data_2BYE
# 
_entry.id   2BYE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2BYE         
PDBE  EBI-25136    
WWPDB D_1290025136 
BMRB  6624         
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  2BYF unspecified 'NMR SOLUTION STRUCTURE OF PHOSPHOLIPASE C EPSILON RA 2 DOMAIN' 
BMRB 6624 unspecified .                                                               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2BYE 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-08-01 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_cs                  REL 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bunney, T.D.'       1  
'Harris, R.'         2  
'Gandarillas, N.L.'  3  
'Josephs, M.B.'      4  
'Roe, S.M.'          5  
'Paterson, H.F.'     6  
'Rodrigues-Lima, F.' 7  
'Esposito, D.'       8  
'Gieschik, P.'       9  
'Pearl, L.H.'        10 
'Driscoll, P.C.'     11 
'Katan, M.'          12 
# 
_citation.id                        primary 
_citation.title                     'Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            21 
_citation.page_first                495 
_citation.page_last                 ? 
_citation.year                      2006 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16483931 
_citation.pdbx_database_id_DOI      10.1016/J.MOLCEL.2006.01.008 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bunney, T.D.'       1  ? 
primary 'Harris, R.'         2  ? 
primary 'Gandarillas, N.L.'  3  ? 
primary 'Josephs, M.B.'      4  ? 
primary 'Roe, S.M.'          5  ? 
primary 'Sorli, S.C.'        6  ? 
primary 'Paterson, H.F.'     7  ? 
primary 'Rodrigues-Lima, F.' 8  ? 
primary 'Esposito, D.'       9  ? 
primary 'Ponting, C.P.'      10 ? 
primary 'Gierschik, P.'      11 ? 
primary 'Pearl, L.H.'        12 ? 
primary 'Driscoll, P.C.'     13 ? 
primary 'Katan, M.'          14 ? 
# 
_cell.entry_id           2BYE 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2BYE 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PHOSPHOLIPASE C, EPSILON 1' 
_entity.formula_weight             12804.598 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'RA1 DOMAIN, RESIDUES 2006-2114' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PHOSPHOLIPASE C EPSILON' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAI
GPEEEIMQILSSWFPEEGYMGRIVLKTQQE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAI
GPEEEIMQILSSWFPEEGYMGRIVLKTQQE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLU n 
1 3   GLU n 
1 4   ARG n 
1 5   LYS n 
1 6   CYS n 
1 7   LEU n 
1 8   GLN n 
1 9   THR n 
1 10  HIS n 
1 11  ARG n 
1 12  VAL n 
1 13  THR n 
1 14  VAL n 
1 15  HIS n 
1 16  GLY n 
1 17  VAL n 
1 18  PRO n 
1 19  GLY n 
1 20  PRO n 
1 21  GLU n 
1 22  PRO n 
1 23  PHE n 
1 24  THR n 
1 25  VAL n 
1 26  PHE n 
1 27  THR n 
1 28  ILE n 
1 29  ASN n 
1 30  GLY n 
1 31  GLY n 
1 32  THR n 
1 33  LYS n 
1 34  ALA n 
1 35  LYS n 
1 36  GLN n 
1 37  LEU n 
1 38  LEU n 
1 39  GLN n 
1 40  GLN n 
1 41  ILE n 
1 42  LEU n 
1 43  THR n 
1 44  ASN n 
1 45  GLU n 
1 46  GLN n 
1 47  ASP n 
1 48  ILE n 
1 49  LYS n 
1 50  PRO n 
1 51  VAL n 
1 52  THR n 
1 53  THR n 
1 54  ASP n 
1 55  TYR n 
1 56  PHE n 
1 57  LEU n 
1 58  MET n 
1 59  GLU n 
1 60  GLU n 
1 61  LYS n 
1 62  TYR n 
1 63  PHE n 
1 64  ILE n 
1 65  SER n 
1 66  LYS n 
1 67  GLU n 
1 68  LYS n 
1 69  ASN n 
1 70  GLU n 
1 71  CYS n 
1 72  ARG n 
1 73  LYS n 
1 74  GLN n 
1 75  PRO n 
1 76  PHE n 
1 77  GLN n 
1 78  ARG n 
1 79  ALA n 
1 80  ILE n 
1 81  GLY n 
1 82  PRO n 
1 83  GLU n 
1 84  GLU n 
1 85  GLU n 
1 86  ILE n 
1 87  MET n 
1 88  GLN n 
1 89  ILE n 
1 90  LEU n 
1 91  SER n 
1 92  SER n 
1 93  TRP n 
1 94  PHE n 
1 95  PRO n 
1 96  GLU n 
1 97  GLU n 
1 98  GLY n 
1 99  TYR n 
1 100 MET n 
1 101 GLY n 
1 102 ARG n 
1 103 ILE n 
1 104 VAL n 
1 105 LEU n 
1 106 LYS n 
1 107 THR n 
1 108 GLN n 
1 109 GLN n 
1 110 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              C41 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PTRIEX4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2BYE         1 ? ? 2BYE   ? 
2 UNP Q5VWL5_HUMAN 1 ? ? Q5VWL5 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2BYE A 1 ? 1   ? 2BYE   1    ? 1    ? 1 1   
2 2 2BYE A 2 ? 110 ? Q5VWL5 2006 ? 2114 ? 2 110 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 C13-NOESY 1 
2 1 15N-NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298.0 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1.0 
_pdbx_nmr_exptl_sample_conditions.pH                     7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         275 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_sample_details.solution_id   1 
_pdbx_nmr_sample_details.contents      '90% WATER. 10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_pdbx_nmr_refine.entry_id           2BYE 
_pdbx_nmr_refine.method             'RESTRAINED SIMULATED ANNEALING, WATER REFINEMENT' 
_pdbx_nmr_refine.details            
;AB INITIO SIMULATED ANNEALING PROTOCOL WITH CARTESIAN MOLECULAR DYNAMICS AND TORSION ANGLE DYNAMICS SIMULATED ANNEALING. A FINAL STEP OF RESTRAINED MOLECULAR DYNAMICS WITH EXPLICIT INCLUSION OF SOLVENT.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2BYE 
_pdbx_nmr_details.text       'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C, 15N-LABELED PROTEIN.' 
# 
_pdbx_nmr_ensemble.entry_id                             2BYE 
_pdbx_nmr_ensemble.conformers_calculated_total_number   100 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         'LOWEST ENERGY STRUCTURE WITH NO RESTRAINT VIOLATIONS' 
# 
_pdbx_nmr_representative.entry_id             2BYE 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           Xplor-NIH ? 'C.D. SCHWIETERS, J.J. KUSZEWSKI, N. TJ' 1 
'structure solution' ANSIG     ? ?                                        2 
'structure solution' CNS       ? ?                                        3 
'structure solution' Xplor-NIH ? ?                                        4 
# 
_exptl.entry_id          2BYE 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2BYE 
_struct.title                     'NMR solution structure of phospholipase c epsilon RA 1 domain' 
_struct.pdbx_descriptor           'PHOSPHOLIPASE C, EPSILON 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2BYE 
_struct_keywords.pdbx_keywords   LIPASE 
_struct_keywords.text            'PHOSPHOLIPASE C EPSILON, RAS ASSOCIATION DOMAIN, UBIQUITIN SUPERFOLD, LIPASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 33 ? THR A 43 ? LYS A 33 THR A 43 1 ? 11 
HELX_P HELX_P2 2 GLU A 85 ? TRP A 93 ? GLU A 85 TRP A 93 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 11  ? VAL A 14  ? ARG A 11  VAL A 14  
AA 2 THR A 24  ? THR A 27  ? THR A 24  THR A 27  
AB 1 GLN A 77  ? ILE A 80  ? GLN A 77  ILE A 80  
AB 2 TYR A 55  ? GLU A 60  ? TYR A 55  GLU A 60  
AB 3 ILE A 103 ? THR A 107 ? ILE A 103 THR A 107 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 14 ? N VAL A 14 O THR A 24  ? O THR A 24  
AB 1 2 N ILE A 80 ? N ILE A 80 O LEU A 57  ? O LEU A 57  
AB 2 3 N MET A 58 ? N MET A 58 O VAL A 104 ? O VAL A 104 
# 
_database_PDB_matrix.entry_id          2BYE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2BYE 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -218.216 -12.820 105.769 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -217.990 -14.204 106.256 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -217.701 -14.256 107.742 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -217.374 -15.312 108.282 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -217.385 -12.225 105.974 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1   ? -218.379 -12.827 104.738 1.00 0.00 ? 1   GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1   ? -219.052 -12.403 106.239 1.00 0.00 ? 1   GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1   ? -218.870 -14.796 106.050 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1   ? -217.151 -14.628 105.723 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 10    N N    . GLU A 1 2   ? -217.836 -13.118 108.406 1.00 0.00 ? 2   GLU A N    1  
ATOM 11    C CA   . GLU A 1 2   ? -217.540 -13.010 109.828 1.00 0.00 ? 2   GLU A CA   1  
ATOM 12    C C    . GLU A 1 2   ? -218.827 -12.677 110.586 1.00 0.00 ? 2   GLU A C    1  
ATOM 13    O O    . GLU A 1 2   ? -218.809 -12.226 111.734 1.00 0.00 ? 2   GLU A O    1  
ATOM 14    C CB   . GLU A 1 2   ? -216.474 -11.927 110.032 1.00 0.00 ? 2   GLU A CB   1  
ATOM 15    C CG   . GLU A 1 2   ? -215.900 -11.852 111.435 1.00 0.00 ? 2   GLU A CG   1  
ATOM 16    C CD   . GLU A 1 2   ? -214.937 -10.697 111.593 1.00 0.00 ? 2   GLU A CD   1  
ATOM 17    O OE1  . GLU A 1 2   ? -215.390 -9.532  111.562 1.00 0.00 ? 2   GLU A OE1  1  
ATOM 18    O OE2  . GLU A 1 2   ? -213.720 -10.940 111.733 1.00 0.00 ? 2   GLU A OE2  1  
ATOM 19    H H    . GLU A 1 2   ? -218.154 -12.318 107.928 1.00 0.00 ? 2   GLU A H    1  
ATOM 20    H HA   . GLU A 1 2   ? -217.160 -13.961 110.170 1.00 0.00 ? 2   GLU A HA   1  
ATOM 21    H HB2  . GLU A 1 2   ? -215.658 -12.117 109.350 1.00 0.00 ? 2   GLU A HB2  1  
ATOM 22    H HB3  . GLU A 1 2   ? -216.907 -10.966 109.793 1.00 0.00 ? 2   GLU A HB3  1  
ATOM 23    H HG2  . GLU A 1 2   ? -216.710 -11.728 112.139 1.00 0.00 ? 2   GLU A HG2  1  
ATOM 24    H HG3  . GLU A 1 2   ? -215.376 -12.773 111.647 1.00 0.00 ? 2   GLU A HG3  1  
ATOM 25    N N    . GLU A 1 3   ? -219.950 -12.928 109.928 1.00 0.00 ? 3   GLU A N    1  
ATOM 26    C CA   . GLU A 1 3   ? -221.257 -12.602 110.477 1.00 0.00 ? 3   GLU A CA   1  
ATOM 27    C C    . GLU A 1 3   ? -221.706 -13.683 111.451 1.00 0.00 ? 3   GLU A C    1  
ATOM 28    O O    . GLU A 1 3   ? -222.009 -14.809 111.050 1.00 0.00 ? 3   GLU A O    1  
ATOM 29    C CB   . GLU A 1 3   ? -222.305 -12.447 109.363 1.00 0.00 ? 3   GLU A CB   1  
ATOM 30    C CG   . GLU A 1 3   ? -221.949 -11.427 108.287 1.00 0.00 ? 3   GLU A CG   1  
ATOM 31    C CD   . GLU A 1 3   ? -220.841 -11.901 107.368 1.00 0.00 ? 3   GLU A CD   1  
ATOM 32    O OE1  . GLU A 1 3   ? -221.064 -12.862 106.606 1.00 0.00 ? 3   GLU A OE1  1  
ATOM 33    O OE2  . GLU A 1 3   ? -219.732 -11.328 107.412 1.00 0.00 ? 3   GLU A OE2  1  
ATOM 34    H H    . GLU A 1 3   ? -219.898 -13.350 109.046 1.00 0.00 ? 3   GLU A H    1  
ATOM 35    H HA   . GLU A 1 3   ? -221.168 -11.668 111.010 1.00 0.00 ? 3   GLU A HA   1  
ATOM 36    H HB2  . GLU A 1 3   ? -222.441 -13.403 108.884 1.00 0.00 ? 3   GLU A HB2  1  
ATOM 37    H HB3  . GLU A 1 3   ? -223.240 -12.148 109.813 1.00 0.00 ? 3   GLU A HB3  1  
ATOM 38    H HG2  . GLU A 1 3   ? -222.829 -11.232 107.693 1.00 0.00 ? 3   GLU A HG2  1  
ATOM 39    H HG3  . GLU A 1 3   ? -221.633 -10.513 108.767 1.00 0.00 ? 3   GLU A HG3  1  
ATOM 40    N N    . ARG A 1 4   ? -221.732 -13.340 112.729 1.00 0.00 ? 4   ARG A N    1  
ATOM 41    C CA   . ARG A 1 4   ? -222.179 -14.266 113.758 1.00 0.00 ? 4   ARG A CA   1  
ATOM 42    C C    . ARG A 1 4   ? -223.694 -14.232 113.835 1.00 0.00 ? 4   ARG A C    1  
ATOM 43    O O    . ARG A 1 4   ? -224.344 -15.228 114.153 1.00 0.00 ? 4   ARG A O    1  
ATOM 44    C CB   . ARG A 1 4   ? -221.556 -13.908 115.107 1.00 0.00 ? 4   ARG A CB   1  
ATOM 45    C CG   . ARG A 1 4   ? -220.039 -13.826 115.053 1.00 0.00 ? 4   ARG A CG   1  
ATOM 46    C CD   . ARG A 1 4   ? -219.429 -15.120 114.533 1.00 0.00 ? 4   ARG A CD   1  
ATOM 47    N NE   . ARG A 1 4   ? -218.022 -14.959 114.168 1.00 0.00 ? 4   ARG A NE   1  
ATOM 48    C CZ   . ARG A 1 4   ? -217.325 -15.858 113.477 1.00 0.00 ? 4   ARG A CZ   1  
ATOM 49    N NH1  . ARG A 1 4   ? -217.886 -17.006 113.118 1.00 0.00 ? 4   ARG A NH1  1  
ATOM 50    N NH2  . ARG A 1 4   ? -216.061 -15.615 113.155 1.00 0.00 ? 4   ARG A NH2  1  
ATOM 51    H H    . ARG A 1 4   ? -221.453 -12.430 112.985 1.00 0.00 ? 4   ARG A H    1  
ATOM 52    H HA   . ARG A 1 4   ? -221.865 -15.259 113.473 1.00 0.00 ? 4   ARG A HA   1  
ATOM 53    H HB2  . ARG A 1 4   ? -221.940 -12.949 115.427 1.00 0.00 ? 4   ARG A HB2  1  
ATOM 54    H HB3  . ARG A 1 4   ? -221.832 -14.660 115.833 1.00 0.00 ? 4   ARG A HB3  1  
ATOM 55    H HG2  . ARG A 1 4   ? -219.755 -13.017 114.397 1.00 0.00 ? 4   ARG A HG2  1  
ATOM 56    H HG3  . ARG A 1 4   ? -219.663 -13.635 116.047 1.00 0.00 ? 4   ARG A HG3  1  
ATOM 57    H HD2  . ARG A 1 4   ? -219.506 -15.875 115.302 1.00 0.00 ? 4   ARG A HD2  1  
ATOM 58    H HD3  . ARG A 1 4   ? -219.983 -15.438 113.663 1.00 0.00 ? 4   ARG A HD3  1  
ATOM 59    H HE   . ARG A 1 4   ? -217.574 -14.118 114.442 1.00 0.00 ? 4   ARG A HE   1  
ATOM 60    H HH11 . ARG A 1 4   ? -218.836 -17.202 113.369 1.00 0.00 ? 4   ARG A HH11 1  
ATOM 61    H HH12 . ARG A 1 4   ? -217.359 -17.681 112.594 1.00 0.00 ? 4   ARG A HH12 1  
ATOM 62    H HH21 . ARG A 1 4   ? -215.622 -14.753 113.431 1.00 0.00 ? 4   ARG A HH21 1  
ATOM 63    H HH22 . ARG A 1 4   ? -215.535 -16.296 112.630 1.00 0.00 ? 4   ARG A HH22 1  
ATOM 64    N N    . LYS A 1 5   ? -224.243 -13.067 113.533 1.00 0.00 ? 5   LYS A N    1  
ATOM 65    C CA   . LYS A 1 5   ? -225.673 -12.912 113.356 1.00 0.00 ? 5   LYS A CA   1  
ATOM 66    C C    . LYS A 1 5   ? -225.917 -12.255 112.006 1.00 0.00 ? 5   LYS A C    1  
ATOM 67    O O    . LYS A 1 5   ? -225.891 -11.031 111.879 1.00 0.00 ? 5   LYS A O    1  
ATOM 68    C CB   . LYS A 1 5   ? -226.283 -12.072 114.485 1.00 0.00 ? 5   LYS A CB   1  
ATOM 69    C CG   . LYS A 1 5   ? -227.803 -12.142 114.543 1.00 0.00 ? 5   LYS A CG   1  
ATOM 70    C CD   . LYS A 1 5   ? -228.283 -13.535 114.927 1.00 0.00 ? 5   LYS A CD   1  
ATOM 71    C CE   . LYS A 1 5   ? -227.866 -13.898 116.345 1.00 0.00 ? 5   LYS A CE   1  
ATOM 72    N NZ   . LYS A 1 5   ? -228.146 -15.323 116.660 1.00 0.00 ? 5   LYS A NZ   1  
ATOM 73    H H    . LYS A 1 5   ? -223.663 -12.281 113.426 1.00 0.00 ? 5   LYS A H    1  
ATOM 74    H HA   . LYS A 1 5   ? -226.119 -13.896 113.355 1.00 0.00 ? 5   LYS A HA   1  
ATOM 75    H HB2  . LYS A 1 5   ? -225.892 -12.423 115.429 1.00 0.00 ? 5   LYS A HB2  1  
ATOM 76    H HB3  . LYS A 1 5   ? -225.997 -11.039 114.347 1.00 0.00 ? 5   LYS A HB3  1  
ATOM 77    H HG2  . LYS A 1 5   ? -228.158 -11.435 115.277 1.00 0.00 ? 5   LYS A HG2  1  
ATOM 78    H HG3  . LYS A 1 5   ? -228.203 -11.889 113.573 1.00 0.00 ? 5   LYS A HG3  1  
ATOM 79    H HD2  . LYS A 1 5   ? -229.360 -13.564 114.860 1.00 0.00 ? 5   LYS A HD2  1  
ATOM 80    H HD3  . LYS A 1 5   ? -227.857 -14.254 114.240 1.00 0.00 ? 5   LYS A HD3  1  
ATOM 81    H HE2  . LYS A 1 5   ? -226.807 -13.715 116.454 1.00 0.00 ? 5   LYS A HE2  1  
ATOM 82    H HE3  . LYS A 1 5   ? -228.410 -13.272 117.038 1.00 0.00 ? 5   LYS A HE3  1  
ATOM 83    H HZ1  . LYS A 1 5   ? -229.163 -15.528 116.543 1.00 0.00 ? 5   LYS A HZ1  1  
ATOM 84    H HZ2  . LYS A 1 5   ? -227.601 -15.945 116.022 1.00 0.00 ? 5   LYS A HZ2  1  
ATOM 85    H HZ3  . LYS A 1 5   ? -227.874 -15.533 117.644 1.00 0.00 ? 5   LYS A HZ3  1  
ATOM 86    N N    . CYS A 1 6   ? -226.115 -13.078 110.993 1.00 0.00 ? 6   CYS A N    1  
ATOM 87    C CA   . CYS A 1 6   ? -226.220 -12.594 109.626 1.00 0.00 ? 6   CYS A CA   1  
ATOM 88    C C    . CYS A 1 6   ? -227.606 -12.030 109.350 1.00 0.00 ? 6   CYS A C    1  
ATOM 89    O O    . CYS A 1 6   ? -228.537 -12.229 110.133 1.00 0.00 ? 6   CYS A O    1  
ATOM 90    C CB   . CYS A 1 6   ? -225.908 -13.729 108.648 1.00 0.00 ? 6   CYS A CB   1  
ATOM 91    S SG   . CYS A 1 6   ? -226.885 -15.226 108.926 1.00 0.00 ? 6   CYS A SG   1  
ATOM 92    H H    . CYS A 1 6   ? -226.214 -14.039 111.170 1.00 0.00 ? 6   CYS A H    1  
ATOM 93    H HA   . CYS A 1 6   ? -225.492 -11.807 109.496 1.00 0.00 ? 6   CYS A HA   1  
ATOM 94    H HB2  . CYS A 1 6   ? -226.106 -13.391 107.641 1.00 0.00 ? 6   CYS A HB2  1  
ATOM 95    H HB3  . CYS A 1 6   ? -224.865 -13.996 108.736 1.00 0.00 ? 6   CYS A HB3  1  
ATOM 96    H HG   . CYS A 1 6   ? -227.557 -15.066 110.063 1.00 0.00 ? 6   CYS A HG   1  
ATOM 97    N N    . LEU A 1 7   ? -227.735 -11.305 108.247 1.00 0.00 ? 7   LEU A N    1  
ATOM 98    C CA   . LEU A 1 7   ? -229.033 -10.819 107.810 1.00 0.00 ? 7   LEU A CA   1  
ATOM 99    C C    . LEU A 1 7   ? -229.827 -11.982 107.234 1.00 0.00 ? 7   LEU A C    1  
ATOM 100   O O    . LEU A 1 7   ? -229.633 -12.365 106.078 1.00 0.00 ? 7   LEU A O    1  
ATOM 101   C CB   . LEU A 1 7   ? -228.898 -9.700  106.761 1.00 0.00 ? 7   LEU A CB   1  
ATOM 102   C CG   . LEU A 1 7   ? -228.283 -8.380  107.249 1.00 0.00 ? 7   LEU A CG   1  
ATOM 103   C CD1  . LEU A 1 7   ? -228.940 -7.924  108.543 1.00 0.00 ? 7   LEU A CD1  1  
ATOM 104   C CD2  . LEU A 1 7   ? -226.776 -8.506  107.419 1.00 0.00 ? 7   LEU A CD2  1  
ATOM 105   H H    . LEU A 1 7   ? -226.939 -11.092 107.717 1.00 0.00 ? 7   LEU A H    1  
ATOM 106   H HA   . LEU A 1 7   ? -229.554 -10.435 108.676 1.00 0.00 ? 7   LEU A HA   1  
ATOM 107   H HB2  . LEU A 1 7   ? -228.287 -10.074 105.952 1.00 0.00 ? 7   LEU A HB2  1  
ATOM 108   H HB3  . LEU A 1 7   ? -229.881 -9.488  106.370 1.00 0.00 ? 7   LEU A HB3  1  
ATOM 109   H HG   . LEU A 1 7   ? -228.468 -7.617  106.506 1.00 0.00 ? 7   LEU A HG   1  
ATOM 110   H HD11 . LEU A 1 7   ? -228.817 -8.688  109.295 1.00 0.00 ? 7   LEU A HD11 1  
ATOM 111   H HD12 . LEU A 1 7   ? -228.476 -7.008  108.880 1.00 0.00 ? 7   LEU A HD12 1  
ATOM 112   H HD13 . LEU A 1 7   ? -229.993 -7.753  108.372 1.00 0.00 ? 7   LEU A HD13 1  
ATOM 113   H HD21 . LEU A 1 7   ? -226.559 -9.303  108.115 1.00 0.00 ? 7   LEU A HD21 1  
ATOM 114   H HD22 . LEU A 1 7   ? -226.323 -8.730  106.464 1.00 0.00 ? 7   LEU A HD22 1  
ATOM 115   H HD23 . LEU A 1 7   ? -226.375 -7.578  107.799 1.00 0.00 ? 7   LEU A HD23 1  
ATOM 116   N N    . GLN A 1 8   ? -230.697 -12.557 108.054 1.00 0.00 ? 8   GLN A N    1  
ATOM 117   C CA   . GLN A 1 8   ? -231.426 -13.757 107.672 1.00 0.00 ? 8   GLN A CA   1  
ATOM 118   C C    . GLN A 1 8   ? -232.558 -13.422 106.711 1.00 0.00 ? 8   GLN A C    1  
ATOM 119   O O    . GLN A 1 8   ? -233.688 -13.154 107.117 1.00 0.00 ? 8   GLN A O    1  
ATOM 120   C CB   . GLN A 1 8   ? -231.959 -14.477 108.913 1.00 0.00 ? 8   GLN A CB   1  
ATOM 121   C CG   . GLN A 1 8   ? -230.887 -14.713 109.965 1.00 0.00 ? 8   GLN A CG   1  
ATOM 122   C CD   . GLN A 1 8   ? -231.376 -15.511 111.159 1.00 0.00 ? 8   GLN A CD   1  
ATOM 123   O OE1  . GLN A 1 8   ? -230.925 -15.296 112.284 1.00 0.00 ? 8   GLN A OE1  1  
ATOM 124   N NE2  . GLN A 1 8   ? -232.280 -16.449 110.926 1.00 0.00 ? 8   GLN A NE2  1  
ATOM 125   H H    . GLN A 1 8   ? -230.850 -12.167 108.942 1.00 0.00 ? 8   GLN A H    1  
ATOM 126   H HA   . GLN A 1 8   ? -230.733 -14.410 107.165 1.00 0.00 ? 8   GLN A HA   1  
ATOM 127   H HB2  . GLN A 1 8   ? -232.746 -13.883 109.354 1.00 0.00 ? 8   GLN A HB2  1  
ATOM 128   H HB3  . GLN A 1 8   ? -232.361 -15.434 108.617 1.00 0.00 ? 8   GLN A HB3  1  
ATOM 129   H HG2  . GLN A 1 8   ? -230.070 -15.252 109.509 1.00 0.00 ? 8   GLN A HG2  1  
ATOM 130   H HG3  . GLN A 1 8   ? -230.530 -13.755 110.313 1.00 0.00 ? 8   GLN A HG3  1  
ATOM 131   H HE21 . GLN A 1 8   ? -232.586 -16.577 110.006 1.00 0.00 ? 8   GLN A HE21 1  
ATOM 132   H HE22 . GLN A 1 8   ? -232.598 -16.986 111.685 1.00 0.00 ? 8   GLN A HE22 1  
ATOM 133   N N    . THR A 1 9   ? -232.232 -13.411 105.432 1.00 0.00 ? 9   THR A N    1  
ATOM 134   C CA   . THR A 1 9   ? -233.202 -13.116 104.398 1.00 0.00 ? 9   THR A CA   1  
ATOM 135   C C    . THR A 1 9   ? -233.875 -14.399 103.921 1.00 0.00 ? 9   THR A C    1  
ATOM 136   O O    . THR A 1 9   ? -233.288 -15.201 103.197 1.00 0.00 ? 9   THR A O    1  
ATOM 137   C CB   . THR A 1 9   ? -232.545 -12.385 103.208 1.00 0.00 ? 9   THR A CB   1  
ATOM 138   O OG1  . THR A 1 9   ? -231.453 -13.158 102.686 1.00 0.00 ? 9   THR A OG1  1  
ATOM 139   C CG2  . THR A 1 9   ? -232.033 -11.017 103.634 1.00 0.00 ? 9   THR A CG2  1  
ATOM 140   H H    . THR A 1 9   ? -231.306 -13.609 105.174 1.00 0.00 ? 9   THR A H    1  
ATOM 141   H HA   . THR A 1 9   ? -233.959 -12.462 104.821 1.00 0.00 ? 9   THR A HA   1  
ATOM 142   H HB   . THR A 1 9   ? -233.287 -12.248 102.437 1.00 0.00 ? 9   THR A HB   1  
ATOM 143   H HG1  . THR A 1 9   ? -231.774 -13.701 101.944 1.00 0.00 ? 9   THR A HG1  1  
ATOM 144   H HG21 . THR A 1 9   ? -231.321 -11.135 104.438 1.00 0.00 ? 9   THR A HG21 1  
ATOM 145   H HG22 . THR A 1 9   ? -231.554 -10.534 102.797 1.00 0.00 ? 9   THR A HG22 1  
ATOM 146   H HG23 . THR A 1 9   ? -232.861 -10.413 103.974 1.00 0.00 ? 9   THR A HG23 1  
ATOM 147   N N    . HIS A 1 10  ? -235.092 -14.614 104.381 1.00 0.00 ? 10  HIS A N    1  
ATOM 148   C CA   . HIS A 1 10  ? -235.879 -15.766 103.964 1.00 0.00 ? 10  HIS A CA   1  
ATOM 149   C C    . HIS A 1 10  ? -237.208 -15.314 103.415 1.00 0.00 ? 10  HIS A C    1  
ATOM 150   O O    . HIS A 1 10  ? -237.830 -14.405 103.945 1.00 0.00 ? 10  HIS A O    1  
ATOM 151   C CB   . HIS A 1 10  ? -236.132 -16.736 105.119 1.00 0.00 ? 10  HIS A CB   1  
ATOM 152   C CG   . HIS A 1 10  ? -234.917 -17.459 105.604 1.00 0.00 ? 10  HIS A CG   1  
ATOM 153   N ND1  . HIS A 1 10  ? -234.637 -18.764 105.264 1.00 0.00 ? 10  HIS A ND1  1  
ATOM 154   C CD2  . HIS A 1 10  ? -233.919 -17.065 106.428 1.00 0.00 ? 10  HIS A CD2  1  
ATOM 155   C CE1  . HIS A 1 10  ? -233.519 -19.142 105.854 1.00 0.00 ? 10  HIS A CE1  1  
ATOM 156   N NE2  . HIS A 1 10  ? -233.064 -18.129 106.568 1.00 0.00 ? 10  HIS A NE2  1  
ATOM 157   H H    . HIS A 1 10  ? -235.479 -13.974 105.009 1.00 0.00 ? 10  HIS A H    1  
ATOM 158   H HA   . HIS A 1 10  ? -235.340 -16.273 103.186 1.00 0.00 ? 10  HIS A HA   1  
ATOM 159   H HB2  . HIS A 1 10  ? -236.542 -16.187 105.944 1.00 0.00 ? 10  HIS A HB2  1  
ATOM 160   H HB3  . HIS A 1 10  ? -236.850 -17.478 104.800 1.00 0.00 ? 10  HIS A HB3  1  
ATOM 161   H HD1  . HIS A 1 10  ? -235.188 -19.334 104.671 1.00 0.00 ? 10  HIS A HD1  1  
ATOM 162   H HD2  . HIS A 1 10  ? -233.819 -16.093 106.891 1.00 0.00 ? 10  HIS A HD2  1  
ATOM 163   H HE1  . HIS A 1 10  ? -233.056 -20.115 105.766 1.00 0.00 ? 10  HIS A HE1  1  
ATOM 164   H HE2  . HIS A 1 10  ? -232.172 -18.092 106.997 1.00 0.00 ? 10  HIS A HE2  1  
ATOM 165   N N    . ARG A 1 11  ? -237.633 -15.931 102.347 1.00 0.00 ? 11  ARG A N    1  
ATOM 166   C CA   . ARG A 1 11  ? -238.916 -15.651 101.798 1.00 0.00 ? 11  ARG A CA   1  
ATOM 167   C C    . ARG A 1 11  ? -239.943 -16.612 102.365 1.00 0.00 ? 11  ARG A C    1  
ATOM 168   O O    . ARG A 1 11  ? -239.728 -17.823 102.391 1.00 0.00 ? 11  ARG A O    1  
ATOM 169   C CB   . ARG A 1 11  ? -238.863 -15.719 100.292 1.00 0.00 ? 11  ARG A CB   1  
ATOM 170   C CG   . ARG A 1 11  ? -239.645 -14.585 99.711  1.00 0.00 ? 11  ARG A CG   1  
ATOM 171   C CD   . ARG A 1 11  ? -239.257 -14.277 98.287  1.00 0.00 ? 11  ARG A CD   1  
ATOM 172   N NE   . ARG A 1 11  ? -239.588 -15.363 97.366  1.00 0.00 ? 11  ARG A NE   1  
ATOM 173   C CZ   . ARG A 1 11  ? -240.356 -15.212 96.287  1.00 0.00 ? 11  ARG A CZ   1  
ATOM 174   N NH1  . ARG A 1 11  ? -240.900 -14.034 96.014  1.00 0.00 ? 11  ARG A NH1  1  
ATOM 175   N NH2  . ARG A 1 11  ? -240.592 -16.237 95.481  1.00 0.00 ? 11  ARG A NH2  1  
ATOM 176   H H    . ARG A 1 11  ? -237.065 -16.581 101.905 1.00 0.00 ? 11  ARG A H    1  
ATOM 177   H HA   . ARG A 1 11  ? -239.185 -14.643 102.080 1.00 0.00 ? 11  ARG A HA   1  
ATOM 178   H HB2  . ARG A 1 11  ? -237.836 -15.649 99.963  1.00 0.00 ? 11  ARG A HB2  1  
ATOM 179   H HB3  . ARG A 1 11  ? -239.294 -16.649 99.954  1.00 0.00 ? 11  ARG A HB3  1  
ATOM 180   H HG2  . ARG A 1 11  ? -240.690 -14.832 99.752  1.00 0.00 ? 11  ARG A HG2  1  
ATOM 181   H HG3  . ARG A 1 11  ? -239.468 -13.714 100.329 1.00 0.00 ? 11  ARG A HG3  1  
ATOM 182   H HD2  . ARG A 1 11  ? -239.773 -13.383 97.979  1.00 0.00 ? 11  ARG A HD2  1  
ATOM 183   H HD3  . ARG A 1 11  ? -238.193 -14.104 98.263  1.00 0.00 ? 11  ARG A HD3  1  
ATOM 184   H HE   . ARG A 1 11  ? -239.200 -16.247 97.555  1.00 0.00 ? 11  ARG A HE   1  
ATOM 185   H HH11 . ARG A 1 11  ? -240.737 -13.248 96.619  1.00 0.00 ? 11  ARG A HH11 1  
ATOM 186   H HH12 . ARG A 1 11  ? -241.476 -13.923 95.202  1.00 0.00 ? 11  ARG A HH12 1  
ATOM 187   H HH21 . ARG A 1 11  ? -240.193 -17.142 95.671  1.00 0.00 ? 11  ARG A HH21 1  
ATOM 188   H HH22 . ARG A 1 11  ? -241.177 -16.112 94.668  1.00 0.00 ? 11  ARG A HH22 1  
ATOM 189   N N    . VAL A 1 12  ? -241.053 -16.068 102.818 1.00 0.00 ? 12  VAL A N    1  
ATOM 190   C CA   . VAL A 1 12  ? -242.078 -16.855 103.471 1.00 0.00 ? 12  VAL A CA   1  
ATOM 191   C C    . VAL A 1 12  ? -243.346 -16.832 102.626 1.00 0.00 ? 12  VAL A C    1  
ATOM 192   O O    . VAL A 1 12  ? -243.882 -15.763 102.314 1.00 0.00 ? 12  VAL A O    1  
ATOM 193   C CB   . VAL A 1 12  ? -242.342 -16.333 104.904 1.00 0.00 ? 12  VAL A CB   1  
ATOM 194   C CG1  . VAL A 1 12  ? -242.484 -14.817 104.908 1.00 0.00 ? 12  VAL A CG1  1  
ATOM 195   C CG2  . VAL A 1 12  ? -243.571 -16.996 105.510 1.00 0.00 ? 12  VAL A CG2  1  
ATOM 196   H H    . VAL A 1 12  ? -241.209 -15.105 102.682 1.00 0.00 ? 12  VAL A H    1  
ATOM 197   H HA   . VAL A 1 12  ? -241.724 -17.877 103.540 1.00 0.00 ? 12  VAL A HA   1  
ATOM 198   H HB   . VAL A 1 12  ? -241.485 -16.589 105.518 1.00 0.00 ? 12  VAL A HB   1  
ATOM 199   H HG11 . VAL A 1 12  ? -243.290 -14.529 104.250 1.00 0.00 ? 12  VAL A HG11 1  
ATOM 200   H HG12 . VAL A 1 12  ? -242.697 -14.476 105.910 1.00 0.00 ? 12  VAL A HG12 1  
ATOM 201   H HG13 . VAL A 1 12  ? -241.560 -14.370 104.563 1.00 0.00 ? 12  VAL A HG13 1  
ATOM 202   H HG21 . VAL A 1 12  ? -244.433 -16.785 104.895 1.00 0.00 ? 12  VAL A HG21 1  
ATOM 203   H HG22 . VAL A 1 12  ? -243.415 -18.064 105.558 1.00 0.00 ? 12  VAL A HG22 1  
ATOM 204   H HG23 . VAL A 1 12  ? -243.734 -16.611 106.505 1.00 0.00 ? 12  VAL A HG23 1  
ATOM 205   N N    . THR A 1 13  ? -243.782 -18.010 102.194 1.00 0.00 ? 13  THR A N    1  
ATOM 206   C CA   . THR A 1 13  ? -244.911 -18.110 101.285 1.00 0.00 ? 13  THR A CA   1  
ATOM 207   C C    . THR A 1 13  ? -246.215 -17.868 102.050 1.00 0.00 ? 13  THR A C    1  
ATOM 208   O O    . THR A 1 13  ? -246.573 -18.646 102.938 1.00 0.00 ? 13  THR A O    1  
ATOM 209   C CB   . THR A 1 13  ? -244.989 -19.502 100.628 1.00 0.00 ? 13  THR A CB   1  
ATOM 210   O OG1  . THR A 1 13  ? -243.713 -19.861 100.080 1.00 0.00 ? 13  THR A OG1  1  
ATOM 211   C CG2  . THR A 1 13  ? -246.053 -19.519 99.532  1.00 0.00 ? 13  THR A CG2  1  
ATOM 212   H H    . THR A 1 13  ? -243.343 -18.827 102.506 1.00 0.00 ? 13  THR A H    1  
ATOM 213   H HA   . THR A 1 13  ? -244.774 -17.357 100.493 1.00 0.00 ? 13  THR A HA   1  
ATOM 214   H HB   . THR A 1 13  ? -245.262 -20.225 101.383 1.00 0.00 ? 13  THR A HB   1  
ATOM 215   H HG1  . THR A 1 13  ? -243.041 -19.249 100.401 1.00 0.00 ? 13  THR A HG1  1  
ATOM 216   H HG21 . THR A 1 13  ? -245.859 -18.717 98.835  1.00 0.00 ? 13  THR A HG21 1  
ATOM 217   H HG22 . THR A 1 13  ? -246.023 -20.464 99.010  1.00 0.00 ? 13  THR A HG22 1  
ATOM 218   H HG23 . THR A 1 13  ? -247.033 -19.383 99.973  1.00 0.00 ? 13  THR A HG23 1  
ATOM 219   N N    . VAL A 1 14  ? -246.915 -16.807 101.710 1.00 0.00 ? 14  VAL A N    1  
ATOM 220   C CA   . VAL A 1 14  ? -248.133 -16.440 102.405 1.00 0.00 ? 14  VAL A CA   1  
ATOM 221   C C    . VAL A 1 14  ? -249.362 -16.757 101.551 1.00 0.00 ? 14  VAL A C    1  
ATOM 222   O O    . VAL A 1 14  ? -249.369 -16.529 100.342 1.00 0.00 ? 14  VAL A O    1  
ATOM 223   C CB   . VAL A 1 14  ? -248.075 -14.948 102.804 1.00 0.00 ? 14  VAL A CB   1  
ATOM 224   C CG1  . VAL A 1 14  ? -249.435 -14.388 103.188 1.00 0.00 ? 14  VAL A CG1  1  
ATOM 225   C CG2  . VAL A 1 14  ? -247.090 -14.769 103.946 1.00 0.00 ? 14  VAL A CG2  1  
ATOM 226   H H    . VAL A 1 14  ? -246.605 -16.245 100.964 1.00 0.00 ? 14  VAL A H    1  
ATOM 227   H HA   . VAL A 1 14  ? -248.183 -17.027 103.311 1.00 0.00 ? 14  VAL A HA   1  
ATOM 228   H HB   . VAL A 1 14  ? -247.709 -14.385 101.959 1.00 0.00 ? 14  VAL A HB   1  
ATOM 229   H HG11 . VAL A 1 14  ? -249.951 -15.087 103.827 1.00 0.00 ? 14  VAL A HG11 1  
ATOM 230   H HG12 . VAL A 1 14  ? -249.298 -13.450 103.705 1.00 0.00 ? 14  VAL A HG12 1  
ATOM 231   H HG13 . VAL A 1 14  ? -250.015 -14.215 102.286 1.00 0.00 ? 14  VAL A HG13 1  
ATOM 232   H HG21 . VAL A 1 14  ? -246.114 -15.114 103.636 1.00 0.00 ? 14  VAL A HG21 1  
ATOM 233   H HG22 . VAL A 1 14  ? -247.033 -13.724 104.212 1.00 0.00 ? 14  VAL A HG22 1  
ATOM 234   H HG23 . VAL A 1 14  ? -247.420 -15.341 104.800 1.00 0.00 ? 14  VAL A HG23 1  
ATOM 235   N N    . HIS A 1 15  ? -250.379 -17.330 102.184 1.00 0.00 ? 15  HIS A N    1  
ATOM 236   C CA   . HIS A 1 15  ? -251.589 -17.756 101.484 1.00 0.00 ? 15  HIS A CA   1  
ATOM 237   C C    . HIS A 1 15  ? -252.714 -16.744 101.613 1.00 0.00 ? 15  HIS A C    1  
ATOM 238   O O    . HIS A 1 15  ? -253.721 -16.844 100.922 1.00 0.00 ? 15  HIS A O    1  
ATOM 239   C CB   . HIS A 1 15  ? -252.066 -19.102 102.027 1.00 0.00 ? 15  HIS A CB   1  
ATOM 240   C CG   . HIS A 1 15  ? -251.701 -20.250 101.143 1.00 0.00 ? 15  HIS A CG   1  
ATOM 241   N ND1  . HIS A 1 15  ? -252.215 -20.419 99.873  1.00 0.00 ? 15  HIS A ND1  1  
ATOM 242   C CD2  . HIS A 1 15  ? -250.843 -21.276 101.339 1.00 0.00 ? 15  HIS A CD2  1  
ATOM 243   C CE1  . HIS A 1 15  ? -251.685 -21.502 99.329  1.00 0.00 ? 15  HIS A CE1  1  
ATOM 244   N NE2  . HIS A 1 15  ? -250.851 -22.036 100.198 1.00 0.00 ? 15  HIS A NE2  1  
ATOM 245   H H    . HIS A 1 15  ? -250.308 -17.492 103.153 1.00 0.00 ? 15  HIS A H    1  
ATOM 246   H HA   . HIS A 1 15  ? -251.344 -17.872 100.438 1.00 0.00 ? 15  HIS A HA   1  
ATOM 247   H HB2  . HIS A 1 15  ? -251.605 -19.270 102.991 1.00 0.00 ? 15  HIS A HB2  1  
ATOM 248   H HB3  . HIS A 1 15  ? -253.142 -19.084 102.149 1.00 0.00 ? 15  HIS A HB3  1  
ATOM 249   H HD1  . HIS A 1 15  ? -252.868 -19.827 99.432  1.00 0.00 ? 15  HIS A HD1  1  
ATOM 250   H HD2  . HIS A 1 15  ? -250.258 -21.460 102.228 1.00 0.00 ? 15  HIS A HD2  1  
ATOM 251   H HE1  . HIS A 1 15  ? -251.879 -21.869 98.333  1.00 0.00 ? 15  HIS A HE1  1  
ATOM 252   H HE2  . HIS A 1 15  ? -250.329 -22.867 100.054 1.00 0.00 ? 15  HIS A HE2  1  
ATOM 253   N N    . GLY A 1 16  ? -252.548 -15.786 102.503 1.00 0.00 ? 16  GLY A N    1  
ATOM 254   C CA   . GLY A 1 16  ? -253.602 -14.801 102.720 1.00 0.00 ? 16  GLY A CA   1  
ATOM 255   C C    . GLY A 1 16  ? -253.214 -13.432 102.209 1.00 0.00 ? 16  GLY A C    1  
ATOM 256   O O    . GLY A 1 16  ? -253.644 -12.411 102.736 1.00 0.00 ? 16  GLY A O    1  
ATOM 257   H H    . GLY A 1 16  ? -251.699 -15.736 103.007 1.00 0.00 ? 16  GLY A H    1  
ATOM 258   H HA2  . GLY A 1 16  ? -254.497 -15.127 102.208 1.00 0.00 ? 16  GLY A HA2  1  
ATOM 259   H HA3  . GLY A 1 16  ? -253.809 -14.735 103.778 1.00 0.00 ? 16  GLY A HA3  1  
ATOM 260   N N    . VAL A 1 17  ? -252.389 -13.426 101.184 1.00 0.00 ? 17  VAL A N    1  
ATOM 261   C CA   . VAL A 1 17  ? -251.812 -12.205 100.654 1.00 0.00 ? 17  VAL A CA   1  
ATOM 262   C C    . VAL A 1 17  ? -252.859 -11.271 100.040 1.00 0.00 ? 17  VAL A C    1  
ATOM 263   O O    . VAL A 1 17  ? -253.939 -11.703 99.632  1.00 0.00 ? 17  VAL A O    1  
ATOM 264   C CB   . VAL A 1 17  ? -250.753 -12.531 99.587  1.00 0.00 ? 17  VAL A CB   1  
ATOM 265   C CG1  . VAL A 1 17  ? -249.760 -13.539 100.112 1.00 0.00 ? 17  VAL A CG1  1  
ATOM 266   C CG2  . VAL A 1 17  ? -251.397 -13.033 98.301  1.00 0.00 ? 17  VAL A CG2  1  
ATOM 267   H H    . VAL A 1 17  ? -252.158 -14.272 100.766 1.00 0.00 ? 17  VAL A H    1  
ATOM 268   H HA   . VAL A 1 17  ? -251.320 -11.692 101.467 1.00 0.00 ? 17  VAL A HA   1  
ATOM 269   H HB   . VAL A 1 17  ? -250.216 -11.633 99.374  1.00 0.00 ? 17  VAL A HB   1  
ATOM 270   H HG11 . VAL A 1 17  ? -250.279 -14.443 100.395 1.00 0.00 ? 17  VAL A HG11 1  
ATOM 271   H HG12 . VAL A 1 17  ? -249.037 -13.766 99.344  1.00 0.00 ? 17  VAL A HG12 1  
ATOM 272   H HG13 . VAL A 1 17  ? -249.253 -13.130 100.974 1.00 0.00 ? 17  VAL A HG13 1  
ATOM 273   H HG21 . VAL A 1 17  ? -252.058 -12.274 97.908  1.00 0.00 ? 17  VAL A HG21 1  
ATOM 274   H HG22 . VAL A 1 17  ? -250.629 -13.252 97.574  1.00 0.00 ? 17  VAL A HG22 1  
ATOM 275   H HG23 . VAL A 1 17  ? -251.963 -13.930 98.508  1.00 0.00 ? 17  VAL A HG23 1  
ATOM 276   N N    . PRO A 1 18  ? -252.536 -9.967  99.972  1.00 0.00 ? 18  PRO A N    1  
ATOM 277   C CA   . PRO A 1 18  ? -253.378 -8.964  99.307  1.00 0.00 ? 18  PRO A CA   1  
ATOM 278   C C    . PRO A 1 18  ? -253.164 -8.980  97.810  1.00 0.00 ? 18  PRO A C    1  
ATOM 279   O O    . PRO A 1 18  ? -253.964 -8.477  97.024  1.00 0.00 ? 18  PRO A O    1  
ATOM 280   C CB   . PRO A 1 18  ? -252.864 -7.661  99.905  1.00 0.00 ? 18  PRO A CB   1  
ATOM 281   C CG   . PRO A 1 18  ? -251.410 -7.930  100.084 1.00 0.00 ? 18  PRO A CG   1  
ATOM 282   C CD   . PRO A 1 18  ? -251.327 -9.354  100.558 1.00 0.00 ? 18  PRO A CD   1  
ATOM 283   H HA   . PRO A 1 18  ? -254.403 -9.102  99.524  1.00 0.00 ? 18  PRO A HA   1  
ATOM 284   H HB2  . PRO A 1 18  ? -253.044 -6.844  99.220  1.00 0.00 ? 18  PRO A HB2  1  
ATOM 285   H HB3  . PRO A 1 18  ? -253.351 -7.471  100.849 1.00 0.00 ? 18  PRO A HB3  1  
ATOM 286   H HG2  . PRO A 1 18  ? -250.897 -7.818  99.141  1.00 0.00 ? 18  PRO A HG2  1  
ATOM 287   H HG3  . PRO A 1 18  ? -250.997 -7.271  100.813 1.00 0.00 ? 18  PRO A HG3  1  
ATOM 288   H HD2  . PRO A 1 18  ? -250.432 -9.827  100.180 1.00 0.00 ? 18  PRO A HD2  1  
ATOM 289   H HD3  . PRO A 1 18  ? -251.355 -9.398  101.635 1.00 0.00 ? 18  PRO A HD3  1  
ATOM 290   N N    . GLY A 1 19  ? -252.039 -9.550  97.470  1.00 0.00 ? 19  GLY A N    1  
ATOM 291   C CA   . GLY A 1 19  ? -251.638 -9.744  96.087  1.00 0.00 ? 19  GLY A CA   1  
ATOM 292   C C    . GLY A 1 19  ? -252.651 -10.531 95.282  1.00 0.00 ? 19  GLY A C    1  
ATOM 293   O O    . GLY A 1 19  ? -253.482 -11.242 95.844  1.00 0.00 ? 19  GLY A O    1  
ATOM 294   H H    . GLY A 1 19  ? -251.459 -9.834  98.201  1.00 0.00 ? 19  GLY A H    1  
ATOM 295   H HA2  . GLY A 1 19  ? -251.499 -8.786  95.618  1.00 0.00 ? 19  GLY A HA2  1  
ATOM 296   H HA3  . GLY A 1 19  ? -250.698 -10.276 96.071  1.00 0.00 ? 19  GLY A HA3  1  
ATOM 297   N N    . PRO A 1 20  ? -252.588 -10.428 93.948  1.00 0.00 ? 20  PRO A N    1  
ATOM 298   C CA   . PRO A 1 20  ? -253.502 -11.134 93.050  1.00 0.00 ? 20  PRO A CA   1  
ATOM 299   C C    . PRO A 1 20  ? -253.262 -12.632 93.095  1.00 0.00 ? 20  PRO A C    1  
ATOM 300   O O    . PRO A 1 20  ? -254.174 -13.437 92.894  1.00 0.00 ? 20  PRO A O    1  
ATOM 301   C CB   . PRO A 1 20  ? -253.131 -10.581 91.674  1.00 0.00 ? 20  PRO A CB   1  
ATOM 302   C CG   . PRO A 1 20  ? -251.706 -10.203 91.821  1.00 0.00 ? 20  PRO A CG   1  
ATOM 303   C CD   . PRO A 1 20  ? -251.603 -9.635  93.201  1.00 0.00 ? 20  PRO A CD   1  
ATOM 304   H HA   . PRO A 1 20  ? -254.529 -10.915 93.273  1.00 0.00 ? 20  PRO A HA   1  
ATOM 305   H HB2  . PRO A 1 20  ? -253.262 -11.346 90.928  1.00 0.00 ? 20  PRO A HB2  1  
ATOM 306   H HB3  . PRO A 1 20  ? -253.746 -9.726  91.442  1.00 0.00 ? 20  PRO A HB3  1  
ATOM 307   H HG2  . PRO A 1 20  ? -251.079 -11.079 91.724  1.00 0.00 ? 20  PRO A HG2  1  
ATOM 308   H HG3  . PRO A 1 20  ? -251.436 -9.470  91.092  1.00 0.00 ? 20  PRO A HG3  1  
ATOM 309   H HD2  . PRO A 1 20  ? -250.617 -9.787  93.592  1.00 0.00 ? 20  PRO A HD2  1  
ATOM 310   H HD3  . PRO A 1 20  ? -251.864 -8.589  93.205  1.00 0.00 ? 20  PRO A HD3  1  
ATOM 311   N N    . GLU A 1 21  ? -252.011 -12.982 93.351  1.00 0.00 ? 21  GLU A N    1  
ATOM 312   C CA   . GLU A 1 21  ? -251.601 -14.373 93.470  1.00 0.00 ? 21  GLU A CA   1  
ATOM 313   C C    . GLU A 1 21  ? -252.341 -15.055 94.618  1.00 0.00 ? 21  GLU A C    1  
ATOM 314   O O    . GLU A 1 21  ? -252.723 -14.411 95.593  1.00 0.00 ? 21  GLU A O    1  
ATOM 315   C CB   . GLU A 1 21  ? -250.085 -14.447 93.688  1.00 0.00 ? 21  GLU A CB   1  
ATOM 316   C CG   . GLU A 1 21  ? -249.293 -13.586 92.711  1.00 0.00 ? 21  GLU A CG   1  
ATOM 317   C CD   . GLU A 1 21  ? -247.794 -13.631 92.948  1.00 0.00 ? 21  GLU A CD   1  
ATOM 318   O OE1  . GLU A 1 21  ? -247.136 -14.574 92.464  1.00 0.00 ? 21  GLU A OE1  1  
ATOM 319   O OE2  . GLU A 1 21  ? -247.264 -12.714 93.608  1.00 0.00 ? 21  GLU A OE2  1  
ATOM 320   H H    . GLU A 1 21  ? -251.338 -12.269 93.458  1.00 0.00 ? 21  GLU A H    1  
ATOM 321   H HA   . GLU A 1 21  ? -251.855 -14.882 92.549  1.00 0.00 ? 21  GLU A HA   1  
ATOM 322   H HB2  . GLU A 1 21  ? -249.859 -14.131 94.695  1.00 0.00 ? 21  GLU A HB2  1  
ATOM 323   H HB3  . GLU A 1 21  ? -249.771 -15.468 93.566  1.00 0.00 ? 21  GLU A HB3  1  
ATOM 324   H HG2  . GLU A 1 21  ? -249.491 -13.931 91.709  1.00 0.00 ? 21  GLU A HG2  1  
ATOM 325   H HG3  . GLU A 1 21  ? -249.624 -12.561 92.808  1.00 0.00 ? 21  GLU A HG3  1  
ATOM 326   N N    . PRO A 1 22  ? -252.542 -16.374 94.512  1.00 0.00 ? 22  PRO A N    1  
ATOM 327   C CA   . PRO A 1 22  ? -253.320 -17.158 95.483  1.00 0.00 ? 22  PRO A CA   1  
ATOM 328   C C    . PRO A 1 22  ? -252.478 -17.436 96.697  1.00 0.00 ? 22  PRO A C    1  
ATOM 329   O O    . PRO A 1 22  ? -252.951 -17.630 97.818  1.00 0.00 ? 22  PRO A O    1  
ATOM 330   C CB   . PRO A 1 22  ? -253.600 -18.465 94.737  1.00 0.00 ? 22  PRO A CB   1  
ATOM 331   C CG   . PRO A 1 22  ? -253.067 -18.257 93.359  1.00 0.00 ? 22  PRO A CG   1  
