ? -1.100  23.555  -82.410  1.00 19.95 ? 219  ASP C O     1 
ATOM   6662  C CB    . ASP C 1 241 ? -0.091  26.218  -82.186  1.00 18.03 ? 219  ASP C CB    1 
ATOM   6663  C CG    . ASP C 1 241 ? -1.397  26.871  -82.385  1.00 16.87 ? 219  ASP C CG    1 
ATOM   6664  O OD1   . ASP C 1 241 ? -2.187  26.950  -81.440  1.00 16.96 ? 219  ASP C OD1   1 
ATOM   6665  O OD2   . ASP C 1 241 ? -1.625  27.305  -83.520  1.00 20.72 ? 219  ASP C OD2   1 
ATOM   6666  N N     . GLY C 1 242 ? -1.688  23.620  -80.239  1.00 18.10 ? 220  GLY C N     1 
ATOM   6667  C CA    . GLY C 1 242 ? -2.650  22.533  -80.306  1.00 17.49 ? 220  GLY C CA    1 
ATOM   6668  C C     . GLY C 1 242 ? -2.095  21.145  -80.009  1.00 17.09 ? 220  GLY C C     1 
ATOM   6669  O O     . GLY C 1 242 ? -0.877  20.898  -80.030  1.00 17.07 ? 220  GLY C O     1 
ATOM   6670  N N     . GLY C 1 243 ? -3.012  20.226  -79.736  1.00 15.99 ? 221  GLY C N     1 
ATOM   6671  C CA    . GLY C 1 243 ? -2.641  18.848  -79.470  1.00 16.39 ? 221  GLY C CA    1 
ATOM   6672  C C     . GLY C 1 243 ? -2.605  18.428  -78.012  1.00 15.91 ? 221  GLY C C     1 
ATOM   6673  O O     . GLY C 1 243 ? -2.785  17.252  -77.708  1.00 18.32 ? 221  GLY C O     1 
ATOM   6674  N N     . CYS C 1 244 ? -2.390  19.369  -77.105  1.00 16.69 ? 222  CYS C N     1 
ATOM   6675  C CA    . CYS C 1 244 ? -2.384  19.059  -75.682  1.00 16.73 ? 222  CYS C CA    1 
ATOM   6676  C C     . CYS C 1 244 ? -3.785  18.767  -75.188  1.00 18.23 ? 222  CYS C C     1 
ATOM   6677  O O     . CYS C 1 244 ? -4.694  19.617  -75.353  1.00 18.25 ? 222  CYS C O     1 
ATOM   6678  C CB    . CYS C 1 244 ? -1.797  20.216  -74.906  1.00 17.57 ? 222  CYS C CB    1 
ATOM   6679  S SG    . CYS C 1 244 ? -0.090  20.408  -75.274  1.00 20.98 ? 222  CYS C SG    1 
ATOM   6680  N N     . THR C 1 245 ? -3.951  17.566  -74.607  1.00 18.28 ? 223  THR C N     1 
ATOM   6681  C CA    . THR C 1 245 ? -5.228  17.126  -74.046  1.00 18.11 ? 223  THR C CA    1 
ATOM   6682  C C     . THR C 1 245 ? -5.158  17.053  -72.530  1.00 18.11 ? 223  THR C C     1 
ATOM   6683  O O     . THR C 1 245 ? -6.176  16.738  -71.859  1.00 17.65 ? 223  THR C O     1 
ATOM   6684  C CB    . THR C 1 245 ? -5.692  15.752  -74.615  1.00 19.81 ? 223  THR C CB    1 
ATOM   6685  O OG1   . THR C 1 245 ? -4.900  14.681  -74.087  1.00 22.34 ? 223  THR C OG1   1 
ATOM   6686  C CG2   . THR C 1 245 ? -5.618  15.736  -76.149  1.00 18.93 ? 223  THR C CG2   1 
ATOM   6687  N N     . CYS C 1 246 ? -3.969  17.343  -71.989  1.00 16.78 ? 224  CYS C N     1 
ATOM   6688  C CA    . CYS C 1 246 ? -3.758  17.240  -70.572  1.00 16.01 ? 224  CYS C CA    1 
ATOM   6689  C C     . CYS C 1 246 ? -2.507  17.978  -70.196  1.00 15.09 ? 224  CYS C C     1 
ATOM   6690  O O     . CYS C 1 246 ? -1.705  18.295  -71.067  1.00 14.26 ? 224  CYS C O     1 
ATOM   6691  C CB    . CYS C 1 246 ? -3.617  15.766  -70.197  1.00 17.90 ? 224  CYS C CB    1 
ATOM   6692  S SG    . CYS C 1 246 ? -2.137  15.026  -70.941  1.00 17.46 ? 224  CYS C SG    1 
ATOM   6693  N N     . PRO C 1 247 ? -2.333  18.266  -68.892  1.00 13.49 ? 225  PRO C N     1 
ATOM   6694  C CA    . PRO C 1 247 ? -1.141  18.961  -68.454  1.00 14.02 ? 225  PRO C CA    1 
ATOM   6695  C C     . PRO C 1 247 ? 0.185   18.255  -68.781  1.00 14.51 ? 225  PRO C C     1 
ATOM   6696  O O     . PRO C 1 247 ? 1.184   18.917  -68.983  1.00 17.14 ? 225  PRO C O     1 
ATOM   6697  C CB    . PRO C 1 247 ? -1.363  19.069  -66.944  1.00 13.57 ? 225  PRO C CB    1 
ATOM   6698  C CG    . PRO C 1 247 ? -2.795  19.059  -66.804  1.00 10.70 ? 225  PRO C CG    1 
ATOM   6699  C CD    . PRO C 1 247 ? -3.232  18.037  -67.758  1.00 10.23 ? 225  PRO C CD    1 
ATOM   6700  N N     . GLY C 1 248 ? 0.179   16.937  -68.842  1.00 14.74 ? 226  GLY C N     1 
ATOM   6701  C CA    . GLY C 1 248 ? 1.358   16.197  -69.190  1.00 15.75 ? 226  GLY C CA    1 
ATOM   6702  C C     . GLY C 1 248 ? 1.814   16.530  -70.583  1.00 17.66 ? 226  GLY C C     1 
ATOM   6703  O O     . GLY C 1 248 ? 2.994   16.695  -70.813  1.00 18.96 ? 226  GLY C O     1 
ATOM   6704  N N     . ASP C 1 249 ? 0.885   16.643  -71.524  1.00 19.53 ? 227  ASP C N     1 
ATOM   6705  C CA    . ASP C 1 249 ? 1.226   17.038  -72.901  1.00 18.59 ? 227  ASP C CA    1 
ATOM   6706  C C     . ASP C 1 249 ? 1.804   18.429  -72.883  1.00 17.57 ? 227  ASP C C     1 
ATOM   6707  O O     . ASP C 1 249 ? 2.750   18.753  -73.620  1.00 18.24 ? 227  ASP C O     1 
ATOM   6708  C CB    . ASP C 1 249 ? -0.002  17.060  -73.807  1.00 19.45 ? 227  ASP C CB    1 
ATOM   6709  C CG    . ASP C 1 249 ? -0.612  15.700  -74.001  1.00 21.19 ? 227  ASP C CG    1 
ATOM   6710  O OD1   . ASP C 1 249 ? 0.159   14.723  -73.981  1.00 27.04 ? 227  ASP C OD1   1 
ATOM   6711  O OD2   . ASP C 1 249 ? -1.854  15.615  -74.172  1.00 22.07 ? 227  ASP C OD2   1 
ATOM   6712  N N     . VAL C 1 250 ? 1.235   19.282  -72.045  1.00 17.48 ? 228  VAL C N     1 
ATOM   6713  C CA    . VAL C 1 250 ? 1.780   20.646  -71.939  1.00 17.06 ? 228  VAL C CA    1 
ATOM   6714  C C     . VAL C 1 250 ? 3.235   20.585  -71.513  1.00 16.12 ? 228  VAL C C     1 
ATOM   6715  O O     . VAL C 1 250 ? 4.049   21.290  -72.029  1.00 16.74 ? 228  VAL C O     1 
ATOM   6716  C CB    . VAL C 1 250 ? 0.957   21.537  -70.997  1.00 17.55 ? 228  VAL C CB    1 
ATOM   6717  C CG1   . VAL C 1 250 ? 1.639   22.954  -70.860  1.00 22.84 ? 228  VAL C CG1   1 
ATOM   6718  C CG2   . VAL C 1 250 ? -0.492  21.635  -71.505  1.00 16.48 ? 228  VAL C CG2   1 
ATOM   6719  N N     . ALA C 1 251 ? 3.522   19.696  -70.572  1.00 15.95 ? 229  ALA C N     1 
ATOM   6720  C CA    . ALA C 1 251 ? 4.867   19.477  -70.051  1.00 15.08 ? 229  ALA C CA    1 
ATOM   6721  C C     . ALA C 1 251 ? 5.809   18.897  -71.116  1.00 15.15 ? 229  ALA C C     1 
ATOM   6722  O O     . ALA C 1 251 ? 6.963   19.303  -71.219  1.00 12.48 ? 229  ALA C O     1 
ATOM   6723  C CB    . ALA C 1 251 ? 4.794   18.549  -68.828  1.00 14.37 ? 229  ALA C CB    1 
ATOM   6724  N N     . LYS C 1 252 ? 5.299   17.953  -71.905  1.00 17.68 ? 230  LYS C N     1 
ATOM   6725  C CA    . LYS C 1 252 ? 6.047   17.376  -73.010  1.00 17.72 ? 230  LYS C CA    1 
ATOM   6726  C C     . LYS C 1 252 ? 6.378   18.394  -74.095  1.00 18.70 ? 230  LYS C C     1 
ATOM   6727  O O     . LYS C 1 252 ? 7.501   18.395  -74.641  1.00 20.01 ? 230  LYS C O     1 
ATOM   6728  C CB    . LYS C 1 252 ? 5.277   16.214  -73.623  1.00 16.53 ? 230  LYS C CB    1 
ATOM   6729  C CG    . LYS C 1 252 ? 5.177   15.002  -72.712  1.00 17.18 ? 230  LYS C CG    1 
ATOM   6730  C CD    . LYS C 1 252 ? 4.482   13.854  -73.396  1.00 19.87 ? 230  LYS C CD    1 
ATOM   6731  C CE    . LYS C 1 252 ? 3.579   13.064  -72.449  1.00 18.18 ? 230  LYS C CE    1 
ATOM   6732  N NZ    . LYS C 1 252 ? 3.048   11.870  -73.149  1.00 9.34  ? 230  LYS C NZ    1 
ATOM   6733  N N     . ALA C 1 253 ? 5.400   19.233  -74.432  1.00 18.49 ? 231  ALA C N     1 
ATOM   6734  C CA    . ALA C 1 253 ? 5.620   20.309  -75.390  1.00 18.66 ? 231  ALA C CA    1 
ATOM   6735  C C     . ALA C 1 253 ? 6.809   21.143  -74.963  1.00 19.05 ? 231  ALA C C     1 
ATOM   6736  O O     . ALA C 1 253 ? 7.728   21.369  -75.736  1.00 18.12 ? 231  ALA C O     1 
ATOM   6737  C CB    . ALA C 1 253 ? 4.423   21.178  -75.480  1.00 19.96 ? 231  ALA C CB    1 
ATOM   6738  N N     . PHE C 1 254 ? 6.785   21.591  -73.716  1.00 18.25 ? 232  PHE C N     1 
ATOM   6739  C CA    . PHE C 1 254 ? 7.892   22.333  -73.150  1.00 18.15 ? 232  PHE C CA    1 
ATOM   6740  C C     . PHE C 1 254 ? 9.256   21.579  -73.136  1.00 17.24 ? 232  PHE C C     1 
ATOM   6741  O O     . PHE C 1 254 ? 10.327  22.158  -73.374  1.00 15.05 ? 232  PHE C O     1 
ATOM   6742  C CB    . PHE C 1 254 ? 7.487   22.757  -71.747  1.00 16.78 ? 232  PHE C CB    1 
ATOM   6743  C CG    . PHE C 1 254 ? 6.665   24.010  -71.722  1.00 18.87 ? 232  PHE C CG    1 
ATOM   6744  C CD1   . PHE C 1 254 ? 7.134   25.162  -72.311  1.00 12.26 ? 232  PHE C CD1   1 
ATOM   6745  C CD2   . PHE C 1 254 ? 5.428   24.041  -71.100  1.00 16.85 ? 232  PHE C CD2   1 
ATOM   6746  C CE1   . PHE C 1 254 ? 6.387   26.313  -72.286  1.00 14.52 ? 232  PHE C CE1   1 
ATOM   6747  C CE2   . PHE C 1 254 ? 4.679   25.212  -71.075  1.00 18.99 ? 232  PHE C CE2   1 
ATOM   6748  C CZ    . PHE C 1 254 ? 5.169   26.346  -71.669  1.00 13.35 ? 232  PHE C CZ    1 
ATOM   6749  N N     . GLY C 1 255 ? 9.193   20.289  -72.818  1.00 17.58 ? 233  GLY C N     1 
ATOM   6750  C CA    . GLY C 1 255 ? 10.373  19.434  -72.790  1.00 16.34 ? 233  GLY C CA    1 
ATOM   6751  C C     . GLY C 1 255 ? 10.964  19.297  -74.180  1.00 16.67 ? 233  GLY C C     1 
ATOM   6752  O O     . GLY C 1 255 ? 12.177  19.169  -74.331  1.00 17.82 ? 233  GLY C O     1 
ATOM   6753  N N     . ALA C 1 256 ? 10.110  19.322  -75.199  1.00 17.14 ? 234  ALA C N     1 
ATOM   6754  C CA    . ALA C 1 256 ? 10.559  19.195  -76.585  1.00 17.65 ? 234  ALA C CA    1 
ATOM   6755  C C     . ALA C 1 256 ? 11.194  20.459  -77.126  1.00 18.10 ? 234  ALA C C     1 
ATOM   6756  O O     . ALA C 1 256 ? 11.854  20.418  -78.187  1.00 20.15 ? 234  ALA C O     1 
ATOM   6757  C CB    . ALA C 1 256 ? 9.411   18.818  -77.468  1.00 17.92 ? 234  ALA C CB    1 
ATOM   6758  N N     . GLY C 1 257 ? 10.984  21.585  -76.435  1.00 16.78 ? 235  GLY C N     1 
ATOM   6759  C CA    . GLY C 1 257 ? 11.653  22.838  -76.796  1.00 16.52 ? 235  GLY C CA    1 
ATOM   6760  C C     . GLY C 1 257 ? 10.734  24.030  -76.991  1.00 17.59 ? 235  GLY C C     1 
ATOM   6761  O O     . GLY C 1 257 ? 11.215  25.150  -77.207  1.00 17.44 ? 235  GLY C O     1 
ATOM   6762  N N     . ALA C 1 258 ? 9.418   23.807  -76.917  1.00 18.33 ? 236  ALA C N     1 
ATOM   6763  C CA    . ALA C 1 258 ? 8.458   24.900  -77.063  1.00 16.96 ? 236  ALA C CA    1 
ATOM   6764  C C     . ALA C 1 258 ? 8.751   26.029  -76.082  1.00 18.60 ? 236  ALA C C     1 
ATOM   6765  O O     . ALA C 1 258 ? 8.943   25.831  -74.874  1.00 19.01 ? 236  ALA C O     1 
ATOM   6766  C CB    . ALA C 1 258 ? 7.090   24.431  -76.877  1.00 17.89 ? 236  ALA C CB    1 
ATOM   6767  N N     . ASP C 1 259 ? 8.798   27.243  -76.611  1.00 19.34 ? 237  ASP C N     1 
ATOM   6768  C CA    . ASP C 1 259 ? 9.013   28.401  -75.770  1.00 17.32 ? 237  ASP C CA    1 
ATOM   6769  C C     . ASP C 1 259 ? 7.686   28.747  -75.099  1.00 15.83 ? 237  ASP C C     1 
ATOM   6770  O O     . ASP C 1 259 ? 7.638   29.018  -73.897  1.00 14.80 ? 237  ASP C O     1 
ATOM   6771  C CB    . ASP C 1 259 ? 9.606   29.555  -76.581  1.00 18.42 ? 237  ASP C CB    1 
ATOM   6772  C CG    . ASP C 1 259 ? 10.974  29.211  -77.146  1.00 16.56 ? 237  ASP C CG    1 
ATOM   6773  O OD1   . ASP C 1 259 ? 11.882  29.070  -76.314  1.00 14.80 ? 237  ASP C OD1   1 
ATOM   6774  O OD2   . ASP C 1 259 ? 11.128  29.057  -78.390  1.00 10.48 ? 237  ASP C OD2   1 
ATOM   6775  N N     . PHE C 1 260 ? 6.606   28.677  -75.866  1.00 15.61 ? 238  PHE C N     1 
ATOM   6776  C CA    . PHE C 1 260 ? 5.261   28.790  -75.304  1.00 16.23 ? 238  PHE C CA    1 
ATOM   6777  C C     . PHE C 1 260 ? 4.419   27.569  -75.681  1.00 14.78 ? 238  PHE C C     1 
ATOM   6778  O O     . PHE C 1 260 ? 4.756   26.802  -76.561  1.00 15.09 ? 238  PHE C O     1 
ATOM   6779  C CB    . PHE C 1 260 ? 4.535   30.034  -75.839  1.00 16.68 ? 238  PHE C CB    1 
ATOM   6780  C CG    . PHE C 1 260 ? 5.308   31.321  -75.718  1.00 17.45 ? 238  PHE C CG    1 
ATOM   6781  C CD1   . PHE C 1 260 ? 4.854   32.338  -74.884  1.00 16.14 ? 238  PHE C CD1   1 
ATOM   6782  C CD2   . PHE C 1 260 ? 6.443   31.546  -76.489  1.00 18.98 ? 238  PHE C CD2   1 
ATOM   6783  C CE1   . PHE C 1 260 ? 5.527   33.521  -74.780  1.00 12.21 ? 238  PHE C CE1   1 
ATOM   6784  C CE2   . PHE C 1 260 ? 7.118   32.727  -76.398  1.00 17.87 ? 238  PHE C CE2   1 
ATOM   6785  C CZ    . PHE C 1 260 ? 6.659   33.726  -75.538  1.00 17.72 ? 238  PHE C CZ    1 
ATOM   6786  N N     . VAL C 1 261 ? 3.282   27.438  -75.040  1.00 14.09 ? 239  VAL C N     1 
ATOM   6787  C CA    . VAL C 1 261 ? 2.304   26.384  -75.381  1.00 14.77 ? 239  VAL C CA    1 
ATOM   6788  C C     . VAL C 1 261 ? 0.942   27.029  -75.503  1.00 14.78 ? 239  VAL C C     1 
ATOM   6789  O O     . VAL C 1 261 ? 0.523   27.746  -74.603  1.00 13.31 ? 239  VAL C O     1 
ATOM   6790  C CB    . VAL C 1 261 ? 2.251   25.224  -74.326  1.00 14.17 ? 239  VAL C CB    1 
ATOM   6791  C CG1   . VAL C 1 261 ? 1.109   24.257  -74.621  1.00 12.18 ? 239  VAL C CG1   1 
ATOM   6792  C CG2   . VAL C 1 261 ? 3.565   24.461  -74.335  1.00 13.12 ? 239  VAL C CG2   1 
ATOM   6793  N N     . MET C 1 262 ? 0.292   26.821  -76.638  1.00 15.84 ? 240  MET C N     1 
ATOM   6794  C CA    . MET C 1 262 ? -0.988  27.404  -76.877  1.00 16.69 ? 240  MET C CA    1 
ATOM   6795  C C     . MET C 1 262 ? -2.093  26.342  -76.765  1.00 17.58 ? 240  MET C C     1 
ATOM   6796  O O     . MET C 1 262 ? -2.010  25.263  -77.380  1.00 17.63 ? 240  MET C O     1 
ATOM   6797  C CB    . MET C 1 262 ? -1.025  28.081  -78.251  1.00 14.62 ? 240  MET C CB    1 
ATOM   6798  C CG    . MET C 1 262 ? -2.288  28.872  -78.453  1.00 12.02 ? 240  MET C CG    1 
ATOM   6799  S SD    . MET C 1 262 ? -2.446  29.699  -80.024  1.00 11.78 ? 240  MET C SD    1 
ATOM   6800  C CE    . MET C 1 262 ? -1.942  31.367  -79.570  1.00 10.62 ? 240  MET C CE    1 
ATOM   6801  N N     . LEU C 1 263 ? -3.144  26.686  -76.030  1.00 16.34 ? 241  LEU C N     1 
ATOM   6802  C CA    . LEU C 1 263 ? -4.192  25.758  -75.713  1.00 17.08 ? 241  LEU C CA    1 
ATOM   6803  C C     . LEU C 1 263 ? -5.575  26.328  -75.994  1.00 15.67 ? 241  LEU C C     1 
ATOM   6804  O O     . LEU C 1 263 ? -5.861  27.437  -75.607  1.00 15.59 ? 241  LEU C O     1 
ATOM   6805  C CB    . LEU C 1 263 ? -4.108  25.413  -74.235  1.00 17.58 ? 241  LEU C CB    1 
ATOM   6806  C CG    . LEU C 1 263 ? -2.749  25.006  -73.682  1.00 17.36 ? 241  LEU C CG    1 
ATOM   6807  C CD1   . LEU C 1 263 ? -2.857  24.902  -72.158  1.00 17.78 ? 241  LEU C CD1   1 
ATOM   6808  C CD2   . LEU C 1 263 ? -2.292  23.712  -74.301  1.00 14.68 ? 241  LEU C CD2   1 
ATOM   6809  N N     . GLY C 1 264 ? -6.435  25.521  -76.620  1.00 15.38 ? 242  GLY C N     1 
ATOM   6810  C CA    . GLY C 1 264 ? -7.821  25.860  -76.873  1.00 15.43 ? 242  GLY C CA    1 
ATOM   6811  C C     . GLY C 1 264 ? -8.771  24.887  -76.225  1.00 16.41 ? 242  GLY C C     1 
ATOM   6812  O O     . GLY C 1 264 ? -9.606  25.280  -75.402  1.00 16.98 ? 242  GLY C O     1 
ATOM   6813  N N     . GLY C 1 265 ? -8.659  23.615  -76.579  1.00 18.60 ? 243  GLY C N     1 
ATOM   6814  C CA    . GLY C 1 265 ? -9.546  22.584  -76.034  1.00 18.12 ? 243  GLY C CA    1 
ATOM   6815  C C     . GLY C 1 265 ? -9.512  22.502  -74.522  1.00 18.05 ? 243  GLY C C     1 
ATOM   6816  O O     . GLY C 1 265 ? -10.564 22.419  -73.862  1.00 18.39 ? 243  GLY C O     1 
ATOM   6817  N N     . MET C 1 266 ? -8.312  22.538  -73.959  1.00 17.74 ? 244  MET C N     1 
ATOM   6818  C CA    . MET C 1 266 ? -8.155  22.484  -72.497  1.00 18.99 ? 244  MET C CA    1 
ATOM   6819  C C     . MET C 1 266 ? -8.750  23.666  -71.758  1.00 17.98 ? 244  MET C C     1 
ATOM   6820  O O     . MET C 1 266 ? -9.034  23.556  -70.571  1.00 17.47 ? 244  MET C O     1 
ATOM   6821  C CB    . MET C 1 266 ? -6.685  22.351  -72.106  1.00 20.04 ? 244  MET C CB    1 
ATOM   6822  C CG    . MET C 1 266 ? -6.205  20.914  -72.059  1.00 21.31 ? 244  MET C CG    1 
ATOM   6823  S SD    . MET C 1 266 ? -4.426  20.789  -72.203  1.00 16.75 ? 244  MET C SD    1 
ATOM   6824  C CE    . MET C 1 266 ? -4.018  20.983  -70.472  1.00 20.71 ? 244  MET C CE    1 
ATOM   6825  N N     . PHE C 1 267 ? -8.911  24.794  -72.441  1.00 16.44 ? 245  PHE C N     1 
ATOM   6826  C CA    . PHE C 1 267 ? -9.551  25.957  -71.831  1.00 16.65 ? 245  PHE C CA    1 
ATOM   6827  C C     . PHE C 1 267 ? -11.013 26.067  -72.167  1.00 16.90 ? 245  PHE C C     1 
ATOM   6828  O O     . PHE C 1 267 ? -11.722 26.828  -71.529  1.00 16.49 ? 245  PHE C O     1 
ATOM   6829  C CB    . PHE C 1 267 ? -8.831  27.255  -72.196  1.00 13.83 ? 245  PHE C CB    1 
ATOM   6830  C CG    . PHE C 1 267 ? -7.525  27.415  -71.501  1.00 15.77 ? 245  PHE C CG    1 
ATOM   6831  C CD1   . PHE C 1 267 ? -7.453  27.372  -70.098  1.00 16.36 ? 245  PHE C CD1   1 
ATOM   6832  C CD2   . PHE C 1 267 ? -6.362  27.601  -72.214  1.00 10.60 ? 245  PHE C CD2   1 
ATOM   6833  C CE1   . PHE C 1 267 ? -6.240  27.518  -69.442  1.00 17.64 ? 245  PHE C CE1   1 
ATOM   6834  C CE2   . PHE C 1 267 ? -5.156  27.760  -71.551  1.00 13.69 ? 245  PHE C CE2   1 
ATOM   6835  C CZ    . PHE C 1 267 ? -5.093  27.720  -70.177  1.00 17.09 ? 245  PHE C CZ    1 
ATOM   6836  N N     . SER C 1 268 ? -11.450 25.307  -73.167  1.00 17.64 ? 246  SER C N     1 
ATOM   6837  C CA    . SER C 1 268 ? -12.867 25.220  -73.533  1.00 16.70 ? 246  SER C CA    1 
ATOM   6838  C C     . SER C 1 268 ? -13.712 24.753  -72.370  1.00 16.26 ? 246  SER C C     1 
ATOM   6839  O O     . SER C 1 268 ? -13.231 24.035  -71.519  1.00 16.62 ? 246  SER C O     1 
ATOM   6840  C CB    . SER C 1 268 ? -13.062 24.260  -74.710  1.00 17.33 ? 246  SER C CB    1 
ATOM   6841  O OG    . SER C 1 268 ? -12.876 22.900  -74.340  1.00 13.59 ? 246  SER C OG    1 
ATOM   6842  N N     . GLY C 1 269 ? -14.971 25.185  -72.338  1.00 18.45 ? 247  GLY C N     1 
ATOM   6843  C CA    . GLY C 1 269 ? -15.974 24.633  -71.413  1.00 18.97 ? 247  GLY C CA    1 
ATOM   6844  C C     . GLY C 1 269 ? -16.117 25.322  -70.066  1.00 20.33 ? 247  GLY C C     1 
ATOM   6845  O O     . GLY C 1 269 ? -16.903 24.887  -69.223  1.00 21.23 ? 247  GLY C O     1 
ATOM   6846  N N     . HIS C 1 270 ? -15.364 26.395  -69.858  1.00 20.52 ? 248  HIS C N     1 
ATOM   6847  C CA    . HIS C 1 270 ? -15.359 27.104  -68.583  1.00 19.18 ? 248  HIS C CA    1 
ATOM   6848  C C     . HIS C 1 270 ? -16.305 28.283  -68.573  1.00 19.33 ? 248  HIS C C     1 
ATOM   6849  O O     . HIS C 1 270 ? -16.740 28.753  -69.624  1.00 18.98 ? 248  HIS C O     1 
ATOM   6850  C CB    . HIS C 1 270 ? -13.969 27.650  -68.289  1.00 19.88 ? 248  HIS C CB    1 
ATOM   6851  C CG    . HIS C 1 270 ? -12.939 26.593  -68.090  1.00 15.24 ? 248  HIS C CG    1 
ATOM   6852  N ND1   . HIS C 1 270 ? -11.961 26.330  -69.019  1.00 13.59 ? 248  HIS C ND1   1 
ATOM   6853  C CD2   . HIS C 1 270 ? -12.732 25.736  -67.065  1.00 13.12 ? 248  HIS C CD2   1 
ATOM   6854  C CE1   . HIS C 1 270 ? -11.188 25.358  -68.572  1.00 20.14 ? 248  HIS C CE1   1 
ATOM   6855  N NE2   . HIS C 1 270 ? -11.635 24.982  -67.387  1.00 18.91 ? 248  HIS C NE2   1 
ATOM   6856  N N     . THR C 1 271 ? -16.593 28.762  -67.363  1.00 20.53 ? 249  THR C N     1 
ATOM   6857  C CA    . THR C 1 271 ? -17.505 29.883  -67.128  1.00 21.06 ? 249  THR C CA    1 
ATOM   6858  C C     . THR C 1 271 ? -17.090 31.136  -67.863  1.00 21.77 ? 249  THR C C     1 
ATOM   6859  O O     . THR C 1 271 ? -17.932 31.939  -68.285  1.00 21.16 ? 249  THR C O     1 
ATOM   6860  C CB    . THR C 1 271 ? -17.540 30.254  -65.639  1.00 21.85 ? 249  THR C CB    1 
ATOM   6861  O OG1   . THR C 1 271 ? -18.110 29.170  -64.911  1.00 21.81 ? 249  THR C OG1   1 
ATOM   6862  C CG2   . THR C 1 271 ? -18.380 31.508  -65.394  1.00 23.03 ? 249  THR C CG2   1 
ATOM   6863  N N     . GLU C 1 272 ? -15.774 31.305  -67.978  1.00 23.63 ? 250  GLU C N     1 
ATOM   6864  C CA    . GLU C 1 272 ? -15.195 32.505  -68.582  1.00 24.24 ? 250  GLU C CA    1 
ATOM   6865  C C     . GLU C 1 272 ? -15.247 32.444  -70.108  1.00 25.83 ? 250  GLU C C     1 
ATOM   6866  O O     . GLU C 1 272 ? -14.976 33.447  -70.804  1.00 26.75 ? 250  GLU C O     1 
ATOM   6867  C CB    . GLU C 1 272 ? -13.745 32.692  -68.144  1.00 24.49 ? 250  GLU C CB    1 
ATOM   6868  C CG    . GLU C 1 272 ? -13.606 33.157  -66.707  1.00 25.54 ? 250  GLU C CG    1 
ATOM   6869  C CD    . GLU C 1 272 ? -13.700 32.034  -65.687  1.00 28.33 ? 250  GLU C CD    1 
ATOM   6870  O OE1   . GLU C 1 272 ? -14.017 30.868  -66.060  1.00 26.04 ? 250  GLU C OE1   1 
ATOM   6871  O OE2   . GLU C 1 272 ? -13.458 32.343  -64.495  1.00 25.28 ? 250  GLU C OE2   1 
ATOM   6872  N N     . CYS C 1 273 ? -15.568 31.258  -70.630  1.00 27.04 ? 251  CYS C N     1 
ATOM   6873  C CA    . CYS C 1 273 ? -15.669 31.060  -72.067  1.00 26.74 ? 251  CYS C CA    1 
ATOM   6874  C C     . CYS C 1 273 ? -16.932 31.725  -72.605  1.00 26.23 ? 251  CYS C C     1 
ATOM   6875  O O     . CYS C 1 273 ? -17.975 31.785  -71.933  1.00 25.38 ? 251  CYS C O     1 
ATOM   6876  C CB    . CYS C 1 273 ? -15.683 29.567  -72.434  1.00 27.15 ? 251  CYS C CB    1 
ATOM   6877  S SG    . CYS C 1 273 ? -14.139 28.681  -72.110  1.00 28.12 ? 251  CYS C SG    1 
ATOM   6878  N N     . ALA C 1 274 ? -16.830 32.215  -73.832  1.00 26.07 ? 252  ALA C N     1 
ATOM   6879  C CA    . ALA C 1 274 ? -17.980 32.779  -74.509  1.00 26.69 ? 252  ALA C CA    1 
ATOM   6880  C C     . ALA C 1 274 ? -18.996 31.677  -74.736  1.00 26.84 ? 252  ALA C C     1 
ATOM   6881  O O     . ALA C 1 274 ? -18.633 30.542  -75.060  1.00 27.34 ? 252  ALA C O     1 
ATOM   6882  C CB    . ALA C 1 274 ? -17.577 33.415  -75.827  1.00 27.93 ? 252  ALA C CB    1 
ATOM   6883  N N     . GLY C 1 275 ? -20.263 32.016  -74.542  1.00 26.43 ? 253  GLY C N     1 
ATOM   6884  C CA    . GLY C 1 275 ? -21.365 31.088  -74.734  1.00 26.42 ? 253  GLY C CA    1 
ATOM   6885  C C     . GLY C 1 275 ? -22.070 30.835  -73.425  1.00 27.44 ? 253  GLY C C     1 
ATOM   6886  O O     . GLY C 1 275 ? -21.506 31.075  -72.357  1.00 27.09 ? 253  GLY C O     1 
ATOM   6887  N N     . GLU C 1 276 ? -23.321 30.377  -73.519  1.00 28.97 ? 254  GLU C N     1 
ATOM   6888  C CA    . GLU C 1 276 ? -24.113 29.955  -72.352  1.00 29.16 ? 254  GLU C CA    1 
ATOM   6889  C C     . GLU C 1 276 ? -24.079 28.426  -72.199  1.00 29.02 ? 254  GLU C C     1 
ATOM   6890  O O     . GLU C 1 276 ? -23.703 27.692  -73.122  1.00 28.02 ? 254  GLU C O     1 
ATOM   6891  C CB    . GLU C 1 276 ? -25.562 30.444  -72.463  1.00 29.13 ? 254  GLU C CB    1 
ATOM   6892  N N     . VAL C 1 277 ? -24.473 27.950  -71.025  1.00 29.26 ? 255  VAL C N     1 
ATOM   6893  C CA    . VAL C 1 277 ? -24.495 26.516  -70.758  1.00 29.85 ? 255  VAL C CA    1 
ATOM   6894  C C     . VAL C 1 277 ? -25.679 25.839  -71.472  1.00 29.75 ? 255  VAL C C     1 
ATOM   6895  O O     . VAL C 1 277 ? -26.774 26.394  -71.508  1.00 29.55 ? 255  VAL C O     1 
ATOM   6896  C CB    . VAL C 1 277 ? -24.546 26.259  -69.251  1.00 29.78 ? 255  VAL C CB    1 
ATOM   6897  C CG1   . VAL C 1 277 ? -24.868 24.792  -68.947  1.00 30.25 ? 255  VAL C CG1   1 
ATOM   6898  C CG2   . VAL C 1 277 ? -23.212 26.663  -68.630  1.00 30.17 ? 255  VAL C CG2   1 
ATOM   6899  N N     . ILE C 1 278 ? -25.439 24.660  -72.055  1.00 29.20 ? 256  ILE C N     1 
ATOM   6900  C CA    . ILE C 1 278 ? -26.484 23.895  -72.758  1.00 28.55 ? 256  ILE C CA    1 
ATOM   6901  C C     . ILE C 1 278 ? -26.963 22.730  -71.901  1.00 27.80 ? 256  ILE C C     1 
ATOM   6902  O O     . ILE C 1 278 ? -26.219 22.227  -71.057  1.00 27.15 ? 256  ILE C O     1 
ATOM   6903  C CB    . ILE C 1 278 ? -26.006 23.347  -74.115  1.00 28.56 ? 256  ILE C CB    1 
ATOM   6904  N N     . ARG C 1 283 ? -26.821 16.756  -68.173  1.00 25.34 ? 261  ARG C N     1 
ATOM   6905  C CA    . ARG C 1 283 ? -25.494 17.027  -68.692  1.00 24.57 ? 261  ARG C CA    1 
ATOM   6906  C C     . ARG C 1 283 ? -25.365 18.524  -69.021  1.00 23.19 ? 261  ARG C C     1 
ATOM   6907  O O     . ARG C 1 283 ? -26.115 19.037  -69.849  1.00 23.24 ? 261  ARG C O     1 
ATOM   6908  C CB    . ARG C 1 283 ? -25.262 16.165  -69.937  1.00 25.39 ? 261  ARG C CB    1 
ATOM   6909  N N     . LYS C 1 284 ? -24.440 19.221  -68.356  1.00 21.73 ? 262  LYS C N     1 
ATOM   6910  C CA    . LYS C 1 284 ? -24.144 20.641  -68.647  1.00 20.86 ? 262  LYS C CA    1 
ATOM   6911  C C     . LYS C 1 284 ? -22.995 20.756  -69.647  1.00 20.37 ? 262  LYS C C     1 
ATOM   6912  O O     . LYS C 1 284 ? -21.924 20.161  -69.447  1.00 18.31 ? 262  LYS C O     1 
ATOM   6913  C CB    . LYS C 1 284 ? -23.737 21.412  -67.381  1.00 20.79 ? 262  LYS C CB    1 
ATOM   6914  C CG    . LYS C 1 284 ? -24.830 22.236  -66.713  1.00 22.78 ? 262  LYS C CG    1 
ATOM   6915  N N     . LEU C 1 285 ? -23.214 21.532  -70.713  1.00 20.56 ? 263  LEU C N     1 
ATOM   6916  C CA    . LEU C 1 285 ? -22.237 21.665  -71.796  1.00 20.08 ? 263  LEU C CA    1 
ATOM   6917  C C     . LEU C 1 285 ? -22.004 23.104  -72.282  1.00 18.80 ? 263  LEU C C     1 
ATOM   6918  O O     . LEU C 1 285 ? -22.865 23.970  -72.173  1.00 15.69 ? 263  LEU C O     1 
ATOM   6919  C CB    . LEU C 1 285 ? -22.698 20.808  -72.988  1.00 20.89 ? 263  LEU C CB    1 
ATOM   6920  C CG    . LEU C 1 285 ? -22.751 19.291  -72.749  1.00 25.46 ? 263  LEU C CG    1 
ATOM   6921  C CD1   . LEU C 1 285 ? -23.875 18.647  -73.556  1.00 28.19 ? 263  LEU C CD1   1 
ATOM   6922  C CD2   . LEU C 1 285 ? -21.404 18.624  -73.045  1.00 25.64 ? 263  LEU C CD2   1 
ATOM   6923  N N     . LYS C 1 286 ? -20.830 23.329  -72.859  1.00 19.27 ? 264  LYS C N     1 
ATOM   6924  C CA    . LYS C 1 286 ? -20.564 24.554  -73.601  1.00 21.30 ? 264  LYS C CA    1 
ATOM   6925  C C     . LYS C 1 286 ? -20.141 24.195  -75.024  1.00 21.44 ? 264  LYS C C     1 
ATOM   6926  O O     . LYS C 1 286 ? -19.490 23.181  -75.242  1.00 22.81 ? 264  LYS C O     1 
ATOM   6927  C CB    . LYS C 1 286 ? -19.475 25.386  -72.914  1.00 22.59 ? 264  LYS C CB    1 
ATOM   6928  C CG    . LYS C 1 286 ? -19.907 26.115  -71.602  1.00 25.18 ? 264  LYS C CG    1 
ATOM   6929  C CD    . LYS C 1 286 ? -20.276 27.597  -71.825  1.00 26.59 ? 264  LYS C CD    1 
ATOM   6930  C CE    . LYS C 1 286 ? -20.031 28.414  -70.566  1.00 27.68 ? 264  LYS C CE    1 
ATOM   6931  N NZ    . LYS C 1 286 ? -19.992 29.893  -70.790  1.00 25.84 ? 264  LYS C NZ    1 
ATOM   6932  N N     . LEU C 1 287 ? -20.525 25.026  -75.985  1.00 21.64 ? 265  LEU C N     1 
ATOM   6933  C CA    . LEU C 1 287 ? -20.176 24.831  -77.386  1.00 21.24 ? 265  LEU C CA    1 
ATOM   6934  C C     . LEU C 1 287 ? -18.744 25.300  -77.641  1.00 20.94 ? 265  LEU C C     1 
ATOM   6935  O O     . LEU C 1 287 ? -18.347 26.379  -77.201  1.00 23.01 ? 265  LEU C O     1 
ATOM   6936  C CB    . LEU C 1 287 ? -21.139 25.643  -78.254  1.00 21.05 ? 265  LEU C CB    1 
ATOM   6937  C CG    . LEU C 1 287 ? -21.105 25.436  -79.773  1.00 22.46 ? 265  LEU C CG    1 
ATOM   6938  C CD1   . LEU C 1 287 ? -21.498 23.992  -80.143  1.00 19.14 ? 265  LEU C CD1   1 
ATOM   6939  C CD2   . LEU C 1 287 ? -22.014 26.469  -80.478  1.00 19.66 ? 265  LEU C CD2   1 
ATOM   6940  N N     . PHE C 1 288 ? -17.967 24.494  -78.356  1.00 20.19 ? 266  PHE C N     1 
ATOM   6941  C CA    . PHE C 1 288 ? -16.577 24.837  -78.688  1.00 18.98 ? 266  PHE C CA    1 
ATOM   6942  C C     . PHE C 1 288 ? -16.395 24.537  -80.177  1.00 19.65 ? 266  PHE C C     1 
ATOM   6943  O O     . PHE C 1 288 ? -16.668 23.421  -80.626  1.00 19.11 ? 266  PHE C O     1 
ATOM   6944  C CB    . PHE C 1 288 ? -15.625 24.016  -77.826  1.00 17.89 ? 266  PHE C CB    1 
ATOM   6945  C CG    . PHE C 1 288 ? -14.163 24.298  -78.064  1.00 12.83 ? 266  PHE C CG    1 
ATOM   6946  C CD1   . PHE C 1 288 ? -13.300 23.292  -78.508  1.00 14.68 ? 266  PHE C CD1   1 
ATOM   6947  C CD2   . PHE C 1 288 ? -13.641 25.539  -77.820  1.00 8.49  ? 266  PHE C CD2   1 
ATOM   6948  C CE1   . PHE C 1 288 ? -11.933 23.544  -78.721  1.00 9.20  ? 266  PHE C CE1   1 
ATOM   6949  C CE2   . PHE C 1 288 ? -12.260 25.793  -78.016  1.00 15.93 ? 266  PHE C CE2   1 
ATOM   6950  C CZ    . PHE C 1 288 ? -11.421 24.789  -78.467  1.00 11.27 ? 266  PHE C CZ    1 
ATOM   6951  N N     . TYR C 1 289 ? -15.990 25.547  -80.945  1.00 20.67 ? 267  TYR C N     1 
ATOM   6952  C CA    . TYR C 1 289 ? -15.952 25.418  -82.398  1.00 22.04 ? 267  TYR C CA    1 
ATOM   6953  C C     . TYR C 1 289 ? -14.665 26.001  -83.052  1.00 23.08 ? 267  TYR C C     1 
ATOM   6954  O O     . TYR C 1 289 ? -14.088 26.993  -82.590  1.00 23.10 ? 267  TYR C O     1 
ATOM   6955  C CB    . TYR C 1 289 ? -17.244 25.986  -83.014  1.00 20.62 ? 267  TYR C CB    1 
ATOM   6956  C CG    . TYR C 1 289 ? -17.518 27.414  -82.652  1.00 20.02 ? 267  TYR C CG    1 
ATOM   6957  C CD1   . TYR C 1 289 ? -18.325 27.751  -81.569  1.00 19.63 ? 267  TYR C CD1   1 
ATOM   6958  C CD2   . TYR C 1 289 ? -16.948 28.448  -83.401  1.00 25.40 ? 267  TYR C CD2   1 
ATOM   6959  C CE1   . TYR C 1 289 ? -18.567 29.118  -81.242  1.00 23.15 ? 267  TYR C CE1   1 
ATOM   6960  C CE2   . TYR C 1 289 ? -17.173 29.794  -83.094  1.00 26.23 ? 267  TYR C CE2   1 
ATOM   6961  C CZ    . TYR C 1 289 ? -17.974 30.129  -82.018  1.00 25.50 ? 267  TYR C CZ    1 
ATOM   6962  O OH    . TYR C 1 289 ? -18.151 31.471  -81.760  1.00 23.12 ? 267  TYR C OH    1 
ATOM   6963  N N     . GLY C 1 290 ? -14.232 25.346  -84.129  1.00 22.78 ? 268  GLY C N     1 
ATOM   6964  C CA    . GLY C 1 290 ? -13.057 25.749  -84.869  1.00 22.24 ? 268  GLY C CA    1 
ATOM   6965  C C     . GLY C 1 290 ? -13.148 27.176  -85.385  1.00 22.15 ? 268  GLY C C     1 
ATOM   6966  O O     . GLY C 1 290 ? -14.249 27.707  -85.647  1.00 22.90 ? 268  GLY C O     1 
ATOM   6967  N N     . MET C 1 291 ? -11.975 27.790  -85.528  1.00 20.86 ? 269  MET C N     1 
ATOM   6968  C CA    . MET C 1 291 ? -11.845 29.161  -86.001  1.00 20.52 ? 269  MET C CA    1 
ATOM   6969  C C     . MET C 1 291 ? -12.319 29.315  -87.456  1.00 20.74 ? 269  MET C C     1 
ATOM   6970  O O     . MET C 1 291 ? -12.764 30.387  -87.844  1.00 21.18 ? 269  MET C O     1 
ATOM   6971  C CB    . MET C 1 291 ? -10.387 29.629  -85.871  1.00 21.79 ? 269  MET C CB    1 
ATOM   6972  C CG    . MET C 1 291 ? -9.798  29.725  -84.451  1.00 20.68 ? 269  MET C CG    1 
ATOM   6973  S SD    . MET C 1 291 ? -7.925  29.681  -84.429  1.00 22.34 ? 269  MET C SD    1 
ATOM   6974  C CE    . MET C 1 291 ? -7.445  31.264  -85.116  1.00 16.08 ? 269  MET C CE    1 
ATOM   6975  N N     . SER C 1 292 ? -12.200 28.253  -88.251  1.00 20.52 ? 270  SER C N     1 
ATOM   6976  C CA    . SER C 1 292 ? -12.724 28.212  -89.625  1.00 19.47 ? 270  SER C CA    1 
ATOM   6977  C C     . SER C 1 292 ? -13.863 27.186  -89.746  1.00 19.12 ? 270  SER C C     1 
ATOM   6978  O O     . SER C 1 292 ? -14.126 26.646  -90.834  1.00 19.58 ? 270  SER C O     1 
ATOM   6979  C CB    . SER C 1 292 ? -11.605 27.860  -90.606  1.00 19.76 ? 270  SER C CB    1 
ATOM   6980  O OG    . SER C 1 292 ? -10.533 28.773  -90.503  1.00 17.43 ? 270  SER C OG    1 
ATOM   6981  N N     . SER C 1 293 ? -14.560 26.944  -88.636  1.00 18.37 ? 271  SER C N     1 
ATOM   6982  C CA    . SER C 1 293 ? -15.710 26.038  -88.627  1.00 18.49 ? 271  SER C CA    1 
ATOM   6983  C C     . SER C 1 293 ? -16.911 26.619  -89.381  1.00 18.12 ? 271  SER C C     1 
ATOM   6984  O O     . SER C 1 293 ? -16.967 27.810  -89.669  1.00 16.45 ? 271  SER C O     1 
ATOM   6985  C CB    . SER C 1 293 ? -16.136 25.705  -87.178  1.00 19.58 ? 271  SER C CB    1 
ATOM   6986  O OG    . SER C 1 293 ? -16.890 26.750  -86.563  1.00 17.75 ? 271  SER C OG    1 
ATOM   6987  N N     . ASP C 1 294 ? -17.870 25.762  -89.699  1.00 20.22 ? 272  ASP C N     1 
ATOM   6988  C CA    . ASP C 1 294 ? -19.139 26.210  -90.259  1.00 22.75 ? 272  ASP C CA    1 
ATOM   6989  C C     . ASP C 1 294 ? -19.898 27.154  -89.309  1.00 20.86 ? 272  ASP C C     1 
ATOM   6990  O O     . ASP C 1 294 ? -20.537 28.105  -89.746  1.00 21.09 ? 272  ASP C O     1 
ATOM   6991  C CB    . ASP C 1 294 ? -19.978 24.996  -90.665  1.00 23.40 ? 272  ASP C CB    1 
ATOM   6992  C CG    . ASP C 1 294 ? -19.459 24.327  -91.954  1.00 32.26 ? 272  ASP C CG    1 
ATOM   6993  O OD1   . ASP C 1 294 ? -18.642 24.952  -92.679  1.00 36.78 ? 272  ASP C OD1   1 
ATOM   6994  O OD2   . ASP C 1 294 ? -19.875 23.178  -92.254  1.00 41.97 ? 272  ASP C OD2   1 
ATOM   6995  N N     . THR C 1 295 ? -19.790 26.892  -88.014  1.00 20.11 ? 273  THR C N     1 
ATOM   6996  C CA    . THR C 1 295 ? -20.353 27.742  -86.978  1.00 19.86 ? 273  THR C CA    1 
ATOM   6997  C C     . THR C 1 295 ? -19.728 29.142  -87.030  1.00 20.17 ? 273  THR C C     1 
ATOM   6998  O O     . THR C 1 295 ? -20.437 30.147  -87.021  1.00 18.61 ? 273  THR C O     1 
ATOM   6999  C CB    . THR C 1 295 ? -20.147 27.081  -85.600  1.00 20.03 ? 273  THR C CB    1 
ATOM   7000  O OG1   . THR C 1 295 ? -20.824 25.813  -85.579  1.00 19.74 ? 273  THR C OG1   1 
ATOM   7001  C CG2   . THR C 1 295 ? -20.672 27.971  -84.466  1.00 20.54 ? 273  THR C CG2   1 
ATOM   7002  N N     . ALA C 1 296 ? -18.403 29.197  -87.116  1.00 22.55 ? 274  ALA C N     1 
ATOM   7003  C CA    . ALA C 1 296 ? -17.678 30.457  -87.225  1.00 24.50 ? 274  ALA C CA    1 
ATOM   7004  C C     . ALA C 1 296 ? -18.076 31.190  -88.516  1.00 25.98 ? 274  ALA C C     1 
ATOM   7005  O O     . ALA C 1 296 ? -18.337 32.402  -88.503  1.00 26.15 ? 274  ALA C O     1 
ATOM   7006  C CB    . ALA C 1 296 ? -16.172 30.184  -87.188  1.00 23.30 ? 274  ALA C CB    1 
ATOM   7007  N N     . MET C 1 297 ? -18.124 30.431  -89.614  1.00 27.56 ? 275  MET C N     1 
ATOM   7008  C CA    A MET C 1 297 ? -18.529 30.949  -90.924  0.50 28.53 ? 275  MET C CA    1 
ATOM   7009  C CA    B MET C 1 297 ? -18.551 30.937  -90.926  0.50 27.76 ? 275  MET C CA    1 
ATOM   7010  C C     . MET C 1 297 ? -19.901 31.629  -90.857  1.00 28.19 ? 275  MET C C     1 
ATOM   7011  O O     . MET C 1 297 ? -20.062 32.737  -91.357  1.00 29.13 ? 275  MET C O     1 
ATOM   7012  C CB    A MET C 1 297 ? -18.504 29.825  -91.981  0.50 28.94 ? 275  MET C CB    1 
ATOM   7013  C CB    B MET C 1 297 ? -18.618 29.802  -91.961  0.50 27.51 ? 275  MET C CB    1 
ATOM   7014  C CG    A MET C 1 297 ? -17.077 29.431  -92.423  0.50 32.05 ? 275  MET C CG    1 
ATOM   7015  C CG    B MET C 1 297 ? -17.531 29.874  -93.017  0.50 26.90 ? 275  MET C CG    1 
ATOM   7016  S SD    A MET C 1 297 ? -16.864 27.787  -93.163  0.50 37.37 ? 275  MET C SD    1 
ATOM   7017  S SD    B MET C 1 297 ? -17.819 31.252  -94.131  0.50 25.97 ? 275  MET C SD    1 
ATOM   7018  C CE    A MET C 1 297 ? -15.129 27.827  -93.629  0.50 35.06 ? 275  MET C CE    1 
ATOM   7019  C CE    B MET C 1 297 ? -16.141 31.691  -94.589  0.50 27.43 ? 275  MET C CE    1 
ATOM   7020  N N     . ASN C 1 298 ? -20.869 30.969  -90.227  1.00 28.13 ? 276  ASN C N     1 
ATOM   7021  C CA    . ASN C 1 298 ? -22.216 31.532  -90.056  1.00 28.77 ? 276  ASN C CA    1 
ATOM   7022  C C     . ASN C 1 298 ? -22.237 32.726  -89.108  1.00 28.51 ? 276  ASN C C     1 
ATOM   7023  O O     . ASN C 1 298 ? -22.935 33.698  -89.355  1.00 27.88 ? 276  ASN C O     1 
ATOM   7024  C CB    . ASN C 1 298 ? -23.180 30.484  -89.497  1.00 28.84 ? 276  ASN C CB    1 
ATOM   7025  C CG    . ASN C 1 298 ? -23.437 29.340  -90.456  1.00 32.23 ? 276  ASN C CG    1 
ATOM   7026  O OD1   . ASN C 1 298 ? -23.320 29.486  -91.674  1.00 33.83 ? 276  ASN C OD1   1 
ATOM   7027  N ND2   . ASN C 1 298 ? -23.804 28.188  -89.906  1.00 31.94 ? 276  ASN C ND2   1 
ATOM   7028  N N     . LYS C 1 299 ? -21.476 32.632  -88.019  1.00 29.53 ? 277  LYS C N     1 
ATOM   7029  C CA    . LYS C 1 299 ? -21.434 33.674  -86.996  1.00 29.70 ? 277  LYS C CA    1 
ATOM   7030  C C     . LYS C 1 299 ? -20.708 34.951  -87.479  1.00 29.94 ? 277  LYS C C     1 
ATOM   7031  O O     . LYS C 1 299 ? -21.065 36.058  -87.074  1.00 28.56 ? 277  LYS C O     1 
ATOM   7032  C CB    . LYS C 1 299 ? -20.770 33.113  -85.739  1.00 29.63 ? 277  LYS C CB    1 
ATOM   7033  C CG    . LYS C 1 299 ? -21.017 33.916  -84.462  1.00 31.95 ? 277  LYS C CG    1 
ATOM   7034  C CD    . LYS C 1 299 ? -20.792 33.067  -83.189  1.00 34.06 ? 277  LYS C CD    1 
ATOM   7035  C CE    . LYS C 1 299 ? -21.888 31.995  -83.000  1.00 34.89 ? 277  LYS C CE    1 
ATOM   7036  N NZ    . LYS C 1 299 ? -21.718 31.178  -81.769  1.00 32.06 ? 277  LYS C NZ    1 
ATOM   7037  N N     . HIS C 1 300 ? -19.698 34.783  -88.339  1.00 30.55 ? 278  HIS C N     1 
ATOM   7038  C CA    . HIS C 1 300 ? -18.913 35.899  -88.884  1.00 30.26 ? 278  HIS C CA    1 
ATOM   7039  C C     . HIS C 1 300 ? -18.868 35.818  -90.414  1.00 30.22 ? 278  HIS C C     1 
ATOM   7040  O O     . HIS C 1 300 ? -19.551 36.568  -91.110  1.00 30.30 ? 278  HIS C O     1 
ATOM   7041  C CB    . HIS C 1 300 ? -17.482 35.888  -88.338  1.00 29.93 ? 278  HIS C CB    1 
ATOM   7042  C CG    . HIS C 1 300 ? -17.370 35.481  -86.899  1.00 29.48 ? 278  HIS C CG    1 
ATOM   7043  N ND1   . HIS C 1 300 ? -17.850 36.253  -85.863  1.00 28.82 ? 278  HIS C ND1   1 
ATOM   7044  C CD2   . HIS C 1 300 ? -16.801 34.392  -86.325  1.00 27.33 ? 278  HIS C CD2   1 
ATOM   7045  C CE1   . HIS C 1 300 ? -17.606 35.644  -84.715  1.00 29.45 ? 278  HIS C CE1   1 
ATOM   7046  N NE2   . HIS C 1 300 ? -16.963 34.517  -84.967  1.00 24.98 ? 278  HIS C NE2   1 
ATOM   7047  N N     . VAL C 1 304 ? -13.239 34.125  -92.178  1.00 39.25 ? 282  VAL C N     1 
ATOM   7048  C CA    . VAL C 1 304 ? -12.865 32.859  -91.525  1.00 40.08 ? 282  VAL C CA    1 
ATOM   7049  C C     . VAL C 1 304 ? -12.682 31.698  -92.514  1.00 39.14 ? 282  VAL C C     1 
ATOM   7050  O O     . VAL C 1 304 ? -12.400 30.567  -92.108  1.00 38.37 ? 282  VAL C O     1 
ATOM   7051  C CB    . VAL C 1 304 ? -13.884 32.433  -90.399  1.00 39.91 ? 282  VAL C CB    1 
ATOM   7052  C CG1   . VAL C 1 304 ? -14.291 33.631  -89.533  1.00 39.82 ? 282  VAL C CG1   1 
ATOM   7053  C CG2   . VAL C 1 304 ? -15.111 31.775  -90.968  1.00 39.42 ? 282  VAL C CG2   1 
ATOM   7054  N N     . ALA C 1 305 ? -12.821 31.994  -93.803  1.00 39.59 ? 283  ALA C N     1 
ATOM   7055  C CA    . ALA C 1 305 ? -12.771 30.978  -94.847  1.00 39.29 ? 283  ALA C CA    1 
ATOM   7056  C C     . ALA C 1 305 ? -11.452 30.192  -94.840  1.00 38.45 ? 283  ALA C C     1 
ATOM   7057  O O     . ALA C 1 305 ? -11.457 28.966  -94.646  1.00 39.11 ? 283  ALA C O     1 
ATOM   7058  C CB    . ALA C 1 305 ? -12.996 31.619  -96.203  1.00 39.36 ? 283  ALA C CB    1 
ATOM   7059  N N     . GLU C 1 306 ? -10.331 30.882  -95.051  1.00 35.28 ? 284  GLU C N     1 
ATOM   7060  C CA    . GLU C 1 306 ? -9.029  30.210  -95.003  1.00 33.01 ? 284  GLU C CA    1 
ATOM   7061  C C     . GLU C 1 306 ? -8.148  30.888  -93.951  1.00 30.81 ? 284  GLU C C     1 
ATOM   7062  O O     . GLU C 1 306 ? -6.981  31.229  -94.187  1.00 29.28 ? 284  GLU C O     1 
ATOM   7063  C CB    . GLU C 1 306 ? -8.375  30.144  -96.389  1.00 33.78 ? 284  GLU C CB    1 
ATOM   7064  N N     . TYR C 1 307 ? -8.743  31.066  -92.775  1.00 28.63 ? 285  TYR C N     1 
ATOM   7065  C CA    . TYR C 1 307 ? -8.052  31.580  -91.601  1.00 26.90 ? 285  TYR C CA    1 
ATOM   7066  C C     . TYR C 1 307 ? -7.143  30.483  -91.045  1.00 25.03 ? 285  TYR C C     1 
ATOM   7067  O O     . TYR C 1 307 ? -5.980  30.743  -90.713  1.00 22.50 ? 285  TYR C O     1 
ATOM   7068  C CB    . TYR C 1 307 ? -9.077  32.040  -90.537  1.00 26.57 ? 285  TYR C CB    1 
ATOM   7069  C CG    . TYR C 1 307 ? -8.503  32.836  -89.352  1.00 27.13 ? 285  TYR C CG    1 
ATOM   7070  C CD1   . TYR C 1 307 ? -7.331  33.606  -89.481  1.00 25.92 ? 285  TYR C CD1   1 
ATOM   7071  C CD2   . TYR C 1 307 ? -9.156  32.841  -88.115  1.00 25.28 ? 285  TYR C CD2   1 
ATOM   7072  C CE1   . TYR C 1 307 ? -6.822  34.336  -88.406  1.00 28.74 ? 285  TYR C CE1   1 
ATOM   7073  C CE2   . TYR C 1 307 ? -8.649  33.559  -87.024  1.00 27.40 ? 285  TYR C CE2   1 
ATOM   7074  C CZ    . TYR C 1 307 ? -7.476  34.309  -87.167  1.00 31.48 ? 285  TYR C CZ    1 
ATOM   7075  O OH    . TYR C 1 307 ? -6.954  35.034  -86.089  1.00 22.66 ? 285  TYR C OH    1 
ATOM   7076  N N     . ARG C 1 308 ? -7.683  29.261  -90.980  1.00 23.89 ? 286  ARG C N     1 
ATOM   7077  C CA    . ARG C 1 308 ? -6.931  28.058  -90.554  1.00 22.61 ? 286  ARG C CA    1 
ATOM   7078  C C     . ARG C 1 308 ? -6.895  27.022  -91.669  1.00 21.14 ? 286  ARG C C     1 
ATOM   7079  O O     . ARG C 1 308 ? -7.616  27.141  -92.666  1.00 21.15 ? 286  ARG C O     1 
ATOM   7080  C CB    . ARG C 1 308 ? -7.513  27.410  -89.280  1.00 22.84 ? 286  ARG C CB    1 
ATOM   7081  C CG    . ARG C 1 308 ? -7.657  28.326  -88.054  1.00 18.70 ? 286  ARG C CG    1 
ATOM   7082  C CD    . ARG C 1 308 ? -6.363  28.493  -87.280  1.00 17.50 ? 286  ARG C CD    1 
ATOM   7083  N NE    . ARG C 1 308 ? -5.259  28.958  -88.104  1.00 20.30 ? 286  ARG C NE    1 
ATOM   7084  C CZ    . ARG C 1 308 ? -4.000  29.085  -87.692  1.00 18.01 ? 286  ARG C CZ    1 
ATOM   7085  N NH1   . ARG C 1 308 ? -3.678  28.837  -86.428  1.00 19.54 ? 286  ARG C NH1   1 
ATOM   7086  N NH2   . ARG C 1 308 ? -3.066  29.483  -88.554  1.00 16.18 ? 286  ARG C NH2   1 
ATOM   7087  N N     . ALA C 1 309 ? -6.019  26.030  -91.512  1.00 19.84 ? 287  ALA C N     1 
ATOM   7088  C CA    . ALA C 1 309 ? -5.754  25.052  -92.584  1.00 20.10 ? 287  ALA C CA    1 
ATOM   7089  C C     . ALA C 1 309 ? -6.925  24.146  -92.938  1.00 20.27 ? 287  ALA C C     1 
ATOM   7090  O O     . ALA C 1 309 ? -6.949  23.573  -94.029  1.00 19.39 ? 287  ALA C O     1 
ATOM   7091  C CB    . ALA C 1 309 ? -4.526  24.199  -92.267  1.00 19.81 ? 287  ALA C CB    1 
ATOM   7092  N N     . SER C 1 310 ? -7.886  24.019  -92.029  1.00 20.35 ? 288  SER C N     1 
ATOM   7093  C CA    . SER C 1 310 ? -9.056  23.168  -92.237  1.00 20.15 ? 288  SER C CA    1 
ATOM   7094  C C     . SER C 1 310 ? -10.284 23.854  -91.668  1.00 20.35 ? 288  SER C C     1 
ATOM   7095  O O     . SER C 1 310 ? -10.195 24.724  -90.807  1.00 20.67 ? 288  SER C O     1 
ATOM   7096  C CB    . SER C 1 310 ? -8.874  21.783  -91.589  1.00 19.67 ? 288  SER C CB    1 
ATOM   7097  O OG    . SER C 1 310 ? -8.840  21.867  -90.173  1.00 16.46 ? 288  SER C OG    1 
ATOM   7098  N N     . GLU C 1 311 ? -11.438 23.458  -92.169  1.00 22.37 ? 289  GLU C N     1 
ATOM   7099  C CA    . GLU C 1 311 ? -12.706 23.908  -91.623  1.00 23.20 ? 289  GLU C CA    1 
ATOM   7100  C C     . GLU C 1 311 ? -12.942 23.039  -90.388  1.00 22.91 ? 289  GLU C C     1 
ATOM   7101  O O     . GLU C 1 311 ? -13.163 21.832  -90.490  1.00 23.89 ? 289  GLU C O     1 
ATOM   7102  C CB    . GLU C 1 311 ? -13.793 23.820  -92.708  1.00 23.86 ? 289  GLU C CB    1 
ATOM   7103  C CG    . GLU C 1 311 ? -15.230 23.526  -92.297  1.00 27.86 ? 289  GLU C CG    1 
ATOM   7104  C CD    . GLU C 1 311 ? -16.034 23.012  -93.483  1.00 29.17 ? 289  GLU C CD    1 
ATOM   7105  O OE1   . GLU C 1 311 ? -16.904 22.135  -93.285  1.00 33.19 ? 289  GLU C OE1   1 
ATOM   7106  O OE2   . GLU C 1 311 ? -15.761 23.471  -94.622  1.00 26.08 ? 289  GLU C OE2   1 
ATOM   7107  N N     . GLY C 1 312 ? -12.851 23.667  -89.221  1.00 22.33 ? 290  GLY C N     1 
ATOM   7108  C CA    . GLY C 1 312 ? -12.743 22.959  -87.970  1.00 21.67 ? 290  GLY C CA    1 
ATOM   7109  C C     . GLY C 1 312 ? -14.060 22.375  -87.521  1.00 21.92 ? 290  GLY C C     1 
ATOM   7110  O O     . GLY C 1 312 ? -15.113 22.688  -88.081  1.00 21.84 ? 290  GLY C O     1 
ATOM   7111  N N     . LYS C 1 313 ? -13.980 21.512  -86.506  1.00 22.66 ? 291  LYS C N     1 
ATOM   7112  C CA    . LYS C 1 313 ? -15.159 20.872  -85.894  1.00 23.43 ? 291  LYS C CA    1 
ATOM   7113  C C     . LYS C 1 313 ? -15.927 21.845  -85.000  1.00 22.00 ? 291  LYS C C     1 
ATOM   7114  O O     . LYS C 1 313 ? -15.367 22.810  -84.485  1.00 22.17 ? 291  LYS C O     1 
ATOM   7115  C CB    . LYS C 1 313 ? -14.748 19.662  -85.028  1.00 24.55 ? 291  LYS C CB    1 
ATOM   7116  C CG    . LYS C 1 313 ? -14.475 18.353  -85.770  1.00 24.94 ? 291  LYS C CG    1 
ATOM   7117  C CD    . LYS C 1 313 ? -13.344 17.541  -85.068  1.00 26.38 ? 291  LYS C CD    1 
ATOM   7118  C CE    . LYS C 1 313 ? -13.797 16.783  -83.820  1.00 24.92 ? 291  LYS C CE    1 
ATOM   7119  N NZ    . LYS C 1 313 ? -13.891 15.324  -84.089  1.00 23.99 ? 291  LYS C NZ    1 
ATOM   7120  N N     . THR C 1 314 ? -17.208 21.553  -84.809  1.00 21.84 ? 292  THR C N     1 
ATOM   7121  C CA    . THR C 1 314 ? -18.014 22.165  -83.759  1.00 22.17 ? 292  THR C CA    1 
ATOM   7122  C C     . THR C 1 314 ? -18.340 21.029  -82.777  1.00 22.19 ? 292  THR C C     1 