ATOM 332   C CD   . PRO A 1 22  ? -252.006 -17.228 93.455  1.00 0.00 ? 22  PRO A CD   1  
ATOM 333   H HA   . PRO A 1 22  ? -254.241 -16.674 95.759  1.00 0.00 ? 22  PRO A HA   1  
ATOM 334   H HB2  . PRO A 1 22  ? -253.096 -19.280 95.236  1.00 0.00 ? 22  PRO A HB2  1  
ATOM 335   H HB3  . PRO A 1 22  ? -254.663 -18.652 94.722  1.00 0.00 ? 22  PRO A HB3  1  
ATOM 336   H HG2  . PRO A 1 22  ? -252.670 -19.174 92.967  1.00 0.00 ? 22  PRO A HG2  1  
ATOM 337   H HG3  . PRO A 1 22  ? -253.837 -17.889 92.744  1.00 0.00 ? 22  PRO A HG3  1  
ATOM 338   H HD2  . PRO A 1 22  ? -251.063 -17.672 93.734  1.00 0.00 ? 22  PRO A HD2  1  
ATOM 339   H HD3  . PRO A 1 22  ? -251.914 -16.684 92.527  1.00 0.00 ? 22  PRO A HD3  1  
ATOM 340   N N    . PHE A 1 23  ? -251.215 -17.489 96.403  1.00 0.00 ? 23  PHE A N    1  
ATOM 341   C CA   . PHE A 1 23  ? -250.168 -17.606 97.391  1.00 0.00 ? 23  PHE A CA   1  
ATOM 342   C C    . PHE A 1 23  ? -248.925 -16.950 96.834  1.00 0.00 ? 23  PHE A C    1  
ATOM 343   O O    . PHE A 1 23  ? -248.541 -17.208 95.694  1.00 0.00 ? 23  PHE A O    1  
ATOM 344   C CB   . PHE A 1 23  ? -249.894 -19.076 97.751  1.00 0.00 ? 23  PHE A CB   1  
ATOM 345   C CG   . PHE A 1 23  ? -249.468 -19.944 96.596  1.00 0.00 ? 23  PHE A CG   1  
ATOM 346   C CD1  . PHE A 1 23  ? -250.403 -20.451 95.707  1.00 0.00 ? 23  PHE A CD1  1  
ATOM 347   C CD2  . PHE A 1 23  ? -248.131 -20.255 96.403  1.00 0.00 ? 23  PHE A CD2  1  
ATOM 348   C CE1  . PHE A 1 23  ? -250.013 -21.248 94.649  1.00 0.00 ? 23  PHE A CE1  1  
ATOM 349   C CE2  . PHE A 1 23  ? -247.735 -21.052 95.347  1.00 0.00 ? 23  PHE A CE2  1  
ATOM 350   C CZ   . PHE A 1 23  ? -248.677 -21.550 94.468  1.00 0.00 ? 23  PHE A CZ   1  
ATOM 351   H H    . PHE A 1 23  ? -250.978 -17.432 95.443  1.00 0.00 ? 23  PHE A H    1  
ATOM 352   H HA   . PHE A 1 23  ? -250.477 -17.073 98.283  1.00 0.00 ? 23  PHE A HA   1  
ATOM 353   H HB2  . PHE A 1 23  ? -249.108 -19.112 98.492  1.00 0.00 ? 23  PHE A HB2  1  
ATOM 354   H HB3  . PHE A 1 23  ? -250.791 -19.505 98.174  1.00 0.00 ? 23  PHE A HB3  1  
ATOM 355   H HD1  . PHE A 1 23  ? -251.449 -20.216 95.847  1.00 0.00 ? 23  PHE A HD1  1  
ATOM 356   H HD2  . PHE A 1 23  ? -247.393 -19.866 97.088  1.00 0.00 ? 23  PHE A HD2  1  
ATOM 357   H HE1  . PHE A 1 23  ? -250.750 -21.636 93.964  1.00 0.00 ? 23  PHE A HE1  1  
ATOM 358   H HE2  . PHE A 1 23  ? -246.690 -21.285 95.208  1.00 0.00 ? 23  PHE A HE2  1  
ATOM 359   H HZ   . PHE A 1 23  ? -248.370 -22.173 93.642  1.00 0.00 ? 23  PHE A HZ   1  
ATOM 360   N N    . THR A 1 24  ? -248.329 -16.073 97.606  1.00 0.00 ? 24  THR A N    1  
ATOM 361   C CA   . THR A 1 24  ? -247.118 -15.421 97.177  1.00 0.00 ? 24  THR A CA   1  
ATOM 362   C C    . THR A 1 24  ? -246.191 -15.233 98.361  1.00 0.00 ? 24  THR A C    1  
ATOM 363   O O    . THR A 1 24  ? -246.623 -15.178 99.511  1.00 0.00 ? 24  THR A O    1  
ATOM 364   C CB   . THR A 1 24  ? -247.393 -14.079 96.463  1.00 0.00 ? 24  THR A CB   1  
ATOM 365   O OG1  . THR A 1 24  ? -246.203 -13.604 95.831  1.00 0.00 ? 24  THR A OG1  1  
ATOM 366   C CG2  . THR A 1 24  ? -247.905 -13.019 97.418  1.00 0.00 ? 24  THR A CG2  1  
ATOM 367   H H    . THR A 1 24  ? -248.705 -15.865 98.488  1.00 0.00 ? 24  THR A H    1  
ATOM 368   H HA   . THR A 1 24  ? -246.632 -16.079 96.470  1.00 0.00 ? 24  THR A HA   1  
ATOM 369   H HB   . THR A 1 24  ? -248.144 -14.245 95.705  1.00 0.00 ? 24  THR A HB   1  
ATOM 370   H HG1  . THR A 1 24  ? -246.413 -13.368 94.910  1.00 0.00 ? 24  THR A HG1  1  
ATOM 371   H HG21 . THR A 1 24  ? -248.816 -13.364 97.883  1.00 0.00 ? 24  THR A HG21 1  
ATOM 372   H HG22 . THR A 1 24  ? -247.162 -12.829 98.180  1.00 0.00 ? 24  THR A HG22 1  
ATOM 373   H HG23 . THR A 1 24  ? -248.101 -12.108 96.873  1.00 0.00 ? 24  THR A HG23 1  
ATOM 374   N N    . VAL A 1 25  ? -244.921 -15.143 98.063  1.00 0.00 ? 25  VAL A N    1  
ATOM 375   C CA   . VAL A 1 25  ? -243.878 -15.244 99.059  1.00 0.00 ? 25  VAL A CA   1  
ATOM 376   C C    . VAL A 1 25  ? -243.117 -13.923 99.157  1.00 0.00 ? 25  VAL A C    1  
ATOM 377   O O    . VAL A 1 25  ? -242.624 -13.419 98.151  1.00 0.00 ? 25  VAL A O    1  
ATOM 378   C CB   . VAL A 1 25  ? -242.910 -16.362 98.641  1.00 0.00 ? 25  VAL A CB   1  
ATOM 379   C CG1  . VAL A 1 25  ? -242.039 -16.814 99.779  1.00 0.00 ? 25  VAL A CG1  1  
ATOM 380   C CG2  . VAL A 1 25  ? -243.652 -17.532 98.015  1.00 0.00 ? 25  VAL A CG2  1  
ATOM 381   H H    . VAL A 1 25  ? -244.667 -14.985 97.126  1.00 0.00 ? 25  VAL A H    1  
ATOM 382   H HA   . VAL A 1 25  ? -244.312 -15.498 100.017 1.00 0.00 ? 25  VAL A HA   1  
ATOM 383   H HB   . VAL A 1 25  ? -242.275 -15.959 97.906  1.00 0.00 ? 25  VAL A HB   1  
ATOM 384   H HG11 . VAL A 1 25  ? -241.511 -15.960 100.185 1.00 0.00 ? 25  VAL A HG11 1  
ATOM 385   H HG12 . VAL A 1 25  ? -242.653 -17.257 100.548 1.00 0.00 ? 25  VAL A HG12 1  
ATOM 386   H HG13 . VAL A 1 25  ? -241.326 -17.541 99.421  1.00 0.00 ? 25  VAL A HG13 1  
ATOM 387   H HG21 . VAL A 1 25  ? -244.192 -17.191 97.144  1.00 0.00 ? 25  VAL A HG21 1  
ATOM 388   H HG22 . VAL A 1 25  ? -242.944 -18.295 97.726  1.00 0.00 ? 25  VAL A HG22 1  
ATOM 389   H HG23 . VAL A 1 25  ? -244.349 -17.940 98.732  1.00 0.00 ? 25  VAL A HG23 1  
ATOM 390   N N    . PHE A 1 26  ? -243.016 -13.357 100.353 1.00 0.00 ? 26  PHE A N    1  
ATOM 391   C CA   . PHE A 1 26  ? -242.286 -12.096 100.516 1.00 0.00 ? 26  PHE A CA   1  
ATOM 392   C C    . PHE A 1 26  ? -241.016 -12.315 101.307 1.00 0.00 ? 26  PHE A C    1  
ATOM 393   O O    . PHE A 1 26  ? -240.981 -13.132 102.232 1.00 0.00 ? 26  PHE A O    1  
ATOM 394   C CB   . PHE A 1 26  ? -243.134 -11.009 101.181 1.00 0.00 ? 26  PHE A CB   1  
ATOM 395   C CG   . PHE A 1 26  ? -244.419 -10.729 100.455 1.00 0.00 ? 26  PHE A CG   1  
ATOM 396   C CD1  . PHE A 1 26  ? -245.575 -11.434 100.755 1.00 0.00 ? 26  PHE A CD1  1  
ATOM 397   C CD2  . PHE A 1 26  ? -244.468 -9.758  99.471  1.00 0.00 ? 26  PHE A CD2  1  
ATOM 398   C CE1  . PHE A 1 26  ? -246.755 -11.170 100.088 1.00 0.00 ? 26  PHE A CE1  1  
ATOM 399   C CE2  . PHE A 1 26  ? -245.644 -9.491  98.799  1.00 0.00 ? 26  PHE A CE2  1  
ATOM 400   C CZ   . PHE A 1 26  ? -246.789 -10.197 99.108  1.00 0.00 ? 26  PHE A CZ   1  
ATOM 401   H H    . PHE A 1 26  ? -243.419 -13.796 101.135 1.00 0.00 ? 26  PHE A H    1  
ATOM 402   H HA   . PHE A 1 26  ? -242.010 -11.765 99.528  1.00 0.00 ? 26  PHE A HA   1  
ATOM 403   H HB2  . PHE A 1 26  ? -243.368 -11.294 102.191 1.00 0.00 ? 26  PHE A HB2  1  
ATOM 404   H HB3  . PHE A 1 26  ? -242.563 -10.091 101.210 1.00 0.00 ? 26  PHE A HB3  1  
ATOM 405   H HD1  . PHE A 1 26  ? -245.550 -12.195 101.527 1.00 0.00 ? 26  PHE A HD1  1  
ATOM 406   H HD2  . PHE A 1 26  ? -243.572 -9.205  99.231  1.00 0.00 ? 26  PHE A HD2  1  
ATOM 407   H HE1  . PHE A 1 26  ? -247.650 -11.726 100.331 1.00 0.00 ? 26  PHE A HE1  1  
ATOM 408   H HE2  . PHE A 1 26  ? -245.667 -8.731  98.032  1.00 0.00 ? 26  PHE A HE2  1  
ATOM 409   H HZ   . PHE A 1 26  ? -247.711 -9.988  98.584  1.00 0.00 ? 26  PHE A HZ   1  
ATOM 410   N N    . THR A 1 27  ? -239.968 -11.605 100.925 1.00 0.00 ? 27  THR A N    1  
ATOM 411   C CA   . THR A 1 27  ? -238.659 -11.831 101.500 1.00 0.00 ? 27  THR A CA   1  
ATOM 412   C C    . THR A 1 27  ? -238.476 -11.022 102.769 1.00 0.00 ? 27  THR A C    1  
ATOM 413   O O    . THR A 1 27  ? -238.871 -9.855  102.843 1.00 0.00 ? 27  THR A O    1  
ATOM 414   C CB   . THR A 1 27  ? -237.537 -11.484 100.508 1.00 0.00 ? 27  THR A CB   1  
ATOM 415   O OG1  . THR A 1 27  ? -238.025 -11.581 99.160  1.00 0.00 ? 27  THR A OG1  1  
ATOM 416   C CG2  . THR A 1 27  ? -236.365 -12.436 100.692 1.00 0.00 ? 27  THR A CG2  1  
ATOM 417   H H    . THR A 1 27  ? -240.079 -10.904 100.242 1.00 0.00 ? 27  THR A H    1  
ATOM 418   H HA   . THR A 1 27  ? -238.582 -12.881 101.745 1.00 0.00 ? 27  THR A HA   1  
ATOM 419   H HB   . THR A 1 27  ? -237.201 -10.474 100.697 1.00 0.00 ? 27  THR A HB   1  
ATOM 420   H HG1  . THR A 1 27  ? -238.674 -10.876 99.005  1.00 0.00 ? 27  THR A HG1  1  
ATOM 421   H HG21 . THR A 1 27  ? -236.702 -13.451 100.524 1.00 0.00 ? 27  THR A HG21 1  
ATOM 422   H HG22 . THR A 1 27  ? -235.587 -12.192 99.984  1.00 0.00 ? 27  THR A HG22 1  
ATOM 423   H HG23 . THR A 1 27  ? -235.978 -12.346 101.700 1.00 0.00 ? 27  THR A HG23 1  
ATOM 424   N N    . ILE A 1 28  ? -237.884 -11.651 103.761 1.00 0.00 ? 28  ILE A N    1  
ATOM 425   C CA   . ILE A 1 28  ? -237.623 -11.009 105.024 1.00 0.00 ? 28  ILE A CA   1  
ATOM 426   C C    . ILE A 1 28  ? -236.133 -10.731 105.152 1.00 0.00 ? 28  ILE A C    1  
ATOM 427   O O    . ILE A 1 28  ? -235.369 -11.034 104.236 1.00 0.00 ? 28  ILE A O    1  
ATOM 428   C CB   . ILE A 1 28  ? -238.109 -11.881 106.191 1.00 0.00 ? 28  ILE A CB   1  
ATOM 429   C CG1  . ILE A 1 28  ? -237.139 -13.024 106.476 1.00 0.00 ? 28  ILE A CG1  1  
ATOM 430   C CG2  . ILE A 1 28  ? -239.479 -12.443 105.858 1.00 0.00 ? 28  ILE A CG2  1  
ATOM 431   C CD1  . ILE A 1 28  ? -237.489 -13.811 107.714 1.00 0.00 ? 28  ILE A CD1  1  
ATOM 432   H H    . ILE A 1 28  ? -237.623 -12.591 103.643 1.00 0.00 ? 28  ILE A H    1  
ATOM 433   H HA   . ILE A 1 28  ? -238.165 -10.082 105.050 1.00 0.00 ? 28  ILE A HA   1  
ATOM 434   H HB   . ILE A 1 28  ? -238.201 -11.258 107.070 1.00 0.00 ? 28  ILE A HB   1  
ATOM 435   H HG12 . ILE A 1 28  ? -237.149 -13.704 105.639 1.00 0.00 ? 28  ILE A HG12 1  
ATOM 436   H HG13 . ILE A 1 28  ? -236.144 -12.624 106.603 1.00 0.00 ? 28  ILE A HG13 1  
ATOM 437   H HG21 . ILE A 1 28  ? -240.126 -11.639 105.520 1.00 0.00 ? 28  ILE A HG21 1  
ATOM 438   H HG22 . ILE A 1 28  ? -239.391 -13.187 105.081 1.00 0.00 ? 28  ILE A HG22 1  
ATOM 439   H HG23 . ILE A 1 28  ? -239.904 -12.887 106.746 1.00 0.00 ? 28  ILE A HG23 1  
ATOM 440   H HD11 . ILE A 1 28  ? -237.507 -13.146 108.564 1.00 0.00 ? 28  ILE A HD11 1  
ATOM 441   H HD12 . ILE A 1 28  ? -238.462 -14.261 107.588 1.00 0.00 ? 28  ILE A HD12 1  
ATOM 442   H HD13 . ILE A 1 28  ? -236.751 -14.582 107.872 1.00 0.00 ? 28  ILE A HD13 1  
ATOM 443   N N    . ASN A 1 29  ? -235.715 -10.165 106.272 1.00 0.00 ? 29  ASN A N    1  
ATOM 444   C CA   . ASN A 1 29  ? -234.317 -9.809  106.461 1.00 0.00 ? 29  ASN A CA   1  
ATOM 445   C C    . ASN A 1 29  ? -234.032 -9.557  107.930 1.00 0.00 ? 29  ASN A C    1  
ATOM 446   O O    . ASN A 1 29  ? -234.955 -9.327  108.712 1.00 0.00 ? 29  ASN A O    1  
ATOM 447   C CB   . ASN A 1 29  ? -233.948 -8.566  105.644 1.00 0.00 ? 29  ASN A CB   1  
ATOM 448   C CG   . ASN A 1 29  ? -234.728 -7.335  106.061 1.00 0.00 ? 29  ASN A CG   1  
ATOM 449   O OD1  . ASN A 1 29  ? -234.310 -6.580  106.942 1.00 0.00 ? 29  ASN A OD1  1  
ATOM 450   N ND2  . ASN A 1 29  ? -235.865 -7.125  105.423 1.00 0.00 ? 29  ASN A ND2  1  
ATOM 451   H H    . ASN A 1 29  ? -236.353 -10.004 107.003 1.00 0.00 ? 29  ASN A H    1  
ATOM 452   H HA   . ASN A 1 29  ? -233.720 -10.637 106.121 1.00 0.00 ? 29  ASN A HA   1  
ATOM 453   H HB2  . ASN A 1 29  ? -232.896 -8.360  105.772 1.00 0.00 ? 29  ASN A HB2  1  
ATOM 454   H HB3  . ASN A 1 29  ? -234.147 -8.759  104.599 1.00 0.00 ? 29  ASN A HB3  1  
ATOM 455   H HD21 . ASN A 1 29  ? -236.131 -7.762  104.729 1.00 0.00 ? 29  ASN A HD21 1  
ATOM 456   H HD22 . ASN A 1 29  ? -236.397 -6.338  105.669 1.00 0.00 ? 29  ASN A HD22 1  
ATOM 457   N N    . GLY A 1 30  ? -232.754 -9.597  108.292 1.00 0.00 ? 30  GLY A N    1  
ATOM 458   C CA   . GLY A 1 30  ? -232.350 -9.338  109.661 1.00 0.00 ? 30  GLY A CA   1  
ATOM 459   C C    . GLY A 1 30  ? -233.000 -10.287 110.644 1.00 0.00 ? 30  GLY A C    1  
ATOM 460   O O    . GLY A 1 30  ? -232.640 -11.466 110.711 1.00 0.00 ? 30  GLY A O    1  
ATOM 461   H H    . GLY A 1 30  ? -232.077 -9.808  107.622 1.00 0.00 ? 30  GLY A H    1  
ATOM 462   H HA2  . GLY A 1 30  ? -231.278 -9.441  109.733 1.00 0.00 ? 30  GLY A HA2  1  
ATOM 463   H HA3  . GLY A 1 30  ? -232.622 -8.326  109.920 1.00 0.00 ? 30  GLY A HA3  1  
ATOM 464   N N    . GLY A 1 31  ? -233.956 -9.774  111.401 1.00 0.00 ? 31  GLY A N    1  
ATOM 465   C CA   . GLY A 1 31  ? -234.678 -10.592 112.350 1.00 0.00 ? 31  GLY A CA   1  
ATOM 466   C C    . GLY A 1 31  ? -236.146 -10.231 112.402 1.00 0.00 ? 31  GLY A C    1  
ATOM 467   O O    . GLY A 1 31  ? -236.687 -9.955  113.474 1.00 0.00 ? 31  GLY A O    1  
ATOM 468   H H    . GLY A 1 31  ? -234.179 -8.816  111.315 1.00 0.00 ? 31  GLY A H    1  
ATOM 469   H HA2  . GLY A 1 31  ? -234.581 -11.629 112.062 1.00 0.00 ? 31  GLY A HA2  1  
ATOM 470   H HA3  . GLY A 1 31  ? -234.248 -10.457 113.331 1.00 0.00 ? 31  GLY A HA3  1  
ATOM 471   N N    . THR A 1 32  ? -236.784 -10.218 111.238 1.00 0.00 ? 32  THR A N    1  
ATOM 472   C CA   . THR A 1 32  ? -238.202 -9.904  111.137 1.00 0.00 ? 32  THR A CA   1  
ATOM 473   C C    . THR A 1 32  ? -239.075 -10.887 111.906 1.00 0.00 ? 32  THR A C    1  
ATOM 474   O O    . THR A 1 32  ? -238.978 -12.101 111.711 1.00 0.00 ? 32  THR A O    1  
ATOM 475   C CB   . THR A 1 32  ? -238.672 -9.911  109.687 1.00 0.00 ? 32  THR A CB   1  
ATOM 476   O OG1  . THR A 1 32  ? -238.038 -10.984 108.986 1.00 0.00 ? 32  THR A OG1  1  
ATOM 477   C CG2  . THR A 1 32  ? -238.376 -8.596  108.988 1.00 0.00 ? 32  THR A CG2  1  
ATOM 478   H H    . THR A 1 32  ? -236.281 -10.418 110.418 1.00 0.00 ? 32  THR A H    1  
ATOM 479   H HA   . THR A 1 32  ? -238.356 -8.919  111.518 1.00 0.00 ? 32  THR A HA   1  
ATOM 480   H HB   . THR A 1 32  ? -239.753 -10.067 109.692 1.00 0.00 ? 32  THR A HB   1  
ATOM 481   H HG1  . THR A 1 32  ? -237.849 -11.699 109.602 1.00 0.00 ? 32  THR A HG1  1  
ATOM 482   H HG21 . THR A 1 32  ? -238.861 -7.789  109.517 1.00 0.00 ? 32  THR A HG21 1  
ATOM 483   H HG22 . THR A 1 32  ? -237.310 -8.429  108.969 1.00 0.00 ? 32  THR A HG22 1  
ATOM 484   H HG23 . THR A 1 32  ? -238.756 -8.640  107.974 1.00 0.00 ? 32  THR A HG23 1  
ATOM 485   N N    . LYS A 1 33  ? -239.923 -10.365 112.779 1.00 0.00 ? 33  LYS A N    1  
ATOM 486   C CA   . LYS A 1 33  ? -240.964 -11.173 113.387 1.00 0.00 ? 33  LYS A CA   1  
ATOM 487   C C    . LYS A 1 33  ? -242.227 -11.072 112.542 1.00 0.00 ? 33  LYS A C    1  
ATOM 488   O O    . LYS A 1 33  ? -242.235 -10.382 111.526 1.00 0.00 ? 33  LYS A O    1  
ATOM 489   C CB   . LYS A 1 33  ? -241.251 -10.720 114.811 1.00 0.00 ? 33  LYS A CB   1  
ATOM 490   C CG   . LYS A 1 33  ? -241.816 -9.326  114.874 1.00 0.00 ? 33  LYS A CG   1  
ATOM 491   C CD   . LYS A 1 33  ? -241.890 -8.805  116.298 1.00 0.00 ? 33  LYS A CD   1  
ATOM 492   C CE   . LYS A 1 33  ? -240.517 -8.699  116.942 1.00 0.00 ? 33  LYS A CE   1  
ATOM 493   N NZ   . LYS A 1 33  ? -239.664 -7.685  116.271 1.00 0.00 ? 33  LYS A NZ   1  
ATOM 494   H H    . LYS A 1 33  ? -239.841 -9.416  113.027 1.00 0.00 ? 33  LYS A H    1  
ATOM 495   H HA   . LYS A 1 33  ? -240.631 -12.190 113.400 1.00 0.00 ? 33  LYS A HA   1  
ATOM 496   H HB2  . LYS A 1 33  ? -241.963 -11.399 115.259 1.00 0.00 ? 33  LYS A HB2  1  
ATOM 497   H HB3  . LYS A 1 33  ? -240.333 -10.743 115.379 1.00 0.00 ? 33  LYS A HB3  1  
ATOM 498   H HG2  . LYS A 1 33  ? -241.185 -8.691  114.288 1.00 0.00 ? 33  LYS A HG2  1  
ATOM 499   H HG3  . LYS A 1 33  ? -242.810 -9.335  114.450 1.00 0.00 ? 33  LYS A HG3  1  
ATOM 500   H HD2  . LYS A 1 33  ? -242.342 -7.826  116.285 1.00 0.00 ? 33  LYS A HD2  1  
ATOM 501   H HD3  . LYS A 1 33  ? -242.500 -9.476  116.883 1.00 0.00 ? 33  LYS A HD3  1  
ATOM 502   H HE2  . LYS A 1 33  ? -240.641 -8.422  117.978 1.00 0.00 ? 33  LYS A HE2  1  
ATOM 503   H HE3  . LYS A 1 33  ? -240.031 -9.662  116.884 1.00 0.00 ? 33  LYS A HE3  1  
ATOM 504   H HZ1  . LYS A 1 33  ? -240.167 -6.772  116.224 1.00 0.00 ? 33  LYS A HZ1  1  
ATOM 505   H HZ2  . LYS A 1 33  ? -238.778 -7.549  116.801 1.00 0.00 ? 33  LYS A HZ2  1  
ATOM 506   H HZ3  . LYS A 1 33  ? -239.432 -7.989  115.302 1.00 0.00 ? 33  LYS A HZ3  1  
ATOM 507   N N    . ALA A 1 34  ? -243.292 -11.723 112.982 1.00 0.00 ? 34  ALA A N    1  
ATOM 508   C CA   . ALA A 1 34  ? -244.550 -11.763 112.240 1.00 0.00 ? 34  ALA A CA   1  
ATOM 509   C C    . ALA A 1 34  ? -245.151 -10.383 111.991 1.00 0.00 ? 34  ALA A C    1  
ATOM 510   O O    . ALA A 1 34  ? -245.957 -10.211 111.089 1.00 0.00 ? 34  ALA A O    1  
ATOM 511   C CB   . ALA A 1 34  ? -245.549 -12.607 112.988 1.00 0.00 ? 34  ALA A CB   1  
ATOM 512   H H    . ALA A 1 34  ? -243.233 -12.210 113.830 1.00 0.00 ? 34  ALA A H    1  
ATOM 513   H HA   . ALA A 1 34  ? -244.361 -12.239 111.290 1.00 0.00 ? 34  ALA A HA   1  
ATOM 514   H HB1  . ALA A 1 34  ? -245.779 -12.138 113.934 1.00 0.00 ? 34  ALA A HB1  1  
ATOM 515   H HB2  . ALA A 1 34  ? -246.452 -12.700 112.403 1.00 0.00 ? 34  ALA A HB2  1  
ATOM 516   H HB3  . ALA A 1 34  ? -245.131 -13.587 113.165 1.00 0.00 ? 34  ALA A HB3  1  
ATOM 517   N N    . LYS A 1 35  ? -244.774 -9.410  112.796 1.00 0.00 ? 35  LYS A N    1  
ATOM 518   C CA   . LYS A 1 35  ? -245.361 -8.092  112.725 1.00 0.00 ? 35  LYS A CA   1  
ATOM 519   C C    . LYS A 1 35  ? -244.713 -7.305  111.604 1.00 0.00 ? 35  LYS A C    1  
ATOM 520   O O    . LYS A 1 35  ? -245.375 -6.776  110.712 1.00 0.00 ? 35  LYS A O    1  
ATOM 521   C CB   . LYS A 1 35  ? -245.139 -7.411  114.069 1.00 0.00 ? 35  LYS A CB   1  
ATOM 522   C CG   . LYS A 1 35  ? -245.353 -5.926  114.034 1.00 0.00 ? 35  LYS A CG   1  
ATOM 523   C CD   . LYS A 1 35  ? -246.798 -5.598  113.735 1.00 0.00 ? 35  LYS A CD   1  
ATOM 524   C CE   . LYS A 1 35  ? -247.064 -4.104  113.788 1.00 0.00 ? 35  LYS A CE   1  
ATOM 525   N NZ   . LYS A 1 35  ? -248.515 -3.812  113.919 1.00 0.00 ? 35  LYS A NZ   1  
ATOM 526   H H    . LYS A 1 35  ? -244.032 -9.557  113.410 1.00 0.00 ? 35  LYS A H    1  
ATOM 527   H HA   . LYS A 1 35  ? -246.423 -8.189  112.525 1.00 0.00 ? 35  LYS A HA   1  
ATOM 528   H HB2  . LYS A 1 35  ? -245.821 -7.834  114.790 1.00 0.00 ? 35  LYS A HB2  1  
ATOM 529   H HB3  . LYS A 1 35  ? -244.126 -7.599  114.392 1.00 0.00 ? 35  LYS A HB3  1  
ATOM 530   H HG2  . LYS A 1 35  ? -245.077 -5.512  114.988 1.00 0.00 ? 35  LYS A HG2  1  
ATOM 531   H HG3  . LYS A 1 35  ? -244.727 -5.520  113.259 1.00 0.00 ? 35  LYS A HG3  1  
ATOM 532   H HD2  . LYS A 1 35  ? -247.026 -5.960  112.744 1.00 0.00 ? 35  LYS A HD2  1  
ATOM 533   H HD3  . LYS A 1 35  ? -247.425 -6.098  114.456 1.00 0.00 ? 35  LYS A HD3  1  
ATOM 534   H HE2  . LYS A 1 35  ? -246.543 -3.687  114.636 1.00 0.00 ? 35  LYS A HE2  1  
ATOM 535   H HE3  . LYS A 1 35  ? -246.695 -3.651  112.880 1.00 0.00 ? 35  LYS A HE3  1  
ATOM 536   H HZ1  . LYS A 1 35  ? -249.055 -4.291  113.166 1.00 0.00 ? 35  LYS A HZ1  1  
ATOM 537   H HZ2  . LYS A 1 35  ? -248.864 -4.147  114.844 1.00 0.00 ? 35  LYS A HZ2  1  
ATOM 538   H HZ3  . LYS A 1 35  ? -248.682 -2.782  113.851 1.00 0.00 ? 35  LYS A HZ3  1  
ATOM 539   N N    . GLN A 1 36  ? -243.398 -7.264  111.677 1.00 0.00 ? 36  GLN A N    1  
ATOM 540   C CA   . GLN A 1 36  ? -242.563 -6.723  110.624 1.00 0.00 ? 36  GLN A CA   1  
ATOM 541   C C    . GLN A 1 36  ? -242.788 -7.508  109.344 1.00 0.00 ? 36  GLN A C    1  
ATOM 542   O O    . GLN A 1 36  ? -242.503 -7.041  108.245 1.00 0.00 ? 36  GLN A O    1  
ATOM 543   C CB   . GLN A 1 36  ? -241.100 -6.834  111.035 1.00 0.00 ? 36  GLN A CB   1  
ATOM 544   C CG   . GLN A 1 36  ? -240.802 -6.231  112.394 1.00 0.00 ? 36  GLN A CG   1  
ATOM 545   C CD   . GLN A 1 36  ? -239.439 -6.632  112.906 1.00 0.00 ? 36  GLN A CD   1  
ATOM 546   O OE1  . GLN A 1 36  ? -239.299 -7.653  113.585 1.00 0.00 ? 36  GLN A OE1  1  
ATOM 547   N NE2  . GLN A 1 36  ? -238.430 -5.847  112.585 1.00 0.00 ? 36  GLN A NE2  1  
ATOM 548   H H    . GLN A 1 36  ? -242.973 -7.591  112.487 1.00 0.00 ? 36  GLN A H    1  
ATOM 549   H HA   . GLN A 1 36  ? -242.823 -5.686  110.469 1.00 0.00 ? 36  GLN A HA   1  
ATOM 550   H HB2  . GLN A 1 36  ? -240.823 -7.877  111.060 1.00 0.00 ? 36  GLN A HB2  1  
ATOM 551   H HB3  . GLN A 1 36  ? -240.495 -6.327  110.301 1.00 0.00 ? 36  GLN A HB3  1  
ATOM 552   H HG2  . GLN A 1 36  ? -240.841 -5.155  112.315 1.00 0.00 ? 36  GLN A HG2  1  
ATOM 553   H HG3  . GLN A 1 36  ? -241.545 -6.568  113.098 1.00 0.00 ? 36  GLN A HG3  1  
ATOM 554   H HE21 . GLN A 1 36  ? -238.617 -5.050  112.034 1.00 0.00 ? 36  GLN A HE21 1  
ATOM 555   H HE22 . GLN A 1 36  ? -237.528 -6.094  112.909 1.00 0.00 ? 36  GLN A HE22 1  
ATOM 556   N N    . LEU A 1 37  ? -243.247 -8.735  109.504 1.00 0.00 ? 37  LEU A N    1  
ATOM 557   C CA   . LEU A 1 37  ? -243.488 -9.588  108.373 1.00 0.00 ? 37  LEU A CA   1  
ATOM 558   C C    . LEU A 1 37  ? -244.840 -9.406  107.752 1.00 0.00 ? 37  LEU A C    1  
ATOM 559   O O    . LEU A 1 37  ? -244.973 -9.479  106.534 1.00 0.00 ? 37  LEU A O    1  
ATOM 560   C CB   . LEU A 1 37  ? -243.259 -11.034 108.719 1.00 0.00 ? 37  LEU A CB   1  
ATOM 561   C CG   . LEU A 1 37  ? -242.229 -11.609 107.804 1.00 0.00 ? 37  LEU A CG   1  
ATOM 562   C CD1  . LEU A 1 37  ? -242.798 -11.618 106.409 1.00 0.00 ? 37  LEU A CD1  1  
ATOM 563   C CD2  . LEU A 1 37  ? -241.015 -10.718 107.843 1.00 0.00 ? 37  LEU A CD2  1  
ATOM 564   H H    . LEU A 1 37  ? -243.395 -9.081  110.407 1.00 0.00 ? 37  LEU A H    1  
ATOM 565   H HA   . LEU A 1 37  ? -242.763 -9.310  107.628 1.00 0.00 ? 37  LEU A HA   1  
ATOM 566   H HB2  . LEU A 1 37  ? -242.919 -11.110 109.744 1.00 0.00 ? 37  LEU A HB2  1  
ATOM 567   H HB3  . LEU A 1 37  ? -244.179 -11.582 108.599 1.00 0.00 ? 37  LEU A HB3  1  
ATOM 568   H HG   . LEU A 1 37  ? -241.957 -12.610 108.102 1.00 0.00 ? 37  LEU A HG   1  
ATOM 569   H HD11 . LEU A 1 37  ? -243.278 -10.654 106.226 1.00 0.00 ? 37  LEU A HD11 1  
ATOM 570   H HD12 . LEU A 1 37  ? -242.007 -11.773 105.692 1.00 0.00 ? 37  LEU A HD12 1  
ATOM 571   H HD13 . LEU A 1 37  ? -243.529 -12.405 106.322 1.00 0.00 ? 37  LEU A HD13 1  
ATOM 572   H HD21 . LEU A 1 37  ? -240.861 -10.365 108.851 1.00 0.00 ? 37  LEU A HD21 1  
ATOM 573   H HD22 . LEU A 1 37  ? -240.151 -11.274 107.519 1.00 0.00 ? 37  LEU A HD22 1  
ATOM 574   H HD23 . LEU A 1 37  ? -241.169 -9.873  107.181 1.00 0.00 ? 37  LEU A HD23 1  
ATOM 575   N N    . LEU A 1 38  ? -245.842 -9.195  108.560 1.00 0.00 ? 38  LEU A N    1  
ATOM 576   C CA   . LEU A 1 38  ? -247.131 -8.867  108.026 1.00 0.00 ? 38  LEU A CA   1  
ATOM 577   C C    . LEU A 1 38  ? -246.951 -7.656  107.110 1.00 0.00 ? 38  LEU A C    1  
ATOM 578   O O    . LEU A 1 38  ? -247.511 -7.594  106.023 1.00 0.00 ? 38  LEU A O    1  
ATOM 579   C CB   . LEU A 1 38  ? -248.124 -8.633  109.178 1.00 0.00 ? 38  LEU A CB   1  
ATOM 580   C CG   . LEU A 1 38  ? -249.592 -8.458  108.774 1.00 0.00 ? 38  LEU A CG   1  
ATOM 581   C CD1  . LEU A 1 38  ? -250.022 -7.005  108.893 1.00 0.00 ? 38  LEU A CD1  1  
ATOM 582   C CD2  . LEU A 1 38  ? -249.814 -8.976  107.358 1.00 0.00 ? 38  LEU A CD2  1  
ATOM 583   H H    . LEU A 1 38  ? -245.721 -9.279  109.531 1.00 0.00 ? 38  LEU A H    1  
ATOM 584   H HA   . LEU A 1 38  ? -247.458 -9.708  107.425 1.00 0.00 ? 38  LEU A HA   1  
ATOM 585   H HB2  . LEU A 1 38  ? -248.065 -9.487  109.838 1.00 0.00 ? 38  LEU A HB2  1  
ATOM 586   H HB3  . LEU A 1 38  ? -247.810 -7.758  109.736 1.00 0.00 ? 38  LEU A HB3  1  
ATOM 587   H HG   . LEU A 1 38  ? -250.210 -9.040  109.441 1.00 0.00 ? 38  LEU A HG   1  
ATOM 588   H HD11 . LEU A 1 38  ? -249.396 -6.391  108.262 1.00 0.00 ? 38  LEU A HD11 1  
ATOM 589   H HD12 . LEU A 1 38  ? -251.052 -6.907  108.582 1.00 0.00 ? 38  LEU A HD12 1  
ATOM 590   H HD13 . LEU A 1 38  ? -249.924 -6.683  109.919 1.00 0.00 ? 38  LEU A HD13 1  
ATOM 591   H HD21 . LEU A 1 38  ? -249.524 -10.018 107.307 1.00 0.00 ? 38  LEU A HD21 1  
ATOM 592   H HD22 . LEU A 1 38  ? -250.854 -8.874  107.092 1.00 0.00 ? 38  LEU A HD22 1  
ATOM 593   H HD23 . LEU A 1 38  ? -249.204 -8.406  106.668 1.00 0.00 ? 38  LEU A HD23 1  
ATOM 594   N N    . GLN A 1 39  ? -246.068 -6.765  107.535 1.00 0.00 ? 39  GLN A N    1  
ATOM 595   C CA   . GLN A 1 39  ? -245.577 -5.668  106.759 1.00 0.00 ? 39  GLN A CA   1  
ATOM 596   C C    . GLN A 1 39  ? -244.977 -6.115  105.454 1.00 0.00 ? 39  GLN A C    1  
ATOM 597   O O    . GLN A 1 39  ? -245.310 -5.599  104.407 1.00 0.00 ? 39  GLN A O    1  
ATOM 598   C CB   . GLN A 1 39  ? -244.459 -5.068  107.557 1.00 0.00 ? 39  GLN A CB   1  
ATOM 599   C CG   . GLN A 1 39  ? -243.960 -3.796  106.969 1.00 0.00 ? 39  GLN A CG   1  
ATOM 600   C CD   . GLN A 1 39  ? -242.935 -3.094  107.842 1.00 0.00 ? 39  GLN A CD   1  
ATOM 601   O OE1  . GLN A 1 39  ? -241.732 -3.337  107.731 1.00 0.00 ? 39  GLN A OE1  1  
ATOM 602   N NE2  . GLN A 1 39  ? -243.404 -2.213  108.713 1.00 0.00 ? 39  GLN A NE2  1  
ATOM 603   H H    . GLN A 1 39  ? -245.728 -6.834  108.434 1.00 0.00 ? 39  GLN A H    1  
ATOM 604   H HA   . GLN A 1 39  ? -246.364 -4.936  106.585 1.00 0.00 ? 39  GLN A HA   1  
ATOM 605   H HB2  . GLN A 1 39  ? -244.770 -4.932  108.563 1.00 0.00 ? 39  GLN A HB2  1  
ATOM 606   H HB3  . GLN A 1 39  ? -243.637 -5.769  107.555 1.00 0.00 ? 39  GLN A HB3  1  
ATOM 607   H HG2  . GLN A 1 39  ? -243.507 -4.054  106.021 1.00 0.00 ? 39  GLN A HG2  1  
ATOM 608   H HG3  . GLN A 1 39  ? -244.802 -3.145  106.811 1.00 0.00 ? 39  GLN A HG3  1  
ATOM 609   H HE21 . GLN A 1 39  ? -244.378 -2.059  108.746 1.00 0.00 ? 39  GLN A HE21 1  
ATOM 610   H HE22 . GLN A 1 39  ? -242.764 -1.747  109.290 1.00 0.00 ? 39  GLN A HE22 1  
ATOM 611   N N    . GLN A 1 40  ? -244.043 -7.038  105.539 1.00 0.00 ? 40  GLN A N    1  
ATOM 612   C CA   . GLN A 1 40  ? -243.349 -7.527  104.371 1.00 0.00 ? 40  GLN A CA   1  
ATOM 613   C C    . GLN A 1 40  ? -244.319 -8.110  103.356 1.00 0.00 ? 40  GLN A C    1  
ATOM 614   O O    . GLN A 1 40  ? -244.069 -8.093  102.156 1.00 0.00 ? 40  GLN A O    1  
ATOM 615   C CB   . GLN A 1 40  ? -242.307 -8.556  104.782 1.00 0.00 ? 40  GLN A CB   1  
ATOM 616   C CG   . GLN A 1 40  ? -240.961 -7.935  105.085 1.00 0.00 ? 40  GLN A CG   1  
ATOM 617   C CD   . GLN A 1 40  ? -240.491 -7.076  103.936 1.00 0.00 ? 40  GLN A CD   1  
ATOM 618   O OE1  . GLN A 1 40  ? -239.736 -6.123  104.116 1.00 0.00 ? 40  GLN A OE1  1  
ATOM 619   N NE2  . GLN A 1 40  ? -240.988 -7.386  102.752 1.00 0.00 ? 40  GLN A NE2  1  
ATOM 620   H H    . GLN A 1 40  ? -243.813 -7.405  106.421 1.00 0.00 ? 40  GLN A H    1  
ATOM 621   H HA   . GLN A 1 40  ? -242.840 -6.688  103.920 1.00 0.00 ? 40  GLN A HA   1  
ATOM 622   H HB2  . GLN A 1 40  ? -242.650 -9.066  105.667 1.00 0.00 ? 40  GLN A HB2  1  
ATOM 623   H HB3  . GLN A 1 40  ? -242.182 -9.271  103.984 1.00 0.00 ? 40  GLN A HB3  1  
ATOM 624   H HG2  . GLN A 1 40  ? -241.044 -7.323  105.972 1.00 0.00 ? 40  GLN A HG2  1  
ATOM 625   H HG3  . GLN A 1 40  ? -240.244 -8.719  105.250 1.00 0.00 ? 40  GLN A HG3  1  
ATOM 626   H HE21 . GLN A 1 40  ? -241.616 -8.142  102.702 1.00 0.00 ? 40  GLN A HE21 1  
ATOM 627   H HE22 . GLN A 1 40  ? -240.732 -6.849  101.987 1.00 0.00 ? 40  GLN A HE22 1  
ATOM 628   N N    . ILE A 1 41  ? -245.424 -8.608  103.865 1.00 0.00 ? 41  ILE A N    1  
ATOM 629   C CA   . ILE A 1 41  ? -246.485 -9.181  103.062 1.00 0.00 ? 41  ILE A CA   1  
ATOM 630   C C    . ILE A 1 41  ? -247.380 -8.088  102.486 1.00 0.00 ? 41  ILE A C    1  
ATOM 631   O O    . ILE A 1 41  ? -247.836 -8.162  101.345 1.00 0.00 ? 41  ILE A O    1  
ATOM 632   C CB   . ILE A 1 41  ? -247.284 -10.151 103.951 1.00 0.00 ? 41  ILE A CB   1  
ATOM 633   C CG1  . ILE A 1 41  ? -246.598 -11.527 103.976 1.00 0.00 ? 41  ILE A CG1  1  
ATOM 634   C CG2  . ILE A 1 41  ? -248.723 -10.286 103.482 1.00 0.00 ? 41  ILE A CG2  1  
ATOM 635   C CD1  . ILE A 1 41  ? -245.084 -11.491 104.139 1.00 0.00 ? 41  ILE A CD1  1  
ATOM 636   H H    . ILE A 1 41  ? -245.525 -8.617  104.840 1.00 0.00 ? 41  ILE A H    1  
ATOM 637   H HA   . ILE A 1 41  ? -246.038 -9.742  102.255 1.00 0.00 ? 41  ILE A HA   1  
ATOM 638   H HB   . ILE A 1 41  ? -247.299 -9.737  104.957 1.00 0.00 ? 41  ILE A HB   1  
ATOM 639   H HG12 . ILE A 1 41  ? -247.000 -12.106 104.793 1.00 0.00 ? 41  ILE A HG12 1  
ATOM 640   H HG13 . ILE A 1 41  ? -246.813 -12.032 103.049 1.00 0.00 ? 41  ILE A HG13 1  
ATOM 641   H HG21 . ILE A 1 41  ? -249.192 -9.314  103.480 1.00 0.00 ? 41  ILE A HG21 1  
ATOM 642   H HG22 . ILE A 1 41  ? -248.742 -10.699 102.484 1.00 0.00 ? 41  ILE A HG22 1  
ATOM 643   H HG23 . ILE A 1 41  ? -249.256 -10.941 104.156 1.00 0.00 ? 41  ILE A HG23 1  
ATOM 644   H HD11 . ILE A 1 41  ? -244.642 -10.916 103.331 1.00 0.00 ? 41  ILE A HD11 1  
ATOM 645   H HD12 . ILE A 1 41  ? -244.839 -11.027 105.083 1.00 0.00 ? 41  ILE A HD12 1  
ATOM 646   H HD13 . ILE A 1 41  ? -244.682 -12.498 104.114 1.00 0.00 ? 41  ILE A HD13 1  
ATOM 647   N N    . LEU A 1 42  ? -247.618 -7.083  103.302 1.00 0.00 ? 42  LEU A N    1  
ATOM 648   C CA   . LEU A 1 42  ? -248.303 -5.869  102.892 1.00 0.00 ? 42  LEU A CA   1  
ATOM 649   C C    . LEU A 1 42  ? -247.552 -5.182  101.769 1.00 0.00 ? 42  LEU A C    1  
ATOM 650   O O    . LEU A 1 42  ? -248.137 -4.697  100.803 1.00 0.00 ? 42  LEU A O    1  
ATOM 651   C CB   . LEU A 1 42  ? -248.357 -4.955  104.090 1.00 0.00 ? 42  LEU A CB   1  
ATOM 652   C CG   . LEU A 1 42  ? -249.322 -5.422  105.155 1.00 0.00 ? 42  LEU A CG   1  
ATOM 653   C CD1  . LEU A 1 42  ? -248.803 -5.034  106.499 1.00 0.00 ? 42  LEU A CD1  1  
ATOM 654   C CD2  . LEU A 1 42  ? -250.698 -4.845  104.924 1.00 0.00 ? 42  LEU A CD2  1  
ATOM 655   H H    . LEU A 1 42  ? -247.329 -7.162  104.238 1.00 0.00 ? 42  LEU A H    1  
ATOM 656   H HA   . LEU A 1 42  ? -249.304 -6.113  102.594 1.00 0.00 ? 42  LEU A HA   1  
ATOM 657   H HB2  . LEU A 1 42  ? -247.363 -4.899  104.513 1.00 0.00 ? 42  LEU A HB2  1  
ATOM 658   H HB3  . LEU A 1 42  ? -248.640 -3.971  103.781 1.00 0.00 ? 42  LEU A HB3  1  
ATOM 659   H HG   . LEU A 1 42  ? -249.397 -6.499  105.122 1.00 0.00 ? 42  LEU A HG   1  
ATOM 660   H HD11 . LEU A 1 42  ? -248.483 -4.006  106.475 1.00 0.00 ? 42  LEU A HD11 1  
ATOM 661   H HD12 . LEU A 1 42  ? -249.577 -5.166  107.237 1.00 0.00 ? 42  LEU A HD12 1  
ATOM 662   H HD13 . LEU A 1 42  ? -247.960 -5.673  106.730 1.00 0.00 ? 42  LEU A HD13 1  
ATOM 663   H HD21 . LEU A 1 42  ? -250.636 -3.767  104.931 1.00 0.00 ? 42  LEU A HD21 1  
ATOM 664   H HD22 . LEU A 1 42  ? -251.071 -5.181  103.970 1.00 0.00 ? 42  LEU A HD22 1  
ATOM 665   H HD23 . LEU A 1 42  ? -251.359 -5.175  105.711 1.00 0.00 ? 42  LEU A HD23 1  
ATOM 666   N N    . THR A 1 43  ? -246.243 -5.197  101.944 1.00 0.00 ? 43  THR A N    1  
ATOM 667   C CA   . THR A 1 43  ? -245.280 -4.456  101.169 1.00 0.00 ? 43  THR A CA   1  
ATOM 668   C C    . THR A 1 43  ? -245.643 -4.352  99.696  1.00 0.00 ? 43  THR A C    1  
ATOM 669   O O    . THR A 1 43  ? -245.473 -5.277  98.902  1.00 0.00 ? 43  THR A O    1  
ATOM 670   C CB   . THR A 1 43  ? -243.883 -5.089  101.364 1.00 0.00 ? 43  THR A CB   1  
ATOM 671   O OG1  . THR A 1 43  ? -243.413 -4.834  102.697 1.00 0.00 ? 43  THR A OG1  1  
ATOM 672   C CG2  . THR A 1 43  ? -242.867 -4.573  100.372 1.00 0.00 ? 43  THR A CG2  1  
ATOM 673   H H    . THR A 1 43  ? -245.898 -5.757  102.663 1.00 0.00 ? 43  THR A H    1  
ATOM 674   H HA   . THR A 1 43  ? -245.253 -3.453  101.584 1.00 0.00 ? 43  THR A HA   1  
ATOM 675   H HB   . THR A 1 43  ? -243.976 -6.157  101.231 1.00 0.00 ? 43  THR A HB   1  
ATOM 676   H HG1  . THR A 1 43  ? -244.117 -5.038  103.331 1.00 0.00 ? 43  THR A HG1  1  
ATOM 677   H HG21 . THR A 1 43  ? -243.212 -4.775  99.370  1.00 0.00 ? 43  THR A HG21 1  
ATOM 678   H HG22 . THR A 1 43  ? -242.738 -3.511  100.505 1.00 0.00 ? 43  THR A HG22 1  
ATOM 679   H HG23 . THR A 1 43  ? -241.924 -5.077  100.536 1.00 0.00 ? 43  THR A HG23 1  
ATOM 680   N N    . ASN A 1 44  ? -246.194 -3.199  99.381  1.00 0.00 ? 44  ASN A N    1  
ATOM 681   C CA   . ASN A 1 44  ? -246.558 -2.832  98.030  1.00 0.00 ? 44  ASN A CA   1  
ATOM 682   C C    . ASN A 1 44  ? -245.321 -2.448  97.244  1.00 0.00 ? 44  ASN A C    1  
ATOM 683   O O    . ASN A 1 44  ? -245.360 -2.345  96.019  1.00 0.00 ? 44  ASN A O    1  
ATOM 684   C CB   . ASN A 1 44  ? -247.522 -1.652  98.065  1.00 0.00 ? 44  ASN A CB   1  
ATOM 685   C CG   . ASN A 1 44  ? -248.720 -1.861  97.169  1.00 0.00 ? 44  ASN A CG   1  
ATOM 686   O OD1  . ASN A 1 44  ? -249.261 -0.911  96.607  1.00 0.00 ? 44  ASN A OD1  1  
ATOM 687   N ND2  . ASN A 1 44  ? -249.153 -3.106  97.051  1.00 0.00 ? 44  ASN A ND2  1  
ATOM 688   H H    . ASN A 1 44  ? -246.391 -2.582  100.097 1.00 0.00 ? 44  ASN A H    1  
ATOM 689   H HA   . ASN A 1 44  ? -247.039 -3.677  97.561  1.00 0.00 ? 44  ASN A HA   1  
ATOM 690   H HB2  . ASN A 1 44  ? -247.871 -1.509  99.078  1.00 0.00 ? 44  ASN A HB2  1  
ATOM 691   H HB3  . ASN A 1 44  ? -247.001 -0.764  97.741  1.00 0.00 ? 44  ASN A HB3  1  
ATOM 692   H HD21 . ASN A 1 44  ? -248.682 -3.812  97.544  1.00 0.00 ? 44  ASN A HD21 1  
ATOM 693   H HD22 . ASN A 1 44  ? -249.925 -3.271  96.481  1.00 0.00 ? 44  ASN A HD22 1  
ATOM 694   N N    . GLU A 1 45  ? -244.238 -2.185  97.983  1.00 0.00 ? 45  GLU A N    1  
ATOM 695   C CA   . GLU A 1 45  ? -242.929 -1.895  97.407  1.00 0.00 ? 45  GLU A CA   1  
ATOM 696   C C    . GLU A 1 45  ? -242.863 -0.510  96.760  1.00 0.00 ? 45  GLU A C    1  
ATOM 697   O O    . GLU A 1 45  ? -241.779 -0.024  96.438  1.00 0.00 ? 45  GLU A O    1  
ATOM 698   C CB   . GLU A 1 45  ? -242.564 -2.983  96.412  1.00 0.00 ? 45  GLU A CB   1  
ATOM 699   C CG   . GLU A 1 45  ? -241.971 -4.228  97.053  1.00 0.00 ? 45  GLU A CG   1  
ATOM 700   C CD   . GLU A 1 45  ? -240.617 -3.979  97.690  1.00 0.00 ? 45  GLU A CD   1  
ATOM 701   O OE1  . GLU A 1 45  ? -240.545 -3.237  98.690  1.00 0.00 ? 45  GLU A OE1  1  
ATOM 702   O OE2  . GLU A 1 45  ? -239.617 -4.536  97.195  1.00 0.00 ? 45  GLU A OE2  1  
ATOM 703   H H    . GLU A 1 45  ? -244.323 -2.201  98.949  1.00 0.00 ? 45  GLU A H    1  
ATOM 704   H HA   . GLU A 1 45  ? -242.213 -1.921  98.216  1.00 0.00 ? 45  GLU A HA   1  
ATOM 705   H HB2  . GLU A 1 45  ? -243.470 -3.275  95.900  1.00 0.00 ? 45  GLU A HB2  1  
ATOM 706   H HB3  . GLU A 1 45  ? -241.861 -2.589  95.703  1.00 0.00 ? 45  GLU A HB3  1  
ATOM 707   H HG2  . GLU A 1 45  ? -242.649 -4.580  97.815  1.00 0.00 ? 45  GLU A HG2  1  
ATOM 708   H HG3  . GLU A 1 45  ? -241.861 -4.990  96.293  1.00 0.00 ? 45  GLU A HG3  1  
ATOM 709   N N    . GLN A 1 46  ? -244.019 0.121   96.585  1.00 0.00 ? 46  GLN A N    1  
ATOM 710   C CA   . GLN A 1 46  ? -244.087 1.481   96.080  1.00 0.00 ? 46  GLN A CA   1  
ATOM 711   C C    . GLN A 1 46  ? -243.521 2.447   97.095  1.00 0.00 ? 46  GLN A C    1  
ATOM 712   O O    . GLN A 1 46  ? -242.315 2.678   97.174  1.00 0.00 ? 46  GLN A O    1  
ATOM 713   C CB   . GLN A 1 46  ? -245.536 1.842   95.739  1.00 0.00 ? 46  GLN A CB   1  
ATOM 714   C CG   . GLN A 1 46  ? -246.192 0.913   94.726  1.00 0.00 ? 46  GLN A CG   1  
ATOM 715   C CD   . GLN A 1 46  ? -245.658 1.084   93.312  1.00 0.00 ? 46  GLN A CD   1  
ATOM 716   O OE1  . GLN A 1 46  ? -244.501 1.454   93.103  1.00 0.00 ? 46  GLN A OE1  1  
ATOM 717   N NE2  . GLN A 1 46  ? -246.504 0.811   92.331  1.00 0.00 ? 46  GLN A NE2  1  
ATOM 718   H H    . GLN A 1 46  ? -244.851 -0.352  96.776  1.00 0.00 ? 46  GLN A H    1  
ATOM 719   H HA   . GLN A 1 46  ? -243.503 1.545   95.214  1.00 0.00 ? 46  GLN A HA   1  
ATOM 720   H HB2  . GLN A 1 46  ? -246.123 1.817   96.646  1.00 0.00 ? 46  GLN A HB2  1  
ATOM 721   H HB3  . GLN A 1 46  ? -245.554 2.841   95.343  1.00 0.00 ? 46  GLN A HB3  1  
ATOM 722   H HG2  . GLN A 1 46  ? -246.020 -0.106  95.033  1.00 0.00 ? 46  GLN A HG2  1  
ATOM 723   H HG3  . GLN A 1 46  ? -247.255 1.109   94.721  1.00 0.00 ? 46  GLN A HG3  1  
ATOM 724   H HE21 . GLN A 1 46  ? -247.415 0.517   92.570  1.00 0.00 ? 46  GLN A HE21 1  
ATOM 725   H HE22 . GLN A 1 46  ? -246.194 0.914   91.407  1.00 0.00 ? 46  GLN A HE22 1  
ATOM 726   N N    . ASP A 1 47  ? -244.414 2.995   97.862  1.00 0.00 ? 47  ASP A N    1  
ATOM 727   C CA   . ASP A 1 47  ? -244.058 3.726   99.067  1.00 0.00 ? 47  ASP A CA   1  
ATOM 728   C C    . ASP A 1 47  ? -243.937 2.714   100.194 1.00 0.00 ? 47  ASP A C    1  
ATOM 729   O O    . ASP A 1 47  ? -243.635 3.036   101.341 1.00 0.00 ? 47  ASP A O    1  
ATOM 730   C CB   . ASP A 1 47  ? -245.113 4.793   99.380  1.00 0.00 ? 47  ASP A CB   1  
ATOM 731   C CG   . ASP A 1 47  ? -244.761 5.643   100.586 1.00 0.00 ? 47  ASP A CG   1  
ATOM 732   O OD1  . ASP A 1 47  ? -243.744 6.366   100.536 1.00 0.00 ? 47  ASP A OD1  1  
ATOM 733   O OD2  . ASP A 1 47  ? -245.505 5.604   101.584 1.00 0.00 ? 47  ASP A OD2  1  
ATOM 734   H H    . ASP A 1 47  ? -245.350 2.911   97.600  1.00 0.00 ? 47  ASP A H    1  
ATOM 735   H HA   . ASP A 1 47  ? -243.101 4.189   98.906  1.00 0.00 ? 47  ASP A HA   1  
ATOM 736   H HB2  . ASP A 1 47  ? -245.217 5.446   98.527  1.00 0.00 ? 47  ASP A HB2  1  
ATOM 737   H HB3  . ASP A 1 47  ? -246.060 4.306   99.569  1.00 0.00 ? 47  ASP A HB3  1  
ATOM 738   N N    . ILE A 1 48  ? -244.137 1.462   99.791  1.00 0.00 ? 48  ILE A N    1  
ATOM 739   C CA   . ILE A 1 48  ? -244.141 0.301   100.680 1.00 0.00 ? 48  ILE A CA   1  
ATOM 740   C C    . ILE A 1 48  ? -245.158 0.452   101.819 1.00 0.00 ? 48  ILE A C    1  
ATOM 741   O O    . ILE A 1 48  ? -245.153 -0.307  102.788 1.00 0.00 ? 48  ILE A O    1  
ATOM 742   C CB   . ILE A 1 48  ? -242.731 0.033   101.257 1.00 0.00 ? 48  ILE A CB   1  