ATOM   7123  O O     . THR C 1 314 ? -18.904 20.022  -83.175  1.00 20.86 ? 292  THR C O     1 
ATOM   7124  C CB    . THR C 1 314 ? -19.307 22.808  -84.362  1.00 22.87 ? 292  THR C CB    1 
ATOM   7125  O OG1   . THR C 1 314 ? -18.959 24.023  -85.043  1.00 26.29 ? 292  THR C OG1   1 
ATOM   7126  C CG2   . THR C 1 314 ? -20.364 23.122  -83.304  1.00 20.53 ? 292  THR C CG2   1 
ATOM   7127  N N     . VAL C 1 315 ? -17.945 21.178  -81.511  1.00 23.00 ? 293  VAL C N     1 
ATOM   7128  C CA    . VAL C 1 315 ? -18.239 20.170  -80.482  1.00 23.25 ? 293  VAL C CA    1 
ATOM   7129  C C     . VAL C 1 315 ? -18.934 20.765  -79.261  1.00 23.02 ? 293  VAL C C     1 
ATOM   7130  O O     . VAL C 1 315 ? -18.818 21.946  -78.964  1.00 22.91 ? 293  VAL C O     1 
ATOM   7131  C CB    . VAL C 1 315 ? -16.966 19.413  -80.003  1.00 23.62 ? 293  VAL C CB    1 
ATOM   7132  C CG1   . VAL C 1 315 ? -16.554 18.359  -81.027  1.00 24.00 ? 293  VAL C CG1   1 
ATOM   7133  C CG2   . VAL C 1 315 ? -15.804 20.382  -79.728  1.00 23.11 ? 293  VAL C CG2   1 
ATOM   7134  N N     . GLU C 1 316 ? -19.682 19.927  -78.569  1.00 23.04 ? 294  GLU C N     1 
ATOM   7135  C CA    . GLU C 1 316 ? -20.200 20.271  -77.248  1.00 23.72 ? 294  GLU C CA    1 
ATOM   7136  C C     . GLU C 1 316 ? -19.221 19.681  -76.232  1.00 24.44 ? 294  GLU C C     1 
ATOM   7137  O O     . GLU C 1 316 ? -18.987 18.470  -76.202  1.00 24.54 ? 294  GLU C O     1 
ATOM   7138  C CB    . GLU C 1 316 ? -21.639 19.740  -77.039  1.00 23.12 ? 294  GLU C CB    1 
ATOM   7139  C CG    . GLU C 1 316 ? -22.714 20.504  -77.840  1.00 21.83 ? 294  GLU C CG    1 
ATOM   7140  N N     . VAL C 1 317 ? -18.643 20.533  -75.403  1.00 24.62 ? 295  VAL C N     1 
ATOM   7141  C CA    . VAL C 1 317 ? -17.703 20.063  -74.393  1.00 24.87 ? 295  VAL C CA    1 
ATOM   7142  C C     . VAL C 1 317 ? -18.386 20.105  -73.031  1.00 25.07 ? 295  VAL C C     1 
ATOM   7143  O O     . VAL C 1 317 ? -19.215 20.985  -72.781  1.00 23.87 ? 295  VAL C O     1 
ATOM   7144  C CB    . VAL C 1 317 ? -16.391 20.897  -74.347  1.00 24.25 ? 295  VAL C CB    1 
ATOM   7145  C CG1   . VAL C 1 317 ? -16.208 21.702  -75.605  1.00 25.28 ? 295  VAL C CG1   1 
ATOM   7146  C CG2   . VAL C 1 317 ? -16.357 21.819  -73.164  1.00 23.76 ? 295  VAL C CG2   1 
ATOM   7147  N N     . PRO C 1 318 ? -18.014 19.175  -72.132  1.00 26.15 ? 296  PRO C N     1 
ATOM   7148  C CA    . PRO C 1 318 ? -18.571 19.155  -70.780  1.00 26.24 ? 296  PRO C CA    1 
ATOM   7149  C C     . PRO C 1 318 ? -18.247 20.454  -70.028  1.00 25.69 ? 296  PRO C C     1 
ATOM   7150  O O     . PRO C 1 318 ? -17.101 20.929  -70.061  1.00 24.76 ? 296  PRO C O     1 
ATOM   7151  C CB    . PRO C 1 318 ? -17.867 17.959  -70.123  1.00 25.86 ? 296  PRO C CB    1 
ATOM   7152  C CG    . PRO C 1 318 ? -16.631 17.753  -70.908  1.00 27.04 ? 296  PRO C CG    1 
ATOM   7153  C CD    . PRO C 1 318 ? -16.986 18.131  -72.317  1.00 27.03 ? 296  PRO C CD    1 
ATOM   7154  N N     . TYR C 1 319 ? -19.256 21.010  -69.356  1.00 25.41 ? 297  TYR C N     1 
ATOM   7155  C CA    . TYR C 1 319 ? -19.069 22.228  -68.571  1.00 25.72 ? 297  TYR C CA    1 
ATOM   7156  C C     . TYR C 1 319 ? -18.098 21.981  -67.405  1.00 26.36 ? 297  TYR C C     1 
ATOM   7157  O O     . TYR C 1 319 ? -18.401 21.212  -66.488  1.00 26.18 ? 297  TYR C O     1 
ATOM   7158  C CB    . TYR C 1 319 ? -20.402 22.761  -68.060  1.00 24.52 ? 297  TYR C CB    1 
ATOM   7159  C CG    . TYR C 1 319 ? -20.262 24.040  -67.278  1.00 25.77 ? 297  TYR C CG    1 
ATOM   7160  C CD1   . TYR C 1 319 ? -19.625 25.147  -67.839  1.00 27.68 ? 297  TYR C CD1   1 
ATOM   7161  C CD2   . TYR C 1 319 ? -20.760 24.153  -65.971  1.00 25.86 ? 297  TYR C CD2   1 
ATOM   7162  C CE1   . TYR C 1 319 ? -19.482 26.338  -67.125  1.00 29.07 ? 297  TYR C CE1   1 
ATOM   7163  C CE2   . TYR C 1 319 ? -20.621 25.338  -65.249  1.00 23.68 ? 297  TYR C CE2   1 
ATOM   7164  C CZ    . TYR C 1 319 ? -19.981 26.420  -65.836  1.00 27.39 ? 297  TYR C CZ    1 
ATOM   7165  O OH    . TYR C 1 319 ? -19.832 27.592  -65.154  1.00 27.30 ? 297  TYR C OH    1 
ATOM   7166  N N     . LYS C 1 320 ? -16.926 22.627  -67.467  1.00 26.25 ? 298  LYS C N     1 
ATOM   7167  C CA    . LYS C 1 320 ? -15.842 22.397  -66.502  1.00 25.60 ? 298  LYS C CA    1 
ATOM   7168  C C     . LYS C 1 320 ? -15.947 23.297  -65.265  1.00 24.85 ? 298  LYS C C     1 
ATOM   7169  O O     . LYS C 1 320 ? -15.291 23.027  -64.255  1.00 25.34 ? 298  LYS C O     1 
ATOM   7170  C CB    . LYS C 1 320 ? -14.459 22.616  -67.141  1.00 25.70 ? 298  LYS C CB    1 
ATOM   7171  C CG    . LYS C 1 320 ? -14.149 21.791  -68.414  1.00 27.08 ? 298  LYS C CG    1 
ATOM   7172  C CD    . LYS C 1 320 ? -12.653 21.400  -68.520  1.00 22.69 ? 298  LYS C CD    1 
ATOM   7173  C CE    . LYS C 1 320 ? -12.000 21.754  -69.908  1.00 23.30 ? 298  LYS C CE    1 
ATOM   7174  N NZ    . LYS C 1 320 ? -12.688 21.160  -71.124  1.00 11.13 ? 298  LYS C NZ    1 
ATOM   7175  N N     . GLY C 1 321 ? -16.758 24.359  -65.343  1.00 23.27 ? 299  GLY C N     1 
ATOM   7176  C CA    . GLY C 1 321 ? -16.875 25.339  -64.259  1.00 21.76 ? 299  GLY C CA    1 
ATOM   7177  C C     . GLY C 1 321 ? -15.913 26.497  -64.422  1.00 20.79 ? 299  GLY C C     1 
ATOM   7178  O O     . GLY C 1 321 ? -15.571 26.854  -65.546  1.00 19.95 ? 299  GLY C O     1 
ATOM   7179  N N     . ASP C 1 322 ? -15.445 27.073  -63.310  1.00 19.96 ? 300  ASP C N     1 
ATOM   7180  C CA    . ASP C 1 322 ? -14.503 28.216  -63.372  1.00 20.36 ? 300  ASP C CA    1 
ATOM   7181  C C     . ASP C 1 322 ? -13.082 27.774  -63.800  1.00 18.36 ? 300  ASP C C     1 
ATOM   7182  O O     . ASP C 1 322 ? -12.571 26.734  -63.365  1.00 17.72 ? 300  ASP C O     1 
ATOM   7183  C CB    . ASP C 1 322 ? -14.431 28.979  -62.022  1.00 21.45 ? 300  ASP C CB    1 
ATOM   7184  C CG    . ASP C 1 322 ? -15.656 29.924  -61.759  1.00 26.15 ? 300  ASP C CG    1 
ATOM   7185  O OD1   . ASP C 1 322 ? -16.162 30.625  -62.666  1.00 29.68 ? 300  ASP C OD1   1 
ATOM   7186  O OD2   . ASP C 1 322 ? -16.090 29.994  -60.595  1.00 28.46 ? 300  ASP C OD2   1 
ATOM   7187  N N     . VAL C 1 323 ? -12.447 28.589  -64.639  1.00 17.93 ? 301  VAL C N     1 
ATOM   7188  C CA    . VAL C 1 323 ? -11.154 28.235  -65.264  1.00 18.03 ? 301  VAL C CA    1 
ATOM   7189  C C     . VAL C 1 323 ? -9.982  28.269  -64.298  1.00 18.97 ? 301  VAL C C     1 
ATOM   7190  O O     . VAL C 1 323 ? -8.928  27.679  -64.561  1.00 19.66 ? 301  VAL C O     1 
ATOM   7191  C CB    . VAL C 1 323 ? -10.840 29.127  -66.486  1.00 16.01 ? 301  VAL C CB    1 
ATOM   7192  C CG1   . VAL C 1 323 ? -10.430 30.523  -66.065  1.00 17.48 ? 301  VAL C CG1   1 
ATOM   7193  C CG2   . VAL C 1 323 ? -9.769  28.481  -67.374  1.00 14.03 ? 301  VAL C CG2   1 
ATOM   7194  N N     . GLU C 1 324 ? -10.172 28.959  -63.177  1.00 20.65 ? 302  GLU C N     1 
ATOM   7195  C CA    . GLU C 1 324 ? -9.200  28.989  -62.082  1.00 21.02 ? 302  GLU C CA    1 
ATOM   7196  C C     . GLU C 1 324 ? -8.647  27.578  -61.826  1.00 20.11 ? 302  GLU C C     1 
ATOM   7197  O O     . GLU C 1 324 ? -7.449  27.315  -61.940  1.00 17.74 ? 302  GLU C O     1 
ATOM   7198  C CB    . GLU C 1 324 ? -9.925  29.545  -60.837  1.00 22.62 ? 302  GLU C CB    1 
ATOM   7199  C CG    . GLU C 1 324 ? -9.154  29.599  -59.509  1.00 29.88 ? 302  GLU C CG    1 
ATOM   7200  C CD    . GLU C 1 324 ? -8.112  30.715  -59.457  1.00 34.28 ? 302  GLU C CD    1 
ATOM   7201  O OE1   . GLU C 1 324 ? -7.509  31.053  -60.503  1.00 36.23 ? 302  GLU C OE1   1 
ATOM   7202  O OE2   . GLU C 1 324 ? -7.889  31.239  -58.349  1.00 39.12 ? 302  GLU C OE2   1 
ATOM   7203  N N     . ASN C 1 325 ? -9.566  26.664  -61.540  1.00 20.33 ? 303  ASN C N     1 
ATOM   7204  C CA    . ASN C 1 325 ? -9.223  25.312  -61.146  1.00 19.69 ? 303  ASN C CA    1 
ATOM   7205  C C     . ASN C 1 325 ? -8.447  24.577  -62.214  1.00 18.02 ? 303  ASN C C     1 
ATOM   7206  O O     . ASN C 1 325 ? -7.507  23.871  -61.887  1.00 18.08 ? 303  ASN C O     1 
ATOM   7207  C CB    . ASN C 1 325 ? -10.486 24.575  -60.737  1.00 21.65 ? 303  ASN C CB    1 
ATOM   7208  C CG    . ASN C 1 325 ? -11.239 25.320  -59.663  1.00 26.49 ? 303  ASN C CG    1 
ATOM   7209  O OD1   . ASN C 1 325 ? -10.672 25.645  -58.609  1.00 37.24 ? 303  ASN C OD1   1 
ATOM   7210  N ND2   . ASN C 1 325 ? -12.503 25.640  -59.931  1.00 31.95 ? 303  ASN C ND2   1 
ATOM   7211  N N     . THR C 1 326 ? -8.814  24.771  -63.484  1.00 16.86 ? 304  THR C N     1 
ATOM   7212  C CA    . THR C 1 326 ? -8.048  24.222  -64.626  1.00 15.37 ? 304  THR C CA    1 
ATOM   7213  C C     . THR C 1 326 ? -6.622  24.775  -64.729  1.00 16.54 ? 304  THR C C     1 
ATOM   7214  O O     . THR C 1 326 ? -5.668  24.031  -64.954  1.00 16.74 ? 304  THR C O     1 
ATOM   7215  C CB    . THR C 1 326 ? -8.749  24.498  -65.945  1.00 13.41 ? 304  THR C CB    1 
ATOM   7216  O OG1   . THR C 1 326 ? -9.958  23.766  -65.995  1.00 11.24 ? 304  THR C OG1   1 
ATOM   7217  C CG2   . THR C 1 326 ? -7.921  24.047  -67.109  1.00 17.81 ? 304  THR C CG2   1 
ATOM   7218  N N     . ILE C 1 327 ? -6.489  26.090  -64.598  1.00 17.94 ? 305  ILE C N     1 
ATOM   7219  C CA    . ILE C 1 327 ? -5.181  26.735  -64.544  1.00 17.17 ? 305  ILE C CA    1 
ATOM   7220  C C     . ILE C 1 327 ? -4.296  26.109  -63.473  1.00 18.08 ? 305  ILE C C     1 
ATOM   7221  O O     . ILE C 1 327 ? -3.141  25.843  -63.706  1.00 19.21 ? 305  ILE C O     1 
ATOM   7222  C CB    . ILE C 1 327 ? -5.321  28.230  -64.187  1.00 16.29 ? 305  ILE C CB    1 
ATOM   7223  C CG1   . ILE C 1 327 ? -5.704  29.044  -65.422  1.00 16.15 ? 305  ILE C CG1   1 
ATOM   7224  C CG2   . ILE C 1 327 ? -4.032  28.740  -63.550  1.00 16.55 ? 305  ILE C CG2   1 
ATOM   7225  C CD1   . ILE C 1 327 ? -6.232  30.444  -65.140  1.00 11.86 ? 305  ILE C CD1   1 
ATOM   7226  N N     . LEU C 1 328 ? -4.848  25.925  -62.278  1.00 18.65 ? 306  LEU C N     1 
ATOM   7227  C CA    . LEU C 1 328 ? -4.083  25.440  -61.132  1.00 19.42 ? 306  LEU C CA    1 
ATOM   7228  C C     . LEU C 1 328 ? -3.607  24.017  -61.382  1.00 19.54 ? 306  LEU C C     1 
ATOM   7229  O O     . LEU C 1 328 ? -2.524  23.632  -60.946  1.00 18.94 ? 306  LEU C O     1 
ATOM   7230  C CB    . LEU C 1 328 ? -4.929  25.520  -59.834  1.00 19.36 ? 306  LEU C CB    1 
ATOM   7231  C CG    . LEU C 1 328 ? -5.276  26.928  -59.318  1.00 20.65 ? 306  LEU C CG    1 
ATOM   7232  C CD1   . LEU C 1 328 ? -6.315  26.905  -58.210  1.00 19.24 ? 306  LEU C CD1   1 
ATOM   7233  C CD2   . LEU C 1 328 ? -4.041  27.644  -58.842  1.00 19.96 ? 306  LEU C CD2   1 
ATOM   7234  N N     . ASP C 1 329 ? -4.433  23.245  -62.079  1.00 19.99 ? 307  ASP C N     1 
ATOM   7235  C CA    . ASP C 1 329 ? -4.094  21.881  -62.428  1.00 20.32 ? 307  ASP C CA    1 
ATOM   7236  C C     . ASP C 1 329 ? -2.982  21.841  -63.465  1.00 18.78 ? 307  ASP C C     1 
ATOM   7237  O O     . ASP C 1 329 ? -2.093  21.007  -63.373  1.00 19.37 ? 307  ASP C O     1 
ATOM   7238  C CB    . ASP C 1 329 ? -5.349  21.121  -62.877  1.00 21.00 ? 307  ASP C CB    1 
ATOM   7239  C CG    . ASP C 1 329 ? -6.338  20.883  -61.714  1.00 30.33 ? 307  ASP C CG    1 
ATOM   7240  O OD1   . ASP C 1 329 ? -5.906  20.524  -60.576  1.00 36.92 ? 307  ASP C OD1   1 
ATOM   7241  O OD2   . ASP C 1 329 ? -7.561  21.045  -61.939  1.00 38.81 ? 307  ASP C OD2   1 
ATOM   7242  N N     . ILE C 1 330 ? -3.013  22.752  -64.431  1.00 17.42 ? 308  ILE C N     1 
ATOM   7243  C CA    . ILE C 1 330 ? -1.982  22.802  -65.489  1.00 16.51 ? 308  ILE C CA    1 
ATOM   7244  C C     . ILE C 1 330 ? -0.630  23.262  -64.919  1.00 16.57 ? 308  ILE C C     1 
ATOM   7245  O O     . ILE C 1 330 ? 0.409   22.604  -65.108  1.00 16.19 ? 308  ILE C O     1 
ATOM   7246  C CB    . ILE C 1 330 ? -2.416  23.738  -66.654  1.00 16.41 ? 308  ILE C CB    1 
ATOM   7247  C CG1   . ILE C 1 330 ? -3.614  23.141  -67.407  1.00 15.33 ? 308  ILE C CG1   1 
ATOM   7248  C CG2   . ILE C 1 330 ? -1.261  24.036  -67.644  1.00 15.18 ? 308  ILE C CG2   1 
ATOM   7249  C CD1   . ILE C 1 330 ? -4.538  24.204  -68.027  1.00 15.79 ? 308  ILE C CD1   1 
ATOM   7250  N N     . LEU C 1 331 ? -0.663  24.387  -64.203  1.00 16.96 ? 309  LEU C N     1 
ATOM   7251  C CA    . LEU C 1 331 ? 0.531   24.921  -63.539  1.00 16.38 ? 309  LEU C CA    1 
ATOM   7252  C C     . LEU C 1 331 ? 1.085   23.942  -62.513  1.00 15.46 ? 309  LEU C C     1 
ATOM   7253  O O     . LEU C 1 331 ? 2.282   23.660  -62.494  1.00 15.70 ? 309  LEU C O     1 
ATOM   7254  C CB    . LEU C 1 331 ? 0.246   26.276  -62.882  1.00 14.96 ? 309  LEU C CB    1 
ATOM   7255  C CG    . LEU C 1 331 ? -0.312  27.325  -63.837  1.00 13.90 ? 309  LEU C CG    1 
ATOM   7256  C CD1   . LEU C 1 331 ? -0.514  28.598  -63.098  1.00 12.25 ? 309  LEU C CD1   1 
ATOM   7257  C CD2   . LEU C 1 331 ? 0.635   27.527  -65.012  1.00 13.06 ? 309  LEU C CD2   1 
ATOM   7258  N N     . GLY C 1 332 ? 0.219   23.402  -61.686  1.00 14.61 ? 310  GLY C N     1 
ATOM   7259  C CA    . GLY C 1 332 ? 0.668   22.424  -60.708  1.00 16.79 ? 310  GLY C CA    1 
ATOM   7260  C C     . GLY C 1 332 ? 1.356   21.185  -61.291  1.00 17.90 ? 310  GLY C C     1 
ATOM   7261  O O     . GLY C 1 332 ? 2.375   20.719  -60.781  1.00 18.91 ? 310  GLY C O     1 
ATOM   7262  N N     . GLY C 1 333 ? 0.770   20.641  -62.348  1.00 18.56 ? 311  GLY C N     1 
ATOM   7263  C CA    . GLY C 1 333 ? 1.311   19.479  -63.018  1.00 18.36 ? 311  GLY C CA    1 
ATOM   7264  C C     . GLY C 1 333 ? 2.626   19.751  -63.689  1.00 17.72 ? 311  GLY C C     1 
ATOM   7265  O O     . GLY C 1 333 ? 3.471   18.867  -63.776  1.00 18.23 ? 311  GLY C O     1 
ATOM   7266  N N     . LEU C 1 334 ? 2.787   20.978  -64.164  1.00 17.81 ? 312  LEU C N     1 
ATOM   7267  C CA    . LEU C 1 334 ? 4.023   21.432  -64.838  1.00 17.49 ? 312  LEU C CA    1 
ATOM   7268  C C     . LEU C 1 334 ? 5.132   21.723  -63.820  1.00 16.66 ? 312  LEU C C     1 
ATOM   7269  O O     . LEU C 1 334 ? 6.310   21.505  -64.086  1.00 15.49 ? 312  LEU C O     1 
ATOM   7270  C CB    . LEU C 1 334 ? 3.709   22.678  -65.651  1.00 16.31 ? 312  LEU C CB    1 
ATOM   7271  C CG    . LEU C 1 334 ? 4.756   23.127  -66.655  1.00 21.36 ? 312  LEU C CG    1 
ATOM   7272  C CD1   . LEU C 1 334 ? 5.095   22.015  -67.637  1.00 21.74 ? 312  LEU C CD1   1 
ATOM   7273  C CD2   . LEU C 1 334 ? 4.249   24.391  -67.380  1.00 19.57 ? 312  LEU C CD2   1 
ATOM   7274  N N     . ARG C 1 335 ? 4.734   22.177  -62.624  1.00 16.13 ? 313  ARG C N     1 
ATOM   7275  C CA    . ARG C 1 335 ? 5.671   22.310  -61.509  1.00 14.13 ? 313  ARG C CA    1 
ATOM   7276  C C     . ARG C 1 335 ? 6.155   20.936  -61.061  1.00 12.47 ? 313  ARG C C     1 
ATOM   7277  O O     . ARG C 1 335 ? 7.324   20.742  -60.789  1.00 13.33 ? 313  ARG C O     1 
ATOM   7278  C CB    . ARG C 1 335 ? 5.057   23.096  -60.354  1.00 14.65 ? 313  ARG C CB    1 
ATOM   7279  C CG    . ARG C 1 335 ? 5.035   24.620  -60.610  1.00 16.03 ? 313  ARG C CG    1 
ATOM   7280  C CD    . ARG C 1 335 ? 4.700   25.510  -59.384  1.00 17.76 ? 313  ARG C CD    1 
ATOM   7281  N NE    . ARG C 1 335 ? 4.584   26.909  -59.823  1.00 19.15 ? 313  ARG C NE    1 
ATOM   7282  C CZ    . ARG C 1 335 ? 3.445   27.551  -60.113  1.00 23.82 ? 313  ARG C CZ    1 
ATOM   7283  N NH1   . ARG C 1 335 ? 2.254   26.967  -59.947  1.00 23.67 ? 313  ARG C NH1   1 
ATOM   7284  N NH2   . ARG C 1 335 ? 3.486   28.819  -60.538  1.00 26.18 ? 313  ARG C NH2   1 
ATOM   7285  N N     . SER C 1 336 ? 5.252   19.968  -61.033  1.00 11.33 ? 314  SER C N     1 
ATOM   7286  C CA    . SER C 1 336 ? 5.596   18.601  -60.665  1.00 10.07 ? 314  SER C CA    1 
ATOM   7287  C C     . SER C 1 336 ? 6.558   17.960  -61.676  1.00 10.24 ? 314  SER C C     1 
ATOM   7288  O O     . SER C 1 336 ? 7.521   17.320  -61.253  1.00 10.07 ? 314  SER C O     1 
ATOM   7289  C CB    . SER C 1 336 ? 4.331   17.739  -60.500  1.00 10.52 ? 314  SER C CB    1 
ATOM   7290  O OG    . SER C 1 336 ? 3.520   18.190  -59.415  1.00 15.21 ? 314  SER C OG    1 
ATOM   7291  N N     . THR C 1 337 ? 6.279   18.122  -62.983  1.00 8.73  ? 315  THR C N     1 
ATOM   7292  C CA    . THR C 1 337 ? 7.158   17.664  -64.036  1.00 10.19 ? 315  THR C CA    1 
ATOM   7293  C C     . THR C 1 337 ? 8.571   18.228  -63.827  1.00 12.32 ? 315  THR C C     1 
ATOM   7294  O O     . THR C 1 337 ? 9.572   17.500  -63.853  1.00 13.06 ? 315  THR C O     1 
ATOM   7295  C CB    . THR C 1 337 ? 6.705   18.149  -65.450  1.00 10.50 ? 315  THR C CB    1 
ATOM   7296  O OG1   . THR C 1 337 ? 5.339   17.815  -65.721  1.00 15.97 ? 315  THR C OG1   1 
ATOM   7297  C CG2   . THR C 1 337 ? 7.556   17.531  -66.499  1.00 10.42 ? 315  THR C CG2   1 
ATOM   7298  N N     . CYS C 1 338 ? 8.657   19.543  -63.653  1.00 14.12 ? 316  CYS C N     1 
ATOM   7299  C CA    . CYS C 1 338 ? 9.925   20.185  -63.474  1.00 14.01 ? 316  CYS C CA    1 
ATOM   7300  C C     . CYS C 1 338 ? 10.649  19.620  -62.279  1.00 14.14 ? 316  CYS C C     1 
ATOM   7301  O O     . CYS C 1 338 ? 11.849  19.331  -62.346  1.00 14.59 ? 316  CYS C O     1 
ATOM   7302  C CB    . CYS C 1 338 ? 9.719   21.670  -63.269  1.00 14.88 ? 316  CYS C CB    1 
ATOM   7303  S SG    . CYS C 1 338 ? 9.212   22.442  -64.758  1.00 10.69 ? 316  CYS C SG    1 
ATOM   7304  N N     . THR C 1 339 ? 9.940   19.476  -61.176  1.00 14.46 ? 317  THR C N     1 
ATOM   7305  C CA    . THR C 1 339 ? 10.545  18.870  -60.004  1.00 14.99 ? 317  THR C CA    1 
ATOM   7306  C C     . THR C 1 339 ? 11.141  17.499  -60.344  1.00 14.39 ? 317  THR C C     1 
ATOM   7307  O O     . THR C 1 339 ? 12.271  17.209  -59.980  1.00 15.46 ? 317  THR C O     1 
ATOM   7308  C CB    . THR C 1 339 ? 9.539   18.735  -58.868  1.00 15.26 ? 317  THR C CB    1 
ATOM   7309  O OG1   . THR C 1 339 ? 8.970   20.018  -58.590  1.00 18.06 ? 317  THR C OG1   1 
ATOM   7310  C CG2   . THR C 1 339 ? 10.225  18.240  -57.615  1.00 17.58 ? 317  THR C CG2   1 
ATOM   7311  N N     . TYR C 1 340 ? 10.381  16.685  -61.067  1.00 13.54 ? 318  TYR C N     1 
ATOM   7312  C CA    . TYR C 1 340 ? 10.715  15.281  -61.276  1.00 13.43 ? 318  TYR C CA    1 
ATOM   7313  C C     . TYR C 1 340 ? 11.847  15.066  -62.248  1.00 14.92 ? 318  TYR C C     1 
ATOM   7314  O O     . TYR C 1 340 ? 12.495  14.013  -62.190  1.00 15.57 ? 318  TYR C O     1 
ATOM   7315  C CB    . TYR C 1 340 ? 9.489   14.471  -61.721  1.00 11.96 ? 318  TYR C CB    1 
ATOM   7316  C CG    . TYR C 1 340 ? 8.324   14.457  -60.734  1.00 9.72  ? 318  TYR C CG    1 
ATOM   7317  C CD1   . TYR C 1 340 ? 8.507   14.767  -59.389  1.00 10.80 ? 318  TYR C CD1   1 
ATOM   7318  C CD2   . TYR C 1 340 ? 7.047   14.084  -61.144  1.00 11.95 ? 318  TYR C CD2   1 
ATOM   7319  C CE1   . TYR C 1 340 ? 7.459   14.733  -58.492  1.00 11.87 ? 318  TYR C CE1   1 
ATOM   7320  C CE2   . TYR C 1 340 ? 5.973   14.042  -60.239  1.00 11.44 ? 318  TYR C CE2   1 
ATOM   7321  C CZ    . TYR C 1 340 ? 6.190   14.362  -58.924  1.00 8.73  ? 318  TYR C CZ    1 
ATOM   7322  O OH    . TYR C 1 340 ? 5.163   14.354  -58.018  1.00 7.63  ? 318  TYR C OH    1 
ATOM   7323  N N     . VAL C 1 341 ? 12.087  16.052  -63.113  1.00 16.67 ? 319  VAL C N     1 
ATOM   7324  C CA    . VAL C 1 341 ? 13.228  16.032  -64.054  1.00 17.75 ? 319  VAL C CA    1 
ATOM   7325  C C     . VAL C 1 341 ? 14.423  16.871  -63.581  1.00 17.75 ? 319  VAL C C     1 
ATOM   7326  O O     . VAL C 1 341 ? 15.482  16.856  -64.201  1.00 17.98 ? 319  VAL C O     1 
ATOM   7327  C CB    . VAL C 1 341 ? 12.767  16.476  -65.453  1.00 17.80 ? 319  VAL C CB    1 
ATOM   7328  C CG1   . VAL C 1 341 ? 11.585  15.614  -65.903  1.00 20.45 ? 319  VAL C CG1   1 
ATOM   7329  C CG2   . VAL C 1 341 ? 12.413  17.972  -65.488  1.00 19.65 ? 319  VAL C CG2   1 
ATOM   7330  N N     . GLY C 1 342 ? 14.231  17.608  -62.489  1.00 18.85 ? 320  GLY C N     1 
ATOM   7331  C CA    . GLY C 1 342 ? 15.281  18.383  -61.858  1.00 17.85 ? 320  GLY C CA    1 
ATOM   7332  C C     . GLY C 1 342 ? 15.354  19.814  -62.341  1.00 18.62 ? 320  GLY C C     1 
ATOM   7333  O O     . GLY C 1 342 ? 16.438  20.412  -62.280  1.00 19.41 ? 320  GLY C O     1 
ATOM   7334  N N     . ALA C 1 343 ? 14.227  20.372  -62.801  1.00 17.50 ? 321  ALA C N     1 
ATOM   7335  C CA    . ALA C 1 343 ? 14.185  21.722  -63.356  1.00 17.45 ? 321  ALA C CA    1 
ATOM   7336  C C     . ALA C 1 343 ? 13.615  22.681  -62.327  1.00 18.96 ? 321  ALA C C     1 
ATOM   7337  O O     . ALA C 1 343 ? 12.436  22.623  -61.996  1.00 18.77 ? 321  ALA C O     1 
ATOM   7338  C CB    . ALA C 1 343 ? 13.339  21.747  -64.658  1.00 16.47 ? 321  ALA C CB    1 
ATOM   7339  N N     . ALA C 1 344 ? 14.451  23.581  -61.812  1.00 20.72 ? 322  ALA C N     1 
ATOM   7340  C CA    . ALA C 1 344 ? 13.991  24.536  -60.802  1.00 20.20 ? 322  ALA C CA    1 
ATOM   7341  C C     . ALA C 1 344 ? 13.202  25.667  -61.443  1.00 19.91 ? 322  ALA C C     1 
ATOM   7342  O O     . ALA C 1 344 ? 12.414  26.341  -60.769  1.00 19.66 ? 322  ALA C O     1 
ATOM   7343  C CB    . ALA C 1 344 ? 15.164  25.064  -60.024  1.00 20.03 ? 322  ALA C CB    1 
ATOM   7344  N N     . LYS C 1 345 ? 13.415  25.845  -62.747  1.00 19.82 ? 323  LYS C N     1 
ATOM   7345  C CA    . LYS C 1 345 ? 12.782  26.875  -63.547  1.00 19.58 ? 323  LYS C CA    1 
ATOM   7346  C C     . LYS C 1 345 ? 12.301  26.186  -64.793  1.00 19.21 ? 323  LYS C C     1 
ATOM   7347  O O     . LYS C 1 345 ? 12.988  25.283  -65.272  1.00 18.84 ? 323  LYS C O     1 
ATOM   7348  C CB    . LYS C 1 345 ? 13.834  27.945  -63.913  1.00 20.28 ? 323  LYS C CB    1 
ATOM   7349  C CG    . LYS C 1 345 ? 14.583  28.531  -62.704  1.00 22.06 ? 323  LYS C CG    1 
ATOM   7350  C CD    . LYS C 1 345 ? 15.401  29.793  -63.048  1.00 24.07 ? 323  LYS C CD    1 
ATOM   7351  N N     . LEU C 1 346 ? 11.145  26.603  -65.322  1.00 18.55 ? 324  LEU C N     1 
ATOM   7352  C CA    . LEU C 1 346 ? 10.638  26.121  -66.614  1.00 18.71 ? 324  LEU C CA    1 
ATOM   7353  C C     . LEU C 1 346 ? 11.638  26.230  -67.760  1.00 19.37 ? 324  LEU C C     1 
ATOM   7354  O O     . LEU C 1 346 ? 11.568  25.458  -68.725  1.00 20.96 ? 324  LEU C O     1 
ATOM   7355  C CB    . LEU C 1 346 ? 9.413   26.916  -67.033  1.00 19.50 ? 324  LEU C CB    1 
ATOM   7356  C CG    . LEU C 1 346 ? 8.589   26.360  -68.202  1.00 18.98 ? 324  LEU C CG    1 
ATOM   7357  C CD1   . LEU C 1 346 ? 8.075   24.931  -67.960  1.00 14.11 ? 324  LEU C CD1   1 
ATOM   7358  C CD2   . LEU C 1 346 ? 7.396   27.302  -68.434  1.00 27.67 ? 324  LEU C CD2   1 
ATOM   7359  N N     . LYS C 1 347 ? 12.493  27.250  -67.674  1.00 19.84 ? 325  LYS C N     1 
ATOM   7360  C CA    . LYS C 1 347 ? 13.659  27.431  -68.527  1.00 20.40 ? 325  LYS C CA    1 
ATOM   7361  C C     . LYS C 1 347 ? 14.414  26.120  -68.692  1.00 19.58 ? 325  LYS C C     1 
ATOM   7362  O O     . LYS C 1 347 ? 14.704  25.692  -69.788  1.00 22.02 ? 325  LYS C O     1 
ATOM   7363  C CB    . LYS C 1 347 ? 14.509  28.526  -67.845  1.00 20.10 ? 325  LYS C CB    1 
ATOM   7364  C CG    . LYS C 1 347 ? 15.819  28.945  -68.442  1.00 22.70 ? 325  LYS C CG    1 
ATOM   7365  C CD    . LYS C 1 347 ? 16.488  29.973  -67.504  1.00 18.34 ? 325  LYS C CD    1 
ATOM   7366  N N     . GLU C 1 348 ? 14.672  25.448  -67.590  1.00 20.18 ? 326  GLU C N     1 
ATOM   7367  C CA    . GLU C 1 348 ? 15.557  24.279  -67.577  1.00 20.19 ? 326  GLU C CA    1 
ATOM   7368  C C     . GLU C 1 348 ? 14.912  22.981  -68.072  1.00 19.57 ? 326  GLU C C     1 
ATOM   7369  O O     . GLU C 1 348 ? 15.582  21.957  -68.165  1.00 19.51 ? 326  GLU C O     1 
ATOM   7370  C CB    . GLU C 1 348 ? 16.088  24.037  -66.159  1.00 20.99 ? 326  GLU C CB    1 
ATOM   7371  C CG    . GLU C 1 348 ? 17.024  25.107  -65.615  1.00 22.19 ? 326  GLU C CG    1 
ATOM   7372  C CD    . GLU C 1 348 ? 17.250  24.961  -64.112  1.00 35.64 ? 326  GLU C CD    1 
ATOM   7373  O OE1   . GLU C 1 348 ? 17.203  23.811  -63.606  1.00 40.51 ? 326  GLU C OE1   1 
ATOM   7374  O OE2   . GLU C 1 348 ? 17.465  25.994  -63.424  1.00 43.50 ? 326  GLU C OE2   1 
ATOM   7375  N N     . LEU C 1 349 ? 13.610  23.002  -68.346  1.00 19.41 ? 327  LEU C N     1 
ATOM   7376  C CA    . LEU C 1 349 ? 12.884  21.784  -68.634  1.00 18.66 ? 327  LEU C CA    1 
ATOM   7377  C C     . LEU C 1 349 ? 13.492  21.080  -69.853  1.00 19.90 ? 327  LEU C C     1 
ATOM   7378  O O     . LEU C 1 349 ? 13.861  19.923  -69.769  1.00 20.20 ? 327  LEU C O     1 
ATOM   7379  C CB    . LEU C 1 349 ? 11.392  22.063  -68.863  1.00 17.83 ? 327  LEU C CB    1 
ATOM   7380  C CG    . LEU C 1 349 ? 10.452  20.962  -68.370  1.00 20.77 ? 327  LEU C CG    1 
ATOM   7381  C CD1   . LEU C 1 349 ? 8.953   21.156  -68.765  1.00 16.00 ? 327  LEU C CD1   1 
ATOM   7382  C CD2   . LEU C 1 349 ? 10.949  19.615  -68.783  1.00 18.69 ? 327  LEU C CD2   1 
ATOM   7383  N N     . SER C 1 350 ? 13.584  21.774  -70.981  1.00 21.24 ? 328  SER C N     1 
ATOM   7384  C CA    . SER C 1 350 ? 14.030  21.145  -72.236  1.00 23.13 ? 328  SER C CA    1 
ATOM   7385  C C     . SER C 1 350 ? 15.423  20.597  -72.065  1.00 23.51 ? 328  SER C C     1 
ATOM   7386  O O     . SER C 1 350 ? 15.734  19.495  -72.502  1.00 26.11 ? 328  SER C O     1 
ATOM   7387  C CB    . SER C 1 350 ? 14.076  22.166  -73.369  1.00 22.45 ? 328  SER C CB    1 
ATOM   7388  O OG    . SER C 1 350 ? 15.085  23.111  -73.082  1.00 26.68 ? 328  SER C OG    1 
ATOM   7389  N N     . ARG C 1 351 ? 16.268  21.394  -71.419  1.00 24.14 ? 329  ARG C N     1 
ATOM   7390  C CA    . ARG C 1 351 ? 17.637  20.992  -71.114  1.00 23.64 ? 329  ARG C CA    1 
ATOM   7391  C C     . ARG C 1 351 ? 17.645  19.676  -70.328  1.00 21.91 ? 329  ARG C C     1 
ATOM   7392  O O     . ARG C 1 351 ? 18.541  18.864  -70.508  1.00 21.72 ? 329  ARG C O     1 
ATOM   7393  C CB    . ARG C 1 351 ? 18.382  22.084  -70.314  1.00 23.22 ? 329  ARG C CB    1 
ATOM   7394  C CG    . ARG C 1 351 ? 18.588  23.405  -71.054  1.00 28.00 ? 329  ARG C CG    1 
ATOM   7395  C CD    . ARG C 1 351 ? 18.668  24.623  -70.100  1.00 31.44 ? 329  ARG C CD    1 
ATOM   7396  N N     . ARG C 1 352 ? 16.645  19.460  -69.475  1.00 20.02 ? 330  ARG C N     1 
ATOM   7397  C CA    . ARG C 1 352 ? 16.570  18.261  -68.637  1.00 19.11 ? 330  ARG C CA    1 
ATOM   7398  C C     . ARG C 1 352 ? 15.511  17.238  -69.082  1.00 18.99 ? 330  ARG C C     1 
ATOM   7399  O O     . ARG C 1 352 ? 15.304  16.196  -68.428  1.00 18.05 ? 330  ARG C O     1 
ATOM   7400  C CB    . ARG C 1 352 ? 16.267  18.661  -67.198  1.00 19.36 ? 330  ARG C CB    1 
ATOM   7401  C CG    . ARG C 1 352 ? 17.372  19.403  -66.536  1.00 23.18 ? 330  ARG C CG    1 
ATOM   7402  C CD    . ARG C 1 352 ? 16.832  20.328  -65.508  1.00 30.37 ? 330  ARG C CD    1 
ATOM   7403  N NE    . ARG C 1 352 ? 17.850  21.248  -65.007  1.00 35.42 ? 330  ARG C NE    1 
ATOM   7404  C CZ    . ARG C 1 352 ? 18.670  21.002  -63.988  1.00 37.89 ? 330  ARG C CZ    1 
ATOM   7405  N NH1   . ARG C 1 352 ? 18.617  19.844  -63.329  1.00 39.39 ? 330  ARG C NH1   1 
ATOM   7406  N NH2   . ARG C 1 352 ? 19.559  21.930  -63.625  1.00 38.61 ? 330  ARG C NH2   1 
ATOM   7407  N N     . ALA C 1 353 ? 14.820  17.539  -70.180  1.00 19.71 ? 331  ALA C N     1 
ATOM   7408  C CA    . ALA C 1 353 ? 13.859  16.620  -70.769  1.00 18.78 ? 331  ALA C CA    1 
ATOM   7409  C C     . ALA C 1 353 ? 14.586  15.527  -71.533  1.00 20.17 ? 331  ALA C C     1 
ATOM   7410  O O     . ALA C 1 353 ? 15.362  15.815  -72.456  1.00 20.06 ? 331  ALA C O     1 
ATOM   7411  C CB    . ALA C 1 353 ? 12.931  17.355  -71.694  1.00 17.80 ? 331  ALA C CB    1 
ATOM   7412  N N     . THR C 1 354 ? 14.381  14.288  -71.096  1.00 20.99 ? 332  THR C N     1 
ATOM   7413  C CA    . THR C 1 354 ? 14.732  13.097  -71.860  1.00 20.88 ? 332  THR C CA    1 
ATOM   7414  C C     . THR C 1 354 ? 13.454  12.306  -72.013  1.00 20.73 ? 332  THR C C     1 
ATOM   7415  O O     . THR C 1 354 ? 12.770  11.990  -71.006  1.00 21.01 ? 332  THR C O     1 
ATOM   7416  C CB    . THR C 1 354 ? 15.757  12.250  -71.122  1.00 20.05 ? 332  THR C CB    1 
ATOM   7417  O OG1   . THR C 1 354 ? 16.962  13.009  -71.002  1.00 23.34 ? 332  THR C OG1   1 
ATOM   7418  C CG2   . THR C 1 354 ? 16.039  10.954  -71.868  1.00 21.94 ? 332  THR C CG2   1 
ATOM   7419  N N     . PHE C 1 355 ? 13.100  12.000  -73.259  1.00 20.50 ? 333  PHE C N     1 
ATOM   7420  C CA    . PHE C 1 355 ? 11.893  11.216  -73.516  1.00 18.64 ? 333  PHE C CA    1 
ATOM   7421  C C     . PHE C 1 355 ? 12.247  9.753   -73.718  1.00 18.92 ? 333  PHE C C     1 
ATOM   7422  O O     . PHE C 1 355 ? 13.346  9.388   -74.186  1.00 15.83 ? 333  PHE C O     1 
ATOM   7423  C CB    . PHE C 1 355 ? 11.136  11.716  -74.739  1.00 17.93 ? 333  PHE C CB    1 
ATOM   7424  C CG    . PHE C 1 355 ? 10.680  13.152  -74.638  1.00 18.71 ? 333  PHE C CG    1 
ATOM   7425  C CD1   . PHE C 1 355 ? 9.427   13.468  -74.114  1.00 13.48 ? 333  PHE C CD1   1 
ATOM   7426  C CD2   . PHE C 1 355 ? 11.497  14.193  -75.086  1.00 19.39 ? 333  PHE C CD2   1 
ATOM   7427  C CE1   . PHE C 1 355 ? 8.999   14.783  -74.049  1.00 13.46 ? 333  PHE C CE1   1 
ATOM   7428  C CE2   . PHE C 1 355 ? 11.068  15.496  -75.020  1.00 17.20 ? 333  PHE C CE2   1 
ATOM   7429  C CZ    . PHE C 1 355 ? 9.809   15.790  -74.501  1.00 13.74 ? 333  PHE C CZ    1 
ATOM   7430  N N     . ILE C 1 356 ? 11.300  8.914   -73.327  1.00 20.27 ? 334  ILE C N     1 
ATOM   7431  C CA    . ILE C 1 356 ? 11.344  7.493   -73.636  1.00 20.77 ? 334  ILE C CA    1 
ATOM   7432  C C     . ILE C 1 356 ? 10.178  7.195   -74.548  1.00 20.80 ? 334  ILE C C     1 
ATOM   7433  O O     . ILE C 1 356 ? 9.126   7.801   -74.432  1.00 18.60 ? 334  ILE C O     1 
ATOM   7434  C CB    . ILE C 1 356 ? 11.246  6.618   -72.366  1.00 21.52 ? 334  ILE C CB    1 
ATOM   7435  C CG1   . ILE C 1 356 ? 10.107  7.124   -71.459  1.00 21.78 ? 334  ILE C CG1   1 
ATOM   7436  C CG2   . ILE C 1 356 ? 12.590  6.620   -71.609  1.00 20.93 ? 334  ILE C CG2   1 
ATOM   7437  C CD1   . ILE C 1 356 ? 9.656   6.104   -70.508  1.00 22.89 ? 334  ILE C CD1   1 
ATOM   7438  N N     . ARG C 1 357 ? 10.385  6.273   -75.477  1.00 23.13 ? 335  ARG C N     1 
ATOM   7439  C CA    . ARG C 1 357 ? 9.324   5.855   -76.376  1.00 23.61 ? 335  ARG C CA    1 
ATOM   7440  C C     . ARG C 1 357 ? 8.566   4.785   -75.643  1.00 21.90 ? 335  ARG C C     1 
ATOM   7441  O O     . ARG C 1 357 ? 9.189   3.900   -75.056  1.00 18.65 ? 335  ARG C O     1 
ATOM   7442  C CB    . ARG C 1 357 ? 9.904   5.291   -77.687  1.00 26.21 ? 335  ARG C CB    1 
ATOM   7443  C CG    . ARG C 1 357 ? 10.903  6.210   -78.423  1.00 30.26 ? 335  ARG C CG    1 
ATOM   7444  C CD    . ARG C 1 357 ? 11.306  5.615   -79.766  1.00 34.19 ? 335  ARG C CD    1 
ATOM   7445  N NE    . ARG C 1 357 ? 12.309  6.433   -80.436  1.00 37.93 ? 335  ARG C NE    1 
ATOM   7446  N N     . VAL C 1 358 ? 7.238   4.870   -75.668  1.00 23.22 ? 336  VAL C N     1 
ATOM   7447  C CA    . VAL C 1 358 ? 6.378   3.884   -75.014  1.00 25.07 ? 336  VAL C CA    1 
ATOM   7448  C C     . VAL C 1 358 ? 5.411   3.290   -76.026  1.00 27.65 ? 336  VAL C C     1 
ATOM   7449  O O     . VAL C 1 358 ? 5.367   3.720   -77.173  1.00 28.54 ? 336  VAL C O     1 
ATOM   7450  C CB    . VAL C 1 358 ? 5.582   4.515   -73.843  1.00 25.22 ? 336  VAL C CB    1 
ATOM   7451  C CG1   . VAL C 1 358 ? 6.537   5.001   -72.741  1.00 26.77 ? 336  VAL C CG1   1 
ATOM   7452  C CG2   . VAL C 1 358 ? 4.678   5.685   -74.313  1.00 24.75 ? 336  VAL C CG2   1 
ATOM   7453  N N     . THR C 1 359 ? 4.633   2.312   -75.574  1.00 29.82 ? 337  THR C N     1 
ATOM   7454  C CA    . THR C 1 359 ? 3.581   1.676   -76.367  1.00 30.30 ? 337  THR C CA    1 
ATOM   7455  C C     . THR C 1 359 ? 2.203   2.057   -75.810  1.00 30.95 ? 337  THR C C     1 
ATOM   7456  O O     . THR C 1 359 ? 1.198   1.985   -76.510  1.00 31.63 ? 337  THR C O     1 
ATOM   7457  C CB    . THR C 1 359 ? 3.769   0.149   -76.359  1.00 30.65 ? 337  THR C CB    1 
ATOM   7458  O OG1   . THR C 1 359 ? 4.156   -0.273  -75.042  1.00 31.53 ? 337  THR C OG1   1 
ATOM   7459  C CG2   . THR C 1 359 ? 4.861   -0.266  -77.354  1.00 30.32 ? 337  THR C CG2   1 
ATOM   7460  N N     . PRO D 1 24  ? 7.420   -20.601 -97.185  1.00 65.36 ? 2    PRO D N     1 
ATOM   7461  C CA    . PRO D 1 24  ? 6.565   -19.606 -96.533  1.00 63.69 ? 2    PRO D CA    1 
ATOM   7462  C C     . PRO D 1 24  ? 7.353   -18.393 -95.998  1.00 60.22 ? 2    PRO D C     1 
ATOM   7463  O O     . PRO D 1 24  ? 7.661   -18.326 -94.800  1.00 61.63 ? 2    PRO D O     1 
ATOM   7464  C CB    . PRO D 1 24  ? 5.891   -20.392 -95.391  1.00 63.77 ? 2    PRO D CB    1 
ATOM   7465  C CG    . PRO D 1 24  ? 6.398   -21.780 -95.449  1.00 64.78 ? 2    PRO D CG    1 
ATOM   7466  C CD    . PRO D 1 24  ? 7.146   -21.974 -96.726  1.00 66.09 ? 2    PRO D CD    1 
ATOM   7467  N N     . ARG D 1 25  ? 7.653   -17.449 -96.898  1.00 54.47 ? 3    ARG D N     1 
ATOM   7468  C CA    . ARG D 1 25  ? 8.452   -16.251 -96.586  1.00 51.48 ? 3    ARG D CA    1 
ATOM   7469  C C     . ARG D 1 25  ? 7.601   -15.088 -96.080  1.00 51.33 ? 3    ARG D C     1 
ATOM   7470  O O     . ARG D 1 25  ? 6.476   -14.889 -96.527  1.00 51.24 ? 3    ARG D O     1 
ATOM   7471  C CB    . ARG D 1 25  ? 9.227   -15.779 -97.827  1.00 51.23 ? 3    ARG D CB    1 
ATOM   7472  N N     . ILE D 1 26  ? 8.147   -14.325 -95.139  1.00 52.47 ? 4    ILE D N     1 
ATOM   7473  C CA    . ILE D 1 26  ? 7.552   -13.059 -94.734  1.00 52.52 ? 4    ILE D CA    1 
ATOM   7474  C C     . ILE D 1 26  ? 8.360   -11.933 -95.361  1.00 52.51 ? 4    ILE D C     1 
ATOM   7475  O O     . ILE D 1 26  ? 9.587   -11.887 -95.241  1.00 51.80 ? 4    ILE D O     1 
ATOM   7476  C CB    . ILE D 1 26  ? 7.505   -12.856 -93.201  1.00 52.88 ? 4    ILE D CB    1 
ATOM   7477  C CG1   . ILE D 1 26  ? 6.735   -13.999 -92.523  1.00 51.74 ? 4    ILE D CG1   1 
ATOM   7478  C CG2   . ILE D 1 26  ? 6.850   -11.501 -92.870  1.00 52.31 ? 4    ILE D CG2   1 
ATOM   7479  C CD1   . ILE D 1 26  ? 6.695   -13.918 -91.003  1.00 50.44 ? 4    ILE D CD1   1 
ATOM   7480  N N     . ASP D 1 27  ? 7.652   -11.030 -96.032  1.00 53.01 ? 5    ASP D N     1 
ATOM   7481  C CA    . ASP D 1 27  ? 8.254   -9.828  -96.604  1.00 52.39 ? 5    ASP D CA    1 
ATOM   7482  C C     . ASP D 1 27  ? 8.709   -8.911  -95.457  1.00 49.92 ? 5    ASP D C     1 
ATOM   7483  O O     . ASP D 1 27  ? 7.906   -8.539  -94.590  1.00 47.24 ? 5    ASP D O     1 
ATOM   7484  C CB    . ASP D 1 27  ? 7.237   -9.122  -97.518  1.00 52.66 ? 5    ASP D CB    1 
ATOM   7485  C CG    . ASP D 1 27  ? 7.891   -8.225  -98.559  1.00 55.26 ? 5    ASP D CG    1 
ATOM   7486  O OD1   . ASP D 1 27  ? 8.528   -7.213  -98.180  1.00 57.78 ? 5    ASP D OD1   1 
ATOM   7487  O OD2   . ASP D 1 27  ? 7.743   -8.524  -99.769  1.00 53.99 ? 5    ASP D OD2   1 
ATOM   7488  N N     . ALA D 1 28  ? 10.005  -8.586  -95.457  1.00 48.93 ? 6    ALA D N     1 
ATOM   7489  C CA    . ALA D 1 28  ? 10.634  -7.751  -94.413  1.00 48.70 ? 6    ALA D CA    1 
ATOM   7490  C C     . ALA D 1 28  ? 10.077  -6.324  -94.379  1.00 47.49 ? 6    ALA D C     1 
ATOM   7491  O O     . ALA D 1 28  ? 9.901   -5.744  -93.305  1.00 46.14 ? 6    ALA D O     1 
ATOM   7492  C CB    . ALA D 1 28  ? 12.151  -7.712  -94.604  1.00 48.80 ? 6    ALA D CB    1 
ATOM   7493  N N     . ASP D 1 29  ? 9.813   -5.773  -95.566  1.00 45.82 ? 7    ASP D N     1 
ATOM   7494  C CA    . ASP D 1 29  ? 9.196   -4.457  -95.707  1.00 43.91 ? 7    ASP D CA    1 
ATOM   7495  C C     . ASP D 1 29  ? 7.779   -4.448  -95.121  1.00 40.16 ? 7    ASP D C     1 
ATOM   7496  O O     . ASP D 1 29  ? 6.932   -5.283  -95.481  1.00 40.67 ? 7    ASP D O     1 
ATOM   7497  C CB    . ASP D 1 29  ? 9.179   -4.026  -97.178  1.00 44.15 ? 7    ASP D CB    1 
ATOM   7498  C CG    . ASP D 1 29  ? 8.802   -2.556  -97.360  1.00 49.08 ? 7    ASP D CG    1 
ATOM   7499  O OD1   . ASP D 1 29  ? 8.835   -1.778  -96.377  1.00 56.13 ? 7    ASP D OD1   1 
ATOM   7500  O OD2   . ASP D 1 29  ? 8.468   -2.171  -98.499  1.00 50.75 ? 7    ASP D OD2   1 
ATOM   7501  N N     . LEU D 1 30  ? 7.545   -3.521  -94.194  1.00 36.17 ? 8    LEU D N     1 
ATOM   7502  C CA    . LEU D 1 30  ? 6.193   -3.248  -93.688  1.00 33.02 ? 8    LEU D CA    1 
ATOM   7503  C C     . LEU D 1 30  ? 5.424   -2.469  -94.736  1.00 30.57 ? 8    LEU D C     1 
ATOM   7504  O O     . LEU D 1 30  ? 5.936   -1.514  -95.297  1.00 32.05 ? 8    LEU D O     1 
ATOM   7505  C CB    . LEU D 1 30  ? 6.218   -2.431  -92.388  1.00 32.45 ? 8    LEU D CB    1 
ATOM   7506  C CG    . LEU D 1 30  ? 4.857   -2.040  -91.796  1.00 30.61 ? 8    LEU D CG    1 
ATOM   7507  C CD1   . LEU D 1 30  ? 4.063   -3.260  -91.480  1.00 27.16 ? 8    LEU D CD1   1 
ATOM   7508  C CD2   . LEU D 1 30  ? 5.019   -1.200  -90.534  1.00 33.87 ? 8    LEU D CD2   1 
ATOM   7509  N N     . LYS D 1 31  ? 4.199   -2.883  -94.993  1.00 26.71 ? 9    LYS D N     1 
ATOM   7510  C CA    . LYS D 1 31  ? 3.385   -2.238  -95.974  1.00 23.67 ? 9    LYS D CA    1 
ATOM   7511  C C     . LYS D 1 31  ? 2.363   -1.371  -95.261  1.00 22.92 ? 9    LYS D C     1 
ATOM   7512  O O     . LYS D 1 31  ? 1.640   -1.849  -94.383  1.00 19.80 ? 9    LYS D O     1 
ATOM   7513  C CB    . LYS D 1 31  ? 2.735   -3.302  -96.841  1.00 23.35 ? 9    LYS D CB    1 
ATOM   7514  C CG    . LYS D 1 31  ? 3.720   -4.286  -97.408  1.00 21.91 ? 9    LYS D CG    1 
ATOM   7515  C CD    . LYS D 1 31  ? 4.695   -3.646  -98.355  1.00 22.39 ? 9    LYS D CD    1 
ATOM   7516  C CE    . LYS D 1 31  ? 5.638   -4.689  -98.881  1.00 24.61 ? 9    LYS D CE    1 
ATOM   7517  N NZ    . LYS D 1 31  ? 6.542   -4.123  -99.894  1.00 26.91 ? 9    LYS D NZ    1 
ATOM   7518  N N     . LEU D 1 32  ? 2.292   -0.103  -95.676  1.00 24.15 ? 10   LEU D N     1 
ATOM   7519  C CA    . LEU D 1 32  ? 1.466   0.911   -95.009  1.00 23.06 ? 10   LEU D CA    1 
ATOM   7520  C C     . LEU D 1 32  ? 0.146   1.129   -95.709  1.00 20.66 ? 10   LEU D C     1 
ATOM   7521  O O     . LEU D 1 32  ? 0.065   0.945   -96.910  1.00 20.49 ? 10   LEU D O     1 
ATOM   7522  C CB    . LEU D 1 32  ? 2.215   2.253   -94.949  1.00 24.06 ? 10   LEU D CB    1 
ATOM   7523  C CG    . LEU D 1 32  ? 3.529   2.236   -94.149  1.00 26.48 ? 10   LEU D CG    1 
ATOM   7524  C CD1   . LEU D 1 32  ? 4.358   3.495   -94.358  1.00 26.71 ? 10   LEU D CD1   1 
ATOM   7525  C CD2   . LEU D 1 32  ? 3.283   2.022   -92.658  1.00 24.20 ? 10   LEU D CD2   1 
ATOM   7526  N N     . ASP D 1 33  ? -0.882  1.505   -94.954  1.00 20.51 ? 11   ASP D N     1 
ATOM   7527  C CA    . ASP D 1 33  ? -2.122  2.048   -95.524  1.00 23.48 ? 11   ASP D CA    1 
ATOM   7528  C C     . ASP D 1 33  ? -2.200  3.573   -95.239  1.00 23.03 ? 11   ASP D C     1 
ATOM   7529  O O     . ASP D 1 33  ? -1.245  4.190   -94.750  1.00 23.84 ? 11   ASP D O     1 
ATOM   7530  C CB    . ASP D 1 33  ? -3.366  1.305   -94.987  1.00 24.26 ? 11   ASP D CB    1 
ATOM   7531  C CG    . ASP D 1 33  ? -4.489  1.144   -96.062  1.00 30.49 ? 11   ASP D CG    1 
ATOM   7532  O OD1   . ASP D 1 33  ? -5.127  2.162   -96.450  1.00 29.32 ? 11   ASP D OD1   1 
ATOM   7533  O OD2   . ASP D 1 33  ? -4.744  -0.010  -96.503  1.00 28.02 ? 11   ASP D OD2   1 
ATOM   7534  N N     . PHE D 1 34  ? -3.334  4.186   -95.556  1.00 21.96 ? 12   PHE D N     1 
ATOM   7535  C CA    . PHE D 1 34  ? -3.425  5.650   -95.541  1.00 20.33 ? 12   PHE D CA    1 
ATOM   7536  C C     . PHE D 1 34  ? -3.294  6.206   -94.136  1.00 19.14 ? 12   PHE D C     1 
ATOM   7537  O O     . PHE D 1 34  ? -2.775  7.305   -93.948  1.00 19.30 ? 12   PHE D O     1 
ATOM   7538  C CB    . PHE D 1 34  ? -4.754  6.149   -96.124  1.00 20.31 ? 12   PHE D CB    1 
ATOM   7539  C CG    . PHE D 1 34  ? -5.020  5.714   -97.547  1.00 22.36 ? 12   PHE D CG    1 
ATOM   7540  C CD1   . PHE D 1 34  ? -4.062  5.926   -98.549  1.00 19.20 ? 12   PHE D CD1   1 
ATOM   7541  C CD2   . PHE D 1 34  ? -6.265  5.122   -97.892  1.00 16.19 ? 12   PHE D CD2   1 
ATOM   7542  C CE1   . PHE D 1 34  ? -4.306  5.537   -99.843  1.00 17.76 ? 12   PHE D CE1   1 
ATOM   7543  C CE2   . PHE D 1 34  ? -6.521  4.736   -99.184  1.00 13.66 ? 12   PHE D CE2   1 
ATOM   7544  C CZ    . PHE D 1 34  ? -5.534  4.947   -100.170 1.00 19.18 ? 12   PHE D CZ    1 
ATOM   7545  N N     . LYS D 1 35  ? -3.798  5.453   -93.160  1.00 19.19 ? 13   LYS D N     1 
ATOM   7546  C CA    . LYS D 1 35  ? -3.839  5.901   -91.759  1.00 19.52 ? 13   LYS D CA    1 
ATOM   7547  C C     . LYS D 1 35  ? -2.440  5.908   -91.141  1.00 18.30 ? 13   LYS D C     1 
ATOM   7548  O O     . LYS D 1 35  ? -2.211  6.571   -90.133  1.00 19.19 ? 13   LYS D O     1 
ATOM   7549  C CB    . LYS D 1 35  ? -4.815  5.057   -90.913  1.00 19.38 ? 13   LYS D CB    1 
ATOM   7550  C CG    . LYS D 1 35  ? -4.348  3.622   -90.621  1.00 25.64 ? 13   LYS D CG    1 
ATOM   7551  N N     . ASP D 1 36  ? -1.502  5.199   -91.770  1.00 16.69 ? 14   ASP D N     1 
ATOM   7552  C CA    . ASP D 1 36  ? -0.132  5.143   -91.262  1.00 15.56 ? 14   ASP D CA    1 
ATOM   7553  C C     . ASP D 1 36  ? 0.686   6.348   -91.646  1.00 14.28 ? 14   ASP D C     1 
ATOM   7554  O O     . ASP D 1 36  ? 1.742   6.521   -91.094  1.00 15.64 ? 14   ASP D O     1 
ATOM   7555  C CB    . ASP D 1 36  ? 0.597   3.854   -91.693  1.00 14.82 ? 14   ASP D CB    1 
ATOM   7556  C CG    . ASP D 1 36  ? -0.201  2.584   -91.373  1.00 15.55 ? 14   ASP D CG    1 
ATOM   7557  O OD1   . ASP D 1 36  ? -0.644  2.380   -90.209  1.00 16.19 ? 14   ASP D OD1   1 
ATOM   7558  O OD2   . ASP D 1 36  ? -0.380  1.777   -92.304  1.00 14.00 ? 14   ASP D OD2   1 
ATOM   7559  N N     . VAL D 1 37  ? 0.202   7.175   -92.574  1.00 14.97 ? 15   VAL D N     1 
ATOM   7560  C CA    . VAL D 1 37  ? 0.968   8.312   -93.079  1.00 14.03 ? 15   VAL D CA    1 
ATOM   7561  C C     . VAL D 1 37  ? 0.219   9.629   -93.051  1.00 13.23 ? 15   VAL D C     1 
ATOM   7562  O O     . VAL D 1 37  ? -1.006  9.672   -92.928  1.00 13.79 ? 15   VAL D O     1 
ATOM   7563  C CB    . VAL D 1 37  ? 1.476   8.045   -94.536  1.00 14.76 ? 15   VAL D CB    1 
ATOM   7564  C CG1   . VAL D 1 37  ? 2.431   6.857   -94.546  1.00 16.35 ? 15   VAL D CG1   1 
ATOM   7565  C CG2   . VAL D 1 37  ? 0.327   7.814   -95.507  1.00 13.31 ? 15   VAL D CG2   1 
ATOM   7566  N N     . LEU D 1 38  ? 0.991   10.707  -93.177  1.00 12.52 ? 16   LEU D N     1 
ATOM   7567  C CA    . LEU D 1 38  ? 0.455   12.040  -93.472  1.00 11.53 ? 16   LEU D CA    1 
ATOM   7568  C C     . LEU D 1 38  ? 1.318   12.622  -94.574  1.00 12.28 ? 16   LEU D C     1 
ATOM   7569  O O     . LEU D 1 38  ? 2.459   12.180  -94.769  1.00 11.77 ? 16   LEU D O     1 
ATOM   7570  C CB    . LEU D 1 38  ? 0.491   12.981  -92.258  1.00 10.01 ? 16   LEU D CB    1 
ATOM   7571  C CG    . LEU D 1 38  ? -0.506  12.723  -91.128  1.00 14.91 ? 16   LEU D CG    1 
ATOM   7572  C CD1   . LEU D 1 38  ? -0.067  13.443  -89.864  1.00 16.54 ? 16   LEU D CD1   1 
ATOM   7573  C CD2   . LEU D 1 38  ? -1.958  13.114  -91.497  1.00 8.08  ? 16   LEU D CD2   1 
ATOM   7574  N N     . LEU D 1 39  ? 0.742   13.582  -95.296  1.00 12.78 ? 17   LEU D N     1 
ATOM   7575  C CA    . LEU D 1 39  ? 1.474   14.405  -96.240  1.00 13.61 ? 17   LEU D CA    1 
ATOM   7576  C C     . LEU D 1 39  ? 2.062   15.621  -95.535  1.00 14.64 ? 17   LEU D C     1 
ATOM   7577  O O     . LEU D 1 39  ? 1.365   16.323  -94.774  1.00 14.99 ? 17   LEU D O     1 
ATOM   7578  C CB    . LEU D 1 39  ? 0.557   14.866  -97.379  1.00 14.40 ? 17   LEU D CB    1 
ATOM   7579  C CG    . LEU D 1 39  ? 0.125   13.752  -98.336  1.00 12.88 ? 17   LEU D CG    1 
ATOM   7580  C CD1   . LEU D 1 39  ? -1.200  14.115  -99.011  1.00 13.87 ? 17   LEU D CD1   1 
ATOM   7581  C CD2   . LEU D 1 39  ? 1.195   13.485  -99.343  1.00 9.53  ? 17   LEU D CD2   1 
ATOM   7582  N N     . ARG D 1 40  ? 3.336   15.871  -95.833  1.00 14.79 ? 18   ARG D N     1 
ATOM   7583  C CA    . ARG D 1 40  ? 4.066   17.012  -95.323  1.00 16.33 ? 18   ARG D CA    1 
ATOM   7584  C C     . ARG D 1 40  ? 3.685   18.286  -96.114  1.00 17.66 ? 18   ARG D C     1 
ATOM   7585  O O     . ARG D 1 40  ? 3.621   18.274  -97.360  1.00 17.33 ? 18   ARG D O     1 
ATOM   7586  C CB    . ARG D 1 40  ? 5.552   16.718  -95.485  1.00 17.26 ? 18   ARG D CB    1 
ATOM   7587  C CG    . ARG D 1 40  ? 6.517   17.696  -94.885  1.00 19.19 ? 18   ARG D CG    1 
ATOM   7588  C CD    . ARG D 1 40  ? 7.887   17.461  -95.504  1.00 23.55 ? 18   ARG D CD    1 
ATOM   7589  N NE    . ARG D 1 40  ? 8.947   18.257  -94.895  1.00 25.30 ? 18   ARG D NE    1 
ATOM   7590  C CZ    . ARG D 1 40  ? 9.120   19.568  -95.063  1.00 33.38 ? 18   ARG D CZ    1 
ATOM   7591  N NH1   . ARG D 1 40  ? 8.296   20.285  -95.828  1.00 30.69 ? 18   ARG D NH1   1 
ATOM   7592  N NH2   . ARG D 1 40  ? 10.134  20.167  -94.445  1.00 37.97 ? 18   ARG D NH2   1 
ATOM   7593  N N     . PRO D 1 41  ? 3.441   19.401  -95.402  1.00 17.51 ? 19   PRO D N     1 
ATOM   7594  C CA    . PRO D 1 41  ? 3.244   20.639  -96.155  1.00 17.16 ? 19   PRO D CA    1 
ATOM   7595  C C     . PRO D 1 41  ? 4.588   21.183  -96.648  1.00 17.57 ? 19   PRO D C     1 
ATOM   7596  O O     . PRO D 1 41  ? 5.630   20.909  -96.048  1.00 16.88 ? 19   PRO D O     1 
ATOM   7597  C CB    . PRO D 1 41  ? 2.546   21.577  -95.157  1.00 15.81 ? 19   PRO D CB    1 
ATOM   7598  C CG    . PRO D 1 41  ? 2.844   21.016  -93.787  1.00 17.83 ? 19   PRO D CG    1 
ATOM   7599  C CD    . PRO D 1 41  ? 3.356   19.599  -93.940  1.00 17.86 ? 19   PRO D CD    1 
ATOM   7600  N N     . LYS D 1 42  ? 4.556   21.920  -97.755  1.00 18.55 ? 20   LYS D N     1 
ATOM   7601  C CA    . LYS D 1 42  ? 5.772   22.469  -98.358  1.00 19.36 ? 20   LYS D CA    1 
ATOM   7602  C C     . LYS D 1 42  ? 5.574   23.900  -98.805  1.00 20.29 ? 20   LYS D C     1 
ATOM   7603  O O     . LYS D 1 42  ? 4.451   24.322  -99.064  1.00 18.55 ? 20   LYS D O     1 
ATOM   7604  C CB    . LYS D 1 42  ? 6.183   21.644  -99.575  1.00 20.30 ? 20   LYS D CB    1 
ATOM   7605  C CG    . LYS D 1 42  ? 7.094   20.467  -99.253  1.00 19.55 ? 20   LYS D CG    1 
ATOM   7606  C CD    . LYS D 1 42  ? 6.790   19.300  -100.132 1.00 17.91 ? 20   LYS D CD    1 
ATOM   7607  C CE    . LYS D 1 42  ? 7.121   17.997  -99.434  1.00 19.09 ? 20   LYS D CE    1 
ATOM   7608  N NZ    . LYS D 1 42  ? 6.763   16.881  -100.340 1.00 18.29 ? 20   LYS D NZ    1 
ATOM   7609  N N     . ARG D 1 43  ? 6.690   24.618  -98.906  1.00 22.41 ? 21   ARG D N     1 
ATOM   7610  C CA    . ARG D 1 43  ? 6.700   26.014  -99.317  1.00 25.08 ? 21   ARG D CA    1 
ATOM   7611  C C     . ARG D 1 43  ? 6.181   26.149  -100.730 1.00 26.13 ? 21   ARG D C     1 
ATOM   7612  O O     . ARG D 1 43  ? 6.557   25.379  -101.603 1.00 26.53 ? 21   ARG D O     1 
ATOM   7613  C CB    . ARG D 1 43  ? 8.122   26.570  -99.308  1.00 26.48 ? 21   ARG D CB    1 
ATOM   7614  C CG    . ARG D 1 43  ? 8.834   26.539  -97.966  1.00 32.70 ? 21   ARG D CG    1 
ATOM   7615  C CD    . ARG D 1 43  ? 10.115  27.353  -98.025  1.00 36.54 ? 21   ARG D CD    1 
ATOM   7616  N NE    . ARG D 1 43  ? 9.799   28.739  -98.350  1.00 40.39 ? 21   ARG D NE    1 
ATOM   7617  C CZ    . ARG D 1 43  ? 10.697  29.684  -98.609  1.00 38.14 ? 21   ARG D CZ    1 
ATOM   7618  N NH1   . ARG D 1 43  ? 12.002  29.429  -98.568  1.00 37.68 ? 21   ARG D NH1   1 
ATOM   7619  N NH2   . ARG D 1 43  ? 10.274  30.907  -98.891  1.00 37.05 ? 21   ARG D NH2   1 
ATOM   7620  N N     . SER D 1 44  ? 5.348   27.150  -100.966 1.00 27.84 ? 22   SER D N     1 
ATOM   7621  C CA    . SER D 1 44  ? 4.871   27.455  -102.318 1.00 28.88 ? 22   SER D CA    1 
ATOM   7622  C C     . SER D 1 44  ? 4.353   28.889  -102.380 1.00 31.08 ? 22   SER D C     1 
ATOM   7623  O O     . SER D 1 44  ? 4.395   29.622  -101.388 1.00 31.74 ? 22   SER D O     1 
ATOM   7624  C CB    . SER D 1 44  ? 3.785   26.467  -102.753 1.00 28.62 ? 22   SER D CB    1 
ATOM   7625  O OG    . SER D 1 44  ? 2.512   26.780  -102.194 1.00 25.95 ? 22   SER D OG    1 
ATOM   7626  N N     . SER D 1 45  ? 3.868   29.283  -103.548 1.00 33.07 ? 23   SER D N     1 
ATOM   7627  C CA    . SER D 1 45  ? 3.315   30.617  -103.750 1.00 34.36 ? 23   SER D CA    1 
ATOM   7628  C C     . SER D 1 45  ? 1.791   30.578  -103.821 1.00 35.14 ? 23   SER D C     1 
ATOM   7629  O O     . SER D 1 45  ? 1.156   31.557  -104.189 1.00 36.07 ? 23   SER D O     1 
ATOM   7630  C CB    . SER D 1 45  ? 3.898   31.213  -105.028 1.00 34.54 ? 23   SER D CB    1 
ATOM   7631  O OG    . SER D 1 45  ? 5.282   30.907  -105.109 1.00 34.63 ? 23   SER D OG    1 
ATOM   7632  N N     . LEU D 1 46  ? 1.210   29.453  -103.428 1.00 36.19 ? 24   LEU D N     1 
ATOM   7633  C CA    . LEU D 1 46  ? -0.229  29.260  -103.515 1.00 37.36 ? 24   LEU D CA    1 
ATOM   7634  C C     . LEU D 1 46  ? -0.902  29.621  -102.179 1.00 38.04 ? 24   LEU D C     1 
ATOM   7635  O O     . LEU D 1 46  ? -0.681  28.960  -101.164 1.00 39.20 ? 24   LEU D O     1 
ATOM   7636  C CB    . LEU D 1 46  ? -0.516  27.806  -103.927 1.00 38.33 ? 24   LEU D CB    1 
ATOM   7637  C CG    . LEU D 1 46  ? 0.407   27.232  -105.027 1.00 36.80 ? 24   LEU D CG    1 
ATOM   7638  C CD1   . LEU D 1 46  ? 0.137   25.750  -105.277 1.00 35.60 ? 24   LEU D CD1   1 
ATOM   7639  C CD2   . LEU D 1 46  ? 0.290   28.027  -106.320 1.00 36.96 ? 24   LEU D CD2   1 
ATOM   7640  N N     . LYS D 1 47  ? -1.687  30.698  -102.168 1.00 38.33 ? 25   LYS D N     1 
ATOM   7641  C CA    . LYS D 1 47  ? -2.362  31.134  -100.939 1.00 37.48 ? 25   LYS D CA    1 
ATOM   7642  C C     . LYS D 1 47  ? -3.626  30.301  -100.754 1.00 35.95 ? 25   LYS D C     1 
ATOM   7643  O O     . LYS D 1 47  ? -3.773  29.592  -99.762  1.00 35.49 ? 25   LYS D O     1 
ATOM   7644  C CB    . LYS D 1 47  ? -2.697  32.637  -100.980 1.00 36.64 ? 25   LYS D CB    1 
ATOM   7645  N N     . SER D 1 48  ? -4.512  30.367  -101.744 1.00 34.23 ? 26   SER D N     1 
ATOM   7646  C CA    . SER D 1 48  ? -5.871  29.834  -101.636 1.00 32.06 ? 26   SER D CA    1 
ATOM   7647  C C     . SER D 1 48  ? -6.082  28.576  -102.456 1.00 29.66 ? 26   SER D C     1 
ATOM   7648  O O     . SER D 1 48  ? -5.480  28.392  -103.504 1.00 28.86 ? 26   SER D O     1 
ATOM   7649  C CB    . SER D 1 48  ? -6.889  30.893  -102.082 1.00 32.40 ? 26   SER D CB    1 
ATOM   7650  O OG    . SER D 1 48  ? -8.110  30.300  -102.496 1.00 32.59 ? 26   SER D OG    1 
ATOM   7651  N N     . ARG D 1 49  ? -6.987  27.735  -101.971 1.00 27.72 ? 27   ARG D N     1 
ATOM   7652  C CA    . ARG D 1 49  ? -7.313  26.458  -102.590 1.00 25.75 ? 27   ARG D CA    1 
ATOM   7653  C C     . ARG D 1 49  ? -8.067  26.603  -103.929 1.00 24.13 ? 27   ARG D C     1 
ATOM   7654  O O     . ARG D 1 49  ? -8.032  25.697  -104.752 1.00 20.98 ? 27   ARG D O     1 
ATOM   7655  C CB    . ARG D 1 49  ? -8.145  25.620  -101.603 1.00 25.43 ? 27   ARG D CB    1 
ATOM   7656  C CG    . ARG D 1 49  ? -9.655  25.819  -101.746 1.00 27.81 ? 27   ARG D CG    1 
ATOM   7657  C CD    . ARG D 1 49  ? -10.377 25.958  -100.459 1.00 28.71 ? 27   ARG D CD    1 
ATOM   7658  N NE    . ARG D 1 49  ? -10.943 24.706  -99.963  1.00 32.95 ? 27   ARG D NE    1 
ATOM   7659  C CZ    . ARG D 1 49  ? -12.244 24.454  -99.778  1.00 37.62 ? 27   ARG D CZ    1 
ATOM   7660  N NH1   . ARG D 1 49  ? -13.185 25.340  -100.090 1.00 36.56 ? 27   ARG D NH1   1 
ATOM   7661  N NH2   . ARG D 1 49  ? -12.610 23.281  -99.267  1.00 38.70 ? 27   ARG D NH2   1 
ATOM   7662  N N     . ALA D 1 50  ? -8.762  27.731  -104.120 1.00 24.34 ? 28   ALA D N     1 
ATOM   7663  C CA    . ALA D 1 50  ? -9.511  27.997  -105.352 1.00 25.21 ? 28   ALA D CA    1 
ATOM   7664  C C     . ALA D 1 50  ? -8.571  28.150  -106.560 1.00 25.66 ? 28   ALA D C     1 
ATOM   7665  O O     . ALA D 1 50  ? -8.957  27.868  -107.696 1.00 26.14 ? 28   ALA D O     1 
ATOM   7666  C CB    . ALA D 1 50  ? -10.376 29.235  -105.187 1.00 24.65 ? 28   ALA D CB    1 
ATOM   7667  N N     . GLU D 1 51  ? -7.333  28.571  -106.299 1.00 26.02 ? 29   GLU D N     1 
ATOM   7668  C CA    . GLU D 1 51  ? -6.270  28.605  -107.314 1.00 26.63 ? 29   GLU D CA    1 
ATOM   7669  C C     . GLU D 1 51  ? -6.036  27.259  -108.010 1.00 26.02 ? 29   GLU D C     1 
ATOM   7670  O O     . GLU D 1 51  ? -5.605  27.228  -109.170 1.00 28.11 ? 29   GLU D O     1 
ATOM   7671  C CB    . GLU D 1 51  ? -4.915  29.025  -106.689 1.00 27.25 ? 29   GLU D CB    1 
ATOM   7672  C CG    . GLU D 1 51  ? -4.694  30.529  -106.482 1.00 32.97 ? 29   GLU D CG    1 
ATOM   7673  C CD    . GLU D 1 51  ? -3.722  30.868  -105.331 1.00 36.88 ? 29   GLU D CD    1 
ATOM   7674  O OE1   . GLU D 1 51  ? -2.614  31.389  -105.583 1.00 43.57 ? 29   GLU D OE1   1 
ATOM   7675  O OE2   . GLU D 1 51  ? -4.076  30.638  -104.162 1.00 37.57 ? 29   GLU D OE2   1 
ATOM   7676  N N     . VAL D 1 52  ? -6.288  26.154  -107.301 1.00 23.31 ? 30   VAL D N     1 
ATOM   7677  C CA    . VAL D 1 52  ? -5.855  24.822  -107.752 1.00 20.29 ? 30   VAL D CA    1 
ATOM   7678  C C     . VAL D 1 52  ? -6.734  24.189  -108.829 1.00 19.17 ? 30   VAL D C     1 
ATOM   7679  O O     . VAL D 1 52  ? -7.947  24.089  -108.678 1.00 18.68 ? 30   VAL D O     1 
ATOM   7680  C CB    . VAL D 1 52  ? -5.707  23.847  -106.548 1.00 19.31 ? 30   VAL D CB    1 
ATOM   7681  C CG1   . VAL D 1 52  ? -5.588  22.390  -106.997 1.00 17.71 ? 30   VAL D CG1   1 
ATOM   7682  C CG2   . VAL D 1 52  ? -4.496  24.241  -105.727 1.00 18.84 ? 30   VAL D CG2   1 
ATOM   7683  N N     . ASP D 1 53  ? -6.097  23.724  -109.897 1.00 18.67 ? 31   ASP D N     1 
ATOM   7684  C CA    . ASP D 1 53  ? -6.780  23.040  -111.002 1.00 19.72 ? 31   ASP D CA    1 
ATOM   7685  C C     . ASP D 1 53  ? -6.733  21.532  -110.781 1.00 19.00 ? 31   ASP D C     1 
ATOM   7686  O O     . ASP D 1 53  ? -5.661  20.920  -110.823 1.00 16.95 ? 31   ASP D O     1 
ATOM   7687  C CB    . ASP D 1 53  ? -6.097  23.394  -112.331 1.00 20.79 ? 31   ASP D CB    1 
ATOM   7688  C CG    . ASP D 1 53  ? -6.739  22.725  -113.536 1.00 25.44 ? 31   ASP D CG    1 
ATOM   7689  O OD1   . ASP D 1 53  ? -7.168  21.567  -113.438 1.00 33.17 ? 31   ASP D OD1   1 
ATOM   7690  O OD2   . ASP D 1 53  ? -6.790  23.356  -114.609 1.00 30.71 ? 31   ASP D OD2   1 
ATOM   7691  N N     . LEU D 1 54  ? -7.900  20.934  -110.567 1.00 18.75 ? 32   LEU D N     1 
ATOM   7692  C CA    . LEU D 1 54  ? -7.997  19.499  -110.336 1.00 19.17 ? 32   LEU D CA    1 
ATOM   7693  C C     . LEU D 1 54  ? -8.129  18.670  -111.618 1.00 20.54 ? 32   LEU D C     1 
ATOM   7694  O O     . LEU D 1 54  ? -7.889  17.461  -111.616 1.00 20.22 ? 32   LEU D O     1 
ATOM   7695  C CB    . LEU D 1 54  ? -9.169  19.218  -109.403 1.00 20.44 ? 32   LEU D CB    1 
ATOM   7696  C CG    . LEU D 1 54  ? -8.955  19.684  -107.969 1.00 16.45 ? 32   LEU D CG    1 
ATOM   7697  C CD1   . LEU D 1 54  ? -10.158 19.293  -107.142 1.00 20.61 ? 32   LEU D CD1   1 
ATOM   7698  C CD2   . LEU D 1 54  ? -7.674  19.066  -107.431 1.00 13.65 ? 32   LEU D CD2   1 
ATOM   7699  N N     . GLU D 1 55  ? -8.532  19.320  -112.702 1.00 22.71 ? 33   GLU D N     1 
ATOM   7700  C CA    . GLU D 1 55  ? -8.592  18.674  -113.997 1.00 23.87 ? 33   GLU D CA    1 
ATOM   7701  C C     . GLU D 1 55  ? -7.223  18.115  -114.389 1.00 23.35 ? 33   GLU D C     1 
ATOM   7702  O O     . GLU D 1 55  ? -6.175  18.707  -114.117 1.00 22.83 ? 33   GLU D O     1 
ATOM   7703  C CB    . GLU D 1 55  ? -9.139  19.615  -115.073 1.00 24.05 ? 33   GLU D CB    1 
ATOM   7704  C CG    . GLU D 1 55  ? -10.644 19.467  -115.325 1.00 30.23 ? 33   GLU D CG    1 
ATOM   7705  N N     . ARG D 1 56  ? -7.263  16.940  -114.999 1.00 23.82 ? 34   ARG D N     1 
ATOM   7706  C CA    . ARG D 1 56  ? -6.087  16.254  -115.473 1.00 24.35 ? 34   ARG D CA    1 
ATOM   7707  C C     . ARG D 1 56  ? -6.326  15.781  -116.904 1.00 23.56 ? 34   ARG D C     1 
ATOM   7708  O O     . ARG D 1 56  ? -7.446  15.393  -117.245 1.00 22.79 ? 34   ARG D O     1 
ATOM   7709  C CB    . ARG D 1 56  ? -5.855  15.059  -114.584 1.00 25.41 ? 34   ARG D CB    1 
ATOM   7710  C CG    . ARG D 1 56  ? -4.524  14.432  -114.760 1.00 33.24 ? 34   ARG D CG    1 
ATOM   7711  C CD    . ARG D 1 56  ? -3.464  15.146  -113.968 1.00 43.64 ? 34   ARG D CD    1 
ATOM   7712  N NE    . ARG D 1 56  ? -2.358  14.234  -113.697 1.00 51.28 ? 34   ARG D NE    1 
ATOM   7713  C CZ    . ARG D 1 56  ? -1.471  13.832  -114.602 1.00 56.39 ? 34   ARG D CZ    1 
ATOM   7714  N NH1   . ARG D 1 56  ? -1.532  14.256  -115.870 1.00 57.01 ? 34   ARG D NH1   1 
ATOM   7715  N NH2   . ARG D 1 56  ? -0.512  12.988  -114.232 1.00 58.90 ? 34   ARG D NH2   1 
ATOM   7716  N N     . THR D 1 57  ? -5.276  15.814  -117.730 1.00 23.11 ? 35   THR D N     1 
ATOM   7717  C CA    . THR D 1 57  ? -5.349  15.345  -119.118 1.00 23.16 ? 35   THR D CA    1 
ATOM   7718  C C     . THR D 1 57  ? -4.460  14.123  -119.286 1.00 22.63 ? 35   THR D C     1 
ATOM   7719  O O     . THR D 1 57  ? -3.250  14.195  -119.053 1.00 22.07 ? 35   THR D O     1 
ATOM   7720  C CB    . THR D 1 57  ? -4.946  16.457  -120.138 1.00 23.59 ? 35   THR D CB    1 
ATOM   7721  O OG1   . THR D 1 57  ? -6.041  17.370  -120.312 1.00 22.75 ? 35   THR D OG1   1 
ATOM   7722  C CG2   . THR D 1 57  ? -4.585  15.873  -121.511 1.00 23.25 ? 35   THR D CG2   1 
ATOM   7723  N N     . PHE D 1 58  ? -5.071  13.008  -119.680 1.00 22.35 ? 36   PHE D N     1 
ATOM   7724  C CA    . PHE D 1 58  ? -4.354  11.754  -119.890 1.00 22.01 ? 36   PHE D CA    1 
ATOM   7725  C C     . PHE D 1 58  ? -4.464  11.320  -121.339 1.00 21.65 ? 36   PHE D C     1 
ATOM   7726  O O     . PHE D 1 58  ? -5.530  11.432  -121.939 1.00 20.32 ? 36   PHE D O     1 
ATOM   7727  C CB    . PHE D 1 58  ? -4.934  10.646  -119.026 1.00 21.19 ? 36   PHE D CB    1 
ATOM   7728  C CG    . PHE D 1 58  ? -4.757  10.861  -117.553 1.00 21.41 ? 36   PHE D CG    1 
ATOM   7729  C CD1   . PHE D 1 58  ? -3.491  11.029  -117.010 1.00 21.69 ? 36   PHE D CD1   1 
ATOM   7730  C CD2   . PHE D 1 58  ? -5.863  10.866  -116.695 1.00 24.16 ? 36   PHE D CD2   1 
ATOM   7731  C CE1   . PHE D 1 58  ? -3.321  11.216  -115.649 1.00 19.57 ? 36   PHE D CE1   1 
ATOM   7732  C CE2   . PHE D 1 58  ? -5.702  11.046  -115.323 1.00 22.59 ? 36   PHE D CE2   1 
ATOM   7733  C CZ    . PHE D 1 58  ? -4.422  11.209  -114.802 1.00 22.39 ? 36   PHE D CZ    1 
ATOM   7734  N N     . THR D 1 59  ? -3.352  10.832  -121.893 1.00 22.23 ? 37   THR D N     1 
ATOM   7735  C CA    . THR D 1 59  ? -3.355  10.120  -123.167 1.00 23.29 ? 37   THR D CA    1 
ATOM   7736  C C     . THR D 1 59  ? -2.993  8.664   -122.874 1.00 23.58 ? 37   THR D C     1 
ATOM   7737  O O     . THR D 1 59  ? -1.870  8.352   -122.460 1.00 25.02 ? 37   THR D O     1 
ATOM   7738  C CB    . THR D 1 59  ? -2.352  10.702  -124.215 1.00 23.74 ? 37   THR D CB    1 
ATOM   7739  O OG1   . THR D 1 59  ? -2.466  12.128  -124.299 1.00 25.12 ? 37   THR D OG1   1 
ATOM   7740  C CG2   . THR D 1 59  ? -2.632  10.121  -125.590 1.00 24.47 ? 37   THR D CG2   1 
ATOM   7741  N N     . PHE D 1 60  ? -3.950  7.774   -123.099 1.00 22.18 ? 38   PHE D N     1 
ATOM   7742  C CA    . PHE D 1 60  ? -3.809  6.372   -122.722 1.00 20.86 ? 38   PHE D CA    1 
ATOM   7743  C C     . PHE D 1 60  ? -2.924  5.574   -123.685 1.00 20.56 ? 38   PHE D C     1 
ATOM   7744  O O     . PHE D 1 60  ? -2.850  5.883   -124.874 1.00 20.59 ? 38   PHE D O     1 
ATOM   7745  C CB    . PHE D 1 60  ? -5.205  5.765   -122.596 1.00 21.00 ? 38   PHE D CB    1 
ATOM   7746  C CG    . PHE D 1 60  ? -6.108  6.537   -121.659 1.00 18.17 ? 38   PHE D CG    1 
ATOM   7747  C CD1   . PHE D 1 60  ? -5.842  6.572   -120.293 1.00 20.00 ? 38   PHE D CD1   1 
ATOM   7748  C CD2   . PHE D 1 60  ? -7.194  7.243   -122.143 1.00 17.95 ? 38   PHE D CD2   1 
ATOM   7749  C CE1   . PHE D 1 60  ? -6.645  7.274   -119.430 1.00 15.89 ? 38   PHE D CE1   1 
ATOM   7750  C CE2   . PHE D 1 60  ? -8.004  7.955   -121.283 1.00 15.23 ? 38   PHE D CE2   1 
ATOM   7751  C CZ    . PHE D 1 60  ? -7.727  7.968   -119.921 1.00 15.45 ? 38   PHE D CZ    1 
ATOM   7752  N N     . ARG D 1 61  ? -2.257  4.551   -123.156 1.00 20.36 ? 39   ARG D N     1 
ATOM   7753  C CA    . ARG D 1 61  ? -1.140  3.900   -123.840 1.00 20.05 ? 39   ARG D CA    1 
ATOM   7754  C C     . ARG D 1 61  ? -1.601  3.049   -124.993 1.00 19.40 ? 39   ARG D C     1 
ATOM   7755  O O     . ARG D 1 61  ? -1.018  3.091   -126.077 1.00 20.88 ? 39   ARG D O     1 
ATOM   7756  C CB    . ARG D 1 61  ? -0.371  3.032   -122.855 1.00 20.81 ? 39   ARG D CB    1 
ATOM   7757  C CG    . ARG D 1 61  ? 0.911   2.373   -123.401 1.00 20.90 ? 39   ARG D CG    1 
ATOM   7758  C CD    . ARG D 1 61  ? 1.373   1.327   -122.399 1.00 21.24 ? 39   ARG D CD    1 
ATOM   7759  N NE    . ARG D 1 61  ? 2.586   0.636   -122.809 1.00 23.21 ? 39   ARG D NE    1 
ATOM   7760  C CZ    . ARG D 1 61  ? 2.616   -0.554  -123.405 1.00 23.82 ? 39   ARG D CZ    1 
ATOM   7761  N NH1   . ARG D 1 61  ? 1.495   -1.207  -123.686 1.00 23.23 ? 39   ARG D NH1   1 
ATOM   7762  N NH2   . ARG D 1 61  ? 3.785   -1.093  -123.732 1.00 20.93 ? 39   ARG D NH2   1 
ATOM   7763  N N     . ASN D 1 62  ? -2.645  2.263   -124.759 1.00 18.63 ? 40   ASN D N     1 
ATOM   7764  C CA    . ASN D 1 62  ? -3.082  1.265   -125.739 1.00 17.23 ? 40   ASN D CA    1 
ATOM   7765  C C     . ASN D 1 62  ? -4.226  1.777   -126.599 1.00 16.43 ? 40   ASN D C     1 
ATOM   7766  O O     . ASN D 1 62  ? -4.195  1.609   -127.805 1.00 16.92 ? 40   ASN D O     1 
ATOM   7767  C CB    . ASN D 1 62  ? -3.433  -0.059  -125.048 1.00 16.36 ? 40   ASN D CB    1 
ATOM   7768  C CG    . ASN D 1 62  ? -2.254  -0.634  -124.328 1.00 16.21 ? 40   ASN D CG    1 
ATOM   7769  O OD1   . ASN D 1 62  ? -1.143  -0.607  -124.859 1.00 14.94 ? 40   ASN D OD1   1 
ATOM   7770  N ND2   . ASN D 1 62  ? -2.459  -1.128  -123.111 1.00 15.27 ? 40   ASN D ND2   1 
ATOM   7771  N N     . SER D 1 63  ? -5.211  2.426   -125.984 1.00 16.41 ? 41   SER D N     1 
ATOM   7772  C CA    . SER D 1 63  ? -6.339  2.976   -126.730 1.00 16.65 ? 41   SER D CA    1 
ATOM   7773  C C     . SER D 1 63  ? -5.903  4.196   -127.558 1.00 17.25 ? 41   SER D C     1 
ATOM   7774  O O     . SER D 1 63  ? -6.510  4.530   -128.577 1.00 17.69 ? 41   SER D O     1 
ATOM   7775  C CB    . SER D 1 63  ? -7.483  3.363   -125.784 1.00 15.65 ? 41   SER D CB    1 
ATOM   7776  O OG    . SER D 1 63  ? -7.247  4.627   -125.191 1.00 13.63 ? 41   SER D OG    1 
ATOM   7777  N N     . LYS D 1 64  ? -4.850  4.862   -127.089 1.00 19.11 ? 42   LYS D N     1 
ATOM   7778  C CA    . LYS D 1 64  ? -4.345  6.124   -127.665 1.00 19.31 ? 42   LYS D CA    1 
ATOM   7779  C C     . LYS D 1 64  ? -5.336  7.284   -127.540 1.00 19.24 ? 42   LYS D C     1 
ATOM   7780  O O     . LYS D 1 64  ? -5.126  8.329   -128.135 1.00 20.20 ? 42   LYS D O     1 
ATOM   7781  C CB    . LYS D 1 64  ? -3.915  5.957   -129.125 1.00 19.72 ? 42   LYS D CB    1 
ATOM   7782  C CG    . LYS D 1 64  ? -3.068  4.715   -129.452 1.00 24.64 ? 42   LYS D CG    1 
ATOM   7783  C CD    . LYS D 1 64  ? -1.716  4.712   -128.744 1.00 28.81 ? 42   LYS D CD    1 
ATOM   7784  C CE    . LYS D 1 64  ? -0.926  3.426   -129.049 1.00 31.40 ? 42   LYS D CE    1 
ATOM   7785  N N     . GLN D 1 65  ? -6.395  7.110   -126.747 1.00 19.92 ? 43   GLN D N     1 
ATOM   7786  C CA    . GLN D 1 65  ? -7.399  8.151   -126.537 1.00 19.81 ? 43   GLN D CA    1 
ATOM   7787  C C     . GLN D 1 65  ? -6.862  9.181   -125.567 1.00 19.83 ? 43   GLN D C     1 
ATOM   7788  O O     . GLN D 1 65  ? -5.868  8.932   -124.887 1.00 19.76 ? 43   GLN D O     1 
ATOM   7789  C CB    . GLN D 1 65  ? -8.692  7.552   -125.986 1.00 19.56 ? 43   GLN D CB    1 
ATOM   7790  C CG    . GLN D 1 65  ? -9.325  6.516   -126.892 1.00 23.53 ? 43   GLN D CG    1 
ATOM   7791  C CD    . GLN D 1 65  ? -9.654  7.062   -128.274 1.00 25.65 ? 43   GLN D CD    1 
ATOM   7792  O OE1   . GLN D 1 65  ? -9.095  6.614   -129.269 1.00 23.11 ? 43   GLN D OE1   1 
ATOM   7793  N NE2   . GLN D 1 65  ? -10.556 8.031   -128.335 1.00 22.10 ? 43   GLN D NE2   1 
ATOM   7794  N N     . THR D 1 66  ? -7.508  10.343  -125.532 1.00 19.51 ? 44   THR D N     1 
ATOM   7795  C CA    . THR D 1 66  ? -7.185  11.373  -124.569 1.00 19.10 ? 44   THR D CA    1 
ATOM   7796  C C     . THR D 1 66  ? -8.420  11.650  -123.720 1.00 19.23 ? 44   THR D C     1 
ATOM   7797  O O     . THR D 1 66  ? -9.546  11.683  -124.228 1.00 16.71 ? 44   THR D O     1 
ATOM   7798  C CB    . THR D 1 66  ? -6.654  12.640  -125.246 1.00 19.80 ? 44   THR D CB    1 
ATOM   7799  O OG1   . THR D 1 66  ? -5.335  12.375  -125.738 1.00 23.04 ? 44   THR D OG1   1 
ATOM   7800  C CG2   . THR D 1 66  ? -6.580  13.821  -124.267 1.00 20.25 ? 44   THR D CG2   1 
ATOM   7801  N N     . TYR D 1 67  ? -8.183  11.812  -122.419 1.00 20.62 ? 45   TYR D N     1 
ATOM   7802  C CA    . TYR D 1 67  ? -9.218  12.116  -121.436 1.00 20.18 ? 45   TYR D CA    1 
ATOM   7803  C C     . TYR D 1 67  ? -8.870  13.430  -120.773 1.00 20.30 ? 45   TYR D C     1 
ATOM   7804  O O     . TYR D 1 67  ? -7.693  13.723  -120.548 1.00 20.63 ? 45   TYR D O     1 
ATOM   7805  C CB    . TYR D 1 67  ? -9.281  11.012  -120.388 1.00 20.52 ? 45   TYR D CB    1 
ATOM   7806  C CG    . TYR D 1 67  ? -9.846  11.395  -119.034 1.00 20.66 ? 45   TYR D CG    1 
ATOM   7807  C CD1   . TYR D 1 67  ? -11.216 11.268  -118.756 1.00 20.59 ? 45   TYR D CD1   1 
ATOM   7808  C CD2   . TYR D 1 67  ? -9.001  11.854  -118.014 1.00 22.20 ? 45   TYR D CD2   1 
ATOM   7809  C CE1   . TYR D 1 67  ? -11.739 11.613  -117.495 1.00 21.42 ? 45   TYR D CE1   1 
ATOM   7810  C CE2   . TYR D 1 67  ? -9.503  12.207  -116.743 1.00 22.26 ? 45   TYR D CE2   1 
ATOM   7811  C CZ    . TYR D 1 67  ? -10.874 12.081  -116.488 1.00 24.66 ? 45   TYR D CZ    1 
ATOM   7812  O OH    . TYR D 1 67  ? -11.359 12.412  -115.238 1.00 20.20 ? 45   TYR D OH    1 
ATOM   7813  N N     . SER D 1 68  ? -9.895  14.219  -120.467 1.00 18.99 ? 46   SER D N     1 
ATOM   7814  C CA    . SER D 1 68  ? -9.735  15.361  -119.586 1.00 19.54 ? 46   SER D CA    1 
ATOM   7815  C C     . SER D 1 68  ? -10.860 15.434  -118.563 1.00 18.26 ? 46   SER D C     1 
ATOM   7816  O O     . SER D 1 68  ? -12.032 15.329  -118.901 1.00 17.08 ? 46   SER D O     1 
ATOM   7817  C CB    . SER D 1 68  ? -9.655  16.658  -120.392 1.00 21.13 ? 46   SER D CB    1 
ATOM   7818  O OG    . SER D 1 68  ? -8.432  16.719  -121.117 1.00 24.82 ? 46   SER D OG    1 
ATOM   7819  N N     . GLY D 1 69  ? -10.492 15.589  -117.301 1.00 17.50 ? 47   GLY D N     1 
ATOM   7820  C CA    . GLY D 1 69  ? -11.474 15.729  -116.249 1.00 16.83 ? 47   GLY D CA    1 
ATOM   7821  C C     . GLY D 1 69  ? -10.833 15.651  -114.893 1.00 16.29 ? 47   GLY D C     1 
ATOM   7822  O O     . GLY D 1 69  ? -9.612  15.566  -114.780 1.00 12.86 ? 47   GLY D O     1 
ATOM   7823  N N     . ILE D 1 70  ? -11.666 15.701  -113.861 1.00 17.77 ? 48   ILE D N     1 
ATOM   7824  C CA    . ILE D 1 70  ? -11.202 15.457  -112.499 1.00 18.91 ? 48   ILE D CA    1 
ATOM   7825  C C     . ILE D 1 70  ? -11.209 13.940  -112.302 1.00 19.30 ? 48   ILE D C     1 
ATOM   7826  O O     . ILE D 1 70  ? -12.280 13.303  -112.267 1.00 20.80 ? 48   ILE D O     1 
ATOM   7827  C CB    . ILE D 1 70  ? -12.045 16.161  -111.431 1.00 18.40 ? 48   ILE D CB    1 
ATOM   7828  C CG1   . ILE D 1 70  ? -12.110 17.672  -111.732 1.00 19.65 ? 48   ILE D CG1   1 
ATOM   7829  C CG2   . ILE D 1 70  ? -11.443 15.906  -110.053 1.00 19.44 ? 48   ILE D CG2   1 
ATOM   7830  C CD1   . ILE D 1 70  ? -12.879 18.479  -110.735 1.00 15.32 ? 48   ILE D CD1   1 
ATOM   7831  N N     . PRO D 1 71  ? -10.007 13.356  -112.183 1.00 17.73 ? 49   PRO D N     1 
ATOM   7832  C CA    . PRO D 1 71  ? -9.840  11.916  -112.178 1.00 16.88 ? 49   PRO D CA    1 
ATOM   7833  C C     . PRO D 1 71  ? -10.314 11.194  -110.920 1.00 17.04 ? 49   PRO D C     1 
ATOM   7834  O O     . PRO D 1 71  ? -9.579  10.395  -110.352 1.00 17.46 ? 49   PRO D O     1 
ATOM   7835  C CB    . PRO D 1 71  ? -8.320  11.755  -112.365 1.00 18.86 ? 49   PRO D CB    1 
ATOM   7836  C CG    . PRO D 1 71  ? -7.717  12.980  -111.784 1.00 19.18 ? 49   PRO D CG    1 
ATOM   7837  C CD    . PRO D 1 71  ? -8.712  14.068  -112.062 1.00 18.12 ? 49   PRO D CD    1 
ATOM   7838  N N     . ILE D 1 72  ? -11.542 11.462  -110.503 1.00 18.70 ? 50   ILE D N     1 
ATOM   7839  C CA    . ILE D 1 72  ? -12.155 10.745  -109.388 1.00 19.12 ? 50   ILE D CA    1 
ATOM   7840  C C     . ILE D 1 72  ? -13.325 10.001  -109.985 1.00 19.15 ? 50   ILE D C     1 
ATOM   7841  O O     . ILE D 1 72  ? -14.144 10.602  -110.710 1.00 18.48 ? 50   ILE D O     1 
ATOM   7842  C CB    . ILE D 1 72  ? -12.625 11.686  -108.247 1.00 19.75 ? 50   ILE D CB    1 
ATOM   7843  C CG1   . ILE D 1 72  ? -11.419 12.268  -107.516 1.00 18.38 ? 50   ILE D CG1   1 
ATOM   7844  C CG2   . ILE D 1 72  ? -13.512 10.927  -107.247 1.00 21.99 ? 50   ILE D CG2   1 
ATOM   7845  C CD1   . ILE D 1 72  ? -11.734 13.484  -106.739 1.00 25.41 ? 50   ILE D CD1   1 
ATOM   7846  N N     . ILE D 1 73  ? -13.388 8.702   -109.684 1.00 19.18 ? 51   ILE D N     1 
ATOM   7847  C CA    . ILE D 1 73  ? -14.345 7.786   -110.302 1.00 18.05 ? 51   ILE D CA    1 
ATOM   7848  C C     . ILE D 1 73  ? -15.286 7.174   -109.270 1.00 18.03 ? 51   ILE D C     1 
ATOM   7849  O O     . ILE D 1 73  ? -14.842 6.665   -108.244 1.00 19.38 ? 51   ILE D O     1 
ATOM   7850  C CB    . ILE D 1 73  ? -13.638 6.608   -110.970 1.00 17.33 ? 51   ILE D CB    1 
ATOM   7851  C CG1   . ILE D 1 73  ? -12.703 7.096   -112.082 1.00 18.42 ? 51   ILE D CG1   1 
ATOM   7852  C CG2   . ILE D 1 73  ? -14.666 5.618   -111.511 1.00 14.58 ? 51   ILE D CG2   1 
ATOM   7853  C CD1   . ILE D 1 73  ? -11.620 6.123   -112.393 1.00 15.26 ? 51   ILE D CD1   1 
ATOM   7854  N N     . VAL D 1 74  ? -16.583 7.204   -109.567 1.00 15.53 ? 52   VAL D N     1 
ATOM   7855  C CA    . VAL D 1 74  ? -17.570 6.499   -108.754 1.00 14.16 ? 52   VAL D CA    1 
ATOM   7856  C C     . VAL D 1 74  ? -17.468 5.032   -109.110 1.00 14.66 ? 52   VAL D C     1 
ATOM   7857  O O     . VAL D 1 74  ? -17.491 4.687   -110.286 1.00 14.27 ? 52   VAL D O     1 
ATOM   7858  C CB    . VAL D 1 74  ? -19.015 6.959   -109.033 1.00 13.33 ? 52   VAL D CB    1 
ATOM   7859  C CG1   . VAL D 1 74  ? -19.985 6.182   -108.168 1.00 12.72 ? 52   VAL D CG1   1 
ATOM   7860  C CG2   . VAL D 1 74  ? -19.172 8.452   -108.790 1.00 9.33  ? 52   VAL D CG2   1 
ATOM   7861  N N     . ALA D 1 75  ? -17.338 4.174   -108.102 1.00 15.91 ? 53   ALA D N     1 
ATOM   7862  C CA    . ALA D 1 75  ? -17.118 2.756   -108.331 1.00 16.31 ? 53   ALA D CA    1 
ATOM   7863  C C     . ALA D 1 75  ? -18.342 2.166   -108.986 1.00 17.93 ? 53   ALA D C     1 
ATOM   7864  O O     . ALA D 1 75  ? -19.466 2.645   -108.750 1.00 17.18 ? 53   ALA D O     1 
ATOM   7865  C CB    . ALA D 1 75  ? -16.837 2.045   -107.009 1.00 16.48 ? 53   ALA D CB    1 
ATOM   7866  N N     . ASN D 1 76  ? -18.121 1.126   -109.799 1.00 19.10 ? 54   ASN D N     1 
ATOM   7867  C CA    . ASN D 1 76  ? -19.202 0.459   -110.535 1.00 18.19 ? 54   ASN D CA    1 
ATOM   7868  C C     . ASN D 1 76  ? -19.982 -0.512  -109.672 1.00 16.69 ? 54   ASN D C     1 
ATOM   7869  O O     . ASN D 1 76  ? -20.162 -1.670  -110.034 1.00 18.66 ? 54   ASN D O     1 
ATOM   7870  C CB    . ASN D 1 76  ? -18.660 -0.233  -111.798 1.00 19.70 ? 54   ASN D CB    1 
ATOM   7871  C CG    . ASN D 1 76  ? -17.456 -1.122  -111.521 1.00 19.82 ? 54   ASN D CG    1 
ATOM   7872  O OD1   . ASN D 1 76  ? -16.877 -1.078  -110.429 1.00 16.05 ? 54   ASN D OD1   1 
ATOM   7873  N ND2   . ASN D 1 76  ? -17.059 -1.921  -112.522 1.00 14.65 ? 54   ASN D ND2   1 
ATOM   7874  N N     . MET D 1 77  ? -20.459 -0.015  -108.539 1.00 15.88 ? 55   MET D N     1 
ATOM   7875  C CA    . MET D 1 77  ? -21.272 -0.789  -107.614 1.00 16.54 ? 55   MET D CA    1 
ATOM   7876  C C     . MET D 1 77  ? -22.739 -0.453  -107.814 1.00 16.94 ? 55   MET D C     1 
ATOM   7877  O O     . MET D 1 77  ? -23.073 0.606   -108.322 1.00 17.24 ? 55   MET D O     1 
ATOM   7878  C CB    . MET D 1 77  ? -20.863 -0.480  -106.173 1.00 16.78 ? 55   MET D CB    1 
ATOM   7879  C CG    . MET D 1 77  ? -19.371 -0.649  -105.930 1.00 17.10 ? 55   MET D CG    1 
ATOM   7880  S SD    . MET D 1 77  ? -18.856 -0.463  -104.226 1.00 19.64 ? 55   MET D SD    1 
ATOM   7881  C CE    . MET D 1 77  ? -19.835 -1.747  -103.462 1.00 24.53 ? 55   MET D CE    1 
ATOM   7882  N N     . ASP D 1 78  ? -23.613 -1.343  -107.365 1.00 19.70 ? 56   ASP D N     1 
ATOM   7883  C CA    . ASP D 1 78  ? -25.046 -1.263  -107.682 1.00 22.23 ? 56   ASP D CA    1 
ATOM   7884  C C     . ASP D 1 78  ? -25.693 0.044   -107.262 1.00 21.75 ? 56   ASP D C     1 
ATOM   7885  O O     . ASP D 1 78  ? -26.560 0.564   -107.967 1.00 23.61 ? 56   ASP D O     1 
ATOM   7886  C CB    . ASP D 1 78  ? -25.827 -2.418  -107.027 1.00 23.13 ? 56   ASP D CB    1 
ATOM   7887  C CG    . ASP D 1 78  ? -25.901 -3.651  -107.896 1.00 26.33 ? 56   ASP D CG    1 
ATOM   7888  O OD1   . ASP D 1 78  ? -26.282 -3.529  -109.071 1.00 30.98 ? 56   ASP D OD1   1 
ATOM   7889  O OD2   . ASP D 1 78  ? -25.600 -4.752  -107.402 1.00 33.25 ? 56   ASP D OD2   1 
ATOM   7890  N N     . THR D 1 79  ? -25.290 0.557   -106.105 1.00 20.74 ? 57   THR D N     1 
ATOM   7891  C CA    . THR D 1 79  ? -25.984 1.689   -105.487 1.00 21.69 ? 57   THR D CA    1 
ATOM   7892  C C     . THR D 1 79  ? -25.375 3.029   -105.897 1.00 20.23 ? 57   THR D C     1 
ATOM   7893  O O     . THR D 1 79  ? -26.101 4.025   -106.024 1.00 17.51 ? 57   THR D O     1 
ATOM   7894  C CB    . THR D 1 79  ? -25.989 1.572   -103.958 1.00 22.56 ? 57   THR D CB    1 
ATOM   7895  O OG1   . THR D 1 79  ? -24.645 1.399   -103.496 1.00 29.00 ? 57   THR D OG1   1 
ATOM   7896  C CG2   . THR D 1 79  ? -26.830 0.381   -103.511 1.00 22.36 ? 57   THR D CG2   1 
ATOM   7897  N N     . VAL D 1 80  ? -24.063 3.048   -106.128 1.00 17.94 ? 58   VAL D N     1 
ATOM   7898  C CA    . VAL D 1 80  ? -23.360 4.296   -106.428 1.00 17.65 ? 58   VAL D CA    1 
ATOM   7899  C C     . VAL D 1 80  ? -23.050 4.498   -107.917 1.00 16.30 ? 58   VAL D C     1 
ATOM   7900  O O     . VAL D 1 80  ? -23.004 5.620   -108.381 1.00 15.48 ? 58   VAL D O     1 
ATOM   7901  C CB    . VAL D 1 80  ? -22.082 4.444   -105.574 1.00 17.66 ? 58   VAL D CB    1 
ATOM   7902  C CG1   . VAL D 1 80  ? -22.445 4.462   -104.092 1.00 20.12 ? 58   VAL D CG1   1 
ATOM   7903  C CG2   . VAL D 1 80  ? -21.077 3.321   -105.859 1.00 19.00 ? 58   VAL D CG2   1 
ATOM   7904  N N     . GLY D 1 81  ? -22.853 3.420   -108.667 1.00 15.71 ? 59   GLY D N     1 
ATOM   7905  C CA    . GLY D 1 81  ? -22.508 3.532   -110.092 1.00 15.52 ? 59   GLY D CA    1 
ATOM   7906  C C     . GLY D 1 81  ? -23.744 3.617   -110.950 1.00 14.24 ? 59   GLY D C     1 
ATOM   7907  O O     . GLY D 1 81  ? -23.946 2.778   -111.820 1.00 13.56 ? 59   GLY D O     1 
ATOM   7908  N N     . THR D 1 82  ? -24.567 4.636   -110.688 1.00 14.36 ? 60   THR D N     1 
ATOM   7909  C CA    . THR D 1 82  ? -25.884 4.804   -111.326 1.00 13.88 ? 60   THR D CA    1 
ATOM   7910  C C     . THR D 1 82  ? -25.864 5.962   -112.315 1.00 14.16 ? 60   THR D C     1 
ATOM   7911  O O     . THR D 1 82  ? -24.951 6.810   -112.287 1.00 14.29 ? 60   THR D O     1 
ATOM   7912  C CB    . THR D 1 82  ? -27.037 5.041   -110.287 1.00 13.69 ? 60   THR D CB    1 
ATOM   7913  O OG1   . THR D 1 82  ? -26.734 6.152   -109.424 1.00 12.52 ? 60   THR D OG1   1 
ATOM   7914  C CG2   . THR D 1 82  ? -27.255 3.807   -109.436 1.00 12.90 ? 60   THR D CG2   1 
ATOM   7915  N N     . PHE D 1 83  ? -26.866 5.978   -113.194 1.00 12.94 ? 61   PHE D N     1 
ATOM   7916  C CA    . PHE D 1 83  ? -27.018 7.058   -114.158 1.00 13.96 ? 61   PHE D CA    1 
ATOM   7917  C C     . PHE D 1 83  ? -27.337 8.388   -113.472 1.00 15.56 ? 61   PHE D C     1 
ATOM   7918  O O     . PHE D 1 83  ? -26.892 9.443   -113.931 1.00 16.27 ? 61   PHE D O     1 
ATOM   7919  C CB    . PHE D 1 83  ? -28.098 6.716   -115.185 1.00 12.70 ? 61   PHE D CB    1 
ATOM   7920  C CG    . PHE D 1 83  ? -27.727 5.574   -116.081 1.00 12.09 ? 61   PHE D CG    1 
ATOM   7921  C CD1   . PHE D 1 83  ? -26.490 5.542   -116.718 1.00 12.35 ? 61   PHE D CD1   1 
ATOM   7922  C CD2   . PHE D 1 83  ? -28.611 4.525   -116.298 1.00 11.75 ? 61   PHE D CD2   1 
ATOM   7923  C CE1   . PHE D 1 83  ? -26.147 4.483   -117.554 1.00 11.05 ? 61   PHE D CE1   1 
ATOM   7924  C CE2   . PHE D 1 83  ? -28.269 3.463   -117.135 1.00 8.25  ? 61   PHE D CE2   1 
ATOM   7925  C CZ    . PHE D 1 83  ? -27.035 3.440   -117.751 1.00 7.43  ? 61   PHE D CZ    1 
ATOM   7926  N N     . GLU D 1 84  ? -28.093 8.333   -112.377 1.00 16.28 ? 62   GLU D N     1 
ATOM   7927  C CA    . GLU D 1 84  ? -28.445 9.545   -111.636 1.00 17.86 ? 62   GLU D CA    1 
ATOM   7928  C C     . GLU D 1 84  ? -27.196 10.141  -111.001 1.00 17.78 ? 62   GLU D C     1 
ATOM   7929  O O     . GLU D 1 84  ? -27.022 11.358  -110.958 1.00 18.34 ? 62   GLU D O     1 
ATOM   7930  C CB    . GLU D 1 84  ? -29.456 9.261   -110.517 1.00 18.41 ? 62   GLU D CB    1 
ATOM   7931  C CG    . GLU D 1 84  ? -30.888 9.011   -110.958 1.00 21.18 ? 62   GLU D CG    1 
ATOM   7932  C CD    . GLU D 1 84  ? -31.106 7.635   -111.570 1.00 28.36 ? 62   GLU D CD    1 
ATOM   7933  O OE1   . GLU D 1 84  ? -30.159 6.800   -111.583 1.00 26.34 ? 62   GLU D OE1   1 
ATOM   7934  O OE2   . GLU D 1 84  ? -32.240 7.401   -112.044 1.00 30.10 ? 62   GLU D OE2   1 
ATOM   7935  N N     . MET D 1 85  ? -26.337 9.269   -110.488 1.00 18.04 ? 63   MET D N     1 
ATOM   7936  C CA    . MET D 1 85  ? -25.068 9.697   -109.919 1.00 19.14 ? 63   MET D CA    1 
ATOM   7937  C C     . MET D 1 85  ? -24.192 10.310  -111.004 1.00 19.14 ? 63   MET D C     1 
ATOM   7938  O O     . MET D 1 85  ? -23.586 11.356  -110.782 1.00 20.32 ? 63   MET D O     1 
ATOM   7939  C CB    . MET D 1 85  ? -24.340 8.517   -109.243 1.00 19.24 ? 63   MET D CB    1 
ATOM   7940  C CG    . MET D 1 85  ? -23.433 8.926   -108.060 1.00 25.67 ? 63   MET D CG    1 
ATOM   7941  S SD    . MET D 1 85  ? -24.294 9.312   -106.488 1.00 25.01 ? 63   MET D SD    1 
ATOM   7942  C CE    . MET D 1 85  ? -23.830 7.956   -105.440 1.00 24.29 ? 63   MET D CE    1 
ATOM   7943  N N     . ALA D 1 86  ? -24.154 9.670   -112.177 1.00 18.80 ? 64   ALA D N     1 
ATOM   7944  C CA    . ALA D 1 86  ? -23.309 10.127  -113.294 1.00 17.61 ? 64   ALA D CA    1 
ATOM   7945  C C     . ALA D 1 86  ? -23.692 11.520  -113.802 1.00 16.70 ? 64   ALA D C     1 
ATOM   7946  O O     . ALA D 1 86  ? -22.825 12.306  -114.204 1.00 17.49 ? 64   ALA D O     1 
ATOM   7947  C CB    . ALA D 1 86  ? -23.340 9.104   -114.437 1.00 17.52 ? 64   ALA D CB    1 
ATOM   7948  N N     . ALA D 1 87  ? -24.986 11.817  -113.763 1.00 14.93 ? 65   ALA D N     1 
ATOM   7949  C CA    . ALA D 1 87  ? -25.492 13.101  -114.210 1.00 14.91 ? 65   ALA D CA    1 
ATOM   7950  C C     . ALA D 1 87  ? -24.948 14.239  -113.350 1.00 15.42 ? 65   ALA D C     1 
ATOM   7951  O O     . ALA D 1 87  ? -24.675 15.327  -113.845 1.00 15.87 ? 65   ALA D O     1 
ATOM   7952  C CB    . ALA D 1 87  ? -27.027 13.100  -114.185 1.00 15.12 ? 65   ALA D CB    1 
ATOM   7953  N N     . VAL D 1 88  ? -24.800 13.976  -112.057 1.00 17.20 ? 66   VAL D N     1 
ATOM   7954  C CA    . VAL D 1 88  ? -24.244 14.947  -111.125 1.00 17.12 ? 66   VAL D CA    1 
ATOM   7955  C C     . VAL D 1 88  ? -22.720 14.993  -111.219 1.00 16.41 ? 66   VAL D C     1 
ATOM   7956  O O     . VAL D 1 88  ? -22.140 16.076  -111.249 1.00 17.03 ? 66   VAL D O     1 
ATOM   7957  C CB    . VAL D 1 88  ? -24.672 14.640  -109.693 1.00 16.46 ? 66   VAL D CB    1 
ATOM   7958  C CG1   . VAL D 1 88  ? -23.987 15.588  -108.718 1.00 18.68 ? 66   VAL D CG1   1 
ATOM   7959  C CG2   . VAL D 1 88  ? -26.201 14.740  -109.577 1.00 18.78 ? 66   VAL D CG2   1 
ATOM   7960  N N     . MET D 1 89  ? -22.082 13.824  -111.276 1.00 16.82 ? 67   MET D N     1 
ATOM   7961  C CA    . MET D 1 89  ? -20.624 13.742  -111.346 1.00 17.27 ? 67   MET D CA    1 
ATOM   7962  C C     . MET D 1 89  ? -20.102 14.489  -112.545 1.00 17.52 ? 67   MET D C     1 
ATOM   7963  O O     . MET D 1 89  ? -19.135 15.226  -112.426 1.00 17.85 ? 67   MET D O     1 
ATOM   7964  C CB    . MET D 1 89  ? -20.137 12.281  -111.453 1.00 18.71 ? 67   MET D CB    1 
ATOM   7965  C CG    . MET D 1 89  ? -20.424 11.394  -110.248 1.00 19.65 ? 67   MET D CG    1 
ATOM   7966  S SD    . MET D 1 89  ? -19.666 12.003  -108.730 1.00 24.94 ? 67   MET D SD    1 
ATOM   7967  C CE    . MET D 1 89  ? -20.713 11.248  -107.490 1.00 27.35 ? 67   MET D CE    1 
ATOM   7968  N N     . SER D 1 90  ? -20.750 14.294  -113.695 1.00 19.58 ? 68   SER D N     1 
ATOM   7969  C CA    . SER D 1 90  ? -20.302 14.870  -114.963 1.00 19.68 ? 68   SER D CA    1 
ATOM   7970  C C     . SER D 1 90  ? -20.336 16.401  -114.927 1.00 20.95 ? 68   SER D C     1 
ATOM   7971  O O     . SER D 1 90  ? -19.488 17.037  -115.545 1.00 21.75 ? 68   SER D O     1 
ATOM   7972  C CB    . SER D 1 90  ? -21.119 14.308  -116.134 1.00 19.98 ? 68   SER D CB    1 
ATOM   7973  O OG    . SER D 1 90  ? -20.432 14.452  -117.370 1.00 20.79 ? 68   SER D OG    1 
ATOM   7974  N N     . GLN D 1 91  ? -21.290 16.985  -114.192 1.00 21.48 ? 69   GLN D N     1 
ATOM   7975  C CA    . GLN D 1 91  ? -21.331 18.447  -113.966 1.00 21.58 ? 69   GLN D CA    1 
ATOM   7976  C C     . GLN D 1 91  ? -20.057 18.977  -113.313 1.00 21.45 ? 69   GLN D C     1 
ATOM   7977  O O     . GLN D 1 91  ? -19.653 20.105  -113.584 1.00 21.86 ? 69   GLN D O     1 
ATOM   7978  C CB    . GLN D 1 91  ? -22.554 18.836  -113.132 1.00 22.95 ? 69   GLN D CB    1 
ATOM   7979  C CG    . GLN D 1 91  ? -23.841 18.885  -113.958 1.00 25.86 ? 69   GLN D CG    1 
ATOM   7980  C CD    . GLN D 1 91  ? -25.102 18.805  -113.123 1.00 31.10 ? 69   GLN D CD    1 
ATOM   7981  O OE1   . GLN D 1 91  ? -25.062 18.583  -111.916 1.00 34.18 ? 69   GLN D OE1   1 
ATOM   7982  N NE2   . GLN D 1 91  ? -26.236 18.979  -113.774 1.00 34.25 ? 69   GLN D NE2   1 
ATOM   7983  N N     . HIS D 1 92  ? -19.424 18.150  -112.476 1.00 19.85 ? 70   HIS D N     1 
ATOM   7984  C CA    . HIS D 1 92  ? -18.148 18.498  -111.838 1.00 18.99 ? 70   HIS D CA    1 
ATOM   7985  C C     . HIS D 1 92  ? -16.922 17.953  -112.594 1.00 19.52 ? 70   HIS D C     1 
ATOM   7986  O O     . HIS D 1 92  ? -15.827 17.909  -112.043 1.00 20.26 ? 70   HIS D O     1 
ATOM   7987  C CB    . HIS D 1 92  ? -18.140 18.004  -110.397 1.00 18.25 ? 70   HIS D CB    1 
ATOM   7988  C CG    . HIS D 1 92  ? -19.188 18.632  -109.537 1.00 19.00 ? 70   HIS D CG    1 
ATOM   7989  N ND1   . HIS D 1 92  ? -18.921 19.684  -108.687 1.00 22.46 ? 70   HIS D ND1   1 
ATOM   7990  C CD2   . HIS D 1 92  ? -20.502 18.349  -109.382 1.00 20.22 ? 70   HIS D CD2   1 
ATOM   7991  C CE1   . HIS D 1 92  ? -20.026 20.022  -108.045 1.00 22.01 ? 70   HIS D CE1   1 
ATOM   7992  N NE2   . HIS D 1 92  ? -20.999 19.226  -108.448 1.00 20.80 ? 70   HIS D NE2   1 
ATOM   7993  N N     . SER D 1 93  ? -17.117 17.560  -113.855 1.00 20.20 ? 71   SER D N     1 
ATOM   7994  C CA    . SER D 1 93  ? -16.081 16.925  -114.692 1.00 21.36 ? 71   SER D CA    1 
ATOM   7995  C C     . SER D 1 93  ? -15.524 15.649  -114.090 1.00 20.75 ? 71   SER D C     1 
ATOM   7996  O O     . SER D 1 93  ? -14.381 15.277  -114.368 1.00 20.25 ? 71   SER D O     1 
ATOM   7997  C CB    . SER D 1 93  ? -14.941 17.893  -114.996 1.00 21.42 ? 71   SER D CB    1 
ATOM   7998  O OG    . SER D 1 93  ? -15.435 18.985  -115.740 1.00 26.53 ? 71   SER D OG    1 
ATOM   7999  N N     . MET D 1 94  ? -16.338 14.972  -113.281 1.00 20.78 ? 72   MET D N     1 
ATOM   8000  C CA    . MET D 1 94  ? -15.924 13.736  -112.630 1.00 21.45 ? 72   MET D CA    1 
ATOM   8001  C C     . MET D 1 94  ? -16.561 12.538  -113.314 1.00 21.27 ? 72   MET D C     1 
ATOM   8002  O O     . MET D 1 94  ? -17.563 12.667  -114.027 1.00 21.53 ? 72   MET D O     1 
ATOM   8003  C CB    . MET D 1 94  ? -16.264 13.760  -111.147 1.00 21.56 ? 72   MET D CB    1 
ATOM   8004  C CG    . MET D 1 94  ? -15.413 14.739  -110.349 1.00 21.45 ? 72   MET D CG    1 
ATOM   8005  S SD    . MET D 1 94  ? -16.135 15.060  -108.729 1.00 23.13 ? 72   MET D SD    1 
ATOM   8006  C CE    . MET D 1 94  ? -15.889 13.491  -107.900 1.00 23.28 ? 72   MET D CE    1 
ATOM   8007  N N     . PHE D 1 95  ? -15.966 11.369  -113.059 1.00 19.87 ? 73   PHE D N     1 
ATOM   8008  C CA    . PHE D 1 95  ? -16.213 10.155  -113.835 1.00 18.53 ? 73   PHE D CA    1 
ATOM   8009  C C     . PHE D 1 95  ? -17.069 9.172   -113.063 1.00 17.27 ? 73   PHE D C     1 
ATOM   8010  O O     . PHE D 1 95  ? -16.971 9.090   -111.847 1.00 18.24 ? 73   PHE D O     1 
ATOM   8011  C CB    . PHE D 1 95  ? -14.865 9.523   -114.188 1.00 18.50 ? 73   PHE D CB    1 
ATOM   8012  C CG    . PHE D 1 95  ? -14.916 8.563   -115.344 1.00 21.34 ? 73   PHE D CG    1 
ATOM   8013  C CD1   . PHE D 1 95  ? -14.714 9.014   -116.653 1.00 14.64 ? 73   PHE D CD1   1 
ATOM   8014  C CD2   . PHE D 1 95  ? -15.143 7.195   -115.122 1.00 23.30 ? 73   PHE D CD2   1 
ATOM   8015  C CE1   . PHE D 1 95  ? -14.742 8.129   -117.714 1.00 19.75 ? 73   PHE D CE1   1 
ATOM   8016  C CE2   . PHE D 1 95  ? -15.179 6.306   -116.175 1.00 19.93 ? 73   PHE D CE2   1 
ATOM   8017  C CZ    . PHE D 1 95  ? -14.977 6.767   -117.478 1.00 19.92 ? 73   PHE D CZ    1 
ATOM   8018  N N     . THR D 1 96  ? -17.904 8.422   -113.775 1.00 16.38 ? 74   THR D N     1 
ATOM   8019  C CA    . THR D 1 96  ? -18.746 7.385   -113.164 1.00 15.79 ? 74   THR D CA    1 
ATOM   8020  C C     . THR D 1 96  ? -18.524 6.075   -113.901 1.00 15.77 ? 74   THR D C     1 
ATOM   8021  O O     . THR D 1 96  ? -18.649 6.031   -115.112 1.00 15.37 ? 74   THR D O     1 
ATOM   8022  C CB    . THR D 1 96  ? -20.266 7.733   -113.233 1.00 15.53 ? 74   THR D CB    1 
ATOM   8023  O OG1   . THR D 1 96  ? -20.500 9.063   -112.745 1.00 18.81 ? 74   THR D OG1   1 
ATOM   8024  C CG2   . THR D 1 96  ? -21.084 6.771   -112.409 1.00 12.73 ? 74   THR D CG2   1 
ATOM   8025  N N     . ALA D 1 97  ? -18.170 5.023   -113.169 1.00 15.81 ? 75   ALA D N     1 
ATOM   8026  C CA    . ALA D 1 97  ? -18.161 3.674   -113.723 1.00 15.36 ? 75   ALA D CA    1 
ATOM   8027  C C     . ALA D 1 97  ? -19.517 3.084   -113.427 1.00 16.33 ? 75   ALA D C     1 
ATOM   8028  O O     . ALA D 1 97  ? -19.907 2.904   -112.272 1.00 14.99 ? 75   ALA D O     1 
ATOM   8029  C CB    . ALA D 1 97  ? -17.060 2.834   -113.133 1.00 14.60 ? 75   ALA D CB    1 
ATOM   8030  N N     . ILE D 1 98  ? -20.264 2.829   -114.489 1.00 17.36 ? 76   ILE D N     1 
ATOM   8031  C CA    . ILE D 1 98  ? -21.653 2.398   -114.356 1.00 15.84 ? 76   ILE D CA    1 
ATOM   8032  C C     . ILE D 1 98  ? -21.713 0.894   -114.089 1.00 16.53 ? 76   ILE D C     1 
ATOM   8033  O O     . ILE D 1 98  ? -21.063 0.110   -114.766 1.00 16.12 ? 76   ILE D O     1 
ATOM   8034  C CB    . ILE D 1 98  ? -22.456 2.757   -115.621 1.00 15.81 ? 76   ILE D CB    1 
ATOM   8035  C CG1   . ILE D 1 98  ? -22.500 4.279   -115.811 1.00 16.00 ? 76   ILE D CG1   1 
ATOM   8036  C CG2   . ILE D 1 98  ? -23.833 2.202   -115.543 1.00 13.92 ? 76   ILE D CG2   1 
ATOM   8037  C CD1   . ILE D 1 98  ? -23.088 5.046   -114.639 1.00 14.71 ? 76   ILE D CD1   1 
ATOM   8038  N N     . HIS D 1 99  ? -22.509 0.494   -113.106 1.00 17.64 ? 77   HIS D N     1 
ATOM   8039  C CA    . HIS D 1 99  ? -22.617 -0.919  -112.785 1.00 17.32 ? 77   HIS D CA    1 
ATOM   8040  C C     . HIS D 1 99  ? -23.143 -1.709  -113.981 1.00 17.83 ? 77   HIS D C     1 
ATOM   8041  O O     . HIS D 1 99  ? -23.845 -1.188  -114.844 1.00 17.79 ? 77   HIS D O     1 
ATOM   8042  C CB    . HIS D 1 99  ? -23.442 -1.186  -111.514 1.00 17.17 ? 77   HIS D CB    1 
ATOM   8043  C CG    . HIS D 1 99  ? -24.909 -0.888  -111.627 1.00 14.46 ? 77   HIS D CG    1 
ATOM   8044  N ND1   . HIS D 1 99  ? -25.823 -1.812  -112.082 1.00 22.29 ? 77   HIS D ND1   1 
ATOM   8045  C CD2   . HIS D 1 99  ? -25.629 0.198   -111.262 1.00 13.24 ? 77   HIS D CD2   1 
ATOM   8046  C CE1   . HIS D 1 99  ? -27.038 -1.293  -112.034 1.00 17.44 ? 77   HIS D CE1   1 