ATOM 743   C CG1  . ILE A 1 48  ? -241.681 0.065   100.142 1.00 0.00 ? 48  ILE A CG1  1  
ATOM 744   C CG2  . ILE A 1 48  ? -242.681 -1.316  101.977 1.00 0.00 ? 48  ILE A CG2  1  
ATOM 745   C CD1  . ILE A 1 48  ? -240.260 -0.114  100.639 1.00 0.00 ? 48  ILE A CD1  1  
ATOM 746   H H    . ILE A 1 48  ? -244.251 1.315   98.826  1.00 0.00 ? 48  ILE A H    1  
ATOM 747   H HA   . ILE A 1 48  ? -244.428 -0.551  100.087 1.00 0.00 ? 48  ILE A HA   1  
ATOM 748   H HB   . ILE A 1 48  ? -242.513 0.810   101.966 1.00 0.00 ? 48  ILE A HB   1  
ATOM 749   H HG12 . ILE A 1 48  ? -241.888 -0.728  99.439  1.00 0.00 ? 48  ILE A HG12 1  
ATOM 750   H HG13 . ILE A 1 48  ? -241.738 1.015   99.632  1.00 0.00 ? 48  ILE A HG13 1  
ATOM 751   H HG21 . ILE A 1 48  ? -243.443 -1.344  102.747 1.00 0.00 ? 48  ILE A HG21 1  
ATOM 752   H HG22 . ILE A 1 48  ? -242.860 -2.110  101.268 1.00 0.00 ? 48  ILE A HG22 1  
ATOM 753   H HG23 . ILE A 1 48  ? -241.711 -1.450  102.430 1.00 0.00 ? 48  ILE A HG23 1  
ATOM 754   H HD11 . ILE A 1 48  ? -240.019 0.677   101.333 1.00 0.00 ? 48  ILE A HD11 1  
ATOM 755   H HD12 . ILE A 1 48  ? -240.170 -1.068  101.135 1.00 0.00 ? 48  ILE A HD12 1  
ATOM 756   H HD13 . ILE A 1 48  ? -239.579 -0.078  99.801  1.00 0.00 ? 48  ILE A HD13 1  
ATOM 757   N N    . LYS A 1 49  ? -246.072 1.391   101.685 1.00 0.00 ? 49  LYS A N    1  
ATOM 758   C CA   . LYS A 1 49  ? -247.038 1.627   102.730 1.00 0.00 ? 49  LYS A CA   1  
ATOM 759   C C    . LYS A 1 49  ? -248.467 1.453   102.240 1.00 0.00 ? 49  LYS A C    1  
ATOM 760   O O    . LYS A 1 49  ? -249.141 2.417   101.877 1.00 0.00 ? 49  LYS A O    1  
ATOM 761   C CB   . LYS A 1 49  ? -246.839 3.016   103.320 1.00 0.00 ? 49  LYS A CB   1  
ATOM 762   C CG   . LYS A 1 49  ? -245.521 3.190   104.058 1.00 0.00 ? 49  LYS A CG   1  
ATOM 763   C CD   . LYS A 1 49  ? -245.440 4.544   104.742 1.00 0.00 ? 49  LYS A CD   1  
ATOM 764   C CE   . LYS A 1 49  ? -244.069 4.784   105.351 1.00 0.00 ? 49  LYS A CE   1  
ATOM 765   N NZ   . LYS A 1 49  ? -243.673 3.699   106.289 1.00 0.00 ? 49  LYS A NZ   1  
ATOM 766   H H    . LYS A 1 49  ? -246.092 1.941   100.884 1.00 0.00 ? 49  LYS A H    1  
ATOM 767   H HA   . LYS A 1 49  ? -246.861 0.891   103.501 1.00 0.00 ? 49  LYS A HA   1  
ATOM 768   H HB2  . LYS A 1 49  ? -246.875 3.742   102.519 1.00 0.00 ? 49  LYS A HB2  1  
ATOM 769   H HB3  . LYS A 1 49  ? -247.638 3.211   103.998 1.00 0.00 ? 49  LYS A HB3  1  
ATOM 770   H HG2  . LYS A 1 49  ? -245.432 2.414   104.804 1.00 0.00 ? 49  LYS A HG2  1  
ATOM 771   H HG3  . LYS A 1 49  ? -244.710 3.105   103.349 1.00 0.00 ? 49  LYS A HG3  1  
ATOM 772   H HD2  . LYS A 1 49  ? -245.640 5.316   104.015 1.00 0.00 ? 49  LYS A HD2  1  
ATOM 773   H HD3  . LYS A 1 49  ? -246.184 4.583   105.525 1.00 0.00 ? 49  LYS A HD3  1  
ATOM 774   H HE2  . LYS A 1 49  ? -243.342 4.840   104.555 1.00 0.00 ? 49  LYS A HE2  1  
ATOM 775   H HE3  . LYS A 1 49  ? -244.087 5.721   105.887 1.00 0.00 ? 49  LYS A HE3  1  
ATOM 776   H HZ1  . LYS A 1 49  ? -244.458 3.477   106.941 1.00 0.00 ? 49  LYS A HZ1  1  
ATOM 777   H HZ2  . LYS A 1 49  ? -243.423 2.837   105.757 1.00 0.00 ? 49  LYS A HZ2  1  
ATOM 778   H HZ3  . LYS A 1 49  ? -242.844 3.995   106.850 1.00 0.00 ? 49  LYS A HZ3  1  
ATOM 779   N N    . PRO A 1 50  ? -248.906 0.194   102.143 1.00 0.00 ? 50  PRO A N    1  
ATOM 780   C CA   . PRO A 1 50  ? -250.311 -0.176  101.924 1.00 0.00 ? 50  PRO A CA   1  
ATOM 781   C C    . PRO A 1 50  ? -251.292 0.354   102.947 1.00 0.00 ? 50  PRO A C    1  
ATOM 782   O O    . PRO A 1 50  ? -251.027 1.282   103.710 1.00 0.00 ? 50  PRO A O    1  
ATOM 783   C CB   . PRO A 1 50  ? -250.250 -1.681  102.103 1.00 0.00 ? 50  PRO A CB   1  
ATOM 784   C CG   . PRO A 1 50  ? -248.962 -2.012  101.520 1.00 0.00 ? 50  PRO A CG   1  
ATOM 785   C CD   . PRO A 1 50  ? -248.051 -1.012  102.125 1.00 0.00 ? 50  PRO A CD   1  
ATOM 786   H HA   . PRO A 1 50  ? -250.646 0.056   100.926 1.00 0.00 ? 50  PRO A HA   1  
ATOM 787   H HB2  . PRO A 1 50  ? -250.286 -1.925  103.155 1.00 0.00 ? 50  PRO A HB2  1  
ATOM 788   H HB3  . PRO A 1 50  ? -251.048 -2.152  101.595 1.00 0.00 ? 50  PRO A HB3  1  
ATOM 789   H HG2  . PRO A 1 50  ? -248.678 -3.011  101.792 1.00 0.00 ? 50  PRO A HG2  1  
ATOM 790   H HG3  . PRO A 1 50  ? -249.007 -1.889  100.456 1.00 0.00 ? 50  PRO A HG3  1  
ATOM 791   H HD2  . PRO A 1 50  ? -247.777 -1.323  103.113 1.00 0.00 ? 50  PRO A HD2  1  
ATOM 792   H HD3  . PRO A 1 50  ? -247.178 -0.862  101.509 1.00 0.00 ? 50  PRO A HD3  1  
ATOM 793   N N    . VAL A 1 51  ? -252.432 -0.304  102.950 1.00 0.00 ? 51  VAL A N    1  
ATOM 794   C CA   . VAL A 1 51  ? -253.442 -0.106  103.971 1.00 0.00 ? 51  VAL A CA   1  
ATOM 795   C C    . VAL A 1 51  ? -253.250 -1.194  105.012 1.00 0.00 ? 51  VAL A C    1  
ATOM 796   O O    . VAL A 1 51  ? -253.955 -2.203  105.026 1.00 0.00 ? 51  VAL A O    1  
ATOM 797   C CB   . VAL A 1 51  ? -254.879 -0.171  103.407 1.00 0.00 ? 51  VAL A CB   1  
ATOM 798   C CG1  . VAL A 1 51  ? -255.896 0.230   104.466 1.00 0.00 ? 51  VAL A CG1  1  
ATOM 799   C CG2  . VAL A 1 51  ? -255.012 0.707   102.172 1.00 0.00 ? 51  VAL A CG2  1  
ATOM 800   H H    . VAL A 1 51  ? -252.578 -0.977  102.248 1.00 0.00 ? 51  VAL A H    1  
ATOM 801   H HA   . VAL A 1 51  ? -253.284 0.861   104.429 1.00 0.00 ? 51  VAL A HA   1  
ATOM 802   H HB   . VAL A 1 51  ? -255.082 -1.194  103.119 1.00 0.00 ? 51  VAL A HB   1  
ATOM 803   H HG11 . VAL A 1 51  ? -255.799 -0.422  105.320 1.00 0.00 ? 51  VAL A HG11 1  
ATOM 804   H HG12 . VAL A 1 51  ? -255.717 1.251   104.769 1.00 0.00 ? 51  VAL A HG12 1  
ATOM 805   H HG13 . VAL A 1 51  ? -256.892 0.145   104.059 1.00 0.00 ? 51  VAL A HG13 1  
ATOM 806   H HG21 . VAL A 1 51  ? -254.781 1.730   102.429 1.00 0.00 ? 51  VAL A HG21 1  
ATOM 807   H HG22 . VAL A 1 51  ? -254.326 0.364   101.412 1.00 0.00 ? 51  VAL A HG22 1  
ATOM 808   H HG23 . VAL A 1 51  ? -256.022 0.649   101.795 1.00 0.00 ? 51  VAL A HG23 1  
ATOM 809   N N    . THR A 1 52  ? -252.235 -1.011  105.828 1.00 0.00 ? 52  THR A N    1  
ATOM 810   C CA   . THR A 1 52  ? -251.794 -2.032  106.745 1.00 0.00 ? 52  THR A CA   1  
ATOM 811   C C    . THR A 1 52  ? -252.778 -2.187  107.899 1.00 0.00 ? 52  THR A C    1  
ATOM 812   O O    . THR A 1 52  ? -252.800 -1.387  108.835 1.00 0.00 ? 52  THR A O    1  
ATOM 813   C CB   . THR A 1 52  ? -250.377 -1.691  107.230 1.00 0.00 ? 52  THR A CB   1  
ATOM 814   O OG1  . THR A 1 52  ? -250.357 -0.382  107.818 1.00 0.00 ? 52  THR A OG1  1  
ATOM 815   C CG2  . THR A 1 52  ? -249.412 -1.731  106.047 1.00 0.00 ? 52  THR A CG2  1  
ATOM 816   H H    . THR A 1 52  ? -251.762 -0.152  105.819 1.00 0.00 ? 52  THR A H    1  
ATOM 817   H HA   . THR A 1 52  ? -251.748 -2.965  106.203 1.00 0.00 ? 52  THR A HA   1  
ATOM 818   H HB   . THR A 1 52  ? -250.067 -2.419  107.959 1.00 0.00 ? 52  THR A HB   1  
ATOM 819   H HG1  . THR A 1 52  ? -251.019 -0.339  108.521 1.00 0.00 ? 52  THR A HG1  1  
ATOM 820   H HG21 . THR A 1 52  ? -249.784 -1.095  105.252 1.00 0.00 ? 52  THR A HG21 1  
ATOM 821   H HG22 . THR A 1 52  ? -248.438 -1.387  106.362 1.00 0.00 ? 52  THR A HG22 1  
ATOM 822   H HG23 . THR A 1 52  ? -249.336 -2.746  105.680 1.00 0.00 ? 52  THR A HG23 1  
ATOM 823   N N    . THR A 1 53  ? -253.620 -3.205  107.794 1.00 0.00 ? 53  THR A N    1  
ATOM 824   C CA   . THR A 1 53  ? -254.731 -3.373  108.697 1.00 0.00 ? 53  THR A CA   1  
ATOM 825   C C    . THR A 1 53  ? -254.539 -4.569  109.630 1.00 0.00 ? 53  THR A C    1  
ATOM 826   O O    . THR A 1 53  ? -253.421 -5.017  109.879 1.00 0.00 ? 53  THR A O    1  
ATOM 827   C CB   . THR A 1 53  ? -256.047 -3.485  107.872 1.00 0.00 ? 53  THR A CB   1  
ATOM 828   O OG1  . THR A 1 53  ? -257.201 -3.575  108.718 1.00 0.00 ? 53  THR A OG1  1  
ATOM 829   C CG2  . THR A 1 53  ? -256.010 -4.685  106.939 1.00 0.00 ? 53  THR A CG2  1  
ATOM 830   H H    . THR A 1 53  ? -253.499 -3.854  107.075 1.00 0.00 ? 53  THR A H    1  
ATOM 831   H HA   . THR A 1 53  ? -254.795 -2.495  109.301 1.00 0.00 ? 53  THR A HA   1  
ATOM 832   H HB   . THR A 1 53  ? -256.136 -2.595  107.267 1.00 0.00 ? 53  THR A HB   1  
ATOM 833   H HG1  . THR A 1 53  ? -257.367 -2.716  109.135 1.00 0.00 ? 53  THR A HG1  1  
ATOM 834   H HG21 . THR A 1 53  ? -255.171 -4.590  106.264 1.00 0.00 ? 53  THR A HG21 1  
ATOM 835   H HG22 . THR A 1 53  ? -255.905 -5.591  107.518 1.00 0.00 ? 53  THR A HG22 1  
ATOM 836   H HG23 . THR A 1 53  ? -256.926 -4.725  106.369 1.00 0.00 ? 53  THR A HG23 1  
ATOM 837   N N    . ASP A 1 54  ? -255.656 -5.067  110.114 1.00 0.00 ? 54  ASP A N    1  
ATOM 838   C CA   . ASP A 1 54  ? -255.741 -6.051  111.188 1.00 0.00 ? 54  ASP A CA   1  
ATOM 839   C C    . ASP A 1 54  ? -255.386 -7.450  110.737 1.00 0.00 ? 54  ASP A C    1  
ATOM 840   O O    . ASP A 1 54  ? -255.813 -8.441  111.316 1.00 0.00 ? 54  ASP A O    1  
ATOM 841   C CB   . ASP A 1 54  ? -257.153 -6.062  111.670 1.00 0.00 ? 54  ASP A CB   1  
ATOM 842   C CG   . ASP A 1 54  ? -257.548 -4.755  112.327 1.00 0.00 ? 54  ASP A CG   1  
ATOM 843   O OD1  . ASP A 1 54  ? -257.113 -4.504  113.470 1.00 0.00 ? 54  ASP A OD1  1  
ATOM 844   O OD2  . ASP A 1 54  ? -258.269 -3.960  111.694 1.00 0.00 ? 54  ASP A OD2  1  
ATOM 845   H H    . ASP A 1 54  ? -256.498 -4.750  109.713 1.00 0.00 ? 54  ASP A H    1  
ATOM 846   H HA   . ASP A 1 54  ? -255.096 -5.752  111.998 1.00 0.00 ? 54  ASP A HA   1  
ATOM 847   H HB2  . ASP A 1 54  ? -257.786 -6.233  110.816 1.00 0.00 ? 54  ASP A HB2  1  
ATOM 848   H HB3  . ASP A 1 54  ? -257.265 -6.862  112.368 1.00 0.00 ? 54  ASP A HB3  1  
ATOM 849   N N    . TYR A 1 55  ? -254.635 -7.514  109.693 1.00 0.00 ? 55  TYR A N    1  
ATOM 850   C CA   . TYR A 1 55  ? -254.129 -8.783  109.183 1.00 0.00 ? 55  TYR A CA   1  
ATOM 851   C C    . TYR A 1 55  ? -253.173 -9.444  110.176 1.00 0.00 ? 55  TYR A C    1  
ATOM 852   O O    . TYR A 1 55  ? -252.448 -8.763  110.902 1.00 0.00 ? 55  TYR A O    1  
ATOM 853   C CB   . TYR A 1 55  ? -253.376 -8.571  107.881 1.00 0.00 ? 55  TYR A CB   1  
ATOM 854   C CG   . TYR A 1 55  ? -254.227 -8.178  106.705 1.00 0.00 ? 55  TYR A CG   1  
ATOM 855   C CD1  . TYR A 1 55  ? -255.496 -8.698  106.537 1.00 0.00 ? 55  TYR A CD1  1  
ATOM 856   C CD2  . TYR A 1 55  ? -253.741 -7.297  105.749 1.00 0.00 ? 55  TYR A CD2  1  
ATOM 857   C CE1  . TYR A 1 55  ? -256.266 -8.353  105.450 1.00 0.00 ? 55  TYR A CE1  1  
ATOM 858   C CE2  . TYR A 1 55  ? -254.503 -6.941  104.658 1.00 0.00 ? 55  TYR A CE2  1  
ATOM 859   C CZ   . TYR A 1 55  ? -255.767 -7.472  104.510 1.00 0.00 ? 55  TYR A CZ   1  
ATOM 860   O OH   . TYR A 1 55  ? -256.530 -7.125  103.420 1.00 0.00 ? 55  TYR A OH   1  
ATOM 861   H H    . TYR A 1 55  ? -254.437 -6.677  109.235 1.00 0.00 ? 55  TYR A H    1  
ATOM 862   H HA   . TYR A 1 55  ? -254.969 -9.438  109.006 1.00 0.00 ? 55  TYR A HA   1  
ATOM 863   H HB2  . TYR A 1 55  ? -252.660 -7.791  108.034 1.00 0.00 ? 55  TYR A HB2  1  
ATOM 864   H HB3  . TYR A 1 55  ? -252.858 -9.477  107.628 1.00 0.00 ? 55  TYR A HB3  1  
ATOM 865   H HD1  . TYR A 1 55  ? -255.882 -9.384  107.275 1.00 0.00 ? 55  TYR A HD1  1  
ATOM 866   H HD2  . TYR A 1 55  ? -252.750 -6.885  105.869 1.00 0.00 ? 55  TYR A HD2  1  
ATOM 867   H HE1  . TYR A 1 55  ? -257.254 -8.772  105.343 1.00 0.00 ? 55  TYR A HE1  1  
ATOM 868   H HE2  . TYR A 1 55  ? -254.106 -6.251  103.928 1.00 0.00 ? 55  TYR A HE2  1  
ATOM 869   H HH   . TYR A 1 55  ? -256.013 -7.239  102.619 1.00 0.00 ? 55  TYR A HH   1  
ATOM 870   N N    . PHE A 1 56  ? -253.185 -10.771 110.199 1.00 0.00 ? 56  PHE A N    1  
ATOM 871   C CA   . PHE A 1 56  ? -252.214 -11.545 110.966 1.00 0.00 ? 56  PHE A CA   1  
ATOM 872   C C    . PHE A 1 56  ? -251.995 -12.894 110.291 1.00 0.00 ? 56  PHE A C    1  
ATOM 873   O O    . PHE A 1 56  ? -252.724 -13.257 109.376 1.00 0.00 ? 56  PHE A O    1  
ATOM 874   C CB   . PHE A 1 56  ? -252.650 -11.732 112.429 1.00 0.00 ? 56  PHE A CB   1  
ATOM 875   C CG   . PHE A 1 56  ? -253.937 -12.487 112.614 1.00 0.00 ? 56  PHE A CG   1  
ATOM 876   C CD1  . PHE A 1 56  ? -253.955 -13.875 112.628 1.00 0.00 ? 56  PHE A CD1  1  
ATOM 877   C CD2  . PHE A 1 56  ? -255.128 -11.805 112.786 1.00 0.00 ? 56  PHE A CD2  1  
ATOM 878   C CE1  . PHE A 1 56  ? -255.141 -14.562 112.807 1.00 0.00 ? 56  PHE A CE1  1  
ATOM 879   C CE2  . PHE A 1 56  ? -256.313 -12.486 112.967 1.00 0.00 ? 56  PHE A CE2  1  
ATOM 880   C CZ   . PHE A 1 56  ? -256.323 -13.864 112.977 1.00 0.00 ? 56  PHE A CZ   1  
ATOM 881   H H    . PHE A 1 56  ? -253.862 -11.251 109.671 1.00 0.00 ? 56  PHE A H    1  
ATOM 882   H HA   . PHE A 1 56  ? -251.280 -11.000 110.947 1.00 0.00 ? 56  PHE A HA   1  
ATOM 883   H HB2  . PHE A 1 56  ? -251.877 -12.270 112.954 1.00 0.00 ? 56  PHE A HB2  1  
ATOM 884   H HB3  . PHE A 1 56  ? -252.768 -10.758 112.883 1.00 0.00 ? 56  PHE A HB3  1  
ATOM 885   H HD1  . PHE A 1 56  ? -253.027 -14.422 112.494 1.00 0.00 ? 56  PHE A HD1  1  
ATOM 886   H HD2  . PHE A 1 56  ? -255.126 -10.725 112.776 1.00 0.00 ? 56  PHE A HD2  1  
ATOM 887   H HE1  . PHE A 1 56  ? -255.146 -15.644 112.814 1.00 0.00 ? 56  PHE A HE1  1  
ATOM 888   H HE2  . PHE A 1 56  ? -257.235 -11.940 113.100 1.00 0.00 ? 56  PHE A HE2  1  
ATOM 889   H HZ   . PHE A 1 56  ? -257.254 -14.395 113.117 1.00 0.00 ? 56  PHE A HZ   1  
ATOM 890   N N    . LEU A 1 57  ? -251.005 -13.634 110.751 1.00 0.00 ? 57  LEU A N    1  
ATOM 891   C CA   . LEU A 1 57  ? -250.595 -14.871 110.092 1.00 0.00 ? 57  LEU A CA   1  
ATOM 892   C C    . LEU A 1 57  ? -251.140 -16.038 110.865 1.00 0.00 ? 57  LEU A C    1  
ATOM 893   O O    . LEU A 1 57  ? -251.640 -15.863 111.964 1.00 0.00 ? 57  LEU A O    1  
ATOM 894   C CB   . LEU A 1 57  ? -249.064 -14.990 109.997 1.00 0.00 ? 57  LEU A CB   1  
ATOM 895   C CG   . LEU A 1 57  ? -248.361 -13.912 109.170 1.00 0.00 ? 57  LEU A CG   1  
ATOM 896   C CD1  . LEU A 1 57  ? -248.637 -12.559 109.770 1.00 0.00 ? 57  LEU A CD1  1  
ATOM 897   C CD2  . LEU A 1 57  ? -246.866 -14.167 109.097 1.00 0.00 ? 57  LEU A CD2  1  
ATOM 898   H H    . LEU A 1 57  ? -250.541 -13.356 111.568 1.00 0.00 ? 57  LEU A H    1  
ATOM 899   H HA   . LEU A 1 57  ? -251.012 -14.887 109.095 1.00 0.00 ? 57  LEU A HA   1  
ATOM 900   H HB2  . LEU A 1 57  ? -248.663 -14.961 110.999 1.00 0.00 ? 57  LEU A HB2  1  
ATOM 901   H HB3  . LEU A 1 57  ? -248.829 -15.951 109.565 1.00 0.00 ? 57  LEU A HB3  1  
ATOM 902   H HG   . LEU A 1 57  ? -248.757 -13.921 108.164 1.00 0.00 ? 57  LEU A HG   1  
ATOM 903   H HD11 . LEU A 1 57  ? -248.500 -12.620 110.850 1.00 0.00 ? 57  LEU A HD11 1  
ATOM 904   H HD12 . LEU A 1 57  ? -247.965 -11.826 109.354 1.00 0.00 ? 57  LEU A HD12 1  
ATOM 905   H HD13 . LEU A 1 57  ? -249.669 -12.290 109.544 1.00 0.00 ? 57  LEU A HD13 1  
ATOM 906   H HD21 . LEU A 1 57  ? -246.686 -15.158 108.706 1.00 0.00 ? 57  LEU A HD21 1  
ATOM 907   H HD22 . LEU A 1 57  ? -246.407 -13.435 108.448 1.00 0.00 ? 57  LEU A HD22 1  
ATOM 908   H HD23 . LEU A 1 57  ? -246.439 -14.086 110.086 1.00 0.00 ? 57  LEU A HD23 1  
ATOM 909   N N    . MET A 1 58  ? -251.079 -17.215 110.280 1.00 0.00 ? 58  MET A N    1  
ATOM 910   C CA   . MET A 1 58  ? -251.504 -18.426 110.957 1.00 0.00 ? 58  MET A CA   1  
ATOM 911   C C    . MET A 1 58  ? -250.834 -19.635 110.346 1.00 0.00 ? 58  MET A C    1  
ATOM 912   O O    . MET A 1 58  ? -250.758 -19.752 109.126 1.00 0.00 ? 58  MET A O    1  
ATOM 913   C CB   . MET A 1 58  ? -253.018 -18.604 110.857 1.00 0.00 ? 58  MET A CB   1  
ATOM 914   C CG   . MET A 1 58  ? -253.822 -17.731 111.799 1.00 0.00 ? 58  MET A CG   1  
ATOM 915   S SD   . MET A 1 58  ? -255.579 -18.099 111.731 1.00 0.00 ? 58  MET A SD   1  
ATOM 916   C CE   . MET A 1 58  ? -255.497 -19.873 111.579 1.00 0.00 ? 58  MET A CE   1  
ATOM 917   H H    . MET A 1 58  ? -250.749 -17.273 109.356 1.00 0.00 ? 58  MET A H    1  
ATOM 918   H HA   . MET A 1 58  ? -251.220 -18.351 111.996 1.00 0.00 ? 58  MET A HA   1  
ATOM 919   H HB2  . MET A 1 58  ? -253.325 -18.373 109.849 1.00 0.00 ? 58  MET A HB2  1  
ATOM 920   H HB3  . MET A 1 58  ? -253.261 -19.634 111.064 1.00 0.00 ? 58  MET A HB3  1  
ATOM 921   H HG2  . MET A 1 58  ? -253.469 -17.884 112.808 1.00 0.00 ? 58  MET A HG2  1  
ATOM 922   H HG3  . MET A 1 58  ? -253.673 -16.701 111.516 1.00 0.00 ? 58  MET A HG3  1  
ATOM 923   H HE1  . MET A 1 58  ? -254.894 -20.270 112.384 1.00 0.00 ? 58  MET A HE1  1  
ATOM 924   H HE2  . MET A 1 58  ? -256.492 -20.286 111.628 1.00 0.00 ? 58  MET A HE2  1  
ATOM 925   H HE3  . MET A 1 58  ? -255.041 -20.126 110.626 1.00 0.00 ? 58  MET A HE3  1  
ATOM 926   N N    . GLU A 1 59  ? -250.341 -20.529 111.181 1.00 0.00 ? 59  GLU A N    1  
ATOM 927   C CA   . GLU A 1 59  ? -249.909 -21.815 110.689 1.00 0.00 ? 59  GLU A CA   1  
ATOM 928   C C    . GLU A 1 59  ? -251.074 -22.785 110.817 1.00 0.00 ? 59  GLU A C    1  
ATOM 929   O O    . GLU A 1 59  ? -251.507 -23.126 111.921 1.00 0.00 ? 59  GLU A O    1  
ATOM 930   C CB   . GLU A 1 59  ? -248.658 -22.341 111.417 1.00 0.00 ? 59  GLU A CB   1  
ATOM 931   C CG   . GLU A 1 59  ? -248.855 -22.648 112.895 1.00 0.00 ? 59  GLU A CG   1  
ATOM 932   C CD   . GLU A 1 59  ? -247.759 -23.535 113.452 1.00 0.00 ? 59  GLU A CD   1  
ATOM 933   O OE1  . GLU A 1 59  ? -247.686 -24.718 113.045 1.00 0.00 ? 59  GLU A OE1  1  
ATOM 934   O OE2  . GLU A 1 59  ? -246.971 -23.056 114.288 1.00 0.00 ? 59  GLU A OE2  1  
ATOM 935   H H    . GLU A 1 59  ? -250.281 -20.327 112.141 1.00 0.00 ? 59  GLU A H    1  
ATOM 936   H HA   . GLU A 1 59  ? -249.681 -21.697 109.639 1.00 0.00 ? 59  GLU A HA   1  
ATOM 937   H HB2  . GLU A 1 59  ? -248.333 -23.249 110.929 1.00 0.00 ? 59  GLU A HB2  1  
ATOM 938   H HB3  . GLU A 1 59  ? -247.874 -21.602 111.328 1.00 0.00 ? 59  GLU A HB3  1  
ATOM 939   H HG2  . GLU A 1 59  ? -248.859 -21.720 113.446 1.00 0.00 ? 59  GLU A HG2  1  
ATOM 940   H HG3  . GLU A 1 59  ? -249.804 -23.148 113.024 1.00 0.00 ? 59  GLU A HG3  1  
ATOM 941   N N    . GLU A 1 60  ? -251.626 -23.180 109.689 1.00 0.00 ? 60  GLU A N    1  
ATOM 942   C CA   . GLU A 1 60  ? -252.736 -24.115 109.702 1.00 0.00 ? 60  GLU A CA   1  
ATOM 943   C C    . GLU A 1 60  ? -252.196 -25.528 109.522 1.00 0.00 ? 60  GLU A C    1  
ATOM 944   O O    . GLU A 1 60  ? -251.738 -25.905 108.440 1.00 0.00 ? 60  GLU A O    1  
ATOM 945   C CB   . GLU A 1 60  ? -253.768 -23.752 108.629 1.00 0.00 ? 60  GLU A CB   1  
ATOM 946   C CG   . GLU A 1 60  ? -254.309 -22.330 108.773 1.00 0.00 ? 60  GLU A CG   1  
ATOM 947   C CD   . GLU A 1 60  ? -255.410 -21.997 107.780 1.00 0.00 ? 60  GLU A CD   1  
ATOM 948   O OE1  . GLU A 1 60  ? -255.223 -22.259 106.574 1.00 0.00 ? 60  GLU A OE1  1  
ATOM 949   O OE2  . GLU A 1 60  ? -256.459 -21.451 108.199 1.00 0.00 ? 60  GLU A OE2  1  
ATOM 950   H H    . GLU A 1 60  ? -251.285 -22.827 108.832 1.00 0.00 ? 60  GLU A H    1  
ATOM 951   H HA   . GLU A 1 60  ? -253.203 -24.050 110.675 1.00 0.00 ? 60  GLU A HA   1  
ATOM 952   H HB2  . GLU A 1 60  ? -253.310 -23.845 107.656 1.00 0.00 ? 60  GLU A HB2  1  
ATOM 953   H HB3  . GLU A 1 60  ? -254.599 -24.440 108.696 1.00 0.00 ? 60  GLU A HB3  1  
ATOM 954   H HG2  . GLU A 1 60  ? -254.703 -22.211 109.772 1.00 0.00 ? 60  GLU A HG2  1  
ATOM 955   H HG3  . GLU A 1 60  ? -253.493 -21.636 108.628 1.00 0.00 ? 60  GLU A HG3  1  
ATOM 956   N N    . LYS A 1 61  ? -252.229 -26.284 110.612 1.00 0.00 ? 61  LYS A N    1  
ATOM 957   C CA   . LYS A 1 61  ? -251.550 -27.568 110.696 1.00 0.00 ? 61  LYS A CA   1  
ATOM 958   C C    . LYS A 1 61  ? -252.539 -28.663 111.101 1.00 0.00 ? 61  LYS A C    1  
ATOM 959   O O    . LYS A 1 61  ? -253.720 -28.388 111.309 1.00 0.00 ? 61  LYS A O    1  
ATOM 960   C CB   . LYS A 1 61  ? -250.427 -27.462 111.740 1.00 0.00 ? 61  LYS A CB   1  
ATOM 961   C CG   . LYS A 1 61  ? -249.368 -28.550 111.648 1.00 0.00 ? 61  LYS A CG   1  
ATOM 962   C CD   . LYS A 1 61  ? -248.381 -28.287 110.522 1.00 0.00 ? 61  LYS A CD   1  
ATOM 963   C CE   . LYS A 1 61  ? -247.505 -27.071 110.807 1.00 0.00 ? 61  LYS A CE   1  
ATOM 964   N NZ   . LYS A 1 61  ? -246.779 -27.191 112.101 1.00 0.00 ? 61  LYS A NZ   1  
ATOM 965   H H    . LYS A 1 61  ? -252.743 -25.973 111.389 1.00 0.00 ? 61  LYS A H    1  
ATOM 966   H HA   . LYS A 1 61  ? -251.126 -27.799 109.730 1.00 0.00 ? 61  LYS A HA   1  
ATOM 967   H HB2  . LYS A 1 61  ? -249.936 -26.507 111.624 1.00 0.00 ? 61  LYS A HB2  1  
ATOM 968   H HB3  . LYS A 1 61  ? -250.870 -27.507 112.725 1.00 0.00 ? 61  LYS A HB3  1  
ATOM 969   H HG2  . LYS A 1 61  ? -248.830 -28.593 112.583 1.00 0.00 ? 61  LYS A HG2  1  
ATOM 970   H HG3  . LYS A 1 61  ? -249.857 -29.497 111.470 1.00 0.00 ? 61  LYS A HG3  1  
ATOM 971   H HD2  . LYS A 1 61  ? -247.747 -29.152 110.402 1.00 0.00 ? 61  LYS A HD2  1  
ATOM 972   H HD3  . LYS A 1 61  ? -248.932 -28.114 109.609 1.00 0.00 ? 61  LYS A HD3  1  
ATOM 973   H HE2  . LYS A 1 61  ? -246.784 -26.968 110.010 1.00 0.00 ? 61  LYS A HE2  1  
ATOM 974   H HE3  . LYS A 1 61  ? -248.134 -26.192 110.838 1.00 0.00 ? 61  LYS A HE3  1  
ATOM 975   H HZ1  . LYS A 1 61  ? -246.372 -28.152 112.203 1.00 0.00 ? 61  LYS A HZ1  1  
ATOM 976   H HZ2  . LYS A 1 61  ? -246.013 -26.491 112.149 1.00 0.00 ? 61  LYS A HZ2  1  
ATOM 977   H HZ3  . LYS A 1 61  ? -247.430 -27.019 112.892 1.00 0.00 ? 61  LYS A HZ3  1  
ATOM 978   N N    . TYR A 1 62  ? -252.048 -29.896 111.200 1.00 0.00 ? 62  TYR A N    1  
ATOM 979   C CA   . TYR A 1 62  ? -252.841 -31.024 111.675 1.00 0.00 ? 62  TYR A CA   1  
ATOM 980   C C    . TYR A 1 62  ? -251.951 -32.016 112.423 1.00 0.00 ? 62  TYR A C    1  
ATOM 981   O O    . TYR A 1 62  ? -250.800 -31.708 112.727 1.00 0.00 ? 62  TYR A O    1  
ATOM 982   C CB   . TYR A 1 62  ? -253.568 -31.712 110.518 1.00 0.00 ? 62  TYR A CB   1  
ATOM 983   C CG   . TYR A 1 62  ? -254.896 -31.075 110.182 1.00 0.00 ? 62  TYR A CG   1  
ATOM 984   C CD1  . TYR A 1 62  ? -255.965 -31.172 111.062 1.00 0.00 ? 62  TYR A CD1  1  
ATOM 985   C CD2  . TYR A 1 62  ? -255.082 -30.379 108.995 1.00 0.00 ? 62  TYR A CD2  1  
ATOM 986   C CE1  . TYR A 1 62  ? -257.184 -30.593 110.771 1.00 0.00 ? 62  TYR A CE1  1  
ATOM 987   C CE2  . TYR A 1 62  ? -256.299 -29.795 108.696 1.00 0.00 ? 62  TYR A CE2  1  
ATOM 988   C CZ   . TYR A 1 62  ? -257.346 -29.905 109.588 1.00 0.00 ? 62  TYR A CZ   1  
ATOM 989   O OH   . TYR A 1 62  ? -258.562 -29.328 109.294 1.00 0.00 ? 62  TYR A OH   1  
ATOM 990   H H    . TYR A 1 62  ? -251.113 -30.054 110.956 1.00 0.00 ? 62  TYR A H    1  
ATOM 991   H HA   . TYR A 1 62  ? -253.574 -30.636 112.369 1.00 0.00 ? 62  TYR A HA   1  
ATOM 992   H HB2  . TYR A 1 62  ? -252.947 -31.671 109.635 1.00 0.00 ? 62  TYR A HB2  1  
ATOM 993   H HB3  . TYR A 1 62  ? -253.750 -32.745 110.779 1.00 0.00 ? 62  TYR A HB3  1  
ATOM 994   H HD1  . TYR A 1 62  ? -255.835 -31.710 111.989 1.00 0.00 ? 62  TYR A HD1  1  
ATOM 995   H HD2  . TYR A 1 62  ? -254.261 -30.298 108.299 1.00 0.00 ? 62  TYR A HD2  1  
ATOM 996   H HE1  . TYR A 1 62  ? -258.002 -30.679 111.470 1.00 0.00 ? 62  TYR A HE1  1  
ATOM 997   H HE2  . TYR A 1 62  ? -256.426 -29.255 107.769 1.00 0.00 ? 62  TYR A HE2  1  
ATOM 998   H HH   . TYR A 1 62  ? -258.859 -28.809 110.049 1.00 0.00 ? 62  TYR A HH   1  
ATOM 999   N N    . PHE A 1 63  ? -252.477 -33.201 112.710 1.00 0.00 ? 63  PHE A N    1  
ATOM 1000  C CA   . PHE A 1 63  ? -251.775 -34.164 113.558 1.00 0.00 ? 63  PHE A CA   1  
ATOM 1001  C C    . PHE A 1 63  ? -251.022 -35.195 112.727 1.00 0.00 ? 63  PHE A C    1  
ATOM 1002  O O    . PHE A 1 63  ? -250.063 -35.806 113.205 1.00 0.00 ? 63  PHE A O    1  
ATOM 1003  C CB   . PHE A 1 63  ? -252.762 -34.880 114.483 1.00 0.00 ? 63  PHE A CB   1  
ATOM 1004  C CG   . PHE A 1 63  ? -253.463 -33.971 115.454 1.00 0.00 ? 63  PHE A CG   1  
ATOM 1005  C CD1  . PHE A 1 63  ? -252.871 -33.640 116.662 1.00 0.00 ? 63  PHE A CD1  1  
ATOM 1006  C CD2  . PHE A 1 63  ? -254.716 -33.454 115.161 1.00 0.00 ? 63  PHE A CD2  1  
ATOM 1007  C CE1  . PHE A 1 63  ? -253.514 -32.809 117.559 1.00 0.00 ? 63  PHE A CE1  1  
ATOM 1008  C CE2  . PHE A 1 63  ? -255.365 -32.624 116.056 1.00 0.00 ? 63  PHE A CE2  1  
ATOM 1009  C CZ   . PHE A 1 63  ? -254.763 -32.301 117.257 1.00 0.00 ? 63  PHE A CZ   1  
ATOM 1010  H H    . PHE A 1 63  ? -253.348 -33.448 112.323 1.00 0.00 ? 63  PHE A H    1  
ATOM 1011  H HA   . PHE A 1 63  ? -251.065 -33.618 114.159 1.00 0.00 ? 63  PHE A HA   1  
ATOM 1012  H HB2  . PHE A 1 63  ? -253.517 -35.367 113.883 1.00 0.00 ? 63  PHE A HB2  1  
ATOM 1013  H HB3  . PHE A 1 63  ? -252.229 -35.627 115.052 1.00 0.00 ? 63  PHE A HB3  1  
ATOM 1014  H HD1  . PHE A 1 63  ? -251.894 -34.036 116.899 1.00 0.00 ? 63  PHE A HD1  1  
ATOM 1015  H HD2  . PHE A 1 63  ? -255.187 -33.706 114.222 1.00 0.00 ? 63  PHE A HD2  1  
ATOM 1016  H HE1  . PHE A 1 63  ? -253.042 -32.559 118.498 1.00 0.00 ? 63  PHE A HE1  1  
ATOM 1017  H HE2  . PHE A 1 63  ? -256.341 -32.227 115.815 1.00 0.00 ? 63  PHE A HE2  1  
ATOM 1018  H HZ   . PHE A 1 63  ? -255.267 -31.654 117.958 1.00 0.00 ? 63  PHE A HZ   1  
ATOM 1019  N N    . ILE A 1 64  ? -251.477 -35.393 111.492 1.00 0.00 ? 64  ILE A N    1  
ATOM 1020  C CA   . ILE A 1 64  ? -250.891 -36.376 110.577 1.00 0.00 ? 64  ILE A CA   1  
ATOM 1021  C C    . ILE A 1 64  ? -251.136 -37.792 111.113 1.00 0.00 ? 64  ILE A C    1  
ATOM 1022  O O    . ILE A 1 64  ? -250.428 -38.743 110.784 1.00 0.00 ? 64  ILE A O    1  
ATOM 1023  C CB   . ILE A 1 64  ? -249.369 -36.140 110.365 1.00 0.00 ? 64  ILE A CB   1  
ATOM 1024  C CG1  . ILE A 1 64  ? -249.074 -34.647 110.179 1.00 0.00 ? 64  ILE A CG1  1  
ATOM 1025  C CG2  . ILE A 1 64  ? -248.863 -36.919 109.152 1.00 0.00 ? 64  ILE A CG2  1  
ATOM 1026  C CD1  . ILE A 1 64  ? -247.602 -34.327 110.039 1.00 0.00 ? 64  ILE A CD1  1  
ATOM 1027  H H    . ILE A 1 64  ? -252.255 -34.870 111.188 1.00 0.00 ? 64  ILE A H    1  
ATOM 1028  H HA   . ILE A 1 64  ? -251.389 -36.275 109.622 1.00 0.00 ? 64  ILE A HA   1  
ATOM 1029  H HB   . ILE A 1 64  ? -248.849 -36.499 111.239 1.00 0.00 ? 64  ILE A HB   1  
ATOM 1030  H HG12 . ILE A 1 64  ? -249.573 -34.299 109.288 1.00 0.00 ? 64  ILE A HG12 1  
ATOM 1031  H HG13 . ILE A 1 64  ? -249.452 -34.104 111.032 1.00 0.00 ? 64  ILE A HG13 1  
ATOM 1032  H HG21 . ILE A 1 64  ? -249.408 -36.610 108.270 1.00 0.00 ? 64  ILE A HG21 1  
ATOM 1033  H HG22 . ILE A 1 64  ? -247.811 -36.724 109.012 1.00 0.00 ? 64  ILE A HG22 1  
ATOM 1034  H HG23 . ILE A 1 64  ? -249.014 -37.977 109.315 1.00 0.00 ? 64  ILE A HG23 1  
ATOM 1035  H HD11 . ILE A 1 64  ? -247.200 -34.850 109.185 1.00 0.00 ? 64  ILE A HD11 1  
ATOM 1036  H HD12 . ILE A 1 64  ? -247.475 -33.263 109.902 1.00 0.00 ? 64  ILE A HD12 1  
ATOM 1037  H HD13 . ILE A 1 64  ? -247.079 -34.639 110.931 1.00 0.00 ? 64  ILE A HD13 1  
ATOM 1038  N N    . SER A 1 65  ? -252.169 -37.924 111.930 1.00 0.00 ? 65  SER A N    1  
ATOM 1039  C CA   . SER A 1 65  ? -252.513 -39.205 112.523 1.00 0.00 ? 65  SER A CA   1  
ATOM 1040  C C    . SER A 1 65  ? -253.461 -39.979 111.612 1.00 0.00 ? 65  SER A C    1  
ATOM 1041  O O    . SER A 1 65  ? -253.483 -41.210 111.622 1.00 0.00 ? 65  SER A O    1  
ATOM 1042  C CB   . SER A 1 65  ? -253.131 -39.001 113.912 1.00 0.00 ? 65  SER A CB   1  
ATOM 1043  O OG   . SER A 1 65  ? -254.216 -38.085 113.876 1.00 0.00 ? 65  SER A OG   1  
ATOM 1044  H H    . SER A 1 65  ? -252.722 -37.138 112.128 1.00 0.00 ? 65  SER A H    1  
ATOM 1045  H HA   . SER A 1 65  ? -251.598 -39.771 112.628 1.00 0.00 ? 65  SER A HA   1  
ATOM 1046  H HB2  . SER A 1 65  ? -253.492 -39.949 114.283 1.00 0.00 ? 65  SER A HB2  1  
ATOM 1047  H HB3  . SER A 1 65  ? -252.376 -38.618 114.583 1.00 0.00 ? 65  SER A HB3  1  
ATOM 1048  H HG   . SER A 1 65  ? -254.210 -37.601 113.030 1.00 0.00 ? 65  SER A HG   1  
ATOM 1049  N N    . LYS A 1 66  ? -254.243 -39.252 110.823 1.00 0.00 ? 66  LYS A N    1  
ATOM 1050  C CA   . LYS A 1 66  ? -255.141 -39.874 109.863 1.00 0.00 ? 66  LYS A CA   1  
ATOM 1051  C C    . LYS A 1 66  ? -255.172 -39.084 108.559 1.00 0.00 ? 66  LYS A C    1  
ATOM 1052  O O    . LYS A 1 66  ? -254.529 -38.040 108.435 1.00 0.00 ? 66  LYS A O    1  
ATOM 1053  C CB   . LYS A 1 66  ? -256.553 -40.019 110.443 1.00 0.00 ? 66  LYS A CB   1  
ATOM 1054  C CG   . LYS A 1 66  ? -257.121 -38.736 111.030 1.00 0.00 ? 66  LYS A CG   1  
ATOM 1055  C CD   . LYS A 1 66  ? -258.578 -38.899 111.442 1.00 0.00 ? 66  LYS A CD   1  
ATOM 1056  C CE   . LYS A 1 66  ? -259.534 -38.635 110.283 1.00 0.00 ? 66  LYS A CE   1  
ATOM 1057  N NZ   . LYS A 1 66  ? -259.384 -39.617 109.177 1.00 0.00 ? 66  LYS A NZ   1  
ATOM 1058  H H    . LYS A 1 66  ? -254.213 -38.269 110.888 1.00 0.00 ? 66  LYS A H    1  
ATOM 1059  H HA   . LYS A 1 66  ? -254.753 -40.860 109.652 1.00 0.00 ? 66  LYS A HA   1  
ATOM 1060  H HB2  . LYS A 1 66  ? -257.218 -40.354 109.662 1.00 0.00 ? 66  LYS A HB2  1  
ATOM 1061  H HB3  . LYS A 1 66  ? -256.528 -40.764 111.225 1.00 0.00 ? 66  LYS A HB3  1  
ATOM 1062  H HG2  . LYS A 1 66  ? -256.542 -38.462 111.899 1.00 0.00 ? 66  LYS A HG2  1  
ATOM 1063  H HG3  . LYS A 1 66  ? -257.053 -37.951 110.290 1.00 0.00 ? 66  LYS A HG3  1  
ATOM 1064  H HD2  . LYS A 1 66  ? -258.729 -39.912 111.791 1.00 0.00 ? 66  LYS A HD2  1  
ATOM 1065  H HD3  . LYS A 1 66  ? -258.795 -38.207 112.242 1.00 0.00 ? 66  LYS A HD3  1  
ATOM 1066  H HE2  . LYS A 1 66  ? -260.545 -38.682 110.653 1.00 0.00 ? 66  LYS A HE2  1  
ATOM 1067  H HE3  . LYS A 1 66  ? -259.342 -37.643 109.899 1.00 0.00 ? 66  LYS A HE3  1  
ATOM 1068  H HZ1  . LYS A 1 66  ? -259.558 -40.586 109.522 1.00 0.00 ? 66  LYS A HZ1  1  
ATOM 1069  H HZ2  . LYS A 1 66  ? -260.061 -39.409 108.419 1.00 0.00 ? 66  LYS A HZ2  1  
ATOM 1070  H HZ3  . LYS A 1 66  ? -258.423 -39.575 108.782 1.00 0.00 ? 66  LYS A HZ3  1  
ATOM 1071  N N    . GLU A 1 67  ? -255.929 -39.588 107.598 1.00 0.00 ? 67  GLU A N    1  
ATOM 1072  C CA   . GLU A 1 67  ? -255.966 -39.029 106.252 1.00 0.00 ? 67  GLU A CA   1  
ATOM 1073  C C    . GLU A 1 67  ? -257.223 -38.188 106.008 1.00 0.00 ? 67  GLU A C    1  
ATOM 1074  O O    . GLU A 1 67  ? -258.121 -38.132 106.857 1.00 0.00 ? 67  GLU A O    1  
ATOM 1075  C CB   . GLU A 1 67  ? -255.881 -40.164 105.221 1.00 0.00 ? 67  GLU A CB   1  
ATOM 1076  C CG   . GLU A 1 67  ? -256.379 -41.513 105.735 1.00 0.00 ? 67  GLU A CG   1  
ATOM 1077  C CD   . GLU A 1 67  ? -257.825 -41.479 106.188 1.00 0.00 ? 67  GLU A CD   1  
ATOM 1078  O OE1  . GLU A 1 67  ? -258.073 -41.183 107.375 1.00 0.00 ? 67  GLU A OE1  1  
ATOM 1079  O OE2  . GLU A 1 67  ? -258.716 -41.737 105.363 1.00 0.00 ? 67  GLU A OE2  1  
ATOM 1080  H H    . GLU A 1 67  ? -256.492 -40.370 107.797 1.00 0.00 ? 67  GLU A H    1  
ATOM 1081  H HA   . GLU A 1 67  ? -255.101 -38.394 106.136 1.00 0.00 ? 67  GLU A HA   1  
ATOM 1082  H HB2  . GLU A 1 67  ? -256.478 -39.894 104.361 1.00 0.00 ? 67  GLU A HB2  1  
ATOM 1083  H HB3  . GLU A 1 67  ? -254.853 -40.278 104.911 1.00 0.00 ? 67  GLU A HB3  1  
ATOM 1084  H HG2  . GLU A 1 67  ? -256.284 -42.243 104.946 1.00 0.00 ? 67  GLU A HG2  1  
ATOM 1085  H HG3  . GLU A 1 67  ? -255.764 -41.812 106.573 1.00 0.00 ? 67  GLU A HG3  1  
ATOM 1086  N N    . LYS A 1 68  ? -257.269 -37.550 104.831 1.00 0.00 ? 68  LYS A N    1  
ATOM 1087  C CA   . LYS A 1 68  ? -258.389 -36.702 104.411 1.00 0.00 ? 68  LYS A CA   1  
ATOM 1088  C C    . LYS A 1 68  ? -258.501 -35.453 105.283 1.00 0.00 ? 68  LYS A C    1  
ATOM 1089  O O    . LYS A 1 68  ? -257.900 -34.425 104.983 1.00 0.00 ? 68  LYS A O    1  
ATOM 1090  C CB   . LYS A 1 68  ? -259.709 -37.485 104.404 1.00 0.00 ? 68  LYS A CB   1  
ATOM 1091  C CG   . LYS A 1 68  ? -260.204 -37.867 103.011 1.00 0.00 ? 68  LYS A CG   1  
ATOM 1092  C CD   . LYS A 1 68  ? -259.180 -38.669 102.214 1.00 0.00 ? 68  LYS A CD   1  
ATOM 1093  C CE   . LYS A 1 68  ? -258.738 -39.925 102.945 1.00 0.00 ? 68  LYS A CE   1  
ATOM 1094  N NZ   . LYS A 1 68  ? -259.876 -40.821 103.276 1.00 0.00 ? 68  LYS A NZ   1  
ATOM 1095  H H    . LYS A 1 68  ? -256.507 -37.643 104.223 1.00 0.00 ? 68  LYS A H    1  
ATOM 1096  H HA   . LYS A 1 68  ? -258.180 -36.382 103.401 1.00 0.00 ? 68  LYS A HA   1  
ATOM 1097  H HB2  . LYS A 1 68  ? -259.576 -38.393 104.973 1.00 0.00 ? 68  LYS A HB2  1  
ATOM 1098  H HB3  . LYS A 1 68  ? -260.471 -36.883 104.879 1.00 0.00 ? 68  LYS A HB3  1  
ATOM 1099  H HG2  . LYS A 1 68  ? -261.100 -38.457 103.111 1.00 0.00 ? 68  LYS A HG2  1  
ATOM 1100  H HG3  . LYS A 1 68  ? -260.431 -36.960 102.469 1.00 0.00 ? 68  LYS A HG3  1  
ATOM 1101  H HD2  . LYS A 1 68  ? -259.620 -38.957 101.272 1.00 0.00 ? 68  LYS A HD2  1  
ATOM 1102  H HD3  . LYS A 1 68  ? -258.316 -38.047 102.032 1.00 0.00 ? 68  LYS A HD3  1  
ATOM 1103  H HE2  . LYS A 1 68  ? -258.043 -40.463 102.317 1.00 0.00 ? 68  LYS A HE2  1  
ATOM 1104  H HE3  . LYS A 1 68  ? -258.242 -39.634 103.859 1.00 0.00 ? 68  LYS A HE3  1  
ATOM 1105  H HZ1  . LYS A 1 68  ? -260.682 -40.266 103.619 1.00 0.00 ? 68  LYS A HZ1  1  
ATOM 1106  H HZ2  . LYS A 1 68  ? -260.171 -41.366 102.436 1.00 0.00 ? 68  LYS A HZ2  1  
ATOM 1107  H HZ3  . LYS A 1 68  ? -259.589 -41.491 104.027 1.00 0.00 ? 68  LYS A HZ3  1  
ATOM 1108  N N    . ASN A 1 69  ? -259.252 -35.553 106.365 1.00 0.00 ? 69  ASN A N    1  
ATOM 1109  C CA   . ASN A 1 69  ? -259.410 -34.440 107.285 1.00 0.00 ? 69  ASN A CA   1  
ATOM 1110  C C    . ASN A 1 69  ? -259.529 -34.964 108.688 1.00 0.00 ? 69  ASN A C    1  
ATOM 1111  O O    . ASN A 1 69  ? -260.354 -35.833 108.971 1.00 0.00 ? 69  ASN A O    1  
ATOM 1112  C CB   . ASN A 1 69  ? -260.636 -33.591 106.935 1.00 0.00 ? 69  ASN A CB   1  
ATOM 1113  C CG   . ASN A 1 69  ? -260.677 -32.284 107.710 1.00 0.00 ? 69  ASN A CG   1  
ATOM 1114  O OD1  . ASN A 1 69  ? -261.742 -31.821 108.118 1.00 0.00 ? 69  ASN A OD1  1  
ATOM 1115  N ND2  . ASN A 1 69  ? -259.520 -31.662 107.885 1.00 0.00 ? 69  ASN A ND2  1  
ATOM 1116  H H    . ASN A 1 69  ? -259.698 -36.400 106.562 1.00 0.00 ? 69  ASN A H    1  
ATOM 1117  H HA   . ASN A 1 69  ? -258.524 -33.834 107.237 1.00 0.00 ? 69  ASN A HA   1  
ATOM 1118  H HB2  . ASN A 1 69  ? -260.618 -33.360 105.879 1.00 0.00 ? 69  ASN A HB2  1  
ATOM 1119  H HB3  . ASN A 1 69  ? -261.530 -34.151 107.161 1.00 0.00 ? 69  ASN A HB3  1  
ATOM 1120  H HD21 . ASN A 1 69  ? -258.714 -32.067 107.504 1.00 0.00 ? 69  ASN A HD21 1  
ATOM 1121  H HD22 . ASN A 1 69  ? -259.516 -30.815 108.389 1.00 0.00 ? 69  ASN A HD22 1  
ATOM 1122  N N    . GLU A 1 70  ? -258.699 -34.440 109.565 1.00 0.00 ? 70  GLU A N    1  
ATOM 1123  C CA   . GLU A 1 70  ? -258.607 -34.961 110.896 1.00 0.00 ? 70  GLU A CA   1  
ATOM 1124  C C    . GLU A 1 70  ? -259.602 -34.282 111.828 1.00 0.00 ? 70  GLU A C    1  
ATOM 1125  O O    . GLU A 1 70  ? -259.217 -33.618 112.787 1.00 0.00 ? 70  GLU A O    1  
ATOM 1126  C CB   . GLU A 1 70  ? -257.180 -34.818 111.408 1.00 0.00 ? 70  GLU A CB   1  
ATOM 1127  C CG   . GLU A 1 70  ? -256.170 -35.516 110.517 1.00 0.00 ? 70  GLU A CG   1  
ATOM 1128  C CD   . GLU A 1 70  ? -254.787 -35.579 111.120 1.00 0.00 ? 70  GLU A CD   1  
ATOM 1129  O OE1  . GLU A 1 70  ? -253.996 -34.648 110.896 1.00 0.00 ? 70  GLU A OE1  1  
ATOM 1130  O OE2  . GLU A 1 70  ? -254.479 -36.577 111.798 1.00 0.00 ? 70  GLU A OE2  1  
ATOM 1131  H H    . GLU A 1 70  ? -258.128 -33.691 109.311 1.00 0.00 ? 70  GLU A H    1  
ATOM 1132  H HA   . GLU A 1 70  ? -258.848 -36.004 110.828 1.00 0.00 ? 70  GLU A HA   1  
ATOM 1133  H HB2  . GLU A 1 70  ? -256.927 -33.768 111.457 1.00 0.00 ? 70  GLU A HB2  1  
ATOM 1134  H HB3  . GLU A 1 70  ? -257.119 -35.242 112.391 1.00 0.00 ? 70  GLU A HB3  1  
ATOM 1135  H HG2  . GLU A 1 70  ? -256.510 -36.523 110.334 1.00 0.00 ? 70  GLU A HG2  1  
ATOM 1136  H HG3  . GLU A 1 70  ? -256.113 -34.983 109.579 1.00 0.00 ? 70  GLU A HG3  1  
ATOM 1137  N N    . CYS A 1 71  ? -260.884 -34.451 111.508 1.00 0.00 ? 71  CYS A N    1  
ATOM 1138  C CA   . CYS A 1 71  ? -261.985 -33.934 112.319 1.00 0.00 ? 71  CYS A CA   1  
ATOM 1139  C C    . CYS A 1 71  ? -261.940 -32.413 112.441 1.00 0.00 ? 71  CYS A C    1  
ATOM 1140  O O    . CYS A 1 71  ? -261.302 -31.867 113.342 1.00 0.00 ? 71  CYS A O    1  
ATOM 1141  C CB   . CYS A 1 71  ? -261.973 -34.575 113.709 1.00 0.00 ? 71  CYS A CB   1  
ATOM 1142  S SG   . CYS A 1 71  ? -261.977 -36.382 113.683 1.00 0.00 ? 71  CYS A SG   1  
ATOM 1143  H H    . CYS A 1 71  ? -261.097 -34.946 110.689 1.00 0.00 ? 71  CYS A H    1  
ATOM 1144  H HA   . CYS A 1 71  ? -262.904 -34.207 111.824 1.00 0.00 ? 71  CYS A HA   1  
ATOM 1145  H HB2  . CYS A 1 71  ? -261.086 -34.257 114.237 1.00 0.00 ? 71  CYS A HB2  1  
ATOM 1146  H HB3  . CYS A 1 71  ? -262.848 -34.252 114.252 1.00 0.00 ? 71  CYS A HB3  1  
ATOM 1147  H HG   . CYS A 1 71  ? -260.901 -36.804 114.334 1.00 0.00 ? 71  CYS A HG   1  
ATOM 1148  N N    . ARG A 1 72  ? -262.632 -31.730 111.535 1.00 0.00 ? 72  ARG A N    1  
ATOM 1149  C CA   . ARG A 1 72  ? -262.704 -30.270 111.560 1.00 0.00 ? 72  ARG A CA   1  
ATOM 1150  C C    . ARG A 1 72  ? -263.657 -29.803 112.665 1.00 0.00 ? 72  ARG A C    1  
ATOM 1151  O O    . ARG A 1 72  ? -264.656 -29.132 112.411 1.00 0.00 ? 72  ARG A O    1  
ATOM 1152  C CB   . ARG A 1 72  ? -263.160 -29.734 110.198 1.00 0.00 ? 72  ARG A CB   1  
ATOM 1153  C CG   . ARG A 1 72  ? -263.035 -28.225 110.051 1.00 0.00 ? 72  ARG A CG   1  