ATOM   8047  N NE2   . HIS D 1 99  ? -26.948 -0.075  -111.536 1.00 11.92 ? 77   HIS D NE2   1 
ATOM   8048  N N     . LYS D 1 100 ? -22.784 -2.983  -114.025 1.00 18.94 ? 78   LYS D N     1 
ATOM   8049  C CA    . LYS D 1 100 ? -23.013 -3.790  -115.221 1.00 18.33 ? 78   LYS D CA    1 
ATOM   8050  C C     . LYS D 1 100 ? -24.433 -4.347  -115.358 1.00 16.70 ? 78   LYS D C     1 
ATOM   8051  O O     . LYS D 1 100 ? -24.690 -5.125  -116.272 1.00 17.06 ? 78   LYS D O     1 
ATOM   8052  C CB    . LYS D 1 100 ? -21.979 -4.925  -115.289 1.00 18.54 ? 78   LYS D CB    1 
ATOM   8053  C CG    . LYS D 1 100 ? -22.164 -6.029  -114.264 1.00 20.90 ? 78   LYS D CG    1 
ATOM   8054  C CD    . LYS D 1 100 ? -21.273 -7.214  -114.584 1.00 24.38 ? 78   LYS D CD    1 
ATOM   8055  C CE    . LYS D 1 100 ? -21.612 -8.425  -113.724 1.00 24.47 ? 78   LYS D CE    1 
ATOM   8056  N NZ    . LYS D 1 100 ? -20.525 -9.439  -113.783 1.00 23.77 ? 78   LYS D NZ    1 
ATOM   8057  N N     . HIS D 1 101 ? -25.349 -3.949  -114.480 1.00 16.73 ? 79   HIS D N     1 
ATOM   8058  C CA    . HIS D 1 101 ? -26.676 -4.575  -114.416 1.00 17.71 ? 79   HIS D CA    1 
ATOM   8059  C C     . HIS D 1 101 ? -27.776 -3.752  -115.046 1.00 17.64 ? 79   HIS D C     1 
ATOM   8060  O O     . HIS D 1 101 ? -28.934 -4.160  -115.049 1.00 20.57 ? 79   HIS D O     1 
ATOM   8061  C CB    . HIS D 1 101 ? -27.014 -4.909  -112.972 1.00 18.09 ? 79   HIS D CB    1 
ATOM   8062  C CG    . HIS D 1 101 ? -26.044 -5.864  -112.359 1.00 20.52 ? 79   HIS D CG    1 
ATOM   8063  N ND1   . HIS D 1 101 ? -26.079 -7.221  -112.611 1.00 16.95 ? 79   HIS D ND1   1 
ATOM   8064  C CD2   . HIS D 1 101 ? -24.984 -5.654  -111.542 1.00 18.93 ? 79   HIS D CD2   1 
ATOM   8065  C CE1   . HIS D 1 101 ? -25.092 -7.806  -111.954 1.00 22.02 ? 79   HIS D CE1   1 
ATOM   8066  N NE2   . HIS D 1 101 ? -24.412 -6.878  -111.301 1.00 18.56 ? 79   HIS D NE2   1 
ATOM   8067  N N     . TYR D 1 102 ? -27.399 -2.603  -115.596 1.00 17.20 ? 80   TYR D N     1 
ATOM   8068  C CA    . TYR D 1 102 ? -28.291 -1.829  -116.439 1.00 15.78 ? 80   TYR D CA    1 
ATOM   8069  C C     . TYR D 1 102 ? -28.500 -2.539  -117.772 1.00 15.95 ? 80   TYR D C     1 
ATOM   8070  O O     . TYR D 1 102 ? -27.566 -3.119  -118.337 1.00 16.87 ? 80   TYR D O     1 
ATOM   8071  C CB    . TYR D 1 102 ? -27.703 -0.454  -116.701 1.00 14.98 ? 80   TYR D CB    1 
ATOM   8072  C CG    . TYR D 1 102 ? -27.890 0.526   -115.574 1.00 16.44 ? 80   TYR D CG    1 
ATOM   8073  C CD1   . TYR D 1 102 ? -29.178 0.885   -115.136 1.00 17.37 ? 80   TYR D CD1   1 
ATOM   8074  C CD2   . TYR D 1 102 ? -26.794 1.135   -114.967 1.00 13.11 ? 80   TYR D CD2   1 
ATOM   8075  C CE1   . TYR D 1 102 ? -29.361 1.820   -114.103 1.00 15.82 ? 80   TYR D CE1   1 
ATOM   8076  C CE2   . TYR D 1 102 ? -26.962 2.075   -113.938 1.00 14.70 ? 80   TYR D CE2   1 
ATOM   8077  C CZ    . TYR D 1 102 ? -28.246 2.413   -113.514 1.00 14.98 ? 80   TYR D CZ    1 
ATOM   8078  O OH    . TYR D 1 102 ? -28.424 3.324   -112.496 1.00 14.27 ? 80   TYR D OH    1 
ATOM   8079  N N     . SER D 1 103 ? -29.729 -2.474  -118.277 1.00 16.57 ? 81   SER D N     1 
ATOM   8080  C CA    . SER D 1 103 ? -30.066 -3.055  -119.563 1.00 15.40 ? 81   SER D CA    1 
ATOM   8081  C C     . SER D 1 103 ? -29.565 -2.182  -120.697 1.00 15.82 ? 81   SER D C     1 
ATOM   8082  O O     . SER D 1 103 ? -29.211 -1.013  -120.509 1.00 16.91 ? 81   SER D O     1 
ATOM   8083  C CB    . SER D 1 103 ? -31.580 -3.227  -119.684 1.00 15.58 ? 81   SER D CB    1 
ATOM   8084  O OG    . SER D 1 103 ? -32.219 -2.004  -120.014 1.00 13.57 ? 81   SER D OG    1 
ATOM   8085  N N     . LEU D 1 104 ? -29.551 -2.769  -121.886 1.00 16.54 ? 82   LEU D N     1 
ATOM   8086  C CA    . LEU D 1 104 ? -29.284 -2.040  -123.113 1.00 16.43 ? 82   LEU D CA    1 
ATOM   8087  C C     . LEU D 1 104 ? -30.223 -0.851  -123.241 1.00 15.14 ? 82   LEU D C     1 
ATOM   8088  O O     . LEU D 1 104 ? -29.767 0.248   -123.545 1.00 14.77 ? 82   LEU D O     1 
ATOM   8089  C CB    . LEU D 1 104 ? -29.444 -2.983  -124.317 1.00 16.50 ? 82   LEU D CB    1 
ATOM   8090  C CG    . LEU D 1 104 ? -29.239 -2.379  -125.710 1.00 18.10 ? 82   LEU D CG    1 
ATOM   8091  C CD1   . LEU D 1 104 ? -27.834 -1.818  -125.877 1.00 18.33 ? 82   LEU D CD1   1 
ATOM   8092  C CD2   . LEU D 1 104 ? -29.531 -3.411  -126.774 1.00 19.43 ? 82   LEU D CD2   1 
ATOM   8093  N N     . ASP D 1 105 ? -31.521 -1.081  -123.014 1.00 14.81 ? 83   ASP D N     1 
ATOM   8094  C CA    . ASP D 1 105 ? -32.545 -0.010  -123.062 1.00 14.86 ? 83   ASP D CA    1 
ATOM   8095  C C     . ASP D 1 105 ? -32.268 1.130   -122.090 1.00 14.39 ? 83   ASP D C     1 
ATOM   8096  O O     . ASP D 1 105 ? -32.449 2.297   -122.421 1.00 13.77 ? 83   ASP D O     1 
ATOM   8097  C CB    . ASP D 1 105 ? -33.940 -0.565  -122.733 1.00 15.39 ? 83   ASP D CB    1 
ATOM   8098  C CG    . ASP D 1 105 ? -34.573 -1.295  -123.888 1.00 19.31 ? 83   ASP D CG    1 
ATOM   8099  O OD1   . ASP D 1 105 ? -34.229 -1.014  -125.056 1.00 21.07 ? 83   ASP D OD1   1 
ATOM   8100  O OD2   . ASP D 1 105 ? -35.438 -2.150  -123.619 1.00 30.34 ? 83   ASP D OD2   1 
ATOM   8101  N N     . ASP D 1 106 ? -31.840 0.779   -120.886 1.00 15.57 ? 84   ASP D N     1 
ATOM   8102  C CA    . ASP D 1 106 ? -31.499 1.768   -119.876 1.00 14.72 ? 84   ASP D CA    1 
ATOM   8103  C C     . ASP D 1 106 ? -30.369 2.676   -120.360 1.00 14.85 ? 84   ASP D C     1 
ATOM   8104  O O     . ASP D 1 106 ? -30.418 3.897   -120.141 1.00 15.10 ? 84   ASP D O     1 
ATOM   8105  C CB    . ASP D 1 106 ? -31.099 1.078   -118.572 1.00 14.99 ? 84   ASP D CB    1 
ATOM   8106  C CG    . ASP D 1 106 ? -32.254 0.348   -117.915 1.00 15.52 ? 84   ASP D CG    1 
ATOM   8107  O OD1   . ASP D 1 106 ? -33.408 0.802   -118.071 1.00 19.63 ? 84   ASP D OD1   1 
ATOM   8108  O OD2   . ASP D 1 106 ? -32.005 -0.674  -117.230 1.00 15.28 ? 84   ASP D OD2   1 
ATOM   8109  N N     . TRP D 1 107 ? -29.355 2.086   -121.004 1.00 14.78 ? 85   TRP D N     1 
ATOM   8110  C CA    . TRP D 1 107 ? -28.265 2.869   -121.590 1.00 15.81 ? 85   TRP D CA    1 
ATOM   8111  C C     . TRP D 1 107 ? -28.768 3.742   -122.739 1.00 16.43 ? 85   TRP D C     1 
ATOM   8112  O O     . TRP D 1 107 ? -28.427 4.927   -122.820 1.00 17.39 ? 85   TRP D O     1 
ATOM   8113  C CB    . TRP D 1 107 ? -27.127 1.982   -122.087 1.00 15.72 ? 85   TRP D CB    1 
ATOM   8114  C CG    . TRP D 1 107 ? -26.141 1.605   -121.017 1.00 18.12 ? 85   TRP D CG    1 
ATOM   8115  C CD1   . TRP D 1 107 ? -26.183 0.499   -120.213 1.00 16.95 ? 85   TRP D CD1   1 
ATOM   8116  C CD2   . TRP D 1 107 ? -24.960 2.334   -120.636 1.00 20.92 ? 85   TRP D CD2   1 
ATOM   8117  N NE1   . TRP D 1 107 ? -25.110 0.501   -119.356 1.00 17.46 ? 85   TRP D NE1   1 
ATOM   8118  C CE2   . TRP D 1 107 ? -24.343 1.610   -119.594 1.00 18.46 ? 85   TRP D CE2   1 
ATOM   8119  C CE3   . TRP D 1 107 ? -24.374 3.531   -121.068 1.00 21.28 ? 85   TRP D CE3   1 
ATOM   8120  C CZ2   . TRP D 1 107 ? -23.159 2.040   -118.976 1.00 23.48 ? 85   TRP D CZ2   1 
ATOM   8121  C CZ3   . TRP D 1 107 ? -23.187 3.961   -120.451 1.00 21.61 ? 85   TRP D CZ3   1 
ATOM   8122  C CH2   . TRP D 1 107 ? -22.600 3.216   -119.415 1.00 21.97 ? 85   TRP D CH2   1 
ATOM   8123  N N     . LYS D 1 108 ? -29.567 3.159   -123.628 1.00 15.97 ? 86   LYS D N     1 
ATOM   8124  C CA    . LYS D 1 108 ? -30.125 3.902   -124.748 1.00 15.91 ? 86   LYS D CA    1 
ATOM   8125  C C     . LYS D 1 108 ? -30.836 5.160   -124.231 1.00 16.01 ? 86   LYS D C     1 
ATOM   8126  O O     . LYS D 1 108 ? -30.654 6.257   -124.773 1.00 17.50 ? 86   LYS D O     1 
ATOM   8127  C CB    . LYS D 1 108 ? -31.083 3.008   -125.559 1.00 15.87 ? 86   LYS D CB    1 
ATOM   8128  N N     . LEU D 1 109 ? -31.614 4.988   -123.161 1.00 15.24 ? 87   LEU D N     1 
ATOM   8129  C CA    . LEU D 1 109 ? -32.374 6.074   -122.545 1.00 14.75 ? 87   LEU D CA    1 
ATOM   8130  C C     . LEU D 1 109 ? -31.449 7.120   -121.928 1.00 14.95 ? 87   LEU D C     1 
ATOM   8131  O O     . LEU D 1 109 ? -31.703 8.324   -122.003 1.00 16.14 ? 87   LEU D O     1 
ATOM   8132  C CB    . LEU D 1 109 ? -33.305 5.504   -121.467 1.00 14.53 ? 87   LEU D CB    1 
ATOM   8133  C CG    . LEU D 1 109 ? -34.301 6.469   -120.821 1.00 14.96 ? 87   LEU D CG    1 
ATOM   8134  C CD1   . LEU D 1 109 ? -35.375 6.907   -121.818 1.00 12.90 ? 87   LEU D CD1   1 
ATOM   8135  C CD2   . LEU D 1 109 ? -34.924 5.814   -119.603 1.00 14.15 ? 87   LEU D CD2   1 
ATOM   8136  N N     . PHE D 1 110 ? -30.376 6.656   -121.312 1.00 15.49 ? 88   PHE D N     1 
ATOM   8137  C CA    . PHE D 1 110 ? -29.421 7.568   -120.714 1.00 15.86 ? 88   PHE D CA    1 
ATOM   8138  C C     . PHE D 1 110 ? -28.664 8.375   -121.779 1.00 16.59 ? 88   PHE D C     1 
ATOM   8139  O O     . PHE D 1 110 ? -28.379 9.553   -121.578 1.00 17.08 ? 88   PHE D O     1 
ATOM   8140  C CB    . PHE D 1 110 ? -28.468 6.803   -119.807 1.00 14.80 ? 88   PHE D CB    1 
ATOM   8141  C CG    . PHE D 1 110 ? -27.521 7.681   -119.050 1.00 14.15 ? 88   PHE D CG    1 
ATOM   8142  C CD1   . PHE D 1 110 ? -27.999 8.624   -118.148 1.00 14.94 ? 88   PHE D CD1   1 
ATOM   8143  C CD2   . PHE D 1 110 ? -26.149 7.565   -119.230 1.00 13.73 ? 88   PHE D CD2   1 
ATOM   8144  C CE1   . PHE D 1 110 ? -27.124 9.436   -117.425 1.00 14.14 ? 88   PHE D CE1   1 
ATOM   8145  C CE2   . PHE D 1 110 ? -25.273 8.371   -118.515 1.00 14.33 ? 88   PHE D CE2   1 
ATOM   8146  C CZ    . PHE D 1 110 ? -25.768 9.315   -117.611 1.00 13.89 ? 88   PHE D CZ    1 
ATOM   8147  N N     . ALA D 1 111 ? -28.358 7.749   -122.908 1.00 17.65 ? 89   ALA D N     1 
ATOM   8148  C CA    . ALA D 1 111 ? -27.727 8.442   -124.029 1.00 17.90 ? 89   ALA D CA    1 
ATOM   8149  C C     . ALA D 1 111 ? -28.662 9.486   -124.613 1.00 17.95 ? 89   ALA D C     1 
ATOM   8150  O O     . ALA D 1 111 ? -28.236 10.590  -124.962 1.00 18.97 ? 89   ALA D O     1 
ATOM   8151  C CB    . ALA D 1 111 ? -27.341 7.449   -125.108 1.00 18.95 ? 89   ALA D CB    1 
ATOM   8152  N N     . THR D 1 112 ? -29.937 9.119   -124.733 1.00 17.57 ? 90   THR D N     1 
ATOM   8153  C CA    . THR D 1 112 ? -30.959 10.021  -125.244 1.00 17.30 ? 90   THR D CA    1 
ATOM   8154  C C     . THR D 1 112 ? -31.050 11.262  -124.360 1.00 16.76 ? 90   THR D C     1 
ATOM   8155  O O     . THR D 1 112 ? -31.062 12.404  -124.841 1.00 16.74 ? 90   THR D O     1 
ATOM   8156  C CB    . THR D 1 112 ? -32.363 9.334   -125.261 1.00 17.80 ? 90   THR D CB    1 
ATOM   8157  O OG1   . THR D 1 112 ? -32.387 8.292   -126.245 1.00 17.20 ? 90   THR D OG1   1 
ATOM   8158  C CG2   . THR D 1 112 ? -33.477 10.334  -125.575 1.00 16.69 ? 90   THR D CG2   1 
ATOM   8159  N N     . ASN D 1 113 ? -31.113 11.013  -123.056 1.00 16.03 ? 91   ASN D N     1 
ATOM   8160  C CA    . ASN D 1 113 ? -31.411 12.046  -122.072 1.00 15.93 ? 91   ASN D CA    1 
ATOM   8161  C C     . ASN D 1 113 ? -30.197 12.780  -121.522 1.00 15.51 ? 91   ASN D C     1 
ATOM   8162  O O     . ASN D 1 113 ? -30.302 13.946  -121.159 1.00 16.09 ? 91   ASN D O     1 
ATOM   8163  C CB    . ASN D 1 113 ? -32.211 11.440  -120.913 1.00 15.97 ? 91   ASN D CB    1 
ATOM   8164  C CG    . ASN D 1 113 ? -33.642 11.123  -121.307 1.00 18.51 ? 91   ASN D CG    1 
ATOM   8165  O OD1   . ASN D 1 113 ? -33.903 10.690  -122.428 1.00 18.46 ? 91   ASN D OD1   1 
ATOM   8166  N ND2   . ASN D 1 113 ? -34.575 11.349  -120.395 1.00 25.81 ? 91   ASN D ND2   1 
ATOM   8167  N N     . HIS D 1 114 ? -29.051 12.119  -121.476 1.00 14.49 ? 92   HIS D N     1 
ATOM   8168  C CA    . HIS D 1 114 ? -27.850 12.730  -120.915 1.00 16.06 ? 92   HIS D CA    1 
ATOM   8169  C C     . HIS D 1 114 ? -26.610 12.542  -121.806 1.00 16.87 ? 92   HIS D C     1 
ATOM   8170  O O     . HIS D 1 114 ? -25.588 11.994  -121.354 1.00 15.18 ? 92   HIS D O     1 
ATOM   8171  C CB    . HIS D 1 114 ? -27.573 12.140  -119.527 1.00 17.73 ? 92   HIS D CB    1 
ATOM   8172  C CG    . HIS D 1 114 ? -28.674 12.367  -118.541 1.00 21.03 ? 92   HIS D CG    1 
ATOM   8173  N ND1   . HIS D 1 114 ? -28.640 13.386  -117.612 1.00 23.91 ? 92   HIS D ND1   1 
ATOM   8174  C CD2   . HIS D 1 114 ? -29.837 11.705  -118.337 1.00 24.43 ? 92   HIS D CD2   1 
ATOM   8175  C CE1   . HIS D 1 114 ? -29.738 13.342  -116.880 1.00 26.16 ? 92   HIS D CE1   1 
ATOM   8176  N NE2   . HIS D 1 114 ? -30.479 12.329  -117.298 1.00 25.44 ? 92   HIS D NE2   1 
ATOM   8177  N N     . PRO D 1 115 ? -26.677 13.024  -123.061 1.00 18.51 ? 93   PRO D N     1 
ATOM   8178  C CA    . PRO D 1 115 ? -25.554 12.872  -123.991 1.00 19.79 ? 93   PRO D CA    1 
ATOM   8179  C C     . PRO D 1 115 ? -24.259 13.508  -123.478 1.00 21.47 ? 93   PRO D C     1 
ATOM   8180  O O     . PRO D 1 115 ? -23.167 13.007  -123.748 1.00 21.37 ? 93   PRO D O     1 
ATOM   8181  C CB    . PRO D 1 115 ? -26.040 13.605  -125.248 1.00 20.11 ? 93   PRO D CB    1 
ATOM   8182  C CG    . PRO D 1 115 ? -27.121 14.543  -124.760 1.00 19.71 ? 93   PRO D CG    1 
ATOM   8183  C CD    . PRO D 1 115 ? -27.787 13.785  -123.664 1.00 19.24 ? 93   PRO D CD    1 
ATOM   8184  N N     . GLU D 1 116 ? -24.398 14.612  -122.748 1.00 24.37 ? 94   GLU D N     1 
ATOM   8185  C CA    . GLU D 1 116 ? -23.265 15.336  -122.170 1.00 26.01 ? 94   GLU D CA    1 
ATOM   8186  C C     . GLU D 1 116 ? -22.429 14.510  -121.193 1.00 26.21 ? 94   GLU D C     1 
ATOM   8187  O O     . GLU D 1 116 ? -21.265 14.839  -120.946 1.00 26.38 ? 94   GLU D O     1 
ATOM   8188  C CB    . GLU D 1 116 ? -23.760 16.592  -121.455 1.00 26.13 ? 94   GLU D CB    1 
ATOM   8189  C CG    . GLU D 1 116 ? -24.729 16.326  -120.294 1.00 28.41 ? 94   GLU D CG    1 
ATOM   8190  C CD    . GLU D 1 116 ? -26.174 16.234  -120.733 1.00 30.07 ? 94   GLU D CD    1 
ATOM   8191  O OE1   . GLU D 1 116 ? -26.446 16.338  -121.947 1.00 29.55 ? 94   GLU D OE1   1 
ATOM   8192  O OE2   . GLU D 1 116 ? -27.045 16.063  -119.861 1.00 32.21 ? 94   GLU D OE2   1 
ATOM   8193  N N     . CYS D 1 117 ? -23.033 13.461  -120.633 1.00 26.34 ? 95   CYS D N     1 
ATOM   8194  C CA    . CYS D 1 117 ? -22.376 12.592  -119.641 1.00 25.29 ? 95   CYS D CA    1 
ATOM   8195  C C     . CYS D 1 117 ? -21.542 11.456  -120.214 1.00 23.79 ? 95   CYS D C     1 
ATOM   8196  O O     . CYS D 1 117 ? -20.685 10.919  -119.514 1.00 22.04 ? 95   CYS D O     1 
ATOM   8197  C CB    . CYS D 1 117 ? -23.430 11.944  -118.731 1.00 25.45 ? 95   CYS D CB    1 
ATOM   8198  S SG    . CYS D 1 117 ? -24.534 13.090  -117.892 1.00 27.01 ? 95   CYS D SG    1 
ATOM   8199  N N     . LEU D 1 118 ? -21.803 11.089  -121.466 1.00 22.93 ? 96   LEU D N     1 
ATOM   8200  C CA    . LEU D 1 118 ? -21.322 9.825   -122.016 1.00 22.49 ? 96   LEU D CA    1 
ATOM   8201  C C     . LEU D 1 118 ? -19.792 9.750   -122.076 1.00 23.53 ? 96   LEU D C     1 
ATOM   8202  O O     . LEU D 1 118 ? -19.188 8.670   -121.971 1.00 24.38 ? 96   LEU D O     1 
ATOM   8203  C CB    . LEU D 1 118 ? -21.945 9.607   -123.392 1.00 22.96 ? 96   LEU D CB    1 
ATOM   8204  C CG    . LEU D 1 118 ? -23.480 9.574   -123.390 1.00 21.77 ? 96   LEU D CG    1 
ATOM   8205  C CD1   . LEU D 1 118 ? -24.032 9.596   -124.819 1.00 20.22 ? 96   LEU D CD1   1 
ATOM   8206  C CD2   . LEU D 1 118 ? -23.976 8.359   -122.613 1.00 20.75 ? 96   LEU D CD2   1 
ATOM   8207  N N     . GLN D 1 119 ? -19.172 10.912  -122.209 1.00 23.40 ? 97   GLN D N     1 
ATOM   8208  C CA    . GLN D 1 119 ? -17.718 11.024  -122.195 1.00 23.53 ? 97   GLN D CA    1 
ATOM   8209  C C     . GLN D 1 119 ? -17.137 10.810  -120.796 1.00 22.51 ? 97   GLN D C     1 
ATOM   8210  O O     . GLN D 1 119 ? -15.933 10.587  -120.661 1.00 23.01 ? 97   GLN D O     1 
ATOM   8211  C CB    . GLN D 1 119 ? -17.327 12.415  -122.681 1.00 24.17 ? 97   GLN D CB    1 
ATOM   8212  C CG    . GLN D 1 119 ? -17.764 13.523  -121.731 1.00 23.44 ? 97   GLN D CG    1 
ATOM   8213  C CD    . GLN D 1 119 ? -17.863 14.837  -122.416 1.00 26.01 ? 97   GLN D CD    1 
ATOM   8214  O OE1   . GLN D 1 119 ? -17.035 15.716  -122.196 1.00 27.66 ? 97   GLN D OE1   1 
ATOM   8215  N NE2   . GLN D 1 119 ? -18.861 14.983  -123.284 1.00 27.50 ? 97   GLN D NE2   1 
ATOM   8216  N N     . ASN D 1 120 ? -17.991 10.893  -119.771 1.00 20.94 ? 98   ASN D N     1 
ATOM   8217  C CA    . ASN D 1 120 ? -17.598 10.736  -118.366 1.00 19.64 ? 98   ASN D CA    1 
ATOM   8218  C C     . ASN D 1 120 ? -18.128 9.457   -117.677 1.00 17.11 ? 98   ASN D C     1 
ATOM   8219  O O     . ASN D 1 120 ? -18.158 9.374   -116.453 1.00 16.95 ? 98   ASN D O     1 
ATOM   8220  C CB    . ASN D 1 120 ? -18.004 12.007  -117.603 1.00 20.57 ? 98   ASN D CB    1 
ATOM   8221  C CG    . ASN D 1 120 ? -17.000 13.127  -117.783 1.00 20.32 ? 98   ASN D CG    1 
ATOM   8222  O OD1   . ASN D 1 120 ? -15.808 12.951  -117.521 1.00 30.44 ? 98   ASN D OD1   1 
ATOM   8223  N ND2   . ASN D 1 120 ? -17.467 14.273  -118.232 1.00 21.92 ? 98   ASN D ND2   1 
ATOM   8224  N N     . VAL D 1 121 ? -18.504 8.455   -118.465 1.00 15.29 ? 99   VAL D N     1 
ATOM   8225  C CA    . VAL D 1 121 ? -18.929 7.168   -117.930 1.00 14.98 ? 99   VAL D CA    1 
ATOM   8226  C C     . VAL D 1 121 ? -18.163 6.000   -118.557 1.00 15.37 ? 99   VAL D C     1 
ATOM   8227  O O     . VAL D 1 121 ? -17.645 6.092   -119.677 1.00 14.31 ? 99   VAL D O     1 
ATOM   8228  C CB    . VAL D 1 121 ? -20.458 6.918   -118.096 1.00 14.91 ? 99   VAL D CB    1 
ATOM   8229  C CG1   . VAL D 1 121 ? -21.266 7.965   -117.345 1.00 17.55 ? 99   VAL D CG1   1 
ATOM   8230  C CG2   . VAL D 1 121 ? -20.864 6.901   -119.564 1.00 17.45 ? 99   VAL D CG2   1 
ATOM   8231  N N     . ALA D 1 122 ? -18.098 4.902   -117.817 1.00 15.92 ? 100  ALA D N     1 
ATOM   8232  C CA    . ALA D 1 122 ? -17.574 3.654   -118.351 1.00 16.48 ? 100  ALA D CA    1 
ATOM   8233  C C     . ALA D 1 122 ? -18.646 2.602   -118.213 1.00 17.16 ? 100  ALA D C     1 
ATOM   8234  O O     . ALA D 1 122 ? -19.404 2.601   -117.243 1.00 17.24 ? 100  ALA D O     1 
ATOM   8235  C CB    . ALA D 1 122 ? -16.295 3.218   -117.640 1.00 15.84 ? 100  ALA D CB    1 
ATOM   8236  N N     . VAL D 1 123 ? -18.712 1.740   -119.218 1.00 18.37 ? 101  VAL D N     1 
ATOM   8237  C CA    . VAL D 1 123 ? -19.570 0.585   -119.210 1.00 18.30 ? 101  VAL D CA    1 
ATOM   8238  C C     . VAL D 1 123 ? -18.755 -0.528  -118.575 1.00 17.84 ? 101  VAL D C     1 
ATOM   8239  O O     . VAL D 1 123 ? -17.563 -0.656  -118.853 1.00 16.94 ? 101  VAL D O     1 
ATOM   8240  C CB    . VAL D 1 123 ? -20.047 0.221   -120.658 1.00 18.68 ? 101  VAL D CB    1 
ATOM   8241  C CG1   . VAL D 1 123 ? -18.869 -0.160  -121.584 1.00 18.34 ? 101  VAL D CG1   1 
ATOM   8242  C CG2   . VAL D 1 123 ? -21.092 -0.897  -120.624 1.00 20.13 ? 101  VAL D CG2   1 
ATOM   8243  N N     . SER D 1 124 ? -19.404 -1.315  -117.719 1.00 17.12 ? 102  SER D N     1 
ATOM   8244  C CA    . SER D 1 124 ? -18.728 -2.329  -116.928 1.00 17.46 ? 102  SER D CA    1 
ATOM   8245  C C     . SER D 1 124 ? -19.115 -3.744  -117.359 1.00 18.26 ? 102  SER D C     1 
ATOM   8246  O O     . SER D 1 124 ? -20.253 -4.008  -117.763 1.00 15.58 ? 102  SER D O     1 
ATOM   8247  C CB    . SER D 1 124 ? -19.020 -2.099  -115.457 1.00 18.22 ? 102  SER D CB    1 
ATOM   8248  O OG    . SER D 1 124 ? -18.483 -0.844  -115.040 1.00 16.28 ? 102  SER D OG    1 
ATOM   8249  N N     . SER D 1 125 ? -18.144 -4.644  -117.276 1.00 20.84 ? 103  SER D N     1 
ATOM   8250  C CA    . SER D 1 125 ? -18.322 -6.038  -117.675 1.00 22.06 ? 103  SER D CA    1 
ATOM   8251  C C     . SER D 1 125 ? -17.464 -6.969  -116.828 1.00 22.94 ? 103  SER D C     1 
ATOM   8252  O O     . SER D 1 125 ? -16.328 -6.630  -116.500 1.00 21.91 ? 103  SER D O     1 
ATOM   8253  C CB    . SER D 1 125 ? -17.923 -6.194  -119.153 1.00 22.68 ? 103  SER D CB    1 
ATOM   8254  O OG    . SER D 1 125 ? -18.144 -7.519  -119.635 1.00 20.17 ? 103  SER D OG    1 
ATOM   8255  N N     . GLY D 1 126 ? -18.011 -8.132  -116.477 1.00 24.03 ? 104  GLY D N     1 
ATOM   8256  C CA    . GLY D 1 126 ? -17.193 -9.255  -116.029 1.00 24.75 ? 104  GLY D CA    1 
ATOM   8257  C C     . GLY D 1 126 ? -16.530 -9.969  -117.202 1.00 25.82 ? 104  GLY D C     1 
ATOM   8258  O O     . GLY D 1 126 ? -16.634 -9.536  -118.349 1.00 25.70 ? 104  GLY D O     1 
ATOM   8259  N N     . SER D 1 127 ? -15.856 -11.077 -116.914 1.00 27.66 ? 105  SER D N     1 
ATOM   8260  C CA    . SER D 1 127 ? -15.149 -11.848 -117.933 1.00 28.20 ? 105  SER D CA    1 
ATOM   8261  C C     . SER D 1 127 ? -16.017 -12.924 -118.587 1.00 27.83 ? 105  SER D C     1 
ATOM   8262  O O     . SER D 1 127 ? -15.531 -13.700 -119.409 1.00 27.31 ? 105  SER D O     1 
ATOM   8263  C CB    . SER D 1 127 ? -13.911 -12.518 -117.321 1.00 27.81 ? 105  SER D CB    1 
ATOM   8264  O OG    . SER D 1 127 ? -14.256 -13.739 -116.672 1.00 27.80 ? 105  SER D OG    1 
ATOM   8265  N N     . GLY D 1 128 ? -17.293 -12.980 -118.226 1.00 28.39 ? 106  GLY D N     1 
ATOM   8266  C CA    . GLY D 1 128 ? -18.214 -13.946 -118.829 1.00 29.35 ? 106  GLY D CA    1 
ATOM   8267  C C     . GLY D 1 128 ? -18.609 -13.613 -120.257 1.00 30.49 ? 106  GLY D C     1 
ATOM   8268  O O     . GLY D 1 128 ? -18.507 -12.460 -120.683 1.00 30.72 ? 106  GLY D O     1 
ATOM   8269  N N     . GLN D 1 129 ? -19.063 -14.627 -120.998 1.00 31.89 ? 107  GLN D N     1 
ATOM   8270  C CA    . GLN D 1 129 ? -19.484 -14.436 -122.395 1.00 31.60 ? 107  GLN D CA    1 
ATOM   8271  C C     . GLN D 1 129 ? -20.699 -13.515 -122.489 1.00 30.65 ? 107  GLN D C     1 
ATOM   8272  O O     . GLN D 1 129 ? -20.767 -12.659 -123.367 1.00 31.18 ? 107  GLN D O     1 
ATOM   8273  C CB    . GLN D 1 129 ? -19.814 -15.761 -123.090 1.00 32.15 ? 107  GLN D CB    1 
ATOM   8274  C CG    . GLN D 1 129 ? -20.032 -15.630 -124.604 1.00 33.45 ? 107  GLN D CG    1 
ATOM   8275  N N     . ASN D 1 130 ? -21.654 -13.702 -121.585 1.00 30.09 ? 108  ASN D N     1 
ATOM   8276  C CA    . ASN D 1 130 ? -22.875 -12.891 -121.555 1.00 29.71 ? 108  ASN D CA    1 
ATOM   8277  C C     . ASN D 1 130 ? -22.610 -11.419 -121.303 1.00 29.89 ? 108  ASN D C     1 
ATOM   8278  O O     . ASN D 1 130 ? -23.230 -10.553 -121.917 1.00 29.96 ? 108  ASN D O     1 
ATOM   8279  C CB    . ASN D 1 130 ? -23.810 -13.389 -120.445 1.00 30.10 ? 108  ASN D CB    1 
ATOM   8280  C CG    . ASN D 1 130 ? -24.985 -14.145 -120.977 1.00 31.21 ? 108  ASN D CG    1 
ATOM   8281  O OD1   . ASN D 1 130 ? -25.823 -13.573 -121.657 1.00 35.05 ? 108  ASN D OD1   1 
ATOM   8282  N ND2   . ASN D 1 130 ? -25.063 -15.432 -120.670 1.00 31.52 ? 108  ASN D ND2   1 
ATOM   8283  N N     . ASP D 1 131 ? -21.715 -11.150 -120.356 1.00 29.11 ? 109  ASP D N     1 
ATOM   8284  C CA    . ASP D 1 131 ? -21.300 -9.784  -120.038 1.00 28.21 ? 109  ASP D CA    1 
ATOM   8285  C C     . ASP D 1 131 ? -20.691 -9.146  -121.274 1.00 26.89 ? 109  ASP D C     1 
ATOM   8286  O O     . ASP D 1 131 ? -21.012 -8.012  -121.617 1.00 27.75 ? 109  ASP D O     1 
ATOM   8287  C CB    . ASP D 1 131 ? -20.241 -9.742  -118.918 1.00 27.71 ? 109  ASP D CB    1 
ATOM   8288  C CG    . ASP D 1 131 ? -20.785 -10.114 -117.543 1.00 29.95 ? 109  ASP D CG    1 
ATOM   8289  O OD1   . ASP D 1 131 ? -22.022 -10.181 -117.350 1.00 35.93 ? 109  ASP D OD1   1 
ATOM   8290  O OD2   . ASP D 1 131 ? -19.944 -10.328 -116.635 1.00 28.48 ? 109  ASP D OD2   1 
ATOM   8291  N N     . LEU D 1 132 ? -19.796 -9.873  -121.936 1.00 25.42 ? 110  LEU D N     1 
ATOM   8292  C CA    . LEU D 1 132 ? -19.086 -9.308  -123.071 1.00 25.27 ? 110  LEU D CA    1 
ATOM   8293  C C     . LEU D 1 132 ? -20.079 -8.958  -124.176 1.00 25.27 ? 110  LEU D C     1 
ATOM   8294  O O     . LEU D 1 132 ? -19.993 -7.880  -124.766 1.00 26.08 ? 110  LEU D O     1 
ATOM   8295  C CB    . LEU D 1 132 ? -18.004 -10.254 -123.599 1.00 25.79 ? 110  LEU D CB    1 
ATOM   8296  C CG    . LEU D 1 132 ? -17.150 -9.740  -124.765 1.00 23.30 ? 110  LEU D CG    1 
ATOM   8297  C CD1   . LEU D 1 132 ? -16.607 -8.360  -124.506 1.00 23.90 ? 110  LEU D CD1   1 
ATOM   8298  C CD2   . LEU D 1 132 ? -16.004 -10.710 -125.037 1.00 22.42 ? 110  LEU D CD2   1 
ATOM   8299  N N     . GLU D 1 133 ? -21.031 -9.858  -124.424 1.00 24.43 ? 111  GLU D N     1 
ATOM   8300  C CA    . GLU D 1 133 ? -22.080 -9.621  -125.426 1.00 24.62 ? 111  GLU D CA    1 
ATOM   8301  C C     . GLU D 1 133 ? -22.937 -8.412  -125.092 1.00 22.34 ? 111  GLU D C     1 
ATOM   8302  O O     . GLU D 1 133 ? -23.215 -7.586  -125.967 1.00 22.88 ? 111  GLU D O     1 
ATOM   8303  C CB    . GLU D 1 133 ? -22.986 -10.846 -125.602 1.00 25.41 ? 111  GLU D CB    1 
ATOM   8304  C CG    . GLU D 1 133 ? -22.349 -11.961 -126.427 1.00 31.87 ? 111  GLU D CG    1 
ATOM   8305  C CD    . GLU D 1 133 ? -23.203 -13.224 -126.489 1.00 39.15 ? 111  GLU D CD    1 
ATOM   8306  O OE1   . GLU D 1 133 ? -24.438 -13.126 -126.279 1.00 39.93 ? 111  GLU D OE1   1 
ATOM   8307  O OE2   . GLU D 1 133 ? -22.634 -14.313 -126.746 1.00 41.06 ? 111  GLU D OE2   1 
ATOM   8308  N N     . LYS D 1 134 ? -23.359 -8.304  -123.837 1.00 20.68 ? 112  LYS D N     1 
ATOM   8309  C CA    . LYS D 1 134 ? -24.193 -7.177  -123.429 1.00 20.45 ? 112  LYS D CA    1 
ATOM   8310  C C     . LYS D 1 134 ? -23.434 -5.865  -123.552 1.00 18.00 ? 112  LYS D C     1 
ATOM   8311  O O     . LYS D 1 134 ? -23.976 -4.873  -124.026 1.00 16.43 ? 112  LYS D O     1 
ATOM   8312  C CB    . LYS D 1 134 ? -24.738 -7.338  -122.005 1.00 20.92 ? 112  LYS D CB    1 
ATOM   8313  C CG    . LYS D 1 134 ? -25.863 -6.352  -121.693 1.00 23.89 ? 112  LYS D CG    1 
ATOM   8314  C CD    . LYS D 1 134 ? -26.668 -6.738  -120.460 1.00 27.04 ? 112  LYS D CD    1 
ATOM   8315  C CE    . LYS D 1 134 ? -26.127 -6.110  -119.185 1.00 26.70 ? 112  LYS D CE    1 
ATOM   8316  N NZ    . LYS D 1 134 ? -27.030 -6.367  -118.018 1.00 28.22 ? 112  LYS D NZ    1 
ATOM   8317  N N     . MET D 1 135 ? -22.176 -5.867  -123.132 1.00 17.69 ? 113  MET D N     1 
ATOM   8318  C CA    . MET D 1 135 ? -21.348 -4.669  -123.225 1.00 18.83 ? 113  MET D CA    1 
ATOM   8319  C C     . MET D 1 135 ? -21.135 -4.274  -124.683 1.00 18.58 ? 113  MET D C     1 
ATOM   8320  O O     . MET D 1 135 ? -21.235 -3.088  -125.042 1.00 18.67 ? 113  MET D O     1 
ATOM   8321  C CB    . MET D 1 135 ? -19.992 -4.874  -122.557 1.00 19.28 ? 113  MET D CB    1 
ATOM   8322  C CG    . MET D 1 135 ? -19.167 -3.596  -122.533 1.00 20.93 ? 113  MET D CG    1 
ATOM   8323  S SD    . MET D 1 135 ? -17.462 -3.819  -122.036 1.00 29.78 ? 113  MET D SD    1 
ATOM   8324  C CE    . MET D 1 135 ? -16.850 -4.914  -123.312 1.00 29.15 ? 113  MET D CE    1 
ATOM   8325  N N     . THR D 1 136 ? -20.824 -5.273  -125.509 1.00 18.76 ? 114  THR D N     1 
ATOM   8326  C CA    . THR D 1 136 ? -20.674 -5.089  -126.959 1.00 17.96 ? 114  THR D CA    1 
ATOM   8327  C C     . THR D 1 136 ? -21.892 -4.384  -127.549 1.00 16.96 ? 114  THR D C     1 
ATOM   8328  O O     . THR D 1 136 ? -21.746 -3.448  -128.334 1.00 15.64 ? 114  THR D O     1 
ATOM   8329  C CB    . THR D 1 136 ? -20.460 -6.460  -127.704 1.00 18.59 ? 114  THR D CB    1 
ATOM   8330  O OG1   . THR D 1 136 ? -19.295 -7.129  -127.199 1.00 17.56 ? 114  THR D OG1   1 
ATOM   8331  C CG2   . THR D 1 136 ? -20.288 -6.265  -129.214 1.00 17.75 ? 114  THR D CG2   1 
ATOM   8332  N N     . SER D 1 137 ? -23.085 -4.839  -127.161 1.00 16.78 ? 115  SER D N     1 
ATOM   8333  C CA    . SER D 1 137 ? -24.341 -4.268  -127.663 1.00 17.59 ? 115  SER D CA    1 
ATOM   8334  C C     . SER D 1 137 ? -24.516 -2.828  -127.223 1.00 18.58 ? 115  SER D C     1 
ATOM   8335  O O     . SER D 1 137 ? -24.997 -1.990  -127.990 1.00 20.96 ? 115  SER D O     1 
ATOM   8336  C CB    . SER D 1 137 ? -25.555 -5.094  -127.214 1.00 17.22 ? 115  SER D CB    1 
ATOM   8337  O OG    . SER D 1 137 ? -25.837 -4.932  -125.833 1.00 17.57 ? 115  SER D OG    1 
ATOM   8338  N N     . ILE D 1 138 ? -24.138 -2.544  -125.984 1.00 18.95 ? 116  ILE D N     1 
ATOM   8339  C CA    . ILE D 1 138 ? -24.227 -1.199  -125.439 1.00 18.51 ? 116  ILE D CA    1 
ATOM   8340  C C     . ILE D 1 138 ? -23.260 -0.249  -126.155 1.00 18.53 ? 116  ILE D C     1 
ATOM   8341  O O     . ILE D 1 138 ? -23.643 0.849   -126.543 1.00 18.31 ? 116  ILE D O     1 
ATOM   8342  C CB    . ILE D 1 138 ? -23.965 -1.219  -123.925 1.00 19.14 ? 116  ILE D CB    1 
ATOM   8343  C CG1   . ILE D 1 138 ? -25.089 -1.979  -123.217 1.00 19.25 ? 116  ILE D CG1   1 
ATOM   8344  C CG2   . ILE D 1 138 ? -23.857 0.211   -123.364 1.00 22.91 ? 116  ILE D CG2   1 
ATOM   8345  C CD1   . ILE D 1 138 ? -24.693 -2.523  -121.859 1.00 19.64 ? 116  ILE D CD1   1 
ATOM   8346  N N     . LEU D 1 139 ? -22.017 -0.674  -126.339 1.00 18.82 ? 117  LEU D N     1 
ATOM   8347  C CA    . LEU D 1 139 ? -21.010 0.161   -127.008 1.00 19.50 ? 117  LEU D CA    1 
ATOM   8348  C C     . LEU D 1 139 ? -21.344 0.438   -128.488 1.00 20.99 ? 117  LEU D C     1 
ATOM   8349  O O     . LEU D 1 139 ? -21.103 1.541   -128.995 1.00 20.87 ? 117  LEU D O     1 
ATOM   8350  C CB    . LEU D 1 139 ? -19.624 -0.480  -126.899 1.00 19.97 ? 117  LEU D CB    1 
ATOM   8351  C CG    . LEU D 1 139 ? -18.962 -0.442  -125.526 1.00 20.70 ? 117  LEU D CG    1 
ATOM   8352  C CD1   . LEU D 1 139 ? -17.677 -1.237  -125.538 1.00 23.55 ? 117  LEU D CD1   1 
ATOM   8353  C CD2   . LEU D 1 139 ? -18.688 0.995   -125.096 1.00 21.01 ? 117  LEU D CD2   1 
ATOM   8354  N N     . GLU D 1 140 ? -21.879 -0.563  -129.183 1.00 23.04 ? 118  GLU D N     1 
ATOM   8355  C CA    . GLU D 1 140 ? -22.291 -0.381  -130.568 1.00 23.85 ? 118  GLU D CA    1 
ATOM   8356  C C     . GLU D 1 140 ? -23.499 0.541   -130.630 1.00 22.06 ? 118  GLU D C     1 
ATOM   8357  O O     . GLU D 1 140 ? -23.611 1.355   -131.545 1.00 21.66 ? 118  GLU D O     1 
ATOM   8358  C CB    . GLU D 1 140 ? -22.621 -1.716  -131.238 1.00 25.13 ? 118  GLU D CB    1 
ATOM   8359  C CG    . GLU D 1 140 ? -21.410 -2.594  -131.535 1.00 30.67 ? 118  GLU D CG    1 
ATOM   8360  C CD    . GLU D 1 140 ? -21.770 -3.808  -132.388 1.00 36.13 ? 118  GLU D CD    1 
ATOM   8361  O OE1   . GLU D 1 140 ? -22.036 -3.629  -133.598 1.00 41.61 ? 118  GLU D OE1   1 
ATOM   8362  O OE2   . GLU D 1 140 ? -21.788 -4.938  -131.857 1.00 32.26 ? 118  GLU D OE2   1 
ATOM   8363  N N     . ALA D 1 141 ? -24.402 0.419   -129.660 1.00 21.24 ? 119  ALA D N     1 
ATOM   8364  C CA    . ALA D 1 141 ? -25.595 1.279   -129.617 1.00 20.26 ? 119  ALA D CA    1 
ATOM   8365  C C     . ALA D 1 141 ? -25.273 2.693   -129.123 1.00 19.03 ? 119  ALA D C     1 
ATOM   8366  O O     . ALA D 1 141 ? -25.975 3.647   -129.470 1.00 18.85 ? 119  ALA D O     1 
ATOM   8367  C CB    . ALA D 1 141 ? -26.682 0.655   -128.746 1.00 20.31 ? 119  ALA D CB    1 
ATOM   8368  N N     . VAL D 1 142 ? -24.219 2.827   -128.321 1.00 18.79 ? 120  VAL D N     1 
ATOM   8369  C CA    . VAL D 1 142 ? -23.832 4.125   -127.745 1.00 18.32 ? 120  VAL D CA    1 
ATOM   8370  C C     . VAL D 1 142 ? -22.350 4.422   -128.014 1.00 18.65 ? 120  VAL D C     1 
ATOM   8371  O O     . VAL D 1 142 ? -21.514 4.292   -127.106 1.00 17.04 ? 120  VAL D O     1 
ATOM   8372  C CB    . VAL D 1 142 ? -24.105 4.155   -126.220 1.00 18.18 ? 120  VAL D CB    1 
ATOM   8373  C CG1   . VAL D 1 142 ? -23.968 5.573   -125.674 1.00 20.11 ? 120  VAL D CG1   1 
ATOM   8374  C CG2   . VAL D 1 142 ? -25.498 3.605   -125.922 1.00 17.29 ? 120  VAL D CG2   1 
ATOM   8375  N N     . PRO D 1 143 ? -22.023 4.854   -129.251 1.00 19.51 ? 121  PRO D N     1 
ATOM   8376  C CA    . PRO D 1 143 ? -20.625 5.056   -129.666 1.00 21.03 ? 121  PRO D CA    1 
ATOM   8377  C C     . PRO D 1 143 ? -19.898 6.147   -128.867 1.00 22.63 ? 121  PRO D C     1 
ATOM   8378  O O     . PRO D 1 143 ? -18.666 6.256   -128.934 1.00 23.20 ? 121  PRO D O     1 
ATOM   8379  C CB    . PRO D 1 143 ? -20.740 5.497   -131.130 1.00 20.67 ? 121  PRO D CB    1 
ATOM   8380  C CG    . PRO D 1 143 ? -22.132 5.225   -131.545 1.00 20.43 ? 121  PRO D CG    1 
ATOM   8381  C CD    . PRO D 1 143 ? -22.971 5.222   -130.316 1.00 19.90 ? 121  PRO D CD    1 
ATOM   8382  N N     . GLN D 1 144 ? -20.664 6.939   -128.119 1.00 23.03 ? 122  GLN D N     1 
ATOM   8383  C CA    . GLN D 1 144 ? -20.123 8.032   -127.312 1.00 23.34 ? 122  GLN D CA    1 
ATOM   8384  C C     . GLN D 1 144 ? -19.438 7.544   -126.034 1.00 22.80 ? 122  GLN D C     1 
ATOM   8385  O O     . GLN D 1 144 ? -18.644 8.284   -125.446 1.00 22.36 ? 122  GLN D O     1 
ATOM   8386  C CB    . GLN D 1 144 ? -21.229 9.024   -126.917 1.00 23.74 ? 122  GLN D CB    1 
ATOM   8387  C CG    . GLN D 1 144 ? -21.899 9.765   -128.066 1.00 25.84 ? 122  GLN D CG    1 
ATOM   8388  C CD    . GLN D 1 144 ? -22.837 8.888   -128.878 1.00 32.01 ? 122  GLN D CD    1 
ATOM   8389  O OE1   . GLN D 1 144 ? -23.526 8.014   -128.342 1.00 30.63 ? 122  GLN D OE1   1 
ATOM   8390  N NE2   . GLN D 1 144 ? -22.860 9.112   -130.186 1.00 35.99 ? 122  GLN D NE2   1 
ATOM   8391  N N     . VAL D 1 145 ? -19.753 6.317   -125.603 1.00 22.95 ? 123  VAL D N     1 
ATOM   8392  C CA    . VAL D 1 145 ? -19.084 5.712   -124.444 1.00 21.98 ? 123  VAL D CA    1 
ATOM   8393  C C     . VAL D 1 145 ? -17.764 5.115   -124.898 1.00 21.69 ? 123  VAL D C     1 
ATOM   8394  O O     . VAL D 1 145 ? -17.741 4.173   -125.688 1.00 22.83 ? 123  VAL D O     1 
ATOM   8395  C CB    . VAL D 1 145 ? -19.918 4.613   -123.774 1.00 22.16 ? 123  VAL D CB    1 
ATOM   8396  C CG1   . VAL D 1 145 ? -19.182 4.072   -122.544 1.00 25.14 ? 123  VAL D CG1   1 
ATOM   8397  C CG2   . VAL D 1 145 ? -21.288 5.141   -123.377 1.00 22.65 ? 123  VAL D CG2   1 
ATOM   8398  N N     . LYS D 1 146 ? -16.670 5.663   -124.385 1.00 22.05 ? 124  LYS D N     1 
ATOM   8399  C CA    . LYS D 1 146 ? -15.325 5.336   -124.845 1.00 21.70 ? 124  LYS D CA    1 
ATOM   8400  C C     . LYS D 1 146 ? -14.450 4.735   -123.764 1.00 20.59 ? 124  LYS D C     1 
ATOM   8401  O O     . LYS D 1 146 ? -13.222 4.708   -123.909 1.00 19.24 ? 124  LYS D O     1 
ATOM   8402  C CB    . LYS D 1 146 ? -14.652 6.616   -125.354 1.00 24.09 ? 124  LYS D CB    1 
ATOM   8403  C CG    . LYS D 1 146 ? -15.251 7.234   -126.638 1.00 26.13 ? 124  LYS D CG    1 
ATOM   8404  C CD    . LYS D 1 146 ? -15.087 6.331   -127.853 1.00 28.93 ? 124  LYS D CD    1 
ATOM   8405  C CE    . LYS D 1 146 ? -13.629 6.133   -128.242 1.00 30.77 ? 124  LYS D CE    1 
ATOM   8406  N NZ    . LYS D 1 146 ? -13.406 4.700   -128.593 1.00 36.54 ? 124  LYS D NZ    1 
ATOM   8407  N N     . PHE D 1 147 ? -15.074 4.269   -122.678 1.00 20.08 ? 125  PHE D N     1 
ATOM   8408  C CA    . PHE D 1 147 ? -14.356 3.649   -121.544 1.00 18.38 ? 125  PHE D CA    1 
ATOM   8409  C C     . PHE D 1 147 ? -15.021 2.359   -121.194 1.00 17.01 ? 125  PHE D C     1 
ATOM   8410  O O     . PHE D 1 147 ? -16.246 2.312   -121.072 1.00 15.37 ? 125  PHE D O     1 
ATOM   8411  C CB    . PHE D 1 147 ? -14.372 4.539   -120.291 1.00 18.75 ? 125  PHE D CB    1 
ATOM   8412  C CG    . PHE D 1 147 ? -13.345 5.630   -120.300 1.00 19.21 ? 125  PHE D CG    1 
ATOM   8413  C CD1   . PHE D 1 147 ? -12.083 5.417   -119.751 1.00 19.68 ? 125  PHE D CD1   1 
ATOM   8414  C CD2   . PHE D 1 147 ? -13.636 6.867   -120.859 1.00 20.34 ? 125  PHE D CD2   1 
ATOM   8415  C CE1   . PHE D 1 147 ? -11.114 6.426   -119.752 1.00 20.25 ? 125  PHE D CE1   1 
ATOM   8416  C CE2   . PHE D 1 147 ? -12.672 7.876   -120.887 1.00 20.52 ? 125  PHE D CE2   1 
ATOM   8417  C CZ    . PHE D 1 147 ? -11.406 7.649   -120.323 1.00 22.81 ? 125  PHE D CZ    1 
ATOM   8418  N N     . ILE D 1 148 ? -14.205 1.324   -121.023 1.00 16.92 ? 126  ILE D N     1 
ATOM   8419  C CA    . ILE D 1 148 ? -14.679 0.007   -120.618 1.00 16.70 ? 126  ILE D CA    1 
ATOM   8420  C C     . ILE D 1 148 ? -14.049 -0.346  -119.275 1.00 16.71 ? 126  ILE D C     1 
ATOM   8421  O O     . ILE D 1 148 ? -12.853 -0.160  -119.095 1.00 15.84 ? 126  ILE D O     1 
ATOM   8422  C CB    . ILE D 1 148 ? -14.300 -1.026  -121.682 1.00 16.76 ? 126  ILE D CB    1 
ATOM   8423  C CG1   . ILE D 1 148 ? -14.987 -0.683  -122.998 1.00 16.41 ? 126  ILE D CG1   1 
ATOM   8424  C CG2   . ILE D 1 148 ? -14.676 -2.419  -121.236 1.00 18.20 ? 126  ILE D CG2   1 
ATOM   8425  C CD1   . ILE D 1 148 ? -14.455 -1.430  -124.180 1.00 21.40 ? 126  ILE D CD1   1 
ATOM   8426  N N     . CYS D 1 149 ? -14.859 -0.842  -118.336 1.00 17.44 ? 127  CYS D N     1 
ATOM   8427  C CA    . CYS D 1 149 ? -14.355 -1.288  -117.036 1.00 18.02 ? 127  CYS D CA    1 
ATOM   8428  C C     . CYS D 1 149 ? -14.543 -2.791  -116.850 1.00 18.48 ? 127  CYS D C     1 
ATOM   8429  O O     . CYS D 1 149 ? -15.675 -3.282  -116.796 1.00 17.65 ? 127  CYS D O     1 
ATOM   8430  C CB    . CYS D 1 149 ? -15.031 -0.536  -115.904 1.00 18.20 ? 127  CYS D CB    1 
ATOM   8431  S SG    . CYS D 1 149 ? -14.141 -0.694  -114.343 1.00 16.23 ? 127  CYS D SG    1 
ATOM   8432  N N     . LEU D 1 150 ? -13.422 -3.504  -116.747 1.00 19.17 ? 128  LEU D N     1 
ATOM   8433  C CA    . LEU D 1 150 ? -13.416 -4.960  -116.634 1.00 19.36 ? 128  LEU D CA    1 
ATOM   8434  C C     . LEU D 1 150 ? -12.983 -5.385  -115.249 1.00 20.88 ? 128  LEU D C     1 
ATOM   8435  O O     . LEU D 1 150 ? -12.020 -4.873  -114.713 1.00 22.50 ? 128  LEU D O     1 
ATOM   8436  C CB    . LEU D 1 150 ? -12.491 -5.570  -117.684 1.00 19.86 ? 128  LEU D CB    1 
ATOM   8437  C CG    . LEU D 1 150 ? -12.727 -5.117  -119.125 1.00 14.28 ? 128  LEU D CG    1 
ATOM   8438  C CD1   . LEU D 1 150 ? -11.640 -5.708  -119.977 1.00 13.63 ? 128  LEU D CD1   1 
ATOM   8439  C CD2   . LEU D 1 150 ? -14.118 -5.503  -119.633 1.00 10.07 ? 128  LEU D CD2   1 
ATOM   8440  N N     . ASP D 1 151 ? -13.701 -6.339  -114.678 1.00 23.37 ? 129  ASP D N     1 
ATOM   8441  C CA    . ASP D 1 151 ? -13.478 -6.740  -113.297 1.00 24.06 ? 129  ASP D CA    1 
ATOM   8442  C C     . ASP D 1 151 ? -13.684 -8.239  -113.103 1.00 22.98 ? 129  ASP D C     1 
ATOM   8443  O O     . ASP D 1 151 ? -14.674 -8.829  -113.539 1.00 21.80 ? 129  ASP D O     1 
ATOM   8444  C CB    . ASP D 1 151 ? -14.380 -5.917  -112.366 1.00 25.11 ? 129  ASP D CB    1 
ATOM   8445  C CG    . ASP D 1 151 ? -13.946 -4.442  -112.258 1.00 28.83 ? 129  ASP D CG    1 
ATOM   8446  O OD1   . ASP D 1 151 ? -12.731 -4.170  -112.097 1.00 31.32 ? 129  ASP D OD1   1 
ATOM   8447  O OD2   . ASP D 1 151 ? -14.831 -3.552  -112.324 1.00 34.28 ? 129  ASP D OD2   1 
ATOM   8448  N N     . VAL D 1 152 ? -12.713 -8.842  -112.431 1.00 22.53 ? 130  VAL D N     1 
ATOM   8449  C CA    . VAL D 1 152 ? -12.737 -10.264 -112.133 1.00 21.31 ? 130  VAL D CA    1 
ATOM   8450  C C     . VAL D 1 152 ? -12.482 -10.513 -110.654 1.00 20.39 ? 130  VAL D C     1 
ATOM   8451  O O     . VAL D 1 152 ? -12.119 -9.595  -109.923 1.00 21.01 ? 130  VAL D O     1 
ATOM   8452  C CB    . VAL D 1 152 ? -11.700 -11.021 -112.978 1.00 21.59 ? 130  VAL D CB    1 
ATOM   8453  C CG1   . VAL D 1 152 ? -12.115 -10.997 -114.433 1.00 23.82 ? 130  VAL D CG1   1 
ATOM   8454  C CG2   . VAL D 1 152 ? -10.297 -10.444 -112.785 1.00 21.77 ? 130  VAL D CG2   1 
ATOM   8455  N N     . ALA D 1 153 ? -12.705 -11.753 -110.222 1.00 19.06 ? 131  ALA D N     1 
ATOM   8456  C CA    . ALA D 1 153 ? -12.330 -12.162 -108.884 1.00 18.70 ? 131  ALA D CA    1 
ATOM   8457  C C     . ALA D 1 153 ? -10.821 -12.183 -108.789 1.00 17.35 ? 131  ALA D C     1 
ATOM   8458  O O     . ALA D 1 153 ? -10.256 -11.618 -107.856 1.00 16.57 ? 131  ALA D O     1 
ATOM   8459  C CB    . ALA D 1 153 ? -12.893 -13.517 -108.547 1.00 19.02 ? 131  ALA D CB    1 
ATOM   8460  N N     . ASN D 1 154 ? -10.172 -12.800 -109.773 1.00 17.62 ? 132  ASN D N     1 
ATOM   8461  C CA    . ASN D 1 154 ? -8.709  -12.983 -109.772 1.00 17.82 ? 132  ASN D CA    1 
ATOM   8462  C C     . ASN D 1 154 ? -8.046  -12.249 -110.942 1.00 16.08 ? 132  ASN D C     1 
ATOM   8463  O O     . ASN D 1 154 ? -7.872  -12.805 -112.028 1.00 15.12 ? 132  ASN D O     1 
ATOM   8464  C CB    . ASN D 1 154 ? -8.327  -14.484 -109.769 1.00 17.90 ? 132  ASN D CB    1 
ATOM   8465  C CG    . ASN D 1 154 ? -6.814  -14.716 -109.643 1.00 17.56 ? 132  ASN D CG    1 
ATOM   8466  O OD1   . ASN D 1 154 ? -6.050  -13.775 -109.429 1.00 19.21 ? 132  ASN D OD1   1 
ATOM   8467  N ND2   . ASN D 1 154 ? -6.384  -15.973 -109.763 1.00 10.17 ? 132  ASN D ND2   1 
ATOM   8468  N N     . GLY D 1 155 ? -7.660  -11.001 -110.684 1.00 14.86 ? 133  GLY D N     1 
ATOM   8469  C CA    . GLY D 1 155 ? -6.938  -10.152 -111.639 1.00 14.07 ? 133  GLY D CA    1 
ATOM   8470  C C     . GLY D 1 155 ? -5.519  -10.612 -111.971 1.00 15.44 ? 133  GLY D C     1 
ATOM   8471  O O     . GLY D 1 155 ? -4.881  -10.085 -112.887 1.00 15.88 ? 133  GLY D O     1 
ATOM   8472  N N     . TYR D 1 156 ? -5.033  -11.607 -111.235 1.00 15.46 ? 134  TYR D N     1 
ATOM   8473  C CA    . TYR D 1 156 ? -3.743  -12.254 -111.517 1.00 15.39 ? 134  TYR D CA    1 
ATOM   8474  C C     . TYR D 1 156 ? -3.829  -13.501 -112.404 1.00 16.49 ? 134  TYR D C     1 
ATOM   8475  O O     . TYR D 1 156 ? -2.782  -14.101 -112.703 1.00 16.89 ? 134  TYR D O     1 
ATOM   8476  C CB    . TYR D 1 156 ? -3.024  -12.629 -110.219 1.00 13.94 ? 134  TYR D CB    1 
ATOM   8477  C CG    . TYR D 1 156 ? -2.551  -11.441 -109.448 1.00 9.54  ? 134  TYR D CG    1 
ATOM   8478  C CD1   . TYR D 1 156 ? -1.213  -11.076 -109.440 1.00 7.74  ? 134  TYR D CD1   1 
ATOM   8479  C CD2   . TYR D 1 156 ? -3.447  -10.676 -108.731 1.00 10.47 ? 134  TYR D CD2   1 
ATOM   8480  C CE1   . TYR D 1 156 ? -0.792  -9.971  -108.728 1.00 11.30 ? 134  TYR D CE1   1 
ATOM   8481  C CE2   . TYR D 1 156 ? -3.034  -9.572  -108.006 1.00 10.46 ? 134  TYR D CE2   1 
ATOM   8482  C CZ    . TYR D 1 156 ? -1.719  -9.222  -108.003 1.00 12.41 ? 134  TYR D CZ    1 
ATOM   8483  O OH    . TYR D 1 156 ? -1.364  -8.116  -107.267 1.00 10.35 ? 134  TYR D OH    1 
ATOM   8484  N N     . SER D 1 157 ? -5.033  -13.861 -112.863 1.00 17.11 ? 135  SER D N     1 
ATOM   8485  C CA    A SER D 1 157 ? -5.174  -15.074 -113.665 0.60 18.02 ? 135  SER D CA    1 
ATOM   8486  C CA    B SER D 1 157 ? -5.234  -15.064 -113.678 0.40 17.86 ? 135  SER D CA    1 
ATOM   8487  C C     . SER D 1 157 ? -4.806  -14.835 -115.119 1.00 18.85 ? 135  SER D C     1 
ATOM   8488  O O     . SER D 1 157 ? -4.938  -13.713 -115.645 1.00 20.19 ? 135  SER D O     1 
ATOM   8489  C CB    A SER D 1 157 ? -6.584  -15.643 -113.596 0.60 18.10 ? 135  SER D CB    1 
ATOM   8490  C CB    B SER D 1 157 ? -6.709  -15.479 -113.672 0.40 17.95 ? 135  SER D CB    1 
ATOM   8491  O OG    A SER D 1 157 ? -6.612  -16.894 -114.249 0.60 18.19 ? 135  SER D OG    1 
ATOM   8492  O OG    B SER D 1 157 ? -7.513  -14.525 -114.353 0.40 16.09 ? 135  SER D OG    1 
ATOM   8493  N N     . GLU D 1 158 ? -4.336  -15.906 -115.761 1.00 20.13 ? 136  GLU D N     1 
ATOM   8494  C CA    . GLU D 1 158 ? -4.013  -15.872 -117.194 1.00 21.48 ? 136  GLU D CA    1 
ATOM   8495  C C     . GLU D 1 158 ? -5.272  -15.726 -118.003 1.00 20.96 ? 136  GLU D C     1 
ATOM   8496  O O     . GLU D 1 158 ? -5.247  -15.205 -119.121 1.00 22.21 ? 136  GLU D O     1 
ATOM   8497  C CB    . GLU D 1 158 ? -3.305  -17.147 -117.662 1.00 22.43 ? 136  GLU D CB    1 
ATOM   8498  C CG    . GLU D 1 158 ? -1.859  -17.267 -117.221 1.00 28.49 ? 136  GLU D CG    1 
ATOM   8499  C CD    . GLU D 1 158 ? -1.102  -15.976 -117.350 1.00 33.88 ? 136  GLU D CD    1 
ATOM   8500  O OE1   . GLU D 1 158 ? -0.635  -15.488 -116.297 1.00 41.39 ? 136  GLU D OE1   1 
ATOM   8501  O OE2   . GLU D 1 158 ? -1.005  -15.445 -118.482 1.00 35.46 ? 136  GLU D OE2   1 
ATOM   8502  N N     . HIS D 1 159 ? -6.368  -16.201 -117.439 1.00 20.25 ? 137  HIS D N     1 
ATOM   8503  C CA    . HIS D 1 159 ? -7.653  -16.088 -118.080 1.00 21.66 ? 137  HIS D CA    1 
ATOM   8504  C C     . HIS D 1 159 ? -8.066  -14.635 -118.197 1.00 20.21 ? 137  HIS D C     1 
ATOM   8505  O O     . HIS D 1 159 ? -8.691  -14.247 -119.182 1.00 22.30 ? 137  HIS D O     1 
ATOM   8506  C CB    . HIS D 1 159 ? -8.678  -16.921 -117.327 1.00 21.77 ? 137  HIS D CB    1 
ATOM   8507  C CG    . HIS D 1 159 ? -8.360  -18.383 -117.354 1.00 33.18 ? 137  HIS D CG    1 
ATOM   8508  N ND1   . HIS D 1 159 ? -8.516  -19.152 -118.487 1.00 36.79 ? 137  HIS D ND1   1 
ATOM   8509  C CD2   . HIS D 1 159 ? -7.845  -19.206 -116.409 1.00 41.02 ? 137  HIS D CD2   1 
ATOM   8510  C CE1   . HIS D 1 159 ? -8.142  -20.393 -118.229 1.00 41.37 ? 137  HIS D CE1   1 
ATOM   8511  N NE2   . HIS D 1 159 ? -7.735  -20.454 -116.975 1.00 43.63 ? 137  HIS D NE2   1 
ATOM   8512  N N     . PHE D 1 160 ? -7.687  -13.825 -117.217 1.00 20.03 ? 138  PHE D N     1 
ATOM   8513  C CA    . PHE D 1 160 ? -8.017  -12.419 -117.262 1.00 19.64 ? 138  PHE D CA    1 
ATOM   8514  C C     . PHE D 1 160 ? -7.142  -11.693 -118.275 1.00 19.13 ? 138  PHE D C     1 
ATOM   8515  O O     . PHE D 1 160 ? -7.638  -10.852 -119.014 1.00 17.99 ? 138  PHE D O     1 
ATOM   8516  C CB    . PHE D 1 160 ? -7.867  -11.780 -115.889 1.00 19.17 ? 138  PHE D CB    1 
ATOM   8517  C CG    . PHE D 1 160 ? -8.367  -10.349 -115.828 1.00 21.51 ? 138  PHE D CG    1 
ATOM   8518  C CD1   . PHE D 1 160 ? -9.638  -10.019 -116.294 1.00 20.35 ? 138  PHE D CD1   1 
ATOM   8519  C CD2   . PHE D 1 160 ? -7.573  -9.332  -115.292 1.00 21.80 ? 138  PHE D CD2   1 
ATOM   8520  C CE1   . PHE D 1 160 ? -10.107 -8.692  -116.227 1.00 20.32 ? 138  PHE D CE1   1 
ATOM   8521  C CE2   . PHE D 1 160 ? -8.036  -8.007  -115.220 1.00 16.02 ? 138  PHE D CE2   1 
ATOM   8522  C CZ    . PHE D 1 160 ? -9.299  -7.686  -115.693 1.00 18.27 ? 138  PHE D CZ    1 
ATOM   8523  N N     . VAL D 1 161 ? -5.849  -12.021 -118.294 1.00 18.71 ? 139  VAL D N     1 
ATOM   8524  C CA    . VAL D 1 161 ? -4.905  -11.489 -119.285 1.00 19.00 ? 139  VAL D CA    1 
ATOM   8525  C C     . VAL D 1 161 ? -5.442  -11.675 -120.711 1.00 20.16 ? 139  VAL D C     1 
ATOM   8526  O O     . VAL D 1 161 ? -5.406  -10.744 -121.527 1.00 19.05 ? 139  VAL D O     1 
ATOM   8527  C CB    . VAL D 1 161 ? -3.499  -12.162 -119.146 1.00 19.31 ? 139  VAL D CB    1 
ATOM   8528  C CG1   . VAL D 1 161 ? -2.699  -12.089 -120.452 1.00 21.21 ? 139  VAL D CG1   1 
ATOM   8529  C CG2   . VAL D 1 161 ? -2.712  -11.527 -118.017 1.00 18.32 ? 139  VAL D CG2   1 
ATOM   8530  N N     . GLU D 1 162 ? -5.943  -12.880 -120.992 1.00 21.84 ? 140  GLU D N     1 
ATOM   8531  C CA    . GLU D 1 162 ? -6.476  -13.232 -122.317 1.00 21.52 ? 140  GLU D CA    1 
ATOM   8532  C C     . GLU D 1 162 ? -7.793  -12.529 -122.633 1.00 19.35 ? 140  GLU D C     1 
ATOM   8533  O O     . GLU D 1 162 ? -8.090  -12.247 -123.806 1.00 19.12 ? 140  GLU D O     1 
ATOM   8534  C CB    . GLU D 1 162 ? -6.689  -14.761 -122.455 1.00 22.80 ? 140  GLU D CB    1 
ATOM   8535  C CG    . GLU D 1 162 ? -5.410  -15.593 -122.571 1.00 26.49 ? 140  GLU D CG    1 
ATOM   8536  C CD    . GLU D 1 162 ? -4.353  -14.941 -123.459 1.00 32.60 ? 140  GLU D CD    1 
ATOM   8537  O OE1   . GLU D 1 162 ? -4.644  -14.590 -124.634 1.00 35.78 ? 140  GLU D OE1   1 
ATOM   8538  O OE2   . GLU D 1 162 ? -3.222  -14.779 -122.966 1.00 36.04 ? 140  GLU D OE2   1 
ATOM   8539  N N     . PHE D 1 163 ? -8.587  -12.279 -121.600 1.00 18.07 ? 141  PHE D N     1 
ATOM   8540  C CA    . PHE D 1 163 ? -9.843  -11.581 -121.767 1.00 18.93 ? 141  PHE D CA    1 
ATOM   8541  C C     . PHE D 1 163 ? -9.590  -10.105 -122.093 1.00 19.38 ? 141  PHE D C     1 
ATOM   8542  O O     . PHE D 1 163 ? -10.275 -9.501  -122.908 1.00 19.94 ? 141  PHE D O     1 
ATOM   8543  C CB    . PHE D 1 163 ? -10.693 -11.713 -120.510 1.00 18.99 ? 141  PHE D CB    1 
ATOM   8544  C CG    . PHE D 1 163 ? -11.961 -10.927 -120.568 1.00 19.22 ? 141  PHE D CG    1 
ATOM   8545  C CD1   . PHE D 1 163 ? -12.958 -11.270 -121.475 1.00 19.98 ? 141  PHE D CD1   1 
ATOM   8546  C CD2   . PHE D 1 163 ? -12.157 -9.830  -119.726 1.00 19.36 ? 141  PHE D CD2   1 
ATOM   8547  C CE1   . PHE D 1 163 ? -14.130 -10.535 -121.556 1.00 18.39 ? 141  PHE D CE1   1 
ATOM   8548  C CE2   . PHE D 1 163 ? -13.334 -9.101  -119.784 1.00 21.42 ? 141  PHE D CE2   1 
ATOM   8549  C CZ    . PHE D 1 163 ? -14.327 -9.454  -120.716 1.00 19.91 ? 141  PHE D CZ    1 
ATOM   8550  N N     . VAL D 1 164 ? -8.589  -9.534  -121.450 1.00 19.81 ? 142  VAL D N     1 
ATOM   8551  C CA    . VAL D 1 164 ? -8.140  -8.186  -121.761 1.00 20.98 ? 142  VAL D CA    1 
ATOM   8552  C C     . VAL D 1 164 ? -7.633  -8.083  -123.195 1.00 20.39 ? 142  VAL D C     1 
ATOM   8553  O O     . VAL D 1 164 ? -8.019  -7.155  -123.910 1.00 22.20 ? 142  VAL D O     1 
ATOM   8554  C CB    . VAL D 1 164 ? -7.080  -7.718  -120.731 1.00 21.52 ? 142  VAL D CB    1 
ATOM   8555  C CG1   . VAL D 1 164 ? -6.291  -6.480  -121.215 1.00 23.53 ? 142  VAL D CG1   1 
ATOM   8556  C CG2   . VAL D 1 164 ? -7.763  -7.439  -119.407 1.00 18.18 ? 142  VAL D CG2   1 
ATOM   8557  N N     . LYS D 1 165 ? -6.795  -9.027  -123.617 1.00 19.39 ? 143  LYS D N     1 
ATOM   8558  C CA    . LYS D 1 165 ? -6.346  -9.101  -125.013 1.00 18.97 ? 143  LYS D CA    1 
ATOM   8559  C C     . LYS D 1 165 ? -7.499  -9.094  -126.010 1.00 19.31 ? 143  LYS D C     1 
ATOM   8560  O O     . LYS D 1 165 ? -7.411  -8.441  -127.062 1.00 19.90 ? 143  LYS D O     1 
ATOM   8561  C CB    . LYS D 1 165 ? -5.513  -10.366 -125.238 1.00 19.32 ? 143  LYS D CB    1 
ATOM   8562  C CG    . LYS D 1 165 ? -4.087  -10.255 -124.752 1.00 22.39 ? 143  LYS D CG    1 
ATOM   8563  C CD    . LYS D 1 165 ? -3.276  -11.479 -125.105 1.00 21.32 ? 143  LYS D CD    1 
ATOM   8564  C CE    . LYS D 1 165 ? -1.972  -11.473 -124.316 1.00 29.78 ? 143  LYS D CE    1 
ATOM   8565  N NZ    . LYS D 1 165 ? -1.272  -12.792 -124.271 1.00 30.58 ? 143  LYS D NZ    1 
ATOM   8566  N N     . LEU D 1 166 ? -8.559  -9.834  -125.672 1.00 19.03 ? 144  LEU D N     1 
ATOM   8567  C CA    . LEU D 1 166 ? -9.743  -9.967  -126.520 1.00 18.90 ? 144  LEU D CA    1 
ATOM   8568  C C     . LEU D 1 166 ? -10.551 -8.684  -126.596 1.00 18.06 ? 144  LEU D C     1 
ATOM   8569  O O     . LEU D 1 166 ? -10.986 -8.268  -127.671 1.00 19.49 ? 144  LEU D O     1 
ATOM   8570  C CB    . LEU D 1 166 ? -10.646 -11.091 -126.024 1.00 17.92 ? 144  LEU D CB    1 
ATOM   8571  C CG    . LEU D 1 166 ? -11.909 -11.350 -126.869 1.00 18.14 ? 144  LEU D CG    1 
ATOM   8572  C CD1   . LEU D 1 166 ? -11.584 -11.639 -128.318 1.00 13.37 ? 144  LEU D CD1   1 
ATOM   8573  C CD2   . LEU D 1 166 ? -12.746 -12.482 -126.293 1.00 16.56 ? 144  LEU D CD2   1 
ATOM   8574  N N     . VAL D 1 167 ? -10.771 -8.070  -125.448 1.00 18.19 ? 145  VAL D N     1 
ATOM   8575  C CA    . VAL D 1 167 ? -11.522 -6.811  -125.382 1.00 17.63 ? 145  VAL D CA    1 
ATOM   8576  C C     . VAL D 1 167 ? -10.763 -5.695  -126.129 1.00 15.89 ? 145  VAL D C     1 
ATOM   8577  O O     . VAL D 1 167 ? -11.381 -4.886  -126.831 1.00 15.07 ? 145  VAL D O     1 
ATOM   8578  C CB    . VAL D 1 167 ? -11.850 -6.403  -123.898 1.00 17.47 ? 145  VAL D CB    1 
ATOM   8579  C CG1   . VAL D 1 167 ? -12.572 -5.046  -123.833 1.00 18.97 ? 145  VAL D CG1   1 
ATOM   8580  C CG2   . VAL D 1 167 ? -12.725 -7.459  -123.240 1.00 16.77 ? 145  VAL D CG2   1 
ATOM   8581  N N     . ARG D 1 168 ? -9.437  -5.666  -125.965 1.00 14.82 ? 146  ARG D N     1 
ATOM   8582  C CA    . ARG D 1 168 ? -8.574  -4.745  -126.699 1.00 14.40 ? 146  ARG D CA    1 
ATOM   8583  C C     . ARG D 1 168 ? -8.770  -4.921  -128.208 1.00 14.48 ? 146  ARG D C     1 
ATOM   8584  O O     . ARG D 1 168 ? -9.007  -3.948  -128.936 1.00 16.68 ? 146  ARG D O     1 
ATOM   8585  C CB    . ARG D 1 168 ? -7.109  -4.978  -126.294 1.00 15.31 ? 146  ARG D CB    1 
ATOM   8586  C CG    . ARG D 1 168 ? -6.031  -4.216  -127.095 1.00 18.12 ? 146  ARG D CG    1 
ATOM   8587  C CD    . ARG D 1 168 ? -6.337  -2.715  -127.337 1.00 20.06 ? 146  ARG D CD    1 
ATOM   8588  N NE    . ARG D 1 168 ? -6.331  -1.913  -126.117 1.00 19.52 ? 146  ARG D NE    1 
ATOM   8589  C CZ    . ARG D 1 168 ? -7.266  -1.034  -125.744 1.00 19.51 ? 146  ARG D CZ    1 
ATOM   8590  N NH1   . ARG D 1 168 ? -8.330  -0.783  -126.482 1.00 23.19 ? 146  ARG D NH1   1 
ATOM   8591  N NH2   . ARG D 1 168 ? -7.122  -0.371  -124.609 1.00 21.48 ? 146  ARG D NH2   1 
ATOM   8592  N N     . ALA D 1 169 ? -8.694  -6.170  -128.663 1.00 13.88 ? 147  ALA D N     1 
ATOM   8593  C CA    . ALA D 1 169 ? -8.852  -6.507  -130.073 1.00 11.69 ? 147  ALA D CA    1 
ATOM   8594  C C     . ALA D 1 169 ? -10.235 -6.129  -130.579 1.00 11.90 ? 147  ALA D C     1 
ATOM   8595  O O     . ALA D 1 169 ? -10.373 -5.582  -131.668 1.00 12.97 ? 147  ALA D O     1 
ATOM   8596  C CB    . ALA D 1 169 ? -8.627  -7.989  -130.272 1.00 11.97 ? 147  ALA D CB    1 
ATOM   8597  N N     . LYS D 1 170 ? -11.258 -6.443  -129.793 1.00 12.23 ? 148  LYS D N     1 
ATOM   8598  C CA    . LYS D 1 170 ? -12.647 -6.132  -130.152 1.00 13.58 ? 148  LYS D CA    1 
ATOM   8599  C C     . LYS D 1 170 ? -12.935 -4.640  -130.202 1.00 15.68 ? 148  LYS D C     1 
ATOM   8600  O O     . LYS D 1 170 ? -13.703 -4.200  -131.060 1.00 16.75 ? 148  LYS D O     1 
ATOM   8601  C CB    . LYS D 1 170 ? -13.637 -6.765  -129.163 1.00 14.15 ? 148  LYS D CB    1 
ATOM   8602  C CG    . LYS D 1 170 ? -13.852 -8.261  -129.345 1.00 18.81 ? 148  LYS D CG    1 
ATOM   8603  C CD    . LYS D 1 170 ? -14.808 -8.835  -128.300 1.00 19.79 ? 148  LYS D CD    1 
ATOM   8604  C CE    . LYS D 1 170 ? -16.262 -8.455  -128.572 1.00 22.57 ? 148  LYS D CE    1 
ATOM   8605  N NZ    . LYS D 1 170 ? -16.765 -8.910  -129.931 1.00 22.04 ? 148  LYS D NZ    1 
ATOM   8606  N N     . PHE D 1 171 ? -12.336 -3.878  -129.277 1.00 17.05 ? 149  PHE D N     1 
ATOM   8607  C CA    . PHE D 1 171 ? -12.550 -2.426  -129.172 1.00 17.32 ? 149  PHE D CA    1 
ATOM   8608  C C     . PHE D 1 171 ? -11.216 -1.639  -129.122 1.00 17.54 ? 149  PHE D C     1 
ATOM   8609  O O     . PHE D 1 171 ? -10.865 -1.085  -128.085 1.00 18.06 ? 149  PHE D O     1 
ATOM   8610  C CB    . PHE D 1 171 ? -13.395 -2.100  -127.931 1.00 17.52 ? 149  PHE D CB    1 
ATOM   8611  C CG    . PHE D 1 171 ? -14.660 -2.909  -127.816 1.00 20.66 ? 149  PHE D CG    1 
ATOM   8612  C CD1   . PHE D 1 171 ? -15.792 -2.575  -128.562 1.00 19.07 ? 149  PHE D CD1   1 
ATOM   8613  C CD2   . PHE D 1 171 ? -14.723 -4.004  -126.944 1.00 22.12 ? 149  PHE D CD2   1 
ATOM   8614  C CE1   . PHE D 1 171 ? -16.963 -3.318  -128.451 1.00 20.46 ? 149  PHE D CE1   1 
ATOM   8615  C CE2   . PHE D 1 171 ? -15.899 -4.754  -126.815 1.00 21.23 ? 149  PHE D CE2   1 
ATOM   8616  C CZ    . PHE D 1 171 ? -17.017 -4.412  -127.565 1.00 22.72 ? 149  PHE D CZ    1 
ATOM   8617  N N     . PRO D 1 172 ? -10.493 -1.553  -130.262 1.00 18.09 ? 150  PRO D N     1 
ATOM   8618  C CA    . PRO D 1 172 ? -9.119  -1.015  -130.272 1.00 18.31 ? 150  PRO D CA    1 
ATOM   8619  C C     . PRO D 1 172 ? -8.986  0.450   -129.891 1.00 18.38 ? 150  PRO D C     1 
ATOM   8620  O O     . PRO D 1 172 ? -7.889  0.885   -129.581 1.00 16.61 ? 150  PRO D O     1 
ATOM   8621  C CB    . PRO D 1 172 ? -8.663  -1.238  -131.723 1.00 17.27 ? 150  PRO D CB    1 
ATOM   8622  C CG    . PRO D 1 172 ? -9.908  -1.369  -132.511 1.00 17.97 ? 150  PRO D CG    1 
ATOM   8623  C CD    . PRO D 1 172 ? -10.933 -1.963  -131.611 1.00 17.30 ? 150  PRO D CD    1 
ATOM   8624  N N     . GLU D 1 173 ? -10.090 1.191   -129.918 1.00 20.70 ? 151  GLU D N     1 
ATOM   8625  C CA    . GLU D 1 173 ? -10.074 2.624   -129.651 1.00 22.72 ? 151  GLU D CA    1 
ATOM   8626  C C     . GLU D 1 173 ? -10.790 2.996   -128.364 1.00 22.78 ? 151  GLU D C     1 
ATOM   8627  O O     . GLU D 1 173 ? -10.878 4.179   -128.026 1.00 22.45 ? 151  GLU D O     1 
ATOM   8628  C CB    . GLU D 1 173 ? -10.691 3.386   -130.816 1.00 25.05 ? 151  GLU D CB    1 
ATOM   8629  C CG    . GLU D 1 173 ? -10.124 2.972   -132.176 1.00 28.51 ? 151  GLU D CG    1 
ATOM   8630  C CD    . GLU D 1 173 ? -10.549 3.890   -133.274 1.00 35.38 ? 151  GLU D CD    1 
ATOM   8631  O OE1   . GLU D 1 173 ? -11.345 4.809   -132.999 1.00 41.55 ? 151  GLU D OE1   1 
ATOM   8632  O OE2   . GLU D 1 173 ? -10.085 3.702   -134.418 1.00 43.24 ? 151  GLU D OE2   1 
ATOM   8633  N N     . HIS D 1 174 ? -11.291 1.989   -127.644 1.00 22.30 ? 152  HIS D N     1 
ATOM   8634  C CA    . HIS D 1 174 ? -11.873 2.210   -126.312 1.00 20.94 ? 152  HIS D CA    1 
ATOM   8635  C C     . HIS D 1 174 ? -10.792 2.141   -125.261 1.00 19.76 ? 152  HIS D C     1 
ATOM   8636  O O     . HIS D 1 174 ? -9.828  1.422   -125.417 1.00 19.27 ? 152  HIS D O     1 
ATOM   8637  C CB    . HIS D 1 174 ? -13.015 1.224   -126.026 1.00 21.02 ? 152  HIS D CB    1 
ATOM   8638  C CG    . HIS D 1 174 ? -14.258 1.532   -126.802 1.00 15.88 ? 152  HIS D CG    1 
ATOM   8639  N ND1   . HIS D 1 174 ? -14.308 1.456   -128.179 1.00 16.41 ? 152  HIS D ND1   1 
ATOM   8640  C CD2   . HIS D 1 174 ? -15.474 1.965   -126.402 1.00 12.05 ? 152  HIS D CD2   1 
ATOM   8641  C CE1   . HIS D 1 174 ? -15.510 1.814   -128.593 1.00 16.78 ? 152  HIS D CE1   1 
ATOM   8642  N NE2   . HIS D 1 174 ? -16.236 2.131   -127.535 1.00 20.00 ? 152  HIS D NE2   1 
ATOM   8643  N N     . THR D 1 175 ? -10.943 2.943   -124.217 1.00 19.19 ? 153  THR D N     1 
ATOM   8644  C CA    . THR D 1 175 ? -9.998  2.936   -123.102 1.00 17.22 ? 153  THR D CA    1 
ATOM   8645  C C     . THR D 1 175 ? -10.428 1.909   -122.092 1.00 15.90 ? 153  THR D C     1 
ATOM   8646  O O     . THR D 1 175 ? -11.580 1.899   -121.667 1.00 12.87 ? 153  THR D O     1 
ATOM   8647  C CB    . THR D 1 175 ? -9.857  4.318   -122.448 1.00 17.06 ? 153  THR D CB    1 
ATOM   8648  O OG1   . THR D 1 175 ? -9.108  5.164   -123.330 1.00 9.98  ? 153  THR D OG1   1 
ATOM   8649  C CG2   . THR D 1 175 ? -9.128  4.224   -121.106 1.00 14.67 ? 153  THR D CG2   1 
ATOM   8650  N N     . ILE D 1 176 ? -9.495  1.038   -121.727 1.00 17.67 ? 154  ILE D N     1 
ATOM   8651  C CA    . ILE D 1 176 ? -9.818  -0.117  -120.872 1.00 17.75 ? 154  ILE D CA    1 
ATOM   8652  C C     . ILE D 1 176 ? -9.267  -0.006  -119.464 1.00 17.57 ? 154  ILE D C     1 
ATOM   8653  O O     . ILE D 1 176 ? -8.065  0.086   -119.258 1.00 13.98 ? 154  ILE D O     1 
ATOM   8654  C CB    . ILE D 1 176 ? -9.395  -1.455  -121.498 1.00 17.07 ? 154  ILE D CB    1 
ATOM   8655  C CG1   . ILE D 1 176 ? -10.170 -1.672  -122.803 1.00 18.38 ? 154  ILE D CG1   1 
ATOM   8656  C CG2   . ILE D 1 176 ? -9.690  -2.603  -120.555 1.00 18.61 ? 154  ILE D CG2   1 
ATOM   8657  C CD1   . ILE D 1 176 ? -9.839  -2.953  -123.516 1.00 16.00 ? 154  ILE D CD1   1 
ATOM   8658  N N     . MET D 1 177 ? -10.204 0.004   -118.512 1.00 20.49 ? 155  MET D N     1 
ATOM   8659  C CA    . MET D 1 177 ? -9.940  -0.158  -117.077 1.00 21.78 ? 155  MET D CA    1 
ATOM   8660  C C     . MET D 1 177 ? -10.079 -1.637  -116.756 1.00 22.12 ? 155  MET D C     1 
ATOM   8661  O O     . MET D 1 177 ? -11.048 -2.269  -117.179 1.00 23.19 ? 155  MET D O     1 
ATOM   8662  C CB    . MET D 1 177 ? -10.940 0.652   -116.233 1.00 22.36 ? 155  MET D CB    1 
ATOM   8663  C CG    . MET D 1 177 ? -10.715 2.152   -116.304 1.00 23.66 ? 155  MET D CG    1 
ATOM   8664  S SD    . MET D 1 177 ? -12.100 3.270   -115.910 1.00 32.38 ? 155  MET D SD    1 
ATOM   8665  C CE    . MET D 1 177 ? -13.147 2.327   -114.826 1.00 27.18 ? 155  MET D CE    1 
ATOM   8666  N N     . ALA D 1 178 ? -9.104  -2.181  -116.031 1.00 22.19 ? 156  ALA D N     1 
ATOM   8667  C CA    . ALA D 1 178 ? -9.043  -3.614  -115.722 1.00 21.40 ? 156  ALA D CA    1 
ATOM   8668  C C     . ALA D 1 178 ? -8.525  -3.831  -114.313 1.00 20.56 ? 156  ALA D C     1 
ATOM   8669  O O     . ALA D 1 178 ? -7.454  -3.368  -113.970 1.00 20.04 ? 156  ALA D O     1 
ATOM   8670  C CB    . ALA D 1 178 ? -8.128  -4.310  -116.694 1.00 21.03 ? 156  ALA D CB    1 
ATOM   8671  N N     . GLY D 1 179 ? -9.249  -4.584  -113.507 1.00 20.33 ? 157  GLY D N     1 
ATOM   8672  C CA    . GLY D 1 179 ? -8.762  -4.899  -112.189 1.00 18.89 ? 157  GLY D CA    1 
ATOM   8673  C C     . GLY D 1 179 ? -9.332  -6.157  -111.595 1.00 17.02 ? 157  GLY D C     1 
ATOM   8674  O O     . GLY D 1 179 ? -10.131 -6.825  -112.224 1.00 16.06 ? 157  GLY D O     1 
ATOM   8675  N N     . ASN D 1 180 ? -8.945  -6.466  -110.358 1.00 18.72 ? 158  ASN D N     1 
ATOM   8676  C CA    . ASN D 1 180 ? -8.035  -5.619  -109.566 1.00 18.81 ? 158  ASN D CA    1 
ATOM   8677  C C     . ASN D 1 180 ? -6.741  -6.346  -109.236 1.00 18.07 ? 158  ASN D C     1 
ATOM   8678  O O     . ASN D 1 180 ? -6.720  -7.559  -109.115 1.00 17.30 ? 158  ASN D O     1 
ATOM   8679  C CB    . ASN D 1 180 ? -8.715  -5.158  -108.273 1.00 19.13 ? 158  ASN D CB    1 
ATOM   8680  C CG    . ASN D 1 180 ? -9.833  -4.152  -108.509 1.00 16.64 ? 158  ASN D CG    1 
ATOM   8681  O OD1   . ASN D 1 180 ? -10.421 -4.105  -109.574 1.00 20.14 ? 158  ASN D OD1   1 
ATOM   8682  N ND2   . ASN D 1 180 ? -10.142 -3.354  -107.493 1.00 12.41 ? 158  ASN D ND2   1 
ATOM   8683  N N     . VAL D 1 181 ? -5.667  -5.586  -109.090 1.00 18.64 ? 159  VAL D N     1 
ATOM   8684  C CA    . VAL D 1 181 ? -4.378  -6.115  -108.643 1.00 18.75 ? 159  VAL D CA    1 
ATOM   8685  C C     . VAL D 1 181 ? -3.778  -5.204  -107.560 1.00 18.66 ? 159  VAL D C     1 
ATOM   8686  O O     . VAL D 1 181 ? -4.340  -4.160  -107.259 1.00 18.36 ? 159  VAL D O     1 
ATOM   8687  C CB    . VAL D 1 181 ? -3.371  -6.279  -109.806 1.00 16.47 ? 159  VAL D CB    1 
ATOM   8688  C CG1   . VAL D 1 181 ? -3.974  -7.081  -110.897 1.00 13.29 ? 159  VAL D CG1   1 
ATOM   8689  C CG2   . VAL D 1 181 ? -2.915  -4.940  -110.323 1.00 19.81 ? 159  VAL D CG2   1 
ATOM   8690  N N     . VAL D 1 182 ? -2.660  -5.628  -106.962 1.00 17.89 ? 160  VAL D N     1 
ATOM   8691  C CA    . VAL D 1 182 ? -1.982  -4.835  -105.923 1.00 17.40 ? 160  VAL D CA    1 
ATOM   8692  C C     . VAL D 1 182 ? -0.465  -4.820  -106.097 1.00 18.26 ? 160  VAL D C     1 
ATOM   8693  O O     . VAL D 1 182 ? 0.255   -4.226  -105.271 1.00 16.23 ? 160  VAL D O     1 
ATOM   8694  C CB    . VAL D 1 182 ? -2.318  -5.295  -104.479 1.00 16.69 ? 160  VAL D CB    1 
ATOM   8695  C CG1   . VAL D 1 182 ? -3.747  -4.915  -104.125 1.00 19.14 ? 160  VAL D CG1   1 
ATOM   8696  C CG2   . VAL D 1 182 ? -2.074  -6.798  -104.282 1.00 16.83 ? 160  VAL D CG2   1 
ATOM   8697  N N     . THR D 1 183 ? 0.022   -5.441  -107.178 1.00 18.36 ? 161  THR D N     1 
ATOM   8698  C CA    . THR D 1 183 ? 1.459   -5.573  -107.381 1.00 20.43 ? 161  THR D CA    1 
ATOM   8699  C C     . THR D 1 183 ? 1.876   -5.262  -108.820 1.00 20.26 ? 161  THR D C     1 
ATOM   8700  O O     . THR D 1 183 ? 1.129   -5.489  -109.773 1.00 21.26 ? 161  THR D O     1 
ATOM   8701  C CB    . THR D 1 183 ? 1.962   -6.944  -106.935 1.00 20.58 ? 161  THR D CB    1 
ATOM   8702  O OG1   . THR D 1 183 ? 1.321   -7.974  -107.691 1.00 18.67 ? 161  THR D OG1   1 
ATOM   8703  C CG2   . THR D 1 183 ? 1.667   -7.138  -105.442 1.00 22.47 ? 161  THR D CG2   1 
ATOM   8704  N N     . GLY D 1 184 ? 3.078   -4.726  -108.954 1.00 19.64 ? 162  GLY D N     1 
ATOM   8705  C CA    . GLY D 1 184 ? 3.529   -4.149  -110.199 1.00 20.99 ? 162  GLY D CA    1 
ATOM   8706  C C     . GLY D 1 184 ? 3.741   -5.086  -111.363 1.00 21.12 ? 162  GLY D C     1 
ATOM   8707  O O     . GLY D 1 184 ? 3.598   -4.671  -112.524 1.00 22.27 ? 162  GLY D O     1 
ATOM   8708  N N     . GLU D 1 185 ? 4.096   -6.337  -111.084 1.00 20.20 ? 163  GLU D N     1 
ATOM   8709  C CA    . GLU D 1 185 ? 4.324   -7.298  -112.158 1.00 19.15 ? 163  GLU D CA    1 
ATOM   8710  C C     . GLU D 1 185 ? 3.032   -7.554  -112.914 1.00 18.26 ? 163  GLU D C     1 
ATOM   8711  O O     . GLU D 1 185 ? 3.055   -7.727  -114.141 1.00 18.89 ? 163  GLU D O     1 
ATOM   8712  C CB    . GLU D 1 185 ? 4.953   -8.607  -111.647 1.00 20.12 ? 163  GLU D CB    1 
ATOM   8713  C CG    . GLU D 1 185 ? 4.000   -9.767  -111.246 1.00 22.89 ? 163  GLU D CG    1 
ATOM   8714  C CD    . GLU D 1 185 ? 3.327   -9.574  -109.887 1.00 26.17 ? 163  GLU D CD    1 
ATOM   8715  O OE1   . GLU D 1 185 ? 3.470   -8.482  -109.288 1.00 30.04 ? 163  GLU D OE1   1 
ATOM   8716  O OE2   . GLU D 1 185 ? 2.656   -10.522 -109.413 1.00 26.00 ? 163  GLU D OE2   1 
ATOM   8717  N N     . MET D 1 186 ? 1.910   -7.584  -112.197 1.00 16.94 ? 164  MET D N     1 
ATOM   8718  C CA    . MET D 1 186 ? 0.614   -7.823  -112.821 1.00 16.77 ? 164  MET D CA    1 
ATOM   8719  C C     . MET D 1 186 ? 0.104   -6.568  -113.501 1.00 16.94 ? 164  MET D C     1 
ATOM   8720  O O     . MET D 1 186 ? -0.617  -6.650  -114.499 1.00 17.52 ? 164  MET D O     1 
ATOM   8721  C CB    . MET D 1 186 ? -0.400  -8.313  -111.801 1.00 15.89 ? 164  MET D CB    1 
ATOM   8722  C CG    . MET D 1 186 ? -1.513  -9.091  -112.444 1.00 16.47 ? 164  MET D CG    1 
ATOM   8723  S SD    . MET D 1 186 ? -0.859  -10.477 -113.371 1.00 26.00 ? 164  MET D SD    1 
ATOM   8724  C CE    . MET D 1 186 ? -2.188  -10.808 -114.521 1.00 21.71 ? 164  MET D CE    1 
ATOM   8725  N N     . VAL D 1 187 ? 0.475   -5.407  -112.958 1.00 16.46 ? 165  VAL D N     1 
ATOM   8726  C CA    . VAL D 1 187 ? 0.186   -4.127  -113.591 1.00 15.88 ? 165  VAL D CA    1 
ATOM   8727  C C     . VAL D 1 187 ? 0.823   -4.121  -114.982 1.00 16.15 ? 165  VAL D C     1 
ATOM   8728  O O     . VAL D 1 187 ? 0.139   -3.869  -115.973 1.00 16.82 ? 165  VAL D O     1 
ATOM   8729  C CB    . VAL D 1 187 ? 0.673   -2.973  -112.678 1.00 16.55 ? 165  VAL D CB    1 
ATOM   8730  C CG1   . VAL D 1 187 ? 0.828   -1.634  -113.427 1.00 17.88 ? 165  VAL D CG1   1 
ATOM   8731  C CG2   . VAL D 1 187 ? -0.294  -2.829  -111.500 1.00 18.85 ? 165  VAL D CG2   1 
ATOM   8732  N N     . GLU D 1 188 ? 2.109   -4.448  -115.063 1.00 16.51 ? 166  GLU D N     1 
ATOM   8733  C CA    . GLU D 1 188 ? 2.783   -4.498  -116.348 1.00 17.89 ? 166  GLU D CA    1 
ATOM   8734  C C     . GLU D 1 188 ? 2.129   -5.487  -117.288 1.00 18.89 ? 166  GLU D C     1 
ATOM   8735  O O     . GLU D 1 188 ? 1.926   -5.194  -118.466 1.00 20.06 ? 166  GLU D O     1 
ATOM   8736  C CB    . GLU D 1 188 ? 4.259   -4.846  -116.181 1.00 18.70 ? 166  GLU D CB    1 
ATOM   8737  C CG    . GLU D 1 188 ? 5.031   -3.711  -115.571 1.00 23.97 ? 166  GLU D CG    1 
ATOM   8738  C CD    . GLU D 1 188 ? 6.334   -4.165  -115.029 1.00 33.45 ? 166  GLU D CD    1 
ATOM   8739  O OE1   . GLU D 1 188 ? 7.129   -4.710  -115.839 1.00 35.30 ? 166  GLU D OE1   1 
ATOM   8740  O OE2   . GLU D 1 188 ? 6.542   -3.989  -113.801 1.00 30.07 ? 166  GLU D OE2   1 
ATOM   8741  N N     . GLU D 1 189 ? 1.802   -6.665  -116.777 1.00 18.43 ? 167  GLU D N     1 
ATOM   8742  C CA    . GLU D 1 189 ? 1.273   -7.709  -117.624 1.00 18.76 ? 167  GLU D CA    1 
ATOM   8743  C C     . GLU D 1 189 ? -0.027  -7.281  -118.243 1.00 18.55 ? 167  GLU D C     1 
ATOM   8744  O O     . GLU D 1 189 ? -0.247  -7.478  -119.419 1.00 18.52 ? 167  GLU D O     1 
ATOM   8745  C CB    . GLU D 1 189 ? 1.026   -8.988  -116.823 1.00 20.73 ? 167  GLU D CB    1 
ATOM   8746  C CG    . GLU D 1 189 ? 0.999   -10.211 -117.703 1.00 26.11 ? 167  GLU D CG    1 
ATOM   8747  C CD    . GLU D 1 189 ? 2.267   -10.314 -118.547 1.00 34.34 ? 167  GLU D CD    1 
ATOM   8748  O OE1   . GLU D 1 189 ? 3.298   -9.740  -118.110 1.00 31.88 ? 167  GLU D OE1   1 
ATOM   8749  O OE2   . GLU D 1 189 ? 2.221   -10.942 -119.634 1.00 37.25 ? 167  GLU D OE2   1 
ATOM   8750  N N     . LEU D 1 190 ? -0.884  -6.690  -117.429 1.00 19.68 ? 168  LEU D N     1 
ATOM   8751  C CA    . LEU D 1 190 ? -2.205  -6.258  -117.876 1.00 20.32 ? 168  LEU D CA    1 
ATOM   8752  C C     . LEU D 1 190 ? -2.126  -5.100  -118.841 1.00 19.99 ? 168  LEU D C     1 
ATOM   8753  O O     . LEU D 1 190 ? -2.952  -4.997  -119.750 1.00 19.03 ? 168  LEU D O     1 
ATOM   8754  C CB    . LEU D 1 190 ? -3.095  -5.868  -116.677 1.00 20.54 ? 168  LEU D CB    1 
ATOM   8755  C CG    . LEU D 1 190 ? -3.513  -7.027  -115.753 1.00 21.02 ? 168  LEU D CG    1 
ATOM   8756  C CD1   . LEU D 1 190 ? -4.329  -6.513  -114.596 1.00 23.80 ? 168  LEU D CD1   1 
ATOM   8757  C CD2   . LEU D 1 190 ? -4.289  -8.106  -116.510 1.00 23.57 ? 168  LEU D CD2   1 
ATOM   8758  N N     . ILE D 1 191 ? -1.143  -4.221  -118.643 1.00 19.88 ? 169  ILE D N     1 
ATOM   8759  C CA    . ILE D 1 191 ? -0.948  -3.097  -119.557 1.00 20.25 ? 169  ILE D CA    1 
ATOM   8760  C C     . ILE D 1 191 ? -0.393  -3.590  -120.879 1.00 20.94 ? 169  ILE D C     1 
ATOM   8761  O O     . ILE D 1 191 ? -0.877  -3.201  -121.942 1.00 21.76 ? 169  ILE D O     1 
ATOM   8762  C CB    . ILE D 1 191 ? -0.051  -1.998  -118.950 1.00 21.39 ? 169  ILE D CB    1 
ATOM   8763  C CG1   . ILE D 1 191 ? -0.813  -1.300  -117.807 1.00 19.49 ? 169  ILE D CG1   1 
ATOM   8764  C CG2   . ILE D 1 191 ? 0.343   -0.967  -120.016 1.00 21.42 ? 169  ILE D CG2   1 
ATOM   8765  C CD1   . ILE D 1 191 ? -0.023  -0.233  -117.060 1.00 18.86 ? 169  ILE D CD1   1 
ATOM   8766  N N     . LEU D 1 192 ? 0.602   -4.466  -120.816 1.00 21.73 ? 170  LEU D N     1 
ATOM   8767  C CA    . LEU D 1 192 ? 1.165   -5.051  -122.033 1.00 21.68 ? 170  LEU D CA    1 
ATOM   8768  C C     . LEU D 1 192 ? 0.128   -5.887  -122.778 1.00 21.26 ? 170  LEU D C     1 
ATOM   8769  O O     . LEU D 1 192 ? 0.212   -6.042  -123.993 1.00 21.70 ? 170  LEU D O     1 
ATOM   8770  C CB    . LEU D 1 192 ? 2.436   -5.866  -121.729 1.00 21.46 ? 170  LEU D CB    1 
ATOM   8771  C CG    . LEU D 1 192 ? 3.604   -5.031  -121.175 1.00 22.42 ? 170  LEU D CG    1 
ATOM   8772  C CD1   . LEU D 1 192 ? 4.758   -5.910  -120.742 1.00 21.33 ? 170  LEU D CD1   1 
ATOM   8773  C CD2   . LEU D 1 192 ? 4.058   -3.998  -122.186 1.00 25.02 ? 170  LEU D CD2   1 
ATOM   8774  N N     . SER D 1 193 ? -0.853  -6.404  -122.049 1.00 20.79 ? 171  SER D N     1 
ATOM   8775  C CA    . SER D 1 193 ? -1.921  -7.190  -122.645 1.00 19.78 ? 171  SER D CA    1 
ATOM   8776  C C     . SER D 1 193 ? -3.079  -6.357  -123.211 1.00 18.58 ? 171  SER D C     1 
ATOM   8777  O O     . SER D 1 193 ? -3.949  -6.892  -123.889 1.00 19.07 ? 171  SER D O     1 
ATOM   8778  C CB    . SER D 1 193 ? -2.423  -8.212  -121.633 1.00 20.09 ? 171  SER D CB    1 
ATOM   8779  O OG    . SER D 1 193 ? -1.362  -9.092  -121.293 1.00 18.09 ? 171  SER D OG    1 
ATOM   8780  N N     . GLY D 1 194 ? -3.079  -5.052  -122.959 1.00 17.56 ? 172  GLY D N     1 
ATOM   8781  C CA    . GLY D 1 194 ? -4.007  -4.130  -123.623 1.00 17.06 ? 172  GLY D CA    1 
ATOM   8782  C C     . GLY D 1 194 ? -4.803  -3.182  -122.737 1.00 18.02 ? 172  GLY D C     1 
ATOM   8783  O O     . GLY D 1 194 ? -5.486  -2.292  -123.248 1.00 18.06 ? 172  GLY D O     1 
ATOM   8784  N N     . ALA D 1 195 ? -4.737  -3.352  -121.420 1.00 17.24 ? 173  ALA D N     1 
ATOM   8785  C CA    . ALA D 1 195 ? -5.476  -2.470  -120.528 1.00 17.20 ? 173  ALA D CA    1 
ATOM   8786  C C     . ALA D 1 195 ? -4.736  -1.154  -120.462 1.00 16.67 ? 173  ALA D C     1 
ATOM   8787  O O     . ALA D 1 195 ? -3.507  -1.138  -120.466 1.00 17.43 ? 173  ALA D O     1 
ATOM   8788  C CB    . ALA D 1 195 ? -5.609  -3.070  -119.139 1.00 18.55 ? 173  ALA D CB    1 
ATOM   8789  N N     . ASP D 1 196 ? -5.476  -0.054  -120.420 1.00 16.77 ? 174  ASP D N     1 
ATOM   8790  C CA    . ASP D 1 196 ? -4.863  1.263   -120.335 1.00 16.77 ? 174  ASP D CA    1 
ATOM   8791  C C     . ASP D 1 196 ? -4.694  1.668   -118.887 1.00 17.58 ? 174  ASP D C     1 
ATOM   8792  O O     . ASP D 1 196 ? -3.691  2.255   -118.516 1.00 16.97 ? 174  ASP D O     1 
ATOM   8793  C CB    . ASP D 1 196 ? -5.693  2.315   -121.046 1.00 15.26 ? 174  ASP D CB    1 
ATOM   8794  C CG    . ASP D 1 196 ? -5.907  1.991   -122.487 1.00 14.74 ? 174  ASP D CG    1 
ATOM   8795  O OD1   . ASP D 1 196 ? -4.975  2.152   -123.300 1.00 8.58  ? 174  ASP D OD1   1 
ATOM   8796  O OD2   . ASP D 1 196 ? -7.024  1.558   -122.802 1.00 17.02 ? 174  ASP D OD2   1 
ATOM   8797  N N     . ILE D 1 197 ? -5.701  1.363   -118.079 1.00 18.82 ? 175  ILE D N     1 
ATOM   8798  C CA    . ILE D 1 197 ? -5.740  1.766   -116.682 1.00 19.35 ? 175  ILE D CA    1 
ATOM   8799  C C     . ILE D 1 197 ? -5.985  0.522   -115.836 1.00 20.10 ? 175  ILE D C     1 
ATOM   8800  O O     . ILE D 1 197 ? -6.912  -0.253  -116.087 1.00 19.60 ? 175  ILE D O     1 
ATOM   8801  C CB    . ILE D 1 197 ? -6.852  2.789   -116.365 1.00 18.71 ? 175  ILE D CB    1 
ATOM   8802  C CG1   . ILE D 1 197 ? -6.847  3.947   -117.361 1.00 16.67 ? 175  ILE D CG1   1 
ATOM   8803  C CG2   . ILE D 1 197 ? -6.667  3.328   -114.955 1.00 18.63 ? 175  ILE D CG2   1 
ATOM   8804  C CD1   . ILE D 1 197 ? -8.158  4.672   -117.399 1.00 18.27 ? 175  ILE D CD1   1 
ATOM   8805  N N     . ILE D 1 198 ? -5.147  0.355   -114.827 1.00 20.27 ? 176  ILE D N     1 
ATOM   8806  C CA    . ILE D 1 198 ? -5.228  -0.787  -113.943 1.00 19.33 ? 176  ILE D CA    1 
ATOM   8807  C C     . ILE D 1 198 ? -5.844  -0.380  -112.620 1.00 16.76 ? 176  ILE D C     1 
ATOM   8808  O O     . ILE D 1 198 ? -5.401  0.569   -111.971 1.00 16.30 ? 176  ILE D O     1 
ATOM   8809  C CB    . ILE D 1 198 ? -3.846  -1.404  -113.696 1.00 19.24 ? 176  ILE D CB    1 
ATOM   8810  C CG1   . ILE D 1 198 ? -3.088  -1.529  -115.026 1.00 17.79 ? 176  ILE D CG1   1 
ATOM   8811  C CG2   . ILE D 1 198 ? -4.004  -2.768  -113.002 1.00 23.90 ? 176  ILE D CG2   1 
ATOM   8812  C CD1   . ILE D 1 198 ? -3.874  -2.257  -116.112 1.00 20.53 ? 176  ILE D CD1   1 
ATOM   8813  N N     . LYS D 1 199 ? -6.885  -1.097  -112.236 1.00 15.64 ? 177  LYS D N     1 
ATOM   8814  C CA    . LYS D 1 199 ? -7.561  -0.829  -110.983 1.00 15.46 ? 177  LYS D CA    1 
ATOM   8815  C C     . LYS D 1 199 ? -6.845  -1.540  -109.837 1.00 15.48 ? 177  LYS D C     1 
ATOM   8816  O O     . LYS D 1 199 ? -6.783  -2.771  -109.785 1.00 14.91 ? 177  LYS D O     1 
ATOM   8817  C CB    . LYS D 1 199 ? -9.009  -1.263  -111.063 1.00 14.21 ? 177  LYS D CB    1 
ATOM   8818  C CG    . LYS D 1 199 ? -9.822  -0.533  -112.088 1.00 12.00 ? 177  LYS D CG    1 
ATOM   8819  C CD    . LYS D 1 199 ? -11.186 -1.199  -112.191 1.00 21.31 ? 177  LYS D CD    1 
ATOM   8820  C CE    . LYS D 1 199 ? -12.023 -0.998  -110.919 1.00 19.35 ? 177  LYS D CE    1 
ATOM   8821  N NZ    . LYS D 1 199 ? -12.535 -2.257  -110.369 1.00 16.85 ? 177  LYS D NZ    1 
ATOM   8822  N N     . VAL D 1 200 ? -6.328  -0.738  -108.911 1.00 15.52 ? 178  VAL D N     1 
ATOM   8823  C CA    . VAL D 1 200 ? -5.469  -1.223  -107.855 1.00 16.29 ? 178  VAL D CA    1 
ATOM   8824  C C     . VAL D 1 200 ? -6.196  -1.231  -106.495 1.00 16.65 ? 178  VAL D C     1 
ATOM   8825  O O     . VAL D 1 200 ? -6.696  -0.200  -106.012 1.00 14.11 ? 178  VAL D O     1 
ATOM   8826  C CB    . VAL D 1 200 ? -4.187  -0.386  -107.803 1.00 14.35 ? 178  VAL D CB    1 
ATOM   8827  C CG1   . VAL D 1 200 ? -3.308  -0.824  -106.654 1.00 13.44 ? 178  VAL D CG1   1 
ATOM   8828  C CG2   . VAL D 1 200 ? -3.457  -0.514  -109.115 1.00 13.88 ? 178  VAL D CG2   1 
ATOM   8829  N N     . GLY D 1 201 ? -6.243  -2.414  -105.889 1.00 17.58 ? 179  GLY D N     1 
ATOM   8830  C CA    . GLY D 1 201 ? -6.707  -2.545  -104.534 1.00 19.64 ? 179  GLY D CA    1 
ATOM   8831  C C     . GLY D 1 201 ? -7.392  -3.874  -104.306 1.00 20.73 ? 179  GLY D C     1 
ATOM   8832  O O     . GLY D 1 201 ? -8.373  -4.197  -104.985 1.00 23.55 ? 179  GLY D O     1 
ATOM   8833  N N     . VAL D 1 202 ? -6.890  -4.635  -103.335 1.00 20.48 ? 180  VAL D N     1 
ATOM   8834  C CA    . VAL D 1 202 ? -7.515  -5.894  -102.911 1.00 20.13 ? 180  VAL D CA    1 
ATOM   8835  C C     . VAL D 1 202 ? -7.470  -5.962  -101.377 1.00 20.51 ? 180  VAL D C     1 
ATOM   8836  O O     . VAL D 1 202 ? -6.394  -6.131  -100.790 1.00 21.14 ? 180  VAL D O     1 
ATOM   8837  C CB    . VAL D 1 202 ? -6.783  -7.157  -103.480 1.00 20.63 ? 180  VAL D CB    1 
ATOM   8838  C CG1   . VAL D 1 202 ? -7.507  -8.425  -103.051 1.00 18.20 ? 180  VAL D CG1   1 
ATOM   8839  C CG2   . VAL D 1 202 ? -6.621  -7.092  -105.028 1.00 18.84 ? 180  VAL D CG2   1 
ATOM   8840  N N     . GLY D 1 203 ? -8.624  -5.822  -100.729 1.00 20.67 ? 181  GLY D N     1 
ATOM   8841  C CA    . GLY D 1 203 ? -8.703  -5.851  -99.255  1.00 20.31 ? 181  GLY D CA    1 
ATOM   8842  C C     . GLY D 1 203 ? -9.320  -4.616  -98.617  1.00 20.16 ? 181  GLY D C     1 
ATOM   8843  O O     . GLY D 1 203 ? -10.333 -4.724  -97.901  1.00 19.89 ? 181  GLY D O     1 
ATOM   8844  N N     . PRO D 1 204 ? -8.700  -3.440  -98.830  1.00 19.35 ? 182  PRO D N     1 
ATOM   8845  C CA    . PRO D 1 204 ? -9.140  -2.162  -98.219  1.00 18.91 ? 182  PRO D CA    1 
ATOM   8846  C C     . PRO D 1 204 ? -10.564 -1.641  -98.513  1.00 18.38 ? 182  PRO D C     1 
ATOM   8847  O O     . PRO D 1 204 ? -11.043 -0.800  -97.760  1.00 19.42 ? 182  PRO D O     1 
ATOM   8848  C CB    . PRO D 1 204 ? -8.071  -1.163  -98.694  1.00 20.16 ? 182  PRO D CB    1 
ATOM   8849  C CG    . PRO D 1 204 ? -6.837  -2.063  -99.011  1.00 20.95 ? 182  PRO D CG    1 
ATOM   8850  C CD    . PRO D 1 204 ? -7.458  -3.279  -99.609  1.00 19.42 ? 182  PRO D CD    1 
ATOM   8851  N N     . GLY D 1 205 ? -11.236 -2.132  -99.556  1.00 16.72 ? 183  GLY D N     1 
ATOM   8852  C CA    . GLY D 1 205 ? -12.610 -1.708  -99.875  1.00 16.14 ? 183  GLY D CA    1 
ATOM   8853  C C     . GLY D 1 205 ? -13.584 -1.754  -98.697  1.00 13.94 ? 183  GLY D C     1 
ATOM   8854  O O     . GLY D 1 205 ? -13.616 -2.740  -98.012  1.00 11.91 ? 183  GLY D O     1 
ATOM   8855  N N     . SER D 1 206 ? -14.377 -0.701  -98.478  1.00 14.46 ? 184  SER D N     1 
ATOM   8856  C CA    . SER D 1 206 ? -15.294 -0.640  -97.317  1.00 14.41 ? 184  SER D CA    1 
ATOM   8857  C C     . SER D 1 206 ? -16.140 -1.909  -97.110  1.00 13.70 ? 184  SER D C     1 
ATOM   8858  O O     . SER D 1 206 ? -16.242 -2.384  -95.981  1.00 12.90 ? 184  SER D O     1 
ATOM   8859  C CB    . SER D 1 206 ? -16.186 0.621   -97.339  1.00 14.46 ? 184  SER D CB    1 
ATOM   8860  O OG    . SER D 1 206 ? -17.197 0.567   -98.334  1.00 15.41 ? 184  SER D OG    1 
ATOM   8861  N N     . VAL D 1 207 ? -16.689 -2.483  -98.183  1.00 14.44 ? 185  VAL D N     1 
ATOM   8862  C CA    . VAL D 1 207 ? -17.458 -3.740  -98.087  1.00 14.37 ? 185  VAL D CA    1 
ATOM   8863  C C     . VAL D 1 207 ? -16.742 -4.995  -98.646  1.00 13.83 ? 185  VAL D C     1 
ATOM   8864  O O     . VAL D 1 207 ? -17.307 -6.078  -98.623  1.00 14.97 ? 185  VAL D O     1 
ATOM   8865  C CB    . VAL D 1 207 ? -18.897 -3.595  -98.698  1.00 13.99 ? 185  VAL D CB    1 
ATOM   8866  C CG1   . VAL D 1 207 ? -19.766 -2.710  -97.800  1.00 13.21 ? 185  VAL D CG1   1 
ATOM   8867  C CG2   . VAL D 1 207 ? -18.848 -3.045  -100.099 1.00 14.72 ? 185  VAL D CG2   1 
ATOM   8868  N N     . CYS D 1 208 ? -15.504 -4.848  -99.102  1.00 13.36 ? 186  CYS D N     1 
ATOM   8869  C CA    . CYS D 1 208 ? -14.621 -5.987  -99.418  1.00 12.93 ? 186  CYS D CA    1 
ATOM   8870  C C     . CYS D 1 208 ? -14.321 -6.806  -98.148  1.00 14.28 ? 186  CYS D C     1 
ATOM   8871  O O     . CYS D 1 208 ? -14.187 -6.253  -97.049  1.00 16.83 ? 186  CYS D O     1 
ATOM   8872  C CB    . CYS D 1 208 ? -13.300 -5.474  -100.059 1.00 13.12 ? 186  CYS D CB    1 
ATOM   8873  S SG    . CYS D 1 208 ? -11.896 -6.642  -100.281 1.00 15.25 ? 186  CYS D SG    1 
ATOM   8874  N N     . THR D 1 209 ? -14.229 -8.121  -98.299  1.00 13.55 ? 187  THR D N     1 
ATOM   8875  C CA    . THR D 1 209 ? -13.979 -9.012  -97.181  1.00 11.76 ? 187  THR D CA    1 
ATOM   8876  C C     . THR D 1 209 ? -12.906 -10.069 -97.504  1.00 11.48 ? 187  THR D C     1 
ATOM   8877  O O     . THR D 1 209 ? -12.912 -11.160 -96.931  1.00 11.29 ? 187  THR D O     1 
ATOM   8878  C CB    . THR D 1 209 ? -15.291 -9.737  -96.792  1.00 11.79 ? 187  THR D CB    1 
ATOM   8879  O OG1   . THR D 1 209 ? -15.761 -10.485 -97.907  1.00 17.69 ? 187  THR D OG1   1 
ATOM   8880  C CG2   . THR D 1 209 ? -16.377 -8.765  -96.400  1.00 13.47 ? 187  THR D CG2   1 
ATOM   8881  N N     . THR D 1 210 ? -11.981 -9.763  -98.413  1.00 12.67 ? 188  THR D N     1 
ATOM   8882  C CA    . THR D 1 210 ? -10.966 -10.747 -98.799  1.00 14.08 ? 188  THR D CA    1 
ATOM   8883  C C     . THR D 1 210 ? -10.067 -11.121 -97.634  1.00 14.86 ? 188  THR D C     1 
ATOM   8884  O O     . THR D 1 210 ? -9.677  -12.275 -97.486  1.00 16.28 ? 188  THR D O     1 
ATOM   8885  C CB    . THR D 1 210 ? -10.048 -10.254 -99.904  1.00 14.67 ? 188  THR D CB    1 
ATOM   8886  O OG1   . THR D 1 210 ? -9.343  -9.092  -99.455  1.00 12.82 ? 188  THR D OG1   1 
ATOM   8887  C CG2   . THR D 1 210 ? -10.835 -9.978  -101.189 1.00 11.85 ? 188  THR D CG2   1 
ATOM   8888  N N     . ARG D 1 211 ? -9.738  -10.144 -96.805  1.00 16.46 ? 189  ARG D N     1 
ATOM   8889  C CA    . ARG D 1 211 ? -8.800  -10.373 -95.710  1.00 17.67 ? 189  ARG D CA    1 
ATOM   8890  C C     . ARG D 1 211 ? -9.407  -11.374 -94.719  1.00 17.19 ? 189  ARG D C     1 
ATOM   8891  O O     . ARG D 1 211 ? -8.728  -12.290 -94.242  1.00 17.40 ? 189  ARG D O     1 
ATOM   8892  C CB    . ARG D 1 211 ? -8.426  -9.043  -95.034  1.00 16.16 ? 189  ARG D CB    1 
ATOM   8893  C CG    . ARG D 1 211 ? -7.720  -8.072  -95.999  1.00 19.92 ? 189  ARG D CG    1 
ATOM   8894  C CD    . ARG D 1 211 ? -7.206  -6.766  -95.360  1.00 22.17 ? 189  ARG D CD    1 
ATOM   8895  N NE    . ARG D 1 211 ? -8.271  -6.050  -94.653  1.00 27.02 ? 189  ARG D NE    1 
ATOM   8896  C CZ    . ARG D 1 211 ? -8.472  -4.732  -94.679  1.00 28.43 ? 189  ARG D CZ    1 
ATOM   8897  N NH1   . ARG D 1 211 ? -7.705  -3.907  -95.379  1.00 29.33 ? 189  ARG D NH1   1 
ATOM   8898  N NH2   . ARG D 1 211 ? -9.490  -4.228  -94.000  1.00 30.24 ? 189  ARG D NH2   1 
ATOM   8899  N N     . THR D 1 212 ? -10.696 -11.180 -94.440  1.00 17.57 ? 190  THR D N     1 
ATOM   8900  C CA    . THR D 1 212 ? -11.440 -11.984 -93.505  1.00 16.83 ? 190  THR D CA    1 
ATOM   8901  C C     . THR D 1 212 ? -11.751 -13.369 -94.073  1.00 17.78 ? 190  THR D C     1 
ATOM   8902  O O     . THR D 1 212 ? -11.744 -14.385 -93.350  1.00 16.82 ? 190  THR D O     1 
ATOM   8903  C CB    . THR D 1 212 ? -12.723 -11.227 -93.119  1.00 17.46 ? 190  THR D CB    1 
ATOM   8904  O OG1   . THR D 1 212 ? -12.436 -10.424 -91.964  1.00 22.16 ? 190  THR D OG1   1 
ATOM   8905  C CG2   . THR D 1 212 ? -13.902 -12.158 -92.791  1.00 22.13 ? 190  THR D CG2   1 
ATOM   8906  N N     . LYS D 1 213 ? -12.023 -13.420 -95.369  1.00 17.83 ? 191  LYS D N     1 
ATOM   8907  C CA    . LYS D 1 213 ? -12.495 -14.656 -95.979  1.00 17.96 ? 191  LYS D CA    1 
ATOM   8908  C C     . LYS D 1 213 ? -11.394 -15.473 -96.661  1.00 16.49 ? 191  LYS D C     1 
ATOM   8909  O O     . LYS D 1 213 ? -11.527 -16.680 -96.801  1.00 16.76 ? 191  LYS D O     1 
ATOM   8910  C CB    . LYS D 1 213 ? -13.656 -14.345 -96.931  1.00 19.06 ? 191  LYS D CB    1 
ATOM   8911  C CG    . LYS D 1 213 ? -14.897 -13.860 -96.174  1.00 21.69 ? 191  LYS D CG    1 
ATOM   8912  C CD    . LYS D 1 213 ? -16.100 -13.603 -97.076  1.00 26.81 ? 191  LYS D CD    1 
ATOM   8913  C CE    . LYS D 1 213 ? -17.311 -13.219 -96.243  1.00 27.56 ? 191  LYS D CE    1 
ATOM   8914  N NZ    . LYS D 1 213 ? -18.232 -12.320 -96.969  1.00 30.81 ? 191  LYS D NZ    1 
ATOM   8915  N N     . THR D 1 214 ? -10.315 -14.814 -97.066  1.00 16.09 ? 192  THR D N     1 
ATOM   8916  C CA    . THR D 1 214 ? -9.199  -15.468 -97.753  1.00 15.82 ? 192  THR D CA    1 
ATOM   8917  C C     . THR D 1 214 ? -7.825  -15.150 -97.160  1.00 16.47 ? 192  THR D C     1 
ATOM   8918  O O     . THR D 1 214 ? -6.864  -15.852 -97.445  1.00 17.48 ? 192  THR D O     1 
ATOM   8919  C CB    . THR D 1 214 ? -9.137  -15.091 -99.258  1.00 15.92 ? 192  THR D CB    1 
ATOM   8920  O OG1   . THR D 1 214 ? -8.603  -13.779 -99.406  1.00 12.43 ? 192  THR D OG1   1 
ATOM   8921  C CG2   . THR D 1 214 ? -10.517 -15.140 -99.897  1.00 15.24 ? 192  THR D CG2   1 
ATOM   8922  N N     . GLY D 1 215 ? -7.710  -14.081 -96.371  1.00 16.30 ? 193  GLY D N     1 
ATOM   8923  C CA    . GLY D 1 215 ? -6.411  -13.675 -95.827  1.00 16.32 ? 193  GLY D CA    1 
ATOM   8924  C C     . GLY D 1 215 ? -5.441  -13.110 -96.858  1.00 15.94 ? 193  GLY D C     1 
ATOM   8925  O O     . GLY D 1 215 ? -4.260  -12.922 -96.579  1.00 13.83 ? 193  GLY D O     1 
ATOM   8926  N N     . VAL D 1 216 ? -5.974  -12.831 -98.045  1.00 18.07 ? 194  VAL D N     1 
ATOM   8927  C CA    . VAL D 1 216 ? -5.256  -12.269 -99.170  1.00 17.80 ? 194  VAL D CA    1 
ATOM   8928  C C     . VAL D 1 216 ? -5.651  -10.810 -99.254  1.00 18.64 ? 194  VAL D C     1 
ATOM   8929  O O     . VAL D 1 216 ? -6.811  -10.442 -99.032  1.00 20.22 ? 194  VAL D O     1 
ATOM   8930  C CB    . VAL D 1 216 ? -5.659  -12.976 -100.480 1.00 16.24 ? 194  VAL D CB    1 
ATOM   8931  C CG1   . VAL D 1 216 ? -5.031  -12.309 -101.689 1.00 18.57 ? 194  VAL D CG1   1 
ATOM   8932  C CG2   . VAL D 1 216 ? -5.277  -14.448 -100.417 1.00 15.49 ? 194  VAL D CG2   1 
ATOM   8933  N N     . GLY D 1 217 ? -4.673  -9.976  -99.566  1.00 17.92 ? 195  GLY D N     1 
ATOM   8934  C CA    . GLY D 1 217 ? -4.898  -8.538  -99.617  1.00 18.75 ? 195  GLY D CA    1 
ATOM   8935  C C     . GLY D 1 217 ? -3.594  -7.773  -99.588  1.00 18.12 ? 195  GLY D C     1 
ATOM   8936  O O     . GLY D 1 217 ? -2.523  -8.369  -99.521  1.00 18.99 ? 195  GLY D O     1 
ATOM   8937  N N     . TYR D 1 218 ? -3.699  -6.448  -99.616  1.00 17.79 ? 196  TYR D N     1 
ATOM   8938  C CA    . TYR D 1 218 ? -2.531  -5.579  -99.588  1.00 17.26 ? 196  TYR D CA    1 
ATOM   8939  C C     . TYR D 1 218 ? -2.965  -4.210  -99.060  1.00 17.56 ? 196  TYR D C     1 
ATOM   8940  O O     . TYR D 1 218 ? -4.047  -3.748  -99.413  1.00 18.97 ? 196  TYR D O     1 
ATOM   8941  C CB    . TYR D 1 218 ? -1.953  -5.471  -101.003 1.00 17.61 ? 196  TYR D CB    1 
ATOM   8942  C CG    . TYR D 1 218 ? -0.446  -5.473  -101.119 1.00 13.98 ? 196  TYR D CG    1 
ATOM   8943  C CD1   . TYR D 1 218 ? 0.262   -6.664  -101.251 1.00 13.76 ? 196  TYR D CD1   1 
ATOM   8944  C CD2   . TYR D 1 218 ? 0.269   -4.281  -101.142 1.00 14.64 ? 196  TYR D CD2   1 
ATOM   8945  C CE1   . TYR D 1 218 ? 1.662   -6.664  -101.386 1.00 18.58 ? 196  TYR D CE1   1 
ATOM   8946  C CE2   . TYR D 1 218 ? 1.664   -4.268  -101.263 1.00 17.47 ? 196  TYR D CE2   1 
ATOM   8947  C CZ    . TYR D 1 218 ? 2.354   -5.459  -101.380 1.00 18.79 ? 196  TYR D CZ    1 
ATOM   8948  O OH    . TYR D 1 218 ? 3.732   -5.437  -101.486 1.00 22.13 ? 196  TYR D OH    1 
ATOM   8949  N N     . PRO D 1 219 ? -2.123  -3.545  -98.219  1.00 18.47 ? 197  PRO D N     1 
ATOM   8950  C CA    . PRO D 1 219 ? -2.451  -2.169  -97.807  1.00 17.86 ? 197  PRO D CA    1 
ATOM   8951  C C     . PRO D 1 219 ? -2.548  -1.243  -99.008  1.00 17.82 ? 197  PRO D C     1 
ATOM   8952  O O     . PRO D 1 219 ? -1.732  -1.360  -99.929  1.00 19.80 ? 197  PRO D O     1 
ATOM   8953  C CB    . PRO D 1 219 ? -1.278  -1.774  -96.914  1.00 16.43 ? 197  PRO D CB    1 
ATOM   8954  C CG    . PRO D 1 219 ? -0.722  -3.037  -96.449  1.00 16.99 ? 197  PRO D CG    1 
ATOM   8955  C CD    . PRO D 1 219 ? -0.843  -3.963  -97.616  1.00 17.63 ? 197  PRO D CD    1 
ATOM   8956  N N     . GLN D 1 220 ? -3.527  -0.327  -98.988  1.00 16.71 ? 198  GLN D N     1 
ATOM   8957  C CA    . GLN D 1 220 ? -3.859  0.470   -100.180 1.00 17.21 ? 198  GLN D CA    1 
ATOM   8958  C C     . GLN D 1 220 ? -2.780  1.455   -100.574 1.00 16.52 ? 198  GLN D C     1 
ATOM   8959  O O     . GLN D 1 220 ? -2.524  1.614   -101.750 1.00 17.79 ? 198  GLN D O     1 
ATOM   8960  C CB    . GLN D 1 220 ? -5.210  1.168   -100.023 1.00 16.94 ? 198  GLN D CB    1 
ATOM   8961  C CG    . GLN D 1 220 ? -5.812  1.709   -101.336 1.00 18.33 ? 198  GLN D CG    1 
ATOM   8962  C CD    . GLN D 1 220 ? -6.173  0.645   -102.363 1.00 17.37 ? 198  GLN D CD    1 
ATOM   8963  O OE1   . GLN D 1 220 ? -6.681  -0.434  -102.025 1.00 15.20 ? 198  GLN D OE1   1 
ATOM   8964  N NE2   . GLN D 1 220 ? -5.939  0.961   -103.648 1.00 19.03 ? 198  GLN D NE2   1 
ATOM   8965  N N     . LEU D 1 221 ? -2.139  2.107   -99.616  1.00 16.91 ? 199  LEU D N     1 
ATOM   8966  C CA    . LEU D 1 221 ? -1.049  3.050   -99.941  1.00 18.79 ? 199  LEU D CA    1 
ATOM   8967  C C     . LEU D 1 221 ? 0.142   2.370   -100.616 1.00 18.02 ? 199  LEU D C     1 
ATOM   8968  O O     . LEU D 1 221 ? 0.629   2.824   -101.662 1.00 18.11 ? 199  LEU D O     1 
ATOM   8969  C CB    . LEU D 1 221 ? -0.561  3.790   -98.683  1.00 19.72 ? 199  LEU D CB    1 