ATOM 1154  C CD   . ARG A 1 72  ? -263.592 -27.756 108.717 1.00 0.00 ? 72  ARG A CD   1  
ATOM 1155  N NE   . ARG A 1 72  ? -265.022 -28.039 108.591 1.00 0.00 ? 72  ARG A NE   1  
ATOM 1156  C CZ   . ARG A 1 72  ? -265.657 -28.163 107.426 1.00 0.00 ? 72  ARG A CZ   1  
ATOM 1157  N NH1  . ARG A 1 72  ? -264.985 -28.047 106.285 1.00 0.00 ? 72  ARG A NH1  1  
ATOM 1158  N NH2  . ARG A 1 72  ? -266.964 -28.405 107.405 1.00 0.00 ? 72  ARG A NH2  1  
ATOM 1159  H H    . ARG A 1 72  ? -263.099 -32.218 110.825 1.00 0.00 ? 72  ARG A H    1  
ATOM 1160  H HA   . ARG A 1 72  ? -261.714 -29.896 111.775 1.00 0.00 ? 72  ARG A HA   1  
ATOM 1161  H HB2  . ARG A 1 72  ? -262.564 -30.197 109.425 1.00 0.00 ? 72  ARG A HB2  1  
ATOM 1162  H HB3  . ARG A 1 72  ? -264.195 -30.002 110.047 1.00 0.00 ? 72  ARG A HB3  1  
ATOM 1163  H HG2  . ARG A 1 72  ? -263.585 -27.746 110.847 1.00 0.00 ? 72  ARG A HG2  1  
ATOM 1164  H HG3  . ARG A 1 72  ? -261.992 -27.951 110.113 1.00 0.00 ? 72  ARG A HG3  1  
ATOM 1165  H HD2  . ARG A 1 72  ? -263.437 -26.691 108.631 1.00 0.00 ? 72  ARG A HD2  1  
ATOM 1166  H HD3  . ARG A 1 72  ? -263.064 -28.262 107.923 1.00 0.00 ? 72  ARG A HD3  1  
ATOM 1167  H HE   . ARG A 1 72  ? -265.534 -28.136 109.426 1.00 0.00 ? 72  ARG A HE   1  
ATOM 1168  H HH11 . ARG A 1 72  ? -264.000 -27.867 106.299 1.00 0.00 ? 72  ARG A HH11 1  
ATOM 1169  H HH12 . ARG A 1 72  ? -265.458 -28.139 105.406 1.00 0.00 ? 72  ARG A HH12 1  
ATOM 1170  H HH21 . ARG A 1 72  ? -267.474 -28.493 108.263 1.00 0.00 ? 72  ARG A HH21 1  
ATOM 1171  H HH22 . ARG A 1 72  ? -267.444 -28.504 106.532 1.00 0.00 ? 72  ARG A HH22 1  
ATOM 1172  N N    . LYS A 1 73  ? -263.340 -30.194 113.889 1.00 0.00 ? 73  LYS A N    1  
ATOM 1173  C CA   . LYS A 1 73  ? -264.114 -29.825 115.055 1.00 0.00 ? 73  LYS A CA   1  
ATOM 1174  C C    . LYS A 1 73  ? -263.163 -29.331 116.140 1.00 0.00 ? 73  LYS A C    1  
ATOM 1175  O O    . LYS A 1 73  ? -263.522 -29.233 117.315 1.00 0.00 ? 73  LYS A O    1  
ATOM 1176  C CB   . LYS A 1 73  ? -264.887 -31.043 115.565 1.00 0.00 ? 73  LYS A CB   1  
ATOM 1177  C CG   . LYS A 1 73  ? -265.962 -30.704 116.579 1.00 0.00 ? 73  LYS A CG   1  
ATOM 1178  C CD   . LYS A 1 73  ? -266.249 -31.873 117.514 1.00 0.00 ? 73  LYS A CD   1  
ATOM 1179  C CE   . LYS A 1 73  ? -265.389 -31.821 118.776 1.00 0.00 ? 73  LYS A CE   1  
ATOM 1180  N NZ   . LYS A 1 73  ? -263.932 -31.722 118.477 1.00 0.00 ? 73  LYS A NZ   1  
ATOM 1181  H H    . LYS A 1 73  ? -262.555 -30.767 114.011 1.00 0.00 ? 73  LYS A H    1  
ATOM 1182  H HA   . LYS A 1 73  ? -264.803 -29.039 114.785 1.00 0.00 ? 73  LYS A HA   1  
ATOM 1183  H HB2  . LYS A 1 73  ? -265.357 -31.533 114.726 1.00 0.00 ? 73  LYS A HB2  1  
ATOM 1184  H HB3  . LYS A 1 73  ? -264.191 -31.728 116.027 1.00 0.00 ? 73  LYS A HB3  1  
ATOM 1185  H HG2  . LYS A 1 73  ? -265.627 -29.861 117.164 1.00 0.00 ? 73  LYS A HG2  1  
ATOM 1186  H HG3  . LYS A 1 73  ? -266.866 -30.442 116.052 1.00 0.00 ? 73  LYS A HG3  1  
ATOM 1187  H HD2  . LYS A 1 73  ? -267.289 -31.841 117.802 1.00 0.00 ? 73  LYS A HD2  1  
ATOM 1188  H HD3  . LYS A 1 73  ? -266.050 -32.798 116.991 1.00 0.00 ? 73  LYS A HD3  1  
ATOM 1189  H HE2  . LYS A 1 73  ? -265.682 -30.960 119.358 1.00 0.00 ? 73  LYS A HE2  1  
ATOM 1190  H HE3  . LYS A 1 73  ? -265.568 -32.718 119.352 1.00 0.00 ? 73  LYS A HE3  1  
ATOM 1191  H HZ1  . LYS A 1 73  ? -263.628 -32.524 117.891 1.00 0.00 ? 73  LYS A HZ1  1  
ATOM 1192  H HZ2  . LYS A 1 73  ? -263.732 -30.835 117.966 1.00 0.00 ? 73  LYS A HZ2  1  
ATOM 1193  H HZ3  . LYS A 1 73  ? -263.380 -31.722 119.362 1.00 0.00 ? 73  LYS A HZ3  1  
ATOM 1194  N N    . GLN A 1 74  ? -261.937 -29.047 115.739 1.00 0.00 ? 74  GLN A N    1  
ATOM 1195  C CA   . GLN A 1 74  ? -260.899 -28.658 116.675 1.00 0.00 ? 74  GLN A CA   1  
ATOM 1196  C C    . GLN A 1 74  ? -259.939 -27.690 115.997 1.00 0.00 ? 74  GLN A C    1  
ATOM 1197  O O    . GLN A 1 74  ? -259.319 -28.034 114.993 1.00 0.00 ? 74  GLN A O    1  
ATOM 1198  C CB   . GLN A 1 74  ? -260.144 -29.902 117.154 1.00 0.00 ? 74  GLN A CB   1  
ATOM 1199  C CG   . GLN A 1 74  ? -259.820 -29.901 118.639 1.00 0.00 ? 74  GLN A CG   1  
ATOM 1200  C CD   . GLN A 1 74  ? -261.061 -29.800 119.510 1.00 0.00 ? 74  GLN A CD   1  
ATOM 1201  O OE1  . GLN A 1 74  ? -261.700 -30.806 119.826 1.00 0.00 ? 74  GLN A OE1  1  
ATOM 1202  N NE2  . GLN A 1 74  ? -261.400 -28.591 119.926 1.00 0.00 ? 74  GLN A NE2  1  
ATOM 1203  H H    . GLN A 1 74  ? -261.723 -29.089 114.782 1.00 0.00 ? 74  GLN A H    1  
ATOM 1204  H HA   . GLN A 1 74  ? -261.364 -28.172 117.519 1.00 0.00 ? 74  GLN A HA   1  
ATOM 1205  H HB2  . GLN A 1 74  ? -260.743 -30.775 116.940 1.00 0.00 ? 74  GLN A HB2  1  
ATOM 1206  H HB3  . GLN A 1 74  ? -259.215 -29.974 116.607 1.00 0.00 ? 74  GLN A HB3  1  
ATOM 1207  H HG2  . GLN A 1 74  ? -259.302 -30.816 118.883 1.00 0.00 ? 74  GLN A HG2  1  
ATOM 1208  H HG3  . GLN A 1 74  ? -259.179 -29.059 118.853 1.00 0.00 ? 74  GLN A HG3  1  
ATOM 1209  H HE21 . GLN A 1 74  ? -260.841 -27.834 119.657 1.00 0.00 ? 74  GLN A HE21 1  
ATOM 1210  H HE22 . GLN A 1 74  ? -262.193 -28.502 120.496 1.00 0.00 ? 74  GLN A HE22 1  
ATOM 1211  N N    . PRO A 1 75  ? -259.824 -26.459 116.515 1.00 0.00 ? 75  PRO A N    1  
ATOM 1212  C CA   . PRO A 1 75  ? -258.938 -25.439 115.950 1.00 0.00 ? 75  PRO A CA   1  
ATOM 1213  C C    . PRO A 1 75  ? -257.467 -25.717 116.253 1.00 0.00 ? 75  PRO A C    1  
ATOM 1214  O O    . PRO A 1 75  ? -256.839 -25.009 117.041 1.00 0.00 ? 75  PRO A O    1  
ATOM 1215  C CB   . PRO A 1 75  ? -259.387 -24.135 116.632 1.00 0.00 ? 75  PRO A CB   1  
ATOM 1216  C CG   . PRO A 1 75  ? -260.632 -24.476 117.385 1.00 0.00 ? 75  PRO A CG   1  
ATOM 1217  C CD   . PRO A 1 75  ? -260.551 -25.944 117.678 1.00 0.00 ? 75  PRO A CD   1  
ATOM 1218  H HA   . PRO A 1 75  ? -259.072 -25.352 114.882 1.00 0.00 ? 75  PRO A HA   1  
ATOM 1219  H HB2  . PRO A 1 75  ? -258.609 -23.791 117.298 1.00 0.00 ? 75  PRO A HB2  1  
ATOM 1220  H HB3  . PRO A 1 75  ? -259.577 -23.383 115.880 1.00 0.00 ? 75  PRO A HB3  1  
ATOM 1221  H HG2  . PRO A 1 75  ? -260.672 -23.911 118.304 1.00 0.00 ? 75  PRO A HG2  1  
ATOM 1222  H HG3  . PRO A 1 75  ? -261.498 -24.263 116.776 1.00 0.00 ? 75  PRO A HG3  1  
ATOM 1223  H HD2  . PRO A 1 75  ? -259.999 -26.119 118.590 1.00 0.00 ? 75  PRO A HD2  1  
ATOM 1224  H HD3  . PRO A 1 75  ? -261.539 -26.375 117.740 1.00 0.00 ? 75  PRO A HD3  1  
ATOM 1225  N N    . PHE A 1 76  ? -256.926 -26.762 115.641 1.00 0.00 ? 76  PHE A N    1  
ATOM 1226  C CA   . PHE A 1 76  ? -255.514 -27.075 115.790 1.00 0.00 ? 76  PHE A CA   1  
ATOM 1227  C C    . PHE A 1 76  ? -254.707 -26.268 114.780 1.00 0.00 ? 76  PHE A C    1  
ATOM 1228  O O    . PHE A 1 76  ? -254.290 -26.768 113.737 1.00 0.00 ? 76  PHE A O    1  
ATOM 1229  C CB   . PHE A 1 76  ? -255.259 -28.578 115.621 1.00 0.00 ? 76  PHE A CB   1  
ATOM 1230  C CG   . PHE A 1 76  ? -253.846 -28.984 115.937 1.00 0.00 ? 76  PHE A CG   1  
ATOM 1231  C CD1  . PHE A 1 76  ? -253.375 -28.936 117.238 1.00 0.00 ? 76  PHE A CD1  1  
ATOM 1232  C CD2  . PHE A 1 76  ? -252.991 -29.411 114.934 1.00 0.00 ? 76  PHE A CD2  1  
ATOM 1233  C CE1  . PHE A 1 76  ? -252.077 -29.304 117.535 1.00 0.00 ? 76  PHE A CE1  1  
ATOM 1234  C CE2  . PHE A 1 76  ? -251.692 -29.781 115.224 1.00 0.00 ? 76  PHE A CE2  1  
ATOM 1235  C CZ   . PHE A 1 76  ? -251.234 -29.727 116.526 1.00 0.00 ? 76  PHE A CZ   1  
ATOM 1236  H H    . PHE A 1 76  ? -257.490 -27.334 115.074 1.00 0.00 ? 76  PHE A H    1  
ATOM 1237  H HA   . PHE A 1 76  ? -255.216 -26.777 116.785 1.00 0.00 ? 76  PHE A HA   1  
ATOM 1238  H HB2  . PHE A 1 76  ? -255.915 -29.124 116.280 1.00 0.00 ? 76  PHE A HB2  1  
ATOM 1239  H HB3  . PHE A 1 76  ? -255.466 -28.859 114.598 1.00 0.00 ? 76  PHE A HB3  1  
ATOM 1240  H HD1  . PHE A 1 76  ? -254.034 -28.606 118.028 1.00 0.00 ? 76  PHE A HD1  1  
ATOM 1241  H HD2  . PHE A 1 76  ? -253.349 -29.455 113.915 1.00 0.00 ? 76  PHE A HD2  1  
ATOM 1242  H HE1  . PHE A 1 76  ? -251.722 -29.261 118.554 1.00 0.00 ? 76  PHE A HE1  1  
ATOM 1243  H HE2  . PHE A 1 76  ? -251.035 -30.111 114.432 1.00 0.00 ? 76  PHE A HE2  1  
ATOM 1244  H HZ   . PHE A 1 76  ? -250.218 -30.013 116.753 1.00 0.00 ? 76  PHE A HZ   1  
ATOM 1245  N N    . GLN A 1 77  ? -254.543 -24.996 115.089 1.00 0.00 ? 77  GLN A N    1  
ATOM 1246  C CA   . GLN A 1 77  ? -253.841 -24.068 114.225 1.00 0.00 ? 77  GLN A CA   1  
ATOM 1247  C C    . GLN A 1 77  ? -253.398 -22.870 115.050 1.00 0.00 ? 77  GLN A C    1  
ATOM 1248  O O    . GLN A 1 77  ? -254.114 -22.433 115.951 1.00 0.00 ? 77  GLN A O    1  
ATOM 1249  C CB   . GLN A 1 77  ? -254.751 -23.645 113.066 1.00 0.00 ? 77  GLN A CB   1  
ATOM 1250  C CG   . GLN A 1 77  ? -256.096 -23.096 113.517 1.00 0.00 ? 77  GLN A CG   1  
ATOM 1251  C CD   . GLN A 1 77  ? -257.123 -23.049 112.399 1.00 0.00 ? 77  GLN A CD   1  
ATOM 1252  O OE1  . GLN A 1 77  ? -258.323 -23.157 112.643 1.00 0.00 ? 77  GLN A OE1  1  
ATOM 1253  N NE2  . GLN A 1 77  ? -256.663 -22.895 111.166 1.00 0.00 ? 77  GLN A NE2  1  
ATOM 1254  H H    . GLN A 1 77  ? -254.914 -24.662 115.935 1.00 0.00 ? 77  GLN A H    1  
ATOM 1255  H HA   . GLN A 1 77  ? -252.969 -24.567 113.831 1.00 0.00 ? 77  GLN A HA   1  
ATOM 1256  H HB2  . GLN A 1 77  ? -254.252 -22.882 112.490 1.00 0.00 ? 77  GLN A HB2  1  
ATOM 1257  H HB3  . GLN A 1 77  ? -254.932 -24.502 112.434 1.00 0.00 ? 77  GLN A HB3  1  
ATOM 1258  H HG2  . GLN A 1 77  ? -256.479 -23.726 114.306 1.00 0.00 ? 77  GLN A HG2  1  
ATOM 1259  H HG3  . GLN A 1 77  ? -255.951 -22.095 113.896 1.00 0.00 ? 77  GLN A HG3  1  
ATOM 1260  H HE21 . GLN A 1 77  ? -255.695 -22.823 111.036 1.00 0.00 ? 77  GLN A HE21 1  
ATOM 1261  H HE22 . GLN A 1 77  ? -257.311 -22.863 110.432 1.00 0.00 ? 77  GLN A HE22 1  
ATOM 1262  N N    . ARG A 1 78  ? -252.217 -22.353 114.771 1.00 0.00 ? 78  ARG A N    1  
ATOM 1263  C CA   . ARG A 1 78  ? -251.661 -21.297 115.599 1.00 0.00 ? 78  ARG A CA   1  
ATOM 1264  C C    . ARG A 1 78  ? -251.759 -19.946 114.910 1.00 0.00 ? 78  ARG A C    1  
ATOM 1265  O O    . ARG A 1 78  ? -251.280 -19.766 113.790 1.00 0.00 ? 78  ARG A O    1  
ATOM 1266  C CB   . ARG A 1 78  ? -250.206 -21.599 115.964 1.00 0.00 ? 78  ARG A CB   1  
ATOM 1267  C CG   . ARG A 1 78  ? -249.603 -20.567 116.898 1.00 0.00 ? 78  ARG A CG   1  
ATOM 1268  C CD   . ARG A 1 78  ? -250.383 -20.484 118.197 1.00 0.00 ? 78  ARG A CD   1  
ATOM 1269  N NE   . ARG A 1 78  ? -250.264 -19.170 118.814 1.00 0.00 ? 78  ARG A NE   1  
ATOM 1270  C CZ   . ARG A 1 78  ? -251.262 -18.538 119.418 1.00 0.00 ? 78  ARG A CZ   1  
ATOM 1271  N NH1  . ARG A 1 78  ? -252.432 -19.143 119.587 1.00 0.00 ? 78  ARG A NH1  1  
ATOM 1272  N NH2  . ARG A 1 78  ? -251.085 -17.310 119.875 1.00 0.00 ? 78  ARG A NH2  1  
ATOM 1273  H H    . ARG A 1 78  ? -251.711 -22.681 113.993 1.00 0.00 ? 78  ARG A H    1  
ATOM 1274  H HA   . ARG A 1 78  ? -252.244 -21.258 116.508 1.00 0.00 ? 78  ARG A HA   1  
ATOM 1275  H HB2  . ARG A 1 78  ? -250.158 -22.565 116.445 1.00 0.00 ? 78  ARG A HB2  1  
ATOM 1276  H HB3  . ARG A 1 78  ? -249.616 -21.624 115.061 1.00 0.00 ? 78  ARG A HB3  1  
ATOM 1277  H HG2  . ARG A 1 78  ? -248.583 -20.844 117.118 1.00 0.00 ? 78  ARG A HG2  1  
ATOM 1278  H HG3  . ARG A 1 78  ? -249.621 -19.601 116.415 1.00 0.00 ? 78  ARG A HG3  1  
ATOM 1279  H HD2  . ARG A 1 78  ? -251.426 -20.681 117.992 1.00 0.00 ? 78  ARG A HD2  1  
ATOM 1280  H HD3  . ARG A 1 78  ? -250.003 -21.229 118.880 1.00 0.00 ? 78  ARG A HD3  1  
ATOM 1281  H HE   . ARG A 1 78  ? -249.380 -18.716 118.751 1.00 0.00 ? 78  ARG A HE   1  
ATOM 1282  H HH11 . ARG A 1 78  ? -252.564 -20.077 119.260 1.00 0.00 ? 78  ARG A HH11 1  
ATOM 1283  H HH12 . ARG A 1 78  ? -253.186 -18.669 120.064 1.00 0.00 ? 78  ARG A HH12 1  
ATOM 1284  H HH21 . ARG A 1 78  ? -250.183 -16.856 119.770 1.00 0.00 ? 78  ARG A HH21 1  
ATOM 1285  H HH22 . ARG A 1 78  ? -251.845 -16.814 120.309 1.00 0.00 ? 78  ARG A HH22 1  
ATOM 1286  N N    . ALA A 1 79  ? -252.401 -19.005 115.586 1.00 0.00 ? 79  ALA A N    1  
ATOM 1287  C CA   . ALA A 1 79  ? -252.487 -17.642 115.099 1.00 0.00 ? 79  ALA A CA   1  
ATOM 1288  C C    . ALA A 1 79  ? -251.182 -16.901 115.392 1.00 0.00 ? 79  ALA A C    1  
ATOM 1289  O O    . ALA A 1 79  ? -250.772 -16.778 116.546 1.00 0.00 ? 79  ALA A O    1  
ATOM 1290  C CB   . ALA A 1 79  ? -253.667 -16.925 115.735 1.00 0.00 ? 79  ALA A CB   1  
ATOM 1291  H H    . ALA A 1 79  ? -252.829 -19.235 116.436 1.00 0.00 ? 79  ALA A H    1  
ATOM 1292  H HA   . ALA A 1 79  ? -252.649 -17.683 114.028 1.00 0.00 ? 79  ALA A HA   1  
ATOM 1293  H HB1  . ALA A 1 79  ? -253.542 -16.904 116.808 1.00 0.00 ? 79  ALA A HB1  1  
ATOM 1294  H HB2  . ALA A 1 79  ? -254.580 -17.448 115.490 1.00 0.00 ? 79  ALA A HB2  1  
ATOM 1295  H HB3  . ALA A 1 79  ? -253.719 -15.915 115.359 1.00 0.00 ? 79  ALA A HB3  1  
ATOM 1296  N N    . ILE A 1 80  ? -250.537 -16.422 114.346 1.00 0.00 ? 80  ILE A N    1  
ATOM 1297  C CA   . ILE A 1 80  ? -249.239 -15.786 114.462 1.00 0.00 ? 80  ILE A CA   1  
ATOM 1298  C C    . ILE A 1 80  ? -249.347 -14.323 114.853 1.00 0.00 ? 80  ILE A C    1  
ATOM 1299  O O    . ILE A 1 80  ? -249.815 -13.486 114.076 1.00 0.00 ? 80  ILE A O    1  
ATOM 1300  C CB   . ILE A 1 80  ? -248.428 -15.900 113.176 1.00 0.00 ? 80  ILE A CB   1  
ATOM 1301  C CG1  . ILE A 1 80  ? -248.345 -17.353 112.724 1.00 0.00 ? 80  ILE A CG1  1  
ATOM 1302  C CG2  . ILE A 1 80  ? -247.031 -15.360 113.412 1.00 0.00 ? 80  ILE A CG2  1  
ATOM 1303  C CD1  . ILE A 1 80  ? -247.301 -17.561 111.662 1.00 0.00 ? 80  ILE A CD1  1  
ATOM 1304  H H    . ILE A 1 80  ? -250.956 -16.485 113.461 1.00 0.00 ? 80  ILE A H    1  
ATOM 1305  H HA   . ILE A 1 80  ? -248.687 -16.292 115.215 1.00 0.00 ? 80  ILE A HA   1  
ATOM 1306  H HB   . ILE A 1 80  ? -248.903 -15.308 112.408 1.00 0.00 ? 80  ILE A HB   1  
ATOM 1307  H HG12 . ILE A 1 80  ? -248.098 -17.978 113.570 1.00 0.00 ? 80  ILE A HG12 1  
ATOM 1308  H HG13 . ILE A 1 80  ? -249.300 -17.657 112.320 1.00 0.00 ? 80  ILE A HG13 1  
ATOM 1309  H HG21 . ILE A 1 80  ? -247.094 -14.334 113.745 1.00 0.00 ? 80  ILE A HG21 1  
ATOM 1310  H HG22 . ILE A 1 80  ? -246.540 -15.953 114.168 1.00 0.00 ? 80  ILE A HG22 1  
ATOM 1311  H HG23 . ILE A 1 80  ? -246.466 -15.406 112.494 1.00 0.00 ? 80  ILE A HG23 1  
ATOM 1312  H HD11 . ILE A 1 80  ? -246.369 -17.123 112.001 1.00 0.00 ? 80  ILE A HD11 1  
ATOM 1313  H HD12 . ILE A 1 80  ? -247.169 -18.614 111.484 1.00 0.00 ? 80  ILE A HD12 1  
ATOM 1314  H HD13 . ILE A 1 80  ? -247.617 -17.069 110.755 1.00 0.00 ? 80  ILE A HD13 1  
ATOM 1315  N N    . GLY A 1 81  ? -248.924 -14.034 116.072 1.00 0.00 ? 81  GLY A N    1  
ATOM 1316  C CA   . GLY A 1 81  ? -248.794 -12.667 116.509 1.00 0.00 ? 81  GLY A CA   1  
ATOM 1317  C C    . GLY A 1 81  ? -247.353 -12.206 116.404 1.00 0.00 ? 81  GLY A C    1  
ATOM 1318  O O    . GLY A 1 81  ? -246.479 -13.011 116.096 1.00 0.00 ? 81  GLY A O    1  
ATOM 1319  H H    . GLY A 1 81  ? -248.686 -14.765 116.682 1.00 0.00 ? 81  GLY A H    1  
ATOM 1320  H HA2  . GLY A 1 81  ? -249.418 -12.037 115.891 1.00 0.00 ? 81  GLY A HA2  1  
ATOM 1321  H HA3  . GLY A 1 81  ? -249.115 -12.590 117.537 1.00 0.00 ? 81  GLY A HA3  1  
ATOM 1322  N N    . PRO A 1 82  ? -247.072 -10.924 116.661 1.00 0.00 ? 82  PRO A N    1  
ATOM 1323  C CA   . PRO A 1 82  ? -245.729 -10.358 116.550 1.00 0.00 ? 82  PRO A CA   1  
ATOM 1324  C C    . PRO A 1 82  ? -244.701 -11.072 117.417 1.00 0.00 ? 82  PRO A C    1  
ATOM 1325  O O    . PRO A 1 82  ? -243.615 -11.414 116.947 1.00 0.00 ? 82  PRO A O    1  
ATOM 1326  C CB   . PRO A 1 82  ? -245.909 -8.908  117.008 1.00 0.00 ? 82  PRO A CB   1  
ATOM 1327  C CG   . PRO A 1 82  ? -247.345 -8.631  116.763 1.00 0.00 ? 82  PRO A CG   1  
ATOM 1328  C CD   . PRO A 1 82  ? -248.035 -9.917  117.088 1.00 0.00 ? 82  PRO A CD   1  
ATOM 1329  H HA   . PRO A 1 82  ? -245.405 -10.368 115.541 1.00 0.00 ? 82  PRO A HA   1  
ATOM 1330  H HB2  . PRO A 1 82  ? -245.661 -8.823  118.055 1.00 0.00 ? 82  PRO A HB2  1  
ATOM 1331  H HB3  . PRO A 1 82  ? -245.275 -8.258  116.423 1.00 0.00 ? 82  PRO A HB3  1  
ATOM 1332  H HG2  . PRO A 1 82  ? -247.687 -7.840  117.415 1.00 0.00 ? 82  PRO A HG2  1  
ATOM 1333  H HG3  . PRO A 1 82  ? -247.503 -8.368  115.727 1.00 0.00 ? 82  PRO A HG3  1  
ATOM 1334  H HD2  . PRO A 1 82  ? -248.188 -9.991  118.136 1.00 0.00 ? 82  PRO A HD2  1  
ATOM 1335  H HD3  . PRO A 1 82  ? -248.964 -10.009 116.547 1.00 0.00 ? 82  PRO A HD3  1  
ATOM 1336  N N    . GLU A 1 83  ? -245.050 -11.284 118.678 1.00 0.00 ? 83  GLU A N    1  
ATOM 1337  C CA   . GLU A 1 83  ? -244.177 -11.943 119.633 1.00 0.00 ? 83  GLU A CA   1  
ATOM 1338  C C    . GLU A 1 83  ? -243.764 -13.331 119.151 1.00 0.00 ? 83  GLU A C    1  
ATOM 1339  O O    . GLU A 1 83  ? -242.611 -13.738 119.295 1.00 0.00 ? 83  GLU A O    1  
ATOM 1340  C CB   . GLU A 1 83  ? -244.890 -12.043 120.969 1.00 0.00 ? 83  GLU A CB   1  
ATOM 1341  C CG   . GLU A 1 83  ? -245.062 -10.702 121.661 1.00 0.00 ? 83  GLU A CG   1  
ATOM 1342  C CD   . GLU A 1 83  ? -245.846 -9.689  120.848 1.00 0.00 ? 83  GLU A CD   1  
ATOM 1343  O OE1  . GLU A 1 83  ? -246.976 -10.008 120.422 1.00 0.00 ? 83  GLU A OE1  1  
ATOM 1344  O OE2  . GLU A 1 83  ? -245.331 -8.572  120.627 1.00 0.00 ? 83  GLU A OE2  1  
ATOM 1345  H H    . GLU A 1 83  ? -245.930 -10.966 118.993 1.00 0.00 ? 83  GLU A H    1  
ATOM 1346  H HA   . GLU A 1 83  ? -243.301 -11.332 119.764 1.00 0.00 ? 83  GLU A HA   1  
ATOM 1347  H HB2  . GLU A 1 83  ? -245.869 -12.474 120.812 1.00 0.00 ? 83  GLU A HB2  1  
ATOM 1348  H HB3  . GLU A 1 83  ? -244.321 -12.690 121.617 1.00 0.00 ? 83  GLU A HB3  1  
ATOM 1349  H HG2  . GLU A 1 83  ? -245.579 -10.867 122.575 1.00 0.00 ? 83  GLU A HG2  1  
ATOM 1350  H HG3  . GLU A 1 83  ? -244.085 -10.293 121.871 1.00 0.00 ? 83  GLU A HG3  1  
ATOM 1351  N N    . GLU A 1 84  ? -244.719 -14.046 118.577 1.00 0.00 ? 84  GLU A N    1  
ATOM 1352  C CA   . GLU A 1 84  ? -244.479 -15.378 118.052 1.00 0.00 ? 84  GLU A CA   1  
ATOM 1353  C C    . GLU A 1 84  ? -243.912 -15.289 116.642 1.00 0.00 ? 84  GLU A C    1  
ATOM 1354  O O    . GLU A 1 84  ? -244.648 -15.206 115.658 1.00 0.00 ? 84  GLU A O    1  
ATOM 1355  C CB   . GLU A 1 84  ? -245.782 -16.174 118.078 1.00 0.00 ? 84  GLU A CB   1  
ATOM 1356  C CG   . GLU A 1 84  ? -246.382 -16.242 119.472 1.00 0.00 ? 84  GLU A CG   1  
ATOM 1357  C CD   . GLU A 1 84  ? -247.771 -16.835 119.504 1.00 0.00 ? 84  GLU A CD   1  
ATOM 1358  O OE1  . GLU A 1 84  ? -247.922 -18.028 119.183 1.00 0.00 ? 84  GLU A OE1  1  
ATOM 1359  O OE2  . GLU A 1 84  ? -248.720 -16.107 119.871 1.00 0.00 ? 84  GLU A OE2  1  
ATOM 1360  H H    . GLU A 1 84  ? -245.614 -13.666 118.500 1.00 0.00 ? 84  GLU A H    1  
ATOM 1361  H HA   . GLU A 1 84  ? -243.754 -15.863 118.691 1.00 0.00 ? 84  GLU A HA   1  
ATOM 1362  H HB2  . GLU A 1 84  ? -246.496 -15.706 117.416 1.00 0.00 ? 84  GLU A HB2  1  
ATOM 1363  H HB3  . GLU A 1 84  ? -245.588 -17.181 117.740 1.00 0.00 ? 84  GLU A HB3  1  
ATOM 1364  H HG2  . GLU A 1 84  ? -245.739 -16.840 120.094 1.00 0.00 ? 84  GLU A HG2  1  
ATOM 1365  H HG3  . GLU A 1 84  ? -246.429 -15.239 119.872 1.00 0.00 ? 84  GLU A HG3  1  
ATOM 1366  N N    . GLU A 1 85  ? -242.592 -15.278 116.560 1.00 0.00 ? 85  GLU A N    1  
ATOM 1367  C CA   . GLU A 1 85  ? -241.900 -15.068 115.300 1.00 0.00 ? 85  GLU A CA   1  
ATOM 1368  C C    . GLU A 1 85  ? -242.117 -16.220 114.325 1.00 0.00 ? 85  GLU A C    1  
ATOM 1369  O O    . GLU A 1 85  ? -242.110 -17.398 114.703 1.00 0.00 ? 85  GLU A O    1  
ATOM 1370  C CB   . GLU A 1 85  ? -240.413 -14.857 115.549 1.00 0.00 ? 85  GLU A CB   1  
ATOM 1371  C CG   . GLU A 1 85  ? -240.115 -13.617 116.370 1.00 0.00 ? 85  GLU A CG   1  
ATOM 1372  C CD   . GLU A 1 85  ? -238.640 -13.297 116.409 1.00 0.00 ? 85  GLU A CD   1  
ATOM 1373  O OE1  . GLU A 1 85  ? -238.117 -12.788 115.398 1.00 0.00 ? 85  GLU A OE1  1  
ATOM 1374  O OE2  . GLU A 1 85  ? -237.995 -13.540 117.449 1.00 0.00 ? 85  GLU A OE2  1  
ATOM 1375  H H    . GLU A 1 85  ? -242.067 -15.409 117.377 1.00 0.00 ? 85  GLU A H    1  
ATOM 1376  H HA   . GLU A 1 85  ? -242.304 -14.170 114.858 1.00 0.00 ? 85  GLU A HA   1  
ATOM 1377  H HB2  . GLU A 1 85  ? -240.021 -15.717 116.073 1.00 0.00 ? 85  GLU A HB2  1  
ATOM 1378  H HB3  . GLU A 1 85  ? -239.909 -14.763 114.599 1.00 0.00 ? 85  GLU A HB3  1  
ATOM 1379  H HG2  . GLU A 1 85  ? -240.644 -12.777 115.937 1.00 0.00 ? 85  GLU A HG2  1  
ATOM 1380  H HG3  . GLU A 1 85  ? -240.463 -13.776 117.381 1.00 0.00 ? 85  GLU A HG3  1  
ATOM 1381  N N    . ILE A 1 86  ? -242.286 -15.868 113.057 1.00 0.00 ? 86  ILE A N    1  
ATOM 1382  C CA   . ILE A 1 86  ? -242.573 -16.846 112.021 1.00 0.00 ? 86  ILE A CA   1  
ATOM 1383  C C    . ILE A 1 86  ? -241.389 -17.766 111.791 1.00 0.00 ? 86  ILE A C    1  
ATOM 1384  O O    . ILE A 1 86  ? -241.560 -18.932 111.457 1.00 0.00 ? 86  ILE A O    1  
ATOM 1385  C CB   . ILE A 1 86  ? -242.961 -16.181 110.688 1.00 0.00 ? 86  ILE A CB   1  
ATOM 1386  C CG1  . ILE A 1 86  ? -241.805 -15.344 110.134 1.00 0.00 ? 86  ILE A CG1  1  
ATOM 1387  C CG2  . ILE A 1 86  ? -244.189 -15.317 110.891 1.00 0.00 ? 86  ILE A CG2  1  
ATOM 1388  C CD1  . ILE A 1 86  ? -242.038 -14.846 108.725 1.00 0.00 ? 86  ILE A CD1  1  
ATOM 1389  H H    . ILE A 1 86  ? -242.210 -14.924 112.812 1.00 0.00 ? 86  ILE A H    1  
ATOM 1390  H HA   . ILE A 1 86  ? -243.412 -17.441 112.355 1.00 0.00 ? 86  ILE A HA   1  
ATOM 1391  H HB   . ILE A 1 86  ? -243.209 -16.960 109.981 1.00 0.00 ? 86  ILE A HB   1  
ATOM 1392  H HG12 . ILE A 1 86  ? -241.657 -14.482 110.768 1.00 0.00 ? 86  ILE A HG12 1  
ATOM 1393  H HG13 . ILE A 1 86  ? -240.905 -15.941 110.133 1.00 0.00 ? 86  ILE A HG13 1  
ATOM 1394  H HG21 . ILE A 1 86  ? -243.979 -14.569 111.641 1.00 0.00 ? 86  ILE A HG21 1  
ATOM 1395  H HG22 . ILE A 1 86  ? -244.446 -14.834 109.961 1.00 0.00 ? 86  ILE A HG22 1  
ATOM 1396  H HG23 . ILE A 1 86  ? -245.013 -15.934 111.219 1.00 0.00 ? 86  ILE A HG23 1  
ATOM 1397  H HD11 . ILE A 1 86  ? -242.189 -15.690 108.067 1.00 0.00 ? 86  ILE A HD11 1  
ATOM 1398  H HD12 . ILE A 1 86  ? -242.914 -14.215 108.707 1.00 0.00 ? 86  ILE A HD12 1  
ATOM 1399  H HD13 . ILE A 1 86  ? -241.179 -14.279 108.396 1.00 0.00 ? 86  ILE A HD13 1  
ATOM 1400  N N    . MET A 1 87  ? -240.186 -17.255 111.995 1.00 0.00 ? 87  MET A N    1  
ATOM 1401  C CA   . MET A 1 87  ? -238.998 -18.065 111.813 1.00 0.00 ? 87  MET A CA   1  
ATOM 1402  C C    . MET A 1 87  ? -238.934 -19.135 112.895 1.00 0.00 ? 87  MET A C    1  
ATOM 1403  O O    . MET A 1 87  ? -238.273 -20.159 112.734 1.00 0.00 ? 87  MET A O    1  
ATOM 1404  C CB   . MET A 1 87  ? -237.738 -17.199 111.810 1.00 0.00 ? 87  MET A CB   1  
ATOM 1405  C CG   . MET A 1 87  ? -236.504 -17.925 111.292 1.00 0.00 ? 87  MET A CG   1  
ATOM 1406  S SD   . MET A 1 87  ? -236.784 -18.736 109.700 1.00 0.00 ? 87  MET A SD   1  
ATOM 1407  C CE   . MET A 1 87  ? -237.451 -17.388 108.719 1.00 0.00 ? 87  MET A CE   1  
ATOM 1408  H H    . MET A 1 87  ? -240.095 -16.311 112.268 1.00 0.00 ? 87  MET A H    1  
ATOM 1409  H HA   . MET A 1 87  ? -239.085 -18.556 110.854 1.00 0.00 ? 87  MET A HA   1  
ATOM 1410  H HB2  . MET A 1 87  ? -237.912 -16.334 111.187 1.00 0.00 ? 87  MET A HB2  1  
ATOM 1411  H HB3  . MET A 1 87  ? -237.539 -16.870 112.819 1.00 0.00 ? 87  MET A HB3  1  
ATOM 1412  H HG2  . MET A 1 87  ? -235.702 -17.210 111.177 1.00 0.00 ? 87  MET A HG2  1  
ATOM 1413  H HG3  . MET A 1 87  ? -236.216 -18.674 112.015 1.00 0.00 ? 87  MET A HG3  1  
ATOM 1414  H HE1  . MET A 1 87  ? -238.339 -17.000 109.195 1.00 0.00 ? 87  MET A HE1  1  
ATOM 1415  H HE2  . MET A 1 87  ? -236.714 -16.601 108.638 1.00 0.00 ? 87  MET A HE2  1  
ATOM 1416  H HE3  . MET A 1 87  ? -237.704 -17.749 107.732 1.00 0.00 ? 87  MET A HE3  1  
ATOM 1417  N N    . GLN A 1 88  ? -239.657 -18.912 113.992 1.00 0.00 ? 88  GLN A N    1  
ATOM 1418  C CA   . GLN A 1 88  ? -239.744 -19.910 115.046 1.00 0.00 ? 88  GLN A CA   1  
ATOM 1419  C C    . GLN A 1 88  ? -240.721 -20.980 114.616 1.00 0.00 ? 88  GLN A C    1  
ATOM 1420  O O    . GLN A 1 88  ? -240.563 -22.158 114.919 1.00 0.00 ? 88  GLN A O    1  
ATOM 1421  C CB   . GLN A 1 88  ? -240.181 -19.297 116.370 1.00 0.00 ? 88  GLN A CB   1  
ATOM 1422  C CG   . GLN A 1 88  ? -239.227 -18.235 116.855 1.00 0.00 ? 88  GLN A CG   1  
ATOM 1423  C CD   . GLN A 1 88  ? -239.544 -17.721 118.248 1.00 0.00 ? 88  GLN A CD   1  
ATOM 1424  O OE1  . GLN A 1 88  ? -238.646 -17.305 118.979 1.00 0.00 ? 88  GLN A OE1  1  
ATOM 1425  N NE2  . GLN A 1 88  ? -240.809 -17.754 118.635 1.00 0.00 ? 88  GLN A NE2  1  
ATOM 1426  H H    . GLN A 1 88  ? -240.180 -18.081 114.066 1.00 0.00 ? 88  GLN A H    1  
ATOM 1427  H HA   . GLN A 1 88  ? -238.766 -20.345 115.167 1.00 0.00 ? 88  GLN A HA   1  
ATOM 1428  H HB2  . GLN A 1 88  ? -241.158 -18.854 116.246 1.00 0.00 ? 88  GLN A HB2  1  
ATOM 1429  H HB3  . GLN A 1 88  ? -240.236 -20.075 117.116 1.00 0.00 ? 88  GLN A HB3  1  
ATOM 1430  H HG2  . GLN A 1 88  ? -238.229 -18.646 116.861 1.00 0.00 ? 88  GLN A HG2  1  
ATOM 1431  H HG3  . GLN A 1 88  ? -239.269 -17.416 116.161 1.00 0.00 ? 88  GLN A HG3  1  
ATOM 1432  H HE21 . GLN A 1 88  ? -241.484 -18.105 118.009 1.00 0.00 ? 88  GLN A HE21 1  
ATOM 1433  H HE22 . GLN A 1 88  ? -241.023 -17.434 119.544 1.00 0.00 ? 88  GLN A HE22 1  
ATOM 1434  N N    . ILE A 1 89  ? -241.734 -20.534 113.890 1.00 0.00 ? 89  ILE A N    1  
ATOM 1435  C CA   . ILE A 1 89  ? -242.725 -21.421 113.302 1.00 0.00 ? 89  ILE A CA   1  
ATOM 1436  C C    . ILE A 1 89  ? -242.064 -22.390 112.324 1.00 0.00 ? 89  ILE A C    1  
ATOM 1437  O O    . ILE A 1 89  ? -242.250 -23.600 112.409 1.00 0.00 ? 89  ILE A O    1  
ATOM 1438  C CB   . ILE A 1 89  ? -243.800 -20.614 112.570 1.00 0.00 ? 89  ILE A CB   1  
ATOM 1439  C CG1  . ILE A 1 89  ? -244.284 -19.488 113.480 1.00 0.00 ? 89  ILE A CG1  1  
ATOM 1440  C CG2  . ILE A 1 89  ? -244.956 -21.508 112.141 1.00 0.00 ? 89  ILE A CG2  1  
ATOM 1441  C CD1  . ILE A 1 89  ? -244.764 -19.945 114.843 1.00 0.00 ? 89  ILE A CD1  1  
ATOM 1442  H H    . ILE A 1 89  ? -241.827 -19.563 113.757 1.00 0.00 ? 89  ILE A H    1  
ATOM 1443  H HA   . ILE A 1 89  ? -243.205 -21.967 114.094 1.00 0.00 ? 89  ILE A HA   1  
ATOM 1444  H HB   . ILE A 1 89  ? -243.358 -20.187 111.682 1.00 0.00 ? 89  ILE A HB   1  
ATOM 1445  H HG12 . ILE A 1 89  ? -243.477 -18.790 113.635 1.00 0.00 ? 89  ILE A HG12 1  
ATOM 1446  H HG13 . ILE A 1 89  ? -245.089 -18.986 112.999 1.00 0.00 ? 89  ILE A HG13 1  
ATOM 1447  H HG21 . ILE A 1 89  ? -245.381 -21.988 113.010 1.00 0.00 ? 89  ILE A HG21 1  
ATOM 1448  H HG22 . ILE A 1 89  ? -245.712 -20.910 111.654 1.00 0.00 ? 89  ILE A HG22 1  
ATOM 1449  H HG23 . ILE A 1 89  ? -244.594 -22.260 111.456 1.00 0.00 ? 89  ILE A HG23 1  
ATOM 1450  H HD11 . ILE A 1 89  ? -245.560 -20.664 114.726 1.00 0.00 ? 89  ILE A HD11 1  
ATOM 1451  H HD12 . ILE A 1 89  ? -243.941 -20.399 115.377 1.00 0.00 ? 89  ILE A HD12 1  
ATOM 1452  H HD13 . ILE A 1 89  ? -245.125 -19.093 115.400 1.00 0.00 ? 89  ILE A HD13 1  
ATOM 1453  N N    . LEU A 1 90  ? -241.262 -21.841 111.412 1.00 0.00 ? 90  LEU A N    1  
ATOM 1454  C CA   . LEU A 1 90  ? -240.532 -22.649 110.439 1.00 0.00 ? 90  LEU A CA   1  
ATOM 1455  C C    . LEU A 1 90  ? -239.434 -23.466 111.119 1.00 0.00 ? 90  LEU A C    1  
ATOM 1456  O O    . LEU A 1 90  ? -238.965 -24.464 110.578 1.00 0.00 ? 90  LEU A O    1  
ATOM 1457  C CB   . LEU A 1 90  ? -239.920 -21.769 109.340 1.00 0.00 ? 90  LEU A CB   1  
ATOM 1458  C CG   . LEU A 1 90  ? -240.887 -21.271 108.256 1.00 0.00 ? 90  LEU A CG   1  
ATOM 1459  C CD1  . LEU A 1 90  ? -241.697 -22.422 107.687 1.00 0.00 ? 90  LEU A CD1  1  
ATOM 1460  C CD2  . LEU A 1 90  ? -241.810 -20.186 108.785 1.00 0.00 ? 90  LEU A CD2  1  
ATOM 1461  H H    . LEU A 1 90  ? -241.168 -20.862 111.386 1.00 0.00 ? 90  LEU A H    1  
ATOM 1462  H HA   . LEU A 1 90  ? -241.238 -23.329 109.985 1.00 0.00 ? 90  LEU A HA   1  
ATOM 1463  H HB2  . LEU A 1 90  ? -239.474 -20.906 109.813 1.00 0.00 ? 90  LEU A HB2  1  
ATOM 1464  H HB3  . LEU A 1 90  ? -239.136 -22.334 108.857 1.00 0.00 ? 90  LEU A HB3  1  
ATOM 1465  H HG   . LEU A 1 90  ? -240.310 -20.846 107.449 1.00 0.00 ? 90  LEU A HG   1  
ATOM 1466  H HD11 . LEU A 1 90  ? -241.030 -23.169 107.285 1.00 0.00 ? 90  LEU A HD11 1  
ATOM 1467  H HD12 . LEU A 1 90  ? -242.300 -22.860 108.472 1.00 0.00 ? 90  LEU A HD12 1  
ATOM 1468  H HD13 . LEU A 1 90  ? -242.341 -22.054 106.901 1.00 0.00 ? 90  LEU A HD13 1  
ATOM 1469  H HD21 . LEU A 1 90  ? -241.220 -19.350 109.133 1.00 0.00 ? 90  LEU A HD21 1  
ATOM 1470  H HD22 . LEU A 1 90  ? -242.469 -19.857 107.994 1.00 0.00 ? 90  LEU A HD22 1  
ATOM 1471  H HD23 . LEU A 1 90  ? -242.396 -20.578 109.603 1.00 0.00 ? 90  LEU A HD23 1  
ATOM 1472  N N    . SER A 1 91  ? -239.018 -23.027 112.299 1.00 0.00 ? 91  SER A N    1  
ATOM 1473  C CA   . SER A 1 91  ? -238.034 -23.758 113.086 1.00 0.00 ? 91  SER A CA   1  
ATOM 1474  C C    . SER A 1 91  ? -238.703 -24.922 113.817 1.00 0.00 ? 91  SER A C    1  
ATOM 1475  O O    . SER A 1 91  ? -238.134 -26.008 113.942 1.00 0.00 ? 91  SER A O    1  
ATOM 1476  C CB   . SER A 1 91  ? -237.354 -22.812 114.081 1.00 0.00 ? 91  SER A CB   1  
ATOM 1477  O OG   . SER A 1 91  ? -236.348 -23.470 114.828 1.00 0.00 ? 91  SER A OG   1  
ATOM 1478  H H    . SER A 1 91  ? -239.373 -22.183 112.645 1.00 0.00 ? 91  SER A H    1  
ATOM 1479  H HA   . SER A 1 91  ? -237.291 -24.152 112.408 1.00 0.00 ? 91  SER A HA   1  
ATOM 1480  H HB2  . SER A 1 91  ? -236.902 -21.993 113.541 1.00 0.00 ? 91  SER A HB2  1  
ATOM 1481  H HB3  . SER A 1 91  ? -238.096 -22.424 114.764 1.00 0.00 ? 91  SER A HB3  1  
ATOM 1482  H HG   . SER A 1 91  ? -236.333 -23.107 115.727 1.00 0.00 ? 91  SER A HG   1  
ATOM 1483  N N    . SER A 1 92  ? -239.927 -24.690 114.277 1.00 0.00 ? 92  SER A N    1  
ATOM 1484  C CA   . SER A 1 92  ? -240.706 -25.713 114.957 1.00 0.00 ? 92  SER A CA   1  
ATOM 1485  C C    . SER A 1 92  ? -241.323 -26.668 113.942 1.00 0.00 ? 92  SER A C    1  
ATOM 1486  O O    . SER A 1 92  ? -241.892 -27.693 114.310 1.00 0.00 ? 92  SER A O    1  
ATOM 1487  C CB   . SER A 1 92  ? -241.801 -25.058 115.807 1.00 0.00 ? 92  SER A CB   1  
ATOM 1488  O OG   . SER A 1 92  ? -242.483 -26.012 116.608 1.00 0.00 ? 92  SER A OG   1  
ATOM 1489  H H    . SER A 1 92  ? -240.315 -23.794 114.168 1.00 0.00 ? 92  SER A H    1  
ATOM 1490  H HA   . SER A 1 92  ? -240.041 -26.266 115.602 1.00 0.00 ? 92  SER A HA   1  
ATOM 1491  H HB2  . SER A 1 92  ? -241.354 -24.319 116.455 1.00 0.00 ? 92  SER A HB2  1  
ATOM 1492  H HB3  . SER A 1 92  ? -242.516 -24.577 115.155 1.00 0.00 ? 92  SER A HB3  1  
ATOM 1493  H HG   . SER A 1 92  ? -242.686 -26.792 116.071 1.00 0.00 ? 92  SER A HG   1  
ATOM 1494  N N    . TRP A 1 93  ? -241.214 -26.304 112.669 1.00 0.00 ? 93  TRP A N    1  
ATOM 1495  C CA   . TRP A 1 93  ? -241.671 -27.145 111.574 1.00 0.00 ? 93  TRP A CA   1  
ATOM 1496  C C    . TRP A 1 93  ? -240.840 -28.420 111.538 1.00 0.00 ? 93  TRP A C    1  
ATOM 1497  O O    . TRP A 1 93  ? -239.679 -28.407 111.116 1.00 0.00 ? 93  TRP A O    1  
ATOM 1498  C CB   . TRP A 1 93  ? -241.536 -26.381 110.251 1.00 0.00 ? 93  TRP A CB   1  
ATOM 1499  C CG   . TRP A 1 93  ? -242.206 -27.030 109.075 1.00 0.00 ? 93  TRP A CG   1  
ATOM 1500  C CD1  . TRP A 1 93  ? -241.840 -28.185 108.444 1.00 0.00 ? 93  TRP A CD1  1  
ATOM 1501  C CD2  . TRP A 1 93  ? -243.349 -26.535 108.370 1.00 0.00 ? 93  TRP A CD2  1  
ATOM 1502  N NE1  . TRP A 1 93  ? -242.691 -28.440 107.397 1.00 0.00 ? 93  TRP A NE1  1  
ATOM 1503  C CE2  . TRP A 1 93  ? -243.625 -27.443 107.332 1.00 0.00 ? 93  TRP A CE2  1  
ATOM 1504  C CE3  . TRP A 1 93  ? -244.169 -25.414 108.520 1.00 0.00 ? 93  TRP A CE3  1  
ATOM 1505  C CZ2  . TRP A 1 93  ? -244.685 -27.266 106.449 1.00 0.00 ? 93  TRP A CZ2  1  
ATOM 1506  C CZ3  . TRP A 1 93  ? -245.221 -25.238 107.640 1.00 0.00 ? 93  TRP A CZ3  1  
ATOM 1507  C CH2  . TRP A 1 93  ? -245.469 -26.159 106.617 1.00 0.00 ? 93  TRP A CH2  1  
ATOM 1508  H H    . TRP A 1 93  ? -240.815 -25.437 112.462 1.00 0.00 ? 93  TRP A H    1  
ATOM 1509  H HA   . TRP A 1 93  ? -242.707 -27.396 111.743 1.00 0.00 ? 93  TRP A HA   1  
ATOM 1510  H HB2  . TRP A 1 93  ? -241.968 -25.400 110.372 1.00 0.00 ? 93  TRP A HB2  1  
ATOM 1511  H HB3  . TRP A 1 93  ? -240.486 -26.276 110.017 1.00 0.00 ? 93  TRP A HB3  1  
ATOM 1512  H HD1  . TRP A 1 93  ? -241.002 -28.799 108.737 1.00 0.00 ? 93  TRP A HD1  1  
ATOM 1513  H HE1  . TRP A 1 93  ? -242.639 -29.211 106.792 1.00 0.00 ? 93  TRP A HE1  1  
ATOM 1514  H HE3  . TRP A 1 93  ? -243.993 -24.692 109.304 1.00 0.00 ? 93  TRP A HE3  1  
ATOM 1515  H HZ2  . TRP A 1 93  ? -244.890 -27.967 105.653 1.00 0.00 ? 93  TRP A HZ2  1  
ATOM 1516  H HZ3  . TRP A 1 93  ? -245.866 -24.377 107.738 1.00 0.00 ? 93  TRP A HZ3  1  
ATOM 1517  H HH2  . TRP A 1 93  ? -246.301 -25.981 105.952 1.00 0.00 ? 93  TRP A HH2  1  
ATOM 1518  N N    . PHE A 1 94  ? -241.428 -29.509 111.993 1.00 0.00 ? 94  PHE A N    1  
ATOM 1519  C CA   . PHE A 1 94  ? -240.718 -30.768 112.093 1.00 0.00 ? 94  PHE A CA   1  
ATOM 1520  C C    . PHE A 1 94  ? -240.577 -31.409 110.719 1.00 0.00 ? 94  PHE A C    1  
ATOM 1521  O O    . PHE A 1 94  ? -241.470 -31.294 109.878 1.00 0.00 ? 94  PHE A O    1  
ATOM 1522  C CB   . PHE A 1 94  ? -241.448 -31.727 113.041 1.00 0.00 ? 94  PHE A CB   1  
ATOM 1523  C CG   . PHE A 1 94  ? -241.652 -31.175 114.424 1.00 0.00 ? 94  PHE A CG   1  
ATOM 1524  C CD1  . PHE A 1 94  ? -240.575 -30.966 115.270 1.00 0.00 ? 94  PHE A CD1  1  
ATOM 1525  C CD2  . PHE A 1 94  ? -242.924 -30.864 114.877 1.00 0.00 ? 94  PHE A CD2  1  
ATOM 1526  C CE1  . PHE A 1 94  ? -240.764 -30.456 116.540 1.00 0.00 ? 94  PHE A CE1  1  
ATOM 1527  C CE2  . PHE A 1 94  ? -243.118 -30.356 116.147 1.00 0.00 ? 94  PHE A CE2  1  
ATOM 1528  C CZ   . PHE A 1 94  ? -242.036 -30.151 116.979 1.00 0.00 ? 94  PHE A CZ   1  
ATOM 1529  H H    . PHE A 1 94  ? -242.384 -29.468 112.253 1.00 0.00 ? 94  PHE A H    1  
ATOM 1530  H HA   . PHE A 1 94  ? -239.734 -30.563 112.486 1.00 0.00 ? 94  PHE A HA   1  
ATOM 1531  H HB2  . PHE A 1 94  ? -242.420 -31.957 112.629 1.00 0.00 ? 94  PHE A HB2  1  
ATOM 1532  H HB3  . PHE A 1 94  ? -240.875 -32.639 113.127 1.00 0.00 ? 94  PHE A HB3  1  
ATOM 1533  H HD1  . PHE A 1 94  ? -239.578 -31.205 114.928 1.00 0.00 ? 94  PHE A HD1  1  
ATOM 1534  H HD2  . PHE A 1 94  ? -243.771 -31.023 114.227 1.00 0.00 ? 94  PHE A HD2  1  
ATOM 1535  H HE1  . PHE A 1 94  ? -239.916 -30.295 117.190 1.00 0.00 ? 94  PHE A HE1  1  
ATOM 1536  H HE2  . PHE A 1 94  ? -244.116 -30.119 116.488 1.00 0.00 ? 94  PHE A HE2  1  
ATOM 1537  H HZ   . PHE A 1 94  ? -242.185 -29.755 117.973 1.00 0.00 ? 94  PHE A HZ   1  
ATOM 1538  N N    . PRO A 1 95  ? -239.449 -32.089 110.469 1.00 0.00 ? 95  PRO A N    1  
ATOM 1539  C CA   . PRO A 1 95  ? -239.232 -32.817 109.218 1.00 0.00 ? 95  PRO A CA   1  
ATOM 1540  C C    . PRO A 1 95  ? -240.266 -33.923 109.039 1.00 0.00 ? 95  PRO A C    1  
ATOM 1541  O O    . PRO A 1 95  ? -240.589 -34.322 107.919 1.00 0.00 ? 95  PRO A O    1  
ATOM 1542  C CB   . PRO A 1 95  ? -237.824 -33.406 109.375 1.00 0.00 ? 95  PRO A CB   1  
ATOM 1543  C CG   . PRO A 1 95  ? -237.183 -32.604 110.456 1.00 0.00 ? 95  PRO A CG   1  
ATOM 1544  C CD   . PRO A 1 95  ? -238.294 -32.190 111.375 1.00 0.00 ? 95  PRO A CD   1  
ATOM 1545  H HA   . PRO A 1 95  ? -239.260 -32.155 108.364 1.00 0.00 ? 95  PRO A HA   1  
ATOM 1546  H HB2  . PRO A 1 95  ? -237.896 -34.449 109.648 1.00 0.00 ? 95  PRO A HB2  1  
ATOM 1547  H HB3  . PRO A 1 95  ? -237.286 -33.310 108.443 1.00 0.00 ? 95  PRO A HB3  1  
ATOM 1548  H HG2  . PRO A 1 95  ? -236.463 -33.211 110.985 1.00 0.00 ? 95  PRO A HG2  1  
ATOM 1549  H HG3  . PRO A 1 95  ? -236.703 -31.735 110.032 1.00 0.00 ? 95  PRO A HG3  1  
ATOM 1550  H HD2  . PRO A 1 95  ? -238.461 -32.940 112.133 1.00 0.00 ? 95  PRO A HD2  1  
ATOM 1551  H HD3  . PRO A 1 95  ? -238.075 -31.234 111.829 1.00 0.00 ? 95  PRO A HD3  1  
ATOM 1552  N N    . GLU A 1 96  ? -240.791 -34.404 110.165 1.00 0.00 ? 96  GLU A N    1  
ATOM 1553  C CA   . GLU A 1 96  ? -241.859 -35.392 110.160 1.00 0.00 ? 96  GLU A CA   1  
ATOM 1554  C C    . GLU A 1 96  ? -243.107 -34.813 109.502 1.00 0.00 ? 96  GLU A C    1  
ATOM 1555  O O    . GLU A 1 96  ? -243.790 -35.498 108.738 1.00 0.00 ? 96  GLU A O    1  
ATOM 1556  C CB   . GLU A 1 96  ? -242.187 -35.857 111.586 1.00 0.00 ? 96  GLU A CB   1  
ATOM 1557  C CG   . GLU A 1 96  ? -241.057 -36.614 112.278 1.00 0.00 ? 96  GLU A CG   1  
ATOM 1558  C CD   . GLU A 1 96  ? -239.898 -35.724 112.691 1.00 0.00 ? 96  GLU A CD   1  
ATOM 1559  O OE1  . GLU A 1 96  ? -240.014 -35.036 113.724 1.00 0.00 ? 96  GLU A OE1  1  
ATOM 1560  O OE2  . GLU A 1 96  ? -238.871 -35.706 111.982 1.00 0.00 ? 96  GLU A OE2  1  
ATOM 1561  H H    . GLU A 1 96  ? -240.437 -34.090 111.024 1.00 0.00 ? 96  GLU A H    1  
ATOM 1562  H HA   . GLU A 1 96  ? -241.524 -36.241 109.581 1.00 0.00 ? 96  GLU A HA   1  
ATOM 1563  H HB2  . GLU A 1 96  ? -242.426 -34.990 112.185 1.00 0.00 ? 96  GLU A HB2  1  
ATOM 1564  H HB3  . GLU A 1 96  ? -243.052 -36.503 111.549 1.00 0.00 ? 96  GLU A HB3  1  