ATOM   8970  C CG    . LEU D 1 221 ? 0.407   4.935   -98.974  1.00 20.90 ? 199  LEU D CG    1 
ATOM   8971  C CD1   . LEU D 1 221 ? -0.381  6.151   -99.384  1.00 26.45 ? 199  LEU D CD1   1 
ATOM   8972  C CD2   . LEU D 1 221 ? 1.282   5.239   -97.796  1.00 22.94 ? 199  LEU D CD2   1 
ATOM   8973  N N     . SER D 1 222 ? 0.603   1.281   -100.018 1.00 18.27 ? 200  SER D N     1 
ATOM   8974  C CA    . SER D 1 222 ? 1.741   0.549   -100.557 1.00 19.24 ? 200  SER D CA    1 
ATOM   8975  C C     . SER D 1 222 ? 1.420   -0.061  -101.932 1.00 19.99 ? 200  SER D C     1 
ATOM   8976  O O     . SER D 1 222 ? 2.291   -0.181  -102.810 1.00 20.87 ? 200  SER D O     1 
ATOM   8977  C CB    . SER D 1 222 ? 2.165   -0.523  -99.567  1.00 18.58 ? 200  SER D CB    1 
ATOM   8978  O OG    . SER D 1 222 ? 2.533   0.079   -98.332  1.00 16.12 ? 200  SER D OG    1 
ATOM   8979  N N     . ALA D 1 223 ? 0.159   -0.427  -102.118 1.00 19.08 ? 201  ALA D N     1 
ATOM   8980  C CA    . ALA D 1 223 ? -0.294  -0.960  -103.375 1.00 19.05 ? 201  ALA D CA    1 
ATOM   8981  C C     . ALA D 1 223 ? -0.090  0.108   -104.444 1.00 19.36 ? 201  ALA D C     1 
ATOM   8982  O O     . ALA D 1 223 ? 0.636   -0.102  -105.424 1.00 17.10 ? 201  ALA D O     1 
ATOM   8983  C CB    . ALA D 1 223 ? -1.766  -1.385  -103.267 1.00 19.54 ? 201  ALA D CB    1 
ATOM   8984  N N     . VAL D 1 224 ? -0.698  1.272   -104.208 1.00 20.78 ? 202  VAL D N     1 
ATOM   8985  C CA    . VAL D 1 224 ? -0.641  2.398   -105.122 1.00 19.73 ? 202  VAL D CA    1 
ATOM   8986  C C     . VAL D 1 224 ? 0.791   2.861   -105.369 1.00 20.80 ? 202  VAL D C     1 
ATOM   8987  O O     . VAL D 1 224 ? 1.144   3.190   -106.494 1.00 22.16 ? 202  VAL D O     1 
ATOM   8988  C CB    . VAL D 1 224 ? -1.503  3.534   -104.599 1.00 19.61 ? 202  VAL D CB    1 
ATOM   8989  C CG1   . VAL D 1 224 ? -1.253  4.814   -105.369 1.00 20.79 ? 202  VAL D CG1   1 
ATOM   8990  C CG2   . VAL D 1 224 ? -2.985  3.138   -104.668 1.00 17.62 ? 202  VAL D CG2   1 
ATOM   8991  N N     . ILE D 1 225 ? 1.617   2.897   -104.332 1.00 22.59 ? 203  ILE D N     1 
ATOM   8992  C CA    . ILE D 1 225 ? 3.025   3.300   -104.479 1.00 25.23 ? 203  ILE D CA    1 
ATOM   8993  C C     . ILE D 1 225 ? 3.762   2.444   -105.482 1.00 25.60 ? 203  ILE D C     1 
ATOM   8994  O O     . ILE D 1 225 ? 4.433   2.953   -106.383 1.00 23.82 ? 203  ILE D O     1 
ATOM   8995  C CB    . ILE D 1 225 ? 3.772   3.170   -103.121 1.00 27.78 ? 203  ILE D CB    1 
ATOM   8996  C CG1   . ILE D 1 225 ? 3.319   4.270   -102.147 1.00 31.32 ? 203  ILE D CG1   1 
ATOM   8997  C CG2   . ILE D 1 225 ? 5.297   3.196   -103.297 1.00 28.14 ? 203  ILE D CG2   1 
ATOM   8998  C CD1   . ILE D 1 225 ? 3.873   5.666   -102.454 1.00 33.73 ? 203  ILE D CD1   1 
ATOM   8999  N N     . GLU D 1 226 ? 3.642   1.134   -105.310 1.00 27.66 ? 204  GLU D N     1 
ATOM   9000  C CA    . GLU D 1 226 ? 4.395   0.172   -106.121 1.00 28.55 ? 204  GLU D CA    1 
ATOM   9001  C C     . GLU D 1 226 ? 3.817   0.054   -107.511 1.00 26.77 ? 204  GLU D C     1 
ATOM   9002  O O     . GLU D 1 226 ? 4.557   0.022   -108.491 1.00 27.35 ? 204  GLU D O     1 
ATOM   9003  C CB    . GLU D 1 226 ? 4.416   -1.206  -105.468 1.00 29.32 ? 204  GLU D CB    1 
ATOM   9004  C CG    . GLU D 1 226 ? 5.130   -1.272  -104.107 1.00 35.12 ? 204  GLU D CG    1 
ATOM   9005  C CD    . GLU D 1 226 ? 4.852   -2.593  -103.384 1.00 40.97 ? 204  GLU D CD    1 
ATOM   9006  O OE1   . GLU D 1 226 ? 4.515   -3.588  -104.080 1.00 39.85 ? 204  GLU D OE1   1 
ATOM   9007  O OE2   . GLU D 1 226 ? 4.960   -2.632  -102.133 1.00 36.78 ? 204  GLU D OE2   1 
ATOM   9008  N N     . CYS D 1 227 ? 2.492   -0.015  -107.579 1.00 25.43 ? 205  CYS D N     1 
ATOM   9009  C CA    . CYS D 1 227 ? 1.777   -0.181  -108.838 1.00 24.52 ? 205  CYS D CA    1 
ATOM   9010  C C     . CYS D 1 227 ? 1.829   1.030   -109.737 1.00 23.85 ? 205  CYS D C     1 
ATOM   9011  O O     . CYS D 1 227 ? 1.836   0.885   -110.961 1.00 23.90 ? 205  CYS D O     1 
ATOM   9012  C CB    . CYS D 1 227 ? 0.317   -0.516  -108.560 1.00 25.23 ? 205  CYS D CB    1 
ATOM   9013  S SG    . CYS D 1 227 ? 0.125   -2.178  -108.037 1.00 24.43 ? 205  CYS D SG    1 
ATOM   9014  N N     . ALA D 1 228 ? 1.808   2.225   -109.140 1.00 23.89 ? 206  ALA D N     1 
ATOM   9015  C CA    . ALA D 1 228 ? 1.913   3.463   -109.913 1.00 22.70 ? 206  ALA D CA    1 
ATOM   9016  C C     . ALA D 1 228 ? 3.239   3.498   -110.653 1.00 22.79 ? 206  ALA D C     1 
ATOM   9017  O O     . ALA D 1 228 ? 3.276   3.760   -111.846 1.00 22.26 ? 206  ALA D O     1 
ATOM   9018  C CB    . ALA D 1 228 ? 1.784   4.666   -109.029 1.00 23.06 ? 206  ALA D CB    1 
ATOM   9019  N N     . ASP D 1 229 ? 4.331   3.236   -109.948 1.00 24.63 ? 207  ASP D N     1 
ATOM   9020  C CA    . ASP D 1 229 ? 5.651   3.217   -110.591 1.00 26.37 ? 207  ASP D CA    1 
ATOM   9021  C C     . ASP D 1 229 ? 5.640   2.293   -111.789 1.00 25.52 ? 207  ASP D C     1 
ATOM   9022  O O     . ASP D 1 229 ? 6.124   2.641   -112.861 1.00 26.85 ? 207  ASP D O     1 
ATOM   9023  C CB    . ASP D 1 229 ? 6.763   2.785   -109.624 1.00 27.57 ? 207  ASP D CB    1 
ATOM   9024  C CG    . ASP D 1 229 ? 7.479   3.974   -108.981 1.00 33.47 ? 207  ASP D CG    1 
ATOM   9025  O OD1   . ASP D 1 229 ? 7.562   5.049   -109.624 1.00 36.34 ? 207  ASP D OD1   1 
ATOM   9026  O OD2   . ASP D 1 229 ? 7.964   3.827   -107.834 1.00 39.79 ? 207  ASP D OD2   1 
ATOM   9027  N N     . SER D 1 230 ? 5.065   1.115   -111.588 1.00 24.59 ? 208  SER D N     1 
ATOM   9028  C CA    . SER D 1 230 ? 5.086   0.052   -112.569 1.00 23.82 ? 208  SER D CA    1 
ATOM   9029  C C     . SER D 1 230 ? 4.311   0.448   -113.833 1.00 22.77 ? 208  SER D C     1 
ATOM   9030  O O     . SER D 1 230 ? 4.774   0.244   -114.965 1.00 23.47 ? 208  SER D O     1 
ATOM   9031  C CB    . SER D 1 230 ? 4.503   -1.214  -111.929 1.00 23.49 ? 208  SER D CB    1 
ATOM   9032  O OG    . SER D 1 230 ? 5.149   -2.381  -112.393 1.00 29.10 ? 208  SER D OG    1 
ATOM   9033  N N     . ALA D 1 231 ? 3.130   1.027   -113.624 1.00 21.74 ? 209  ALA D N     1 
ATOM   9034  C CA    . ALA D 1 231 ? 2.285   1.511   -114.717 1.00 19.90 ? 209  ALA D CA    1 
ATOM   9035  C C     . ALA D 1 231 ? 2.965   2.643   -115.470 1.00 19.66 ? 209  ALA D C     1 
ATOM   9036  O O     . ALA D 1 231 ? 3.053   2.617   -116.698 1.00 19.78 ? 209  ALA D O     1 
ATOM   9037  C CB    . ALA D 1 231 ? 0.927   1.959   -114.198 1.00 18.86 ? 209  ALA D CB    1 
ATOM   9038  N N     . HIS D 1 232 ? 3.466   3.632   -114.738 1.00 19.56 ? 210  HIS D N     1 
ATOM   9039  C CA    . HIS D 1 232 ? 4.018   4.828   -115.369 1.00 19.39 ? 210  HIS D CA    1 
ATOM   9040  C C     . HIS D 1 232 ? 5.302   4.557   -116.116 1.00 19.26 ? 210  HIS D C     1 
ATOM   9041  O O     . HIS D 1 232 ? 5.612   5.283   -117.054 1.00 18.90 ? 210  HIS D O     1 
ATOM   9042  C CB    . HIS D 1 232 ? 4.266   5.934   -114.353 1.00 19.73 ? 210  HIS D CB    1 
ATOM   9043  C CG    . HIS D 1 232 ? 3.047   6.318   -113.586 1.00 17.83 ? 210  HIS D CG    1 
ATOM   9044  N ND1   . HIS D 1 232 ? 3.109   7.013   -112.400 1.00 11.27 ? 210  HIS D ND1   1 
ATOM   9045  C CD2   . HIS D 1 232 ? 1.739   6.055   -113.810 1.00 15.74 ? 210  HIS D CD2   1 
ATOM   9046  C CE1   . HIS D 1 232 ? 1.886   7.188   -111.942 1.00 20.41 ? 210  HIS D CE1   1 
ATOM   9047  N NE2   . HIS D 1 232 ? 1.037   6.607   -112.772 1.00 18.21 ? 210  HIS D NE2   1 
ATOM   9048  N N     . GLY D 1 233 ? 6.035   3.525   -115.700 1.00 20.75 ? 211  GLY D N     1 
ATOM   9049  C CA    . GLY D 1 233 ? 7.216   3.048   -116.434 1.00 21.60 ? 211  GLY D CA    1 
ATOM   9050  C C     . GLY D 1 233 ? 6.881   2.606   -117.850 1.00 21.79 ? 211  GLY D C     1 
ATOM   9051  O O     . GLY D 1 233 ? 7.739   2.627   -118.740 1.00 21.92 ? 211  GLY D O     1 
ATOM   9052  N N     . LEU D 1 234 ? 5.620   2.221   -118.052 1.00 21.70 ? 212  LEU D N     1 
ATOM   9053  C CA    . LEU D 1 234 ? 5.123   1.822   -119.365 1.00 22.44 ? 212  LEU D CA    1 
ATOM   9054  C C     . LEU D 1 234 ? 4.305   2.916   -120.022 1.00 22.10 ? 212  LEU D C     1 
ATOM   9055  O O     . LEU D 1 234 ? 3.705   2.685   -121.061 1.00 23.82 ? 212  LEU D O     1 
ATOM   9056  C CB    . LEU D 1 234 ? 4.268   0.547   -119.249 1.00 23.12 ? 212  LEU D CB    1 
ATOM   9057  C CG    . LEU D 1 234 ? 4.986   -0.726  -118.769 1.00 23.56 ? 212  LEU D CG    1 
ATOM   9058  C CD1   . LEU D 1 234 ? 3.977   -1.822  -118.592 1.00 24.25 ? 212  LEU D CD1   1 
ATOM   9059  C CD2   . LEU D 1 234 ? 6.080   -1.161  -119.729 1.00 23.93 ? 212  LEU D CD2   1 
ATOM   9060  N N     . LYS D 1 235 ? 4.292   4.107   -119.435 1.00 21.59 ? 213  LYS D N     1 
ATOM   9061  C CA    . LYS D 1 235 ? 3.380   5.179   -119.864 1.00 21.33 ? 213  LYS D CA    1 
ATOM   9062  C C     . LYS D 1 235 ? 1.895   4.761   -119.740 1.00 19.51 ? 213  LYS D C     1 
ATOM   9063  O O     . LYS D 1 235 ? 1.041   5.222   -120.489 1.00 19.28 ? 213  LYS D O     1 
ATOM   9064  C CB    . LYS D 1 235 ? 3.723   5.666   -121.285 1.00 21.51 ? 213  LYS D CB    1 
ATOM   9065  C CG    . LYS D 1 235 ? 5.017   6.468   -121.345 1.00 25.41 ? 213  LYS D CG    1 
ATOM   9066  C CD    . LYS D 1 235 ? 5.601   6.484   -122.739 1.00 32.33 ? 213  LYS D CD    1 
ATOM   9067  C CE    . LYS D 1 235 ? 6.417   5.214   -123.023 1.00 33.72 ? 213  LYS D CE    1 
ATOM   9068  N N     . GLY D 1 236 ? 1.609   3.881   -118.784 1.00 17.97 ? 214  GLY D N     1 
ATOM   9069  C CA    . GLY D 1 236 ? 0.236   3.489   -118.463 1.00 17.01 ? 214  GLY D CA    1 
ATOM   9070  C C     . GLY D 1 236 ? -0.283  4.235   -117.249 1.00 15.17 ? 214  GLY D C     1 
ATOM   9071  O O     . GLY D 1 236 ? 0.377   5.136   -116.744 1.00 12.80 ? 214  GLY D O     1 
ATOM   9072  N N     . HIS D 1 237 ? -1.456  3.839   -116.776 1.00 15.92 ? 215  HIS D N     1 
ATOM   9073  C CA    . HIS D 1 237 ? -2.156  4.542   -115.717 1.00 16.36 ? 215  HIS D CA    1 
ATOM   9074  C C     . HIS D 1 237 ? -2.796  3.601   -114.690 1.00 16.81 ? 215  HIS D C     1 
ATOM   9075  O O     . HIS D 1 237 ? -3.098  2.452   -115.000 1.00 16.25 ? 215  HIS D O     1 
ATOM   9076  C CB    . HIS D 1 237 ? -3.256  5.370   -116.338 1.00 15.72 ? 215  HIS D CB    1 
ATOM   9077  C CG    . HIS D 1 237 ? -2.764  6.456   -117.220 1.00 10.34 ? 215  HIS D CG    1 
ATOM   9078  N ND1   . HIS D 1 237 ? -2.534  6.273   -118.560 1.00 14.74 ? 215  HIS D ND1   1 
ATOM   9079  C CD2   . HIS D 1 237 ? -2.491  7.754   -116.963 1.00 13.29 ? 215  HIS D CD2   1 
ATOM   9080  C CE1   . HIS D 1 237 ? -2.124  7.408   -119.090 1.00 10.85 ? 215  HIS D CE1   1 
ATOM   9081  N NE2   . HIS D 1 237 ? -2.099  8.323   -118.145 1.00 6.38  ? 215  HIS D NE2   1 
ATOM   9082  N N     . ILE D 1 238 ? -3.025  4.098   -113.475 1.00 17.15 ? 216  ILE D N     1 
ATOM   9083  C CA    . ILE D 1 238 ? -3.755  3.319   -112.479 1.00 17.18 ? 216  ILE D CA    1 
ATOM   9084  C C     . ILE D 1 238 ? -4.914  4.063   -111.822 1.00 16.22 ? 216  ILE D C     1 
ATOM   9085  O O     . ILE D 1 238 ? -4.929  5.292   -111.776 1.00 16.41 ? 216  ILE D O     1 
ATOM   9086  C CB    . ILE D 1 238 ? -2.826  2.746   -111.377 1.00 18.52 ? 216  ILE D CB    1 
ATOM   9087  C CG1   . ILE D 1 238 ? -2.132  3.856   -110.594 1.00 16.02 ? 216  ILE D CG1   1 
ATOM   9088  C CG2   . ILE D 1 238 ? -1.810  1.811   -111.998 1.00 21.86 ? 216  ILE D CG2   1 
ATOM   9089  C CD1   . ILE D 1 238 ? -1.602  3.389   -109.294 1.00 18.12 ? 216  ILE D CD1   1 
ATOM   9090  N N     . ILE D 1 239 ? -5.875  3.274   -111.336 1.00 14.80 ? 217  ILE D N     1 
ATOM   9091  C CA    . ILE D 1 239 ? -6.917  3.724   -110.444 1.00 12.95 ? 217  ILE D CA    1 
ATOM   9092  C C     . ILE D 1 239 ? -6.642  3.139   -109.074 1.00 13.50 ? 217  ILE D C     1 
ATOM   9093  O O     . ILE D 1 239 ? -6.519  1.935   -108.949 1.00 15.28 ? 217  ILE D O     1 
ATOM   9094  C CB    . ILE D 1 239 ? -8.278  3.204   -110.943 1.00 13.72 ? 217  ILE D CB    1 
ATOM   9095  C CG1   . ILE D 1 239 ? -8.639  3.866   -112.272 1.00 14.23 ? 217  ILE D CG1   1 
ATOM   9096  C CG2   . ILE D 1 239 ? -9.395  3.439   -109.931 1.00 11.49 ? 217  ILE D CG2   1 
ATOM   9097  C CD1   . ILE D 1 239 ? -9.515  3.033   -113.174 1.00 12.29 ? 217  ILE D CD1   1 
ATOM   9098  N N     . SER D 1 240 ? -6.527  3.984   -108.050 1.00 13.30 ? 218  SER D N     1 
ATOM   9099  C CA    . SER D 1 240 ? -6.608  3.522   -106.656 1.00 13.06 ? 218  SER D CA    1 
ATOM   9100  C C     . SER D 1 240 ? -8.076  3.161   -106.349 1.00 14.33 ? 218  SER D C     1 
ATOM   9101  O O     . SER D 1 240 ? -8.956  4.032   -106.179 1.00 12.30 ? 218  SER D O     1 
ATOM   9102  C CB    . SER D 1 240 ? -6.080  4.584   -105.670 1.00 12.45 ? 218  SER D CB    1 
ATOM   9103  O OG    . SER D 1 240 ? -5.928  4.056   -104.353 1.00 8.20  ? 218  SER D OG    1 
ATOM   9104  N N     . ASP D 1 241 ? -8.330  1.865   -106.275 1.00 15.97 ? 219  ASP D N     1 
ATOM   9105  C CA    . ASP D 1 241 ? -9.679  1.369   -106.123 1.00 18.01 ? 219  ASP D CA    1 
ATOM   9106  C C     . ASP D 1 241 ? -9.949  0.839   -104.722 1.00 17.96 ? 219  ASP D C     1 
ATOM   9107  O O     . ASP D 1 241 ? -9.576  -0.286  -104.391 1.00 20.01 ? 219  ASP D O     1 
ATOM   9108  C CB    . ASP D 1 241 ? -9.950  0.283   -107.157 1.00 18.18 ? 219  ASP D CB    1 
ATOM   9109  C CG    . ASP D 1 241 ? -11.352 -0.221  -107.082 1.00 16.52 ? 219  ASP D CG    1 
ATOM   9110  O OD1   . ASP D 1 241 ? -12.184 0.483   -106.483 1.00 17.85 ? 219  ASP D OD1   1 
ATOM   9111  O OD2   . ASP D 1 241 ? -11.628 -1.319  -107.586 1.00 17.04 ? 219  ASP D OD2   1 
ATOM   9112  N N     . GLY D 1 242 ? -10.635 1.637   -103.918 1.00 18.27 ? 220  GLY D N     1 
ATOM   9113  C CA    . GLY D 1 242 ? -11.062 1.215   -102.597 1.00 17.29 ? 220  GLY D CA    1 
ATOM   9114  C C     . GLY D 1 242 ? -10.163 1.719   -101.495 1.00 17.05 ? 220  GLY D C     1 
ATOM   9115  O O     . GLY D 1 242 ? -9.005  2.063   -101.737 1.00 17.56 ? 220  GLY D O     1 
ATOM   9116  N N     . GLY D 1 243 ? -10.716 1.791   -100.283 1.00 16.23 ? 221  GLY D N     1 
ATOM   9117  C CA    . GLY D 1 243 ? -9.950  2.148   -99.084  1.00 16.45 ? 221  GLY D CA    1 
ATOM   9118  C C     . GLY D 1 243 ? -10.103 3.566   -98.559  1.00 16.04 ? 221  GLY D C     1 
ATOM   9119  O O     . GLY D 1 243 ? -9.895  3.807   -97.386  1.00 18.59 ? 221  GLY D O     1 
ATOM   9120  N N     . CYS D 1 244 ? -10.447 4.517   -99.417  1.00 16.81 ? 222  CYS D N     1 
ATOM   9121  C CA    . CYS D 1 244 ? -10.592 5.912   -98.997  1.00 16.80 ? 222  CYS D CA    1 
ATOM   9122  C C     . CYS D 1 244 ? -11.842 6.078   -98.151  1.00 18.26 ? 222  CYS D C     1 
ATOM   9123  O O     . CYS D 1 244 ? -12.952 5.734   -98.578  1.00 18.22 ? 222  CYS D O     1 
ATOM   9124  C CB    . CYS D 1 244 ? -10.642 6.845   -100.207 1.00 17.61 ? 222  CYS D CB    1 
ATOM   9125  S SG    . CYS D 1 244 ? -9.067  6.895   -101.117 1.00 21.41 ? 222  CYS D SG    1 
ATOM   9126  N N     . THR D 1 245 ? -11.638 6.583   -96.940  1.00 18.33 ? 223  THR D N     1 
ATOM   9127  C CA    . THR D 1 245 ? -12.709 6.796   -95.995  1.00 18.18 ? 223  THR D CA    1 
ATOM   9128  C C     . THR D 1 245 ? -12.973 8.267   -95.811  1.00 17.90 ? 223  THR D C     1 
ATOM   9129  O O     . THR D 1 245 ? -13.925 8.635   -95.143  1.00 17.73 ? 223  THR D O     1 
ATOM   9130  C CB    . THR D 1 245 ? -12.321 6.213   -94.658  1.00 18.78 ? 223  THR D CB    1 
ATOM   9131  O OG1   . THR D 1 245 ? -11.125 6.860   -94.201  1.00 22.37 ? 223  THR D OG1   1 
ATOM   9132  C CG2   . THR D 1 245 ? -12.050 4.723   -94.809  1.00 19.36 ? 223  THR D CG2   1 
ATOM   9133  N N     . CYS D 1 246 ? -12.123 9.103   -96.404  1.00 17.07 ? 224  CYS D N     1 
ATOM   9134  C CA    . CYS D 1 246 ? -12.223 10.542  -96.268  1.00 15.94 ? 224  CYS D CA    1 
ATOM   9135  C C     . CYS D 1 246 ? -11.403 11.228  -97.367  1.00 15.26 ? 224  CYS D C     1 
ATOM   9136  O O     . CYS D 1 246 ? -10.568 10.585  -98.027  1.00 14.18 ? 224  CYS D O     1 
ATOM   9137  C CB    . CYS D 1 246 ? -11.731 10.973  -94.873  1.00 18.05 ? 224  CYS D CB    1 
ATOM   9138  S SG    . CYS D 1 246 ? -9.944  10.711  -94.579  1.00 18.91 ? 224  CYS D SG    1 
ATOM   9139  N N     . PRO D 1 247 ? -11.643 12.542  -97.579  1.00 13.77 ? 225  PRO D N     1 
ATOM   9140  C CA    . PRO D 1 247 ? -10.927 13.240  -98.631  1.00 14.09 ? 225  PRO D CA    1 
ATOM   9141  C C     . PRO D 1 247 ? -9.406  13.218  -98.460  1.00 14.58 ? 225  PRO D C     1 
ATOM   9142  O O     . PRO D 1 247 ? -8.668  13.349  -99.436  1.00 17.25 ? 225  PRO D O     1 
ATOM   9143  C CB    . PRO D 1 247 ? -11.440 14.681  -98.502  1.00 13.95 ? 225  PRO D CB    1 
ATOM   9144  C CG    . PRO D 1 247 ? -12.734 14.565  -97.839  1.00 11.52 ? 225  PRO D CG    1 
ATOM   9145  C CD    . PRO D 1 247 ? -12.582 13.441  -96.892  1.00 10.77 ? 225  PRO D CD    1 
ATOM   9146  N N     . GLY D 1 248 ? -8.933  13.088  -97.236  1.00 14.75 ? 226  GLY D N     1 
ATOM   9147  C CA    . GLY D 1 248 ? -7.507  13.038  -97.010  1.00 16.06 ? 226  GLY D CA    1 
ATOM   9148  C C     . GLY D 1 248 ? -6.891  11.806  -97.629  1.00 17.72 ? 226  GLY D C     1 
ATOM   9149  O O     . GLY D 1 248 ? -5.813  11.883  -98.190  1.00 18.60 ? 226  GLY D O     1 
ATOM   9150  N N     . ASP D 1 249 ? -7.574  10.670  -97.493  1.00 19.38 ? 227  ASP D N     1 
ATOM   9151  C CA    . ASP D 1 249 ? -7.135  9.416   -98.100  1.00 18.71 ? 227  ASP D CA    1 
ATOM   9152  C C     . ASP D 1 249 ? -7.100  9.564   -99.614  1.00 17.58 ? 227  ASP D C     1 
ATOM   9153  O O     . ASP D 1 249 ? -6.163  9.104   -100.257 1.00 17.99 ? 227  ASP D O     1 
ATOM   9154  C CB    . ASP D 1 249 ? -8.072  8.264   -97.704  1.00 20.49 ? 227  ASP D CB    1 
ATOM   9155  C CG    . ASP D 1 249 ? -8.059  7.974   -96.199  1.00 21.98 ? 227  ASP D CG    1 
ATOM   9156  O OD1   . ASP D 1 249 ? -7.309  8.668   -95.477  1.00 27.47 ? 227  ASP D OD1   1 
ATOM   9157  O OD2   . ASP D 1 249 ? -8.799  7.066   -95.746  1.00 20.20 ? 227  ASP D OD2   1 
ATOM   9158  N N     . VAL D 1 250 ? -8.121  10.223  -100.164 1.00 17.38 ? 228  VAL D N     1 
ATOM   9159  C CA    . VAL D 1 250 ? -8.207  10.482  -101.597 1.00 16.74 ? 228  VAL D CA    1 
ATOM   9160  C C     . VAL D 1 250 ? -6.982  11.266  -102.018 1.00 16.29 ? 228  VAL D C     1 
ATOM   9161  O O     . VAL D 1 250 ? -6.383  10.951  -103.044 1.00 17.29 ? 228  VAL D O     1 
ATOM   9162  C CB    . VAL D 1 250 ? -9.514  11.239  -101.976 1.00 17.28 ? 228  VAL D CB    1 
ATOM   9163  C CG1   . VAL D 1 250 ? -9.493  11.694  -103.442 1.00 22.59 ? 228  VAL D CG1   1 
ATOM   9164  C CG2   . VAL D 1 250 ? -10.732 10.376  -101.711 1.00 17.80 ? 228  VAL D CG2   1 
ATOM   9165  N N     . ALA D 1 251 ? -6.603  12.257  -101.209 1.00 15.64 ? 229  ALA D N     1 
ATOM   9166  C CA    . ALA D 1 251 ? -5.408  13.066  -101.451 1.00 15.10 ? 229  ALA D CA    1 
ATOM   9167  C C     . ALA D 1 251 ? -4.118  12.251  -101.349 1.00 15.11 ? 229  ALA D C     1 
ATOM   9168  O O     . ALA D 1 251 ? -3.227  12.418  -102.160 1.00 12.72 ? 229  ALA D O     1 
ATOM   9169  C CB    . ALA D 1 251 ? -5.379  14.249  -100.497 1.00 16.62 ? 229  ALA D CB    1 
ATOM   9170  N N     . LYS D 1 252 ? -4.039  11.351  -100.369 1.00 17.83 ? 230  LYS D N     1 
ATOM   9171  C CA    . LYS D 1 252 ? -2.881  10.455  -100.218 1.00 17.71 ? 230  LYS D CA    1 
ATOM   9172  C C     . LYS D 1 252 ? -2.750  9.495   -101.386 1.00 18.68 ? 230  LYS D C     1 
ATOM   9173  O O     . LYS D 1 252 ? -1.643  9.199   -101.842 1.00 20.32 ? 230  LYS D O     1 
ATOM   9174  C CB    . LYS D 1 252 ? -2.955  9.668   -98.922  1.00 15.86 ? 230  LYS D CB    1 
ATOM   9175  C CG    . LYS D 1 252 ? -2.801  10.515  -97.665  1.00 16.25 ? 230  LYS D CG    1 
ATOM   9176  C CD    . LYS D 1 252 ? -3.283  9.732   -96.420  1.00 19.16 ? 230  LYS D CD    1 
ATOM   9177  C CE    . LYS D 1 252 ? -3.373  10.581  -95.162  1.00 17.41 ? 230  LYS D CE    1 
ATOM   9178  N NZ    . LYS D 1 252 ? -3.723  9.735   -94.005  1.00 13.38 ? 230  LYS D NZ    1 
ATOM   9179  N N     . ALA D 1 253 ? -3.879  8.991   -101.862 1.00 18.75 ? 231  ALA D N     1 
ATOM   9180  C CA    . ALA D 1 253 ? -3.890  8.133   -103.034 1.00 18.95 ? 231  ALA D CA    1 
ATOM   9181  C C     . ALA D 1 253 ? -3.192  8.830   -104.202 1.00 19.21 ? 231  ALA D C     1 
ATOM   9182  O O     . ALA D 1 253 ? -2.263  8.282   -104.814 1.00 18.31 ? 231  ALA D O     1 
ATOM   9183  C CB    . ALA D 1 253 ? -5.324  7.760   -103.406 1.00 19.10 ? 231  ALA D CB    1 
ATOM   9184  N N     . PHE D 1 254 ? -3.656  10.037  -104.503 1.00 18.49 ? 232  PHE D N     1 
ATOM   9185  C CA    . PHE D 1 254 ? -3.058  10.863  -105.556 1.00 18.05 ? 232  PHE D CA    1 
ATOM   9186  C C     . PHE D 1 254 ? -1.562  11.182  -105.315 1.00 17.09 ? 232  PHE D C     1 
ATOM   9187  O O     . PHE D 1 254 ? -0.761  11.204  -106.258 1.00 15.48 ? 232  PHE D O     1 
ATOM   9188  C CB    . PHE D 1 254 ? -3.862  12.161  -105.742 1.00 16.07 ? 232  PHE D CB    1 
ATOM   9189  C CG    . PHE D 1 254 ? -5.143  11.982  -106.520 1.00 16.33 ? 232  PHE D CG    1 
ATOM   9190  C CD1   . PHE D 1 254 ? -5.115  11.571  -107.852 1.00 14.18 ? 232  PHE D CD1   1 
ATOM   9191  C CD2   . PHE D 1 254 ? -6.378  12.234  -105.927 1.00 15.38 ? 232  PHE D CD2   1 
ATOM   9192  C CE1   . PHE D 1 254 ? -6.301  11.388  -108.577 1.00 13.98 ? 232  PHE D CE1   1 
ATOM   9193  C CE2   . PHE D 1 254 ? -7.572  12.074  -106.649 1.00 18.14 ? 232  PHE D CE2   1 
ATOM   9194  C CZ    . PHE D 1 254 ? -7.533  11.645  -107.976 1.00 11.23 ? 232  PHE D CZ    1 
ATOM   9195  N N     . GLY D 1 255 ? -1.203  11.441  -104.062 1.00 17.32 ? 233  GLY D N     1 
ATOM   9196  C CA    . GLY D 1 255 ? 0.182   11.731  -103.675 1.00 16.40 ? 233  GLY D CA    1 
ATOM   9197  C C     . GLY D 1 255 ? 1.088   10.528  -103.865 1.00 16.43 ? 233  GLY D C     1 
ATOM   9198  O O     . GLY D 1 255 ? 2.274   10.668  -104.149 1.00 17.02 ? 233  GLY D O     1 
ATOM   9199  N N     . ALA D 1 256 ? 0.512   9.342   -103.711 1.00 17.27 ? 234  ALA D N     1 
ATOM   9200  C CA    . ALA D 1 256 ? 1.252   8.093   -103.879 1.00 18.02 ? 234  ALA D CA    1 
ATOM   9201  C C     . ALA D 1 256 ? 1.436   7.697   -105.339 1.00 17.93 ? 234  ALA D C     1 
ATOM   9202  O O     . ALA D 1 256 ? 2.183   6.763   -105.630 1.00 20.09 ? 234  ALA D O     1 
ATOM   9203  C CB    . ALA D 1 256 ? 0.569   6.976   -103.122 1.00 19.20 ? 234  ALA D CB    1 
ATOM   9204  N N     . GLY D 1 257 ? 0.741   8.376   -106.246 1.00 16.73 ? 235  GLY D N     1 
ATOM   9205  C CA    . GLY D 1 257 ? 0.950   8.174   -107.684 1.00 16.55 ? 235  GLY D CA    1 
ATOM   9206  C C     . GLY D 1 257 ? -0.280  7.777   -108.468 1.00 17.29 ? 235  GLY D C     1 
ATOM   9207  O O     . GLY D 1 257 ? -0.212  7.681   -109.674 1.00 17.55 ? 235  GLY D O     1 
ATOM   9208  N N     . ALA D 1 258 ? -1.402  7.553   -107.787 1.00 18.39 ? 236  ALA D N     1 
ATOM   9209  C CA    . ALA D 1 258 ? -2.656  7.174   -108.439 1.00 17.34 ? 236  ALA D CA    1 
ATOM   9210  C C     . ALA D 1 258 ? -3.046  8.229   -109.473 1.00 18.76 ? 236  ALA D C     1 
ATOM   9211  O O     . ALA D 1 258 ? -3.030  9.440   -109.201 1.00 18.97 ? 236  ALA D O     1 
ATOM   9212  C CB    . ALA D 1 258 ? -3.736  7.018   -107.417 1.00 17.58 ? 236  ALA D CB    1 
ATOM   9213  N N     . ASP D 1 259 ? -3.360  7.752   -110.674 1.00 19.28 ? 237  ASP D N     1 
ATOM   9214  C CA    . ASP D 1 259 ? -3.750  8.617   -111.763 1.00 17.10 ? 237  ASP D CA    1 
ATOM   9215  C C     . ASP D 1 259 ? -5.222  8.993   -111.549 1.00 15.85 ? 237  ASP D C     1 
ATOM   9216  O O     . ASP D 1 259 ? -5.597  10.155  -111.677 1.00 15.06 ? 237  ASP D O     1 
ATOM   9217  C CB    . ASP D 1 259 ? -3.474  7.895   -113.082 1.00 17.24 ? 237  ASP D CB    1 
ATOM   9218  C CG    . ASP D 1 259 ? -1.960  7.567   -113.278 1.00 17.50 ? 237  ASP D CG    1 
ATOM   9219  O OD1   . ASP D 1 259 ? -1.220  8.475   -113.678 1.00 15.90 ? 237  ASP D OD1   1 
ATOM   9220  O OD2   . ASP D 1 259 ? -1.502  6.413   -113.057 1.00 11.05 ? 237  ASP D OD2   1 
ATOM   9221  N N     . PHE D 1 260 ? -6.030  8.007   -111.163 1.00 15.91 ? 238  PHE D N     1 
ATOM   9222  C CA    . PHE D 1 260 ? -7.413  8.209   -110.739 1.00 16.10 ? 238  PHE D CA    1 
ATOM   9223  C C     . PHE D 1 260 ? -7.615  7.623   -109.347 1.00 15.02 ? 238  PHE D C     1 
ATOM   9224  O O     . PHE D 1 260 ? -6.831  6.800   -108.883 1.00 15.22 ? 238  PHE D O     1 
ATOM   9225  C CB    . PHE D 1 260 ? -8.380  7.455   -111.650 1.00 16.80 ? 238  PHE D CB    1 
ATOM   9226  C CG    . PHE D 1 260 ? -8.238  7.769   -113.089 1.00 15.42 ? 238  PHE D CG    1 
ATOM   9227  C CD1   . PHE D 1 260 ? -9.206  8.513   -113.735 1.00 14.75 ? 238  PHE D CD1   1 
ATOM   9228  C CD2   . PHE D 1 260 ? -7.130  7.306   -113.810 1.00 18.37 ? 238  PHE D CD2   1 
ATOM   9229  C CE1   . PHE D 1 260 ? -9.083  8.804   -115.083 1.00 14.91 ? 238  PHE D CE1   1 
ATOM   9230  C CE2   . PHE D 1 260 ? -6.981  7.593   -115.152 1.00 16.93 ? 238  PHE D CE2   1 
ATOM   9231  C CZ    . PHE D 1 260 ? -7.958  8.355   -115.796 1.00 16.87 ? 238  PHE D CZ    1 
ATOM   9232  N N     . VAL D 1 261 ? -8.712  8.008   -108.710 1.00 14.00 ? 239  VAL D N     1 
ATOM   9233  C CA    . VAL D 1 261 ? -9.112  7.402   -107.447 1.00 14.71 ? 239  VAL D CA    1 
ATOM   9234  C C     . VAL D 1 261 ? -10.570 6.983   -107.592 1.00 14.89 ? 239  VAL D C     1 
ATOM   9235  O O     . VAL D 1 261 ? -11.420 7.780   -107.998 1.00 12.82 ? 239  VAL D O     1 
ATOM   9236  C CB    . VAL D 1 261 ? -8.895  8.349   -106.220 1.00 15.16 ? 239  VAL D CB    1 
ATOM   9237  C CG1   . VAL D 1 261 ? -9.690  7.877   -104.995 1.00 13.40 ? 239  VAL D CG1   1 
ATOM   9238  C CG2   . VAL D 1 261 ? -7.424  8.459   -105.877 1.00 12.45 ? 239  VAL D CG2   1 
ATOM   9239  N N     . MET D 1 262 ? -10.840 5.713   -107.284 1.00 16.47 ? 240  MET D N     1 
ATOM   9240  C CA    . MET D 1 262 ? -12.206 5.196   -107.347 1.00 17.17 ? 240  MET D CA    1 
ATOM   9241  C C     . MET D 1 262 ? -12.847 4.999   -105.970 1.00 17.39 ? 240  MET D C     1 
ATOM   9242  O O     . MET D 1 262 ? -12.282 4.373   -105.090 1.00 17.51 ? 240  MET D O     1 
ATOM   9243  C CB    . MET D 1 262 ? -12.258 3.897   -108.119 1.00 17.97 ? 240  MET D CB    1 
ATOM   9244  C CG    . MET D 1 262 ? -13.654 3.294   -108.223 1.00 13.99 ? 240  MET D CG    1 
ATOM   9245  S SD    . MET D 1 262 ? -13.494 1.822   -109.217 1.00 20.22 ? 240  MET D SD    1 
ATOM   9246  C CE    . MET D 1 262 ? -13.470 2.459   -110.893 1.00 14.67 ? 240  MET D CE    1 
ATOM   9247  N N     . LEU D 1 263 ? -14.067 5.503   -105.841 1.00 16.41 ? 241  LEU D N     1 
ATOM   9248  C CA    . LEU D 1 263 ? -14.758 5.562   -104.569 1.00 17.27 ? 241  LEU D CA    1 
ATOM   9249  C C     . LEU D 1 263 ? -16.151 4.925   -104.604 1.00 15.73 ? 241  LEU D C     1 
ATOM   9250  O O     . LEU D 1 263 ? -16.965 5.241   -105.483 1.00 15.49 ? 241  LEU D O     1 
ATOM   9251  C CB    . LEU D 1 263 ? -14.943 7.034   -104.175 1.00 18.00 ? 241  LEU D CB    1 
ATOM   9252  C CG    . LEU D 1 263 ? -13.681 7.872   -104.050 1.00 16.43 ? 241  LEU D CG    1 
ATOM   9253  C CD1   . LEU D 1 263 ? -14.054 9.319   -103.789 1.00 17.25 ? 241  LEU D CD1   1 
ATOM   9254  C CD2   . LEU D 1 263 ? -12.815 7.295   -102.964 1.00 16.08 ? 241  LEU D CD2   1 
ATOM   9255  N N     . GLY D 1 264 ? -16.442 4.092   -103.609 1.00 14.89 ? 242  GLY D N     1 
ATOM   9256  C CA    . GLY D 1 264 ? -17.770 3.534   -103.431 1.00 15.54 ? 242  GLY D CA    1 
ATOM   9257  C C     . GLY D 1 264 ? -18.390 3.987   -102.123 1.00 16.47 ? 242  GLY D C     1 
ATOM   9258  O O     . GLY D 1 264 ? -19.414 4.658   -102.099 1.00 16.65 ? 242  GLY D O     1 
ATOM   9259  N N     . GLY D 1 265 ? -17.761 3.608   -101.020 1.00 18.86 ? 243  GLY D N     1 
ATOM   9260  C CA    . GLY D 1 265 ? -18.289 3.884   -99.685  1.00 18.21 ? 243  GLY D CA    1 
ATOM   9261  C C     . GLY D 1 265 ? -18.535 5.355   -99.469  1.00 18.01 ? 243  GLY D C     1 
ATOM   9262  O O     . GLY D 1 265 ? -19.588 5.725   -98.967  1.00 18.14 ? 243  GLY D O     1 
ATOM   9263  N N     . MET D 1 266 ? -17.582 6.194   -99.878  1.00 17.95 ? 244  MET D N     1 
ATOM   9264  C CA    . MET D 1 266 ? -17.719 7.649   -99.718  1.00 19.00 ? 244  MET D CA    1 
ATOM   9265  C C     . MET D 1 266 ? -18.844 8.275   -100.562 1.00 18.08 ? 244  MET D C     1 
ATOM   9266  O O     . MET D 1 266 ? -19.317 9.366   -100.247 1.00 17.51 ? 244  MET D O     1 
ATOM   9267  C CB    . MET D 1 266 ? -16.399 8.339   -100.028 1.00 20.43 ? 244  MET D CB    1 
ATOM   9268  C CG    . MET D 1 266 ? -15.365 8.217   -98.941  1.00 19.42 ? 244  MET D CG    1 
ATOM   9269  S SD    . MET D 1 266 ? -13.798 8.870   -99.499  1.00 21.12 ? 244  MET D SD    1 
ATOM   9270  C CE    . MET D 1 266 ? -14.250 10.611  -99.658  1.00 19.92 ? 244  MET D CE    1 
ATOM   9271  N N     . PHE D 1 267 ? -19.259 7.598   -101.630 1.00 16.62 ? 245  PHE D N     1 
ATOM   9272  C CA    . PHE D 1 267 ? -20.401 8.051   -102.407 1.00 16.51 ? 245  PHE D CA    1 
ATOM   9273  C C     . PHE D 1 267 ? -21.715 7.356   -102.030 1.00 17.01 ? 245  PHE D C     1 
ATOM   9274  O O     . PHE D 1 267 ? -22.800 7.825   -102.409 1.00 16.55 ? 245  PHE D O     1 
ATOM   9275  C CB    . PHE D 1 267 ? -20.109 7.875   -103.880 1.00 17.00 ? 245  PHE D CB    1 
ATOM   9276  C CG    . PHE D 1 267 ? -19.149 8.884   -104.431 1.00 15.17 ? 245  PHE D CG    1 
ATOM   9277  C CD1   . PHE D 1 267 ? -19.373 10.243  -104.254 1.00 15.65 ? 245  PHE D CD1   1 
ATOM   9278  C CD2   . PHE D 1 267 ? -18.055 8.475   -105.175 1.00 13.66 ? 245  PHE D CD2   1 
ATOM   9279  C CE1   . PHE D 1 267 ? -18.504 11.182  -104.790 1.00 18.77 ? 245  PHE D CE1   1 
ATOM   9280  C CE2   . PHE D 1 267 ? -17.175 9.402   -105.726 1.00 17.23 ? 245  PHE D CE2   1 
ATOM   9281  C CZ    . PHE D 1 267 ? -17.392 10.755  -105.535 1.00 20.53 ? 245  PHE D CZ    1 
ATOM   9282  N N     . SER D 1 268 ? -21.614 6.264   -101.266 1.00 17.50 ? 246  SER D N     1 
ATOM   9283  C CA    . SER D 1 268 ? -22.795 5.586   -100.706 1.00 16.81 ? 246  SER D CA    1 
ATOM   9284  C C     . SER D 1 268 ? -23.619 6.516   -99.806  1.00 16.49 ? 246  SER D C     1 
ATOM   9285  O O     . SER D 1 268 ? -23.088 7.471   -99.217  1.00 16.77 ? 246  SER D O     1 
ATOM   9286  C CB    . SER D 1 268 ? -22.399 4.366   -99.889  1.00 16.30 ? 246  SER D CB    1 
ATOM   9287  O OG    . SER D 1 268 ? -22.122 4.757   -98.569  1.00 10.79 ? 246  SER D OG    1 
ATOM   9288  N N     . GLY D 1 269 ? -24.920 6.236   -99.735  1.00 18.30 ? 247  GLY D N     1 
ATOM   9289  C CA    . GLY D 1 269 ? -25.825 6.878   -98.775  1.00 18.97 ? 247  GLY D CA    1 
ATOM   9290  C C     . GLY D 1 269 ? -26.507 8.151   -99.240  1.00 20.25 ? 247  GLY D C     1 
ATOM   9291  O O     . GLY D 1 269 ? -27.232 8.771   -98.471  1.00 21.13 ? 247  GLY D O     1 
ATOM   9292  N N     . HIS D 1 270 ? -26.272 8.550   -100.487 1.00 20.41 ? 248  HIS D N     1 
ATOM   9293  C CA    . HIS D 1 270 ? -26.809 9.804   -101.013 1.00 19.23 ? 248  HIS D CA    1 
ATOM   9294  C C     . HIS D 1 270 ? -28.129 9.638   -101.737 1.00 19.37 ? 248  HIS D C     1 
ATOM   9295  O O     . HIS D 1 270 ? -28.485 8.544   -102.143 1.00 19.09 ? 248  HIS D O     1 
ATOM   9296  C CB    . HIS D 1 270 ? -25.826 10.420  -101.992 1.00 18.88 ? 248  HIS D CB    1 
ATOM   9297  C CG    . HIS D 1 270 ? -24.556 10.851  -101.355 1.00 15.37 ? 248  HIS D CG    1 
ATOM   9298  N ND1   . HIS D 1 270 ? -23.384 10.142  -101.486 1.00 13.13 ? 248  HIS D ND1   1 
ATOM   9299  C CD2   . HIS D 1 270 ? -24.279 11.912  -100.562 1.00 14.86 ? 248  HIS D CD2   1 
ATOM   9300  C CE1   . HIS D 1 270 ? -22.434 10.755  -100.803 1.00 20.85 ? 248  HIS D CE1   1 
ATOM   9301  N NE2   . HIS D 1 270 ? -22.950 11.832  -100.235 1.00 18.37 ? 248  HIS D NE2   1 
ATOM   9302  N N     . THR D 1 271 ? -28.824 10.756  -101.929 1.00 20.60 ? 249  THR D N     1 
ATOM   9303  C CA    . THR D 1 271 ? -30.101 10.794  -102.641 1.00 20.95 ? 249  THR D CA    1 
ATOM   9304  C C     . THR D 1 271 ? -30.029 10.207  -104.044 1.00 21.80 ? 249  THR D C     1 
ATOM   9305  O O     . THR D 1 271 ? -30.986 9.608   -104.539 1.00 21.52 ? 249  THR D O     1 
ATOM   9306  C CB    . THR D 1 271 ? -30.520 12.241  -102.872 1.00 21.30 ? 249  THR D CB    1 
ATOM   9307  O OG1   . THR D 1 271 ? -29.914 13.068  -101.878 1.00 22.98 ? 249  THR D OG1   1 
ATOM   9308  C CG2   . THR D 1 271 ? -32.056 12.385  -102.866 1.00 25.03 ? 249  THR D CG2   1 
ATOM   9309  N N     . GLU D 1 272 ? -28.889 10.418  -104.694 1.00 23.58 ? 250  GLU D N     1 
ATOM   9310  C CA    . GLU D 1 272 ? -28.684 9.993   -106.073 1.00 24.26 ? 250  GLU D CA    1 
ATOM   9311  C C     . GLU D 1 272 ? -28.386 8.498   -106.136 1.00 25.53 ? 250  GLU D C     1 
ATOM   9312  O O     . GLU D 1 272 ? -28.382 7.909   -107.214 1.00 26.65 ? 250  GLU D O     1 
ATOM   9313  C CB    . GLU D 1 272 ? -27.533 10.775  -106.723 1.00 24.77 ? 250  GLU D CB    1 
ATOM   9314  C CG    . GLU D 1 272 ? -27.802 12.272  -106.972 1.00 25.85 ? 250  GLU D CG    1 
ATOM   9315  C CD    . GLU D 1 272 ? -27.828 13.123  -105.706 1.00 26.75 ? 250  GLU D CD    1 
ATOM   9316  O OE1   . GLU D 1 272 ? -27.379 12.646  -104.640 1.00 24.30 ? 250  GLU D OE1   1 
ATOM   9317  O OE2   . GLU D 1 272 ? -28.302 14.281  -105.779 1.00 20.92 ? 250  GLU D OE2   1 
ATOM   9318  N N     . CYS D 1 273 ? -28.127 7.889   -104.980 1.00 26.86 ? 251  CYS D N     1 
ATOM   9319  C CA    . CYS D 1 273 ? -27.849 6.454   -104.908 1.00 26.82 ? 251  CYS D CA    1 
ATOM   9320  C C     . CYS D 1 273 ? -29.103 5.642   -105.146 1.00 26.15 ? 251  CYS D C     1 
ATOM   9321  O O     . CYS D 1 273 ? -30.212 6.043   -104.760 1.00 25.34 ? 251  CYS D O     1 
ATOM   9322  C CB    . CYS D 1 273 ? -27.269 6.035   -103.543 1.00 26.93 ? 251  CYS D CB    1 
ATOM   9323  S SG    . CYS D 1 273 ? -25.528 6.330   -103.335 1.00 25.88 ? 251  CYS D SG    1 
ATOM   9324  N N     . ALA D 1 274 ? -28.905 4.478   -105.752 1.00 25.93 ? 252  ALA D N     1 
ATOM   9325  C CA    . ALA D 1 274 ? -29.974 3.514   -105.916 1.00 26.75 ? 252  ALA D CA    1 
ATOM   9326  C C     . ALA D 1 274 ? -30.453 3.060   -104.552 1.00 26.91 ? 252  ALA D C     1 
ATOM   9327  O O     . ALA D 1 274 ? -29.633 2.799   -103.659 1.00 27.30 ? 252  ALA D O     1 
ATOM   9328  C CB    . ALA D 1 274 ? -29.496 2.306   -106.710 1.00 27.47 ? 252  ALA D CB    1 
ATOM   9329  N N     . GLY D 1 275 ? -31.776 2.967   -104.405 1.00 26.50 ? 253  GLY D N     1 
ATOM   9330  C CA    . GLY D 1 275 ? -32.397 2.504   -103.171 1.00 26.51 ? 253  GLY D CA    1 
ATOM   9331  C C     . GLY D 1 275 ? -33.207 3.601   -102.516 1.00 27.41 ? 253  GLY D C     1 
ATOM   9332  O O     . GLY D 1 275 ? -33.018 4.788   -102.792 1.00 27.03 ? 253  GLY D O     1 
ATOM   9333  N N     . GLU D 1 276 ? -34.129 3.189   -101.655 1.00 28.76 ? 254  GLU D N     1 
ATOM   9334  C CA    . GLU D 1 276 ? -34.923 4.120   -100.862 1.00 29.23 ? 254  GLU D CA    1 
ATOM   9335  C C     . GLU D 1 276 ? -34.299 4.278   -99.469  1.00 28.99 ? 254  GLU D C     1 
ATOM   9336  O O     . GLU D 1 276 ? -33.439 3.486   -99.059  1.00 27.82 ? 254  GLU D O     1 
ATOM   9337  C CB    . GLU D 1 276 ? -36.390 3.641   -100.770 1.00 29.72 ? 254  GLU D CB    1 
ATOM   9338  N N     . VAL D 1 277 ? -34.738 5.309   -98.752  1.00 29.32 ? 255  VAL D N     1 
ATOM   9339  C CA    . VAL D 1 277 ? -34.286 5.552   -97.384  1.00 29.87 ? 255  VAL D CA    1 
ATOM   9340  C C     . VAL D 1 277 ? -34.959 4.566   -96.417  1.00 29.69 ? 255  VAL D C     1 
ATOM   9341  O O     . VAL D 1 277 ? -36.149 4.277   -96.539  1.00 29.47 ? 255  VAL D O     1 
ATOM   9342  C CB    . VAL D 1 277 ? -34.562 7.021   -96.956  1.00 30.24 ? 255  VAL D CB    1 
ATOM   9343  C CG1   . VAL D 1 277 ? -34.265 7.238   -95.463  1.00 29.85 ? 255  VAL D CG1   1 
ATOM   9344  C CG2   . VAL D 1 277 ? -33.741 7.977   -97.820  1.00 30.12 ? 255  VAL D CG2   1 
ATOM   9345  N N     . ILE D 1 278 ? -34.179 4.048   -95.472  1.00 29.12 ? 256  ILE D N     1 
ATOM   9346  C CA    . ILE D 1 278 ? -34.671 3.099   -94.471  1.00 28.65 ? 256  ILE D CA    1 
ATOM   9347  C C     . ILE D 1 278 ? -34.860 3.775   -93.100  1.00 27.79 ? 256  ILE D C     1 
ATOM   9348  O O     . ILE D 1 278 ? -34.277 4.825   -92.817  1.00 26.95 ? 256  ILE D O     1 
ATOM   9349  C CB    . ILE D 1 278 ? -33.724 1.875   -94.360  1.00 28.54 ? 256  ILE D CB    1 
ATOM   9350  N N     . ARG D 1 283 ? -33.254 7.282   -87.173  1.00 25.18 ? 261  ARG D N     1 
ATOM   9351  C CA    . ARG D 1 283 ? -32.085 7.176   -88.024  1.00 24.54 ? 261  ARG D CA    1 
ATOM   9352  C C     . ARG D 1 283 ? -32.508 6.921   -89.484  1.00 23.14 ? 261  ARG D C     1 
ATOM   9353  O O     . ARG D 1 283 ? -33.237 5.967   -89.768  1.00 23.10 ? 261  ARG D O     1 
ATOM   9354  C CB    . ARG D 1 283 ? -31.181 6.053   -87.514  1.00 25.21 ? 261  ARG D CB    1 
ATOM   9355  N N     . LYS D 1 284 ? -32.069 7.783   -90.400  1.00 21.78 ? 262  LYS D N     1 
ATOM   9356  C CA    . LYS D 1 284 ? -32.284 7.574   -91.846  1.00 20.89 ? 262  LYS D CA    1 
ATOM   9357  C C     . LYS D 1 284 ? -31.059 6.898   -92.477  1.00 20.22 ? 262  LYS D C     1 
ATOM   9358  O O     . LYS D 1 284 ? -29.922 7.339   -92.296  1.00 18.26 ? 262  LYS D O     1 
ATOM   9359  C CB    . LYS D 1 284 ? -32.598 8.896   -92.561  1.00 20.56 ? 262  LYS D CB    1 
ATOM   9360  N N     . LEU D 1 285 ? -31.303 5.815   -93.209  1.00 20.45 ? 263  LEU D N     1 
ATOM   9361  C CA    . LEU D 1 285 ? -30.226 5.006   -93.777  1.00 19.92 ? 263  LEU D CA    1 
ATOM   9362  C C     . LEU D 1 285 ? -30.501 4.566   -95.221  1.00 18.81 ? 263  LEU D C     1 
ATOM   9363  O O     . LEU D 1 285 ? -31.648 4.490   -95.660  1.00 15.86 ? 263  LEU D O     1 
ATOM   9364  C CB    . LEU D 1 285 ? -29.993 3.780   -92.885  1.00 19.88 ? 263  LEU D CB    1 
ATOM   9365  N N     . LYS D 1 286 ? -29.428 4.289   -95.954  1.00 19.37 ? 264  LYS D N     1 
ATOM   9366  C CA    . LYS D 1 286 ? -29.518 3.647   -97.267  1.00 21.23 ? 264  LYS D CA    1 
ATOM   9367  C C     . LYS D 1 286 ? -28.710 2.360   -97.212  1.00 21.44 ? 264  LYS D C     1 
ATOM   9368  O O     . LYS D 1 286 ? -27.730 2.275   -96.471  1.00 22.71 ? 264  LYS D O     1 
ATOM   9369  C CB    . LYS D 1 286 ? -28.998 4.563   -98.378  1.00 21.86 ? 264  LYS D CB    1 
ATOM   9370  C CG    . LYS D 1 286 ? -29.947 5.712   -98.720  1.00 24.65 ? 264  LYS D CG    1 
ATOM   9371  C CD    . LYS D 1 286 ? -30.840 5.433   -99.939  1.00 26.89 ? 264  LYS D CD    1 
ATOM   9372  C CE    . LYS D 1 286 ? -30.210 5.926   -101.250 1.00 27.66 ? 264  LYS D CE    1 
ATOM   9373  N NZ    . LYS D 1 286 ? -31.204 6.550   -102.184 1.00 25.81 ? 264  LYS D NZ    1 
ATOM   9374  N N     . LEU D 1 287 ? -29.129 1.355   -97.973  1.00 21.61 ? 265  LEU D N     1 
ATOM   9375  C CA    . LEU D 1 287 ? -28.386 0.088   -98.050  1.00 21.41 ? 265  LEU D CA    1 
ATOM   9376  C C     . LEU D 1 287 ? -27.231 0.190   -99.043  1.00 20.73 ? 265  LEU D C     1 
ATOM   9377  O O     . LEU D 1 287 ? -27.379 0.730   -100.136 1.00 22.83 ? 265  LEU D O     1 
ATOM   9378  C CB    . LEU D 1 287 ? -29.290 -1.094  -98.433  1.00 22.44 ? 265  LEU D CB    1 
ATOM   9379  C CG    . LEU D 1 287 ? -28.775 -2.478  -97.975  1.00 21.10 ? 265  LEU D CG    1 
ATOM   9380  C CD1   . LEU D 1 287 ? -29.188 -2.772  -96.524  1.00 18.46 ? 265  LEU D CD1   1 
ATOM   9381  C CD2   . LEU D 1 287 ? -29.252 -3.591  -98.881  1.00 20.72 ? 265  LEU D CD2   1 
ATOM   9382  N N     . PHE D 1 288 ? -26.083 -0.342  -98.652  1.00 19.95 ? 266  PHE D N     1 
ATOM   9383  C CA    . PHE D 1 288 ? -24.891 -0.336  -99.498  1.00 18.96 ? 266  PHE D CA    1 
ATOM   9384  C C     . PHE D 1 288 ? -24.300 -1.741  -99.449  1.00 19.62 ? 266  PHE D C     1 
ATOM   9385  O O     . PHE D 1 288 ? -23.998 -2.256  -98.370  1.00 19.06 ? 266  PHE D O     1 
ATOM   9386  C CB    . PHE D 1 288 ? -23.910 0.703   -98.962  1.00 17.80 ? 266  PHE D CB    1 
ATOM   9387  C CG    . PHE D 1 288 ? -22.625 0.807   -99.730  1.00 14.27 ? 266  PHE D CG    1 
ATOM   9388  C CD1   . PHE D 1 288 ? -21.400 0.580   -99.099  1.00 13.45 ? 266  PHE D CD1   1 
ATOM   9389  C CD2   . PHE D 1 288 ? -22.632 1.163   -101.068 1.00 9.15  ? 266  PHE D CD2   1 
ATOM   9390  C CE1   . PHE D 1 288 ? -20.201 0.700   -99.801  1.00 12.55 ? 266  PHE D CE1   1 
ATOM   9391  C CE2   . PHE D 1 288 ? -21.450 1.281   -101.776 1.00 14.60 ? 266  PHE D CE2   1 
ATOM   9392  C CZ    . PHE D 1 288 ? -20.225 1.045   -101.144 1.00 14.05 ? 266  PHE D CZ    1 
ATOM   9393  N N     . TYR D 1 289 ? -24.154 -2.371  -100.612 1.00 20.66 ? 267  TYR D N     1 
ATOM   9394  C CA    . TYR D 1 289 ? -23.734 -3.765  -100.656 1.00 21.97 ? 267  TYR D CA    1 
ATOM   9395  C C     . TYR D 1 289 ? -22.661 -4.054  -101.719 1.00 23.08 ? 267  TYR D C     1 
ATOM   9396  O O     . TYR D 1 289 ? -22.586 -3.388  -102.773 1.00 23.12 ? 267  TYR D O     1 
ATOM   9397  C CB    . TYR D 1 289 ? -24.949 -4.695  -100.813 1.00 21.52 ? 267  TYR D CB    1 
ATOM   9398  C CG    . TYR D 1 289 ? -25.796 -4.410  -102.029 1.00 21.28 ? 267  TYR D CG    1 
ATOM   9399  C CD1   . TYR D 1 289 ? -26.918 -3.587  -101.947 1.00 20.88 ? 267  TYR D CD1   1 
ATOM   9400  C CD2   . TYR D 1 289 ? -25.469 -4.961  -103.268 1.00 23.77 ? 267  TYR D CD2   1 
ATOM   9401  C CE1   . TYR D 1 289 ? -27.701 -3.321  -103.077 1.00 22.71 ? 267  TYR D CE1   1 
ATOM   9402  C CE2   . TYR D 1 289 ? -26.229 -4.704  -104.400 1.00 24.64 ? 267  TYR D CE2   1 
ATOM   9403  C CZ    . TYR D 1 289 ? -27.345 -3.881  -104.307 1.00 26.01 ? 267  TYR D CZ    1 
ATOM   9404  O OH    . TYR D 1 289 ? -28.105 -3.632  -105.437 1.00 24.22 ? 267  TYR D OH    1 
ATOM   9405  N N     . GLY D 1 290 ? -21.827 -5.051  -101.403 1.00 22.75 ? 268  GLY D N     1 
ATOM   9406  C CA    . GLY D 1 290 ? -20.762 -5.500  -102.282 1.00 22.28 ? 268  GLY D CA    1 
ATOM   9407  C C     . GLY D 1 290 ? -21.252 -5.993  -103.628 1.00 21.98 ? 268  GLY D C     1 
ATOM   9408  O O     . GLY D 1 290 ? -22.368 -6.494  -103.772 1.00 22.79 ? 268  GLY D O     1 
ATOM   9409  N N     . MET D 1 291 ? -20.393 -5.839  -104.618 1.00 20.79 ? 269  MET D N     1 
ATOM   9410  C CA    . MET D 1 291 ? -20.670 -6.257  -105.980 1.00 20.46 ? 269  MET D CA    1 
ATOM   9411  C C     . MET D 1 291 ? -20.849 -7.769  -106.107 1.00 20.98 ? 269  MET D C     1 
ATOM   9412  O O     . MET D 1 291 ? -21.614 -8.239  -106.960 1.00 21.21 ? 269  MET D O     1 
ATOM   9413  C CB    . MET D 1 291 ? -19.517 -5.810  -106.861 1.00 20.77 ? 269  MET D CB    1 
ATOM   9414  C CG    . MET D 1 291 ? -19.441 -4.284  -106.993 1.00 22.44 ? 269  MET D CG    1 
ATOM   9415  S SD    . MET D 1 291 ? -17.919 -3.666  -107.718 1.00 19.60 ? 269  MET D SD    1 
ATOM   9416  C CE    . MET D 1 291 ? -18.048 -4.277  -109.374 1.00 14.06 ? 269  MET D CE    1 
ATOM   9417  N N     . SER D 1 292 ? -20.147 -8.523  -105.256 1.00 20.63 ? 270  SER D N     1 
ATOM   9418  C CA    . SER D 1 292 ? -20.305 -9.977  -105.172 1.00 19.44 ? 270  SER D CA    1 
ATOM   9419  C C     . SER D 1 292 ? -20.962 -10.380 -103.846 1.00 19.28 ? 270  SER D C     1 
ATOM   9420  O O     . SER D 1 292 ? -20.790 -11.499 -103.376 1.00 19.59 ? 270  SER D O     1 
ATOM   9421  C CB    . SER D 1 292 ? -18.942 -10.666 -105.311 1.00 19.45 ? 270  SER D CB    1 
ATOM   9422  O OG    . SER D 1 292 ? -18.440 -10.607 -106.636 1.00 17.22 ? 270  SER D OG    1 
ATOM   9423  N N     . SER D 1 293 ? -21.736 -9.478  -103.251 1.00 18.69 ? 271  SER D N     1 
ATOM   9424  C CA    . SER D 1 293 ? -22.409 -9.757  -101.976 1.00 18.50 ? 271  SER D CA    1 
ATOM   9425  C C     . SER D 1 293 ? -23.551 -10.748 -102.168 1.00 18.12 ? 271  SER D C     1 
ATOM   9426  O O     . SER D 1 293 ? -23.991 -11.005 -103.287 1.00 16.62 ? 271  SER D O     1 
ATOM   9427  C CB    . SER D 1 293 ? -22.958 -8.465  -101.360 1.00 17.95 ? 271  SER D CB    1 
ATOM   9428  O OG    . SER D 1 293 ? -23.902 -7.841  -102.218 1.00 17.02 ? 271  SER D OG    1 
ATOM   9429  N N     . ASP D 1 294 ? -24.033 -11.300 -101.063 1.00 20.43 ? 272  ASP D N     1 
ATOM   9430  C CA    . ASP D 1 294 ? -25.255 -12.124 -101.081 1.00 22.97 ? 272  ASP D CA    1 
ATOM   9431  C C     . ASP D 1 294 ? -26.456 -11.339 -101.611 1.00 21.05 ? 272  ASP D C     1 
ATOM   9432  O O     . ASP D 1 294 ? -27.294 -11.896 -102.327 1.00 21.25 ? 272  ASP D O     1 
ATOM   9433  C CB    . ASP D 1 294 ? -25.565 -12.674 -99.682  1.00 23.38 ? 272  ASP D CB    1 
ATOM   9434  C CG    . ASP D 1 294 ? -24.688 -13.852 -99.320  1.00 30.64 ? 272  ASP D CG    1 
ATOM   9435  O OD1   . ASP D 1 294 ? -24.325 -14.617 -100.242 1.00 34.99 ? 272  ASP D OD1   1 
ATOM   9436  O OD2   . ASP D 1 294 ? -24.365 -14.011 -98.121  1.00 39.94 ? 272  ASP D OD2   1 
ATOM   9437  N N     . THR D 1 295 ? -26.520 -10.057 -101.247 1.00 20.07 ? 273  THR D N     1 
ATOM   9438  C CA    . THR D 1 295 ? -27.569 -9.153  -101.704 1.00 19.97 ? 273  THR D CA    1 
ATOM   9439  C C     . THR D 1 295 ? -27.541 -8.995  -103.233 1.00 20.24 ? 273  THR D C     1 
ATOM   9440  O O     . THR D 1 295 ? -28.578 -9.042  -103.896 1.00 18.78 ? 273  THR D O     1 
ATOM   9441  C CB    . THR D 1 295 ? -27.471 -7.787  -100.968 1.00 20.24 ? 273  THR D CB    1 
ATOM   9442  O OG1   . THR D 1 295 ? -27.940 -7.941  -99.618  1.00 18.46 ? 273  THR D OG1   1 
ATOM   9443  C CG2   . THR D 1 295 ? -28.311 -6.709  -101.659 1.00 20.97 ? 273  THR D CG2   1 
ATOM   9444  N N     . ALA D 1 296 ? -26.351 -8.824  -103.789 1.00 22.68 ? 274  ALA D N     1 
ATOM   9445  C CA    . ALA D 1 296 ? -26.194 -8.739  -105.240 1.00 24.57 ? 274  ALA D CA    1 
ATOM   9446  C C     . ALA D 1 296 ? -26.537 -10.077 -105.896 1.00 25.91 ? 274  ALA D C     1 
ATOM   9447  O O     . ALA D 1 296 ? -27.236 -10.109 -106.909 1.00 26.16 ? 274  ALA D O     1 
ATOM   9448  C CB    . ALA D 1 296 ? -24.770 -8.305  -105.602 1.00 24.87 ? 274  ALA D CB    1 
ATOM   9449  N N     . MET D 1 297 ? -26.056 -11.177 -105.312 1.00 27.50 ? 275  MET D N     1 
ATOM   9450  C CA    . MET D 1 297 ? -26.333 -12.518 -105.852 1.00 27.26 ? 275  MET D CA    1 
ATOM   9451  C C     . MET D 1 297 ? -27.839 -12.807 -105.898 1.00 28.24 ? 275  MET D C     1 
ATOM   9452  O O     . MET D 1 297 ? -28.326 -13.366 -106.878 1.00 29.07 ? 275  MET D O     1 
ATOM   9453  C CB    . MET D 1 297 ? -25.589 -13.619 -105.075 1.00 26.50 ? 275  MET D CB    1 
ATOM   9454  C CG    . MET D 1 297 ? -24.525 -14.325 -105.888 1.00 23.42 ? 275  MET D CG    1 
ATOM   9455  N N     . ASN D 1 298 ? -28.570 -12.417 -104.858 1.00 28.07 ? 276  ASN D N     1 
ATOM   9456  C CA    . ASN D 1 298 ? -30.024 -12.567 -104.846 1.00 28.84 ? 276  ASN D CA    1 
ATOM   9457  C C     . ASN D 1 298 ? -30.727 -11.642 -105.834 1.00 28.49 ? 276  ASN D C     1 
ATOM   9458  O O     . ASN D 1 298 ? -31.694 -12.029 -106.472 1.00 27.88 ? 276  ASN D O     1 
ATOM   9459  C CB    . ASN D 1 298 ? -30.550 -12.282 -103.443 1.00 29.73 ? 276  ASN D CB    1 
ATOM   9460  C CG    . ASN D 1 298 ? -30.057 -13.285 -102.426 1.00 32.68 ? 276  ASN D CG    1 
ATOM   9461  O OD1   . ASN D 1 298 ? -30.037 -14.494 -102.686 1.00 32.85 ? 276  ASN D OD1   1 
ATOM   9462  N ND2   . ASN D 1 298 ? -29.669 -12.793 -101.251 1.00 33.15 ? 276  ASN D ND2   1 
ATOM   9463  N N     . LYS D 1 299 ? -30.229 -10.416 -105.941 1.00 29.59 ? 277  LYS D N     1 
ATOM   9464  C CA    . LYS D 1 299 ? -30.795 -9.394  -106.828 1.00 29.81 ? 277  LYS D CA    1 
ATOM   9465  C C     . LYS D 1 299 ? -30.523 -9.680  -108.325 1.00 29.91 ? 277  LYS D C     1 
ATOM   9466  O O     . LYS D 1 299 ? -31.359 -9.381  -109.184 1.00 28.34 ? 277  LYS D O     1 
ATOM   9467  C CB    . LYS D 1 299 ? -30.234 -8.027  -106.406 1.00 30.31 ? 277  LYS D CB    1 
ATOM   9468  C CG    . LYS D 1 299 ? -30.811 -6.805  -107.129 1.00 31.07 ? 277  LYS D CG    1 
ATOM   9469  C CD    . LYS D 1 299 ? -31.077 -5.591  -106.198 1.00 34.37 ? 277  LYS D CD    1 
ATOM   9470  C CE    . LYS D 1 299 ? -30.433 -5.676  -104.796 1.00 34.86 ? 277  LYS D CE    1 
ATOM   9471  N NZ    . LYS D 1 299 ? -30.531 -4.386  -104.037 1.00 36.43 ? 277  LYS D NZ    1 
ATOM   9472  N N     . HIS D 1 300 ? -29.357 -10.268 -108.615 1.00 30.56 ? 278  HIS D N     1 
ATOM   9473  C CA    . HIS D 1 300 ? -28.941 -10.612 -109.988 1.00 30.31 ? 278  HIS D CA    1 
ATOM   9474  C C     . HIS D 1 300 ? -28.587 -12.087 -110.086 1.00 30.09 ? 278  HIS D C     1 
ATOM   9475  O O     . HIS D 1 300 ? -29.305 -12.868 -110.690 1.00 30.27 ? 278  HIS D O     1 
ATOM   9476  C CB    . HIS D 1 300 ? -27.703 -9.817  -110.419 1.00 30.30 ? 278  HIS D CB    1 
ATOM   9477  C CG    . HIS D 1 300 ? -27.686 -8.396  -109.943 1.00 31.05 ? 278  HIS D CG    1 
ATOM   9478  N ND1   . HIS D 1 300 ? -28.532 -7.428  -110.448 1.00 29.38 ? 278  HIS D ND1   1 
ATOM   9479  C CD2   . HIS D 1 300 ? -26.906 -7.775  -109.023 1.00 27.38 ? 278  HIS D CD2   1 
ATOM   9480  C CE1   . HIS D 1 300 ? -28.286 -6.277  -109.846 1.00 30.07 ? 278  HIS D CE1   1 
ATOM   9481  N NE2   . HIS D 1 300 ? -27.303 -6.459  -108.980 1.00 26.42 ? 278  HIS D NE2   1 
ATOM   9482  N N     . ALA D 1 305 ? -20.904 -13.960 -109.110 1.00 39.59 ? 283  ALA D N     1 
ATOM   9483  C CA    . ALA D 1 305 ? -20.301 -14.986 -108.249 1.00 39.32 ? 283  ALA D CA    1 
ATOM   9484  C C     . ALA D 1 305 ? -18.824 -14.692 -108.011 1.00 38.34 ? 283  ALA D C     1 
ATOM   9485  O O     . ALA D 1 305 ? -18.400 -14.528 -106.861 1.00 39.07 ? 283  ALA D O     1 
ATOM   9486  C CB    . ALA D 1 305 ? -20.484 -16.390 -108.835 1.00 38.93 ? 283  ALA D CB    1 
ATOM   9487  N N     . GLU D 1 306 ? -18.045 -14.625 -109.090 1.00 35.31 ? 284  GLU D N     1 
ATOM   9488  C CA    . GLU D 1 306 ? -16.619 -14.310 -108.989 1.00 33.16 ? 284  GLU D CA    1 
ATOM   9489  C C     . GLU D 1 306 ? -16.323 -13.067 -109.823 1.00 30.88 ? 284  GLU D C     1 
ATOM   9490  O O     . GLU D 1 306 ? -15.390 -13.040 -110.634 1.00 29.32 ? 284  GLU D O     1 
ATOM   9491  C CB    . GLU D 1 306 ? -15.762 -15.498 -109.451 1.00 34.50 ? 284  GLU D CB    1 
ATOM   9492  N N     . TYR D 1 307 ? -17.142 -12.043 -109.610 1.00 28.63 ? 285  TYR D N     1 
ATOM   9493  C CA    . TYR D 1 307 ? -16.951 -10.749 -110.228 1.00 26.76 ? 285  TYR D CA    1 
ATOM   9494  C C     . TYR D 1 307 ? -15.846 -10.022 -109.476 1.00 24.93 ? 285  TYR D C     1 
ATOM   9495  O O     . TYR D 1 307 ? -14.972 -9.404  -110.090 1.00 22.41 ? 285  TYR D O     1 
ATOM   9496  C CB    . TYR D 1 307 ? -18.274 -9.971  -110.207 1.00 26.17 ? 285  TYR D CB    1 
ATOM   9497  C CG    . TYR D 1 307 ? -18.314 -8.655  -110.972 1.00 26.59 ? 285  TYR D CG    1 
ATOM   9498  C CD1   . TYR D 1 307 ? -17.518 -8.424  -112.095 1.00 27.33 ? 285  TYR D CD1   1 
ATOM   9499  C CD2   . TYR D 1 307 ? -19.188 -7.654  -110.588 1.00 26.91 ? 285  TYR D CD2   1 
ATOM   9500  C CE1   . TYR D 1 307 ? -17.580 -7.215  -112.786 1.00 28.66 ? 285  TYR D CE1   1 
ATOM   9501  C CE2   . TYR D 1 307 ? -19.256 -6.446  -111.274 1.00 29.79 ? 285  TYR D CE2   1 
ATOM   9502  C CZ    . TYR D 1 307 ? -18.447 -6.223  -112.363 1.00 29.26 ? 285  TYR D CZ    1 
ATOM   9503  O OH    . TYR D 1 307 ? -18.532 -5.007  -113.013 1.00 20.83 ? 285  TYR D OH    1 
ATOM   9504  N N     . ARG D 1 308 ? -15.892 -10.127 -108.144 1.00 24.10 ? 286  ARG D N     1 
ATOM   9505  C CA    . ARG D 1 308 ? -14.902 -9.530  -107.241 1.00 22.67 ? 286  ARG D CA    1 
ATOM   9506  C C     . ARG D 1 308 ? -14.214 -10.612 -106.407 1.00 21.11 ? 286  ARG D C     1 
ATOM   9507  O O     . ARG D 1 308 ? -14.724 -11.725 -106.288 1.00 20.91 ? 286  ARG D O     1 
ATOM   9508  C CB    . ARG D 1 308 ? -15.599 -8.530  -106.312 1.00 22.52 ? 286  ARG D CB    1 
ATOM   9509  C CG    . ARG D 1 308 ? -16.306 -7.355  -106.995 1.00 18.39 ? 286  ARG D CG    1 
ATOM   9510  C CD    . ARG D 1 308 ? -15.335 -6.240  -107.337 1.00 18.10 ? 286  ARG D CD    1 
ATOM   9511  N NE    . ARG D 1 308 ? -14.397 -6.661  -108.367 1.00 20.30 ? 286  ARG D NE    1 
ATOM   9512  C CZ    . ARG D 1 308 ? -13.337 -5.963  -108.749 1.00 19.13 ? 286  ARG D CZ    1 
ATOM   9513  N NH1   . ARG D 1 308 ? -13.081 -4.793  -108.187 1.00 19.92 ? 286  ARG D NH1   1 
ATOM   9514  N NH2   . ARG D 1 308 ? -12.529 -6.444  -109.693 1.00 17.87 ? 286  ARG D NH2   1 
ATOM   9515  N N     . ALA D 1 309 ? -13.063 -10.267 -105.824 1.00 19.92 ? 287  ALA D N     1 
ATOM   9516  C CA    . ALA D 1 309 ? -12.224 -11.249 -105.116 1.00 20.00 ? 287  ALA D CA    1 
ATOM   9517  C C     . ALA D 1 309 ? -12.867 -11.863 -103.869 1.00 20.30 ? 287  ALA D C     1 
ATOM   9518  O O     . ALA D 1 309 ? -12.457 -12.947 -103.453 1.00 19.38 ? 287  ALA D O     1 
ATOM   9519  C CB    . ALA D 1 309 ? -10.889 -10.660 -104.763 1.00 18.43 ? 287  ALA D CB    1 
ATOM   9520  N N     . SER D 1 310 ? -13.879 -11.189 -103.303 1.00 20.58 ? 288  SER D N     1 
ATOM   9521  C CA    . SER D 1 310 ? -14.580 -11.645 -102.093 1.00 20.29 ? 288  SER D CA    1 
ATOM   9522  C C     . SER D 1 310 ? -16.071 -11.465 -102.238 1.00 20.58 ? 288  SER D C     1 
ATOM   9523  O O     . SER D 1 310 ? -16.524 -10.615 -102.995 1.00 21.07 ? 288  SER D O     1 
ATOM   9524  C CB    . SER D 1 310 ? -14.167 -10.812 -100.885 1.00 20.86 ? 288  SER D CB    1 
ATOM   9525  O OG    . SER D 1 310 ? -14.684 -9.486  -100.974 1.00 17.68 ? 288  SER D OG    1 
ATOM   9526  N N     . GLU D 1 311 ? -16.835 -12.238 -101.481 1.00 22.38 ? 289  GLU D N     1 
ATOM   9527  C CA    . GLU D 1 311 ? -18.262 -12.001 -101.367 1.00 23.22 ? 289  GLU D CA    1 
ATOM   9528  C C     . GLU D 1 311 ? -18.412 -10.845 -100.380 1.00 23.06 ? 289  GLU D C     1 
ATOM   9529  O O     . GLU D 1 311 ? -18.117 -10.991 -99.194  1.00 23.92 ? 289  GLU D O     1 
ATOM   9530  C CB    . GLU D 1 311 ? -18.990 -13.266 -100.879 1.00 23.03 ? 289  GLU D CB    1 
ATOM   9531  N N     . GLY D 1 312 ? -18.847 -9.691  -100.876 1.00 22.49 ? 290  GLY D N     1 
ATOM   9532  C CA    . GLY D 1 312 ? -18.744 -8.456  -100.111 1.00 21.72 ? 290  GLY D CA    1 
ATOM   9533  C C     . GLY D 1 312 ? -19.798 -8.325  -99.045  1.00 21.86 ? 290  GLY D C     1 
ATOM   9534  O O     . GLY D 1 312 ? -20.753 -9.100  -99.014  1.00 22.00 ? 290  GLY D O     1 
ATOM   9535  N N     . LYS D 1 313 ? -19.611 -7.330  -98.183  1.00 22.42 ? 291  LYS D N     1 
ATOM   9536  C CA    . LYS D 1 313 ? -20.550 -7.009  -97.118  1.00 23.21 ? 291  LYS D CA    1 
ATOM   9537  C C     . LYS D 1 313 ? -21.819 -6.343  -97.648  1.00 21.93 ? 291  LYS D C     1 
ATOM   9538  O O     . LYS D 1 313 ? -21.840 -5.772  -98.730  1.00 22.19 ? 291  LYS D O     1 
ATOM   9539  C CB    . LYS D 1 313 ? -19.894 -6.062  -96.098  1.00 23.59 ? 291  LYS D CB    1 
ATOM   9540  C CG    . LYS D 1 313 ? -19.049 -6.733  -95.026  1.00 24.16 ? 291  LYS D CG    1 
ATOM   9541  C CD    . LYS D 1 313 ? -18.367 -5.711  -94.124  1.00 23.74 ? 291  LYS D CD    1 
ATOM   9542  N N     . THR D 1 314 ? -22.885 -6.442  -96.872  1.00 21.93 ? 292  THR D N     1 
ATOM   9543  C CA    . THR D 1 314 ? -24.057 -5.608  -97.046  1.00 22.12 ? 292  THR D CA    1 
ATOM   9544  C C     . THR D 1 314 ? -24.147 -4.743  -95.786  1.00 22.19 ? 292  THR D C     1 
ATOM   9545  O O     . THR D 1 314 ? -24.229 -5.272  -94.684  1.00 21.09 ? 292  THR D O     1 
ATOM   9546  C CB    . THR D 1 314 ? -25.297 -6.496  -97.224  1.00 21.47 ? 292  THR D CB    1 
ATOM   9547  O OG1   . THR D 1 314 ? -25.136 -7.288  -98.412  1.00 21.50 ? 292  THR D OG1   1 
ATOM   9548  C CG2   . THR D 1 314 ? -26.560 -5.664  -97.319  1.00 20.52 ? 292  THR D CG2   1 
ATOM   9549  N N     . VAL D 1 315 ? -24.097 -3.423  -95.939  1.00 22.94 ? 293  VAL D N     1 
ATOM   9550  C CA    . VAL D 1 315 ? -24.204 -2.520  -94.786  1.00 23.22 ? 293  VAL D CA    1 
ATOM   9551  C C     . VAL D 1 315 ? -25.310 -1.484  -94.971  1.00 23.09 ? 293  VAL D C     1 
ATOM   9552  O O     . VAL D 1 315 ? -25.663 -1.132  -96.102  1.00 22.71 ? 293  VAL D O     1 
ATOM   9553  C CB    . VAL D 1 315 ? -22.868 -1.772  -94.469  1.00 23.57 ? 293  VAL D CB    1 
ATOM   9554  C CG1   . VAL D 1 315 ? -21.754 -2.763  -94.177  1.00 24.09 ? 293  VAL D CG1   1 
ATOM   9555  C CG2   . VAL D 1 315 ? -22.458 -0.822  -95.606  1.00 23.44 ? 293  VAL D CG2   1 
ATOM   9556  N N     . GLU D 1 316 ? -25.851 -1.020  -93.841  1.00 22.99 ? 294  GLU D N     1 
ATOM   9557  C CA    . GLU D 1 316 ? -26.726 0.140   -93.804  1.00 23.58 ? 294  GLU D CA    1 
ATOM   9558  C C     . GLU D 1 316 ? -25.837 1.346   -93.485  1.00 24.43 ? 294  GLU D C     1 
ATOM   9559  O O     . GLU D 1 316 ? -25.159 1.379   -92.456  1.00 24.21 ? 294  GLU D O     1 
ATOM   9560  C CB    . GLU D 1 316 ? -27.835 -0.041  -92.760  1.00 23.47 ? 294  GLU D CB    1 
ATOM   9561  N N     . VAL D 1 317 ? -25.817 2.318   -94.393  1.00 24.83 ? 295  VAL D N     1 
ATOM   9562  C CA    . VAL D 1 317 ? -25.012 3.522   -94.212  1.00 24.91 ? 295  VAL D CA    1 
ATOM   9563  C C     . VAL D 1 317 ? -25.938 4.701   -93.869  1.00 25.06 ? 295  VAL D C     1 
ATOM   9564  O O     . VAL D 1 317 ? -27.054 4.774   -94.380  1.00 23.89 ? 295  VAL D O     1 
ATOM   9565  C CB    . VAL D 1 317 ? -24.109 3.816   -95.447  1.00 23.97 ? 295  VAL D CB    1 
ATOM   9566  C CG1   . VAL D 1 317 ? -24.385 2.861   -96.573  1.00 23.69 ? 295  VAL D CG1   1 
ATOM   9567  C CG2   . VAL D 1 317 ? -24.249 5.267   -95.918  1.00 24.91 ? 295  VAL D CG2   1 
ATOM   9568  N N     . PRO D 1 318 ? -25.484 5.612   -92.981  1.00 26.13 ? 296  PRO D N     1 
ATOM   9569  C CA    . PRO D 1 318 ? -26.244 6.839   -92.703  1.00 26.27 ? 296  PRO D CA    1 
ATOM   9570  C C     . PRO D 1 318 ? -26.608 7.626   -93.961  1.00 25.61 ? 296  PRO D C     1 
ATOM   9571  O O     . PRO D 1 318 ? -25.762 7.839   -94.831  1.00 25.02 ? 296  PRO D O     1 
ATOM   9572  C CB    . PRO D 1 318 ? -25.283 7.678   -91.843  1.00 26.29 ? 296  PRO D CB    1 
ATOM   9573  C CG    . PRO D 1 318 ? -24.347 6.708   -91.231  1.00 26.89 ? 296  PRO D CG    1 
ATOM   9574  C CD    . PRO D 1 318 ? -24.258 5.522   -92.162  1.00 26.75 ? 296  PRO D CD    1 
ATOM   9575  N N     . TYR D 1 319 ? -27.861 8.061   -94.047  1.00 25.42 ? 297  TYR D N     1 
ATOM   9576  C CA    . TYR D 1 319 ? -28.300 8.892   -95.169  1.00 25.63 ? 297  TYR D CA    1 
ATOM   9577  C C     . TYR D 1 319 ? -27.558 10.236  -95.155  1.00 26.30 ? 297  TYR D C     1 
ATOM   9578  O O     . TYR D 1 319 ? -27.704 11.025  -94.220  1.00 26.45 ? 297  TYR D O     1 
ATOM   9579  C CB    . TYR D 1 319 ? -29.815 9.113   -95.152  1.00 24.82 ? 297  TYR D CB    1 
ATOM   9580  C CG    . TYR D 1 319 ? -30.325 9.912   -96.342  1.00 25.27 ? 297  TYR D CG    1 
ATOM   9581  C CD1   . TYR D 1 319 ? -30.166 9.440   -97.645  1.00 26.37 ? 297  TYR D CD1   1 
ATOM   9582  C CD2   . TYR D 1 319 ? -30.960 11.141  -96.167  1.00 25.51 ? 297  TYR D CD2   1 
ATOM   9583  C CE1   . TYR D 1 319 ? -30.620 10.171  -98.744  1.00 27.89 ? 297  TYR D CE1   1 
ATOM   9584  C CE2   . TYR D 1 319 ? -31.426 11.879  -97.262  1.00 25.16 ? 297  TYR D CE2   1 
ATOM   9585  C CZ    . TYR D 1 319 ? -31.254 11.386  -98.548  1.00 26.89 ? 297  TYR D CZ    1 
ATOM   9586  O OH    . TYR D 1 319 ? -31.714 12.101  -99.636  1.00 24.42 ? 297  TYR D OH    1 
ATOM   9587  N N     . LYS D 1 320 ? -26.754 10.477  -96.190  1.00 26.15 ? 298  LYS D N     1 
ATOM   9588  C CA    . LYS D 1 320 ? -25.905 11.662  -96.266  1.00 25.65 ? 298  LYS D CA    1 
ATOM   9589  C C     . LYS D 1 320 ? -26.603 12.865  -96.916  1.00 24.82 ? 298  LYS D C     1 
ATOM   9590  O O     . LYS D 1 320 ? -26.137 14.001  -96.789  1.00 25.45 ? 298  LYS D O     1 
ATOM   9591  C CB    . LYS D 1 320 ? -24.631 11.343  -97.060  1.00 25.46 ? 298  LYS D CB    1 
ATOM   9592  C CG    . LYS D 1 320 ? -23.850 10.147  -96.552  1.00 27.45 ? 298  LYS D CG    1 
ATOM   9593  N N     . GLY D 1 321 ? -27.707 12.627  -97.616  1.00 23.35 ? 299  GLY D N     1 
ATOM   9594  C CA    . GLY D 1 321 ? -28.392 13.693  -98.361  1.00 21.91 ? 299  GLY D CA    1 
ATOM   9595  C C     . GLY D 1 321 ? -27.946 13.746  -99.817  1.00 20.92 ? 299  GLY D C     1 
ATOM   9596  O O     . GLY D 1 321 ? -27.603 12.716  -100.401 1.00 19.79 ? 299  GLY D O     1 
ATOM   9597  N N     . ASP D 1 322 ? -27.956 14.947  -100.406 1.00 20.03 ? 300  ASP D N     1 
ATOM   9598  C CA    . ASP D 1 322 ? -27.511 15.135  -101.799 1.00 20.26 ? 300  ASP D CA    1 
ATOM   9599  C C     . ASP D 1 322 ? -25.988 15.028  -101.954 1.00 18.55 ? 300  ASP D C     1 
ATOM   9600  O O     . ASP D 1 322 ? -25.223 15.527  -101.117 1.00 18.07 ? 300  ASP D O     1 
ATOM   9601  C CB    . ASP D 1 322 ? -27.993 16.477  -102.364 1.00 20.45 ? 300  ASP D CB    1 
ATOM   9602  C CG    . ASP D 1 322 ? -29.442 16.435  -102.817 1.00 25.49 ? 300  ASP D CG    1 
ATOM   9603  O OD1   . ASP D 1 322 ? -29.866 15.403  -103.385 1.00 29.98 ? 300  ASP D OD1   1 
ATOM   9604  O OD2   . ASP D 1 322 ? -30.165 17.438  -102.616 1.00 28.71 ? 300  ASP D OD2   1 
ATOM   9605  N N     . VAL D 1 323 ? -25.560 14.384  -103.038 1.00 17.83 ? 301  VAL D N     1 
ATOM   9606  C CA    . VAL D 1 323 ? -24.139 14.074  -103.268 1.00 18.09 ? 301  VAL D CA    1 
ATOM   9607  C C     . VAL D 1 323 ? -23.302 15.304  -103.612 1.00 18.99 ? 301  VAL D C     1 
ATOM   9608  O O     . VAL D 1 323 ? -22.072 15.273  -103.504 1.00 19.52 ? 301  VAL D O     1 
ATOM   9609  C CB    . VAL D 1 323 ? -23.970 13.009  -104.405 1.00 16.52 ? 301  VAL D CB    1 
ATOM   9610  C CG1   . VAL D 1 323 ? -24.013 13.649  -105.797 1.00 17.70 ? 301  VAL D CG1   1 
ATOM   9611  C CG2   . VAL D 1 323 ? -22.691 12.230  -104.232 1.00 15.67 ? 301  VAL D CG2   1 
ATOM   9612  N N     . GLU D 1 324 ? -23.976 16.368  -104.054 1.00 20.55 ? 302  GLU D N     1 
ATOM   9613  C CA    . GLU D 1 324 ? -23.332 17.645  -104.365 1.00 20.87 ? 302  GLU D CA    1 
ATOM   9614  C C     . GLU D 1 324 ? -22.410 18.060  -103.225 1.00 20.19 ? 302  GLU D C     1 
ATOM   9615  O O     . GLU D 1 324 ? -21.220 18.315  -103.453 1.00 18.25 ? 302  GLU D O     1 
ATOM   9616  C CB    . GLU D 1 324 ? -24.387 18.728  -104.617 1.00 21.66 ? 302  GLU D CB    1 
ATOM   9617  C CG    . GLU D 1 324 ? -23.837 20.093  -105.042 1.00 27.85 ? 302  GLU D CG    1 
ATOM   9618  C CD    . GLU D 1 324 ? -23.485 20.189  -106.534 1.00 34.72 ? 302  GLU D CD    1 
ATOM   9619  O OE1   . GLU D 1 324 ? -23.649 19.187  -107.269 1.00 37.64 ? 302  GLU D OE1   1 
ATOM   9620  O OE2   . GLU D 1 324 ? -23.049 21.282  -106.977 1.00 39.20 ? 302  GLU D OE2   1 
ATOM   9621  N N     . ASN D 1 325 ? -22.952 18.080  -102.004 1.00 20.10 ? 303  ASN D N     1 
ATOM   9622  C CA    . ASN D 1 325 ? -22.202 18.504  -100.830 1.00 19.56 ? 303  ASN D CA    1 
ATOM   9623  C C     . ASN D 1 325 ? -20.944 17.648  -100.596 1.00 18.19 ? 303  ASN D C     1 
ATOM   9624  O O     . ASN D 1 325 ? -19.867 18.186  -100.315 1.00 18.08 ? 303  ASN D O     1 
ATOM   9625  C CB    . ASN D 1 325 ? -23.121 18.535  -99.606  1.00 19.86 ? 303  ASN D CB    1 
ATOM   9626  C CG    . ASN D 1 325 ? -24.145 19.667  -99.677  1.00 24.47 ? 303  ASN D CG    1 
ATOM   9627  N N     . THR D 1 326 ? -21.088 16.328  -100.732 1.00 16.61 ? 304  THR D N     1 
ATOM   9628  C CA    . THR D 1 326 ? -19.979 15.398  -100.599 1.00 15.48 ? 304  THR D CA    1 
ATOM   9629  C C     . THR D 1 326 ? -18.893 15.644  -101.638 1.00 16.55 ? 304  THR D C     1 
ATOM   9630  O O     . THR D 1 326 ? -17.706 15.622  -101.314 1.00 16.65 ? 304  THR D O     1 
ATOM   9631  C CB    . THR D 1 326 ? -20.492 13.967  -100.739 1.00 15.89 ? 304  THR D CB    1 
ATOM   9632  O OG1   . THR D 1 326 ? -21.401 13.709  -99.664  1.00 11.27 ? 304  THR D OG1   1 
ATOM   9633  C CG2   . THR D 1 326 ? -19.328 12.924  -100.742 1.00 16.77 ? 304  THR D CG2   1 
ATOM   9634  N N     . ILE D 1 327 ? -19.301 15.844  -102.892 1.00 17.65 ? 305  ILE D N     1 
ATOM   9635  C CA    . ILE D 1 327 ? -18.363 16.176  -103.971 1.00 17.32 ? 305  ILE D CA    1 
ATOM   9636  C C     . ILE D 1 327 ? -17.561 17.428  -103.642 1.00 18.33 ? 305  ILE D C     1 
ATOM   9637  O O     . ILE D 1 327 ? -16.339 17.463  -103.838 1.00 19.12 ? 305  ILE D O     1 
ATOM   9638  C CB    . ILE D 1 327 ? -19.088 16.360  -105.326 1.00 18.25 ? 305  ILE D CB    1 
ATOM   9639  C CG1   . ILE D 1 327 ? -19.370 14.991  -105.950 1.00 17.10 ? 305  ILE D CG1   1 
ATOM   9640  C CG2   . ILE D 1 327 ? -18.266 17.232  -106.315 1.00 16.71 ? 305  ILE D CG2   1 
ATOM   9641  C CD1   . ILE D 1 327 ? -20.236 15.058  -107.193 1.00 13.64 ? 305  ILE D CD1   1 
ATOM   9642  N N     . LEU D 1 328 ? -18.253 18.447  -103.142 1.00 18.44 ? 306  LEU D N     1 
ATOM   9643  C CA    . LEU D 1 328 ? -17.622 19.717  -102.809 1.00 19.35 ? 306  LEU D CA    1 
ATOM   9644  C C     . LEU D 1 328 ? -16.613 19.564  -101.661 1.00 19.58 ? 306  LEU D C     1 
ATOM   9645  O O     . LEU D 1 328 ? -15.575 20.230  -101.647 1.00 19.05 ? 306  LEU D O     1 
ATOM   9646  C CB    . LEU D 1 328 ? -18.694 20.770  -102.485 1.00 18.75 ? 306  LEU D CB    1 
ATOM   9647  C CG    . LEU D 1 328 ? -19.634 21.108  -103.661 1.00 20.19 ? 306  LEU D CG    1 
ATOM   9648  C CD1   . LEU D 1 328 ? -20.796 21.982  -103.205 1.00 18.90 ? 306  LEU D CD1   1 
ATOM   9649  C CD2   . LEU D 1 328 ? -18.902 21.762  -104.850 1.00 18.46 ? 306  LEU D CD2   1 
ATOM   9650  N N     . ASP D 1 329 ? -16.915 18.678  -100.715 1.00 20.05 ? 307  ASP D N     1 
ATOM   9651  C CA    . ASP D 1 329 ? -16.010 18.389  -99.607  1.00 20.43 ? 307  ASP D CA    1 
ATOM   9652  C C     . ASP D 1 329 ? -14.756 17.698  -100.116 1.00 18.85 ? 307  ASP D C     1 
ATOM   9653  O O     . ASP D 1 329 ? -13.652 18.012  -99.672  1.00 19.20 ? 307  ASP D O     1 
ATOM   9654  C CB    . ASP D 1 329 ? -16.698 17.506  -98.539  1.00 21.76 ? 307  ASP D CB    1 
ATOM   9655  C CG    . ASP D 1 329 ? -17.928 18.187  -97.878  1.00 30.87 ? 307  ASP D CG    1 
ATOM   9656  O OD1   . ASP D 1 329 ? -18.019 19.447  -97.863  1.00 39.38 ? 307  ASP D OD1   1 
ATOM   9657  O OD2   . ASP D 1 329 ? -18.806 17.451  -97.357  1.00 37.72 ? 307  ASP D OD2   1 
ATOM   9658  N N     . ILE D 1 330 ? -14.928 16.765  -101.053 1.00 17.48 ? 308  ILE D N     1 
ATOM   9659  C CA    . ILE D 1 330 ? -13.799 15.979  -101.565 1.00 16.72 ? 308  ILE D CA    1 
ATOM   9660  C C     . ILE D 1 330 ? -12.868 16.845  -102.399 1.00 16.42 ? 308  ILE D C     1 
ATOM   9661  O O     . ILE D 1 330 ? -11.655 16.841  -102.186 1.00 16.05 ? 308  ILE D O     1 
ATOM   9662  C CB    . ILE D 1 330 ? -14.244 14.745  -102.386 1.00 16.30 ? 308  ILE D CB    1 
ATOM   9663  C CG1   . ILE D 1 330 ? -15.088 13.813  -101.514 1.00 14.81 ? 308  ILE D CG1   1 
ATOM   9664  C CG2   . ILE D 1 330 ? -13.014 13.991  -102.898 1.00 15.27 ? 308  ILE D CG2   1 
ATOM   9665  C CD1   . ILE D 1 330 ? -15.771 12.723  -102.268 1.00 15.83 ? 308  ILE D CD1   1 
ATOM   9666  N N     . LEU D 1 331 ? -13.461 17.558  -103.354 1.00 16.87 ? 309  LEU D N     1 
ATOM   9667  C CA    . LEU D 1 331 ? -12.739 18.470  -104.233 1.00 16.27 ? 309  LEU D CA    1 
ATOM   9668  C C     . LEU D 1 331 ? -12.080 19.600  -103.434 1.00 15.54 ? 309  LEU D C     1 
ATOM   9669  O O     . LEU D 1 331 ? -10.903 19.922  -103.636 1.00 15.71 ? 309  LEU D O     1 
ATOM   9670  C CB    . LEU D 1 331 ? -13.694 19.043  -105.306 1.00 16.73 ? 309  LEU D CB    1 
ATOM   9671  C CG    . LEU D 1 331 ? -14.323 18.044  -106.308 1.00 15.03 ? 309  LEU D CG    1 
ATOM   9672  C CD1   . LEU D 1 331 ? -15.336 18.714  -107.252 1.00 10.90 ? 309  LEU D CD1   1 
ATOM   9673  C CD2   . LEU D 1 331 ? -13.245 17.348  -107.115 1.00 13.38 ? 309  LEU D CD2   1 
ATOM   9674  N N     . GLY D 1 332 ? -12.836 20.188  -102.517 1.00 14.96 ? 310  GLY D N     1 
ATOM   9675  C CA    . GLY D 1 332 ? -12.311 21.235  -101.652 1.00 16.58 ? 310  GLY D CA    1 
ATOM   9676  C C     . GLY D 1 332 ? -11.097 20.805  -100.844 1.00 17.82 ? 310  GLY D C     1 
ATOM   9677  O O     . GLY D 1 332 ? -10.106 21.536  -100.752 1.00 19.12 ? 310  GLY D O     1 
ATOM   9678  N N     . GLY D 1 333 ? -11.177 19.622  -100.248 1.00 18.37 ? 311  GLY D N     1 
ATOM   9679  C CA    . GLY D 1 333 ? -10.084 19.088  -99.455  1.00 18.26 ? 311  GLY D CA    1 
ATOM   9680  C C     . GLY D 1 333 ? -8.857  18.744  -100.275 1.00 17.90 ? 311  GLY D C     1 
ATOM   9681  O O     . GLY D 1 333 ? -7.726  18.855  -99.801  1.00 18.40 ? 311  GLY D O     1 
ATOM   9682  N N     . LEU D 1 334 ? -9.081  18.327  -101.512 1.00 17.73 ? 312  LEU D N     1 
ATOM   9683  C CA    . LEU D 1 334 ? -7.999  17.948  -102.409 1.00 17.47 ? 312  LEU D CA    1 
ATOM   9684  C C     . LEU D 1 334 ? -7.323  19.193  -102.968 1.00 16.64 ? 312  LEU D C     1 
ATOM   9685  O O     . LEU D 1 334 ? -6.114  19.192  -103.201 1.00 15.68 ? 312  LEU D O     1 
ATOM   9686  C CB    . LEU D 1 334 ? -8.538  17.036  -103.518 1.00 17.86 ? 312  LEU D CB    1 
ATOM   9687  C CG    . LEU D 1 334 ? -7.552  16.378  -104.497 1.00 21.82 ? 312  LEU D CG    1 
ATOM   9688  C CD1   . LEU D 1 334 ? -6.488  15.541  -103.806 1.00 20.35 ? 312  LEU D CD1   1 
ATOM   9689  C CD2   . LEU D 1 334 ? -8.321  15.532  -105.516 1.00 20.53 ? 312  LEU D CD2   1 
ATOM   9690  N N     . ARG D 1 335 ? -8.096  20.264  -103.145 1.00 16.01 ? 313  ARG D N     1 
ATOM   9691  C CA    . ARG D 1 335 ? -7.532  21.561  -103.513 1.00 14.19 ? 313  ARG D CA    1 
ATOM   9692  C C     . ARG D 1 335 ? -6.660  22.091  -102.383 1.00 12.54 ? 313  ARG D C     1 
ATOM   9693  O O     . ARG D 1 335 ? -5.555  22.579  -102.622 1.00 13.24 ? 313  ARG D O     1 
ATOM   9694  C CB    . ARG D 1 335 ? -8.641  22.550  -103.875 1.00 14.96 ? 313  ARG D CB    1 
ATOM   9695  C CG    . ARG D 1 335 ? -9.176  22.334  -105.290 1.00 16.99 ? 313  ARG D CG    1 
ATOM   9696  C CD    . ARG D 1 335 ? -10.246 23.353  -105.736 1.00 19.89 ? 313  ARG D CD    1 
ATOM   9697  N NE    . ARG D 1 335 ? -10.769 22.927  -107.036 1.00 21.36 ? 313  ARG D NE    1 
ATOM   9698  C CZ    . ARG D 1 335 ? -12.007 22.490  -107.299 1.00 24.74 ? 313  ARG D CZ    1 
ATOM   9699  N NH1   . ARG D 1 335 ? -12.960 22.455  -106.367 1.00 22.18 ? 313  ARG D NH1   1 
ATOM   9700  N NH2   . ARG D 1 335 ? -12.299 22.100  -108.543 1.00 26.90 ? 313  ARG D NH2   1 
ATOM   9701  N N     . SER D 1 336 ? -7.146  21.955  -101.154 1.00 11.35 ? 314  SER D N     1 
ATOM   9702  C CA    . SER D 1 336 ? -6.388  22.345  -99.973  1.00 10.18 ? 314  SER D CA    1 
ATOM   9703  C C     . SER D 1 336 ? -5.055  21.579  -99.852  1.00 10.26 ? 314  SER D C     1 
ATOM   9704  O O     . SER D 1 336 ? -3.986  22.188  -99.641  1.00 10.15 ? 314  SER D O     1 
ATOM   9705  C CB    . SER D 1 336 ? -7.247  22.120  -98.739  1.00 10.44 ? 314  SER D CB    1 
ATOM   9706  O OG    . SER D 1 336 ? -8.434  22.886  -98.839  1.00 13.09 ? 314  SER D OG    1 
ATOM   9707  N N     . THR D 1 337 ? -5.126  20.253  -99.988  1.00 9.14  ? 315  THR D N     1 
ATOM   9708  C CA    . THR D 1 337 ? -3.939  19.417  -100.001 1.00 10.61 ? 315  THR D CA    1 
ATOM   9709  C C     . THR D 1 337 ? -2.917  19.976  -100.961 1.00 11.84 ? 315  THR D C     1 
ATOM   9710  O O     . THR D 1 337 ? -1.754  20.111  -100.632 1.00 12.18 ? 315  THR D O     1 
ATOM   9711  C CB    . THR D 1 337 ? -4.238  17.963  -100.472 1.00 11.02 ? 315  THR D CB    1 
ATOM   9712  O OG1   . THR D 1 337 ? -5.287  17.380  -99.690  1.00 14.57 ? 315  THR D OG1   1 
ATOM   9713  C CG2   . THR D 1 337 ? -2.985  17.091  -100.336 1.00 11.73 ? 315  THR D CG2   1 
ATOM   9714  N N     . CYS D 1 338 ? -3.370  20.242  -102.177 1.00 14.13 ? 316  CYS D N     1 
ATOM   9715  C CA    . CYS D 1 338 ? -2.490  20.662  -103.257 1.00 14.02 ? 316  CYS D CA    1 
ATOM   9716  C C     . CYS D 1 338 ? -1.862  21.991  -102.949 1.00 14.18 ? 316  CYS D C     1 
ATOM   9717  O O     . CYS D 1 338 ? -0.678  22.175  -103.180 1.00 14.31 ? 316  CYS D O     1 
ATOM   9718  C CB    . CYS D 1 338 ? -3.275  20.741  -104.548 1.00 15.99 ? 316  CYS D CB    1 
ATOM   9719  S SG    . CYS D 1 338 ? -3.645  19.158  -105.235 1.00 10.68 ? 316  CYS D SG    1 
ATOM   9720  N N     . THR D 1 339 ? -2.662  22.905  -102.413 1.00 14.91 ? 317  THR D N     1 
ATOM   9721  C CA    . THR D 1 339 ? -2.153  24.186  -101.917 1.00 15.14 ? 317  THR D CA    1 
ATOM   9722  C C     . THR D 1 339 ? -1.034  23.983  -100.895 1.00 14.51 ? 317  THR D C     1 
ATOM   9723  O O     . THR D 1 339 ? 0.010   24.637  -100.972 1.00 15.37 ? 317  THR D O     1 
ATOM   9724  C CB    . THR D 1 339 ? -3.277  25.011  -101.264 1.00 14.73 ? 317  THR D CB    1 
ATOM   9725  O OG1   . THR D 1 339 ? -4.436  24.991  -102.102 1.00 18.46 ? 317  THR D OG1   1 
ATOM   9726  C CG2   . THR D 1 339 ? -2.853  26.417  -101.096 1.00 17.29 ? 317  THR D CG2   1 
ATOM   9727  N N     . TYR D 1 340 ? -1.259  23.066  -99.953  1.00 13.70 ? 318  TYR D N     1 
ATOM   9728  C CA    . TYR D 1 340 ? -0.371  22.909  -98.798  1.00 13.45 ? 318  TYR D CA    1 
ATOM   9729  C C     . TYR D 1 340 ? 0.968   22.246  -99.129  1.00 14.85 ? 318  TYR D C     1 
ATOM   9730  O O     . TYR D 1 340 ? 1.954   22.440  -98.413  1.00 15.45 ? 318  TYR D O     1 
ATOM   9731  C CB    . TYR D 1 340 ? -1.090  22.158  -97.666  1.00 13.38 ? 318  TYR D CB    1 
ATOM   9732  C CG    . TYR D 1 340 ? -2.359  22.835  -97.189  1.00 11.00 ? 318  TYR D CG    1 
ATOM   9733  C CD1   . TYR D 1 340 ? -2.507  24.225  -97.246  1.00 10.92 ? 318  TYR D CD1   1 
ATOM   9734  C CD2   . TYR D 1 340 ? -3.399  22.092  -96.652  1.00 14.15 ? 318  TYR D CD2   1 
ATOM   9735  C CE1   . TYR D 1 340 ? -3.657  24.842  -96.820  1.00 10.58 ? 318  TYR D CE1   1 
ATOM   9736  C CE2   . TYR D 1 340 ? -4.572  22.713  -96.217  1.00 11.63 ? 318  TYR D CE2   1 
ATOM   9737  C CZ    . TYR D 1 340 ? -4.683  24.086  -96.307  1.00 9.70  ? 318  TYR D CZ    1 
ATOM   9738  O OH    . TYR D 1 340 ? -5.823  24.709  -95.881  1.00 9.99  ? 318  TYR D OH    1 
ATOM   9739  N N     . VAL D 1 341 ? 1.000   21.479  -100.216 1.00 16.60 ? 319  VAL D N     1 
ATOM   9740  C CA    . VAL D 1 341 ? 2.245   20.839  -100.684 1.00 17.65 ? 319  VAL D CA    1 
ATOM   9741  C C     . VAL D 1 341 ? 2.871   21.572  -101.873 1.00 17.80 ? 319  VAL D C     1 
ATOM   9742  O O     . VAL D 1 341 ? 3.960   21.228  -102.320 1.00 17.68 ? 319  VAL D O     1 
ATOM   9743  C CB    . VAL D 1 341 ? 2.064   19.349  -101.035 1.00 17.20 ? 319  VAL D CB    1 
ATOM   9744  C CG1   . VAL D 1 341 ? 1.588   18.568  -99.816  1.00 19.85 ? 319  VAL D CG1   1 
ATOM   9745  C CG2   . VAL D 1 341 ? 1.120   19.158  -102.212 1.00 19.63 ? 319  VAL D CG2   1 
ATOM   9746  N N     . GLY D 1 342 ? 2.165   22.585  -102.373 1.00 19.04 ? 320  GLY D N     1 
ATOM   9747  C CA    . GLY D 1 342 ? 2.666   23.472  -103.426 1.00 18.09 ? 320  GLY D CA    1 
ATOM   9748  C C     . GLY D 1 342 ? 2.329   23.040  -104.837 1.00 18.47 ? 320  GLY D C     1 
ATOM   9749  O O     . GLY D 1 342 ? 3.061   23.349  -105.765 1.00 18.91 ? 320  GLY D O     1 
ATOM   9750  N N     . ALA D 1 343 ? 1.211   22.332  -104.994 1.00 17.96 ? 321  ALA D N     1 
ATOM   9751  C CA    . ALA D 1 343 ? 0.793   21.797  -106.282 1.00 17.51 ? 321  ALA D CA    1 
ATOM   9752  C C     . ALA D 1 343 ? -0.355  22.633  -106.852 1.00 18.93 ? 321  ALA D C     1 
ATOM   9753  O O     . ALA D 1 343 ? -1.463  22.618  -106.336 1.00 18.66 ? 321  ALA D O     1 
ATOM   9754  C CB    . ALA D 1 343 ? 0.384   20.345  -106.139 1.00 17.39 ? 321  ALA D CB    1 
ATOM   9755  N N     . ALA D 1 344 ? -0.069  23.384  -107.912 1.00 20.65 ? 322  ALA D N     1 
ATOM   9756  C CA    . ALA D 1 344 ? -1.057  24.271  -108.528 1.00 20.18 ? 322  ALA D CA    1 
ATOM   9757  C C     . ALA D 1 344 ? -2.054  23.483  -109.359 1.00 19.94 ? 322  ALA D C     1 
ATOM   9758  O O     . ALA D 1 344 ? -3.150  23.962  -109.675 1.00 19.54 ? 322  ALA D O     1 
ATOM   9759  C CB    . ALA D 1 344 ? -0.353  25.277  -109.397 1.00 19.92 ? 322  ALA D CB    1 
ATOM   9760  N N     . LYS D 1 345 ? -1.639  22.281  -109.734 1.00 19.78 ? 323  LYS D N     1 
ATOM   9761  C CA    . LYS D 1 345 ? -2.449  21.361  -110.509 1.00 19.63 ? 323  LYS D CA    1 
ATOM   9762  C C     . LYS D 1 345 ? -2.351  19.995  -109.843 1.00 19.03 ? 323  LYS D C     1 
ATOM   9763  O O     . LYS D 1 345 ? -1.305  19.652  -109.296 1.00 18.64 ? 323  LYS D O     1 
ATOM   9764  C CB    . LYS D 1 345 ? -1.939  21.265  -111.951 1.00 20.41 ? 323  LYS D CB    1 
ATOM   9765  C CG    . LYS D 1 345 ? -1.993  22.566  -112.725 1.00 22.64 ? 323  LYS D CG    1 
ATOM   9766  C CD    . LYS D 1 345 ? -1.753  22.330  -114.227 1.00 23.43 ? 323  LYS D CD    1 
ATOM   9767  N N     . LEU D 1 346 ? -3.431  19.220  -109.898 1.00 18.46 ? 324  LEU D N     1 
ATOM   9768  C CA    . LEU D 1 346 ? -3.435  17.827  -109.390 1.00 18.87 ? 324  LEU D CA    1 
ATOM   9769  C C     . LEU D 1 346 ? -2.330  16.951  -109.978 1.00 19.09 ? 324  LEU D C     1 
ATOM   9770  O O     . LEU D 1 346 ? -1.858  16.019  -109.338 1.00 20.89 ? 324  LEU D O     1 
ATOM   9771  C CB    . LEU D 1 346 ? -4.784  17.137  -109.648 1.00 19.44 ? 324  LEU D CB    1 
ATOM   9772  C CG    . LEU D 1 346 ? -5.040  15.766  -108.993 1.00 18.25 ? 324  LEU D CG    1 
ATOM   9773  C CD1   . LEU D 1 346 ? -4.714  15.756  -107.507 1.00 15.50 ? 324  LEU D CD1   1 
ATOM   9774  C CD2   . LEU D 1 346 ? -6.484  15.319  -109.185 1.00 23.29 ? 324  LEU D CD2   1 
ATOM   9775  N N     . LYS D 1 347 ? -1.938  17.242  -111.210 1.00 19.86 ? 325  LYS D N     1 
ATOM   9776  C CA    . LYS D 1 347 ? -0.767  16.604  -111.830 1.00 20.44 ? 325  LYS D CA    1 
ATOM   9777  C C     . LYS D 1 347 ? 0.478   16.692  -110.923 1.00 19.94 ? 325  LYS D C     1 
ATOM   9778  O O     . LYS D 1 347 ? 1.217   15.724  -110.772 1.00 21.90 ? 325  LYS D O     1 
ATOM   9779  C CB    . LYS D 1 347 ? -0.469  17.208  -113.218 1.00 20.66 ? 325  LYS D CB    1 
ATOM   9780  N N     . GLU D 1 348 ? 0.693   17.855  -110.305 1.00 20.39 ? 326  GLU D N     1 
ATOM   9781  C CA    . GLU D 1 348 ? 1.903   18.107  -109.513 1.00 20.35 ? 326  GLU D CA    1 
ATOM   9782  C C     . GLU D 1 348 ? 1.920   17.402  -108.142 1.00 19.63 ? 326  GLU D C     1 
ATOM   9783  O O     . GLU D 1 348 ? 2.971   17.333  -107.502 1.00 19.53 ? 326  GLU D O     1 
ATOM   9784  C CB    . GLU D 1 348 ? 2.102   19.625  -109.299 1.00 21.95 ? 326  GLU D CB    1 
ATOM   9785  C CG    . GLU D 1 348 ? 2.613   20.399  -110.499 1.00 22.98 ? 326  GLU D CG    1 
ATOM   9786  C CD    . GLU D 1 348 ? 2.293   21.875  -110.401 1.00 34.91 ? 326  GLU D CD    1 
ATOM   9787  O OE1   . GLU D 1 348 ? 2.389   22.444  -109.285 1.00 37.80 ? 326  GLU D OE1   1 
ATOM   9788  O OE2   . GLU D 1 348 ? 1.941   22.470  -111.446 1.00 40.94 ? 326  GLU D OE2   1 
ATOM   9789  N N     . LEU D 1 349 ? 0.779   16.865  -107.702 1.00 19.33 ? 327  LEU D N     1 
ATOM   9790  C CA    . LEU D 1 349 ? 0.658   16.340  -106.342 1.00 18.79 ? 327  LEU D CA    1 
ATOM   9791  C C     . LEU D 1 349 ? 1.736   15.323  -106.041 1.00 19.95 ? 327  LEU D C     1 
ATOM   9792  O O     . LEU D 1 349 ? 2.514   15.507  -105.117 1.00 20.56 ? 327  LEU D O     1 
ATOM   9793  C CB    . LEU D 1 349 ? -0.708  15.675  -106.086 1.00 17.87 ? 327  LEU D CB    1 
ATOM   9794  C CG    . LEU D 1 349 ? -1.339  15.933  -104.702 1.00 17.90 ? 327  LEU D CG    1 
ATOM   9795  C CD1   . LEU D 1 349 ? -2.574  15.083  -104.511 1.00 15.13 ? 327  LEU D CD1   1 
ATOM   9796  C CD2   . LEU D 1 349 ? -0.391  15.737  -103.531 1.00 16.81 ? 327  LEU D CD2   1 
ATOM   9797  N N     . SER D 1 350 ? 1.778   14.253  -106.820 1.00 21.18 ? 328  SER D N     1 
ATOM   9798  C CA    . SER D 1 350 ? 2.671   13.135  -106.538 1.00 23.03 ? 328  SER D CA    1 
ATOM   9799  C C     . SER D 1 350 ? 4.136   13.560  -106.577 1.00 23.58 ? 328  SER D C     1 
ATOM   9800  O O     . SER D 1 350 ? 4.945   13.111  -105.762 1.00 26.29 ? 328  SER D O     1 
ATOM   9801  C CB    . SER D 1 350 ? 2.396   11.988  -107.508 1.00 22.73 ? 328  SER D CB    1 
ATOM   9802  O OG    . SER D 1 350 ? 1.781   12.497  -108.672 1.00 29.03 ? 328  SER D OG    1 
ATOM   9803  N N     . ARG D 1 351 ? 4.464   14.445  -107.509 1.00 24.13 ? 329  ARG D N     1 
ATOM   9804  C CA    . ARG D 1 351 ? 5.798   15.049  -107.571 1.00 23.68 ? 329  ARG D CA    1 
ATOM   9805  C C     . ARG D 1 351 ? 6.144   15.742  -106.245 1.00 21.99 ? 329  ARG D C     1 
ATOM   9806  O O     . ARG D 1 351 ? 7.300   15.707  -105.805 1.00 21.52 ? 329  ARG D O     1 
ATOM   9807  C CB    . ARG D 1 351 ? 5.914   16.067  -108.728 1.00 23.56 ? 329  ARG D CB    1 
ATOM   9808  C CG    . ARG D 1 351 ? 5.517   15.536  -110.115 1.00 27.86 ? 329  ARG D CG    1 
ATOM   9809  N N     . ARG D 1 352 ? 5.152   16.375  -105.615 1.00 20.27 ? 330  ARG D N     1 
ATOM   9810  C CA    . ARG D 1 352 ? 5.408   17.183  -104.415 1.00 19.30 ? 330  ARG D CA    1 
ATOM   9811  C C     . ARG D 1 352 ? 4.932   16.521  -103.132 1.00 18.79 ? 330  ARG D C     1 
ATOM   9812  O O     . ARG D 1 352 ? 5.039   17.099  -102.050 1.00 17.95 ? 330  ARG D O     1 
ATOM   9813  C CB    . ARG D 1 352 ? 4.830   18.586  -104.577 1.00 20.28 ? 330  ARG D CB    1 
ATOM   9814  C CG    . ARG D 1 352 ? 5.553   19.396  -105.652 1.00 23.04 ? 330  ARG D CG    1 
ATOM   9815  C CD    . ARG D 1 352 ? 4.671   20.519  -106.155 1.00 30.34 ? 330  ARG D CD    1 
ATOM   9816  N NE    . ARG D 1 352 ? 5.140   21.116  -107.412 1.00 34.72 ? 330  ARG D NE    1 
ATOM   9817  C CZ    . ARG D 1 352 ? 5.746   22.300  -107.534 1.00 36.08 ? 330  ARG D CZ    1 
ATOM   9818  N NH1   . ARG D 1 352 ? 6.006   23.065  -106.481 1.00 39.39 ? 330  ARG D NH1   1 
ATOM   9819  N NH2   . ARG D 1 352 ? 6.102   22.730  -108.733 1.00 36.50 ? 330  ARG D NH2   1 
ATOM   9820  N N     . ALA D 1 353 ? 4.427   15.295  -103.257 1.00 19.44 ? 331  ALA D N     1 
ATOM   9821  C CA    . ALA D 1 353 ? 4.012   14.504  -102.109 1.00 18.85 ? 331  ALA D CA    1 
ATOM   9822  C C     . ALA D 1 353 ? 5.218   13.888  -101.433 1.00 20.19 ? 331  ALA D C     1 
ATOM   9823  O O     . ALA D 1 353 ? 5.965   13.133  -102.055 1.00 19.94 ? 331  ALA D O     1 
ATOM   9824  C CB    . ALA D 1 353 ? 3.080   13.429  -102.524 1.00 19.36 ? 331  ALA D CB    1 
ATOM   9825  N N     . THR D 1 354 ? 5.419   14.255  -100.166 1.00 21.12 ? 332  THR D N     1 
ATOM   9826  C CA    . THR D 1 354 ? 6.350   13.573  -99.281  1.00 20.96 ? 332  THR D CA    1 
ATOM   9827  C C     . THR D 1 354 ? 5.503   13.101  -98.124  1.00 20.38 ? 332  THR D C     1 
ATOM   9828  O O     . THR D 1 354 ? 4.778   13.872  -97.523  1.00 20.81 ? 332  THR D O     1 
ATOM   9829  C CB    . THR D 1 354 ? 7.497   14.510  -98.770  1.00 21.78 ? 332  THR D CB    1 
ATOM   9830  O OG1   . THR D 1 354 ? 8.314   14.936  -99.867  1.00 21.79 ? 332  THR D OG1   1 
ATOM   9831  C CG2   . THR D 1 354 ? 8.384   13.805  -97.734  1.00 23.32 ? 332  THR D CG2   1 
ATOM   9832  N N     . PHE D 1 355 ? 5.578   11.819  -97.835  1.00 20.25 ? 333  PHE D N     1 
ATOM   9833  C CA    . PHE D 1 355 ? 4.854   11.253  -96.723  1.00 18.88 ? 333  PHE D CA    1 
ATOM   9834  C C     . PHE D 1 355 ? 5.729   11.147  -95.484  1.00 18.69 ? 333  PHE D C     1 
ATOM   9835  O O     . PHE D 1 355 ? 6.912   10.878  -95.579  1.00 15.98 ? 333  PHE D O     1 
ATOM   9836  C CB    . PHE D 1 355 ? 4.358   9.861   -97.075  1.00 17.34 ? 333  PHE D CB    1 
ATOM   9837  C CG    . PHE D 1 355 ? 3.347   9.833   -98.166  1.00 17.85 ? 333  PHE D CG    1 
ATOM   9838  C CD1   . PHE D 1 355 ? 2.005   10.032  -97.887  1.00 11.91 ? 333  PHE D CD1   1 
ATOM   9839  C CD2   . PHE D 1 355 ? 3.727   9.555   -99.474  1.00 19.46 ? 333  PHE D CD2   1 
ATOM   9840  C CE1   . PHE D 1 355 ? 1.070   9.968   -98.888  1.00 12.56 ? 333  PHE D CE1   1 
ATOM   9841  C CE2   . PHE D 1 355 ? 2.792   9.493   -100.483 1.00 16.63 ? 333  PHE D CE2   1 
ATOM   9842  C CZ    . PHE D 1 355 ? 1.464   9.690   -100.194 1.00 14.93 ? 333  PHE D CZ    1 
ATOM   9843  N N     . ILE D 1 356 ? 5.115   11.339  -94.321  1.00 19.99 ? 334  ILE D N     1 
ATOM   9844  C CA    . ILE D 1 356 ? 5.742   10.989  -93.048  1.00 20.77 ? 334  ILE D CA    1 
ATOM   9845  C C     . ILE D 1 356 ? 4.966   9.820   -92.408  1.00 20.91 ? 334  ILE D C     1 
ATOM   9846  O O     . ILE D 1 356 ? 3.741   9.733   -92.529  1.00 18.62 ? 334  ILE D O     1 
ATOM   9847  C CB    . ILE D 1 356 ? 5.825   12.198  -92.081  1.00 20.80 ? 334  ILE D CB    1 
ATOM   9848  C CG1   . ILE D 1 356 ? 4.438   12.749  -91.759  1.00 21.84 ? 334  ILE D CG1   1 
ATOM   9849  C CG2   . ILE D 1 356 ? 6.674   13.313  -92.692  1.00 21.25 ? 334  ILE D CG2   1 
ATOM   9850  C CD1   . ILE D 1 356 ? 4.337   13.314  -90.401  1.00 20.98 ? 334  ILE D CD1   1 
ATOM   9851  N N     . ARG D 1 357 ? 5.699   8.915   -91.762  1.00 23.03 ? 335  ARG D N     1 
ATOM   9852  C CA    . ARG D 1 357 ? 5.100   7.802   -91.057  1.00 23.35 ? 335  ARG D CA    1 
ATOM   9853  C C     . ARG D 1 357 ? 4.661   8.340   -89.706  1.00 21.84 ? 335  ARG D C     1 
ATOM   9854  O O     . ARG D 1 357 ? 5.421   9.033   -89.035  1.00 18.48 ? 335  ARG D O     1 
ATOM   9855  C CB    . ARG D 1 357 ? 6.096   6.657   -90.853  1.00 25.16 ? 335  ARG D CB    1 
ATOM   9856  C CG    . ARG D 1 357 ? 6.844   6.208   -92.105  1.00 30.10 ? 335  ARG D CG    1 
ATOM   9857  N N     . VAL D 1 358 ? 3.438   8.012   -89.310  1.00 23.19 ? 336  VAL D N     1 
ATOM   9858  C CA    . VAL D 1 358 ? 2.927   8.399   -88.005  1.00 25.05 ? 336  VAL D CA    1 
ATOM   9859  C C     . VAL D 1 358 ? 2.419   7.188   -87.232  1.00 27.60 ? 336  VAL D C     1 
ATOM   9860  O O     . VAL D 1 358 ? 2.364   6.079   -87.763  1.00 28.62 ? 336  VAL D O     1 
ATOM   9861  C CB    . VAL D 1 358 ? 1.812   9.448   -88.108  1.00 25.35 ? 336  VAL D CB    1 
ATOM   9862  C CG1   . VAL D 1 358 ? 2.285   10.621  -88.948  1.00 25.55 ? 336  VAL D CG1   1 
ATOM   9863  C CG2   . VAL D 1 358 ? 0.531   8.845   -88.673  1.00 25.47 ? 336  VAL D CG2   1 
ATOM   9864  N N     . THR D 1 359 ? 2.043   7.424   -85.980  1.00 29.59 ? 337  THR D N     1 
ATOM   9865  C CA    . THR D 1 359 ? 1.474   6.405   -85.102  1.00 30.28 ? 337  THR D CA    1 
ATOM   9866  C C     . THR D 1 359 ? -0.029  6.640   -84.943  1.00 30.97 ? 337  THR D C     1 
ATOM   9867  O O     . THR D 1 359 ? -0.755  5.760   -84.489  1.00 31.74 ? 337  THR D O     1 
ATOM   9868  C CB    . THR D 1 359 ? 2.090   6.451   -83.691  1.00 31.06 ? 337  THR D CB    1 
ATOM   9869  O OG1   . THR D 1 359 ? 2.030   7.796   -83.196  1.00 33.14 ? 337  THR D OG1   1 
ATOM   9870  C CG2   . THR D 1 359 ? 3.540   5.958   -83.703  1.00 29.54 ? 337  THR D CG2   1 
HETATM 9871  K K     . K   E 2 .   ? -1.722  4.823   -64.650  1.00 24.29 ? 1339 K   A K     1 
HETATM 9872  P P     . 5GP F 3 .   ? -1.741  -0.904  -58.971  1.00 12.08 ? 1340 5GP A P     1 
HETATM 9873  O O1P   . 5GP F 3 .   ? -1.661  -0.731  -60.490  1.00 2.00  ? 1340 5GP A O1P   1 
HETATM 9874  O O2P   . 5GP F 3 .   ? -1.214  -2.241  -58.485  1.00 13.80 ? 1340 5GP A O2P   1 
HETATM 9875  O O3P   . 5GP F 3 .   ? -3.029  -0.512  -58.315  1.00 8.29  ? 1340 5GP A O3P   1 
HETATM 9876  O "O5'" . 5GP F 3 .   ? -0.740  0.169   -58.346  1.00 4.97  ? 1340 5GP A "O5'" 1 
HETATM 9877  C "C5'" . 5GP F 3 .   ? -0.639  0.407   -56.955  1.00 13.28 ? 1340 5GP A "C5'" 1 
HETATM 9878  C "C4'" . 5GP F 3 .   ? 0.400   1.525   -56.818  1.00 10.15 ? 1340 5GP A "C4'" 1 
HETATM 9879  O "O4'" . 5GP F 3 .   ? -0.104  2.733   -57.374  1.00 13.38 ? 1340 5GP A "O4'" 1 
HETATM 9880  C "C3'" . 5GP F 3 .   ? 0.798   1.914   -55.396  1.00 7.50  ? 1340 5GP A "C3'" 1 
HETATM 9881  O "O3'" . 5GP F 3 .   ? 1.686   0.970   -54.791  1.00 7.77  ? 1340 5GP A "O3'" 1 
HETATM 9882  C "C2'" . 5GP F 3 .   ? 1.382   3.293   -55.592  1.00 5.47  ? 1340 5GP A "C2'" 1 
HETATM 9883  O "O2'" . 5GP F 3 .   ? 2.728   3.255   -56.073  1.00 8.92  ? 1340 5GP A "O2'" 1 
HETATM 9884  C "C1'" . 5GP F 3 .   ? 0.536   3.846   -56.721  1.00 10.04 ? 1340 5GP A "C1'" 1 
HETATM 9885  N N9    . 5GP F 3 .   ? -0.462  4.836   -56.243  1.00 3.79  ? 1340 5GP A N9    1 
HETATM 9886  C C8    . 5GP F 3 .   ? -1.547  4.698   -55.442  1.00 6.72  ? 1340 5GP A C8    1 
HETATM 9887  N N7    . 5GP F 3 .   ? -2.146  5.904   -55.284  1.00 2.00  ? 1340 5GP A N7    1 
HETATM 9888  C C5    . 5GP F 3 .   ? -1.420  6.805   -56.009  1.00 13.02 ? 1340 5GP A C5    1 
HETATM 9889  C C6    . 5GP F 3 .   ? -1.469  8.192   -56.280  1.00 12.87 ? 1340 5GP A C6    1 
HETATM 9890  O O6    . 5GP F 3 .   ? -2.368  8.911   -55.796  1.00 9.74  ? 1340 5GP A O6    1 
HETATM 9891  N N1    . 5GP F 3 .   ? -0.518  8.764   -57.073  1.00 7.09  ? 1340 5GP A N1    1 
HETATM 9892  C C2    . 5GP F 3 .   ? 0.499   7.998   -57.591  1.00 9.68  ? 1340 5GP A C2    1 
HETATM 9893  N N2    . 5GP F 3 .   ? 1.504   8.441   -58.372  1.00 6.58  ? 1340 5GP A N2    1 