ATOM 1565  H HG2  . GLU A 1 96  ? -241.454 -37.091 113.161 1.00 0.00 ? 96  GLU A HG2  1  
ATOM 1566  H HG3  . GLU A 1 96  ? -240.686 -37.370 111.601 1.00 0.00 ? 96  GLU A HG3  1  
ATOM 1567  N N    . GLU A 1 97  ? -243.392 -33.546 109.796 1.00 0.00 ? 97  GLU A N    1  
ATOM 1568  C CA   . GLU A 1 97  ? -244.499 -32.844 109.159 1.00 0.00 ? 97  GLU A CA   1  
ATOM 1569  C C    . GLU A 1 97  ? -244.194 -32.682 107.677 1.00 0.00 ? 97  GLU A C    1  
ATOM 1570  O O    . GLU A 1 97  ? -244.960 -33.127 106.819 1.00 0.00 ? 97  GLU A O    1  
ATOM 1571  C CB   . GLU A 1 97  ? -244.718 -31.472 109.802 1.00 0.00 ? 97  GLU A CB   1  
ATOM 1572  C CG   . GLU A 1 97  ? -244.940 -31.524 111.306 1.00 0.00 ? 97  GLU A CG   1  
ATOM 1573  C CD   . GLU A 1 97  ? -245.102 -30.147 111.918 1.00 0.00 ? 97  GLU A CD   1  
ATOM 1574  O OE1  . GLU A 1 97  ? -244.088 -29.440 112.076 1.00 0.00 ? 97  GLU A OE1  1  
ATOM 1575  O OE2  . GLU A 1 97  ? -246.243 -29.761 112.234 1.00 0.00 ? 97  GLU A OE2  1  
ATOM 1576  H H    . GLU A 1 97  ? -242.836 -33.069 110.447 1.00 0.00 ? 97  GLU A H    1  
ATOM 1577  H HA   . GLU A 1 97  ? -245.390 -33.443 109.275 1.00 0.00 ? 97  GLU A HA   1  
ATOM 1578  H HB2  . GLU A 1 97  ? -243.853 -30.855 109.610 1.00 0.00 ? 97  GLU A HB2  1  
ATOM 1579  H HB3  . GLU A 1 97  ? -245.584 -31.012 109.348 1.00 0.00 ? 97  GLU A HB3  1  
ATOM 1580  H HG2  . GLU A 1 97  ? -245.832 -32.099 111.508 1.00 0.00 ? 97  GLU A HG2  1  
ATOM 1581  H HG3  . GLU A 1 97  ? -244.090 -32.008 111.764 1.00 0.00 ? 97  GLU A HG3  1  
ATOM 1582  N N    . GLY A 1 98  ? -243.064 -32.042 107.397 1.00 0.00 ? 98  GLY A N    1  
ATOM 1583  C CA   . GLY A 1 98  ? -242.550 -31.964 106.043 1.00 0.00 ? 98  GLY A CA   1  
ATOM 1584  C C    . GLY A 1 98  ? -243.387 -31.111 105.110 1.00 0.00 ? 98  GLY A C    1  
ATOM 1585  O O    . GLY A 1 98  ? -243.059 -29.952 104.858 1.00 0.00 ? 98  GLY A O    1  
ATOM 1586  H H    . GLY A 1 98  ? -242.564 -31.619 108.131 1.00 0.00 ? 98  GLY A H    1  
ATOM 1587  H HA2  . GLY A 1 98  ? -241.552 -31.554 106.079 1.00 0.00 ? 98  GLY A HA2  1  
ATOM 1588  H HA3  . GLY A 1 98  ? -242.496 -32.965 105.641 1.00 0.00 ? 98  GLY A HA3  1  
ATOM 1589  N N    . TYR A 1 99  ? -244.471 -31.684 104.612 1.00 0.00 ? 99  TYR A N    1  
ATOM 1590  C CA   . TYR A 1 99  ? -245.258 -31.065 103.555 1.00 0.00 ? 99  TYR A CA   1  
ATOM 1591  C C    . TYR A 1 99  ? -246.608 -30.568 104.061 1.00 0.00 ? 99  TYR A C    1  
ATOM 1592  O O    . TYR A 1 99  ? -247.398 -30.022 103.294 1.00 0.00 ? 99  TYR A O    1  
ATOM 1593  C CB   . TYR A 1 99  ? -245.463 -32.067 102.410 1.00 0.00 ? 99  TYR A CB   1  
ATOM 1594  C CG   . TYR A 1 99  ? -245.953 -33.428 102.866 1.00 0.00 ? 99  TYR A CG   1  
ATOM 1595  C CD1  . TYR A 1 99  ? -247.307 -33.676 103.061 1.00 0.00 ? 99  TYR A CD1  1  
ATOM 1596  C CD2  . TYR A 1 99  ? -245.057 -34.464 103.106 1.00 0.00 ? 99  TYR A CD2  1  
ATOM 1597  C CE1  . TYR A 1 99  ? -247.752 -34.915 103.482 1.00 0.00 ? 99  TYR A CE1  1  
ATOM 1598  C CE2  . TYR A 1 99  ? -245.496 -35.705 103.525 1.00 0.00 ? 99  TYR A CE2  1  
ATOM 1599  C CZ   . TYR A 1 99  ? -246.842 -35.925 103.713 1.00 0.00 ? 99  TYR A CZ   1  
ATOM 1600  O OH   . TYR A 1 99  ? -247.280 -37.158 104.132 1.00 0.00 ? 99  TYR A OH   1  
ATOM 1601  H H    . TYR A 1 99  ? -244.756 -32.550 104.975 1.00 0.00 ? 99  TYR A H    1  
ATOM 1602  H HA   . TYR A 1 99  ? -244.698 -30.222 103.180 1.00 0.00 ? 99  TYR A HA   1  
ATOM 1603  H HB2  . TYR A 1 99  ? -246.190 -31.671 101.718 1.00 0.00 ? 99  TYR A HB2  1  
ATOM 1604  H HB3  . TYR A 1 99  ? -244.523 -32.209 101.895 1.00 0.00 ? 99  TYR A HB3  1  
ATOM 1605  H HD1  . TYR A 1 99  ? -248.017 -32.882 102.880 1.00 0.00 ? 99  TYR A HD1  1  
ATOM 1606  H HD2  . TYR A 1 99  ? -244.001 -34.290 102.959 1.00 0.00 ? 99  TYR A HD2  1  
ATOM 1607  H HE1  . TYR A 1 99  ? -248.807 -35.087 103.628 1.00 0.00 ? 99  TYR A HE1  1  
ATOM 1608  H HE2  . TYR A 1 99  ? -244.782 -36.496 103.705 1.00 0.00 ? 99  TYR A HE2  1  
ATOM 1609  H HH   . TYR A 1 99  ? -248.062 -37.407 103.632 1.00 0.00 ? 99  TYR A HH   1  
ATOM 1610  N N    . MET A 1 100 ? -246.881 -30.754 105.343 1.00 0.00 ? 100 MET A N    1  
ATOM 1611  C CA   . MET A 1 100 ? -248.165 -30.343 105.890 1.00 0.00 ? 100 MET A CA   1  
ATOM 1612  C C    . MET A 1 100 ? -248.064 -29.006 106.610 1.00 0.00 ? 100 MET A C    1  
ATOM 1613  O O    . MET A 1 100 ? -247.309 -28.859 107.570 1.00 0.00 ? 100 MET A O    1  
ATOM 1614  C CB   . MET A 1 100 ? -248.731 -31.400 106.839 1.00 0.00 ? 100 MET A CB   1  
ATOM 1615  C CG   . MET A 1 100 ? -250.062 -30.988 107.450 1.00 0.00 ? 100 MET A CG   1  
ATOM 1616  S SD   . MET A 1 100 ? -250.800 -32.270 108.474 1.00 0.00 ? 100 MET A SD   1  
ATOM 1617  C CE   . MET A 1 100 ? -251.065 -33.557 107.259 1.00 0.00 ? 100 MET A CE   1  
ATOM 1618  H H    . MET A 1 100 ? -246.210 -31.160 105.929 1.00 0.00 ? 100 MET A H    1  
ATOM 1619  H HA   . MET A 1 100 ? -248.846 -30.229 105.060 1.00 0.00 ? 100 MET A HA   1  
ATOM 1620  H HB2  . MET A 1 100 ? -248.877 -32.321 106.292 1.00 0.00 ? 100 MET A HB2  1  
ATOM 1621  H HB3  . MET A 1 100 ? -248.026 -31.571 107.638 1.00 0.00 ? 100 MET A HB3  1  
ATOM 1622  H HG2  . MET A 1 100 ? -249.904 -30.112 108.060 1.00 0.00 ? 100 MET A HG2  1  
ATOM 1623  H HG3  . MET A 1 100 ? -250.747 -30.747 106.651 1.00 0.00 ? 100 MET A HG3  1  
ATOM 1624  H HE1  . MET A 1 100 ? -251.703 -33.183 106.473 1.00 0.00 ? 100 MET A HE1  1  
ATOM 1625  H HE2  . MET A 1 100 ? -250.116 -33.858 106.842 1.00 0.00 ? 100 MET A HE2  1  
ATOM 1626  H HE3  . MET A 1 100 ? -251.537 -34.407 107.732 1.00 0.00 ? 100 MET A HE3  1  
ATOM 1627  N N    . GLY A 1 101 ? -248.826 -28.036 106.130 1.00 0.00 ? 101 GLY A N    1  
ATOM 1628  C CA   . GLY A 1 101 ? -248.876 -26.741 106.770 1.00 0.00 ? 101 GLY A CA   1  
ATOM 1629  C C    . GLY A 1 101 ? -248.783 -25.614 105.767 1.00 0.00 ? 101 GLY A C    1  
ATOM 1630  O O    . GLY A 1 101 ? -248.397 -25.834 104.619 1.00 0.00 ? 101 GLY A O    1  
ATOM 1631  H H    . GLY A 1 101 ? -249.342 -28.193 105.312 1.00 0.00 ? 101 GLY A H    1  
ATOM 1632  H HA2  . GLY A 1 101 ? -249.805 -26.653 107.316 1.00 0.00 ? 101 GLY A HA2  1  
ATOM 1633  H HA3  . GLY A 1 101 ? -248.051 -26.660 107.463 1.00 0.00 ? 101 GLY A HA3  1  
ATOM 1634  N N    . ARG A 1 102 ? -249.158 -24.413 106.186 1.00 0.00 ? 102 ARG A N    1  
ATOM 1635  C CA   . ARG A 1 102 ? -249.043 -23.234 105.338 1.00 0.00 ? 102 ARG A CA   1  
ATOM 1636  C C    . ARG A 1 102 ? -249.250 -21.977 106.158 1.00 0.00 ? 102 ARG A C    1  
ATOM 1637  O O    . ARG A 1 102 ? -249.926 -22.008 107.188 1.00 0.00 ? 102 ARG A O    1  
ATOM 1638  C CB   . ARG A 1 102 ? -250.059 -23.251 104.181 1.00 0.00 ? 102 ARG A CB   1  
ATOM 1639  C CG   . ARG A 1 102 ? -251.517 -23.032 104.592 1.00 0.00 ? 102 ARG A CG   1  
ATOM 1640  C CD   . ARG A 1 102 ? -252.133 -24.283 105.196 1.00 0.00 ? 102 ARG A CD   1  
ATOM 1641  N NE   . ARG A 1 102 ? -253.554 -24.104 105.481 1.00 0.00 ? 102 ARG A NE   1  
ATOM 1642  C CZ   . ARG A 1 102 ? -254.472 -25.062 105.380 1.00 0.00 ? 102 ARG A CZ   1  
ATOM 1643  N NH1  . ARG A 1 102 ? -254.133 -26.287 104.990 1.00 0.00 ? 102 ARG A NH1  1  
ATOM 1644  N NH2  . ARG A 1 102 ? -255.733 -24.784 105.680 1.00 0.00 ? 102 ARG A NH2  1  
ATOM 1645  H H    . ARG A 1 102 ? -249.522 -24.313 107.092 1.00 0.00 ? 102 ARG A H    1  
ATOM 1646  H HA   . ARG A 1 102 ? -248.045 -23.218 104.927 1.00 0.00 ? 102 ARG A HA   1  
ATOM 1647  H HB2  . ARG A 1 102 ? -249.792 -22.473 103.479 1.00 0.00 ? 102 ARG A HB2  1  
ATOM 1648  H HB3  . ARG A 1 102 ? -249.991 -24.205 103.680 1.00 0.00 ? 102 ARG A HB3  1  
ATOM 1649  H HG2  . ARG A 1 102 ? -251.567 -22.228 105.321 1.00 0.00 ? 102 ARG A HG2  1  
ATOM 1650  H HG3  . ARG A 1 102 ? -252.085 -22.752 103.715 1.00 0.00 ? 102 ARG A HG3  1  
ATOM 1651  H HD2  . ARG A 1 102 ? -252.015 -25.100 104.500 1.00 0.00 ? 102 ARG A HD2  1  
ATOM 1652  H HD3  . ARG A 1 102 ? -251.616 -24.517 106.116 1.00 0.00 ? 102 ARG A HD3  1  
ATOM 1653  H HE   . ARG A 1 102 ? -253.848 -23.205 105.780 1.00 0.00 ? 102 ARG A HE   1  
ATOM 1654  H HH11 . ARG A 1 102 ? -253.180 -26.498 104.770 1.00 0.00 ? 102 ARG A HH11 1  
ATOM 1655  H HH12 . ARG A 1 102 ? -254.830 -27.002 104.914 1.00 0.00 ? 102 ARG A HH12 1  
ATOM 1656  H HH21 . ARG A 1 102 ? -255.980 -23.850 105.983 1.00 0.00 ? 102 ARG A HH21 1  
ATOM 1657  H HH22 . ARG A 1 102 ? -256.440 -25.486 105.609 1.00 0.00 ? 102 ARG A HH22 1  
ATOM 1658  N N    . ILE A 1 103 ? -248.664 -20.881 105.703 1.00 0.00 ? 103 ILE A N    1  
ATOM 1659  C CA   . ILE A 1 103 ? -248.920 -19.589 106.307 1.00 0.00 ? 103 ILE A CA   1  
ATOM 1660  C C    . ILE A 1 103 ? -250.184 -19.010 105.730 1.00 0.00 ? 103 ILE A C    1  
ATOM 1661  O O    . ILE A 1 103 ? -250.304 -18.837 104.518 1.00 0.00 ? 103 ILE A O    1  
ATOM 1662  C CB   . ILE A 1 103 ? -247.793 -18.565 106.055 1.00 0.00 ? 103 ILE A CB   1  
ATOM 1663  C CG1  . ILE A 1 103 ? -246.453 -19.080 106.587 1.00 0.00 ? 103 ILE A CG1  1  
ATOM 1664  C CG2  . ILE A 1 103 ? -248.136 -17.229 106.706 1.00 0.00 ? 103 ILE A CG2  1  
ATOM 1665  C CD1  . ILE A 1 103 ? -246.402 -19.169 108.101 1.00 0.00 ? 103 ILE A CD1  1  
ATOM 1666  H H    . ILE A 1 103 ? -248.045 -20.942 104.946 1.00 0.00 ? 103 ILE A H    1  
ATOM 1667  H HA   . ILE A 1 103 ? -249.042 -19.730 107.374 1.00 0.00 ? 103 ILE A HA   1  
ATOM 1668  H HB   . ILE A 1 103 ? -247.725 -18.399 104.986 1.00 0.00 ? 103 ILE A HB   1  
ATOM 1669  H HG12 . ILE A 1 103 ? -246.270 -20.067 106.189 1.00 0.00 ? 103 ILE A HG12 1  
ATOM 1670  H HG13 . ILE A 1 103 ? -245.665 -18.414 106.266 1.00 0.00 ? 103 ILE A HG13 1  
ATOM 1671  H HG21 . ILE A 1 103 ? -249.067 -16.859 106.303 1.00 0.00 ? 103 ILE A HG21 1  
ATOM 1672  H HG22 . ILE A 1 103 ? -248.235 -17.365 107.773 1.00 0.00 ? 103 ILE A HG22 1  
ATOM 1673  H HG23 . ILE A 1 103 ? -247.349 -16.517 106.504 1.00 0.00 ? 103 ILE A HG23 1  
ATOM 1674  H HD11 . ILE A 1 103 ? -246.679 -18.211 108.525 1.00 0.00 ? 103 ILE A HD11 1  
ATOM 1675  H HD12 . ILE A 1 103 ? -247.095 -19.924 108.443 1.00 0.00 ? 103 ILE A HD12 1  
ATOM 1676  H HD13 . ILE A 1 103 ? -245.401 -19.426 108.415 1.00 0.00 ? 103 ILE A HD13 1  
ATOM 1677  N N    . VAL A 1 104 ? -251.122 -18.724 106.585 1.00 0.00 ? 104 VAL A N    1  
ATOM 1678  C CA   . VAL A 1 104 ? -252.295 -18.022 106.186 1.00 0.00 ? 104 VAL A CA   1  
ATOM 1679  C C    . VAL A 1 104 ? -252.163 -16.575 106.636 1.00 0.00 ? 104 VAL A C    1  
ATOM 1680  O O    . VAL A 1 104 ? -251.448 -16.283 107.593 1.00 0.00 ? 104 VAL A O    1  
ATOM 1681  C CB   . VAL A 1 104 ? -253.564 -18.661 106.798 1.00 0.00 ? 104 VAL A CB   1  
ATOM 1682  C CG1  . VAL A 1 104 ? -254.207 -17.736 107.774 1.00 0.00 ? 104 VAL A CG1  1  
ATOM 1683  C CG2  . VAL A 1 104 ? -254.547 -19.037 105.713 1.00 0.00 ? 104 VAL A CG2  1  
ATOM 1684  H H    . VAL A 1 104 ? -251.020 -18.986 107.522 1.00 0.00 ? 104 VAL A H    1  
ATOM 1685  H HA   . VAL A 1 104 ? -252.368 -18.059 105.109 1.00 0.00 ? 104 VAL A HA   1  
ATOM 1686  H HB   . VAL A 1 104 ? -253.292 -19.552 107.343 1.00 0.00 ? 104 VAL A HB   1  
ATOM 1687  H HG11 . VAL A 1 104 ? -253.508 -17.507 108.561 1.00 0.00 ? 104 VAL A HG11 1  
ATOM 1688  H HG12 . VAL A 1 104 ? -254.490 -16.830 107.261 1.00 0.00 ? 104 VAL A HG12 1  
ATOM 1689  H HG13 . VAL A 1 104 ? -255.082 -18.211 108.187 1.00 0.00 ? 104 VAL A HG13 1  
ATOM 1690  H HG21 . VAL A 1 104 ? -254.068 -19.702 105.011 1.00 0.00 ? 104 VAL A HG21 1  
ATOM 1691  H HG22 . VAL A 1 104 ? -255.400 -19.527 106.157 1.00 0.00 ? 104 VAL A HG22 1  
ATOM 1692  H HG23 . VAL A 1 104 ? -254.873 -18.140 105.203 1.00 0.00 ? 104 VAL A HG23 1  
ATOM 1693  N N    . LEU A 1 105 ? -252.811 -15.680 105.933 1.00 0.00 ? 105 LEU A N    1  
ATOM 1694  C CA   . LEU A 1 105 ? -252.955 -14.325 106.404 1.00 0.00 ? 105 LEU A CA   1  
ATOM 1695  C C    . LEU A 1 105 ? -254.440 -14.070 106.597 1.00 0.00 ? 105 LEU A C    1  
ATOM 1696  O O    . LEU A 1 105 ? -255.201 -14.009 105.633 1.00 0.00 ? 105 LEU A O    1  
ATOM 1697  C CB   . LEU A 1 105 ? -252.395 -13.337 105.401 1.00 0.00 ? 105 LEU A CB   1  
ATOM 1698  C CG   . LEU A 1 105 ? -252.105 -11.963 105.975 1.00 0.00 ? 105 LEU A CG   1  
ATOM 1699  C CD1  . LEU A 1 105 ? -250.969 -12.067 106.973 1.00 0.00 ? 105 LEU A CD1  1  
ATOM 1700  C CD2  . LEU A 1 105 ? -251.776 -10.975 104.870 1.00 0.00 ? 105 LEU A CD2  1  
ATOM 1701  H H    . LEU A 1 105 ? -253.218 -15.935 105.080 1.00 0.00 ? 105 LEU A H    1  
ATOM 1702  H HA   . LEU A 1 105 ? -252.422 -14.217 107.359 1.00 0.00 ? 105 LEU A HA   1  
ATOM 1703  H HB2  . LEU A 1 105 ? -251.482 -13.743 104.991 1.00 0.00 ? 105 LEU A HB2  1  
ATOM 1704  H HB3  . LEU A 1 105 ? -253.114 -13.229 104.606 1.00 0.00 ? 105 LEU A HB3  1  
ATOM 1705  H HG   . LEU A 1 105 ? -252.979 -11.605 106.500 1.00 0.00 ? 105 LEU A HG   1  
ATOM 1706  H HD11 . LEU A 1 105 ? -251.224 -12.797 107.731 1.00 0.00 ? 105 LEU A HD11 1  
ATOM 1707  H HD12 . LEU A 1 105 ? -250.071 -12.381 106.463 1.00 0.00 ? 105 LEU A HD12 1  
ATOM 1708  H HD13 . LEU A 1 105 ? -250.806 -11.105 107.435 1.00 0.00 ? 105 LEU A HD13 1  
ATOM 1709  H HD21 . LEU A 1 105 ? -252.598 -10.932 104.169 1.00 0.00 ? 105 LEU A HD21 1  
ATOM 1710  H HD22 . LEU A 1 105 ? -251.617 -9.994  105.297 1.00 0.00 ? 105 LEU A HD22 1  
ATOM 1711  H HD23 . LEU A 1 105 ? -250.882 -11.293 104.355 1.00 0.00 ? 105 LEU A HD23 1  
ATOM 1712  N N    . LYS A 1 106 ? -254.849 -13.982 107.836 1.00 0.00 ? 106 LYS A N    1  
ATOM 1713  C CA   . LYS A 1 106 ? -256.246 -13.771 108.170 1.00 0.00 ? 106 LYS A CA   1  
ATOM 1714  C C    . LYS A 1 106 ? -256.469 -12.291 108.448 1.00 0.00 ? 106 LYS A C    1  
ATOM 1715  O O    . LYS A 1 106 ? -255.564 -11.472 108.290 1.00 0.00 ? 106 LYS A O    1  
ATOM 1716  C CB   . LYS A 1 106 ? -256.663 -14.562 109.421 1.00 0.00 ? 106 LYS A CB   1  
ATOM 1717  C CG   . LYS A 1 106 ? -256.398 -16.059 109.380 1.00 0.00 ? 106 LYS A CG   1  
ATOM 1718  C CD   . LYS A 1 106 ? -257.421 -16.838 108.560 1.00 0.00 ? 106 LYS A CD   1  
ATOM 1719  C CE   . LYS A 1 106 ? -257.212 -18.339 108.748 1.00 0.00 ? 106 LYS A CE   1  
ATOM 1720  N NZ   . LYS A 1 106 ? -257.978 -19.171 107.781 1.00 0.00 ? 106 LYS A NZ   1  
ATOM 1721  H H    . LYS A 1 106 ? -254.180 -14.012 108.549 1.00 0.00 ? 106 LYS A H    1  
ATOM 1722  H HA   . LYS A 1 106 ? -256.846 -14.084 107.325 1.00 0.00 ? 106 LYS A HA   1  
ATOM 1723  H HB2  . LYS A 1 106 ? -256.134 -14.159 110.271 1.00 0.00 ? 106 LYS A HB2  1  
ATOM 1724  H HB3  . LYS A 1 106 ? -257.722 -14.417 109.576 1.00 0.00 ? 106 LYS A HB3  1  
ATOM 1725  H HG2  . LYS A 1 106 ? -255.420 -16.228 108.952 1.00 0.00 ? 106 LYS A HG2  1  
ATOM 1726  H HG3  . LYS A 1 106 ? -256.408 -16.435 110.392 1.00 0.00 ? 106 LYS A HG3  1  
ATOM 1727  H HD2  . LYS A 1 106 ? -258.415 -16.574 108.891 1.00 0.00 ? 106 LYS A HD2  1  
ATOM 1728  H HD3  . LYS A 1 106 ? -257.303 -16.591 107.516 1.00 0.00 ? 106 LYS A HD3  1  
ATOM 1729  H HE2  . LYS A 1 106 ? -256.162 -18.554 108.629 1.00 0.00 ? 106 LYS A HE2  1  
ATOM 1730  H HE3  . LYS A 1 106 ? -257.516 -18.602 109.749 1.00 0.00 ? 106 LYS A HE3  1  
ATOM 1731  H HZ1  . LYS A 1 106 ? -257.808 -18.841 106.811 1.00 0.00 ? 106 LYS A HZ1  1  
ATOM 1732  H HZ2  . LYS A 1 106 ? -257.665 -20.169 107.854 1.00 0.00 ? 106 LYS A HZ2  1  
ATOM 1733  H HZ3  . LYS A 1 106 ? -258.994 -19.122 107.988 1.00 0.00 ? 106 LYS A HZ3  1  
ATOM 1734  N N    . THR A 1 107 ? -257.667 -11.968 108.882 1.00 0.00 ? 107 THR A N    1  
ATOM 1735  C CA   . THR A 1 107 ? -257.996 -10.661 109.348 1.00 0.00 ? 107 THR A CA   1  
ATOM 1736  C C    . THR A 1 107 ? -258.384 -10.826 110.806 1.00 0.00 ? 107 THR A C    1  
ATOM 1737  O O    . THR A 1 107 ? -258.729 -11.928 111.234 1.00 0.00 ? 107 THR A O    1  
ATOM 1738  C CB   . THR A 1 107 ? -259.183 -10.059 108.566 1.00 0.00 ? 107 THR A CB   1  
ATOM 1739  O OG1  . THR A 1 107 ? -260.319 -10.930 108.656 1.00 0.00 ? 107 THR A OG1  1  
ATOM 1740  C CG2  . THR A 1 107 ? -258.829 -9.843  107.103 1.00 0.00 ? 107 THR A CG2  1  
ATOM 1741  H H    . THR A 1 107 ? -258.347 -12.649 108.953 1.00 0.00 ? 107 THR A H    1  
ATOM 1742  H HA   . THR A 1 107 ? -257.124 -10.013 109.249 1.00 0.00 ? 107 THR A HA   1  
ATOM 1743  H HB   . THR A 1 107 ? -259.438 -9.103  109.005 1.00 0.00 ? 107 THR A HB   1  
ATOM 1744  H HG1  . THR A 1 107 ? -260.733 -11.009 107.792 1.00 0.00 ? 107 THR A HG1  1  
ATOM 1745  H HG21 . THR A 1 107 ? -257.980 -9.180  107.033 1.00 0.00 ? 107 THR A HG21 1  
ATOM 1746  H HG22 . THR A 1 107 ? -258.583 -10.791 106.648 1.00 0.00 ? 107 THR A HG22 1  
ATOM 1747  H HG23 . THR A 1 107 ? -259.671 -9.405  106.589 1.00 0.00 ? 107 THR A HG23 1  
ATOM 1748  N N    . GLN A 1 108 ? -258.339 -9.761  111.551 1.00 0.00 ? 108 GLN A N    1  
ATOM 1749  C CA   . GLN A 1 108 ? -258.686 -9.787  112.973 1.00 0.00 ? 108 GLN A CA   1  
ATOM 1750  C C    . GLN A 1 108 ? -260.201 -9.800  113.175 1.00 0.00 ? 108 GLN A C    1  
ATOM 1751  O O    . GLN A 1 108 ? -260.717 -9.279  114.164 1.00 0.00 ? 108 GLN A O    1  
ATOM 1752  C CB   . GLN A 1 108 ? -258.051 -8.596  113.695 1.00 0.00 ? 108 GLN A CB   1  
ATOM 1753  C CG   . GLN A 1 108 ? -256.616 -8.849  114.127 1.00 0.00 ? 108 GLN A CG   1  
ATOM 1754  C CD   . GLN A 1 108 ? -255.964 -7.639  114.769 1.00 0.00 ? 108 GLN A CD   1  
ATOM 1755  O OE1  . GLN A 1 108 ? -254.753 -7.439  114.650 1.00 0.00 ? 108 GLN A OE1  1  
ATOM 1756  N NE2  . GLN A 1 108 ? -256.753 -6.828  115.459 1.00 0.00 ? 108 GLN A NE2  1  
ATOM 1757  H H    . GLN A 1 108 ? -258.059 -8.936  111.141 1.00 0.00 ? 108 GLN A H    1  
ATOM 1758  H HA   . GLN A 1 108 ? -258.279 -10.698 113.387 1.00 0.00 ? 108 GLN A HA   1  
ATOM 1759  H HB2  . GLN A 1 108 ? -258.056 -7.745  113.029 1.00 0.00 ? 108 GLN A HB2  1  
ATOM 1760  H HB3  . GLN A 1 108 ? -258.631 -8.359  114.567 1.00 0.00 ? 108 GLN A HB3  1  
ATOM 1761  H HG2  . GLN A 1 108 ? -256.606 -9.658  114.842 1.00 0.00 ? 108 GLN A HG2  1  
ATOM 1762  H HG3  . GLN A 1 108 ? -256.039 -9.133  113.259 1.00 0.00 ? 108 GLN A HG3  1  
ATOM 1763  H HE21 . GLN A 1 108 ? -257.710 -7.050  115.525 1.00 0.00 ? 108 GLN A HE21 1  
ATOM 1764  H HE22 . GLN A 1 108 ? -256.355 -6.031  115.868 1.00 0.00 ? 108 GLN A HE22 1  
ATOM 1765  N N    . GLN A 1 109 ? -260.898 -10.428 112.243 1.00 0.00 ? 109 GLN A N    1  
ATOM 1766  C CA   . GLN A 1 109 ? -262.327 -10.590 112.314 1.00 0.00 ? 109 GLN A CA   1  
ATOM 1767  C C    . GLN A 1 109 ? -262.656 -12.047 112.590 1.00 0.00 ? 109 GLN A C    1  
ATOM 1768  O O    . GLN A 1 109 ? -261.943 -12.951 112.156 1.00 0.00 ? 109 GLN A O    1  
ATOM 1769  C CB   . GLN A 1 109 ? -262.961 -10.111 111.013 1.00 0.00 ? 109 GLN A CB   1  
ATOM 1770  C CG   . GLN A 1 109 ? -264.293 -10.746 110.709 1.00 0.00 ? 109 GLN A CG   1  
ATOM 1771  C CD   . GLN A 1 109 ? -265.435 -10.118 111.487 1.00 0.00 ? 109 GLN A CD   1  
ATOM 1772  O OE1  . GLN A 1 109 ? -265.406 -8.933  111.806 1.00 0.00 ? 109 GLN A OE1  1  
ATOM 1773  N NE2  . GLN A 1 109 ? -266.438 -10.913 111.813 1.00 0.00 ? 109 GLN A NE2  1  
ATOM 1774  H H    . GLN A 1 109 ? -260.425 -10.826 111.481 1.00 0.00 ? 109 GLN A H    1  
ATOM 1775  H HA   . GLN A 1 109 ? -262.696 -9.989  113.128 1.00 0.00 ? 109 GLN A HA   1  
ATOM 1776  H HB2  . GLN A 1 109 ? -263.119 -9.053  111.094 1.00 0.00 ? 109 GLN A HB2  1  
ATOM 1777  H HB3  . GLN A 1 109 ? -262.288 -10.310 110.192 1.00 0.00 ? 109 GLN A HB3  1  
ATOM 1778  H HG2  . GLN A 1 109 ? -264.490 -10.654 109.655 1.00 0.00 ? 109 GLN A HG2  1  
ATOM 1779  H HG3  . GLN A 1 109 ? -264.222 -11.788 110.977 1.00 0.00 ? 109 GLN A HG3  1  
ATOM 1780  H HE21 . GLN A 1 109 ? -266.389 -11.859 111.544 1.00 0.00 ? 109 GLN A HE21 1  
ATOM 1781  H HE22 . GLN A 1 109 ? -267.189 -10.528 112.309 1.00 0.00 ? 109 GLN A HE22 1  
ATOM 1782  N N    . GLU A 1 110 ? -263.735 -12.263 113.311 1.00 0.00 ? 110 GLU A N    1  
ATOM 1783  C CA   . GLU A 1 110 ? -264.100 -13.598 113.754 1.00 0.00 ? 110 GLU A CA   1  
ATOM 1784  C C    . GLU A 1 110 ? -265.553 -13.912 113.416 1.00 0.00 ? 110 GLU A C    1  
ATOM 1785  O O    . GLU A 1 110 ? -266.039 -13.573 112.334 1.00 0.00 ? 110 GLU A O    1  
ATOM 1786  C CB   . GLU A 1 110 ? -263.872 -13.717 115.257 1.00 0.00 ? 110 GLU A CB   1  
ATOM 1787  C CG   . GLU A 1 110 ? -264.105 -15.114 115.788 1.00 0.00 ? 110 GLU A CG   1  
ATOM 1788  C CD   . GLU A 1 110 ? -263.948 -15.193 117.292 1.00 0.00 ? 110 GLU A CD   1  
ATOM 1789  O OE1  . GLU A 1 110 ? -264.953 -14.980 118.002 1.00 0.00 ? 110 GLU A OE1  1  
ATOM 1790  O OE2  . GLU A 1 110 ? -262.819 -15.456 117.759 1.00 0.00 ? 110 GLU A OE2  1  
ATOM 1791  H H    . GLU A 1 110 ? -264.310 -11.505 113.537 1.00 0.00 ? 110 GLU A H    1  
ATOM 1792  H HA   . GLU A 1 110 ? -263.463 -14.305 113.246 1.00 0.00 ? 110 GLU A HA   1  
ATOM 1793  H HB2  . GLU A 1 110 ? -262.854 -13.434 115.481 1.00 0.00 ? 110 GLU A HB2  1  
ATOM 1794  H HB3  . GLU A 1 110 ? -264.546 -13.044 115.768 1.00 0.00 ? 110 GLU A HB3  1  
ATOM 1795  H HG2  . GLU A 1 110 ? -265.107 -15.418 115.525 1.00 0.00 ? 110 GLU A HG2  1  
ATOM 1796  H HG3  . GLU A 1 110 ? -263.393 -15.780 115.328 1.00 0.00 ? 110 GLU A HG3  1  
ATOM 1797  N N    . GLY A 1 1   ? -229.529 -11.556 101.541 1.00 0.00 ? 1   GLY A N    2  
ATOM 1798  C CA   . GLY A 1 1   ? -228.347 -11.304 100.691 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1799  C C    . GLY A 1 1   ? -227.084 -11.350 101.508 1.00 0.00 ? 1   GLY A C    2  
ATOM 1800  O O    . GLY A 1 1   ? -226.973 -10.630 102.499 1.00 0.00 ? 1   GLY A O    2  
ATOM 1801  H H1   . GLY A 1 1   ? -229.574 -10.853 102.309 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1802  H H2   . GLY A 1 1   ? -230.404 -11.503 100.982 1.00 0.00 ? 1   GLY A H2   2  
ATOM 1803  H H3   . GLY A 1 1   ? -229.462 -12.507 101.973 1.00 0.00 ? 1   GLY A H3   2  
ATOM 1804  H HA2  . GLY A 1 1   ? -228.296 -12.056 99.919  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1805  H HA3  . GLY A 1 1   ? -228.441 -10.329 100.233 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1806  N N    . GLU A 1 2   ? -226.141 -12.190 101.094 1.00 0.00 ? 2   GLU A N    2  
ATOM 1807  C CA   . GLU A 1 2   ? -224.924 -12.425 101.860 1.00 0.00 ? 2   GLU A CA   2  
ATOM 1808  C C    . GLU A 1 2   ? -225.271 -12.915 103.261 1.00 0.00 ? 2   GLU A C    2  
ATOM 1809  O O    . GLU A 1 2   ? -224.990 -12.252 104.260 1.00 0.00 ? 2   GLU A O    2  
ATOM 1810  C CB   . GLU A 1 2   ? -224.057 -11.163 101.912 1.00 0.00 ? 2   GLU A CB   2  
ATOM 1811  C CG   . GLU A 1 2   ? -223.618 -10.690 100.535 1.00 0.00 ? 2   GLU A CG   2  
ATOM 1812  C CD   . GLU A 1 2   ? -222.917 -11.780 99.752  1.00 0.00 ? 2   GLU A CD   2  
ATOM 1813  O OE1  . GLU A 1 2   ? -223.613 -12.618 99.144  1.00 0.00 ? 2   GLU A OE1  2  
ATOM 1814  O OE2  . GLU A 1 2   ? -221.668 -11.818 99.774  1.00 0.00 ? 2   GLU A OE2  2  
ATOM 1815  H H    . GLU A 1 2   ? -226.257 -12.657 100.241 1.00 0.00 ? 2   GLU A H    2  
ATOM 1816  H HA   . GLU A 1 2   ? -224.371 -13.206 101.355 1.00 0.00 ? 2   GLU A HA   2  
ATOM 1817  H HB2  . GLU A 1 2   ? -224.620 -10.371 102.382 1.00 0.00 ? 2   GLU A HB2  2  
ATOM 1818  H HB3  . GLU A 1 2   ? -223.174 -11.368 102.498 1.00 0.00 ? 2   GLU A HB3  2  
ATOM 1819  H HG2  . GLU A 1 2   ? -224.488 -10.371 99.981  1.00 0.00 ? 2   GLU A HG2  2  
ATOM 1820  H HG3  . GLU A 1 2   ? -222.941 -9.857  100.653 1.00 0.00 ? 2   GLU A HG3  2  
ATOM 1821  N N    . GLU A 1 3   ? -225.905 -14.084 103.306 1.00 0.00 ? 3   GLU A N    2  
ATOM 1822  C CA   . GLU A 1 3   ? -226.359 -14.690 104.552 1.00 0.00 ? 3   GLU A CA   2  
ATOM 1823  C C    . GLU A 1 3   ? -225.168 -15.105 105.415 1.00 0.00 ? 3   GLU A C    2  
ATOM 1824  O O    . GLU A 1 3   ? -224.765 -16.269 105.409 1.00 0.00 ? 3   GLU A O    2  
ATOM 1825  C CB   . GLU A 1 3   ? -227.211 -15.929 104.249 1.00 0.00 ? 3   GLU A CB   2  
ATOM 1826  C CG   . GLU A 1 3   ? -228.249 -15.730 103.153 1.00 0.00 ? 3   GLU A CG   2  
ATOM 1827  C CD   . GLU A 1 3   ? -229.369 -14.797 103.557 1.00 0.00 ? 3   GLU A CD   2  
ATOM 1828  O OE1  . GLU A 1 3   ? -230.048 -15.090 104.558 1.00 0.00 ? 3   GLU A OE1  2  
ATOM 1829  O OE2  . GLU A 1 3   ? -229.582 -13.775 102.867 1.00 0.00 ? 3   GLU A OE2  2  
ATOM 1830  H H    . GLU A 1 3   ? -226.076 -14.556 102.468 1.00 0.00 ? 3   GLU A H    2  
ATOM 1831  H HA   . GLU A 1 3   ? -226.955 -13.967 105.088 1.00 0.00 ? 3   GLU A HA   2  
ATOM 1832  H HB2  . GLU A 1 3   ? -226.556 -16.732 103.946 1.00 0.00 ? 3   GLU A HB2  2  
ATOM 1833  H HB3  . GLU A 1 3   ? -227.727 -16.222 105.152 1.00 0.00 ? 3   GLU A HB3  2  
ATOM 1834  H HG2  . GLU A 1 3   ? -227.759 -15.318 102.284 1.00 0.00 ? 3   GLU A HG2  2  
ATOM 1835  H HG3  . GLU A 1 3   ? -228.676 -16.691 102.901 1.00 0.00 ? 3   GLU A HG3  2  
ATOM 1836  N N    . ARG A 1 4   ? -224.577 -14.151 106.121 1.00 0.00 ? 4   ARG A N    2  
ATOM 1837  C CA   . ARG A 1 4   ? -223.405 -14.439 106.937 1.00 0.00 ? 4   ARG A CA   2  
ATOM 1838  C C    . ARG A 1 4   ? -223.464 -13.745 108.295 1.00 0.00 ? 4   ARG A C    2  
ATOM 1839  O O    . ARG A 1 4   ? -222.704 -14.096 109.202 1.00 0.00 ? 4   ARG A O    2  
ATOM 1840  C CB   . ARG A 1 4   ? -222.122 -14.042 106.196 1.00 0.00 ? 4   ARG A CB   2  
ATOM 1841  C CG   . ARG A 1 4   ? -221.852 -14.886 104.959 1.00 0.00 ? 4   ARG A CG   2  
ATOM 1842  C CD   . ARG A 1 4   ? -220.520 -14.546 104.310 1.00 0.00 ? 4   ARG A CD   2  
ATOM 1843  N NE   . ARG A 1 4   ? -220.461 -13.164 103.838 1.00 0.00 ? 4   ARG A NE   2  
ATOM 1844  C CZ   . ARG A 1 4   ? -220.712 -12.791 102.580 1.00 0.00 ? 4   ARG A CZ   2  
ATOM 1845  N NH1  . ARG A 1 4   ? -221.100 -13.680 101.674 1.00 0.00 ? 4   ARG A NH1  2  
ATOM 1846  N NH2  . ARG A 1 4   ? -220.579 -11.525 102.219 1.00 0.00 ? 4   ARG A NH2  2  
ATOM 1847  H H    . ARG A 1 4   ? -224.925 -13.235 106.073 1.00 0.00 ? 4   ARG A H    2  
ATOM 1848  H HA   . ARG A 1 4   ? -223.384 -15.505 107.104 1.00 0.00 ? 4   ARG A HA   2  
ATOM 1849  H HB2  . ARG A 1 4   ? -222.202 -13.009 105.891 1.00 0.00 ? 4   ARG A HB2  2  
ATOM 1850  H HB3  . ARG A 1 4   ? -221.283 -14.147 106.867 1.00 0.00 ? 4   ARG A HB3  2  
ATOM 1851  H HG2  . ARG A 1 4   ? -221.843 -15.927 105.242 1.00 0.00 ? 4   ARG A HG2  2  
ATOM 1852  H HG3  . ARG A 1 4   ? -222.643 -14.715 104.243 1.00 0.00 ? 4   ARG A HG3  2  
ATOM 1853  H HD2  . ARG A 1 4   ? -219.734 -14.700 105.035 1.00 0.00 ? 4   ARG A HD2  2  
ATOM 1854  H HD3  . ARG A 1 4   ? -220.366 -15.209 103.471 1.00 0.00 ? 4   ARG A HD3  2  
ATOM 1855  H HE   . ARG A 1 4   ? -220.201 -12.478 104.492 1.00 0.00 ? 4   ARG A HE   2  
ATOM 1856  H HH11 . ARG A 1 4   ? -221.206 -14.642 101.918 1.00 0.00 ? 4   ARG A HH11 2  
ATOM 1857  H HH12 . ARG A 1 4   ? -221.302 -13.376 100.727 1.00 0.00 ? 4   ARG A HH12 2  
ATOM 1858  H HH21 . ARG A 1 4   ? -220.284 -10.828 102.884 1.00 0.00 ? 4   ARG A HH21 2  
ATOM 1859  H HH22 . ARG A 1 4   ? -220.783 -11.253 101.264 1.00 0.00 ? 4   ARG A HH22 2  
ATOM 1860  N N    . LYS A 1 5   ? -224.363 -12.771 108.445 1.00 0.00 ? 5   LYS A N    2  
ATOM 1861  C CA   . LYS A 1 5   ? -224.500 -12.051 109.710 1.00 0.00 ? 5   LYS A CA   2  
ATOM 1862  C C    . LYS A 1 5   ? -225.671 -11.083 109.656 1.00 0.00 ? 5   LYS A C    2  
ATOM 1863  O O    . LYS A 1 5   ? -226.503 -11.050 110.562 1.00 0.00 ? 5   LYS A O    2  
ATOM 1864  C CB   . LYS A 1 5   ? -223.211 -11.292 110.051 1.00 0.00 ? 5   LYS A CB   2  
ATOM 1865  C CG   . LYS A 1 5   ? -223.188 -10.727 111.463 1.00 0.00 ? 5   LYS A CG   2  
ATOM 1866  C CD   . LYS A 1 5   ? -221.774 -10.359 111.894 1.00 0.00 ? 5   LYS A CD   2  
ATOM 1867  C CE   . LYS A 1 5   ? -221.245 -9.137  111.157 1.00 0.00 ? 5   LYS A CE   2  
ATOM 1868  N NZ   . LYS A 1 5   ? -221.867 -7.877  111.645 1.00 0.00 ? 5   LYS A NZ   2  
ATOM 1869  H H    . LYS A 1 5   ? -224.959 -12.547 107.698 1.00 0.00 ? 5   LYS A H    2  
ATOM 1870  H HA   . LYS A 1 5   ? -224.691 -12.780 110.482 1.00 0.00 ? 5   LYS A HA   2  
ATOM 1871  H HB2  . LYS A 1 5   ? -222.373 -11.965 109.943 1.00 0.00 ? 5   LYS A HB2  2  
ATOM 1872  H HB3  . LYS A 1 5   ? -223.095 -10.474 109.357 1.00 0.00 ? 5   LYS A HB3  2  
ATOM 1873  H HG2  . LYS A 1 5   ? -223.805 -9.841  111.497 1.00 0.00 ? 5   LYS A HG2  2  
ATOM 1874  H HG3  . LYS A 1 5   ? -223.581 -11.468 112.144 1.00 0.00 ? 5   LYS A HG3  2  
ATOM 1875  H HD2  . LYS A 1 5   ? -221.777 -10.150 112.953 1.00 0.00 ? 5   LYS A HD2  2  
ATOM 1876  H HD3  . LYS A 1 5   ? -221.121 -11.197 111.695 1.00 0.00 ? 5   LYS A HD3  2  
ATOM 1877  H HE2  . LYS A 1 5   ? -220.177 -9.078  111.303 1.00 0.00 ? 5   LYS A HE2  2  
ATOM 1878  H HE3  . LYS A 1 5   ? -221.457 -9.248  110.104 1.00 0.00 ? 5   LYS A HE3  2  
ATOM 1879  H HZ1  . LYS A 1 5   ? -221.770 -7.810  112.683 1.00 0.00 ? 5   LYS A HZ1  2  
ATOM 1880  H HZ2  . LYS A 1 5   ? -221.395 -7.053  111.213 1.00 0.00 ? 5   LYS A HZ2  2  
ATOM 1881  H HZ3  . LYS A 1 5   ? -222.883 -7.850  111.401 1.00 0.00 ? 5   LYS A HZ3  2  
ATOM 1882  N N    . CYS A 1 6   ? -225.744 -10.307 108.589 1.00 0.00 ? 6   CYS A N    2  
ATOM 1883  C CA   . CYS A 1 6   ? -226.811 -9.336  108.434 1.00 0.00 ? 6   CYS A CA   2  
ATOM 1884  C C    . CYS A 1 6   ? -227.410 -9.440  107.039 1.00 0.00 ? 6   CYS A C    2  
ATOM 1885  O O    . CYS A 1 6   ? -226.830 -10.074 106.159 1.00 0.00 ? 6   CYS A O    2  
ATOM 1886  C CB   . CYS A 1 6   ? -226.282 -7.923  108.684 1.00 0.00 ? 6   CYS A CB   2  
ATOM 1887  S SG   . CYS A 1 6   ? -227.565 -6.648  108.771 1.00 0.00 ? 6   CYS A SG   2  
ATOM 1888  H H    . CYS A 1 6   ? -225.075 -10.397 107.879 1.00 0.00 ? 6   CYS A H    2  
ATOM 1889  H HA   . CYS A 1 6   ? -227.576 -9.563  109.161 1.00 0.00 ? 6   CYS A HA   2  
ATOM 1890  H HB2  . CYS A 1 6   ? -225.745 -7.908  109.621 1.00 0.00 ? 6   CYS A HB2  2  
ATOM 1891  H HB3  . CYS A 1 6   ? -225.606 -7.655  107.884 1.00 0.00 ? 6   CYS A HB3  2  
ATOM 1892  H HG   . CYS A 1 6   ? -227.035 -5.510  108.328 1.00 0.00 ? 6   CYS A HG   2  
ATOM 1893  N N    . LEU A 1 7   ? -228.567 -8.806  106.855 1.00 0.00 ? 7   LEU A N    2  
ATOM 1894  C CA   . LEU A 1 7   ? -229.279 -8.809  105.587 1.00 0.00 ? 7   LEU A CA   2  
ATOM 1895  C C    . LEU A 1 7   ? -229.715 -10.212 105.167 1.00 0.00 ? 7   LEU A C    2  
ATOM 1896  O O    . LEU A 1 7   ? -229.850 -10.488 103.975 1.00 0.00 ? 7   LEU A O    2  
ATOM 1897  C CB   . LEU A 1 7   ? -228.409 -8.169  104.512 1.00 0.00 ? 7   LEU A CB   2  
ATOM 1898  C CG   . LEU A 1 7   ? -228.318 -6.641  104.565 1.00 0.00 ? 7   LEU A CG   2  
ATOM 1899  C CD1  . LEU A 1 7   ? -227.400 -6.126  103.469 1.00 0.00 ? 7   LEU A CD1  2  
ATOM 1900  C CD2  . LEU A 1 7   ? -229.701 -6.018  104.437 1.00 0.00 ? 7   LEU A CD2  2  
ATOM 1901  H H    . LEU A 1 7   ? -228.931 -8.286  107.585 1.00 0.00 ? 7   LEU A H    2  
ATOM 1902  H HA   . LEU A 1 7   ? -230.163 -8.204  105.714 1.00 0.00 ? 7   LEU A HA   2  
ATOM 1903  H HB2  . LEU A 1 7   ? -227.414 -8.564  104.629 1.00 0.00 ? 7   LEU A HB2  2  
ATOM 1904  H HB3  . LEU A 1 7   ? -228.788 -8.456  103.546 1.00 0.00 ? 7   LEU A HB3  2  
ATOM 1905  H HG   . LEU A 1 7   ? -227.902 -6.345  105.518 1.00 0.00 ? 7   LEU A HG   2  
ATOM 1906  H HD11 . LEU A 1 7   ? -227.764 -6.461  102.508 1.00 0.00 ? 7   LEU A HD11 2  
ATOM 1907  H HD12 . LEU A 1 7   ? -227.386 -5.046  103.492 1.00 0.00 ? 7   LEU A HD12 2  
ATOM 1908  H HD13 . LEU A 1 7   ? -226.401 -6.504  103.628 1.00 0.00 ? 7   LEU A HD13 2  
ATOM 1909  H HD21 . LEU A 1 7   ? -230.328 -6.362  105.246 1.00 0.00 ? 7   LEU A HD21 2  
ATOM 1910  H HD22 . LEU A 1 7   ? -229.616 -4.942  104.481 1.00 0.00 ? 7   LEU A HD22 2  
ATOM 1911  H HD23 . LEU A 1 7   ? -230.139 -6.306  103.493 1.00 0.00 ? 7   LEU A HD23 2  
ATOM 1912  N N    . GLN A 1 8   ? -229.954 -11.087 106.146 1.00 0.00 ? 8   GLN A N    2  
ATOM 1913  C CA   . GLN A 1 8   ? -230.525 -12.407 105.870 1.00 0.00 ? 8   GLN A CA   2  
ATOM 1914  C C    . GLN A 1 8   ? -231.902 -12.265 105.227 1.00 0.00 ? 8   GLN A C    2  
ATOM 1915  O O    . GLN A 1 8   ? -232.892 -12.015 105.913 1.00 0.00 ? 8   GLN A O    2  
ATOM 1916  C CB   . GLN A 1 8   ? -230.662 -13.244 107.149 1.00 0.00 ? 8   GLN A CB   2  
ATOM 1917  C CG   . GLN A 1 8   ? -229.396 -13.966 107.595 1.00 0.00 ? 8   GLN A CG   2  
ATOM 1918  C CD   . GLN A 1 8   ? -228.342 -13.041 108.160 1.00 0.00 ? 8   GLN A CD   2  
ATOM 1919  O OE1  . GLN A 1 8   ? -227.458 -12.576 107.447 1.00 0.00 ? 8   GLN A OE1  2  
ATOM 1920  N NE2  . GLN A 1 8   ? -228.434 -12.765 109.453 1.00 0.00 ? 8   GLN A NE2  2  
ATOM 1921  H H    . GLN A 1 8   ? -229.727 -10.848 107.065 1.00 0.00 ? 8   GLN A H    2  
ATOM 1922  H HA   . GLN A 1 8   ? -229.867 -12.917 105.180 1.00 0.00 ? 8   GLN A HA   2  
ATOM 1923  H HB2  . GLN A 1 8   ? -230.971 -12.593 107.953 1.00 0.00 ? 8   GLN A HB2  2  
ATOM 1924  H HB3  . GLN A 1 8   ? -231.432 -13.985 106.991 1.00 0.00 ? 8   GLN A HB3  2  
ATOM 1925  H HG2  . GLN A 1 8   ? -229.660 -14.686 108.354 1.00 0.00 ? 8   GLN A HG2  2  
ATOM 1926  H HG3  . GLN A 1 8   ? -228.979 -14.485 106.744 1.00 0.00 ? 8   GLN A HG3  2  
ATOM 1927  H HE21 . GLN A 1 8   ? -229.168 -13.170 109.960 1.00 0.00 ? 8   GLN A HE21 2  
ATOM 1928  H HE22 . GLN A 1 8   ? -227.765 -12.163 109.850 1.00 0.00 ? 8   GLN A HE22 2  
ATOM 1929  N N    . THR A 1 9   ? -231.974 -12.430 103.917 1.00 0.00 ? 9   THR A N    2  
ATOM 1930  C CA   . THR A 1 9   ? -233.221 -12.213 103.203 1.00 0.00 ? 9   THR A CA   2  
ATOM 1931  C C    . THR A 1 9   ? -233.840 -13.540 102.776 1.00 0.00 ? 9   THR A C    2  
ATOM 1932  O O    . THR A 1 9   ? -233.402 -14.164 101.809 1.00 0.00 ? 9   THR A O    2  
ATOM 1933  C CB   . THR A 1 9   ? -233.022 -11.314 101.962 1.00 0.00 ? 9   THR A CB   2  
ATOM 1934  O OG1  . THR A 1 9   ? -232.095 -11.922 101.051 1.00 0.00 ? 9   THR A OG1  2  
ATOM 1935  C CG2  . THR A 1 9   ? -232.514 -9.935  102.360 1.00 0.00 ? 9   THR A CG2  2  
ATOM 1936  H H    . THR A 1 9   ? -231.175 -12.727 103.425 1.00 0.00 ? 9   THR A H    2  
ATOM 1937  H HA   . THR A 1 9   ? -233.908 -11.707 103.878 1.00 0.00 ? 9   THR A HA   2  
ATOM 1938  H HB   . THR A 1 9   ? -233.976 -11.198 101.471 1.00 0.00 ? 9   THR A HB   2  
ATOM 1939  H HG1  . THR A 1 9   ? -232.337 -12.852 100.928 1.00 0.00 ? 9   THR A HG1  2  
ATOM 1940  H HG21 . THR A 1 9   ? -231.575 -10.036 102.885 1.00 0.00 ? 9   THR A HG21 2  
ATOM 1941  H HG22 . THR A 1 9   ? -232.368 -9.336  101.473 1.00 0.00 ? 9   THR A HG22 2  
ATOM 1942  H HG23 . THR A 1 9   ? -233.238 -9.456  103.004 1.00 0.00 ? 9   THR A HG23 2  
ATOM 1943  N N    . HIS A 1 10  ? -234.842 -13.979 103.515 1.00 0.00 ? 10  HIS A N    2  
ATOM 1944  C CA   . HIS A 1 10  ? -235.523 -15.231 103.213 1.00 0.00 ? 10  HIS A CA   2  
ATOM 1945  C C    . HIS A 1 10  ? -236.980 -14.959 102.900 1.00 0.00 ? 10  HIS A C    2  
ATOM 1946  O O    . HIS A 1 10  ? -237.619 -14.157 103.560 1.00 0.00 ? 10  HIS A O    2  
ATOM 1947  C CB   . HIS A 1 10  ? -235.419 -16.213 104.384 1.00 0.00 ? 10  HIS A CB   2  
ATOM 1948  C CG   . HIS A 1 10  ? -234.011 -16.566 104.754 1.00 0.00 ? 10  HIS A CG   2  
ATOM 1949  N ND1  . HIS A 1 10  ? -233.451 -17.800 104.517 1.00 0.00 ? 10  HIS A ND1  2  
ATOM 1950  C CD2  . HIS A 1 10  ? -233.040 -15.823 105.332 1.00 0.00 ? 10  HIS A CD2  2  
ATOM 1951  C CE1  . HIS A 1 10  ? -232.198 -17.797 104.932 1.00 0.00 ? 10  HIS A CE1  2  
ATOM 1952  N NE2  . HIS A 1 10  ? -231.919 -16.606 105.430 1.00 0.00 ? 10  HIS A NE2  2  
ATOM 1953  H H    . HIS A 1 10  ? -235.142 -13.443 104.278 1.00 0.00 ? 10  HIS A H    2  
ATOM 1954  H HA   . HIS A 1 10  ? -235.054 -15.664 102.343 1.00 0.00 ? 10  HIS A HA   2  
ATOM 1955  H HB2  . HIS A 1 10  ? -235.893 -15.778 105.248 1.00 0.00 ? 10  HIS A HB2  2  
ATOM 1956  H HB3  . HIS A 1 10  ? -235.932 -17.127 104.122 1.00 0.00 ? 10  HIS A HB3  2  
ATOM 1957  H HD1  . HIS A 1 10  ? -233.905 -18.568 104.109 1.00 0.00 ? 10  HIS A HD1  2  
ATOM 1958  H HD2  . HIS A 1 10  ? -233.133 -14.797 105.657 1.00 0.00 ? 10  HIS A HD2  2  
ATOM 1959  H HE1  . HIS A 1 10  ? -231.513 -18.630 104.874 1.00 0.00 ? 10  HIS A HE1  2  
ATOM 1960  H HE2  . HIS A 1 10  ? -230.999 -16.232 105.465 1.00 0.00 ? 10  HIS A HE2  2  
ATOM 1961  N N    . ARG A 1 11  ? -237.494 -15.603 101.879 1.00 0.00 ? 11  ARG A N    2  
ATOM 1962  C CA   . ARG A 1 11  ? -238.859 -15.419 101.487 1.00 0.00 ? 11  ARG A CA   2  
ATOM 1963  C C    . ARG A 1 11  ? -239.765 -16.415 102.197 1.00 0.00 ? 11  ARG A C    2  
ATOM 1964  O O    . ARG A 1 11  ? -239.369 -17.550 102.457 1.00 0.00 ? 11  ARG A O    2  
ATOM 1965  C CB   . ARG A 1 11  ? -238.965 -15.561 99.987  1.00 0.00 ? 11  ARG A CB   2  
ATOM 1966  C CG   . ARG A 1 11  ? -239.814 -14.473 99.405  1.00 0.00 ? 11  ARG A CG   2  
ATOM 1967  C CD   . ARG A 1 11  ? -239.427 -14.162 97.977  1.00 0.00 ? 11  ARG A CD   2  
ATOM 1968  N NE   . ARG A 1 11  ? -240.367 -13.236 97.341  1.00 0.00 ? 11  ARG A NE   2  
ATOM 1969  C CZ   . ARG A 1 11  ? -240.035 -12.346 96.408  1.00 0.00 ? 11  ARG A CZ   2  
ATOM 1970  N NH1  . ARG A 1 11  ? -238.773 -12.232 96.006  1.00 0.00 ? 11  ARG A NH1  2  
ATOM 1971  N NH2  . ARG A 1 11  ? -240.973 -11.561 95.884  1.00 0.00 ? 11  ARG A NH2  2  
ATOM 1972  H H    . ARG A 1 11  ? -236.946 -16.202 101.365 1.00 0.00 ? 11  ARG A H    2  
ATOM 1973  H HA   . ARG A 1 11  ? -239.152 -14.416 101.755 1.00 0.00 ? 11  ARG A HA   2  
ATOM 1974  H HB2  . ARG A 1 11  ? -237.977 -15.504 99.552  1.00 0.00 ? 11  ARG A HB2  2  
ATOM 1975  H HB3  . ARG A 1 11  ? -239.412 -16.513 99.747  1.00 0.00 ? 11  ARG A HB3  2  
ATOM 1976  H HG2  . ARG A 1 11  ? -240.848 -14.777 99.444  1.00 0.00 ? 11  ARG A HG2  2  
ATOM 1977  H HG3  . ARG A 1 11  ? -239.683 -13.589 100.015 1.00 0.00 ? 11  ARG A HG3  2  
ATOM 1978  H HD2  . ARG A 1 11  ? -238.446 -13.716 97.987  1.00 0.00 ? 11  ARG A HD2  2  
ATOM 1979  H HD3  . ARG A 1 11  ? -239.401 -15.083 97.418  1.00 0.00 ? 11  ARG A HD3  2  
ATOM 1980  H HE   . ARG A 1 11  ? -241.313 -13.289 97.627  1.00 0.00 ? 11  ARG A HE   2  
ATOM 1981  H HH11 . ARG A 1 11  ? -238.064 -12.817 96.407  1.00 0.00 ? 11  ARG A HH11 2  
ATOM 1982  H HH12 . ARG A 1 11  ? -238.524 -11.564 95.304  1.00 0.00 ? 11  ARG A HH12 2  
ATOM 1983  H HH21 . ARG A 1 11  ? -241.928 -11.643 96.190  1.00 0.00 ? 11  ARG A HH21 2  
ATOM 1984  H HH22 . ARG A 1 11  ? -240.735 -10.884 95.185  1.00 0.00 ? 11  ARG A HH22 2  
ATOM 1985  N N    . VAL A 1 12  ? -240.975 -15.984 102.505 1.00 0.00 ? 12  VAL A N    2  
ATOM 1986  C CA   . VAL A 1 12  ? -241.932 -16.812 103.216 1.00 0.00 ? 12  VAL A CA   2  
ATOM 1987  C C    . VAL A 1 12  ? -243.254 -16.820 102.452 1.00 0.00 ? 12  VAL A C    2  
ATOM 1988  O O    . VAL A 1 12  ? -243.843 -15.767 102.192 1.00 0.00 ? 12  VAL A O    2  
ATOM 1989  C CB   . VAL A 1 12  ? -242.124 -16.314 104.670 1.00 0.00 ? 12  VAL A CB   2  
ATOM 1990  C CG1  . VAL A 1 12  ? -242.317 -14.807 104.704 1.00 0.00 ? 12  VAL A CG1  2  
ATOM 1991  C CG2  . VAL A 1 12  ? -243.288 -17.024 105.342 1.00 0.00 ? 12  VAL A CG2  2  
ATOM 1992  H H    . VAL A 1 12  ? -241.247 -15.076 102.233 1.00 0.00 ? 12  VAL A H    2  
ATOM 1993  H HA   . VAL A 1 12  ? -241.540 -17.821 103.250 1.00 0.00 ? 12  VAL A HA   2  
ATOM 1994  H HB   . VAL A 1 12  ? -241.223 -16.545 105.224 1.00 0.00 ? 12  VAL A HB   2  
ATOM 1995  H HG11 . VAL A 1 12  ? -243.188 -14.542 104.124 1.00 0.00 ? 12  VAL A HG11 2  
ATOM 1996  H HG12 . VAL A 1 12  ? -242.452 -14.485 105.726 1.00 0.00 ? 12  VAL A HG12 2  
ATOM 1997  H HG13 . VAL A 1 12  ? -241.443 -14.325 104.285 1.00 0.00 ? 12  VAL A HG13 2  
ATOM 1998  H HG21 . VAL A 1 12  ? -244.194 -16.837 104.786 1.00 0.00 ? 12  VAL A HG21 2  
ATOM 1999  H HG22 . VAL A 1 12  ? -243.093 -18.087 105.369 1.00 0.00 ? 12  VAL A HG22 2  
ATOM 2000  H HG23 . VAL A 1 12  ? -243.401 -16.654 106.351 1.00 0.00 ? 12  VAL A HG23 2  
ATOM 2001  N N    . THR A 1 13  ? -243.681 -18.005 102.035 1.00 0.00 ? 13  THR A N    2  
ATOM 2002  C CA   . THR A 1 13  ? -244.833 -18.132 101.157 1.00 0.00 ? 13  THR A CA   2  
ATOM 2003  C C    . THR A 1 13  ? -246.131 -17.910 101.937 1.00 0.00 ? 13  THR A C    2  
ATOM 2004  O O    . THR A 1 13  ? -246.432 -18.644 102.881 1.00 0.00 ? 13  THR A O    2  
ATOM 2005  C CB   . THR A 1 13  ? -244.890 -19.531 100.521 1.00 0.00 ? 13  THR A CB   2  
ATOM 2006  O OG1  . THR A 1 13  ? -243.624 -19.858 99.936  1.00 0.00 ? 13  THR A OG1  2  
ATOM 2007  C CG2  . THR A 1 13  ? -245.981 -19.594 99.460  1.00 0.00 ? 13  THR A CG2  2  
ATOM 2008  H H    . THR A 1 13  ? -243.217 -18.815 102.333 1.00 0.00 ? 13  THR A H    2  
ATOM 2009  H HA   . THR A 1 13  ? -244.729 -17.388 100.353 1.00 0.00 ? 13  THR A HA   2  
ATOM 2010  H HB   . THR A 1 13  ? -245.118 -20.249 101.292 1.00 0.00 ? 13  THR A HB   2  
ATOM 2011  H HG1  . THR A 1 13  ? -243.046 -19.091 99.974  1.00 0.00 ? 13  THR A HG1  2  
ATOM 2012  H HG21 . THR A 1 13  ? -245.791 -18.843 98.705  1.00 0.00 ? 13  THR A HG21 2  
ATOM 2013  H HG22 . THR A 1 13  ? -245.986 -20.572 99.003  1.00 0.00 ? 13  THR A HG22 2  
ATOM 2014  H HG23 . THR A 1 13  ? -246.942 -19.406 99.918  1.00 0.00 ? 13  THR A HG23 2  
ATOM 2015  N N    . VAL A 1 14  ? -246.900 -16.916 101.539 1.00 0.00 ? 14  VAL A N    2  
ATOM 2016  C CA   . VAL A 1 14  ? -248.152 -16.602 102.203 1.00 0.00 ? 14  VAL A CA   2  
ATOM 2017  C C    . VAL A 1 14  ? -249.331 -17.108 101.369 1.00 0.00 ? 14  VAL A C    2  
ATOM 2018  O O    . VAL A 1 14  ? -249.375 -16.907 100.156 1.00 0.00 ? 14  VAL A O    2  
ATOM 2019  C CB   . VAL A 1 14  ? -248.260 -15.078 102.434 1.00 0.00 ? 14  VAL A CB   2  
ATOM 2020  C CG1  . VAL A 1 14  ? -249.570 -14.693 103.101 1.00 0.00 ? 14  VAL A CG1  2  
ATOM 2021  C CG2  . VAL A 1 14  ? -247.082 -14.594 103.262 1.00 0.00 ? 14  VAL A CG2  2  
ATOM 2022  H H    . VAL A 1 14  ? -246.622 -16.372 100.768 1.00 0.00 ? 14  VAL A H    2  
ATOM 2023  H HA   . VAL A 1 14  ? -248.159 -17.096 103.162 1.00 0.00 ? 14  VAL A HA   2  
ATOM 2024  H HB   . VAL A 1 14  ? -248.216 -14.586 101.474 1.00 0.00 ? 14  VAL A HB   2  
ATOM 2025  H HG11 . VAL A 1 14  ? -250.394 -15.110 102.541 1.00 0.00 ? 14  VAL A HG11 2  
ATOM 2026  H HG12 . VAL A 1 14  ? -249.589 -15.072 104.112 1.00 0.00 ? 14  VAL A HG12 2  
ATOM 2027  H HG13 . VAL A 1 14  ? -249.656 -13.614 103.113 1.00 0.00 ? 14  VAL A HG13 2  
ATOM 2028  H HG21 . VAL A 1 14  ? -247.065 -15.122 104.204 1.00 0.00 ? 14  VAL A HG21 2  
ATOM 2029  H HG22 . VAL A 1 14  ? -246.164 -14.783 102.727 1.00 0.00 ? 14  VAL A HG22 2  
ATOM 2030  H HG23 . VAL A 1 14  ? -247.180 -13.534 103.444 1.00 0.00 ? 14  VAL A HG23 2  
ATOM 2031  N N    . HIS A 1 15  ? -250.266 -17.800 102.011 1.00 0.00 ? 15  HIS A N    2  
ATOM 2032  C CA   . HIS A 1 15  ? -251.411 -18.379 101.307 1.00 0.00 ? 15  HIS A CA   2  
ATOM 2033  C C    . HIS A 1 15  ? -252.709 -17.645 101.616 1.00 0.00 ? 15  HIS A C    2  
ATOM 2034  O O    . HIS A 1 15  ? -253.781 -18.090 101.216 1.00 0.00 ? 15  HIS A O    2  
ATOM 2035  C CB   . HIS A 1 15  ? -251.566 -19.856 101.663 1.00 0.00 ? 15  HIS A CB   2  
ATOM 2036  C CG   . HIS A 1 15  ? -250.850 -20.781 100.730 1.00 0.00 ? 15  HIS A CG   2  
ATOM 2037  N ND1  . HIS A 1 15  ? -251.488 -21.473 99.722  1.00 0.00 ? 15  HIS A ND1  2  
ATOM 2038  C CD2  . HIS A 1 15  ? -249.544 -21.137 100.660 1.00 0.00 ? 15  HIS A CD2  2  
ATOM 2039  C CE1  . HIS A 1 15  ? -250.609 -22.214 99.074  1.00 0.00 ? 15  HIS A CE1  2  
ATOM 2040  N NE2  . HIS A 1 15  ? -249.421 -22.029 99.622  1.00 0.00 ? 15  HIS A NE2  2  
ATOM 2041  H H    . HIS A 1 15  ? -250.185 -17.935 102.983 1.00 0.00 ? 15  HIS A H    2  
ATOM 2042  H HA   . HIS A 1 15  ? -251.215 -18.298 100.247 1.00 0.00 ? 15  HIS A HA   2  
ATOM 2043  H HB2  . HIS A 1 15  ? -251.174 -20.021 102.655 1.00 0.00 ? 15  HIS A HB2  2  
ATOM 2044  H HB3  . HIS A 1 15  ? -252.615 -20.114 101.651 1.00 0.00 ? 15  HIS A HB3  2  
ATOM 2045  H HD1  . HIS A 1 15  ? -252.446 -21.420 99.509  1.00 0.00 ? 15  HIS A HD1  2  
ATOM 2046  H HD2  . HIS A 1 15  ? -248.749 -20.787 101.305 1.00 0.00 ? 15  HIS A HD2  2  
ATOM 2047  H HE1  . HIS A 1 15  ? -250.825 -22.861 98.238  1.00 0.00 ? 15  HIS A HE1  2  
ATOM 2048  H HE2  . HIS A 1 15  ? -248.570 -22.322 99.226  1.00 0.00 ? 15  HIS A HE2  2  
ATOM 2049  N N    . GLY A 1 16  ? -252.616 -16.541 102.339 1.00 0.00 ? 16  GLY A N    2  
ATOM 2050  C CA   . GLY A 1 16  ? -253.805 -15.740 102.608 1.00 0.00 ? 16  GLY A CA   2  
ATOM 2051  C C    . GLY A 1 16  ? -253.612 -14.288 102.226 1.00 0.00 ? 16  GLY A C    2  
ATOM 2052  O O    . GLY A 1 16  ? -254.199 -13.394 102.824 1.00 0.00 ? 16  GLY A O    2  
ATOM 2053  H H    . GLY A 1 16  ? -251.742 -16.273 102.703 1.00 0.00 ? 16  GLY A H    2  
ATOM 2054  H HA2  . GLY A 1 16  ? -254.634 -16.143 102.045 1.00 0.00 ? 16  GLY A HA2  2  
ATOM 2055  H HA3  . GLY A 1 16  ? -254.035 -15.797 103.662 1.00 0.00 ? 16  GLY A HA3  2  
ATOM 2056  N N    . VAL A 1 17  ? -252.789 -14.066 101.219 1.00 0.00 ? 17  VAL A N    2  
ATOM 2057  C CA   . VAL A 1 17  ? -252.359 -12.730 100.842 1.00 0.00 ? 17  VAL A CA   2  
ATOM 2058  C C    . VAL A 1 17  ? -253.523 -11.848 100.374 1.00 0.00 ? 17  VAL A C    2  
ATOM 2059  O O    . VAL A 1 17  ? -254.578 -12.345 99.987  1.00 0.00 ? 17  VAL A O    2  
ATOM 2060  C CB   . VAL A 1 17  ? -251.291 -12.798 99.729  1.00 0.00 ? 17  VAL A CB   2  
ATOM 2061  C CG1  . VAL A 1 17  ? -250.256 -13.856 100.037 1.00 0.00 ? 17  VAL A CG1  2  
ATOM 2062  C CG2  . VAL A 1 17  ? -251.918 -13.049 98.365  1.00 0.00 ? 17  VAL A CG2  2  
ATOM 2063  H H    . VAL A 1 17  ? -252.471 -14.822 100.699 1.00 0.00 ? 17  VAL A H    2  
ATOM 2064  H HA   . VAL A 1 17  ? -251.905 -12.274 101.709 1.00 0.00 ? 17  VAL A HA   2  
ATOM 2065  H HB   . VAL A 1 17  ? -250.785 -11.853 99.704  1.00 0.00 ? 17  VAL A HB   2  
ATOM 2066  H HG11 . VAL A 1 17  ? -250.741 -14.815 100.143 1.00 0.00 ? 17  VAL A HG11 2  
ATOM 2067  H HG12 . VAL A 1 17  ? -249.539 -13.903 99.232  1.00 0.00 ? 17  VAL A HG12 2  
ATOM 2068  H HG13 . VAL A 1 17  ? -249.748 -13.606 100.956 1.00 0.00 ? 17  VAL A HG13 2  
ATOM 2069  H HG21 . VAL A 1 17  ? -252.462 -13.982 98.385  1.00 0.00 ? 17  VAL A HG21 2  
ATOM 2070  H HG22 . VAL A 1 17  ? -252.595 -12.242 98.127  1.00 0.00 ? 17  VAL A HG22 2  
ATOM 2071  H HG23 . VAL A 1 17  ? -251.142 -13.101 97.616  1.00 0.00 ? 17  VAL A HG23 2  
ATOM 2072  N N    . PRO A 1 18  ? -253.328 -10.517 100.415 1.00 0.00 ? 18  PRO A N    2  
ATOM 2073  C CA   . PRO A 1 18  ? -254.316 -9.543  99.931  1.00 0.00 ? 18  PRO A CA   2  
ATOM 2074  C C    . PRO A 1 18  ? -254.213 -9.359  98.433  1.00 0.00 ? 18  PRO A C    2  
ATOM 2075  O O    . PRO A 1 18  ? -255.087 -8.794  97.774  1.00 0.00 ? 18  PRO A O    2  
ATOM 2076  C CB   . PRO A 1 18  ? -253.888 -8.272  100.650 1.00 0.00 ? 18  PRO A CB   2  
ATOM 2077  C CG   . PRO A 1 18  ? -252.404 -8.394  100.667 1.00 0.00 ? 18  PRO A CG   2  
ATOM 2078  C CD   . PRO A 1 18  ? -252.128 -9.844  100.950 1.00 0.00 ? 18  PRO A CD   2  
ATOM 2079  H HA   . PRO A 1 18  ? -255.306 -9.816  100.195 1.00 0.00 ? 18  PRO A HA   2  
ATOM 2080  H HB2  . PRO A 1 18  ? -254.217 -7.405  100.095 1.00 0.00 ? 18  PRO A HB2  2  
ATOM 2081  H HB3  . PRO A 1 18  ? -254.296 -8.257  101.648 1.00 0.00 ? 18  PRO A HB3  2  
ATOM 2082  H HG2  . PRO A 1 18  ? -252.002 -8.117  99.703  1.00 0.00 ? 18  PRO A HG2  2  
ATOM 2083  H HG3  . PRO A 1 18  ? -251.990 -7.780  101.433 1.00 0.00 ? 18  PRO A HG3  2  
ATOM 2084  H HD2  . PRO A 1 18  ? -251.238 -10.169 100.430 1.00 0.00 ? 18  PRO A HD2  2  
ATOM 2085  H HD3  . PRO A 1 18  ? -252.031 -10.014 102.013 1.00 0.00 ? 18  PRO A HD3  2  
ATOM 2086  N N    . GLY A 1 19  ? -253.089 -9.809  97.953  1.00 0.00 ? 19  GLY A N    2  
ATOM 2087  C CA   . GLY A 1 19  ? -252.787 -9.826  96.533  1.00 0.00 ? 19  GLY A CA   2  
ATOM 2088  C C    . GLY A 1 19  ? -253.759 -10.667 95.731  1.00 0.00 ? 19  GLY A C    2  
ATOM 2089  O O    . GLY A 1 19  ? -254.516 -11.458 96.290  1.00 0.00 ? 19  GLY A O    2  
ATOM 2090  H H    . GLY A 1 19  ? -252.437 -10.133 98.602  1.00 0.00 ? 19  GLY A H    2  
ATOM 2091  H HA2  . GLY A 1 19  ? -252.810 -8.820  96.152  1.00 0.00 ? 19  GLY A HA2  2  
ATOM 2092  H HA3  . GLY A 1 19  ? -251.793 -10.223 96.396  1.00 0.00 ? 19  GLY A HA3  2  
ATOM 2093  N N    . PRO A 1 20  ? -253.751 -10.508 94.403  1.00 0.00 ? 20  PRO A N    2  
ATOM 2094  C CA   . PRO A 1 20  ? -254.605 -11.276 93.498  1.00 0.00 ? 20  PRO A CA   2  
ATOM 2095  C C    . PRO A 1 20  ? -254.192 -12.736 93.452  1.00 0.00 ? 20  PRO A C    2  
ATOM 2096  O O    . PRO A 1 20  ? -255.001 -13.622 93.165  1.00 0.00 ? 20  PRO A O    2  
ATOM 2097  C CB   . PRO A 1 20  ? -254.338 -10.621 92.143  1.00 0.00 ? 20  PRO A CB   2  
ATOM 2098  C CG   . PRO A 1 20  ? -252.951 -10.119 92.277  1.00 0.00 ? 20  PRO A CG   2  
ATOM 2099  C CD   . PRO A 1 20  ? -252.881 -9.584  93.668  1.00 0.00 ? 20  PRO A CD   2  
ATOM 2100  H HA   . PRO A 1 20  ? -255.644 -11.188 93.756  1.00 0.00 ? 20  PRO A HA   2  
ATOM 2101  H HB2  . PRO A 1 20  ? -254.420 -11.355 91.361  1.00 0.00 ? 20  PRO A HB2  2  
ATOM 2102  H HB3  . PRO A 1 20  ? -255.038 -9.816  91.977  1.00 0.00 ? 20  PRO A HB3  2  
ATOM 2103  H HG2  . PRO A 1 20  ? -252.252 -10.933 92.149  1.00 0.00 ? 20  PRO A HG2  2  
ATOM 2104  H HG3  . PRO A 1 20  ? -252.761 -9.347  91.566  1.00 0.00 ? 20  PRO A HG3  2  
ATOM 2105  H HD2  . PRO A 1 20  ? -251.876 -9.634  94.035  1.00 0.00 ? 20  PRO A HD2  2  
ATOM 2106  H HD3  . PRO A 1 20  ? -253.259 -8.574  93.713  1.00 0.00 ? 20  PRO A HD3  2  
ATOM 2107  N N    . GLU A 1 21  ? -252.909 -12.966 93.699  1.00 0.00 ? 21  GLU A N    2  
ATOM 2108  C CA   . GLU A 1 21  ? -252.361 -14.313 93.718  1.00 0.00 ? 21  GLU A CA   2  
ATOM 2109  C C    . GLU A 1 21  ? -252.970 -15.136 94.845  1.00 0.00 ? 21  GLU A C    2  
ATOM 2110  O O    . GLU A 1 21  ? -253.368 -14.608 95.880  1.00 0.00 ? 21  GLU A O    2  
ATOM 2111  C CB   . GLU A 1 21  ? -250.839 -14.279 93.875  1.00 0.00 ? 21  GLU A CB   2  
ATOM 2112  C CG   . GLU A 1 21  ? -250.162 -13.175 93.083  1.00 0.00 ? 21  GLU A CG   2  
ATOM 2113  C CD   . GLU A 1 21  ? -249.687 -12.041 93.965  1.00 0.00 ? 21  GLU A CD   2  
ATOM 2114  O OE1  . GLU A 1 21  ? -250.539 -11.260 94.431  1.00 0.00 ? 21  GLU A OE1  2  
ATOM 2115  O OE2  . GLU A 1 21  ? -248.464 -11.939 94.198  1.00 0.00 ? 21  GLU A OE2  2  
ATOM 2116  H H    . GLU A 1 21  ? -252.306 -12.191 93.862  1.00 0.00 ? 21  GLU A H    2  
ATOM 2117  H HA   . GLU A 1 21  ? -252.609 -14.793 92.778  1.00 0.00 ? 21  GLU A HA   2  
ATOM 2118  H HB2  . GLU A 1 21  ? -250.600 -14.148 94.919  1.00 0.00 ? 21  GLU A HB2  2  
ATOM 2119  H HB3  . GLU A 1 21  ? -250.442 -15.220 93.543  1.00 0.00 ? 21  GLU A HB3  2  
ATOM 2120  H HG2  . GLU A 1 21  ? -249.314 -13.590 92.567  1.00 0.00 ? 21  GLU A HG2  2  
ATOM 2121  H HG3  . GLU A 1 21  ? -250.865 -12.782 92.362  1.00 0.00 ? 21  GLU A HG3  2  
ATOM 2122  N N    . PRO A 1 22  ? -253.030 -16.454 94.650  1.00 0.00 ? 22  PRO A N    2  
ATOM 2123  C CA   . PRO A 1 22  ? -253.611 -17.383 95.616  1.00 0.00 ? 22  PRO A CA   2  
ATOM 2124  C C    . PRO A 1 22  ? -252.609 -17.688 96.700  1.00 0.00 ? 22  PRO A C    2  
ATOM 2125  O O    . PRO A 1 22  ? -252.932 -17.926 97.864  1.00 0.00 ? 22  PRO A O    2  
ATOM 2126  C CB   . PRO A 1 22  ? -253.882 -18.640 94.789  1.00 0.00 ? 22  PRO A CB   2  
ATOM 2127  C CG   . PRO A 1 22  ? -253.416 -18.327 93.400  1.00 0.00 ? 22  PRO A CG   2  
ATOM 2128  C CD   . PRO A 1 22  ? -252.510 -17.156 93.477  1.00 0.00 ? 22  PRO A CD   2  
ATOM 2129  H HA   . PRO A 1 22  ? -254.526 -17.010 96.040  1.00 0.00 ? 22  PRO A HA   2  
ATOM 2130  H HB2  . PRO A 1 22  ? -253.331 -19.470 95.207  1.00 0.00 ? 22  PRO A HB2  2  
ATOM 2131  H HB3  . PRO A 1 22  ? -254.939 -18.861 94.806  1.00 0.00 ? 22  PRO A HB3  2  
ATOM 2132  H HG2  . PRO A 1 22  ? -252.900 -19.168 92.984  1.00 0.00 ? 22  PRO A HG2  2  
ATOM 2133  H HG3  . PRO A 1 22  ? -254.246 -18.069 92.806  1.00 0.00 ? 22  PRO A HG3  2  
ATOM 2134  H HD2  . PRO A 1 22  ? -251.487 -17.468 93.615  1.00 0.00 ? 22  PRO A HD2  2  
ATOM 2135  H HD3  . PRO A 1 22  ? -252.607 -16.550 92.591  1.00 0.00 ? 22  PRO A HD3  2  
ATOM 2136  N N    . PHE A 1 23  ? -251.383 -17.709 96.254  1.00 0.00 ? 23  PHE A N    2  
ATOM 2137  C CA   . PHE A 1 23  ? -250.232 -17.846 97.117  1.00 0.00 ? 23  PHE A CA   2  
ATOM 2138  C C    . PHE A 1 23  ? -249.079 -17.044 96.542  1.00 0.00 ? 23  PHE A C    2  
ATOM 2139  O O    . PHE A 1 23  ? -248.755 -17.166 95.362  1.00 0.00 ? 23  PHE A O    2  
ATOM 2140  C CB   . PHE A 1 23  ? -249.836 -19.322 97.288  1.00 0.00 ? 23  PHE A CB   2  
ATOM 2141  C CG   . PHE A 1 23  ? -249.475 -20.037 96.011  1.00 0.00 ? 23  PHE A CG   2  
ATOM 2142  C CD1  . PHE A 1 23  ? -250.462 -20.517 95.164  1.00 0.00 ? 23  PHE A CD1  2  
ATOM 2143  C CD2  . PHE A 1 23  ? -248.146 -20.237 95.664  1.00 0.00 ? 23  PHE A CD2  2  
ATOM 2144  C CE1  . PHE A 1 23  ? -250.132 -21.179 93.997  1.00 0.00 ? 23  PHE A CE1  2  
ATOM 2145  C CE2  . PHE A 1 23  ? -247.811 -20.898 94.497  1.00 0.00 ? 23  PHE A CE2  2  
ATOM 2146  C CZ   . PHE A 1 23  ? -248.805 -21.369 93.662  1.00 0.00 ? 23  PHE A CZ   2  
ATOM 2147  H H    . PHE A 1 23  ? -251.256 -17.614 95.280  1.00 0.00 ? 23  PHE A H    2  
ATOM 2148  H HA   . PHE A 1 23  ? -250.489 -17.437 98.083  1.00 0.00 ? 23  PHE A HA   2  
ATOM 2149  H HB2  . PHE A 1 23  ? -248.982 -19.380 97.946  1.00 0.00 ? 23  PHE A HB2  2  
ATOM 2150  H HB3  . PHE A 1 23  ? -250.662 -19.852 97.741  1.00 0.00 ? 23  PHE A HB3  2  
ATOM 2151  H HD1  . PHE A 1 23  ? -251.500 -20.367 95.422  1.00 0.00 ? 23  PHE A HD1  2  
ATOM 2152  H HD2  . PHE A 1 23  ? -247.368 -19.869 96.316  1.00 0.00 ? 23  PHE A HD2  2  
ATOM 2153  H HE1  . PHE A 1 23  ? -250.911 -21.548 93.346  1.00 0.00 ? 23  PHE A HE1  2  
ATOM 2154  H HE2  . PHE A 1 23  ? -246.772 -21.045 94.238  1.00 0.00 ? 23  PHE A HE2  2  
ATOM 2155  H HZ   . PHE A 1 23  ? -248.546 -21.885 92.750  1.00 0.00 ? 23  PHE A HZ   2  
ATOM 2156  N N    . THR A 1 24  ? -248.481 -16.212 97.370  1.00 0.00 ? 24  THR A N    2  
ATOM 2157  C CA   . THR A 1 24  ? -247.340 -15.430 96.955  1.00 0.00 ? 24  THR A CA   2  
ATOM 2158  C C    . THR A 1 24  ? -246.393 -15.277 98.134  1.00 0.00 ? 24  THR A C    2  
ATOM 2159  O O    . THR A 1 24  ? -246.807 -15.328 99.292  1.00 0.00 ? 24  THR A O    2  
ATOM 2160  C CB   . THR A 1 24  ? -247.753 -14.052 96.381  1.00 0.00 ? 24  THR A CB   2  
ATOM 2161  O OG1  . THR A 1 24  ? -246.636 -13.418 95.747  1.00 0.00 ? 24  THR A OG1  2  
ATOM 2162  C CG2  . THR A 1 24  ? -248.300 -13.137 97.458  1.00 0.00 ? 24  THR A CG2  2  
ATOM 2163  H H    . THR A 1 24  ? -248.813 -16.124 98.290  1.00 0.00 ? 24  THR A H    2  
ATOM 2164  H HA   . THR A 1 24  ? -246.832 -15.983 96.177  1.00 0.00 ? 24  THR A HA   2  
ATOM 2165  H HB   . THR A 1 24  ? -248.527 -14.209 95.643  1.00 0.00 ? 24  THR A HB   2  
ATOM 2166  H HG1  . THR A 1 24  ? -246.972 -12.766 95.106  1.00 0.00 ? 24  THR A HG1  2  
ATOM 2167  H HG21 . THR A 1 24  ? -247.548 -12.990 98.220  1.00 0.00 ? 24  THR A HG21 2  
ATOM 2168  H HG22 . THR A 1 24  ? -248.563 -12.184 97.022  1.00 0.00 ? 24  THR A HG22 2  
ATOM 2169  H HG23 . THR A 1 24  ? -249.178 -13.585 97.900  1.00 0.00 ? 24  THR A HG23 2  
ATOM 2170  N N    . VAL A 1 25  ? -245.128 -15.119 97.835  1.00 0.00 ? 25  VAL A N    2  
ATOM 2171  C CA   . VAL A 1 25  ? -244.078 -15.210 98.834  1.00 0.00 ? 25  VAL A CA   2  
ATOM 2172  C C    . VAL A 1 25  ? -243.356 -13.867 98.955  1.00 0.00 ? 25  VAL A C    2  
ATOM 2173  O O    . VAL A 1 25  ? -242.944 -13.298 97.942  1.00 0.00 ? 25  VAL A O    2  
ATOM 2174  C CB   . VAL A 1 25  ? -243.075 -16.298 98.402  1.00 0.00 ? 25  VAL A CB   2  
ATOM 2175  C CG1  . VAL A 1 25  ? -242.170 -16.716 99.530  1.00 0.00 ? 25  VAL A CG1  2  
ATOM 2176  C CG2  . VAL A 1 25  ? -243.785 -17.496 97.794  1.00 0.00 ? 25  VAL A CG2  2  
ATOM 2177  H H    . VAL A 1 25  ? -244.885 -14.913 96.907  1.00 0.00 ? 25  VAL A H    2  
ATOM 2178  H HA   . VAL A 1 25  ? -244.508 -15.490 99.788  1.00 0.00 ? 25  VAL A HA   2  
ATOM 2179  H HB   . VAL A 1 25  ? -242.464 -15.877 97.653  1.00 0.00 ? 25  VAL A HB   2  
ATOM 2180  H HG11 . VAL A 1 25  ? -241.634 -15.852 99.899  1.00 0.00 ? 25  VAL A HG11 2  
ATOM 2181  H HG12 . VAL A 1 25  ? -242.762 -17.141 100.327 1.00 0.00 ? 25  VAL A HG12 2  
ATOM 2182  H HG13 . VAL A 1 25  ? -241.464 -17.451 99.173  1.00 0.00 ? 25  VAL A HG13 2  
ATOM 2183  H HG21 . VAL A 1 25  ? -244.355 -17.178 96.933  1.00 0.00 ? 25  VAL A HG21 2  
ATOM 2184  H HG22 . VAL A 1 25  ? -243.056 -18.231 97.491  1.00 0.00 ? 25  VAL A HG22 2  
ATOM 2185  H HG23 . VAL A 1 25  ? -244.452 -17.929 98.525  1.00 0.00 ? 25  VAL A HG23 2  
ATOM 2186  N N    . PHE A 1 26  ? -243.198 -13.353 100.173 1.00 0.00 ? 26  PHE A N    2  
ATOM 2187  C CA   . PHE A 1 26  ? -242.518 -12.067 100.361 1.00 0.00 ? 26  PHE A CA   2  
ATOM 2188  C C    . PHE A 1 26  ? -241.194 -12.253 101.074 1.00 0.00 ? 26  PHE A C    2  
ATOM 2189  O O    . PHE A 1 26  ? -241.066 -13.100 101.958 1.00 0.00 ? 26  PHE A O    2  
ATOM 2190  C CB   . PHE A 1 26  ? -243.382 -11.062 101.124 1.00 0.00 ? 26  PHE A CB   2  
ATOM 2191  C CG   . PHE A 1 26  ? -244.784 -10.946 100.590 1.00 0.00 ? 26  PHE A CG   2  
ATOM 2192  C CD1  . PHE A 1 26  ? -245.793 -11.781 101.048 1.00 0.00 ? 26  PHE A CD1  2  
ATOM 2193  C CD2  . PHE A 1 26  ? -245.089 -9.999  99.626  1.00 0.00 ? 26  PHE A CD2  2  
ATOM 2194  C CE1  . PHE A 1 26  ? -247.077 -11.671 100.552 1.00 0.00 ? 26  PHE A CE1  2  
ATOM 2195  C CE2  . PHE A 1 26  ? -246.371 -9.886  99.128  1.00 0.00 ? 26  PHE A CE2  2  
ATOM 2196  C CZ   . PHE A 1 26  ? -247.366 -10.723 99.591  1.00 0.00 ? 26  PHE A CZ   2  
ATOM 2197  H H    . PHE A 1 26  ? -243.538 -13.842 100.954 1.00 0.00 ? 26  PHE A H    2  
ATOM 2198  H HA   . PHE A 1 26  ? -242.310 -11.672 99.386  1.00 0.00 ? 26  PHE A HA   2  
ATOM 2199  H HB2  . PHE A 1 26  ? -243.430 -11.335 102.164 1.00 0.00 ? 26  PHE A HB2  2  
ATOM 2200  H HB3  . PHE A 1 26  ? -242.921 -10.086 101.049 1.00 0.00 ? 26  PHE A HB3  2  
ATOM 2201  H HD1  . PHE A 1 26  ? -245.566 -12.523 101.803 1.00 0.00 ? 26  PHE A HD1  2  
ATOM 2202  H HD2  . PHE A 1 26  ? -244.312 -9.345  99.264  1.00 0.00 ? 26  PHE A HD2  2  
ATOM 2203  H HE1  . PHE A 1 26  ? -247.854 -12.326 100.916 1.00 0.00 ? 26  PHE A HE1  2  
ATOM 2204  H HE2  . PHE A 1 26  ? -246.597 -9.143  98.376  1.00 0.00 ? 26  PHE A HE2  2  
ATOM 2205  H HZ   . PHE A 1 26  ? -248.371 -10.635 99.202  1.00 0.00 ? 26  PHE A HZ   2  
ATOM 2206  N N    . THR A 1 27  ? -240.206 -11.475 100.657 1.00 0.00 ? 27  THR A N    2  
ATOM 2207  C CA   . THR A 1 27  ? -238.856 -11.609 101.169 1.00 0.00 ? 27  THR A CA   2  
ATOM 2208  C C    . THR A 1 27  ? -238.683 -10.830 102.458 1.00 0.00 ? 27  THR A C    2  
ATOM 2209  O O    . THR A 1 27  ? -239.247 -9.751  102.622 1.00 0.00 ? 27  THR A O    2  
ATOM 2210  C CB   . THR A 1 27  ? -237.825 -11.106 100.145 1.00 0.00 ? 27  THR A CB   2  
ATOM 2211  O OG1  . THR A 1 27  ? -238.437 -10.988 98.852  1.00 0.00 ? 27  THR A OG1  2  
ATOM 2212  C CG2  . THR A 1 27  ? -236.645 -12.062 100.062 1.00 0.00 ? 27  THR A CG2  2  
ATOM 2213  H H    . THR A 1 27  ? -240.391 -10.788 99.985  1.00 0.00 ? 27  THR A H    2  
ATOM 2214  H HA   . THR A 1 27  ? -238.668 -12.655 101.358 1.00 0.00 ? 27  THR A HA   2  
ATOM 2215  H HB   . THR A 1 27  ? -237.467 -10.137 100.459 1.00 0.00 ? 27  THR A HB   2  
ATOM 2216  H HG1  . THR A 1 27  ? -238.372 -10.073 98.554  1.00 0.00 ? 27  THR A HG1  2  
ATOM 2217  H HG21 . THR A 1 27  ? -237.001 -13.050 99.802  1.00 0.00 ? 27  THR A HG21 2  
ATOM 2218  H HG22 . THR A 1 27  ? -235.954 -11.716 99.306  1.00 0.00 ? 27  THR A HG22 2  
ATOM 2219  H HG23 . THR A 1 27  ? -236.144 -12.099 101.019 1.00 0.00 ? 27  THR A HG23 2  
ATOM 2220  N N    . ILE A 1 28  ? -237.912 -11.387 103.368 1.00 0.00 ? 28  ILE A N    2  
ATOM 2221  C CA   . ILE A 1 28  ? -237.616 -10.730 104.622 1.00 0.00 ? 28  ILE A CA   2  
ATOM 2222  C C    . ILE A 1 28  ? -236.164 -10.274 104.624 1.00 0.00 ? 28  ILE A C    2  
ATOM 2223  O O    . ILE A 1 28  ? -235.485 -10.386 103.606 1.00 0.00 ? 28  ILE A O    2  
ATOM 2224  C CB   . ILE A 1 28  ? -237.882 -11.669 105.806 1.00 0.00 ? 28  ILE A CB   2  
ATOM 2225  C CG1  . ILE A 1 28  ? -236.747 -12.679 105.976 1.00 0.00 ? 28  ILE A CG1  2  
ATOM 2226  C CG2  . ILE A 1 28  ? -239.202 -12.398 105.581 1.00 0.00 ? 28  ILE A CG2  2  
ATOM 2227  C CD1  . ILE A 1 28  ? -236.851 -13.479 107.244 1.00 0.00 ? 28  ILE A CD1  2  
ATOM 2228  H H    . ILE A 1 28  ? -237.538 -12.278 103.198 1.00 0.00 ? 28  ILE A H    2  
ATOM 2229  H HA   . ILE A 1 28  ? -238.260 -9.873  104.717 1.00 0.00 ? 28  ILE A HA   2  
ATOM 2230  H HB   . ILE A 1 28  ? -237.971 -11.073 106.707 1.00 0.00 ? 28  ILE A HB   2  
ATOM 2231  H HG12 . ILE A 1 28  ? -236.763 -13.368 105.147 1.00 0.00 ? 28  ILE A HG12 2  
ATOM 2232  H HG13 . ILE A 1 28  ? -235.803 -12.153 105.988 1.00 0.00 ? 28  ILE A HG13 2  
ATOM 2233  H HG21 . ILE A 1 28  ? -239.967 -11.679 105.281 1.00 0.00 ? 28  ILE A HG21 2  
ATOM 2234  H HG22 . ILE A 1 28  ? -239.087 -13.144 104.810 1.00 0.00 ? 28  ILE A HG22 2  
ATOM 2235  H HG23 . ILE A 1 28  ? -239.508 -12.865 106.508 1.00 0.00 ? 28  ILE A HG23 2  
ATOM 2236  H HD11 . ILE A 1 28  ? -236.846 -12.808 108.089 1.00 0.00 ? 28  ILE A HD11 2  
ATOM 2237  H HD12 . ILE A 1 28  ? -237.772 -14.042 107.237 1.00 0.00 ? 28  ILE A HD12 2  
ATOM 2238  H HD13 . ILE A 1 28  ? -236.014 -14.157 107.313 1.00 0.00 ? 28  ILE A HD13 2  
ATOM 2239  N N    . ASN A 1 29  ? -235.689 -9.763  105.750 1.00 0.00 ? 29  ASN A N    2  
ATOM 2240  C CA   . ASN A 1 29  ? -234.304 -9.326  105.861 1.00 0.00 ? 29  ASN A CA   2  
ATOM 2241  C C    . ASN A 1 29  ? -233.871 -9.283  107.322 1.00 0.00 ? 29  ASN A C    2  
ATOM 2242  O O    . ASN A 1 29  ? -234.653 -8.919  108.201 1.00 0.00 ? 29  ASN A O    2  
ATOM 2243  C CB   . ASN A 1 29  ? -234.097 -7.955  105.206 1.00 0.00 ? 29  ASN A CB   2  
ATOM 2244  C CG   . ASN A 1 29  ? -234.883 -6.850  105.879 1.00 0.00 ? 29  ASN A CG   2  
ATOM 2245  O OD1  . ASN A 1 29  ? -234.392 -6.187  106.791 1.00 0.00 ? 29  ASN A OD1  2  
ATOM 2246  N ND2  . ASN A 1 29  ? -236.107 -6.639  105.429 1.00 0.00 ? 29  ASN A ND2  2  
ATOM 2247  H H    . ASN A 1 29  ? -236.273 -9.694  106.531 1.00 0.00 ? 29  ASN A H    2  
ATOM 2248  H HA   . ASN A 1 29  ? -233.698 -10.049 105.342 1.00 0.00 ? 29  ASN A HA   2  
ATOM 2249  H HB2  . ASN A 1 29  ? -233.050 -7.701  105.249 1.00 0.00 ? 29  ASN A HB2  2  
ATOM 2250  H HB3  . ASN A 1 29  ? -234.404 -8.012  104.171 1.00 0.00 ? 29  ASN A HB3  2  
ATOM 2251  H HD21 . ASN A 1 29  ? -236.435 -7.200  104.696 1.00 0.00 ? 29  ASN A HD21 2  
ATOM 2252  H HD22 . ASN A 1 29  ? -236.633 -5.935  105.846 1.00 0.00 ? 29  ASN A HD22 2  
ATOM 2253  N N    . GLY A 1 30  ? -232.635 -9.693  107.573 1.00 0.00 ? 30  GLY A N    2  
ATOM 2254  C CA   . GLY A 1 30  ? -232.074 -9.629  108.910 1.00 0.00 ? 30  GLY A CA   2  
ATOM 2255  C C    . GLY A 1 30  ? -232.755 -10.576 109.881 1.00 0.00 ? 30  GLY A C    2  
ATOM 2256  O O    . GLY A 1 30  ? -232.595 -11.792 109.788 1.00 0.00 ? 30  GLY A O    2  
ATOM 2257  H H    . GLY A 1 30  ? -232.103 -10.069 106.843 1.00 0.00 ? 30  GLY A H    2  
ATOM 2258  H HA2  . GLY A 1 30  ? -231.025 -9.880  108.860 1.00 0.00 ? 30  GLY A HA2  2  
ATOM 2259  H HA3  . GLY A 1 30  ? -232.172 -8.619  109.282 1.00 0.00 ? 30  GLY A HA3  2  
ATOM 2260  N N    . GLY A 1 31  ? -233.517 -10.011 110.808 1.00 0.00 ? 31  GLY A N    2  
ATOM 2261  C CA   . GLY A 1 31  ? -234.212 -10.808 111.800 1.00 0.00 ? 31  GLY A CA   2  
ATOM 2262  C C    . GLY A 1 31  ? -235.633 -10.329 111.997 1.00 0.00 ? 31  GLY A C    2  
ATOM 2263  O O    . GLY A 1 31  ? -236.015 -9.903  113.094 1.00 0.00 ? 31  GLY A O    2  
ATOM 2264  H H    . GLY A 1 31  ? -233.621 -9.037  110.810 1.00 0.00 ? 31  GLY A H    2  
ATOM 2265  H HA2  . GLY A 1 31  ? -234.228 -11.840 111.475 1.00 0.00 ? 31  GLY A HA2  2  
ATOM 2266  H HA3  . GLY A 1 31  ? -233.684 -10.742 112.739 1.00 0.00 ? 31  GLY A HA3  2  
ATOM 2267  N N    . THR A 1 32  ? -236.408 -10.382 110.926 1.00 0.00 ? 32  THR A N    2  
ATOM 2268  C CA   . THR A 1 32  ? -237.777 -9.903  110.935 1.00 0.00 ? 32  THR A CA   2  
ATOM 2269  C C    . THR A 1 32  ? -238.683 -10.719 111.838 1.00 0.00 ? 32  THR A C    2  
ATOM 2270  O O    . THR A 1 32  ? -238.739 -11.945 111.732 1.00 0.00 ? 32  THR A O    2  
ATOM 2271  C CB   . THR A 1 32  ? -238.369 -9.930  109.539 1.00 0.00 ? 32  THR A CB   2  
ATOM 2272  O OG1  . THR A 1 32  ? -237.958 -11.130 108.882 1.00 0.00 ? 32  THR A OG1  2  
ATOM 2273  C CG2  . THR A 1 32  ? -237.935 -8.714  108.735 1.00 0.00 ? 32  THR A CG2  2  
ATOM 2274  H H    . THR A 1 32  ? -236.048 -10.761 110.095 1.00 0.00 ? 32  THR A H    2  
ATOM 2275  H HA   . THR A 1 32  ? -237.776 -8.888  111.254 1.00 0.00 ? 32  THR A HA   2  
ATOM 2276  H HB   . THR A 1 32  ? -239.456 -9.923  109.635 1.00 0.00 ? 32  THR A HB   2  
ATOM 2277  H HG1  . THR A 1 32  ? -238.160 -11.886 109.445 1.00 0.00 ? 32  THR A HG1  2  
ATOM 2278  H HG21 . THR A 1 32  ? -238.244 -7.816  109.247 1.00 0.00 ? 32  THR A HG21 2  
ATOM 2279  H HG22 . THR A 1 32  ? -236.860 -8.717  108.630 1.00 0.00 ? 32  THR A HG22 2  
ATOM 2280  H HG23 . THR A 1 32  ? -238.393 -8.748  107.756 1.00 0.00 ? 32  THR A HG23 2  
ATOM 2281  N N    . LYS A 1 33  ? -239.401 -10.030 112.713 1.00 0.00 ? 33  LYS A N    2  
ATOM 2282  C CA   . LYS A 1 33  ? -240.463 -10.662 113.472 1.00 0.00 ? 33  LYS A CA   2  
ATOM 2283  C C    . LYS A 1 33  ? -241.631 -10.931 112.563 1.00 0.00 ? 33  LYS A C    2  
ATOM 2284  O O    . LYS A 1 33  ? -241.639 -10.493 111.420 1.00 0.00 ? 33  LYS A O    2  
ATOM 2285  C CB   . LYS A 1 33  ? -240.945 -9.777  114.616 1.00 0.00 ? 33  LYS A CB   2  
ATOM 2286  C CG   . LYS A 1 33  ? -239.979 -9.686  115.762 1.00 0.00 ? 33  LYS A CG   2  
ATOM 2287  C CD   . LYS A 1 33  ? -238.925 -8.621  115.528 1.00 0.00 ? 33  LYS A CD   2  
ATOM 2288  C CE   . LYS A 1 33  ? -237.616 -8.977  116.225 1.00 0.00 ? 33  LYS A CE   2  
ATOM 2289  N NZ   . LYS A 1 33  ? -237.030 -10.251 115.714 1.00 0.00 ? 33  LYS A NZ   2  
ATOM 2290  H H    . LYS A 1 33  ? -239.215 -9.084  112.846 1.00 0.00 ? 33  LYS A H    2  
ATOM 2291  H HA   . LYS A 1 33  ? -240.092 -11.593 113.871 1.00 0.00 ? 33  LYS A HA   2  
ATOM 2292  H HB2  . LYS A 1 33  ? -241.113 -8.780  114.236 1.00 0.00 ? 33  LYS A HB2  2  
ATOM 2293  H HB3  . LYS A 1 33  ? -241.880 -10.172 114.990 1.00 0.00 ? 33  LYS A HB3  2  
ATOM 2294  H HG2  . LYS A 1 33  ? -240.533 -9.457  116.647 1.00 0.00 ? 33  LYS A HG2  2  
ATOM 2295  H HG3  . LYS A 1 33  ? -239.490 -10.642 115.881 1.00 0.00 ? 33  LYS A HG3  2  
ATOM 2296  H HD2  . LYS A 1 33  ? -238.757 -8.524  114.465 1.00 0.00 ? 33  LYS A HD2  2  
ATOM 2297  H HD3  . LYS A 1 33  ? -239.287 -7.683  115.922 1.00 0.00 ? 33  LYS A HD3  2  
ATOM 2298  H HE2  . LYS A 1 33  ? -236.909 -8.178  116.062 1.00 0.00 ? 33  LYS A HE2  2  
ATOM 2299  H HE3  . LYS A 1 33  ? -237.805 -9.078  117.283 1.00 0.00 ? 33  LYS A HE3  2  
ATOM 2300  H HZ1  . LYS A 1 33  ? -237.724 -11.034 115.806 1.00 0.00 ? 33  LYS A HZ1  2  
ATOM 2301  H HZ2  . LYS A 1 33  ? -236.770 -10.156 114.710 1.00 0.00 ? 33  LYS A HZ2  2  
ATOM 2302  H HZ3  . LYS A 1 33  ? -236.184 -10.501 116.257 1.00 0.00 ? 33  LYS A HZ3  2  
ATOM 2303  N N    . ALA A 1 34  ? -242.636 -11.601 113.085 1.00 0.00 ? 34  ALA A N    2  
ATOM 2304  C CA   . ALA A 1 34  ? -243.860 -11.816 112.333 1.00 0.00 ? 34  ALA A CA   2  
ATOM 2305  C C    . ALA A 1 34  ? -244.571 -10.485 112.118 1.00 0.00 ? 34  ALA A C    2  
ATOM 2306  O O    . ALA A 1 34  ? -245.407 -10.350 111.239 1.00 0.00 ? 34  ALA A O    2  
ATOM 2307  C CB   . ALA A 1 34  ? -244.762 -12.804 113.051 1.00 0.00 ? 34  ALA A CB   2  
ATOM 2308  H H    . ALA A 1 34  ? -242.559 -11.953 114.003 1.00 0.00 ? 34  ALA A H    2  
ATOM 2309  H HA   . ALA A 1 34  ? -243.589 -12.234 111.367 1.00 0.00 ? 34  ALA A HA   2  
ATOM 2310  H HB1  . ALA A 1 34  ? -245.663 -12.954 112.476 1.00 0.00 ? 34  ALA A HB1  2  
ATOM 2311  H HB2  . ALA A 1 34  ? -244.246 -13.745 113.167 1.00 0.00 ? 34  ALA A HB2  2  
ATOM 2312  H HB3  . ALA A 1 34  ? -245.018 -12.413 114.025 1.00 0.00 ? 34  ALA A HB3  2  
ATOM 2313  N N    . LYS A 1 35  ? -244.226 -9.508  112.950 1.00 0.00 ? 35  LYS A N    2  
ATOM 2314  C CA   . LYS A 1 35  ? -244.817 -8.170  112.873 1.00 0.00 ? 35  LYS A CA   2  
ATOM 2315  C C    . LYS A 1 35  ? -244.143 -7.364  111.772 1.00 0.00 ? 35  LYS A C    2  
ATOM 2316  O O    . LYS A 1 35  ? -244.810 -6.828  110.882 1.00 0.00 ? 35  LYS A O    2  
ATOM 2317  C CB   . LYS A 1 35  ? -244.715 -7.441  114.229 1.00 0.00 ? 35  LYS A CB   2  
ATOM 2318  C CG   . LYS A 1 35  ? -243.291 -7.251  114.749 1.00 0.00 ? 35  LYS A CG   2  
ATOM 2319  C CD   . LYS A 1 35  ? -243.255 -6.597  116.128 1.00 0.00 ? 35  LYS A CD   2  
ATOM 2320  C CE   . LYS A 1 35  ? -243.681 -7.562  117.225 1.00 0.00 ? 35  LYS A CE   2  
ATOM 2321  N NZ   . LYS A 1 35  ? -243.613 -6.950  118.581 1.00 0.00 ? 35  LYS A NZ   2  
ATOM 2322  H H    . LYS A 1 35  ? -243.519 -9.685  113.598 1.00 0.00 ? 35  LYS A H    2  
ATOM 2323  H HA   . LYS A 1 35  ? -245.865 -8.287  112.608 1.00 0.00 ? 35  LYS A HA   2  
ATOM 2324  H HB2  . LYS A 1 35  ? -245.167 -6.465  114.132 1.00 0.00 ? 35  LYS A HB2  2  
ATOM 2325  H HB3  . LYS A 1 35  ? -245.269 -8.005  114.965 1.00 0.00 ? 35  LYS A HB3  2  
ATOM 2326  H HG2  . LYS A 1 35  ? -242.813 -8.217  114.813 1.00 0.00 ? 35  LYS A HG2  2  
ATOM 2327  H HG3  . LYS A 1 35  ? -242.748 -6.629  114.052 1.00 0.00 ? 35  LYS A HG3  2  
ATOM 2328  H HD2  . LYS A 1 35  ? -242.249 -6.263  116.331 1.00 0.00 ? 35  LYS A HD2  2  
ATOM 2329  H HD3  . LYS A 1 35  ? -243.923 -5.748  116.130 1.00 0.00 ? 35  LYS A HD3  2  
ATOM 2330  H HE2  . LYS A 1 35  ? -244.697 -7.872  117.034 1.00 0.00 ? 35  LYS A HE2  2  
ATOM 2331  H HE3  . LYS A 1 35  ? -243.032 -8.426  117.197 1.00 0.00 ? 35  LYS A HE3  2  
ATOM 2332  H HZ1  . LYS A 1 35  ? -244.228 -6.116  118.631 1.00 0.00 ? 35  LYS A HZ1  2  
ATOM 2333  H HZ2  . LYS A 1 35  ? -243.934 -7.643  119.303 1.00 0.00 ? 35  LYS A HZ2  2  
ATOM 2334  H HZ3  . LYS A 1 35  ? -242.640 -6.668  118.804 1.00 0.00 ? 35  LYS A HZ3  2  
ATOM 2335  N N    . GLN A 1 36  ? -242.810 -7.313  111.812 1.00 0.00 ? 36  GLN A N    2  
ATOM 2336  C CA   . GLN A 1 36  ? -242.050 -6.653  110.772 1.00 0.00 ? 36  GLN A CA   2  
ATOM 2337  C C    . GLN A 1 36  ? -242.279 -7.384  109.465 1.00 0.00 ? 36  GLN A C    2  
ATOM 2338  O O    . GLN A 1 36  ? -242.103 -6.838  108.375 1.00 0.00 ? 36  GLN A O    2  
ATOM 2339  C CB   . GLN A 1 36  ? -240.560 -6.652  111.115 1.00 0.00 ? 36  GLN A CB   2  
ATOM 2340  C CG   . GLN A 1 36  ? -240.234 -6.078  112.487 1.00 0.00 ? 36  GLN A CG   2  
ATOM 2341  C CD   . GLN A 1 36  ? -240.863 -4.722  112.724 1.00 0.00 ? 36  GLN A CD   2  
ATOM 2342  O OE1  . GLN A 1 36  ? -241.972 -4.626  113.243 1.00 0.00 ? 36  GLN A OE1  2  
ATOM 2343  N NE2  . GLN A 1 36  ? -240.162 -3.668  112.350 1.00 0.00 ? 36  GLN A NE2  2  
ATOM 2344  H H    . GLN A 1 36  ? -242.328 -7.725  112.561 1.00 0.00 ? 36  GLN A H    2  
ATOM 2345  H HA   . GLN A 1 36  ? -242.403 -5.636  110.682 1.00 0.00 ? 36  GLN A HA   2  
ATOM 2346  H HB2  . GLN A 1 36  ? -240.195 -7.668  111.083 1.00 0.00 ? 36  GLN A HB2  2  
ATOM 2347  H HB3  . GLN A 1 36  ? -240.038 -6.071  110.375 1.00 0.00 ? 36  GLN A HB3  2  
ATOM 2348  H HG2  . GLN A 1 36  ? -240.596 -6.755  113.241 1.00 0.00 ? 36  GLN A HG2  2  
ATOM 2349  H HG3  . GLN A 1 36  ? -239.163 -5.980  112.576 1.00 0.00 ? 36  GLN A HG3  2  
ATOM 2350  H HE21 . GLN A 1 36  ? -239.279 -3.816  111.942 1.00 0.00 ? 36  GLN A HE21 2  
ATOM 2351  H HE22 . GLN A 1 36  ? -240.554 -2.780  112.499 1.00 0.00 ? 36  GLN A HE22 2  
ATOM 2352  N N    . LEU A 1 37  ? -242.648 -8.643  109.590 1.00 0.00 ? 37  LEU A N    2  
ATOM 2353  C CA   . LEU A 1 37  ? -242.898 -9.454  108.441 1.00 0.00 ? 37  LEU A CA   2  
ATOM 2354  C C    . LEU A 1 37  ? -244.286 -9.314  107.902 1.00 0.00 ? 37  LEU A C    2  
ATOM 2355  O O    . LEU A 1 37  ? -244.467 -9.347  106.701 1.00 0.00 ? 37  LEU A O    2  
ATOM 2356  C CB   . LEU A 1 37  ? -242.603 -10.900 108.719 1.00 0.00 ? 37  LEU A CB   2  
ATOM 2357  C CG   . LEU A 1 37  ? -241.731 -11.459 107.648 1.00 0.00 ? 37  LEU A CG   2  
ATOM 2358  C CD1  . LEU A 1 37  ? -242.528 -11.561 106.369 1.00 0.00 ? 37  LEU A CD1  2  
ATOM 2359  C CD2  . LEU A 1 37  ? -240.574 -10.508 107.449 1.00 0.00 ? 37  LEU A CD2  2  
ATOM 2360  H H    . LEU A 1 37  ? -242.724 -9.038  110.479 1.00 0.00 ? 37  LEU A H    2  
ATOM 2361  H HA   . LEU A 1 37  ? -242.220 -9.119  107.675 1.00 0.00 ? 37  LEU A HA   2  
ATOM 2362  H HB2  . LEU A 1 37  ? -242.104 -10.985 109.675 1.00 0.00 ? 37  LEU A HB2  2  
ATOM 2363  H HB3  . LEU A 1 37  ? -243.528 -11.454 108.743 1.00 0.00 ? 37  LEU A HB3  2  
ATOM 2364  H HG   . LEU A 1 37  ? -241.359 -12.430 107.935 1.00 0.00 ? 37  LEU A HG   2  
ATOM 2365  H HD11 . LEU A 1 37  ? -243.040 -10.608 106.207 1.00 0.00 ? 37  LEU A HD11 2  
ATOM 2366  H HD12 . LEU A 1 37  ? -241.867 -11.761 105.540 1.00 0.00 ? 37  LEU A HD12 2  
ATOM 2367  H HD13 . LEU A 1 37  ? -243.259 -12.346 106.457 1.00 0.00 ? 37  LEU A HD13 2  
ATOM 2368  H HD21 . LEU A 1 37  ? -240.329 -10.034 108.388 1.00 0.00 ? 37  LEU A HD21 2  
ATOM 2369  H HD22 . LEU A 1 37  ? -239.718 -11.057 107.091 1.00 0.00 ? 37  LEU A HD22 2  
ATOM 2370  H HD23 . LEU A 1 37  ? -240.845 -9.754  106.721 1.00 0.00 ? 37  LEU A HD23 2  
ATOM 2371  N N    . LEU A 1 38  ? -245.265 -9.189  108.762 1.00 0.00 ? 38  LEU A N    2  
ATOM 2372  C CA   . LEU A 1 38  ? -246.607 -8.938  108.302 1.00 0.00 ? 38  LEU A CA   2  
ATOM 2373  C C    . LEU A 1 38  ? -246.547 -7.743  107.347 1.00 0.00 ? 38  LEU A C    2  
ATOM 2374  O O    . LEU A 1 38  ? -247.157 -7.750  106.295 1.00 0.00 ? 38  LEU A O    2  
ATOM 2375  C CB   . LEU A 1 38  ? -247.533 -8.703  109.508 1.00 0.00 ? 38  LEU A CB   2  
ATOM 2376  C CG   . LEU A 1 38  ? -249.036 -8.839  109.234 1.00 0.00 ? 38  LEU A CG   2  
ATOM 2377  C CD1  . LEU A 1 38  ? -249.768 -7.551  109.568 1.00 0.00 ? 38  LEU A CD1  2  
ATOM 2378  C CD2  . LEU A 1 38  ? -249.287 -9.244  107.789 1.00 0.00 ? 38  LEU A CD2  2  
ATOM 2379  H H    . LEU A 1 38  ? -245.090 -9.288  109.724 1.00 0.00 ? 38  LEU A H    2  
ATOM 2380  H HA   . LEU A 1 38  ? -246.943 -9.811  107.742 1.00 0.00 ? 38  LEU A HA   2  
ATOM 2381  H HB2  . LEU A 1 38  ? -247.270 -9.428  110.266 1.00 0.00 ? 38  LEU A HB2  2  
ATOM 2382  H HB3  . LEU A 1 38  ? -247.341 -7.717  109.908 1.00 0.00 ? 38  LEU A HB3  2  
ATOM 2383  H HG   . LEU A 1 38  ? -249.436 -9.618  109.869 1.00 0.00 ? 38  LEU A HG   2  
ATOM 2384  H HD11 . LEU A 1 38  ? -249.624 -7.315  110.613 1.00 0.00 ? 38  LEU A HD11 2  