HETATM 9894  N N3    . 5GP F 3 .   ? 0.558   6.693   -57.350  1.00 10.34 ? 1340 5GP A N3    1 
HETATM 9895  C C4    . 5GP F 3 .   ? -0.369  6.093   -56.582  1.00 10.13 ? 1340 5GP A C4    1 
HETATM 9896  K K     . K   G 2 .   ? -7.228  -16.203 -75.772  1.00 26.22 ? 1338 K   B K     1 
HETATM 9897  P P     . 5GP H 3 .   ? -9.804  -21.892 -81.172  1.00 18.05 ? 1339 5GP B P     1 
HETATM 9898  O O1P   . 5GP H 3 .   ? -8.985  -20.624 -81.288  1.00 7.74  ? 1339 5GP B O1P   1 
HETATM 9899  O O2P   . 5GP H 3 .   ? -9.921  -22.565 -82.507  1.00 8.11  ? 1339 5GP B O2P   1 
HETATM 9900  O O3P   . 5GP H 3 .   ? -11.095 -21.824 -80.358  1.00 5.80  ? 1339 5GP B O3P   1 
HETATM 9901  O "O5'" . 5GP H 3 .   ? -8.823  -22.809 -80.291  1.00 17.03 ? 1339 5GP B "O5'" 1 
HETATM 9902  C "C5'" . 5GP H 3 .   ? -9.100  -24.172 -80.026  1.00 20.11 ? 1339 5GP B "C5'" 1 
HETATM 9903  C "C4'" . 5GP H 3 .   ? -8.049  -24.633 -79.039  1.00 17.77 ? 1339 5GP B "C4'" 1 
HETATM 9904  O "O4'" . 5GP H 3 .   ? -8.065  -23.821 -77.858  1.00 10.42 ? 1339 5GP B "O4'" 1 
HETATM 9905  C "C3'" . 5GP H 3 .   ? -8.244  -26.044 -78.502  1.00 18.34 ? 1339 5GP B "C3'" 1 
HETATM 9906  O "O3'" . 5GP H 3 .   ? -7.971  -27.058 -79.444  1.00 10.46 ? 1339 5GP B "O3'" 1 
HETATM 9907  C "C2'" . 5GP H 3 .   ? -7.275  -26.029 -77.339  1.00 18.30 ? 1339 5GP B "C2'" 1 
HETATM 9908  O "O2'" . 5GP H 3 .   ? -5.900  -26.224 -77.715  1.00 10.47 ? 1339 5GP B "O2'" 1 
HETATM 9909  C "C1'" . 5GP H 3 .   ? -7.487  -24.619 -76.799  1.00 15.92 ? 1339 5GP B "C1'" 1 
HETATM 9910  N N9    . 5GP H 3 .   ? -8.356  -24.741 -75.596  1.00 7.02  ? 1339 5GP B N9    1 
HETATM 9911  C C8    . 5GP H 3 .   ? -9.635  -25.130 -75.533  1.00 10.94 ? 1339 5GP B C8    1 
HETATM 9912  N N7    . 5GP H 3 .   ? -10.071 -25.096 -74.250  1.00 5.02  ? 1339 5GP B N7    1 
HETATM 9913  C C5    . 5GP H 3 .   ? -9.032  -24.669 -73.499  1.00 12.67 ? 1339 5GP B C5    1 
HETATM 9914  C C6    . 5GP H 3 .   ? -8.836  -24.439 -72.138  1.00 4.94  ? 1339 5GP B C6    1 
HETATM 9915  O O6    . 5GP H 3 .   ? -9.749  -24.641 -71.303  1.00 17.95 ? 1339 5GP B O6    1 
HETATM 9916  N N1    . 5GP H 3 .   ? -7.612  -24.013 -71.725  1.00 14.88 ? 1339 5GP B N1    1 
HETATM 9917  C C2    . 5GP H 3 .   ? -6.610  -23.817 -72.608  1.00 6.09  ? 1339 5GP B C2    1 
HETATM 9918  N N2    . 5GP H 3 .   ? -5.411  -23.396 -72.252  1.00 8.93  ? 1339 5GP B N2    1 
HETATM 9919  N N3    . 5GP H 3 .   ? -6.778  -24.021 -73.913  1.00 15.25 ? 1339 5GP B N3    1 
HETATM 9920  C C4    . 5GP H 3 .   ? -7.966  -24.454 -74.371  1.00 9.04  ? 1339 5GP B C4    1 
HETATM 9921  K K     . K   I 2 .   ? -7.643  16.754  -84.837  1.00 31.24 ? 1338 K   C K     1 
HETATM 9922  P P     . 5GP J 3 .   ? -6.339  22.541  -79.218  1.00 10.87 ? 1339 5GP C P     1 
HETATM 9923  O O1P   . 5GP J 3 .   ? -6.002  21.099  -79.458  1.00 2.00  ? 1339 5GP C O1P   1 
HETATM 9924  O O2P   . 5GP J 3 .   ? -5.854  22.937  -77.845  1.00 6.58  ? 1339 5GP C O2P   1 
HETATM 9925  O O3P   . 5GP J 3 .   ? -7.753  22.998  -79.547  1.00 15.47 ? 1339 5GP C O3P   1 
HETATM 9926  O "O5'" . 5GP J 3 .   ? -5.472  23.384  -80.289  1.00 16.57 ? 1339 5GP C "O5'" 1 
HETATM 9927  C "C5'" . 5GP J 3 .   ? -5.785  24.750  -80.561  1.00 17.98 ? 1339 5GP C "C5'" 1 
HETATM 9928  C "C4'" . 5GP J 3 .   ? -5.272  25.143  -81.930  1.00 12.99 ? 1339 5GP C "C4'" 1 
HETATM 9929  O "O4'" . 5GP J 3 .   ? -5.968  24.421  -82.959  1.00 13.19 ? 1339 5GP C "O4'" 1 
HETATM 9930  C "C3'" . 5GP J 3 .   ? -5.555  26.596  -82.259  1.00 11.81 ? 1339 5GP C "C3'" 1 
HETATM 9931  O "O3'" . 5GP J 3 .   ? -4.614  27.487  -81.718  1.00 3.83  ? 1339 5GP C "O3'" 1 
HETATM 9932  C "C2'" . 5GP J 3 .   ? -5.541  26.610  -83.768  1.00 12.16 ? 1339 5GP C "C2'" 1 
HETATM 9933  O "O2'" . 5GP J 3 .   ? -4.204  26.724  -84.226  1.00 11.30 ? 1339 5GP C "O2'" 1 
HETATM 9934  C "C1'" . 5GP J 3 .   ? -6.115  25.245  -84.143  1.00 13.79 ? 1339 5GP C "C1'" 1 
HETATM 9935  N N9    . 5GP J 3 .   ? -7.507  25.440  -84.700  1.00 17.88 ? 1339 5GP C N9    1 
HETATM 9936  C C8    . 5GP J 3 .   ? -8.603  26.047  -84.162  1.00 15.73 ? 1339 5GP C C8    1 
HETATM 9937  N N7    . 5GP J 3 .   ? -9.637  26.011  -85.062  1.00 12.18 ? 1339 5GP C N7    1 
HETATM 9938  C C5    . 5GP J 3 .   ? -9.187  25.381  -86.184  1.00 18.08 ? 1339 5GP C C5    1 
HETATM 9939  C C6    . 5GP J 3 .   ? -9.724  25.044  -87.437  1.00 11.30 ? 1339 5GP C C6    1 
HETATM 9940  O O6    . 5GP J 3 .   ? -10.894 25.311  -87.735  1.00 14.17 ? 1339 5GP C O6    1 
HETATM 9941  N N1    . 5GP J 3 .   ? -8.972  24.390  -88.350  1.00 14.73 ? 1339 5GP C N1    1 
HETATM 9942  C C2    . 5GP J 3 .   ? -7.683  24.074  -88.067  1.00 17.09 ? 1339 5GP C C2    1 
HETATM 9943  N N2    . 5GP J 3 .   ? -6.884  23.443  -88.943  1.00 19.40 ? 1339 5GP C N2    1 
HETATM 9944  N N3    . 5GP J 3 .   ? -7.133  24.392  -86.886  1.00 17.43 ? 1339 5GP C N3    1 
HETATM 9945  C C4    . 5GP J 3 .   ? -7.855  25.032  -85.932  1.00 20.51 ? 1339 5GP C C4    1 
HETATM 9946  K K     . K   K 2 .   ? -12.336 -4.172  -96.019  1.00 22.07 ? 1338 K   D K     1 
HETATM 9947  P P     . 5GP L 3 .   ? -14.476 1.810   -101.179 1.00 20.46 ? 1339 5GP D P     1 
HETATM 9948  O O1P   . 5GP L 3 .   ? -13.309 1.670   -100.231 1.00 15.57 ? 1339 5GP D O1P   1 
HETATM 9949  O O2P   . 5GP L 3 .   ? -14.434 3.079   -101.973 1.00 14.06 ? 1339 5GP D O2P   1 
HETATM 9950  O O3P   . 5GP L 3 .   ? -15.851 1.439   -100.644 1.00 10.28 ? 1339 5GP D O3P   1 
HETATM 9951  O "O5'" . 5GP L 3 .   ? -14.208 0.606   -102.180 1.00 14.95 ? 1339 5GP D "O5'" 1 
HETATM 9952  C "C5'" . 5GP L 3 .   ? -14.987 0.443   -103.350 1.00 17.30 ? 1339 5GP D "C5'" 1 
HETATM 9953  C "C4'" . 5GP L 3 .   ? -14.402 -0.764  -104.037 1.00 18.63 ? 1339 5GP D "C4'" 1 
HETATM 9954  O "O4'" . 5GP L 3 .   ? -14.452 -1.930  -103.192 1.00 5.36  ? 1339 5GP D "O4'" 1 
HETATM 9955  C "C3'" . 5GP L 3 .   ? -15.117 -1.120  -105.332 1.00 22.13 ? 1339 5GP D "C3'" 1 
HETATM 9956  O "O3'" . 5GP L 3 .   ? -14.782 -0.235  -106.400 1.00 18.03 ? 1339 5GP D "O3'" 1 
HETATM 9957  C "C2'" . 5GP L 3 .   ? -14.625 -2.543  -105.516 1.00 22.04 ? 1339 5GP D "C2'" 1 
HETATM 9958  O "O2'" . 5GP L 3 .   ? -13.370 -2.544  -106.212 1.00 19.23 ? 1339 5GP D "O2'" 1 
HETATM 9959  C "C1'" . 5GP L 3 .   ? -14.513 -3.067  -104.069 1.00 10.97 ? 1339 5GP D "C1'" 1 
HETATM 9960  N N9    . 5GP L 3 .   ? -15.710 -3.929  -103.840 1.00 12.04 ? 1339 5GP D N9    1 
HETATM 9961  C C8    . 5GP L 3 .   ? -17.031 -3.638  -103.884 1.00 7.91  ? 1339 5GP D C8    1 
HETATM 9962  N N7    . 5GP L 3 .   ? -17.747 -4.760  -103.626 1.00 9.58  ? 1339 5GP D N7    1 
HETATM 9963  C C5    . 5GP L 3 .   ? -16.855 -5.769  -103.442 1.00 9.91  ? 1339 5GP D C5    1 
HETATM 9964  C C6    . 5GP L 3 .   ? -16.939 -7.134  -103.157 1.00 9.58  ? 1339 5GP D C6    1 
HETATM 9965  O O6    . 5GP L 3 .   ? -18.069 -7.654  -103.028 1.00 10.96 ? 1339 5GP D O6    1 
HETATM 9966  N N1    . 5GP L 3 .   ? -15.784 -7.869  -103.021 1.00 8.37  ? 1339 5GP D N1    1 
HETATM 9967  C C2    . 5GP L 3 .   ? -14.558 -7.260  -103.162 1.00 13.73 ? 1339 5GP D C2    1 
HETATM 9968  N N2    . 5GP L 3 .   ? -13.358 -7.887  -103.065 1.00 17.72 ? 1339 5GP D N2    1 
HETATM 9969  N N3    . 5GP L 3 .   ? -14.468 -5.951  -103.430 1.00 12.42 ? 1339 5GP D N3    1 
HETATM 9970  C C4    . 5GP L 3 .   ? -15.588 -5.213  -103.570 1.00 12.20 ? 1339 5GP D C4    1 
HETATM 9971  O O     . HOH M 4 .   ? 17.082  12.684  -80.102  1.00 19.14 ? 2001 HOH A O     1 
HETATM 9972  O O     . HOH M 4 .   ? 8.046   -35.573 -64.500  1.00 17.84 ? 2002 HOH A O     1 
HETATM 9973  O O     . HOH M 4 .   ? 14.249  -30.879 -66.779  1.00 14.50 ? 2003 HOH A O     1 
HETATM 9974  O O     . HOH M 4 .   ? 2.052   -25.858 -54.004  1.00 14.35 ? 2004 HOH A O     1 
HETATM 9975  O O     . HOH M 4 .   ? -8.217  -1.745  -37.539  1.00 12.31 ? 2005 HOH A O     1 
HETATM 9976  O O     . HOH M 4 .   ? 11.755  -19.578 -54.121  1.00 4.87  ? 2006 HOH A O     1 
HETATM 9977  O O     . HOH M 4 .   ? 21.160  -9.378  -49.625  1.00 5.55  ? 2007 HOH A O     1 
HETATM 9978  O O     . HOH M 4 .   ? 4.997   -12.455 -47.714  1.00 11.17 ? 2008 HOH A O     1 
HETATM 9979  O O     . HOH M 4 .   ? 2.891   2.114   -52.423  1.00 2.00  ? 2009 HOH A O     1 
HETATM 9980  O O     . HOH M 4 .   ? -5.467  4.977   -50.891  1.00 3.87  ? 2010 HOH A O     1 
HETATM 9981  O O     . HOH M 4 .   ? -9.640  -10.210 -41.917  1.00 13.75 ? 2011 HOH A O     1 
HETATM 9982  O O     . HOH M 4 .   ? -2.244  8.359   -66.580  1.00 19.79 ? 2012 HOH A O     1 
HETATM 9983  O O     . HOH M 4 .   ? 1.192   -20.355 -48.746  1.00 2.72  ? 2013 HOH A O     1 
HETATM 9984  O O     . HOH M 4 .   ? 2.061   -20.440 -46.299  1.00 21.47 ? 2014 HOH A O     1 
HETATM 9985  O O     . HOH M 4 .   ? -0.162  -10.047 -44.458  1.00 9.83  ? 2015 HOH A O     1 
HETATM 9986  O O     . HOH M 4 .   ? -3.774  6.388   -31.152  1.00 17.98 ? 2016 HOH A O     1 
HETATM 9987  O O     . HOH M 4 .   ? -6.727  -2.577  -35.180  1.00 20.13 ? 2017 HOH A O     1 
HETATM 9988  O O     . HOH M 4 .   ? -9.127  -9.876  -39.384  1.00 2.40  ? 2018 HOH A O     1 
HETATM 9989  O O     . HOH M 4 .   ? 1.669   -16.134 -39.967  1.00 16.25 ? 2019 HOH A O     1 
HETATM 9990  O O     . HOH M 4 .   ? 6.903   -6.909  -39.958  1.00 11.30 ? 2020 HOH A O     1 
HETATM 9991  O O     . HOH M 4 .   ? 7.182   -12.232 -43.879  1.00 16.08 ? 2021 HOH A O     1 
HETATM 9992  O O     . HOH M 4 .   ? 3.813   -16.589 -42.422  1.00 23.41 ? 2022 HOH A O     1 
HETATM 9993  O O     . HOH M 4 .   ? 5.618   16.843  -40.932  1.00 19.95 ? 2023 HOH A O     1 
HETATM 9994  O O     . HOH M 4 .   ? 1.204   12.203  -36.890  1.00 19.66 ? 2024 HOH A O     1 
HETATM 9995  O O     . HOH M 4 .   ? 4.337   14.322  -41.695  1.00 25.79 ? 2025 HOH A O     1 
HETATM 9996  O O     . HOH M 4 .   ? 4.485   5.094   -47.051  1.00 7.17  ? 2026 HOH A O     1 
HETATM 9997  O O     . HOH M 4 .   ? 11.315  13.731  -52.271  1.00 14.53 ? 2027 HOH A O     1 
HETATM 9998  O O     . HOH M 4 .   ? 10.546  11.833  -59.944  1.00 8.90  ? 2028 HOH A O     1 
HETATM 9999  O O     . HOH M 4 .   ? 15.000  14.488  -45.096  1.00 17.88 ? 2029 HOH A O     1 
HETATM 10000 O O     . HOH M 4 .   ? 15.733  18.794  -45.571  1.00 8.96  ? 2030 HOH A O     1 
HETATM 10001 O O     . HOH M 4 .   ? 18.189  13.433  -42.762  1.00 19.41 ? 2031 HOH A O     1 
HETATM 10002 O O     . HOH M 4 .   ? 21.696  1.936   -39.250  1.00 11.91 ? 2032 HOH A O     1 
HETATM 10003 O O     . HOH M 4 .   ? 23.778  6.167   -58.501  1.00 5.43  ? 2033 HOH A O     1 
HETATM 10004 O O     . HOH M 4 .   ? 23.955  10.322  -50.865  1.00 19.77 ? 2034 HOH A O     1 
HETATM 10005 O O     . HOH M 4 .   ? 18.282  -5.558  -49.963  1.00 3.79  ? 2035 HOH A O     1 
HETATM 10006 O O     . HOH M 4 .   ? -0.517  7.727   -64.859  1.00 18.32 ? 2036 HOH A O     1 
HETATM 10007 O O     . HOH M 4 .   ? 2.392   3.670   -61.089  1.00 16.20 ? 2037 HOH A O     1 
HETATM 10008 O O     . HOH M 4 .   ? 6.740   2.291   -63.906  1.00 10.76 ? 2038 HOH A O     1 
HETATM 10009 O O     . HOH M 4 .   ? 24.227  -2.652  -59.294  1.00 2.25  ? 2039 HOH A O     1 
HETATM 10010 O O     . HOH M 4 .   ? 25.888  -8.988  -57.072  1.00 21.34 ? 2040 HOH A O     1 
HETATM 10011 O O     . HOH M 4 .   ? 19.348  -9.416  -54.536  1.00 4.60  ? 2041 HOH A O     1 
HETATM 10012 O O     . HOH M 4 .   ? 18.018  -12.161 -50.975  1.00 2.21  ? 2042 HOH A O     1 
HETATM 10013 O O     . HOH M 4 .   ? 4.045   -4.537  -60.274  1.00 2.00  ? 2043 HOH A O     1 
HETATM 10014 O O     . HOH M 4 .   ? 11.950  -12.800 -59.795  1.00 2.00  ? 2044 HOH A O     1 
HETATM 10015 O O     . HOH M 4 .   ? 16.411  -8.308  -64.890  1.00 8.09  ? 2045 HOH A O     1 
HETATM 10016 O O     . HOH M 4 .   ? 0.802   -4.039  -59.496  1.00 2.00  ? 2046 HOH A O     1 
HETATM 10017 O O     . HOH M 4 .   ? -20.965 -3.220  -47.588  1.00 12.93 ? 2047 HOH A O     1 
HETATM 10018 O O     . HOH M 4 .   ? -26.485 -2.808  -57.415  1.00 6.50  ? 2048 HOH A O     1 
HETATM 10019 O O     . HOH M 4 .   ? -11.670 -1.019  -52.769  1.00 13.14 ? 2049 HOH A O     1 
HETATM 10020 O O     . HOH M 4 .   ? -15.919 1.132   -50.904  1.00 7.76  ? 2050 HOH A O     1 
HETATM 10021 O O     . HOH M 4 .   ? -3.567  8.091   -48.538  1.00 11.85 ? 2051 HOH A O     1 
HETATM 10022 O O     . HOH M 4 .   ? -2.665  15.443  -53.048  1.00 15.36 ? 2052 HOH A O     1 
HETATM 10023 O O     . HOH M 4 .   ? -12.849 11.632  -49.075  1.00 3.38  ? 2053 HOH A O     1 
HETATM 10024 O O     . HOH M 4 .   ? -13.600 3.592   -48.419  1.00 3.31  ? 2054 HOH A O     1 
HETATM 10025 O O     . HOH M 4 .   ? -8.969  -15.857 -45.976  1.00 18.48 ? 2055 HOH A O     1 
HETATM 10026 O O     . HOH M 4 .   ? 12.722  -15.225 -59.677  1.00 2.84  ? 2056 HOH A O     1 
HETATM 10027 O O     . HOH M 4 .   ? 16.418  -16.947 -69.851  1.00 17.38 ? 2057 HOH A O     1 
HETATM 10028 O O     . HOH M 4 .   ? -2.619  -4.595  -59.072  1.00 2.00  ? 2058 HOH A O     1 
HETATM 10029 O O     . HOH M 4 .   ? -2.690  -2.331  -62.294  1.00 2.00  ? 2059 HOH A O     1 
HETATM 10030 O O     . HOH M 4 .   ? -2.976  2.487   -58.196  1.00 2.00  ? 2060 HOH A O     1 
HETATM 10031 O O     . HOH N 4 .   ? 17.366  -14.552 -68.300  1.00 24.18 ? 2001 HOH B O     1 
HETATM 10032 O O     . HOH N 4 .   ? -4.158  -8.725  -91.466  1.00 12.66 ? 2002 HOH B O     1 
HETATM 10033 O O     . HOH N 4 .   ? -0.345  -5.453  -87.127  1.00 18.63 ? 2003 HOH B O     1 
HETATM 10034 O O     . HOH N 4 .   ? -7.722  -35.416 -104.401 1.00 13.37 ? 2004 HOH B O     1 
HETATM 10035 O O     . HOH N 4 .   ? 0.607   -34.140 -100.576 1.00 16.43 ? 2005 HOH B O     1 
HETATM 10036 O O     . HOH N 4 .   ? 6.599   -38.773 -92.869  1.00 7.06  ? 2006 HOH B O     1 
HETATM 10037 O O     . HOH N 4 .   ? 10.382  -43.260 -86.825  1.00 14.84 ? 2007 HOH B O     1 
HETATM 10038 O O     . HOH N 4 .   ? -6.956  -40.973 -94.184  1.00 10.49 ? 2008 HOH B O     1 
HETATM 10039 O O     . HOH N 4 .   ? -11.012 -33.599 -74.916  1.00 9.38  ? 2009 HOH B O     1 
HETATM 10040 O O     . HOH N 4 .   ? -7.177  -29.509 -78.257  1.00 14.26 ? 2010 HOH B O     1 
HETATM 10041 O O     . HOH N 4 .   ? -6.092  -14.572 -72.504  1.00 11.38 ? 2011 HOH B O     1 
HETATM 10042 O O     . HOH N 4 .   ? -13.673 -40.124 -75.494  1.00 17.25 ? 2012 HOH B O     1 
HETATM 10043 O O     . HOH N 4 .   ? -17.053 -45.293 -70.166  1.00 16.82 ? 2013 HOH B O     1 
HETATM 10044 O O     . HOH N 4 .   ? -23.865 -43.685 -78.069  1.00 20.13 ? 2014 HOH B O     1 
HETATM 10045 O O     . HOH N 4 .   ? -9.358  -42.578 -87.121  1.00 13.06 ? 2015 HOH B O     1 
HETATM 10046 O O     . HOH N 4 .   ? -4.115  -34.423 -69.175  1.00 4.24  ? 2016 HOH B O     1 
HETATM 10047 O O     . HOH N 4 .   ? -6.432  -46.418 -62.645  1.00 10.87 ? 2017 HOH B O     1 
HETATM 10048 O O     . HOH N 4 .   ? -5.185  -51.500 -67.044  1.00 26.01 ? 2018 HOH B O     1 
HETATM 10049 O O     . HOH N 4 .   ? -12.388 -55.036 -77.893  1.00 21.74 ? 2019 HOH B O     1 
HETATM 10050 O O     . HOH N 4 .   ? -0.362  -27.588 -73.587  1.00 3.07  ? 2020 HOH B O     1 
HETATM 10051 O O     . HOH N 4 .   ? 2.540   -32.408 -68.780  1.00 7.36  ? 2021 HOH B O     1 
HETATM 10052 O O     . HOH N 4 .   ? 5.422   -40.228 -68.227  1.00 19.05 ? 2022 HOH B O     1 
HETATM 10053 O O     . HOH N 4 .   ? 5.665   -51.868 -79.142  1.00 5.08  ? 2023 HOH B O     1 
HETATM 10054 O O     . HOH N 4 .   ? 5.736   -47.489 -84.651  1.00 20.39 ? 2024 HOH B O     1 
HETATM 10055 O O     . HOH N 4 .   ? -0.969  -49.654 -83.096  1.00 9.96  ? 2025 HOH B O     1 
HETATM 10056 O O     . HOH N 4 .   ? -7.726  -48.691 -82.928  1.00 13.58 ? 2026 HOH B O     1 
HETATM 10057 O O     . HOH N 4 .   ? -4.621  -17.230 -73.679  1.00 11.81 ? 2027 HOH B O     1 
HETATM 10058 O O     . HOH N 4 .   ? -4.188  -21.454 -77.711  1.00 15.50 ? 2028 HOH B O     1 
HETATM 10059 O O     . HOH N 4 .   ? 8.218   -15.621 -86.975  1.00 20.31 ? 2029 HOH B O     1 
HETATM 10060 O O     . HOH N 4 .   ? 12.255  -21.178 -88.671  1.00 13.81 ? 2030 HOH B O     1 
HETATM 10061 O O     . HOH N 4 .   ? 6.461   -33.788 -93.480  1.00 11.30 ? 2031 HOH B O     1 
HETATM 10062 O O     . HOH N 4 .   ? 3.365   -36.701 -95.366  1.00 13.71 ? 2032 HOH B O     1 
HETATM 10063 O O     . HOH N 4 .   ? 4.696   -37.405 -89.281  1.00 2.58  ? 2033 HOH B O     1 
HETATM 10064 O O     . HOH N 4 .   ? -3.709  -21.492 -80.372  1.00 8.72  ? 2034 HOH B O     1 
HETATM 10065 O O     . HOH N 4 .   ? -5.170  -22.409 -85.783  1.00 2.00  ? 2035 HOH B O     1 
HETATM 10066 O O     . HOH N 4 .   ? -10.442 -18.341 -82.428  1.00 2.00  ? 2036 HOH B O     1 
HETATM 10067 O O     . HOH N 4 .   ? -6.670  -12.123 -89.144  1.00 11.53 ? 2037 HOH B O     1 
HETATM 10068 O O     . HOH N 4 .   ? 4.297   -32.129 -94.445  1.00 6.08  ? 2038 HOH B O     1 
HETATM 10069 O O     . HOH N 4 .   ? -24.013 -32.971 -80.905  1.00 20.35 ? 2039 HOH B O     1 
HETATM 10070 O O     . HOH N 4 .   ? -27.091 -30.336 -80.095  1.00 13.16 ? 2040 HOH B O     1 
HETATM 10071 O O     . HOH N 4 .   ? -33.507 -15.470 -77.973  1.00 19.54 ? 2041 HOH B O     1 
HETATM 10072 O O     . HOH N 4 .   ? -21.427 -27.547 -65.473  1.00 17.68 ? 2042 HOH B O     1 
HETATM 10073 O O     . HOH N 4 .   ? -6.326  -34.841 -75.784  1.00 8.52  ? 2043 HOH B O     1 
HETATM 10074 O O     . HOH N 4 .   ? -5.082  -25.950 -66.625  1.00 14.59 ? 2044 HOH B O     1 
HETATM 10075 O O     . HOH N 4 .   ? -17.523 -26.568 -100.152 1.00 13.83 ? 2045 HOH B O     1 
HETATM 10076 O O     . HOH N 4 .   ? -13.464 -16.556 -105.498 1.00 17.80 ? 2046 HOH B O     1 
HETATM 10077 O O     . HOH N 4 .   ? 2.486   -18.918 -106.943 1.00 10.82 ? 2047 HOH B O     1 
HETATM 10078 O O     . HOH N 4 .   ? 1.202   -26.150 -98.204  1.00 14.35 ? 2048 HOH B O     1 
HETATM 10079 O O     . HOH N 4 .   ? -10.654 -22.407 -77.432  1.00 12.42 ? 2049 HOH B O     1 
HETATM 10080 O O     . HOH N 4 .   ? -8.833  -22.408 -84.466  1.00 11.30 ? 2050 HOH B O     1 
HETATM 10081 O O     . HOH O 4 .   ? 7.850   9.700   -91.195  1.00 14.69 ? 2001 HOH C O     1 
HETATM 10082 O O     . HOH O 4 .   ? 13.798  14.022  -68.342  1.00 2.00  ? 2002 HOH C O     1 
HETATM 10083 O O     . HOH O 4 .   ? 25.869  10.001  -55.748  1.00 17.25 ? 2003 HOH C O     1 
HETATM 10084 O O     . HOH O 4 .   ? 5.108   18.357  -53.982  1.00 12.84 ? 2004 HOH C O     1 
HETATM 10085 O O     . HOH O 4 .   ? 6.303   30.051  -60.597  1.00 7.51  ? 2005 HOH C O     1 
HETATM 10086 O O     . HOH O 4 .   ? 12.151  29.930  -66.262  1.00 13.44 ? 2006 HOH C O     1 
HETATM 10087 O O     . HOH O 4 .   ? 9.082   45.116  -72.937  1.00 2.00  ? 2007 HOH C O     1 
HETATM 10088 O O     . HOH O 4 .   ? 2.213   35.374  -70.126  1.00 4.49  ? 2008 HOH C O     1 
HETATM 10089 O O     . HOH O 4 .   ? 5.361   40.256  -66.051  1.00 12.49 ? 2009 HOH C O     1 
HETATM 10090 O O     . HOH O 4 .   ? -6.493  40.732  -64.396  1.00 2.00  ? 2010 HOH C O     1 
HETATM 10091 O O     . HOH O 4 .   ? -2.278  34.176  -58.689  1.00 12.07 ? 2011 HOH C O     1 
HETATM 10092 O O     . HOH O 4 .   ? -1.113  30.161  -59.647  1.00 15.84 ? 2012 HOH C O     1 
HETATM 10093 O O     . HOH O 4 .   ? -10.443 41.491  -82.001  1.00 5.48  ? 2013 HOH C O     1 
HETATM 10094 O O     . HOH O 4 .   ? -9.397  34.878  -84.005  1.00 13.77 ? 2014 HOH C O     1 
HETATM 10095 O O     . HOH O 4 .   ? -15.107 44.764  -74.051  1.00 10.76 ? 2015 HOH C O     1 
HETATM 10096 O O     . HOH O 4 .   ? -9.150  52.642  -74.179  1.00 16.08 ? 2016 HOH C O     1 
HETATM 10097 O O     . HOH O 4 .   ? 0.366   42.928  -75.217  1.00 5.57  ? 2017 HOH C O     1 
HETATM 10098 O O     . HOH O 4 .   ? -7.851  40.243  -81.568  1.00 2.00  ? 2018 HOH C O     1 
HETATM 10099 O O     . HOH O 4 .   ? -7.214  34.900  -92.846  1.00 3.22  ? 2019 HOH C O     1 
HETATM 10100 O O     . HOH O 4 .   ? -7.720  40.771  -98.720  1.00 8.11  ? 2020 HOH C O     1 
HETATM 10101 O O     . HOH O 4 .   ? -10.056 41.331  -97.392  1.00 16.91 ? 2021 HOH C O     1 
HETATM 10102 O O     . HOH O 4 .   ? -9.805  40.503  -94.189  1.00 25.05 ? 2022 HOH C O     1 
HETATM 10103 O O     . HOH O 4 .   ? -8.639  38.212  -93.469  1.00 17.17 ? 2023 HOH C O     1 
HETATM 10104 O O     . HOH O 4 .   ? -5.914  52.970  -87.702  1.00 8.27  ? 2024 HOH C O     1 
HETATM 10105 O O     . HOH O 4 .   ? -5.752  52.369  -74.291  1.00 17.42 ? 2025 HOH C O     1 
HETATM 10106 O O     . HOH O 4 .   ? -2.519  27.382  -90.672  1.00 12.16 ? 2026 HOH C O     1 
HETATM 10107 O O     . HOH O 4 .   ? -2.924  31.018  -96.891  1.00 8.81  ? 2027 HOH C O     1 
HETATM 10108 O O     . HOH O 4 .   ? 7.089   29.714  -98.807  1.00 26.40 ? 2028 HOH C O     1 
HETATM 10109 O O     . HOH O 4 .   ? 12.625  46.500  -84.635  1.00 6.21  ? 2029 HOH C O     1 
HETATM 10110 O O     . HOH O 4 .   ? 9.548   49.816  -77.894  1.00 12.60 ? 2030 HOH C O     1 
HETATM 10111 O O     . HOH O 4 .   ? 9.030   23.226  -98.346  1.00 6.16  ? 2031 HOH C O     1 
HETATM 10112 O O     . HOH O 4 .   ? 11.963  35.894  -81.252  1.00 2.03  ? 2032 HOH C O     1 
HETATM 10113 O O     . HOH O 4 .   ? -4.542  29.613  -83.529  1.00 3.97  ? 2033 HOH C O     1 
HETATM 10114 O O     . HOH O 4 .   ? -8.856  14.741  -87.829  1.00 13.83 ? 2034 HOH C O     1 
HETATM 10115 O O     . HOH O 4 .   ? 1.891   19.430  -85.614  1.00 2.00  ? 2035 HOH C O     1 
HETATM 10116 O O     . HOH O 4 .   ? 12.601  26.832  -74.987  1.00 4.62  ? 2036 HOH C O     1 
HETATM 10117 O O     . HOH O 4 .   ? -2.793  22.517  -77.095  1.00 2.88  ? 2037 HOH C O     1 
HETATM 10118 O O     . HOH O 4 .   ? -11.686 31.693  -62.797  1.00 19.07 ? 2038 HOH C O     1 
HETATM 10119 O O     . HOH O 4 .   ? -19.299 33.491  -70.541  1.00 25.81 ? 2039 HOH C O     1 
HETATM 10120 O O     . HOH O 4 .   ? -29.321 16.568  -69.149  1.00 24.85 ? 2040 HOH C O     1 
HETATM 10121 O O     . HOH O 4 .   ? -23.205 29.987  -86.018  1.00 17.43 ? 2041 HOH C O     1 
HETATM 10122 O O     . HOH O 4 .   ? -23.262 31.539  -93.868  1.00 21.04 ? 2042 HOH C O     1 
HETATM 10123 O O     . HOH O 4 .   ? -8.881  29.169  -56.297  1.00 22.05 ? 2043 HOH C O     1 
HETATM 10124 O O     . HOH O 4 .   ? 1.047   24.832  -58.552  1.00 7.25  ? 2044 HOH C O     1 
HETATM 10125 O O     . HOH O 4 .   ? 12.515  24.667  -71.168  1.00 2.42  ? 2045 HOH C O     1 
HETATM 10126 O O     . HOH O 4 .   ? -5.850  22.392  -75.649  1.00 2.00  ? 2046 HOH C O     1 
HETATM 10127 O O     . HOH O 4 .   ? -8.613  22.890  -82.173  1.00 14.13 ? 2047 HOH C O     1 
HETATM 10128 O O     . HOH P 4 .   ? 7.383   -20.594 -99.680  1.00 10.29 ? 2001 HOH D O     1 
HETATM 10129 O O     . HOH P 4 .   ? -3.007  9.473   -90.555  1.00 17.54 ? 2002 HOH D O     1 
HETATM 10130 O O     . HOH P 4 .   ? 4.127   16.602  -99.333  1.00 2.88  ? 2003 HOH D O     1 
HETATM 10131 O O     . HOH P 4 .   ? 2.241   25.928  -100.114 1.00 11.54 ? 2004 HOH D O     1 
HETATM 10132 O O     . HOH P 4 .   ? -22.497 21.698  -110.754 1.00 17.68 ? 2005 HOH D O     1 
HETATM 10133 O O     . HOH P 4 .   ? -10.509 22.588  -111.082 1.00 17.79 ? 2006 HOH D O     1 
HETATM 10134 O O     . HOH P 4 .   ? -3.305  12.385  -111.641 1.00 17.98 ? 2007 HOH D O     1 
HETATM 10135 O O     . HOH P 4 .   ? -6.925  4.390   -132.064 1.00 10.41 ? 2008 HOH D O     1 
HETATM 10136 O O     . HOH P 4 .   ? -3.313  10.447  -128.782 1.00 10.50 ? 2009 HOH D O     1 
HETATM 10137 O O     . HOH P 4 .   ? -28.975 13.338  -111.194 1.00 12.29 ? 2010 HOH D O     1 
HETATM 10138 O O     . HOH P 4 .   ? -11.951 -7.164  -93.985  1.00 24.33 ? 2011 HOH D O     1 
HETATM 10139 O O     . HOH P 4 .   ? -19.802 22.707  -111.372 1.00 6.39  ? 2012 HOH D O     1 
HETATM 10140 O O     . HOH P 4 .   ? -22.398 -0.763  -117.267 1.00 11.64 ? 2013 HOH D O     1 
HETATM 10141 O O     . HOH P 4 .   ? -10.951 -13.717 -116.226 1.00 17.69 ? 2014 HOH D O     1 
HETATM 10142 O O     . HOH P 4 .   ? -18.697 -17.680 -119.884 1.00 13.26 ? 2015 HOH D O     1 
HETATM 10143 O O     . HOH P 4 .   ? -24.332 -2.454  -134.231 1.00 21.95 ? 2016 HOH D O     1 
HETATM 10144 O O     . HOH P 4 .   ? -11.430 6.629   -123.998 1.00 8.80  ? 2017 HOH D O     1 
HETATM 10145 O O     . HOH P 4 .   ? -15.277 -11.247 -113.994 1.00 14.89 ? 2018 HOH D O     1 
HETATM 10146 O O     . HOH P 4 .   ? -10.123 -8.377  -108.572 1.00 13.96 ? 2019 HOH D O     1 
HETATM 10147 O O     . HOH P 4 .   ? -11.529 -15.839 -118.201 1.00 26.56 ? 2020 HOH D O     1 
HETATM 10148 O O     . HOH P 4 .   ? 3.010   -13.080 -109.331 1.00 15.01 ? 2021 HOH D O     1 
HETATM 10149 O O     . HOH P 4 .   ? 4.720   -12.884 -119.383 1.00 27.72 ? 2022 HOH D O     1 
HETATM 10150 O O     . HOH P 4 .   ? 0.832   -10.071 -122.303 1.00 18.37 ? 2023 HOH D O     1 
HETATM 10151 O O     . HOH P 4 .   ? -7.214  -13.477 -92.097  1.00 21.81 ? 2024 HOH D O     1 
HETATM 10152 O O     . HOH P 4 .   ? -7.139  -11.125 -92.032  1.00 14.79 ? 2025 HOH D O     1 
HETATM 10153 O O     . HOH P 4 .   ? -10.973 -7.471  -96.839  1.00 14.14 ? 2026 HOH D O     1 
HETATM 10154 O O     . HOH P 4 .   ? 4.881   -4.238  -106.533 1.00 15.47 ? 2027 HOH D O     1 
HETATM 10155 O O     . HOH P 4 .   ? -9.003  4.098   -103.193 1.00 7.32  ? 2028 HOH D O     1 
HETATM 10156 O O     . HOH P 4 .   ? -14.205 3.355   -97.965  1.00 15.52 ? 2029 HOH D O     1 
HETATM 10157 O O     . HOH P 4 .   ? -30.168 6.062   -108.684 1.00 16.00 ? 2030 HOH D O     1 
HETATM 10158 O O     . HOH P 4 .   ? -31.871 7.586   -106.132 1.00 22.64 ? 2031 HOH D O     1 
HETATM 10159 O O     . HOH P 4 .   ? -34.350 4.205   -87.594  1.00 30.81 ? 2032 HOH D O     1 
HETATM 10160 O O     . HOH P 4 .   ? 6.423   21.530  -103.357 1.00 14.73 ? 2033 HOH D O     1 
HETATM 10161 O O     . HOH P 4 .   ? 6.819   25.124  -104.889 1.00 12.06 ? 2034 HOH D O     1 
HETATM 10162 O O     . HOH P 4 .   ? 8.561   14.697  -102.897 1.00 21.46 ? 2035 HOH D O     1 
HETATM 10163 O O     . HOH P 4 .   ? 1.953   10.193  -84.422  1.00 16.17 ? 2036 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -21 ?   ?   ?   A . n 
A 1 2   HIS 2   -20 ?   ?   ?   A . n 
A 1 3   HIS 3   -19 ?   ?   ?   A . n 
A 1 4   HIS 4   -18 ?   ?   ?   A . n 
A 1 5   HIS 5   -17 ?   ?   ?   A . n 
A 1 6   HIS 6   -16 ?   ?   ?   A . n 
A 1 7   HIS 7   -15 ?   ?   ?   A . n 
A 1 8   SER 8   -14 ?   ?   ?   A . n 
A 1 9   SER 9   -13 ?   ?   ?   A . n 
A 1 10  GLY 10  -12 ?   ?   ?   A . n 
A 1 11  VAL 11  -11 ?   ?   ?   A . n 
A 1 12  ASP 12  -10 ?   ?   ?   A . n 
A 1 13  LEU 13  -9  ?   ?   ?   A . n 
A 1 14  GLY 14  -8  ?   ?   ?   A . n 
A 1 15  THR 15  -7  ?   ?   ?   A . n 
A 1 16  GLU 16  -6  ?   ?   ?   A . n 
A 1 17  ASN 17  -5  ?   ?   ?   A . n 
A 1 18  LEU 18  -4  ?   ?   ?   A . n 
A 1 19  TYR 19  -3  ?   ?   ?   A . n 
A 1 20  PHE 20  -2  ?   ?   ?   A . n 
A 1 21  GLN 21  -1  ?   ?   ?   A . n 
A 1 22  SER 22  0   ?   ?   ?   A . n 
A 1 23  MET 23  1   ?   ?   ?   A . n 
A 1 24  PRO 24  2   2   PRO PRO A . n 
A 1 25  ARG 25  3   3   ARG ARG A . n 
A 1 26  ILE 26  4   4   ILE ILE A . n 
A 1 27  ASP 27  5   5   ASP ASP A . n 
A 1 28  ALA 28  6   6   ALA ALA A . n 
A 1 29  ASP 29  7   7   ASP ASP A . n 
A 1 30  LEU 30  8   8   LEU LEU A . n 
A 1 31  LYS 31  9   9   LYS LYS A . n 
A 1 32  LEU 32  10  10  LEU LEU A . n 
A 1 33  ASP 33  11  11  ASP ASP A . n 
A 1 34  PHE 34  12  12  PHE PHE A . n 
A 1 35  LYS 35  13  13  LYS LYS A . n 
A 1 36  ASP 36  14  14  ASP ASP A . n 
A 1 37  VAL 37  15  15  VAL VAL A . n 
A 1 38  LEU 38  16  16  LEU LEU A . n 
A 1 39  LEU 39  17  17  LEU LEU A . n 
A 1 40  ARG 40  18  18  ARG ARG A . n 
A 1 41  PRO 41  19  19  PRO PRO A . n 
A 1 42  LYS 42  20  20  LYS LYS A . n 
A 1 43  ARG 43  21  21  ARG ARG A . n 
A 1 44  SER 44  22  22  SER SER A . n 
A 1 45  SER 45  23  23  SER SER A . n 
A 1 46  LEU 46  24  24  LEU LEU A . n 
A 1 47  LYS 47  25  25  LYS LYS A . n 
A 1 48  SER 48  26  26  SER SER A . n 
A 1 49  ARG 49  27  27  ARG ARG A . n 
A 1 50  ALA 50  28  28  ALA ALA A . n 
A 1 51  GLU 51  29  29  GLU GLU A . n 
A 1 52  VAL 52  30  30  VAL VAL A . n 
A 1 53  ASP 53  31  31  ASP ASP A . n 
A 1 54  LEU 54  32  32  LEU LEU A . n 
A 1 55  GLU 55  33  33  GLU GLU A . n 
A 1 56  ARG 56  34  34  ARG ARG A . n 
A 1 57  THR 57  35  35  THR THR A . n 
A 1 58  PHE 58  36  36  PHE PHE A . n 
A 1 59  THR 59  37  37  THR THR A . n 
A 1 60  PHE 60  38  38  PHE PHE A . n 
A 1 61  ARG 61  39  39  ARG ARG A . n 
A 1 62  ASN 62  40  40  ASN ASN A . n 
A 1 63  SER 63  41  41  SER SER A . n 
A 1 64  LYS 64  42  42  LYS LYS A . n 
A 1 65  GLN 65  43  43  GLN GLN A . n 
A 1 66  THR 66  44  44  THR THR A . n 
A 1 67  TYR 67  45  45  TYR TYR A . n 
A 1 68  SER 68  46  46  SER SER A . n 
A 1 69  GLY 69  47  47  GLY GLY A . n 
A 1 70  ILE 70  48  48  ILE ILE A . n 
A 1 71  PRO 71  49  49  PRO PRO A . n 
A 1 72  ILE 72  50  50  ILE ILE A . n 
A 1 73  ILE 73  51  51  ILE ILE A . n 
A 1 74  VAL 74  52  52  VAL VAL A . n 
A 1 75  ALA 75  53  53  ALA ALA A . n 
A 1 76  ASN 76  54  54  ASN ASN A . n 
A 1 77  MET 77  55  55  MET MET A . n 
A 1 78  ASP 78  56  56  ASP ASP A . n 
A 1 79  THR 79  57  57  THR THR A . n 
A 1 80  VAL 80  58  58  VAL VAL A . n 
A 1 81  GLY 81  59  59  GLY GLY A . n 
A 1 82  THR 82  60  60  THR THR A . n 
A 1 83  PHE 83  61  61  PHE PHE A . n 
A 1 84  GLU 84  62  62  GLU GLU A . n 
A 1 85  MET 85  63  63  MET MET A . n 
A 1 86  ALA 86  64  64  ALA ALA A . n 
A 1 87  ALA 87  65  65  ALA ALA A . n 
A 1 88  VAL 88  66  66  VAL VAL A . n 
A 1 89  MET 89  67  67  MET MET A . n 
A 1 90  SER 90  68  68  SER SER A . n 
A 1 91  GLN 91  69  69  GLN GLN A . n 
A 1 92  HIS 92  70  70  HIS HIS A . n 
A 1 93  SER 93  71  71  SER SER A . n 
A 1 94  MET 94  72  72  MET MET A . n 
A 1 95  PHE 95  73  73  PHE PHE A . n 
A 1 96  THR 96  74  74  THR THR A . n 
A 1 97  ALA 97  75  75  ALA ALA A . n 
A 1 98  ILE 98  76  76  ILE ILE A . n 
A 1 99  HIS 99  77  77  HIS HIS A . n 
A 1 100 LYS 100 78  78  LYS LYS A . n 
A 1 101 HIS 101 79  79  HIS HIS A . n 
A 1 102 TYR 102 80  80  TYR TYR A . n 
A 1 103 SER 103 81  81  SER SER A . n 
A 1 104 LEU 104 82  82  LEU LEU A . n 
A 1 105 ASP 105 83  83  ASP ASP A . n 
A 1 106 ASP 106 84  84  ASP ASP A . n 
A 1 107 TRP 107 85  85  TRP TRP A . n 
A 1 108 LYS 108 86  86  LYS LYS A . n 
A 1 109 LEU 109 87  87  LEU LEU A . n 
A 1 110 PHE 110 88  88  PHE PHE A . n 
A 1 111 ALA 111 89  89  ALA ALA A . n 
A 1 112 THR 112 90  90  THR THR A . n 
A 1 113 ASN 113 91  91  ASN ASN A . n 
A 1 114 HIS 114 92  92  HIS HIS A . n 
A 1 115 PRO 115 93  93  PRO PRO A . n 
A 1 116 GLU 116 94  94  GLU GLU A . n 
A 1 117 CYS 117 95  95  CYS CYS A . n 
A 1 118 LEU 118 96  96  LEU LEU A . n 
A 1 119 GLN 119 97  97  GLN GLN A . n 
A 1 120 ASN 120 98  98  ASN ASN A . n 
A 1 121 VAL 121 99  99  VAL VAL A . n 
A 1 122 ALA 122 100 100 ALA ALA A . n 
A 1 123 VAL 123 101 101 VAL VAL A . n 
A 1 124 SER 124 102 102 SER SER A . n 
A 1 125 SER 125 103 103 SER SER A . n 
A 1 126 GLY 126 104 104 GLY GLY A . n 
A 1 127 SER 127 105 105 SER SER A . n 
A 1 128 GLY 128 106 106 GLY GLY A . n 
A 1 129 GLN 129 107 107 GLN GLN A . n 
A 1 130 ASN 130 108 108 ASN ASN A . n 
A 1 131 ASP 131 109 109 ASP ASP A . n 
A 1 132 LEU 132 110 110 LEU LEU A . n 
A 1 133 GLU 133 111 111 GLU GLU A . n 
A 1 134 LYS 134 112 112 LYS LYS A . n 
A 1 135 MET 135 113 113 MET MET A . n 
A 1 136 THR 136 114 114 THR THR A . n 
A 1 137 SER 137 115 115 SER SER A . n 
A 1 138 ILE 138 116 116 ILE ILE A . n 
A 1 139 LEU 139 117 117 LEU LEU A . n 
A 1 140 GLU 140 118 118 GLU GLU A . n 
A 1 141 ALA 141 119 119 ALA ALA A . n 
A 1 142 VAL 142 120 120 VAL VAL A . n 
A 1 143 PRO 143 121 121 PRO PRO A . n 
A 1 144 GLN 144 122 122 GLN GLN A . n 
A 1 145 VAL 145 123 123 VAL VAL A . n 
A 1 146 LYS 146 124 124 LYS LYS A . n 
A 1 147 PHE 147 125 125 PHE PHE A . n 
A 1 148 ILE 148 126 126 ILE ILE A . n 
A 1 149 CYS 149 127 127 CYS CYS A . n 
A 1 150 LEU 150 128 128 LEU LEU A . n 
A 1 151 ASP 151 129 129 ASP ASP A . n 
A 1 152 VAL 152 130 130 VAL VAL A . n 
A 1 153 ALA 153 131 131 ALA ALA A . n 
A 1 154 ASN 154 132 132 ASN ASN A . n 
A 1 155 GLY 155 133 133 GLY GLY A . n 
A 1 156 TYR 156 134 134 TYR TYR A . n 
A 1 157 SER 157 135 135 SER SER A . n 
A 1 158 GLU 158 136 136 GLU GLU A . n 
A 1 159 HIS 159 137 137 HIS HIS A . n 
A 1 160 PHE 160 138 138 PHE PHE A . n 
A 1 161 VAL 161 139 139 VAL VAL A . n 
A 1 162 GLU 162 140 140 GLU GLU A . n 
A 1 163 PHE 163 141 141 PHE PHE A . n 
A 1 164 VAL 164 142 142 VAL VAL A . n 
A 1 165 LYS 165 143 143 LYS LYS A . n 
A 1 166 LEU 166 144 144 LEU LEU A . n 
A 1 167 VAL 167 145 145 VAL VAL A . n 
A 1 168 ARG 168 146 146 ARG ARG A . n 
A 1 169 ALA 169 147 147 ALA ALA A . n 
A 1 170 LYS 170 148 148 LYS LYS A . n 
A 1 171 PHE 171 149 149 PHE PHE A . n 
A 1 172 PRO 172 150 150 PRO PRO A . n 
A 1 173 GLU 173 151 151 GLU GLU A . n 
A 1 174 HIS 174 152 152 HIS HIS A . n 
A 1 175 THR 175 153 153 THR THR A . n 
A 1 176 ILE 176 154 154 ILE ILE A . n 
A 1 177 MET 177 155 155 MET MET A . n 
A 1 178 ALA 178 156 156 ALA ALA A . n 
A 1 179 GLY 179 157 157 GLY GLY A . n 
A 1 180 ASN 180 158 158 ASN ASN A . n 
A 1 181 VAL 181 159 159 VAL VAL A . n 
A 1 182 VAL 182 160 160 VAL VAL A . n 
A 1 183 THR 183 161 161 THR THR A . n 
A 1 184 GLY 184 162 162 GLY GLY A . n 
A 1 185 GLU 185 163 163 GLU GLU A . n 
A 1 186 MET 186 164 164 MET MET A . n 
A 1 187 VAL 187 165 165 VAL VAL A . n 
A 1 188 GLU 188 166 166 GLU GLU A . n 
A 1 189 GLU 189 167 167 GLU GLU A . n 
A 1 190 LEU 190 168 168 LEU LEU A . n 
A 1 191 ILE 191 169 169 ILE ILE A . n 
A 1 192 LEU 192 170 170 LEU LEU A . n 
A 1 193 SER 193 171 171 SER SER A . n 
A 1 194 GLY 194 172 172 GLY GLY A . n 
A 1 195 ALA 195 173 173 ALA ALA A . n 
A 1 196 ASP 196 174 174 ASP ASP A . n 
A 1 197 ILE 197 175 175 ILE ILE A . n 
A 1 198 ILE 198 176 176 ILE ILE A . n 
A 1 199 LYS 199 177 177 LYS LYS A . n 
A 1 200 VAL 200 178 178 VAL VAL A . n 
A 1 201 GLY 201 179 179 GLY GLY A . n 
A 1 202 VAL 202 180 180 VAL VAL A . n 
A 1 203 GLY 203 181 181 GLY GLY A . n 
A 1 204 PRO 204 182 182 PRO PRO A . n 
A 1 205 GLY 205 183 183 GLY GLY A . n 
A 1 206 SER 206 184 184 SER SER A . n 
A 1 207 VAL 207 185 185 VAL VAL A . n 
A 1 208 CYS 208 186 186 CYS CYS A . n 
A 1 209 THR 209 187 187 THR THR A . n 
A 1 210 THR 210 188 188 THR THR A . n 
A 1 211 ARG 211 189 189 ARG ARG A . n 
A 1 212 THR 212 190 190 THR THR A . n 
A 1 213 LYS 213 191 191 LYS LYS A . n 
A 1 214 THR 214 192 192 THR THR A . n 
A 1 215 GLY 215 193 193 GLY GLY A . n 
A 1 216 VAL 216 194 194 VAL VAL A . n 
A 1 217 GLY 217 195 195 GLY GLY A . n 
A 1 218 TYR 218 196 196 TYR TYR A . n 
A 1 219 PRO 219 197 197 PRO PRO A . n 
A 1 220 GLN 220 198 198 GLN GLN A . n 
A 1 221 LEU 221 199 199 LEU LEU A . n 
A 1 222 SER 222 200 200 SER SER A . n 
A 1 223 ALA 223 201 201 ALA ALA A . n 
A 1 224 VAL 224 202 202 VAL VAL A . n 
A 1 225 ILE 225 203 203 ILE ILE A . n 
A 1 226 GLU 226 204 204 GLU GLU A . n 
A 1 227 CYS 227 205 205 CYS CYS A . n 
A 1 228 ALA 228 206 206 ALA ALA A . n 
A 1 229 ASP 229 207 207 ASP ASP A . n 
A 1 230 SER 230 208 208 SER SER A . n 
A 1 231 ALA 231 209 209 ALA ALA A . n 
A 1 232 HIS 232 210 210 HIS HIS A . n 
A 1 233 GLY 233 211 211 GLY GLY A . n 
A 1 234 LEU 234 212 212 LEU LEU A . n 
A 1 235 LYS 235 213 213 LYS LYS A . n 
A 1 236 GLY 236 214 214 GLY GLY A . n 
A 1 237 HIS 237 215 215 HIS HIS A . n 
A 1 238 ILE 238 216 216 ILE ILE A . n 
A 1 239 ILE 239 217 217 ILE ILE A . n 
A 1 240 SER 240 218 218 SER SER A . n 
A 1 241 ASP 241 219 219 ASP ASP A . n 
A 1 242 GLY 242 220 220 GLY GLY A . n 
A 1 243 GLY 243 221 221 GLY GLY A . n 
A 1 244 CYS 244 222 222 CYS CYS A . n 
A 1 245 THR 245 223 223 THR THR A . n 
A 1 246 CYS 246 224 224 CYS CYS A . n 
A 1 247 PRO 247 225 225 PRO PRO A . n 
A 1 248 GLY 248 226 226 GLY GLY A . n 
A 1 249 ASP 249 227 227 ASP ASP A . n 
A 1 250 VAL 250 228 228 VAL VAL A . n 
A 1 251 ALA 251 229 229 ALA ALA A . n 
A 1 252 LYS 252 230 230 LYS LYS A . n 
A 1 253 ALA 253 231 231 ALA ALA A . n 
A 1 254 PHE 254 232 232 PHE PHE A . n 
A 1 255 GLY 255 233 233 GLY GLY A . n 
A 1 256 ALA 256 234 234 ALA ALA A . n 
A 1 257 GLY 257 235 235 GLY GLY A . n 
A 1 258 ALA 258 236 236 ALA ALA A . n 
A 1 259 ASP 259 237 237 ASP ASP A . n 
A 1 260 PHE 260 238 238 PHE PHE A . n 
A 1 261 VAL 261 239 239 VAL VAL A . n 
A 1 262 MET 262 240 240 MET MET A . n 
A 1 263 LEU 263 241 241 LEU LEU A . n 
A 1 264 GLY 264 242 242 GLY GLY A . n 
A 1 265 GLY 265 243 243 GLY GLY A . n 
A 1 266 MET 266 244 244 MET MET A . n 
A 1 267 PHE 267 245 245 PHE PHE A . n 
A 1 268 SER 268 246 246 SER SER A . n 
A 1 269 GLY 269 247 247 GLY GLY A . n 
A 1 270 HIS 270 248 248 HIS HIS A . n 
A 1 271 THR 271 249 249 THR THR A . n 
A 1 272 GLU 272 250 250 GLU GLU A . n 
A 1 273 CYS 273 251 251 CYS CYS A . n 
A 1 274 ALA 274 252 252 ALA ALA A . n 
A 1 275 GLY 275 253 253 GLY GLY A . n 
A 1 276 GLU 276 254 254 GLU GLU A . n 
A 1 277 VAL 277 255 255 VAL VAL A . n 
A 1 278 ILE 278 256 256 ILE ILE A . n 
A 1 279 GLU 279 257 257 GLU GLU A . n 
A 1 280 ARG 280 258 258 ARG ARG A . n 
A 1 281 ASN 281 259 259 ASN ASN A . n 
A 1 282 GLY 282 260 260 GLY GLY A . n 
A 1 283 ARG 283 261 261 ARG ARG A . n 
A 1 284 LYS 284 262 262 LYS LYS A . n 
A 1 285 LEU 285 263 263 LEU LEU A . n 
A 1 286 LYS 286 264 264 LYS LYS A . n 
A 1 287 LEU 287 265 265 LEU LEU A . n 
A 1 288 PHE 288 266 266 PHE PHE A . n 
A 1 289 TYR 289 267 267 TYR TYR A . n 
A 1 290 GLY 290 268 268 GLY GLY A . n 
A 1 291 MET 291 269 269 MET MET A . n 
A 1 292 SER 292 270 270 SER SER A . n 
A 1 293 SER 293 271 271 SER SER A . n 
A 1 294 ASP 294 272 272 ASP ASP A . n 
A 1 295 THR 295 273 273 THR THR A . n 
A 1 296 ALA 296 274 274 ALA ALA A . n 
A 1 297 MET 297 275 275 MET MET A . n 
A 1 298 ASN 298 276 276 ASN ASN A . n 
A 1 299 LYS 299 277 277 LYS LYS A . n 
A 1 300 HIS 300 278 278 HIS HIS A . n 
A 1 301 ALA 301 279 ?   ?   ?   A . n 
A 1 302 GLY 302 280 ?   ?   ?   A . n 
A 1 303 GLY 303 281 281 GLY GLY A . n 
A 1 304 VAL 304 282 282 VAL VAL A . n 
A 1 305 ALA 305 283 283 ALA ALA A . n 
A 1 306 GLU 306 284 284 GLU GLU A . n 
A 1 307 TYR 307 285 285 TYR TYR A . n 
A 1 308 ARG 308 286 286 ARG ARG A . n 
A 1 309 ALA 309 287 287 ALA ALA A . n 
A 1 310 SER 310 288 288 SER SER A . n 
A 1 311 GLU 311 289 289 GLU GLU A . n 
A 1 312 GLY 312 290 290 GLY GLY A . n 
A 1 313 LYS 313 291 291 LYS LYS A . n 
A 1 314 THR 314 292 292 THR THR A . n 
A 1 315 VAL 315 293 293 VAL VAL A . n 
A 1 316 GLU 316 294 294 GLU GLU A . n 
A 1 317 VAL 317 295 295 VAL VAL A . n 
A 1 318 PRO 318 296 296 PRO PRO A . n 
A 1 319 TYR 319 297 297 TYR TYR A . n 
A 1 320 LYS 320 298 298 LYS LYS A . n 
A 1 321 GLY 321 299 299 GLY GLY A . n 
A 1 322 ASP 322 300 300 ASP ASP A . n 
A 1 323 VAL 323 301 301 VAL VAL A . n 
A 1 324 GLU 324 302 302 GLU GLU A . n 
A 1 325 ASN 325 303 303 ASN ASN A . n 
A 1 326 THR 326 304 304 THR THR A . n 
A 1 327 ILE 327 305 305 ILE ILE A . n 
A 1 328 LEU 328 306 306 LEU LEU A . n 
A 1 329 ASP 329 307 307 ASP ASP A . n 
A 1 330 ILE 330 308 308 ILE ILE A . n 
A 1 331 LEU 331 309 309 LEU LEU A . n 
A 1 332 GLY 332 310 310 GLY GLY A . n 
A 1 333 GLY 333 311 311 GLY GLY A . n 
A 1 334 LEU 334 312 312 LEU LEU A . n 
A 1 335 ARG 335 313 313 ARG ARG A . n 
A 1 336 SER 336 314 314 SER SER A . n 
A 1 337 THR 337 315 315 THR THR A . n 
A 1 338 CYS 338 316 316 CYS CYS A . n 
A 1 339 THR 339 317 317 THR THR A . n 
A 1 340 TYR 340 318 318 TYR TYR A . n 
A 1 341 VAL 341 319 319 VAL VAL A . n 
A 1 342 GLY 342 320 320 GLY GLY A . n 
A 1 343 ALA 343 321 321 ALA ALA A . n 
A 1 344 ALA 344 322 322 ALA ALA A . n 
A 1 345 LYS 345 323 323 LYS LYS A . n 
A 1 346 LEU 346 324 324 LEU LEU A . n 
A 1 347 LYS 347 325 325 LYS LYS A . n 
A 1 348 GLU 348 326 326 GLU GLU A . n 
A 1 349 LEU 349 327 327 LEU LEU A . n 
A 1 350 SER 350 328 328 SER SER A . n 
A 1 351 ARG 351 329 329 ARG ARG A . n 
A 1 352 ARG 352 330 330 ARG ARG A . n 
A 1 353 ALA 353 331 331 ALA ALA A . n 
A 1 354 THR 354 332 332 THR THR A . n 
A 1 355 PHE 355 333 333 PHE PHE A . n 
A 1 356 ILE 356 334 334 ILE ILE A . n 
A 1 357 ARG 357 335 335 ARG ARG A . n 
A 1 358 VAL 358 336 336 VAL VAL A . n 
A 1 359 THR 359 337 337 THR THR A . n 
A 1 360 GLN 360 338 338 GLN GLN A . n 
A 1 361 GLN 361 339 ?   ?   ?   A . n 
A 1 362 HIS 362 340 ?   ?   ?   A . n 
A 1 363 ASN 363 341 ?   ?   ?   A . n 
A 1 364 THR 364 342 ?   ?   ?   A . n 
A 1 365 VAL 365 343 ?   ?   ?   A . n 
A 1 366 PHE 366 344 ?   ?   ?   A . n 
A 1 367 SER 367 345 ?   ?   ?   A . n 
B 1 1   MET 1   -21 ?   ?   ?   B . n 
B 1 2   HIS 2   -20 ?   ?   ?   B . n 
B 1 3   HIS 3   -19 ?   ?   ?   B . n 
B 1 4   HIS 4   -18 ?   ?   ?   B . n 
B 1 5   HIS 5   -17 ?   ?   ?   B . n 
B 1 6   HIS 6   -16 ?   ?   ?   B . n 
B 1 7   HIS 7   -15 ?   ?   ?   B . n 
B 1 8   SER 8   -14 ?   ?   ?   B . n 
B 1 9   SER 9   -13 ?   ?   ?   B . n 
B 1 10  GLY 10  -12 ?   ?   ?   B . n 
B 1 11  VAL 11  -11 ?   ?   ?   B . n 
B 1 12  ASP 12  -10 ?   ?   ?   B . n 
B 1 13  LEU 13  -9  ?   ?   ?   B . n 
B 1 14  GLY 14  -8  ?   ?   ?   B . n 
B 1 15  THR 15  -7  ?   ?   ?   B . n 
B 1 16  GLU 16  -6  ?   ?   ?   B . n 
B 1 17  ASN 17  -5  ?   ?   ?   B . n 
B 1 18  LEU 18  -4  ?   ?   ?   B . n 
B 1 19  TYR 19  -3  ?   ?   ?   B . n 
B 1 20  PHE 20  -2  ?   ?   ?   B . n 
B 1 21  GLN 21  -1  ?   ?   ?   B . n 
B 1 22  SER 22  0   ?   ?   ?   B . n 
B 1 23  MET 23  1   ?   ?   ?   B . n 
B 1 24  PRO 24  2   2   PRO PRO B . n 
B 1 25  ARG 25  3   3   ARG ARG B . n 
B 1 26  ILE 26  4   4   ILE ILE B . n 
B 1 27  ASP 27  5   5   ASP ASP B . n 
B 1 28  ALA 28  6   6   ALA ALA B . n 
B 1 29  ASP 29  7   7   ASP ASP B . n 
B 1 30  LEU 30  8   8   LEU LEU B . n 
B 1 31  LYS 31  9   9   LYS LYS B . n 
B 1 32  LEU 32  10  10  LEU LEU B . n 
B 1 33  ASP 33  11  11  ASP ASP B . n 
B 1 34  PHE 34  12  12  PHE PHE B . n 
B 1 35  LYS 35  13  13  LYS LYS B . n 
B 1 36  ASP 36  14  14  ASP ASP B . n 
B 1 37  VAL 37  15  15  VAL VAL B . n 
B 1 38  LEU 38  16  16  LEU LEU B . n 
B 1 39  LEU 39  17  17  LEU LEU B . n 
B 1 40  ARG 40  18  18  ARG ARG B . n 
B 1 41  PRO 41  19  19  PRO PRO B . n 
B 1 42  LYS 42  20  20  LYS LYS B . n 
B 1 43  ARG 43  21  21  ARG ARG B . n 
B 1 44  SER 44  22  22  SER SER B . n 
B 1 45  SER 45  23  23  SER SER B . n 
B 1 46  LEU 46  24  24  LEU LEU B . n 
B 1 47  LYS 47  25  25  LYS LYS B . n 
B 1 48  SER 48  26  26  SER SER B . n 
B 1 49  ARG 49  27  27  ARG ARG B . n 
B 1 50  ALA 50  28  28  ALA ALA B . n 
B 1 51  GLU 51  29  29  GLU GLU B . n 
B 1 52  VAL 52  30  30  VAL VAL B . n 
B 1 53  ASP 53  31  31  ASP ASP B . n 
B 1 54  LEU 54  32  32  LEU LEU B . n 
B 1 55  GLU 55  33  33  GLU GLU B . n 
B 1 56  ARG 56  34  34  ARG ARG B . n 
B 1 57  THR 57  35  35  THR THR B . n 
B 1 58  PHE 58  36  36  PHE PHE B . n 
B 1 59  THR 59  37  37  THR THR B . n 
B 1 60  PHE 60  38  38  PHE PHE B . n 
B 1 61  ARG 61  39  39  ARG ARG B . n 
B 1 62  ASN 62  40  40  ASN ASN B . n 
B 1 63  SER 63  41  41  SER SER B . n 
B 1 64  LYS 64  42  42  LYS LYS B . n 
B 1 65  GLN 65  43  43  GLN GLN B . n 
B 1 66  THR 66  44  44  THR THR B . n 
B 1 67  TYR 67  45  45  TYR TYR B . n 
B 1 68  SER 68  46  46  SER SER B . n 
B 1 69  GLY 69  47  47  GLY GLY B . n 
B 1 70  ILE 70  48  48  ILE ILE B . n 
B 1 71  PRO 71  49  49  PRO PRO B . n 
B 1 72  ILE 72  50  50  ILE ILE B . n 
B 1 73  ILE 73  51  51  ILE ILE B . n 
B 1 74  VAL 74  52  52  VAL VAL B . n 
B 1 75  ALA 75  53  53  ALA ALA B . n 
B 1 76  ASN 76  54  54  ASN ASN B . n 
B 1 77  MET 77  55  55  MET MET B . n 
B 1 78  ASP 78  56  56  ASP ASP B . n 
B 1 79  THR 79  57  57  THR THR B . n 
B 1 80  VAL 80  58  58  VAL VAL B . n 
B 1 81  GLY 81  59  59  GLY GLY B . n 
B 1 82  THR 82  60  60  THR THR B . n 
B 1 83  PHE 83  61  61  PHE PHE B . n 
B 1 84  GLU 84  62  62  GLU GLU B . n 
B 1 85  MET 85  63  63  MET MET B . n 
B 1 86  ALA 86  64  64  ALA ALA B . n 
B 1 87  ALA 87  65  65  ALA ALA B . n 
B 1 88  VAL 88  66  66  VAL VAL B . n 
B 1 89  MET 89  67  67  MET MET B . n 
B 1 90  SER 90  68  68  SER SER B . n 
B 1 91  GLN 91  69  69  GLN GLN B . n 
B 1 92  HIS 92  70  70  HIS HIS B . n 
B 1 93  SER 93  71  71  SER SER B . n 
B 1 94  MET 94  72  72  MET MET B . n 
B 1 95  PHE 95  73  73  PHE PHE B . n 
B 1 96  THR 96  74  74  THR THR B . n 
B 1 97  ALA 97  75  75  ALA ALA B . n 
B 1 98  ILE 98  76  76  ILE ILE B . n 
B 1 99  HIS 99  77  77  HIS HIS B . n