ATOM 2385  H HD12 . LEU A 1 38  ? -249.379 -6.748  108.960 1.00 0.00 ? 38  LEU A HD12 2  
ATOM 2386  H HD13 . LEU A 1 38  ? -250.822 -7.675  109.370 1.00 0.00 ? 38  LEU A HD13 2  
ATOM 2387  H HD21 . LEU A 1 38  ? -248.728 -10.148 107.560 1.00 0.00 ? 38  LEU A HD21 2  
ATOM 2388  H HD22 . LEU A 1 38  ? -250.339 -9.426  107.639 1.00 0.00 ? 38  LEU A HD22 2  
ATOM 2389  H HD23 . LEU A 1 38  ? -248.959 -8.452  107.131 1.00 0.00 ? 38  LEU A HD23 2  
ATOM 2390  N N    . GLN A 1 39  ? -245.695 -6.791  107.690 1.00 0.00 ? 39  GLN A N    2  
ATOM 2391  C CA   . GLN A 1 39  ? -245.314 -5.707  106.834 1.00 0.00 ? 39  GLN A CA   2  
ATOM 2392  C C    . GLN A 1 39  ? -244.792 -6.189  105.505 1.00 0.00 ? 39  GLN A C    2  
ATOM 2393  O O    . GLN A 1 39  ? -245.259 -5.769  104.471 1.00 0.00 ? 39  GLN A O    2  
ATOM 2394  C CB   . GLN A 1 39  ? -244.160 -5.038  107.512 1.00 0.00 ? 39  GLN A CB   2  
ATOM 2395  C CG   . GLN A 1 39  ? -243.747 -3.783  106.831 1.00 0.00 ? 39  GLN A CG   2  
ATOM 2396  C CD   . GLN A 1 39  ? -242.541 -3.120  107.472 1.00 0.00 ? 39  GLN A CD   2  
ATOM 2397  O OE1  . GLN A 1 39  ? -242.407 -1.901  107.454 1.00 0.00 ? 39  GLN A OE1  2  
ATOM 2398  N NE2  . GLN A 1 39  ? -241.647 -3.923  108.033 1.00 0.00 ? 39  GLN A NE2  2  
ATOM 2399  H H    . GLN A 1 39  ? -245.311 -6.798  108.575 1.00 0.00 ? 39  GLN A H    2  
ATOM 2400  H HA   . GLN A 1 39  ? -246.143 -5.012  106.696 1.00 0.00 ? 39  GLN A HA   2  
ATOM 2401  H HB2  . GLN A 1 39  ? -244.400 -4.861  108.531 1.00 0.00 ? 39  GLN A HB2  2  
ATOM 2402  H HB3  . GLN A 1 39  ? -243.320 -5.717  107.481 1.00 0.00 ? 39  GLN A HB3  2  
ATOM 2403  H HG2  . GLN A 1 39  ? -243.502 -4.053  105.813 1.00 0.00 ? 39  GLN A HG2  2  
ATOM 2404  H HG3  . GLN A 1 39  ? -244.580 -3.102  106.844 1.00 0.00 ? 39  GLN A HG3  2  
ATOM 2405  H HE21 . GLN A 1 39  ? -241.810 -4.892  108.004 1.00 0.00 ? 39  GLN A HE21 2  
ATOM 2406  H HE22 . GLN A 1 39  ? -240.861 -3.516  108.449 1.00 0.00 ? 39  GLN A HE22 2  
ATOM 2407  N N    . GLN A 1 40  ? -243.779 -7.030  105.550 1.00 0.00 ? 40  GLN A N    2  
ATOM 2408  C CA   . GLN A 1 40  ? -243.196 -7.585  104.342 1.00 0.00 ? 40  GLN A CA   2  
ATOM 2409  C C    . GLN A 1 40  ? -244.241 -8.282  103.481 1.00 0.00 ? 40  GLN A C    2  
ATOM 2410  O O    . GLN A 1 40  ? -244.125 -8.332  102.263 1.00 0.00 ? 40  GLN A O    2  
ATOM 2411  C CB   . GLN A 1 40  ? -242.075 -8.548  104.706 1.00 0.00 ? 40  GLN A CB   2  
ATOM 2412  C CG   . GLN A 1 40  ? -240.740 -7.856  104.871 1.00 0.00 ? 40  GLN A CG   2  
ATOM 2413  C CD   . GLN A 1 40  ? -240.406 -7.024  103.655 1.00 0.00 ? 40  GLN A CD   2  
ATOM 2414  O OE1  . GLN A 1 40  ? -239.668 -6.046  103.731 1.00 0.00 ? 40  GLN A OE1  2  
ATOM 2415  N NE2  . GLN A 1 40  ? -240.997 -7.396  102.531 1.00 0.00 ? 40  GLN A NE2  2  
ATOM 2416  H H    . GLN A 1 40  ? -243.404 -7.282  106.426 1.00 0.00 ? 40  GLN A H    2  
ATOM 2417  H HA   . GLN A 1 40  ? -242.771 -6.768  103.780 1.00 0.00 ? 40  GLN A HA   2  
ATOM 2418  H HB2  . GLN A 1 40  ? -242.321 -9.036  105.635 1.00 0.00 ? 40  GLN A HB2  2  
ATOM 2419  H HB3  . GLN A 1 40  ? -241.981 -9.290  103.928 1.00 0.00 ? 40  GLN A HB3  2  
ATOM 2420  H HG2  . GLN A 1 40  ? -240.781 -7.212  105.737 1.00 0.00 ? 40  GLN A HG2  2  
ATOM 2421  H HG3  . GLN A 1 40  ? -239.976 -8.600  105.006 1.00 0.00 ? 40  GLN A HG3  2  
ATOM 2422  H HE21 . GLN A 1 40  ? -241.597 -8.174  102.565 1.00 0.00 ? 40  GLN A HE21 2  
ATOM 2423  H HE22 . GLN A 1 40  ? -240.833 -6.880  101.729 1.00 0.00 ? 40  GLN A HE22 2  
ATOM 2424  N N    . ILE A 1 41  ? -245.252 -8.799  104.139 1.00 0.00 ? 41  ILE A N    2  
ATOM 2425  C CA   . ILE A 1 41  ? -246.368 -9.478  103.504 1.00 0.00 ? 41  ILE A CA   2  
ATOM 2426  C C    . ILE A 1 41  ? -247.337 -8.455  102.904 1.00 0.00 ? 41  ILE A C    2  
ATOM 2427  O O    . ILE A 1 41  ? -248.043 -8.714  101.931 1.00 0.00 ? 41  ILE A O    2  
ATOM 2428  C CB   . ILE A 1 41  ? -247.089 -10.344 104.562 1.00 0.00 ? 41  ILE A CB   2  
ATOM 2429  C CG1  . ILE A 1 41  ? -246.093 -11.284 105.261 1.00 0.00 ? 41  ILE A CG1  2  
ATOM 2430  C CG2  . ILE A 1 41  ? -248.230 -11.137 103.963 1.00 0.00 ? 41  ILE A CG2  2  
ATOM 2431  C CD1  . ILE A 1 41  ? -245.095 -11.958 104.332 1.00 0.00 ? 41  ILE A CD1  2  
ATOM 2432  H H    . ILE A 1 41  ? -245.248 -8.731  105.120 1.00 0.00 ? 41  ILE A H    2  
ATOM 2433  H HA   . ILE A 1 41  ? -245.987 -10.121 102.724 1.00 0.00 ? 41  ILE A HA   2  
ATOM 2434  H HB   . ILE A 1 41  ? -247.509 -9.671  105.303 1.00 0.00 ? 41  ILE A HB   2  
ATOM 2435  H HG12 . ILE A 1 41  ? -245.530 -10.719 105.990 1.00 0.00 ? 41  ILE A HG12 2  
ATOM 2436  H HG13 . ILE A 1 41  ? -246.646 -12.060 105.771 1.00 0.00 ? 41  ILE A HG13 2  
ATOM 2437  H HG21 . ILE A 1 41  ? -248.915 -10.464 103.472 1.00 0.00 ? 41  ILE A HG21 2  
ATOM 2438  H HG22 . ILE A 1 41  ? -247.841 -11.846 103.249 1.00 0.00 ? 41  ILE A HG22 2  
ATOM 2439  H HG23 . ILE A 1 41  ? -248.742 -11.662 104.756 1.00 0.00 ? 41  ILE A HG23 2  
ATOM 2440  H HD11 . ILE A 1 41  ? -244.627 -11.214 103.704 1.00 0.00 ? 41  ILE A HD11 2  
ATOM 2441  H HD12 . ILE A 1 41  ? -244.332 -12.455 104.918 1.00 0.00 ? 41  ILE A HD12 2  
ATOM 2442  H HD13 . ILE A 1 41  ? -245.603 -12.680 103.715 1.00 0.00 ? 41  ILE A HD13 2  
ATOM 2443  N N    . LEU A 1 42  ? -247.344 -7.293  103.522 1.00 0.00 ? 42  LEU A N    2  
ATOM 2444  C CA   . LEU A 1 42  ? -248.269 -6.213  103.216 1.00 0.00 ? 42  LEU A CA   2  
ATOM 2445  C C    . LEU A 1 42  ? -247.737 -5.267  102.148 1.00 0.00 ? 42  LEU A C    2  
ATOM 2446  O O    . LEU A 1 42  ? -248.486 -4.783  101.299 1.00 0.00 ? 42  LEU A O    2  
ATOM 2447  C CB   . LEU A 1 42  ? -248.474 -5.435  104.494 1.00 0.00 ? 42  LEU A CB   2  
ATOM 2448  C CG   . LEU A 1 42  ? -249.253 -6.202  105.545 1.00 0.00 ? 42  LEU A CG   2  
ATOM 2449  C CD1  . LEU A 1 42  ? -249.180 -5.494  106.857 1.00 0.00 ? 42  LEU A CD1  2  
ATOM 2450  C CD2  . LEU A 1 42  ? -250.691 -6.390  105.123 1.00 0.00 ? 42  LEU A CD2  2  
ATOM 2451  H H    . LEU A 1 42  ? -246.686 -7.148  104.234 1.00 0.00 ? 42  LEU A H    2  
ATOM 2452  H HA   . LEU A 1 42  ? -249.211 -6.628  102.919 1.00 0.00 ? 42  LEU A HA   2  
ATOM 2453  H HB2  . LEU A 1 42  ? -247.497 -5.178  104.887 1.00 0.00 ? 42  LEU A HB2  2  
ATOM 2454  H HB3  . LEU A 1 42  ? -248.987 -4.523  104.283 1.00 0.00 ? 42  LEU A HB3  2  
ATOM 2455  H HG   . LEU A 1 42  ? -248.810 -7.180  105.667 1.00 0.00 ? 42  LEU A HG   2  
ATOM 2456  H HD11 . LEU A 1 42  ? -249.582 -4.504  106.746 1.00 0.00 ? 42  LEU A HD11 2  
ATOM 2457  H HD12 . LEU A 1 42  ? -249.747 -6.045  107.588 1.00 0.00 ? 42  LEU A HD12 2  
ATOM 2458  H HD13 . LEU A 1 42  ? -248.149 -5.436  107.163 1.00 0.00 ? 42  LEU A HD13 2  
ATOM 2459  H HD21 . LEU A 1 42  ? -251.149 -5.425  104.975 1.00 0.00 ? 42  LEU A HD21 2  
ATOM 2460  H HD22 . LEU A 1 42  ? -250.723 -6.952  104.202 1.00 0.00 ? 42  LEU A HD22 2  
ATOM 2461  H HD23 . LEU A 1 42  ? -251.218 -6.928  105.895 1.00 0.00 ? 42  LEU A HD23 2  
ATOM 2462  N N    . THR A 1 43  ? -246.436 -5.017  102.245 1.00 0.00 ? 43  THR A N    2  
ATOM 2463  C CA   . THR A 1 43  ? -245.755 -3.917  101.602 1.00 0.00 ? 43  THR A CA   2  
ATOM 2464  C C    . THR A 1 43  ? -246.217 -3.683  100.180 1.00 0.00 ? 43  THR A C    2  
ATOM 2465  O O    . THR A 1 43  ? -246.060 -4.506  99.282  1.00 0.00 ? 43  THR A O    2  
ATOM 2466  C CB   . THR A 1 43  ? -244.217 -4.099  101.640 1.00 0.00 ? 43  THR A CB   2  
ATOM 2467  O OG1  . THR A 1 43  ? -243.573 -3.015  100.962 1.00 0.00 ? 43  THR A OG1  2  
ATOM 2468  C CG2  . THR A 1 43  ? -243.792 -5.418  101.011 1.00 0.00 ? 43  THR A CG2  2  
ATOM 2469  H H    . THR A 1 43  ? -245.904 -5.602  102.799 1.00 0.00 ? 43  THR A H    2  
ATOM 2470  H HA   . THR A 1 43  ? -245.990 -3.026  102.189 1.00 0.00 ? 43  THR A HA   2  
ATOM 2471  H HB   . THR A 1 43  ? -243.901 -4.097  102.673 1.00 0.00 ? 43  THR A HB   2  
ATOM 2472  H HG1  . THR A 1 43  ? -243.169 -3.344  100.148 1.00 0.00 ? 43  THR A HG1  2  
ATOM 2473  H HG21 . THR A 1 43  ? -244.139 -5.457  99.989  1.00 0.00 ? 43  THR A HG21 2  
ATOM 2474  H HG22 . THR A 1 43  ? -242.714 -5.495  101.030 1.00 0.00 ? 43  THR A HG22 2  
ATOM 2475  H HG23 . THR A 1 43  ? -244.221 -6.238  101.569 1.00 0.00 ? 43  THR A HG23 2  
ATOM 2476  N N    . ASN A 1 44  ? -246.829 -2.542  100.024 1.00 0.00 ? 44  ASN A N    2  
ATOM 2477  C CA   . ASN A 1 44  ? -247.204 -2.030  98.714  1.00 0.00 ? 44  ASN A CA   2  
ATOM 2478  C C    . ASN A 1 44  ? -245.978 -1.476  98.012  1.00 0.00 ? 44  ASN A C    2  
ATOM 2479  O O    . ASN A 1 44  ? -246.024 -1.123  96.836  1.00 0.00 ? 44  ASN A O    2  
ATOM 2480  C CB   . ASN A 1 44  ? -248.270 -0.947  98.836  1.00 0.00 ? 44  ASN A CB   2  
ATOM 2481  C CG   . ASN A 1 44  ? -249.627 -1.500  99.237  1.00 0.00 ? 44  ASN A CG   2  
ATOM 2482  O OD1  . ASN A 1 44  ? -250.429 -0.812  99.861  1.00 0.00 ? 44  ASN A OD1  2  
ATOM 2483  N ND2  . ASN A 1 44  ? -249.889 -2.752  98.890  1.00 0.00 ? 44  ASN A ND2  2  
ATOM 2484  H H    . ASN A 1 44  ? -247.042 -2.036  100.827 1.00 0.00 ? 44  ASN A H    2  
ATOM 2485  H HA   . ASN A 1 44  ? -247.597 -2.853  98.135  1.00 0.00 ? 44  ASN A HA   2  
ATOM 2486  H HB2  . ASN A 1 44  ? -247.954 -0.235  99.584  1.00 0.00 ? 44  ASN A HB2  2  
ATOM 2487  H HB3  . ASN A 1 44  ? -248.372 -0.445  97.886  1.00 0.00 ? 44  ASN A HB3  2  
ATOM 2488  H HD21 . ASN A 1 44  ? -249.202 -3.253  98.399  1.00 0.00 ? 44  ASN A HD21 2  
ATOM 2489  H HD22 . ASN A 1 44  ? -250.756 -3.129  99.142  1.00 0.00 ? 44  ASN A HD22 2  
ATOM 2490  N N    . GLU A 1 45  ? -244.900 -1.362  98.782  1.00 0.00 ? 45  GLU A N    2  
ATOM 2491  C CA   . GLU A 1 45  ? -243.578 -1.058  98.255  1.00 0.00 ? 45  GLU A CA   2  
ATOM 2492  C C    . GLU A 1 45  ? -243.494 0.336   97.633  1.00 0.00 ? 45  GLU A C    2  
ATOM 2493  O O    . GLU A 1 45  ? -242.668 0.589   96.762  1.00 0.00 ? 45  GLU A O    2  
ATOM 2494  C CB   . GLU A 1 45  ? -243.172 -2.138  97.258  1.00 0.00 ? 45  GLU A CB   2  
ATOM 2495  C CG   . GLU A 1 45  ? -242.632 -3.398  97.922  1.00 0.00 ? 45  GLU A CG   2  
ATOM 2496  C CD   . GLU A 1 45  ? -242.089 -4.411  96.929  1.00 0.00 ? 45  GLU A CD   2  
ATOM 2497  O OE1  . GLU A 1 45  ? -240.882 -4.342  96.614  1.00 0.00 ? 45  GLU A OE1  2  
ATOM 2498  O OE2  . GLU A 1 45  ? -242.862 -5.285  96.484  1.00 0.00 ? 45  GLU A OE2  2  
ATOM 2499  H H    . GLU A 1 45  ? -244.999 -1.502  99.743  1.00 0.00 ? 45  GLU A H    2  
ATOM 2500  H HA   . GLU A 1 45  ? -242.891 -1.092  99.086  1.00 0.00 ? 45  GLU A HA   2  
ATOM 2501  H HB2  . GLU A 1 45  ? -244.047 -2.411  96.686  1.00 0.00 ? 45  GLU A HB2  2  
ATOM 2502  H HB3  . GLU A 1 45  ? -242.420 -1.744  96.599  1.00 0.00 ? 45  GLU A HB3  2  
ATOM 2503  H HG2  . GLU A 1 45  ? -241.835 -3.120  98.594  1.00 0.00 ? 45  GLU A HG2  2  
ATOM 2504  H HG3  . GLU A 1 45  ? -243.430 -3.861  98.485  1.00 0.00 ? 45  GLU A HG3  2  
ATOM 2505  N N    . GLN A 1 46  ? -244.347 1.243   98.100  1.00 0.00 ? 46  GLN A N    2  
ATOM 2506  C CA   . GLN A 1 46  ? -244.205 2.655   97.783  1.00 0.00 ? 46  GLN A CA   2  
ATOM 2507  C C    . GLN A 1 46  ? -242.988 3.190   98.496  1.00 0.00 ? 46  GLN A C    2  
ATOM 2508  O O    . GLN A 1 46  ? -241.851 3.052   98.053  1.00 0.00 ? 46  GLN A O    2  
ATOM 2509  C CB   . GLN A 1 46  ? -245.446 3.423   98.235  1.00 0.00 ? 46  GLN A CB   2  
ATOM 2510  C CG   . GLN A 1 46  ? -246.749 2.843   97.725  1.00 0.00 ? 46  GLN A CG   2  
ATOM 2511  C CD   . GLN A 1 46  ? -247.952 3.664   98.145  1.00 0.00 ? 46  GLN A CD   2  
ATOM 2512  O OE1  . GLN A 1 46  ? -248.363 4.583   97.441  1.00 0.00 ? 46  GLN A OE1  2  
ATOM 2513  N NE2  . GLN A 1 46  ? -248.522 3.343   99.297  1.00 0.00 ? 46  GLN A NE2  2  
ATOM 2514  H H    . GLN A 1 46  ? -245.094 0.954   98.656  1.00 0.00 ? 46  GLN A H    2  
ATOM 2515  H HA   . GLN A 1 46  ? -244.072 2.770   96.742  1.00 0.00 ? 46  GLN A HA   2  
ATOM 2516  H HB2  . GLN A 1 46  ? -245.479 3.426   99.314  1.00 0.00 ? 46  GLN A HB2  2  
ATOM 2517  H HB3  . GLN A 1 46  ? -245.367 4.435   97.887  1.00 0.00 ? 46  GLN A HB3  2  
ATOM 2518  H HG2  . GLN A 1 46  ? -246.713 2.805   96.648  1.00 0.00 ? 46  GLN A HG2  2  
ATOM 2519  H HG3  . GLN A 1 46  ? -246.856 1.846   98.120  1.00 0.00 ? 46  GLN A HG3  2  
ATOM 2520  H HE21 . GLN A 1 46  ? -248.145 2.599   99.816  1.00 0.00 ? 46  GLN A HE21 2  
ATOM 2521  H HE22 . GLN A 1 46  ? -249.303 3.859   99.582  1.00 0.00 ? 46  GLN A HE22 2  
ATOM 2522  N N    . ASP A 1 47  ? -243.266 3.791   99.612  1.00 0.00 ? 47  ASP A N    2  
ATOM 2523  C CA   . ASP A 1 47  ? -242.288 3.981   100.655 1.00 0.00 ? 47  ASP A CA   2  
ATOM 2524  C C    . ASP A 1 47  ? -242.437 2.805   101.612 1.00 0.00 ? 47  ASP A C    2  
ATOM 2525  O O    . ASP A 1 47  ? -242.061 2.867   102.779 1.00 0.00 ? 47  ASP A O    2  
ATOM 2526  C CB   . ASP A 1 47  ? -242.508 5.312   101.370 1.00 0.00 ? 47  ASP A CB   2  
ATOM 2527  C CG   . ASP A 1 47  ? -243.854 5.401   102.054 1.00 0.00 ? 47  ASP A CG   2  
ATOM 2528  O OD1  . ASP A 1 47  ? -244.844 5.763   101.387 1.00 0.00 ? 47  ASP A OD1  2  
ATOM 2529  O OD2  . ASP A 1 47  ? -243.932 5.128   103.268 1.00 0.00 ? 47  ASP A OD2  2  
ATOM 2530  H H    . ASP A 1 47  ? -244.168 4.133   99.735  1.00 0.00 ? 47  ASP A H    2  
ATOM 2531  H HA   . ASP A 1 47  ? -241.302 3.960   100.209 1.00 0.00 ? 47  ASP A HA   2  
ATOM 2532  H HB2  . ASP A 1 47  ? -241.748 5.432   102.113 1.00 0.00 ? 47  ASP A HB2  2  
ATOM 2533  H HB3  . ASP A 1 47  ? -242.435 6.115   100.653 1.00 0.00 ? 47  ASP A HB3  2  
ATOM 2534  N N    . ILE A 1 48  ? -243.007 1.733   101.040 1.00 0.00 ? 48  ILE A N    2  
ATOM 2535  C CA   . ILE A 1 48  ? -243.289 0.467   101.703 1.00 0.00 ? 48  ILE A CA   2  
ATOM 2536  C C    . ILE A 1 48  ? -244.715 0.392   102.202 1.00 0.00 ? 48  ILE A C    2  
ATOM 2537  O O    . ILE A 1 48  ? -245.402 -0.604  101.984 1.00 0.00 ? 48  ILE A O    2  
ATOM 2538  C CB   . ILE A 1 48  ? -242.299 0.133   102.837 1.00 0.00 ? 48  ILE A CB   2  
ATOM 2539  C CG1  . ILE A 1 48  ? -240.916 -0.192  102.261 1.00 0.00 ? 48  ILE A CG1  2  
ATOM 2540  C CG2  . ILE A 1 48  ? -242.818 -1.023  103.681 1.00 0.00 ? 48  ILE A CG2  2  
ATOM 2541  C CD1  . ILE A 1 48  ? -239.867 -0.476  103.316 1.00 0.00 ? 48  ILE A CD1  2  
ATOM 2542  H H    . ILE A 1 48  ? -243.251 1.808   100.101 1.00 0.00 ? 48  ILE A H    2  
ATOM 2543  H HA   . ILE A 1 48  ? -243.191 -0.277  100.961 1.00 0.00 ? 48  ILE A HA   2  
ATOM 2544  H HB   . ILE A 1 48  ? -242.221 1.004   103.465 1.00 0.00 ? 48  ILE A HB   2  
ATOM 2545  H HG12 . ILE A 1 48  ? -240.992 -1.064  101.630 1.00 0.00 ? 48  ILE A HG12 2  
ATOM 2546  H HG13 . ILE A 1 48  ? -240.574 0.645   101.670 1.00 0.00 ? 48  ILE A HG13 2  
ATOM 2547  H HG21 . ILE A 1 48  ? -242.962 -1.889  103.052 1.00 0.00 ? 48  ILE A HG21 2  
ATOM 2548  H HG22 . ILE A 1 48  ? -242.105 -1.253  104.457 1.00 0.00 ? 48  ILE A HG22 2  
ATOM 2549  H HG23 . ILE A 1 48  ? -243.762 -0.744  104.128 1.00 0.00 ? 48  ILE A HG23 2  
ATOM 2550  H HD11 . ILE A 1 48  ? -239.768 0.381   103.965 1.00 0.00 ? 48  ILE A HD11 2  
ATOM 2551  H HD12 . ILE A 1 48  ? -240.165 -1.337  103.898 1.00 0.00 ? 48  ILE A HD12 2  
ATOM 2552  H HD13 . ILE A 1 48  ? -238.920 -0.677  102.837 1.00 0.00 ? 48  ILE A HD13 2  
ATOM 2553  N N    . LYS A 1 49  ? -245.153 1.478   102.784 1.00 0.00 ? 49  LYS A N    2  
ATOM 2554  C CA   . LYS A 1 49  ? -246.417 1.540   103.521 1.00 0.00 ? 49  LYS A CA   2  
ATOM 2555  C C    . LYS A 1 49  ? -247.627 1.062   102.703 1.00 0.00 ? 49  LYS A C    2  
ATOM 2556  O O    . LYS A 1 49  ? -248.022 1.674   101.708 1.00 0.00 ? 49  LYS A O    2  
ATOM 2557  C CB   . LYS A 1 49  ? -246.678 2.961   104.041 1.00 0.00 ? 49  LYS A CB   2  
ATOM 2558  C CG   . LYS A 1 49  ? -246.955 3.989   102.953 1.00 0.00 ? 49  LYS A CG   2  
ATOM 2559  C CD   . LYS A 1 49  ? -247.802 5.146   103.468 1.00 0.00 ? 49  LYS A CD   2  
ATOM 2560  C CE   . LYS A 1 49  ? -247.061 5.991   104.490 1.00 0.00 ? 49  LYS A CE   2  
ATOM 2561  N NZ   . LYS A 1 49  ? -245.885 6.673   103.894 1.00 0.00 ? 49  LYS A NZ   2  
ATOM 2562  H H    . LYS A 1 49  ? -244.599 2.267   102.721 1.00 0.00 ? 49  LYS A H    2  
ATOM 2563  H HA   . LYS A 1 49  ? -246.314 0.886   104.373 1.00 0.00 ? 49  LYS A HA   2  
ATOM 2564  H HB2  . LYS A 1 49  ? -247.524 2.931   104.699 1.00 0.00 ? 49  LYS A HB2  2  
ATOM 2565  H HB3  . LYS A 1 49  ? -245.813 3.287   104.600 1.00 0.00 ? 49  LYS A HB3  2  
ATOM 2566  H HG2  . LYS A 1 49  ? -246.015 4.379   102.596 1.00 0.00 ? 49  LYS A HG2  2  
ATOM 2567  H HG3  . LYS A 1 49  ? -247.478 3.505   102.142 1.00 0.00 ? 49  LYS A HG3  2  
ATOM 2568  H HD2  . LYS A 1 49  ? -248.077 5.773   102.634 1.00 0.00 ? 49  LYS A HD2  2  
ATOM 2569  H HD3  . LYS A 1 49  ? -248.696 4.745   103.925 1.00 0.00 ? 49  LYS A HD3  2  
ATOM 2570  H HE2  . LYS A 1 49  ? -247.738 6.736   104.881 1.00 0.00 ? 49  LYS A HE2  2  
ATOM 2571  H HE3  . LYS A 1 49  ? -246.728 5.352   105.295 1.00 0.00 ? 49  LYS A HE3  2  
ATOM 2572  H HZ1  . LYS A 1 49  ? -246.163 7.181   103.032 1.00 0.00 ? 49  LYS A HZ1  2  
ATOM 2573  H HZ2  . LYS A 1 49  ? -245.475 7.346   104.565 1.00 0.00 ? 49  LYS A HZ2  2  
ATOM 2574  H HZ3  . LYS A 1 49  ? -245.153 5.964   103.637 1.00 0.00 ? 49  LYS A HZ3  2  
ATOM 2575  N N    . PRO A 1 50  ? -248.171 -0.100  103.077 1.00 0.00 ? 50  PRO A N    2  
ATOM 2576  C CA   . PRO A 1 50  ? -249.502 -0.548  102.655 1.00 0.00 ? 50  PRO A CA   2  
ATOM 2577  C C    . PRO A 1 50  ? -250.638 0.143   103.383 1.00 0.00 ? 50  PRO A C    2  
ATOM 2578  O O    . PRO A 1 50  ? -250.537 1.281   103.840 1.00 0.00 ? 50  PRO A O    2  
ATOM 2579  C CB   . PRO A 1 50  ? -249.528 -2.010  103.100 1.00 0.00 ? 50  PRO A CB   2  
ATOM 2580  C CG   . PRO A 1 50  ? -248.130 -2.369  103.315 1.00 0.00 ? 50  PRO A CG   2  
ATOM 2581  C CD   . PRO A 1 50  ? -247.495 -1.144  103.846 1.00 0.00 ? 50  PRO A CD   2  
ATOM 2582  H HA   . PRO A 1 50  ? -249.642 -0.485  101.589 1.00 0.00 ? 50  PRO A HA   2  
ATOM 2583  H HB2  . PRO A 1 50  ? -250.099 -2.099  104.012 1.00 0.00 ? 50  PRO A HB2  2  
ATOM 2584  H HB3  . PRO A 1 50  ? -249.969 -2.609  102.349 1.00 0.00 ? 50  PRO A HB3  2  
ATOM 2585  H HG2  . PRO A 1 50  ? -248.071 -3.172  104.030 1.00 0.00 ? 50  PRO A HG2  2  
ATOM 2586  H HG3  . PRO A 1 50  ? -247.688 -2.653  102.379 1.00 0.00 ? 50  PRO A HG3  2  
ATOM 2587  H HD2  . PRO A 1 50  ? -247.696 -1.063  104.876 1.00 0.00 ? 50  PRO A HD2  2  
ATOM 2588  H HD3  . PRO A 1 50  ? -246.432 -1.144  103.655 1.00 0.00 ? 50  PRO A HD3  2  
ATOM 2589  N N    . VAL A 1 51  ? -251.714 -0.614  103.497 1.00 0.00 ? 51  VAL A N    2  
ATOM 2590  C CA   . VAL A 1 51  ? -252.857 -0.260  104.318 1.00 0.00 ? 51  VAL A CA   2  
ATOM 2591  C C    . VAL A 1 51  ? -252.992 -1.341  105.378 1.00 0.00 ? 51  VAL A C    2  
ATOM 2592  O O    . VAL A 1 51  ? -253.795 -2.266  105.257 1.00 0.00 ? 51  VAL A O    2  
ATOM 2593  C CB   . VAL A 1 51  ? -254.170 -0.166  103.511 1.00 0.00 ? 51  VAL A CB   2  
ATOM 2594  C CG1  . VAL A 1 51  ? -255.283 0.421   104.366 1.00 0.00 ? 51  VAL A CG1  2  
ATOM 2595  C CG2  . VAL A 1 51  ? -253.975 0.655   102.242 1.00 0.00 ? 51  VAL A CG2  2  
ATOM 2596  H H    . VAL A 1 51  ? -251.715 -1.479  103.029 1.00 0.00 ? 51  VAL A H    2  
ATOM 2597  H HA   . VAL A 1 51  ? -252.660 0.691   104.794 1.00 0.00 ? 51  VAL A HA   2  
ATOM 2598  H HB   . VAL A 1 51  ? -254.460 -1.169  103.229 1.00 0.00 ? 51  VAL A HB   2  
ATOM 2599  H HG11 . VAL A 1 51  ? -254.988 1.396   104.723 1.00 0.00 ? 51  VAL A HG11 2  
ATOM 2600  H HG12 . VAL A 1 51  ? -256.183 0.511   103.775 1.00 0.00 ? 51  VAL A HG12 2  
ATOM 2601  H HG13 . VAL A 1 51  ? -255.470 -0.228  105.209 1.00 0.00 ? 51  VAL A HG13 2  
ATOM 2602  H HG21 . VAL A 1 51  ? -253.621 1.642   102.503 1.00 0.00 ? 51  VAL A HG21 2  
ATOM 2603  H HG22 . VAL A 1 51  ? -253.249 0.169   101.607 1.00 0.00 ? 51  VAL A HG22 2  
ATOM 2604  H HG23 . VAL A 1 51  ? -254.915 0.738   101.718 1.00 0.00 ? 51  VAL A HG23 2  
ATOM 2605  N N    . THR A 1 52  ? -252.146 -1.246  106.382 1.00 0.00 ? 52  THR A N    2  
ATOM 2606  C CA   . THR A 1 52  ? -251.959 -2.318  107.328 1.00 0.00 ? 52  THR A CA   2  
ATOM 2607  C C    . THR A 1 52  ? -253.095 -2.383  108.344 1.00 0.00 ? 52  THR A C    2  
ATOM 2608  O O    . THR A 1 52  ? -253.173 -1.571  109.266 1.00 0.00 ? 52  THR A O    2  
ATOM 2609  C CB   . THR A 1 52  ? -250.600 -2.137  108.016 1.00 0.00 ? 52  THR A CB   2  
ATOM 2610  O OG1  . THR A 1 52  ? -250.546 -0.855  108.652 1.00 0.00 ? 52  THR A OG1  2  
ATOM 2611  C CG2  . THR A 1 52  ? -249.486 -2.234  106.981 1.00 0.00 ? 52  THR A CG2  2  
ATOM 2612  H H    . THR A 1 52  ? -251.627 -0.423  106.497 1.00 0.00 ? 52  THR A H    2  
ATOM 2613  H HA   . THR A 1 52  ? -251.932 -3.246  106.776 1.00 0.00 ? 52  THR A HA   2  
ATOM 2614  H HB   . THR A 1 52  ? -250.468 -2.913  108.750 1.00 0.00 ? 52  THR A HB   2  
ATOM 2615  H HG1  . THR A 1 52  ? -251.291 -0.770  109.262 1.00 0.00 ? 52  THR A HG1  2  
ATOM 2616  H HG21 . THR A 1 52  ? -249.573 -3.172  106.446 1.00 0.00 ? 52  THR A HG21 2  
ATOM 2617  H HG22 . THR A 1 52  ? -249.574 -1.418  106.277 1.00 0.00 ? 52  THR A HG22 2  
ATOM 2618  H HG23 . THR A 1 52  ? -248.525 -2.187  107.473 1.00 0.00 ? 52  THR A HG23 2  
ATOM 2619  N N    . THR A 1 53  ? -253.988 -3.344  108.143 1.00 0.00 ? 53  THR A N    2  
ATOM 2620  C CA   . THR A 1 53  ? -255.170 -3.484  108.971 1.00 0.00 ? 53  THR A CA   2  
ATOM 2621  C C    . THR A 1 53  ? -255.114 -4.763  109.818 1.00 0.00 ? 53  THR A C    2  
ATOM 2622  O O    . THR A 1 53  ? -254.034 -5.240  110.163 1.00 0.00 ? 53  THR A O    2  
ATOM 2623  C CB   . THR A 1 53  ? -256.440 -3.437  108.071 1.00 0.00 ? 53  THR A CB   2  
ATOM 2624  O OG1  . THR A 1 53  ? -257.645 -3.460  108.846 1.00 0.00 ? 53  THR A OG1  2  
ATOM 2625  C CG2  . THR A 1 53  ? -256.463 -4.590  107.076 1.00 0.00 ? 53  THR A CG2  2  
ATOM 2626  H H    . THR A 1 53  ? -253.857 -3.969  107.403 1.00 0.00 ? 53  THR A H    2  
ATOM 2627  H HA   . THR A 1 53  ? -255.203 -2.648  109.639 1.00 0.00 ? 53  THR A HA   2  
ATOM 2628  H HB   . THR A 1 53  ? -256.415 -2.514  107.509 1.00 0.00 ? 53  THR A HB   2  
ATOM 2629  H HG1  . THR A 1 53  ? -257.515 -2.987  109.678 1.00 0.00 ? 53  THR A HG1  2  
ATOM 2630  H HG21 . THR A 1 53  ? -256.453 -5.530  107.611 1.00 0.00 ? 53  THR A HG21 2  
ATOM 2631  H HG22 . THR A 1 53  ? -257.357 -4.529  106.473 1.00 0.00 ? 53  THR A HG22 2  
ATOM 2632  H HG23 . THR A 1 53  ? -255.594 -4.533  106.439 1.00 0.00 ? 53  THR A HG23 2  
ATOM 2633  N N    . ASP A 1 54  ? -256.291 -5.289  110.126 1.00 0.00 ? 54  ASP A N    2  
ATOM 2634  C CA   . ASP A 1 54  ? -256.510 -6.425  111.038 1.00 0.00 ? 54  ASP A CA   2  
ATOM 2635  C C    . ASP A 1 54  ? -255.834 -7.720  110.605 1.00 0.00 ? 54  ASP A C    2  
ATOM 2636  O O    . ASP A 1 54  ? -256.068 -8.773  111.187 1.00 0.00 ? 54  ASP A O    2  
ATOM 2637  C CB   . ASP A 1 54  ? -257.997 -6.682  111.097 1.00 0.00 ? 54  ASP A CB   2  
ATOM 2638  C CG   . ASP A 1 54  ? -258.742 -5.642  111.904 1.00 0.00 ? 54  ASP A CG   2  
ATOM 2639  O OD1  . ASP A 1 54  ? -258.997 -4.546  111.365 1.00 0.00 ? 54  ASP A OD1  2  
ATOM 2640  O OD2  . ASP A 1 54  ? -259.071 -5.922  113.076 1.00 0.00 ? 54  ASP A OD2  2  
ATOM 2641  H H    . ASP A 1 54  ? -257.086 -4.883  109.711 1.00 0.00 ? 54  ASP A H    2  
ATOM 2642  H HA   . ASP A 1 54  ? -256.167 -6.155  112.027 1.00 0.00 ? 54  ASP A HA   2  
ATOM 2643  H HB2  . ASP A 1 54  ? -258.380 -6.678  110.089 1.00 0.00 ? 54  ASP A HB2  2  
ATOM 2644  H HB3  . ASP A 1 54  ? -258.160 -7.650  111.535 1.00 0.00 ? 54  ASP A HB3  2  
ATOM 2645  N N    . TYR A 1 55  ? -255.033 -7.650  109.586 1.00 0.00 ? 55  TYR A N    2  
ATOM 2646  C CA   . TYR A 1 55  ? -254.350 -8.829  109.068 1.00 0.00 ? 55  TYR A CA   2  
ATOM 2647  C C    . TYR A 1 55  ? -253.342 -9.395  110.067 1.00 0.00 ? 55  TYR A C    2  
ATOM 2648  O O    . TYR A 1 55  ? -252.734 -8.661  110.843 1.00 0.00 ? 55  TYR A O    2  
ATOM 2649  C CB   . TYR A 1 55  ? -253.609 -8.488  107.792 1.00 0.00 ? 55  TYR A CB   2  
ATOM 2650  C CG   . TYR A 1 55  ? -254.480 -8.092  106.635 1.00 0.00 ? 55  TYR A CG   2  
ATOM 2651  C CD1  . TYR A 1 55  ? -255.648 -8.773  106.355 1.00 0.00 ? 55  TYR A CD1  2  
ATOM 2652  C CD2  . TYR A 1 55  ? -254.117 -7.036  105.813 1.00 0.00 ? 55  TYR A CD2  2  
ATOM 2653  C CE1  . TYR A 1 55  ? -256.439 -8.418  105.287 1.00 0.00 ? 55  TYR A CE1  2  
ATOM 2654  C CE2  . TYR A 1 55  ? -254.898 -6.669  104.741 1.00 0.00 ? 55  TYR A CE2  2  
ATOM 2655  C CZ   . TYR A 1 55  ? -256.063 -7.363  104.479 1.00 0.00 ? 55  TYR A CZ   2  
ATOM 2656  O OH   . TYR A 1 55  ? -256.850 -7.003  103.412 1.00 0.00 ? 55  TYR A OH   2  
ATOM 2657  H H    . TYR A 1 55  ? -254.891 -6.777  109.168 1.00 0.00 ? 55  TYR A H    2  
ATOM 2658  H HA   . TYR A 1 55  ? -255.094 -9.581  108.852 1.00 0.00 ? 55  TYR A HA   2  
ATOM 2659  H HB2  . TYR A 1 55  ? -252.965 -7.666  107.999 1.00 0.00 ? 55  TYR A HB2  2  
ATOM 2660  H HB3  . TYR A 1 55  ? -253.019 -9.334  107.492 1.00 0.00 ? 55  TYR A HB3  2  
ATOM 2661  H HD1  . TYR A 1 55  ? -255.940 -9.598  106.991 1.00 0.00 ? 55  TYR A HD1  2  
ATOM 2662  H HD2  . TYR A 1 55  ? -253.204 -6.498  106.022 1.00 0.00 ? 55  TYR A HD2  2  
ATOM 2663  H HE1  . TYR A 1 55  ? -257.347 -8.964  105.091 1.00 0.00 ? 55  TYR A HE1  2  
ATOM 2664  H HE2  . TYR A 1 55  ? -254.595 -5.843  104.115 1.00 0.00 ? 55  TYR A HE2  2  
ATOM 2665  H HH   . TYR A 1 55  ? -257.776 -7.057  103.663 1.00 0.00 ? 55  TYR A HH   2  
ATOM 2666  N N    . PHE A 1 56  ? -253.178 -10.709 110.021 1.00 0.00 ? 56  PHE A N    2  
ATOM 2667  C CA   . PHE A 1 56  ? -252.153 -11.410 110.788 1.00 0.00 ? 56  PHE A CA   2  
ATOM 2668  C C    . PHE A 1 56  ? -251.853 -12.727 110.095 1.00 0.00 ? 56  PHE A C    2  
ATOM 2669  O O    . PHE A 1 56  ? -252.406 -13.004 109.044 1.00 0.00 ? 56  PHE A O    2  
ATOM 2670  C CB   . PHE A 1 56  ? -252.583 -11.645 112.248 1.00 0.00 ? 56  PHE A CB   2  
ATOM 2671  C CG   . PHE A 1 56  ? -253.948 -12.253 112.396 1.00 0.00 ? 56  PHE A CG   2  
ATOM 2672  C CD1  . PHE A 1 56  ? -255.065 -11.442 112.382 1.00 0.00 ? 56  PHE A CD1  2  
ATOM 2673  C CD2  . PHE A 1 56  ? -254.118 -13.626 112.537 1.00 0.00 ? 56  PHE A CD2  2  
ATOM 2674  C CE1  . PHE A 1 56  ? -256.328 -11.971 112.504 1.00 0.00 ? 56  PHE A CE1  2  
ATOM 2675  C CE2  . PHE A 1 56  ? -255.392 -14.165 112.656 1.00 0.00 ? 56  PHE A CE2  2  
ATOM 2676  C CZ   . PHE A 1 56  ? -256.499 -13.326 112.638 1.00 0.00 ? 56  PHE A CZ   2  
ATOM 2677  H H    . PHE A 1 56  ? -253.769 -11.237 109.436 1.00 0.00 ? 56  PHE A H    2  
ATOM 2678  H HA   . PHE A 1 56  ? -251.259 -10.801 110.775 1.00 0.00 ? 56  PHE A HA   2  
ATOM 2679  H HB2  . PHE A 1 56  ? -251.874 -12.308 112.720 1.00 0.00 ? 56  PHE A HB2  2  
ATOM 2680  H HB3  . PHE A 1 56  ? -252.582 -10.700 112.770 1.00 0.00 ? 56  PHE A HB3  2  
ATOM 2681  H HD1  . PHE A 1 56  ? -254.940 -10.374 112.278 1.00 0.00 ? 56  PHE A HD1  2  
ATOM 2682  H HD2  . PHE A 1 56  ? -253.244 -14.276 112.554 1.00 0.00 ? 56  PHE A HD2  2  
ATOM 2683  H HE1  . PHE A 1 56  ? -257.187 -11.317 112.492 1.00 0.00 ? 56  PHE A HE1  2  
ATOM 2684  H HE2  . PHE A 1 56  ? -255.522 -15.236 112.763 1.00 0.00 ? 56  PHE A HE2  2  
ATOM 2685  H HZ   . PHE A 1 56  ? -257.501 -13.729 112.722 1.00 0.00 ? 56  PHE A HZ   2  
ATOM 2686  N N    . LEU A 1 57  ? -250.983 -13.533 110.662 1.00 0.00 ? 57  LEU A N    2  
ATOM 2687  C CA   . LEU A 1 57  ? -250.611 -14.800 110.042 1.00 0.00 ? 57  LEU A CA   2  
ATOM 2688  C C    . LEU A 1 57  ? -251.305 -15.909 110.803 1.00 0.00 ? 57  LEU A C    2  
ATOM 2689  O O    . LEU A 1 57  ? -251.832 -15.669 111.883 1.00 0.00 ? 57  LEU A O    2  
ATOM 2690  C CB   . LEU A 1 57  ? -249.086 -15.023 110.057 1.00 0.00 ? 57  LEU A CB   2  
ATOM 2691  C CG   . LEU A 1 57  ? -248.225 -14.005 109.291 1.00 0.00 ? 57  LEU A CG   2  
ATOM 2692  C CD1  . LEU A 1 57  ? -248.509 -12.604 109.777 1.00 0.00 ? 57  LEU A CD1  2  
ATOM 2693  C CD2  . LEU A 1 57  ? -246.748 -14.317 109.460 1.00 0.00 ? 57  LEU A CD2  2  
ATOM 2694  H H    . LEU A 1 57  ? -250.586 -13.285 111.524 1.00 0.00 ? 57  LEU A H    2  
ATOM 2695  H HA   . LEU A 1 57  ? -250.963 -14.797 109.021 1.00 0.00 ? 57  LEU A HA   2  
ATOM 2696  H HB2  . LEU A 1 57  ? -248.762 -15.022 111.086 1.00 0.00 ? 57  LEU A HB2  2  
ATOM 2697  H HB3  . LEU A 1 57  ? -248.890 -16.001 109.644 1.00 0.00 ? 57  LEU A HB3  2  
ATOM 2698  H HG   . LEU A 1 57  ? -248.464 -14.054 108.239 1.00 0.00 ? 57  LEU A HG   2  
ATOM 2699  H HD11 . LEU A 1 57  ? -248.529 -12.608 110.865 1.00 0.00 ? 57  LEU A HD11 2  
ATOM 2700  H HD12 . LEU A 1 57  ? -247.747 -11.930 109.422 1.00 0.00 ? 57  LEU A HD12 2  
ATOM 2701  H HD13 . LEU A 1 57  ? -249.483 -12.299 109.402 1.00 0.00 ? 57  LEU A HD13 2  
ATOM 2702  H HD21 . LEU A 1 57  ? -246.553 -15.331 109.143 1.00 0.00 ? 57  LEU A HD21 2  
ATOM 2703  H HD22 . LEU A 1 57  ? -246.165 -13.634 108.858 1.00 0.00 ? 57  LEU A HD22 2  
ATOM 2704  H HD23 . LEU A 1 57  ? -246.470 -14.201 110.500 1.00 0.00 ? 57  LEU A HD23 2  
ATOM 2705  N N    . MET A 1 58  ? -251.325 -17.104 110.253 1.00 0.00 ? 58  MET A N    2  
ATOM 2706  C CA   . MET A 1 58  ? -251.940 -18.230 110.934 1.00 0.00 ? 58  MET A CA   2  
ATOM 2707  C C    . MET A 1 58  ? -251.478 -19.545 110.354 1.00 0.00 ? 58  MET A C    2  
ATOM 2708  O O    . MET A 1 58  ? -251.111 -19.621 109.182 1.00 0.00 ? 58  MET A O    2  
ATOM 2709  C CB   . MET A 1 58  ? -253.462 -18.162 110.848 1.00 0.00 ? 58  MET A CB   2  
ATOM 2710  C CG   . MET A 1 58  ? -254.123 -17.539 112.065 1.00 0.00 ? 58  MET A CG   2  
ATOM 2711  S SD   . MET A 1 58  ? -255.904 -17.778 112.074 1.00 0.00 ? 58  MET A SD   2  
ATOM 2712  C CE   . MET A 1 58  ? -255.959 -19.520 111.684 1.00 0.00 ? 58  MET A CE   2  
ATOM 2713  H H    . MET A 1 58  ? -250.924 -17.236 109.368 1.00 0.00 ? 58  MET A H    2  
ATOM 2714  H HA   . MET A 1 58  ? -251.647 -18.187 111.972 1.00 0.00 ? 58  MET A HA   2  
ATOM 2715  H HB2  . MET A 1 58  ? -253.737 -17.580 109.981 1.00 0.00 ? 58  MET A HB2  2  
ATOM 2716  H HB3  . MET A 1 58  ? -253.844 -19.165 110.732 1.00 0.00 ? 58  MET A HB3  2  
ATOM 2717  H HG2  . MET A 1 58  ? -253.709 -17.991 112.955 1.00 0.00 ? 58  MET A HG2  2  
ATOM 2718  H HG3  . MET A 1 58  ? -253.914 -16.480 112.069 1.00 0.00 ? 58  MET A HG3  2  
ATOM 2719  H HE1  . MET A 1 58  ? -255.322 -20.059 112.371 1.00 0.00 ? 58  MET A HE1  2  
ATOM 2720  H HE2  . MET A 1 58  ? -256.973 -19.878 111.767 1.00 0.00 ? 58  MET A HE2  2  
ATOM 2721  H HE3  . MET A 1 58  ? -255.605 -19.665 110.668 1.00 0.00 ? 58  MET A HE3  2  
ATOM 2722  N N    . GLU A 1 59  ? -251.503 -20.573 111.183 1.00 0.00 ? 59  GLU A N    2  
ATOM 2723  C CA   . GLU A 1 59  ? -251.207 -21.918 110.741 1.00 0.00 ? 59  GLU A CA   2  
ATOM 2724  C C    . GLU A 1 59  ? -252.479 -22.722 110.588 1.00 0.00 ? 59  GLU A C    2  
ATOM 2725  O O    . GLU A 1 59  ? -253.137 -23.058 111.575 1.00 0.00 ? 59  GLU A O    2  
ATOM 2726  C CB   . GLU A 1 59  ? -250.296 -22.634 111.724 1.00 0.00 ? 59  GLU A CB   2  
ATOM 2727  C CG   . GLU A 1 59  ? -248.841 -22.248 111.608 1.00 0.00 ? 59  GLU A CG   2  
ATOM 2728  C CD   . GLU A 1 59  ? -247.973 -23.151 112.445 1.00 0.00 ? 59  GLU A CD   2  
ATOM 2729  O OE1  . GLU A 1 59  ? -248.077 -24.387 112.285 1.00 0.00 ? 59  GLU A OE1  2  
ATOM 2730  O OE2  . GLU A 1 59  ? -247.212 -22.635 113.282 1.00 0.00 ? 59  GLU A OE2  2  
ATOM 2731  H H    . GLU A 1 59  ? -251.732 -20.423 112.124 1.00 0.00 ? 59  GLU A H    2  
ATOM 2732  H HA   . GLU A 1 59  ? -250.714 -21.855 109.784 1.00 0.00 ? 59  GLU A HA   2  
ATOM 2733  H HB2  . GLU A 1 59  ? -250.624 -22.410 112.728 1.00 0.00 ? 59  GLU A HB2  2  
ATOM 2734  H HB3  . GLU A 1 59  ? -250.375 -23.699 111.558 1.00 0.00 ? 59  GLU A HB3  2  
ATOM 2735  H HG2  . GLU A 1 59  ? -248.540 -22.324 110.575 1.00 0.00 ? 59  GLU A HG2  2  
ATOM 2736  H HG3  . GLU A 1 59  ? -248.718 -21.231 111.949 1.00 0.00 ? 59  GLU A HG3  2  
ATOM 2737  N N    . GLU A 1 60  ? -252.821 -23.025 109.353 1.00 0.00 ? 60  GLU A N    2  
ATOM 2738  C CA   . GLU A 1 60  ? -253.942 -23.896 109.078 1.00 0.00 ? 60  GLU A CA   2  
ATOM 2739  C C    . GLU A 1 60  ? -253.438 -25.313 108.866 1.00 0.00 ? 60  GLU A C    2  
ATOM 2740  O O    . GLU A 1 60  ? -252.783 -25.599 107.865 1.00 0.00 ? 60  GLU A O    2  
ATOM 2741  C CB   . GLU A 1 60  ? -254.702 -23.420 107.839 1.00 0.00 ? 60  GLU A CB   2  
ATOM 2742  C CG   . GLU A 1 60  ? -255.267 -22.018 107.970 1.00 0.00 ? 60  GLU A CG   2  
ATOM 2743  C CD   . GLU A 1 60  ? -256.567 -21.962 108.747 1.00 0.00 ? 60  GLU A CD   2  
ATOM 2744  O OE1  . GLU A 1 60  ? -256.557 -22.247 109.958 1.00 0.00 ? 60  GLU A OE1  2  
ATOM 2745  O OE2  . GLU A 1 60  ? -257.598 -21.595 108.145 1.00 0.00 ? 60  GLU A OE2  2  
ATOM 2746  H H    . GLU A 1 60  ? -252.307 -22.648 108.607 1.00 0.00 ? 60  GLU A H    2  
ATOM 2747  H HA   . GLU A 1 60  ? -254.604 -23.876 109.933 1.00 0.00 ? 60  GLU A HA   2  
ATOM 2748  H HB2  . GLU A 1 60  ? -254.031 -23.437 106.992 1.00 0.00 ? 60  GLU A HB2  2  
ATOM 2749  H HB3  . GLU A 1 60  ? -255.521 -24.099 107.652 1.00 0.00 ? 60  GLU A HB3  2  
ATOM 2750  H HG2  . GLU A 1 60  ? -254.542 -21.400 108.476 1.00 0.00 ? 60  GLU A HG2  2  
ATOM 2751  H HG3  . GLU A 1 60  ? -255.442 -21.623 106.979 1.00 0.00 ? 60  GLU A HG3  2  
ATOM 2752  N N    . LYS A 1 61  ? -253.704 -26.186 109.824 1.00 0.00 ? 61  LYS A N    2  
ATOM 2753  C CA   . LYS A 1 61  ? -253.363 -27.591 109.679 1.00 0.00 ? 61  LYS A CA   2  
ATOM 2754  C C    . LYS A 1 61  ? -254.387 -28.266 108.759 1.00 0.00 ? 61  LYS A C    2  
ATOM 2755  O O    . LYS A 1 61  ? -255.230 -27.592 108.165 1.00 0.00 ? 61  LYS A O    2  
ATOM 2756  C CB   . LYS A 1 61  ? -253.305 -28.288 111.051 1.00 0.00 ? 61  LYS A CB   2  
ATOM 2757  C CG   . LYS A 1 61  ? -252.038 -28.005 111.874 1.00 0.00 ? 61  LYS A CG   2  
ATOM 2758  C CD   . LYS A 1 61  ? -251.922 -26.544 112.305 1.00 0.00 ? 61  LYS A CD   2  
ATOM 2759  C CE   . LYS A 1 61  ? -250.889 -26.353 113.419 1.00 0.00 ? 61  LYS A CE   2  
ATOM 2760  N NZ   . LYS A 1 61  ? -249.483 -26.577 112.967 1.00 0.00 ? 61  LYS A NZ   2  
ATOM 2761  H H    . LYS A 1 61  ? -254.145 -25.881 110.648 1.00 0.00 ? 61  LYS A H    2  
ATOM 2762  H HA   . LYS A 1 61  ? -252.389 -27.646 109.213 1.00 0.00 ? 61  LYS A HA   2  
ATOM 2763  H HB2  . LYS A 1 61  ? -254.156 -27.968 111.633 1.00 0.00 ? 61  LYS A HB2  2  
ATOM 2764  H HB3  . LYS A 1 61  ? -253.373 -29.355 110.897 1.00 0.00 ? 61  LYS A HB3  2  
ATOM 2765  H HG2  . LYS A 1 61  ? -252.056 -28.624 112.757 1.00 0.00 ? 61  LYS A HG2  2  
ATOM 2766  H HG3  . LYS A 1 61  ? -251.175 -28.262 111.275 1.00 0.00 ? 61  LYS A HG3  2  
ATOM 2767  H HD2  . LYS A 1 61  ? -251.626 -25.952 111.453 1.00 0.00 ? 61  LYS A HD2  2  
ATOM 2768  H HD3  . LYS A 1 61  ? -252.885 -26.208 112.660 1.00 0.00 ? 61  LYS A HD3  2  
ATOM 2769  H HE2  . LYS A 1 61  ? -250.973 -25.345 113.794 1.00 0.00 ? 61  LYS A HE2  2  
ATOM 2770  H HE3  . LYS A 1 61  ? -251.114 -27.046 114.217 1.00 0.00 ? 61  LYS A HE3  2  
ATOM 2771  H HZ1  . LYS A 1 61  ? -249.439 -27.377 112.311 1.00 0.00 ? 61  LYS A HZ1  2  
ATOM 2772  H HZ2  . LYS A 1 61  ? -249.114 -25.723 112.485 1.00 0.00 ? 61  LYS A HZ2  2  
ATOM 2773  H HZ3  . LYS A 1 61  ? -248.868 -26.784 113.792 1.00 0.00 ? 61  LYS A HZ3  2  
ATOM 2774  N N    . TYR A 1 62  ? -254.316 -29.580 108.614 1.00 0.00 ? 62  TYR A N    2  
ATOM 2775  C CA   . TYR A 1 62  ? -255.241 -30.283 107.732 1.00 0.00 ? 62  TYR A CA   2  
ATOM 2776  C C    . TYR A 1 62  ? -255.700 -31.585 108.370 1.00 0.00 ? 62  TYR A C    2  
ATOM 2777  O O    . TYR A 1 62  ? -254.946 -32.229 109.093 1.00 0.00 ? 62  TYR A O    2  
ATOM 2778  C CB   . TYR A 1 62  ? -254.593 -30.549 106.368 1.00 0.00 ? 62  TYR A CB   2  
ATOM 2779  C CG   . TYR A 1 62  ? -255.539 -31.132 105.342 1.00 0.00 ? 62  TYR A CG   2  
ATOM 2780  C CD1  . TYR A 1 62  ? -256.504 -30.340 104.731 1.00 0.00 ? 62  TYR A CD1  2  
ATOM 2781  C CD2  . TYR A 1 62  ? -255.468 -32.471 104.984 1.00 0.00 ? 62  TYR A CD2  2  
ATOM 2782  C CE1  . TYR A 1 62  ? -257.373 -30.870 103.795 1.00 0.00 ? 62  TYR A CE1  2  
ATOM 2783  C CE2  . TYR A 1 62  ? -256.331 -33.008 104.049 1.00 0.00 ? 62  TYR A CE2  2  
ATOM 2784  C CZ   . TYR A 1 62  ? -257.282 -32.205 103.456 1.00 0.00 ? 62  TYR A CZ   2  
ATOM 2785  O OH   . TYR A 1 62  ? -258.146 -32.738 102.528 1.00 0.00 ? 62  TYR A OH   2  
ATOM 2786  H H    . TYR A 1 62  ? -253.646 -30.091 109.119 1.00 0.00 ? 62  TYR A H    2  
ATOM 2787  H HA   . TYR A 1 62  ? -256.102 -29.647 107.589 1.00 0.00 ? 62  TYR A HA   2  
ATOM 2788  H HB2  . TYR A 1 62  ? -254.210 -29.620 105.973 1.00 0.00 ? 62  TYR A HB2  2  
ATOM 2789  H HB3  . TYR A 1 62  ? -253.774 -31.242 106.497 1.00 0.00 ? 62  TYR A HB3  2  
ATOM 2790  H HD1  . TYR A 1 62  ? -256.573 -29.297 104.998 1.00 0.00 ? 62  TYR A HD1  2  
ATOM 2791  H HD2  . TYR A 1 62  ? -254.723 -33.099 105.449 1.00 0.00 ? 62  TYR A HD2  2  
ATOM 2792  H HE1  . TYR A 1 62  ? -258.116 -30.239 103.330 1.00 0.00 ? 62  TYR A HE1  2  
ATOM 2793  H HE2  . TYR A 1 62  ? -256.258 -34.053 103.784 1.00 0.00 ? 62  TYR A HE2  2  
ATOM 2794  H HH   . TYR A 1 62  ? -258.220 -32.143 101.779 1.00 0.00 ? 62  TYR A HH   2  
ATOM 2795  N N    . PHE A 1 63  ? -256.938 -31.963 108.094 1.00 0.00 ? 63  PHE A N    2  
ATOM 2796  C CA   . PHE A 1 63  ? -257.540 -33.133 108.710 1.00 0.00 ? 63  PHE A CA   2  
ATOM 2797  C C    . PHE A 1 63  ? -257.155 -34.412 107.965 1.00 0.00 ? 63  PHE A C    2  
ATOM 2798  O O    . PHE A 1 63  ? -257.808 -34.803 106.999 1.00 0.00 ? 63  PHE A O    2  
ATOM 2799  C CB   . PHE A 1 63  ? -259.065 -32.970 108.739 1.00 0.00 ? 63  PHE A CB   2  
ATOM 2800  C CG   . PHE A 1 63  ? -259.794 -34.037 109.508 1.00 0.00 ? 63  PHE A CG   2  
ATOM 2801  C CD1  . PHE A 1 63  ? -259.971 -33.919 110.877 1.00 0.00 ? 63  PHE A CD1  2  
ATOM 2802  C CD2  . PHE A 1 63  ? -260.311 -35.152 108.863 1.00 0.00 ? 63  PHE A CD2  2  
ATOM 2803  C CE1  . PHE A 1 63  ? -260.645 -34.890 111.588 1.00 0.00 ? 63  PHE A CE1  2  
ATOM 2804  C CE2  . PHE A 1 63  ? -260.986 -36.127 109.570 1.00 0.00 ? 63  PHE A CE2  2  
ATOM 2805  C CZ   . PHE A 1 63  ? -261.155 -35.995 110.934 1.00 0.00 ? 63  PHE A CZ   2  
ATOM 2806  H H    . PHE A 1 63  ? -257.464 -31.441 107.452 1.00 0.00 ? 63  PHE A H    2  
ATOM 2807  H HA   . PHE A 1 63  ? -257.176 -33.199 109.724 1.00 0.00 ? 63  PHE A HA   2  
ATOM 2808  H HB2  . PHE A 1 63  ? -259.305 -32.019 109.192 1.00 0.00 ? 63  PHE A HB2  2  
ATOM 2809  H HB3  . PHE A 1 63  ? -259.437 -32.979 107.725 1.00 0.00 ? 63  PHE A HB3  2  
ATOM 2810  H HD1  . PHE A 1 63  ? -259.574 -33.055 111.388 1.00 0.00 ? 63  PHE A HD1  2  
ATOM 2811  H HD2  . PHE A 1 63  ? -260.178 -35.255 107.796 1.00 0.00 ? 63  PHE A HD2  2  
ATOM 2812  H HE1  . PHE A 1 63  ? -260.775 -34.786 112.655 1.00 0.00 ? 63  PHE A HE1  2  
ATOM 2813  H HE2  . PHE A 1 63  ? -261.384 -36.989 109.057 1.00 0.00 ? 63  PHE A HE2  2  
ATOM 2814  H HZ   . PHE A 1 63  ? -261.683 -36.756 111.489 1.00 0.00 ? 63  PHE A HZ   2  
ATOM 2815  N N    . ILE A 1 64  ? -256.068 -35.037 108.392 1.00 0.00 ? 64  ILE A N    2  
ATOM 2816  C CA   . ILE A 1 64  ? -255.700 -36.352 107.880 1.00 0.00 ? 64  ILE A CA   2  
ATOM 2817  C C    . ILE A 1 64  ? -255.848 -37.376 108.983 1.00 0.00 ? 64  ILE A C    2  
ATOM 2818  O O    . ILE A 1 64  ? -256.080 -38.566 108.750 1.00 0.00 ? 64  ILE A O    2  
ATOM 2819  C CB   . ILE A 1 64  ? -254.258 -36.377 107.315 1.00 0.00 ? 64  ILE A CB   2  
ATOM 2820  C CG1  . ILE A 1 64  ? -254.125 -35.386 106.156 1.00 0.00 ? 64  ILE A CG1  2  
ATOM 2821  C CG2  . ILE A 1 64  ? -253.872 -37.781 106.857 1.00 0.00 ? 64  ILE A CG2  2  
ATOM 2822  C CD1  . ILE A 1 64  ? -252.757 -35.383 105.506 1.00 0.00 ? 64  ILE A CD1  2  
ATOM 2823  H H    . ILE A 1 64  ? -255.492 -34.600 109.055 1.00 0.00 ? 64  ILE A H    2  
ATOM 2824  H HA   . ILE A 1 64  ? -256.384 -36.595 107.103 1.00 0.00 ? 64  ILE A HA   2  
ATOM 2825  H HB   . ILE A 1 64  ? -253.583 -36.086 108.105 1.00 0.00 ? 64  ILE A HB   2  
ATOM 2826  H HG12 . ILE A 1 64  ? -254.851 -35.633 105.396 1.00 0.00 ? 64  ILE A HG12 2  
ATOM 2827  H HG13 . ILE A 1 64  ? -254.321 -34.388 106.521 1.00 0.00 ? 64  ILE A HG13 2  
ATOM 2828  H HG21 . ILE A 1 64  ? -254.569 -38.118 106.105 1.00 0.00 ? 64  ILE A HG21 2  
ATOM 2829  H HG22 . ILE A 1 64  ? -252.875 -37.763 106.442 1.00 0.00 ? 64  ILE A HG22 2  
ATOM 2830  H HG23 . ILE A 1 64  ? -253.899 -38.455 107.701 1.00 0.00 ? 64  ILE A HG23 2  
ATOM 2831  H HD11 . ILE A 1 64  ? -252.008 -35.127 106.241 1.00 0.00 ? 64  ILE A HD11 2  
ATOM 2832  H HD12 . ILE A 1 64  ? -252.547 -36.364 105.104 1.00 0.00 ? 64  ILE A HD12 2  
ATOM 2833  H HD13 . ILE A 1 64  ? -252.740 -34.656 104.707 1.00 0.00 ? 64  ILE A HD13 2  
ATOM 2834  N N    . SER A 1 65  ? -255.787 -36.854 110.175 1.00 0.00 ? 65  SER A N    2  
ATOM 2835  C CA   . SER A 1 65  ? -255.819 -37.624 111.405 1.00 0.00 ? 65  SER A CA   2  
ATOM 2836  C C    . SER A 1 65  ? -257.174 -38.310 111.593 1.00 0.00 ? 65  SER A C    2  
ATOM 2837  O O    . SER A 1 65  ? -258.222 -37.715 111.327 1.00 0.00 ? 65  SER A O    2  
ATOM 2838  C CB   . SER A 1 65  ? -255.540 -36.666 112.551 1.00 0.00 ? 65  SER A CB   2  
ATOM 2839  O OG   . SER A 1 65  ? -254.758 -35.570 112.097 1.00 0.00 ? 65  SER A OG   2  
ATOM 2840  H H    . SER A 1 65  ? -255.718 -35.885 110.234 1.00 0.00 ? 65  SER A H    2  
ATOM 2841  H HA   . SER A 1 65  ? -255.039 -38.368 111.364 1.00 0.00 ? 65  SER A HA   2  
ATOM 2842  H HB2  . SER A 1 65  ? -256.474 -36.291 112.943 1.00 0.00 ? 65  SER A HB2  2  
ATOM 2843  H HB3  . SER A 1 65  ? -255.000 -37.182 113.331 1.00 0.00 ? 65  SER A HB3  2  
ATOM 2844  H HG   . SER A 1 65  ? -254.008 -35.430 112.707 1.00 0.00 ? 65  SER A HG   2  
ATOM 2845  N N    . LYS A 1 66  ? -257.156 -39.566 112.038 1.00 0.00 ? 66  LYS A N    2  
ATOM 2846  C CA   . LYS A 1 66  ? -258.387 -40.351 112.141 1.00 0.00 ? 66  LYS A CA   2  
ATOM 2847  C C    . LYS A 1 66  ? -258.411 -41.203 113.411 1.00 0.00 ? 66  LYS A C    2  
ATOM 2848  O O    . LYS A 1 66  ? -259.214 -42.133 113.512 1.00 0.00 ? 66  LYS A O    2  
ATOM 2849  C CB   . LYS A 1 66  ? -258.534 -41.260 110.912 1.00 0.00 ? 66  LYS A CB   2  
ATOM 2850  C CG   . LYS A 1 66  ? -258.297 -40.543 109.592 1.00 0.00 ? 66  LYS A CG   2  
ATOM 2851  C CD   . LYS A 1 66  ? -258.558 -41.435 108.391 1.00 0.00 ? 66  LYS A CD   2  
ATOM 2852  C CE   . LYS A 1 66  ? -257.962 -40.833 107.127 1.00 0.00 ? 66  LYS A CE   2  
ATOM 2853  N NZ   . LYS A 1 66  ? -258.267 -39.379 107.002 1.00 0.00 ? 66  LYS A NZ   2  
ATOM 2854  H H    . LYS A 1 66  ? -256.303 -39.972 112.302 1.00 0.00 ? 66  LYS A H    2  
ATOM 2855  H HA   . LYS A 1 66  ? -259.218 -39.662 112.167 1.00 0.00 ? 66  LYS A HA   2  
ATOM 2856  H HB2  . LYS A 1 66  ? -257.822 -42.068 110.990 1.00 0.00 ? 66  LYS A HB2  2  
ATOM 2857  H HB3  . LYS A 1 66  ? -259.532 -41.673 110.900 1.00 0.00 ? 66  LYS A HB3  2  
ATOM 2858  H HG2  . LYS A 1 66  ? -258.955 -39.689 109.538 1.00 0.00 ? 66  LYS A HG2  2  
ATOM 2859  H HG3  . LYS A 1 66  ? -257.271 -40.207 109.560 1.00 0.00 ? 66  LYS A HG3  2  
ATOM 2860  H HD2  . LYS A 1 66  ? -258.112 -42.402 108.567 1.00 0.00 ? 66  LYS A HD2  2  
ATOM 2861  H HD3  . LYS A 1 66  ? -259.625 -41.543 108.261 1.00 0.00 ? 66  LYS A HD3  2  
ATOM 2862  H HE2  . LYS A 1 66  ? -256.890 -40.964 107.154 1.00 0.00 ? 66  LYS A HE2  2  
ATOM 2863  H HE3  . LYS A 1 66  ? -258.366 -41.352 106.271 1.00 0.00 ? 66  LYS A HE3  2  
ATOM 2864  H HZ1  . LYS A 1 66  ? -259.294 -39.224 107.026 1.00 0.00 ? 66  LYS A HZ1  2  
ATOM 2865  H HZ2  . LYS A 1 66  ? -257.829 -38.857 107.792 1.00 0.00 ? 66  LYS A HZ2  2  
ATOM 2866  H HZ3  . LYS A 1 66  ? -257.888 -39.008 106.107 1.00 0.00 ? 66  LYS A HZ3  2  
ATOM 2867  N N    . GLU A 1 67  ? -257.554 -40.864 114.378 1.00 0.00 ? 67  GLU A N    2  
ATOM 2868  C CA   . GLU A 1 67  ? -257.413 -41.640 115.618 1.00 0.00 ? 67  GLU A CA   2  
ATOM 2869  C C    . GLU A 1 67  ? -256.896 -43.049 115.322 1.00 0.00 ? 67  GLU A C    2  
ATOM 2870  O O    . GLU A 1 67  ? -256.446 -43.330 114.207 1.00 0.00 ? 67  GLU A O    2  
ATOM 2871  C CB   . GLU A 1 67  ? -258.741 -41.722 116.388 1.00 0.00 ? 67  GLU A CB   2  
ATOM 2872  C CG   . GLU A 1 67  ? -259.227 -40.388 116.931 1.00 0.00 ? 67  GLU A CG   2  
ATOM 2873  C CD   . GLU A 1 67  ? -258.269 -39.773 117.933 1.00 0.00 ? 67  GLU A CD   2  
ATOM 2874  O OE1  . GLU A 1 67  ? -258.391 -40.075 119.135 1.00 0.00 ? 67  GLU A OE1  2  
ATOM 2875  O OE2  . GLU A 1 67  ? -257.410 -38.967 117.522 1.00 0.00 ? 67  GLU A OE2  2  
ATOM 2876  H H    . GLU A 1 67  ? -256.997 -40.068 114.259 1.00 0.00 ? 67  GLU A H    2  
ATOM 2877  H HA   . GLU A 1 67  ? -256.686 -41.133 116.236 1.00 0.00 ? 67  GLU A HA   2  
ATOM 2878  H HB2  . GLU A 1 67  ? -259.500 -42.113 115.728 1.00 0.00 ? 67  GLU A HB2  2  
ATOM 2879  H HB3  . GLU A 1 67  ? -258.619 -42.399 117.220 1.00 0.00 ? 67  GLU A HB3  2  
ATOM 2880  H HG2  . GLU A 1 67  ? -259.348 -39.703 116.106 1.00 0.00 ? 67  GLU A HG2  2  
ATOM 2881  H HG3  . GLU A 1 67  ? -260.182 -40.539 117.413 1.00 0.00 ? 67  GLU A HG3  2  
ATOM 2882  N N    . LYS A 1 68  ? -256.943 -43.917 116.341 1.00 0.00 ? 68  LYS A N    2  
ATOM 2883  C CA   . LYS A 1 68  ? -256.493 -45.316 116.240 1.00 0.00 ? 68  LYS A CA   2  
ATOM 2884  C C    . LYS A 1 68  ? -254.972 -45.418 116.157 1.00 0.00 ? 68  LYS A C    2  
ATOM 2885  O O    . LYS A 1 68  ? -254.359 -46.241 116.834 1.00 0.00 ? 68  LYS A O    2  
ATOM 2886  C CB   . LYS A 1 68  ? -257.141 -46.033 115.047 1.00 0.00 ? 68  LYS A CB   2  
ATOM 2887  C CG   . LYS A 1 68  ? -258.636 -46.277 115.214 1.00 0.00 ? 68  LYS A CG   2  
ATOM 2888  C CD   . LYS A 1 68  ? -258.930 -47.187 116.400 1.00 0.00 ? 68  LYS A CD   2  
ATOM 2889  C CE   . LYS A 1 68  ? -258.296 -48.561 116.232 1.00 0.00 ? 68  LYS A CE   2  
ATOM 2890  N NZ   . LYS A 1 68  ? -258.811 -49.272 115.029 1.00 0.00 ? 68  LYS A NZ   2  
ATOM 2891  H H    . LYS A 1 68  ? -257.287 -43.601 117.203 1.00 0.00 ? 68  LYS A H    2  
ATOM 2892  H HA   . LYS A 1 68  ? -256.807 -45.812 117.144 1.00 0.00 ? 68  LYS A HA   2  
ATOM 2893  H HB2  . LYS A 1 68  ? -256.994 -45.434 114.161 1.00 0.00 ? 68  LYS A HB2  2  
ATOM 2894  H HB3  . LYS A 1 68  ? -256.656 -46.988 114.910 1.00 0.00 ? 68  LYS A HB3  2  
ATOM 2895  H HG2  . LYS A 1 68  ? -259.129 -45.330 115.372 1.00 0.00 ? 68  LYS A HG2  2  
ATOM 2896  H HG3  . LYS A 1 68  ? -259.018 -46.737 114.314 1.00 0.00 ? 68  LYS A HG3  2  
ATOM 2897  H HD2  . LYS A 1 68  ? -258.541 -46.731 117.297 1.00 0.00 ? 68  LYS A HD2  2  
ATOM 2898  H HD3  . LYS A 1 68  ? -260.001 -47.305 116.492 1.00 0.00 ? 68  LYS A HD3  2  
ATOM 2899  H HE2  . LYS A 1 68  ? -257.228 -48.439 116.135 1.00 0.00 ? 68  LYS A HE2  2  
ATOM 2900  H HE3  . LYS A 1 68  ? -258.511 -49.151 117.110 1.00 0.00 ? 68  LYS A HE3  2  
ATOM 2901  H HZ1  . LYS A 1 68  ? -259.845 -49.362 115.084 1.00 0.00 ? 68  LYS A HZ1  2  
ATOM 2902  H HZ2  . LYS A 1 68  ? -258.567 -48.740 114.170 1.00 0.00 ? 68  LYS A HZ2  2  
ATOM 2903  H HZ3  . LYS A 1 68  ? -258.392 -50.222 114.970 1.00 0.00 ? 68  LYS A HZ3  2  
ATOM 2904  N N    . ASN A 1 69  ? -254.378 -44.596 115.316 1.00 0.00 ? 69  ASN A N    2  
ATOM 2905  C CA   . ASN A 1 69  ? -252.931 -44.502 115.219 1.00 0.00 ? 69  ASN A CA   2  
ATOM 2906  C C    . ASN A 1 69  ? -252.498 -43.209 115.874 1.00 0.00 ? 69  ASN A C    2  
ATOM 2907  O O    . ASN A 1 69  ? -253.344 -42.383 116.223 1.00 0.00 ? 69  ASN A O    2  
ATOM 2908  C CB   . ASN A 1 69  ? -252.490 -44.561 113.747 1.00 0.00 ? 69  ASN A CB   2  
ATOM 2909  C CG   . ASN A 1 69  ? -250.991 -44.747 113.577 1.00 0.00 ? 69  ASN A CG   2  
ATOM 2910  O OD1  . ASN A 1 69  ? -250.238 -43.781 113.500 1.00 0.00 ? 69  ASN A OD1  2  
ATOM 2911  N ND2  . ASN A 1 69  ? -250.550 -45.993 113.510 1.00 0.00 ? 69  ASN A ND2  2  
ATOM 2912  H H    . ASN A 1 69  ? -254.935 -44.015 114.751 1.00 0.00 ? 69  ASN A H    2  
ATOM 2913  H HA   . ASN A 1 69  ? -252.495 -45.319 115.765 1.00 0.00 ? 69  ASN A HA   2  
ATOM 2914  H HB2  . ASN A 1 69  ? -252.989 -45.388 113.263 1.00 0.00 ? 69  ASN A HB2  2  
ATOM 2915  H HB3  . ASN A 1 69  ? -252.776 -43.642 113.259 1.00 0.00 ? 69  ASN A HB3  2  
ATOM 2916  H HD21 . ASN A 1 69  ? -251.202 -46.721 113.572 1.00 0.00 ? 69  ASN A HD21 2  
ATOM 2917  H HD22 . ASN A 1 69  ? -249.586 -46.136 113.399 1.00 0.00 ? 69  ASN A HD22 2  
ATOM 2918  N N    . GLU A 1 70  ? -251.202 -43.032 116.061 1.00 0.00 ? 70  GLU A N    2  
ATOM 2919  C CA   . GLU A 1 70  ? -250.714 -41.881 116.784 1.00 0.00 ? 70  GLU A CA   2  
ATOM 2920  C C    . GLU A 1 70  ? -250.791 -40.634 115.903 1.00 0.00 ? 70  GLU A C    2  
ATOM 2921  O O    . GLU A 1 70  ? -249.812 -40.224 115.281 1.00 0.00 ? 70  GLU A O    2  
ATOM 2922  C CB   . GLU A 1 70  ? -249.291 -42.124 117.296 1.00 0.00 ? 70  GLU A CB   2  
ATOM 2923  C CG   . GLU A 1 70  ? -248.823 -41.098 118.315 1.00 0.00 ? 70  GLU A CG   2  
ATOM 2924  C CD   . GLU A 1 70  ? -247.522 -41.499 118.980 1.00 0.00 ? 70  GLU A CD   2  
ATOM 2925  O OE1  . GLU A 1 70  ? -246.448 -41.137 118.457 1.00 0.00 ? 70  GLU A OE1  2  
ATOM 2926  O OE2  . GLU A 1 70  ? -247.578 -42.177 120.029 1.00 0.00 ? 70  GLU A OE2  2  
ATOM 2927  H H    . GLU A 1 70  ? -250.563 -43.675 115.692 1.00 0.00 ? 70  GLU A H    2  
ATOM 2928  H HA   . GLU A 1 70  ? -251.372 -41.754 117.626 1.00 0.00 ? 70  GLU A HA   2  
ATOM 2929  H HB2  . GLU A 1 70  ? -249.251 -43.099 117.757 1.00 0.00 ? 70  GLU A HB2  2  
ATOM 2930  H HB3  . GLU A 1 70  ? -248.611 -42.103 116.458 1.00 0.00 ? 70  GLU A HB3  2  
ATOM 2931  H HG2  . GLU A 1 70  ? -248.679 -40.152 117.815 1.00 0.00 ? 70  GLU A HG2  2  
ATOM 2932  H HG3  . GLU A 1 70  ? -249.583 -40.992 119.075 1.00 0.00 ? 70  GLU A HG3  2  
ATOM 2933  N N    . CYS A 1 71  ? -251.991 -40.079 115.826 1.00 0.00 ? 71  CYS A N    2  
ATOM 2934  C CA   . CYS A 1 71  ? -252.278 -38.911 115.011 1.00 0.00 ? 71  CYS A CA   2  
ATOM 2935  C C    . CYS A 1 71  ? -253.640 -38.366 115.431 1.00 0.00 ? 71  CYS A C    2  
ATOM 2936  O O    . CYS A 1 71  ? -254.677 -38.945 115.100 1.00 0.00 ? 71  CYS A O    2  
ATOM 2937  C CB   . CYS A 1 71  ? -252.276 -39.297 113.524 1.00 0.00 ? 71  CYS A CB   2  
ATOM 2938  S SG   . CYS A 1 71  ? -252.349 -37.904 112.373 1.00 0.00 ? 71  CYS A SG   2  
ATOM 2939  H H    . CYS A 1 71  ? -252.728 -40.487 116.332 1.00 0.00 ? 71  CYS A H    2  
ATOM 2940  H HA   . CYS A 1 71  ? -251.518 -38.168 115.199 1.00 0.00 ? 71  CYS A HA   2  
ATOM 2941  H HB2  . CYS A 1 71  ? -251.373 -39.848 113.306 1.00 0.00 ? 71  CYS A HB2  2  
ATOM 2942  H HB3  . CYS A 1 71  ? -253.129 -39.930 113.327 1.00 0.00 ? 71  CYS A HB3  2  
ATOM 2943  H HG   . CYS A 1 71  ? -252.306 -36.777 113.083 1.00 0.00 ? 71  CYS A HG   2  
ATOM 2944  N N    . ARG A 1 72  ? -253.625 -37.274 116.186 1.00 0.00 ? 72  ARG A N    2  
ATOM 2945  C CA   . ARG A 1 72  ? -254.828 -36.777 116.847 1.00 0.00 ? 72  ARG A CA   2  
ATOM 2946  C C    . ARG A 1 72  ? -255.863 -36.258 115.855 1.00 0.00 ? 72  ARG A C    2  
ATOM 2947  O O    . ARG A 1 72  ? -255.655 -35.242 115.195 1.00 0.00 ? 72  ARG A O    2  
ATOM 2948  C CB   . ARG A 1 72  ? -254.477 -35.679 117.858 1.00 0.00 ? 72  ARG A CB   2  
ATOM 2949  C CG   . ARG A 1 72  ? -255.698 -35.008 118.469 1.00 0.00 ? 72  ARG A CG   2  
ATOM 2950  C CD   . ARG A 1 72  ? -256.633 -36.023 119.111 1.00 0.00 ? 72  ARG A CD   2  
ATOM 2951  N NE   . ARG A 1 72  ? -257.923 -35.431 119.462 1.00 0.00 ? 72  ARG A NE   2  
ATOM 2952  C CZ   . ARG A 1 72  ? -258.993 -36.139 119.821 1.00 0.00 ? 72  ARG A CZ   2  
ATOM 2953  N NH1  . ARG A 1 72  ? -258.939 -37.466 119.843 1.00 0.00 ? 72  ARG A NH1  2  
ATOM 2954  N NH2  . ARG A 1 72  ? -260.130 -35.518 120.129 1.00 0.00 ? 72  ARG A NH2  2  
ATOM 2955  H H    . ARG A 1 72  ? -252.788 -36.774 116.281 1.00 0.00 ? 72  ARG A H    2  
ATOM 2956  H HA   . ARG A 1 72  ? -255.263 -37.606 117.385 1.00 0.00 ? 72  ARG A HA   2  
ATOM 2957  H HB2  . ARG A 1 72  ? -253.892 -36.114 118.656 1.00 0.00 ? 72  ARG A HB2  2  
ATOM 2958  H HB3  . ARG A 1 72  ? -253.886 -34.922 117.362 1.00 0.00 ? 72  ARG A HB3  2  
ATOM 2959  H HG2  . ARG A 1 72  ? -255.372 -34.307 119.223 1.00 0.00 ? 72  ARG A HG2  2  
ATOM 2960  H HG3  . ARG A 1 72  ? -256.233 -34.480 117.693 1.00 0.00 ? 72  ARG A HG3  2  
ATOM 2961  H HD2  . ARG A 1 72  ? -256.797 -36.833 118.416 1.00 0.00 ? 72  ARG A HD2  2  
ATOM 2962  H HD3  . ARG A 1 72  ? -256.168 -36.406 120.007 1.00 0.00 ? 72  ARG A HD3  2  
ATOM 2963  H HE   . ARG A 1 72  ? -257.994 -34.453 119.416 1.00 0.00 ? 72  ARG A HE   2  
ATOM 2964  H HH11 . ARG A 1 72  ? -258.091 -37.947 119.582 1.00 0.00 ? 72  ARG A HH11 2  
ATOM 2965  H HH12 . ARG A 1 72  ? -259.738 -38.003 120.109 1.00 0.00 ? 72  ARG A HH12 2  
ATOM 2966  H HH21 . ARG A 1 72  ? -260.182 -34.520 120.088 1.00 0.00 ? 72  ARG A HH21 2  
ATOM 2967  H HH22 . ARG A 1 72  ? -260.936 -36.047 120.396 1.00 0.00 ? 72  ARG A HH22 2  
ATOM 2968  N N    . LYS A 1 73  ? -256.984 -36.963 115.786 1.00 0.00 ? 73  LYS A N    2  
ATOM 2969  C CA   . LYS A 1 73  ? -258.095 -36.578 114.933 1.00 0.00 ? 73  LYS A CA   2  
ATOM 2970  C C    . LYS A 1 73  ? -258.617 -35.206 115.337 1.00 0.00 ? 73  LYS A C    2  
ATOM 2971  O O    . LYS A 1 73  ? -258.862 -34.956 116.520 1.00 0.00 ? 73  LYS A O    2  
ATOM 2972  C CB   . LYS A 1 73  ? -259.205 -37.627 115.035 1.00 0.00 ? 73  LYS A CB   2  
ATOM 2973  C CG   . LYS A 1 73  ? -260.373 -37.407 114.094 1.00 0.00 ? 73  LYS A CG   2  
ATOM 2974  C CD   . LYS A 1 73  ? -261.386 -38.534 114.217 1.00 0.00 ? 73  LYS A CD   2  
ATOM 2975  C CE   . LYS A 1 73  ? -262.529 -38.378 113.228 1.00 0.00 ? 73  LYS A CE   2  
ATOM 2976  N NZ   . LYS A 1 73  ? -263.499 -39.504 113.324 1.00 0.00 ? 73  LYS A NZ   2  
ATOM 2977  H H    . LYS A 1 73  ? -257.071 -37.775 116.347 1.00 0.00 ? 73  LYS A H    2  
ATOM 2978  H HA   . LYS A 1 73  ? -257.739 -36.535 113.914 1.00 0.00 ? 73  LYS A HA   2  
ATOM 2979  H HB2  . LYS A 1 73  ? -258.782 -38.597 114.819 1.00 0.00 ? 73  LYS A HB2  2  
ATOM 2980  H HB3  . LYS A 1 73  ? -259.583 -37.629 116.047 1.00 0.00 ? 73  LYS A HB3  2  
ATOM 2981  H HG2  . LYS A 1 73  ? -260.853 -36.472 114.340 1.00 0.00 ? 73  LYS A HG2  2  
ATOM 2982  H HG3  . LYS A 1 73  ? -260.007 -37.372 113.078 1.00 0.00 ? 73  LYS A HG3  2  
ATOM 2983  H HD2  . LYS A 1 73  ? -260.889 -39.473 114.029 1.00 0.00 ? 73  LYS A HD2  2  
ATOM 2984  H HD3  . LYS A 1 73  ? -261.788 -38.532 115.220 1.00 0.00 ? 73  LYS A HD3  2  
ATOM 2985  H HE2  . LYS A 1 73  ? -263.044 -37.451 113.435 1.00 0.00 ? 73  LYS A HE2  2  
ATOM 2986  H HE3  . LYS A 1 73  ? -262.121 -38.348 112.229 1.00 0.00 ? 73  LYS A HE3  2  
ATOM 2987  H HZ1  . LYS A 1 73  ? -263.018 -40.407 113.137 1.00 0.00 ? 73  LYS A HZ1  2  
ATOM 2988  H HZ2  . LYS A 1 73  ? -263.914 -39.537 114.276 1.00 0.00 ? 73  LYS A HZ2  2  
ATOM 2989  H HZ3  . LYS A 1 73  ? -264.262 -39.380 112.627 1.00 0.00 ? 73  LYS A HZ3  2  
ATOM 2990  N N    . GLN A 1 74  ? -258.777 -34.334 114.344 1.00 0.00 ? 74  GLN A N    2  
ATOM 2991  C CA   . GLN A 1 74  ? -259.174 -32.944 114.560 1.00 0.00 ? 74  GLN A CA   2  
ATOM 2992  C C    . GLN A 1 74  ? -258.026 -32.169 115.208 1.00 0.00 ? 74  GLN A C    2  
ATOM 2993  O O    . GLN A 1 74  ? -257.913 -32.101 116.435 1.00 0.00 ? 74  GLN A O    2  
ATOM 2994  C CB   . GLN A 1 74  ? -260.451 -32.846 115.406 1.00 0.00 ? 74  GLN A CB   2  
ATOM 2995  C CG   . GLN A 1 74  ? -260.960 -31.425 115.581 1.00 0.00 ? 74  GLN A CG   2  
ATOM 2996  C CD   . GLN A 1 74  ? -262.211 -31.359 116.433 1.00 0.00 ? 74  GLN A CD   2  
ATOM 2997  O OE1  . GLN A 1 74  ? -263.014 -32.289 116.455 1.00 0.00 ? 74  GLN A OE1  2  
ATOM 2998  N NE2  . GLN A 1 74  ? -262.383 -30.256 117.144 1.00 0.00 ? 74  GLN A NE2  2  
ATOM 2999  H H    . GLN A 1 74  ? -258.602 -34.632 113.430 1.00 0.00 ? 74  GLN A H    2  
ATOM 3000  H HA   . GLN A 1 74  ? -259.366 -32.511 113.589 1.00 0.00 ? 74  GLN A HA   2  
ATOM 3001  H HB2  . GLN A 1 74  ? -261.227 -33.427 114.931 1.00 0.00 ? 74  GLN A HB2  2  
ATOM 3002  H HB3  . GLN A 1 74  ? -260.253 -33.258 116.384 1.00 0.00 ? 74  GLN A HB3  2  
ATOM 3003  H HG2  . GLN A 1 74  ? -260.188 -30.837 116.056 1.00 0.00 ? 74  GLN A HG2  2  
ATOM 3004  H HG3  . GLN A 1 74  ? -261.181 -31.011 114.610 1.00 0.00 ? 74  GLN A HG3  2  
ATOM 3005  H HE21 . GLN A 1 74  ? -261.702 -29.555 117.081 1.00 0.00 ? 74  GLN A HE21 2  
ATOM 3006  H HE22 . GLN A 1 74  ? -263.184 -30.188 117.701 1.00 0.00 ? 74  GLN A HE22 2  
ATOM 3007  N N    . PRO A 1 75  ? -257.139 -31.605 114.374 1.00 0.00 ? 75  PRO A N    2  
ATOM 3008  C CA   . PRO A 1 75  ? -255.961 -30.867 114.831 1.00 0.00 ? 75  PRO A CA   2  
ATOM 3009  C C    . PRO A 1 75  ? -256.311 -29.490 115.394 1.00 0.00 ? 75  PRO A C    2  
ATOM 3010  O O    . PRO A 1 75  ? -257.470 -29.070 115.381 1.00 0.00 ? 75  PRO A O    2  
ATOM 3011  C CB   . PRO A 1 75  ? -255.099 -30.722 113.565 1.00 0.00 ? 75  PRO A CB   2  
ATOM 3012  C CG   . PRO A 1 75  ? -255.753 -31.577 112.529 1.00 0.00 ? 75  PRO A CG   2  
ATOM 3013  C CD   . PRO A 1 75  ? -257.199 -31.654 112.912 1.00 0.00 ? 75  PRO A CD   2  
ATOM 3014  H HA   . PRO A 1 75  ? -255.413 -31.425 115.578 1.00 0.00 ? 75  PRO A HA   2  
ATOM 3015  H HB2  . PRO A 1 75  ? -255.079 -29.686 113.261 1.00 0.00 ? 75  PRO A HB2  2  
ATOM 3016  H HB3  . PRO A 1 75  ? -254.094 -31.058 113.773 1.00 0.00 ? 75  PRO A HB3  2  
ATOM 3017  H HG2  . PRO A 1 75  ? -255.646 -31.121 111.556 1.00 0.00 ? 75  PRO A HG2  2  
ATOM 3018  H HG3  . PRO A 1 75  ? -255.310 -32.562 112.533 1.00 0.00 ? 75  PRO A HG3  2  
ATOM 3019  H HD2  . PRO A 1 75  ? -257.744 -30.809 112.516 1.00 0.00 ? 75  PRO A HD2  2  
ATOM 3020  H HD3  . PRO A 1 75  ? -257.634 -32.583 112.572 1.00 0.00 ? 75  PRO A HD3  2  
ATOM 3021  N N    . PHE A 1 76  ? -255.295 -28.787 115.873 1.00 0.00 ? 76  PHE A N    2  
ATOM 3022  C CA   . PHE A 1 76  ? -255.482 -27.478 116.476 1.00 0.00 ? 76  PHE A CA   2  
ATOM 3023  C C    . PHE A 1 76  ? -254.826 -26.394 115.627 1.00 0.00 ? 76  PHE A C    2  
ATOM 3024  O O    . PHE A 1 76  ? -253.734 -26.588 115.089 1.00 0.00 ? 76  PHE A O    2  
ATOM 3025  C CB   . PHE A 1 76  ? -254.913 -27.460 117.904 1.00 0.00 ? 76  PHE A CB   2  
ATOM 3026  C CG   . PHE A 1 76  ? -253.456 -27.835 117.993 1.00 0.00 ? 76  PHE A CG   2  
ATOM 3027  C CD1  . PHE A 1 76  ? -253.072 -29.165 118.048 1.00 0.00 ? 76  PHE A CD1  2  
ATOM 3028  C CD2  . PHE A 1 76  ? -252.473 -26.856 118.023 1.00 0.00 ? 76  PHE A CD2  2  
ATOM 3029  C CE1  . PHE A 1 76  ? -251.738 -29.514 118.131 1.00 0.00 ? 76  PHE A CE1  2  
ATOM 3030  C CE2  . PHE A 1 76  ? -251.138 -27.200 118.105 1.00 0.00 ? 76  PHE A CE2  2  
ATOM 3031  C CZ   . PHE A 1 76  ? -250.769 -28.531 118.158 1.00 0.00 ? 76  PHE A CZ   2  
ATOM 3032  H H    . PHE A 1 76  ? -254.391 -29.155 115.809 1.00 0.00 ? 76  PHE A H    2  
ATOM 3033  H HA   . PHE A 1 76  ? -256.544 -27.286 116.522 1.00 0.00 ? 76  PHE A HA   2  
ATOM 3034  H HB2  . PHE A 1 76  ? -255.024 -26.468 118.312 1.00 0.00 ? 76  PHE A HB2  2  
ATOM 3035  H HB3  . PHE A 1 76  ? -255.473 -28.157 118.512 1.00 0.00 ? 76  PHE A HB3  2  
ATOM 3036  H HD1  . PHE A 1 76  ? -253.829 -29.936 118.024 1.00 0.00 ? 76  PHE A HD1  2  
ATOM 3037  H HD2  . PHE A 1 76  ? -252.758 -25.816 117.981 1.00 0.00 ? 76  PHE A HD2  2  
ATOM 3038  H HE1  . PHE A 1 76  ? -251.453 -30.554 118.173 1.00 0.00 ? 76  PHE A HE1  2  
ATOM 3039  H HE2  . PHE A 1 76  ? -250.381 -26.429 118.127 1.00 0.00 ? 76  PHE A HE2  2  
ATOM 3040  H HZ   . PHE A 1 76  ? -249.726 -28.801 118.222 1.00 0.00 ? 76  PHE A HZ   2  
ATOM 3041  N N    . GLN A 1 77  ? -255.502 -25.261 115.507 1.00 0.00 ? 77  GLN A N    2  
ATOM 3042  C CA   . GLN A 1 77  ? -254.985 -24.132 114.745 1.00 0.00 ? 77  GLN A CA   2  
ATOM 3043  C C    . GLN A 1 77  ? -254.421 -23.091 115.705 1.00 0.00 ? 77  GLN A C    2  
ATOM 3044  O O    . GLN A 1 77  ? -254.608 -23.197 116.918 1.00 0.00 ? 77  GLN A O    2  
ATOM 3045  C CB   . GLN A 1 77  ? -256.100 -23.497 113.903 1.00 0.00 ? 77  GLN A CB   2  
ATOM 3046  C CG   . GLN A 1 77  ? -256.998 -24.500 113.190 1.00 0.00 ? 77  GLN A CG   2  
ATOM 3047  C CD   . GLN A 1 77  ? -256.287 -25.292 112.108 1.00 0.00 ? 77  GLN A CD   2  
ATOM 3048  O OE1  . GLN A 1 77  ? -255.726 -26.356 112.362 1.00 0.00 ? 77  GLN A OE1  2  
ATOM 3049  N NE2  . GLN A 1 77  ? -256.299 -24.773 110.894 1.00 0.00 ? 77  GLN A NE2  2  
ATOM 3050  H H    . GLN A 1 77  ? -256.371 -25.177 115.952 1.00 0.00 ? 77  GLN A H    2  
ATOM 3051  H HA   . GLN A 1 77  ? -254.199 -24.489 114.096 1.00 0.00 ? 77  GLN A HA   2  
ATOM 3052  H HB2  . GLN A 1 77  ? -256.720 -22.892 114.548 1.00 0.00 ? 77  GLN A HB2  2  
ATOM 3053  H HB3  . GLN A 1 77  ? -255.648 -22.861 113.157 1.00 0.00 ? 77  GLN A HB3  2  
ATOM 3054  H HG2  . GLN A 1 77  ? -257.387 -25.193 113.919 1.00 0.00 ? 77  GLN A HG2  2  
ATOM 3055  H HG3  . GLN A 1 77  ? -257.819 -23.963 112.737 1.00 0.00 ? 77  GLN A HG3  2  
ATOM 3056  H HE21 . GLN A 1 77  ? -256.753 -23.904 110.758 1.00 0.00 ? 77  GLN A HE21 2  
ATOM 3057  H HE22 . GLN A 1 77  ? -255.876 -25.275 110.173 1.00 0.00 ? 77  GLN A HE22 2  
ATOM 3058  N N    . ARG A 1 78  ? -253.734 -22.088 115.175 1.00 0.00 ? 78  ARG A N    2  
ATOM 3059  C CA   . ARG A 1 78  ? -253.238 -20.994 116.001 1.00 0.00 ? 78  ARG A CA   2  
ATOM 3060  C C    . ARG A 1 78  ? -253.042 -19.735 115.173 1.00 0.00 ? 78  ARG A C    2  
ATOM 3061  O O    . ARG A 1 78  ? -252.739 -19.804 113.978 1.00 0.00 ? 78  ARG A O    2  
ATOM 3062  C CB   . ARG A 1 78  ? -251.928 -21.367 116.706 1.00 0.00 ? 78  ARG A CB   2  
ATOM 3063  C CG   . ARG A 1 78  ? -250.792 -21.736 115.769 1.00 0.00 ? 78  ARG A CG   2  
ATOM 3064  C CD   . ARG A 1 78  ? -249.508 -21.979 116.541 1.00 0.00 ? 78  ARG A CD   2  
ATOM 3065  N NE   . ARG A 1 78  ? -248.510 -22.674 115.738 1.00 0.00 ? 78  ARG A NE   2  
ATOM 3066  C CZ   . ARG A 1 78  ? -248.029 -23.874 116.039 1.00 0.00 ? 78  ARG A CZ   2  
ATOM 3067  N NH1  . ARG A 1 78  ? -248.408 -24.484 117.153 1.00 0.00 ? 78  ARG A NH1  2  
ATOM 3068  N NH2  . ARG A 1 78  ? -247.167 -24.462 115.227 1.00 0.00 ? 78  ARG A NH2  2  
ATOM 3069  H H    . ARG A 1 78  ? -253.564 -22.078 114.208 1.00 0.00 ? 78  ARG A H    2  
ATOM 3070  H HA   . ARG A 1 78  ? -253.987 -20.793 116.752 1.00 0.00 ? 78  ARG A HA   2  
ATOM 3071  H HB2  . ARG A 1 78  ? -251.608 -20.529 117.306 1.00 0.00 ? 78  ARG A HB2  2  
ATOM 3072  H HB3  . ARG A 1 78  ? -252.115 -22.210 117.356 1.00 0.00 ? 78  ARG A HB3  2  
ATOM 3073  H HG2  . ARG A 1 78  ? -251.056 -22.637 115.234 1.00 0.00 ? 78  ARG A HG2  2  
ATOM 3074  H HG3  . ARG A 1 78  ? -250.635 -20.929 115.069 1.00 0.00 ? 78  ARG A HG3  2  
ATOM 3075  H HD2  . ARG A 1 78  ? -249.106 -21.027 116.853 1.00 0.00 ? 78  ARG A HD2  2  
ATOM 3076  H HD3  . ARG A 1 78  ? -249.735 -22.576 117.412 1.00 0.00 ? 78  ARG A HD3  2  
ATOM 3077  H HE   . ARG A 1 78  ? -248.190 -22.229 114.913 1.00 0.00 ? 78  ARG A HE   2  
ATOM 3078  H HH11 . ARG A 1 78  ? -249.053 -24.046 117.775 1.00 0.00 ? 78  ARG A HH11 2  
ATOM 3079  H HH12 . ARG A 1 78  ? -248.048 -25.411 117.369 1.00 0.00 ? 78  ARG A HH12 2  
ATOM 3080  H HH21 . ARG A 1 78  ? -246.874 -23.994 114.378 1.00 0.00 ? 78  ARG A HH21 2  
ATOM 3081  H HH22 . ARG A 1 78  ? -246.815 -25.378 115.440 1.00 0.00 ? 78  ARG A HH22 2  
ATOM 3082  N N    . ALA A 1 79  ? -253.221 -18.592 115.816 1.00 0.00 ? 79  ALA A N    2  
ATOM 3083  C CA   . ALA A 1 79  ? -253.075 -17.305 115.160 1.00 0.00 ? 79  ALA A CA   2  
ATOM 3084  C C    . ALA A 1 79  ? -251.714 -16.703 115.478 1.00 0.00 ? 79  ALA A C    2  
ATOM 3085  O O    . ALA A 1 79  ? -251.223 -16.840 116.593 1.00 0.00 ? 79  ALA A O    2  
ATOM 3086  C CB   . ALA A 1 79  ? -254.189 -16.364 115.589 1.00 0.00 ? 79  ALA A CB   2  
ATOM 3087  H H    . ALA A 1 79  ? -253.443 -18.613 116.769 1.00 0.00 ? 79  ALA A H    2  
ATOM 3088  H HA   . ALA A 1 79  ? -253.156 -17.465 114.091 1.00 0.00 ? 79  ALA A HA   2  
ATOM 3089  H HB1  . ALA A 1 79  ? -254.131 -16.197 116.654 1.00 0.00 ? 79  ALA A HB1  2  
ATOM 3090  H HB2  . ALA A 1 79  ? -255.145 -16.803 115.345 1.00 0.00 ? 79  ALA A HB2  2  
ATOM 3091  H HB3  . ALA A 1 79  ? -254.083 -15.421 115.070 1.00 0.00 ? 79  ALA A HB3  2  
ATOM 3092  N N    . ILE A 1 80  ? -251.111 -16.057 114.494 1.00 0.00 ? 80  ILE A N    2  
ATOM 3093  C CA   . ILE A 1 80  ? -249.794 -15.464 114.654 1.00 0.00 ? 80  ILE A CA   2  
ATOM 3094  C C    . ILE A 1 80  ? -249.841 -14.159 115.426 1.00 0.00 ? 80  ILE A C    2  
ATOM 3095  O O    . ILE A 1 80  ? -250.420 -13.168 114.972 1.00 0.00 ? 80  ILE A O    2  
ATOM 3096  C CB   . ILE A 1 80  ? -249.100 -15.249 113.294 1.00 0.00 ? 80  ILE A CB   2  
ATOM 3097  C CG1  . ILE A 1 80  ? -248.495 -16.570 112.821 1.00 0.00 ? 80  ILE A CG1  2  
ATOM 3098  C CG2  . ILE A 1 80  ? -248.024 -14.170 113.376 1.00 0.00 ? 80  ILE A CG2  2  
ATOM 3099  C CD1  . ILE A 1 80  ? -247.410 -17.075 113.738 1.00 0.00 ? 80  ILE A CD1  2  
ATOM 3100  H H    . ILE A 1 80  ? -251.569 -15.968 113.631 1.00 0.00 ? 80  ILE A H    2  
ATOM 3101  H HA   . ILE A 1 80  ? -249.190 -16.153 115.204 1.00 0.00 ? 80  ILE A HA   2  
ATOM 3102  H HB   . ILE A 1 80  ? -249.843 -14.929 112.580 1.00 0.00 ? 80  ILE A HB   2  
ATOM 3103  H HG12 . ILE A 1 80  ? -249.270 -17.320 112.776 1.00 0.00 ? 80  ILE A HG12 2  
ATOM 3104  H HG13 . ILE A 1 80  ? -248.067 -16.436 111.838 1.00 0.00 ? 80  ILE A HG13 2  
ATOM 3105  H HG21 . ILE A 1 80  ? -248.467 -13.244 113.711 1.00 0.00 ? 80  ILE A HG21 2  
ATOM 3106  H HG22 . ILE A 1 80  ? -247.259 -14.478 114.075 1.00 0.00 ? 80  ILE A HG22 2  
ATOM 3107  H HG23 . ILE A 1 80  ? -247.583 -14.026 112.401 1.00 0.00 ? 80  ILE A HG23 2  
ATOM 3108  H HD11 . ILE A 1 80  ? -246.618 -16.339 113.795 1.00 0.00 ? 80  ILE A HD11 2  
ATOM 3109  H HD12 . ILE A 1 80  ? -247.824 -17.235 114.721 1.00 0.00 ? 80  ILE A HD12 2  
ATOM 3110  H HD13 . ILE A 1 80  ? -247.016 -18.001 113.355 1.00 0.00 ? 80  ILE A HD13 2  
ATOM 3111  N N    . GLY A 1 81  ? -249.259 -14.186 116.610 1.00 0.00 ? 81  GLY A N    2  
ATOM 3112  C CA   . GLY A 1 81  ? -248.957 -12.967 117.302 1.00 0.00 ? 81  GLY A CA   2  
ATOM 3113  C C    . GLY A 1 81  ? -247.645 -12.407 116.803 1.00 0.00 ? 81  GLY A C    2  
ATOM 3114  O O    . GLY A 1 81  ? -246.730 -13.164 116.499 1.00 0.00 ? 81  GLY A O    2  
ATOM 3115  H H    . GLY A 1 81  ? -249.036 -15.057 117.029 1.00 0.00 ? 81  GLY A H    2  
ATOM 3116  H HA2  . GLY A 1 81  ? -249.747 -12.249 117.125 1.00 0.00 ? 81  GLY A HA2  2  
ATOM 3117  H HA3  . GLY A 1 81  ? -248.879 -13.164 118.360 1.00 0.00 ? 81  GLY A HA3  2  
ATOM 3118  N N    . PRO A 1 82  ? -247.527 -11.084 116.678 1.00 0.00 ? 82  PRO A N    2  
ATOM 3119  C CA   . PRO A 1 82  ? -246.315 -10.431 116.193 1.00 0.00 ? 82  PRO A CA   2  
ATOM 3120  C C    . PRO A 1 82  ? -245.070 -10.810 116.978 1.00 0.00 ? 82  PRO A C    2  
ATOM 3121  O O    . PRO A 1 82  ? -243.954 -10.757 116.454 1.00 0.00 ? 82  PRO A O    2  
ATOM 3122  C CB   . PRO A 1 82  ? -246.633 -8.947  116.358 1.00 0.00 ? 82  PRO A CB   2  
ATOM 3123  C CG   . PRO A 1 82  ? -248.109 -8.887  116.264 1.00 0.00 ? 82  PRO A CG   2  
ATOM 3124  C CD   . PRO A 1 82  ? -248.570 -10.111 116.987 1.00 0.00 ? 82  PRO A CD   2  
ATOM 3125  H HA   . PRO A 1 82  ? -246.153 -10.648 115.168 1.00 0.00 ? 82  PRO A HA   2  
ATOM 3126  H HB2  . PRO A 1 82  ? -246.279 -8.602  117.319 1.00 0.00 ? 82  PRO A HB2  2  
ATOM 3127  H HB3  . PRO A 1 82  ? -246.163 -8.385  115.570 1.00 0.00 ? 82  PRO A HB3  2  
ATOM 3128  H HG2  . PRO A 1 82  ? -248.479 -7.994  116.749 1.00 0.00 ? 82  PRO A HG2  2  
ATOM 3129  H HG3  . PRO A 1 82  ? -248.421 -8.919  115.231 1.00 0.00 ? 82  PRO A HG3  2  
ATOM 3130  H HD2  . PRO A 1 82  ? -248.590 -9.926  118.033 1.00 0.00 ? 82  PRO A HD2  2  
ATOM 3131  H HD3  . PRO A 1 82  ? -249.534 -10.439 116.626 1.00 0.00 ? 82  PRO A HD3  2  
ATOM 3132  N N    . GLU A 1 83  ? -245.273 -11.158 118.235 1.00 0.00 ? 83  GLU A N    2  
ATOM 3133  C CA   . GLU A 1 83  ? -244.202 -11.617 119.093 1.00 0.00 ? 83  GLU A CA   2  
ATOM 3134  C C    . GLU A 1 83  ? -243.705 -12.987 118.642 1.00 0.00 ? 83  GLU A C    2  
ATOM 3135  O O    . GLU A 1 83  ? -242.503 -13.228 118.547 1.00 0.00 ? 83  GLU A O    2  
ATOM 3136  C CB   . GLU A 1 83  ? -244.705 -11.680 120.523 1.00 0.00 ? 83  GLU A CB   2  
ATOM 3137  C CG   . GLU A 1 83  ? -245.418 -10.410 120.965 1.00 0.00 ? 83  GLU A CG   2  
ATOM 3138  C CD   . GLU A 1 83  ? -244.856 -9.144  120.338 1.00 0.00 ? 83  GLU A CD   2  
ATOM 3139  O OE1  . GLU A 1 83  ? -243.703 -8.771  120.633 1.00 0.00 ? 83  GLU A OE1  2  
ATOM 3140  O OE2  . GLU A 1 83  ? -245.570 -8.512  119.530 1.00 0.00 ? 83  GLU A OE2  2  
ATOM 3141  H H    . GLU A 1 83  ? -246.172 -11.076 118.611 1.00 0.00 ? 83  GLU A H    2  
ATOM 3142  H HA   . GLU A 1 83  ? -243.397 -10.904 119.040 1.00 0.00 ? 83  GLU A HA   2  
ATOM 3143  H HB2  . GLU A 1 83  ? -245.395 -12.507 120.612 1.00 0.00 ? 83  GLU A HB2  2  
ATOM 3144  H HB3  . GLU A 1 83  ? -243.872 -11.851 121.176 1.00 0.00 ? 83  GLU A HB3  2  
ATOM 3145  H HG2  . GLU A 1 83  ? -246.460 -10.488 120.698 1.00 0.00 ? 83  GLU A HG2  2  
ATOM 3146  H HG3  . GLU A 1 83  ? -245.329 -10.331 122.026 1.00 0.00 ? 83  GLU A HG3  2  
ATOM 3147  N N    . GLU A 1 84  ? -244.653 -13.877 118.381 1.00 0.00 ? 84  GLU A N    2  
ATOM 3148  C CA   . GLU A 1 84  ? -244.362 -15.193 117.818 1.00 0.00 ? 84  GLU A CA   2  
ATOM 3149  C C    . GLU A 1 84  ? -243.798 -15.042 116.411 1.00 0.00 ? 84  GLU A C    2  
ATOM 3150  O O    . GLU A 1 84  ? -244.529 -14.776 115.458 1.00 0.00 ? 84  GLU A O    2  
ATOM 3151  C CB   . GLU A 1 84  ? -245.632 -16.041 117.770 1.00 0.00 ? 84  GLU A CB   2  
ATOM 3152  C CG   . GLU A 1 84  ? -246.305 -16.218 119.118 1.00 0.00 ? 84  GLU A CG   2  
ATOM 3153  C CD   . GLU A 1 84  ? -247.680 -16.839 118.992 1.00 0.00 ? 84  GLU A CD   2  
ATOM 3154  O OE1  . GLU A 1 84  ? -248.600 -16.140 118.513 1.00 0.00 ? 84  GLU A OE1  2  
ATOM 3155  O OE2  . GLU A 1 84  ? -247.842 -18.018 119.369 1.00 0.00 ? 84  GLU A OE2  2  
ATOM 3156  H H    . GLU A 1 84  ? -245.581 -13.643 118.575 1.00 0.00 ? 84  GLU A H    2  
ATOM 3157  H HA   . GLU A 1 84  ? -243.631 -15.675 118.448 1.00 0.00 ? 84  GLU A HA   2  
ATOM 3158  H HB2  . GLU A 1 84  ? -246.337 -15.573 117.100 1.00 0.00 ? 84  GLU A HB2  2  
ATOM 3159  H HB3  . GLU A 1 84  ? -245.381 -17.020 117.387 1.00 0.00 ? 84  GLU A HB3  2  
ATOM 3160  H HG2  . GLU A 1 84  ? -245.690 -16.858 119.735 1.00 0.00 ? 84  GLU A HG2  2  
ATOM 3161  H HG3  . GLU A 1 84  ? -246.400 -15.249 119.587 1.00 0.00 ? 84  GLU A HG3  2  
ATOM 3162  N N    . GLU A 1 85  ? -242.497 -15.206 116.279 1.00 0.00 ? 85  GLU A N    2  
ATOM 3163  C CA   . GLU A 1 85  ? -241.836 -14.965 115.013 1.00 0.00 ? 85  GLU A CA   2  
ATOM 3164  C C    . GLU A 1 85  ? -241.858 -16.190 114.115 1.00 0.00 ? 85  GLU A C    2  
ATOM 3165  O O    . GLU A 1 85  ? -241.737 -17.326 114.574 1.00 0.00 ? 85  GLU A O    2  
ATOM 3166  C CB   . GLU A 1 85  ? -240.407 -14.507 115.246 1.00 0.00 ? 85  GLU A CB   2  
ATOM 3167  C CG   . GLU A 1 85  ? -240.326 -13.207 116.018 1.00 0.00 ? 85  GLU A CG   2  
ATOM 3168  C CD   . GLU A 1 85  ? -238.917 -12.651 116.045 1.00 0.00 ? 85  GLU A CD   2  
ATOM 3169  O OE1  . GLU A 1 85  ? -238.369 -12.378 114.960 1.00 0.00 ? 85  GLU A OE1  2  
ATOM 3170  O OE2  . GLU A 1 85  ? -238.365 -12.440 117.139 1.00 0.00 ? 85  GLU A OE2  2  
ATOM 3171  H H    . GLU A 1 85  ? -241.968 -15.499 117.055 1.00 0.00 ? 85  GLU A H    2  
ATOM 3172  H HA   . GLU A 1 85  ? -242.373 -14.170 114.518 1.00 0.00 ? 85  GLU A HA   2  
ATOM 3173  H HB2  . GLU A 1 85  ? -239.880 -15.269 115.804 1.00 0.00 ? 85  GLU A HB2  2  
ATOM 3174  H HB3  . GLU A 1 85  ? -239.921 -14.368 114.292 1.00 0.00 ? 85  GLU A HB3  2  
ATOM 3175  H HG2  . GLU A 1 85  ? -240.988 -12.480 115.552 1.00 0.00 ? 85  GLU A HG2  2  
ATOM 3176  H HG3  . GLU A 1 85  ? -240.652 -13.383 117.032 1.00 0.00 ? 85  GLU A HG3  2  
ATOM 3177  N N    . ILE A 1 86  ? -241.987 -15.935 112.824 1.00 0.00 ? 86  ILE A N    2  
ATOM 3178  C CA   . ILE A 1 86  ? -242.084 -16.982 111.816 1.00 0.00 ? 86  ILE A CA   2  
ATOM 3179  C C    . ILE A 1 86  ? -240.847 -17.869 111.797 1.00 0.00 ? 86  ILE A C    2  
ATOM 3180  O O    . ILE A 1 86  ? -240.940 -19.070 111.560 1.00 0.00 ? 86  ILE A O    2  
ATOM 3181  C CB   . ILE A 1 86  ? -242.295 -16.365 110.422 1.00 0.00 ? 86  ILE A CB   2  
ATOM 3182  C CG1  . ILE A 1 86  ? -241.152 -15.397 110.086 1.00 0.00 ? 86  ILE A CG1  2  
ATOM 3183  C CG2  . ILE A 1 86  ? -243.634 -15.654 110.388 1.00 0.00 ? 86  ILE A CG2  2  
ATOM 3184  C CD1  . ILE A 1 86  ? -241.335 -14.658 108.780 1.00 0.00 ? 86  ILE A CD1  2  
ATOM 3185  H H    . ILE A 1 86  ? -242.026 -14.999 112.534 1.00 0.00 ? 86  ILE A H    2  
ATOM 3186  H HA   . ILE A 1 86  ? -242.945 -17.590 112.049 1.00 0.00 ? 86  ILE A HA   2  
ATOM 3187  H HB   . ILE A 1 86  ? -242.315 -17.163 109.695 1.00 0.00 ? 86  ILE A HB   2  
ATOM 3188  H HG12 . ILE A 1 86  ? -241.073 -14.661 110.872 1.00 0.00 ? 86  ILE A HG12 2  
ATOM 3189  H HG13 . ILE A 1 86  ? -240.228 -15.953 110.027 1.00 0.00 ? 86  ILE A HG13 2  
ATOM 3190  H HG21 . ILE A 1 86  ? -243.666 -14.921 111.182 1.00 0.00 ? 86  ILE A HG21 2  
ATOM 3191  H HG22 . ILE A 1 86  ? -243.758 -15.163 109.435 1.00 0.00 ? 86  ILE A HG22 2  
ATOM 3192  H HG23 . ILE A 1 86  ? -244.425 -16.373 110.532 1.00 0.00 ? 86  ILE A HG23 2  
ATOM 3193  H HD11 . ILE A 1 86  ? -241.451 -15.368 107.976 1.00 0.00 ? 86  ILE A HD11 2  
ATOM 3194  H HD12 . ILE A 1 86  ? -242.216 -14.034 108.842 1.00 0.00 ? 86  ILE A HD12 2  
ATOM 3195  H HD13 . ILE A 1 86  ? -240.469 -14.039 108.595 1.00 0.00 ? 86  ILE A HD13 2  
ATOM 3196  N N    . MET A 1 87  ? -239.692 -17.282 112.070 1.00 0.00 ? 87  MET A N    2  
ATOM 3197  C CA   . MET A 1 87  ? -238.449 -18.034 112.075 1.00 0.00 ? 87  MET A CA   2  
ATOM 3198  C C    . MET A 1 87  ? -238.388 -18.962 113.275 1.00 0.00 ? 87  MET A C    2  
ATOM 3199  O O    . MET A 1 87  ? -237.663 -19.949 113.264 1.00 0.00 ? 87  MET A O    2  
ATOM 3200  C CB   . MET A 1 87  ? -237.239 -17.102 112.042 1.00 0.00 ? 87  MET A CB   2  
ATOM 3201  C CG   . MET A 1 87  ? -236.988 -16.515 110.662 1.00 0.00 ? 87  MET A CG   2  
ATOM 3202  S SD   . MET A 1 87  ? -236.710 -17.797 109.422 1.00 0.00 ? 87  MET A SD   2  
ATOM 3203  C CE   . MET A 1 87  ? -236.770 -16.841 107.910 1.00 0.00 ? 87  MET A CE   2  
ATOM 3204  H H    . MET A 1 87  ? -239.675 -16.324 112.272 1.00 0.00 ? 87  MET A H    2  
ATOM 3205  H HA   . MET A 1 87  ? -238.439 -18.640 111.181 1.00 0.00 ? 87  MET A HA   2  
ATOM 3206  H HB2  . MET A 1 87  ? -237.401 -16.290 112.736 1.00 0.00 ? 87  MET A HB2  2  
ATOM 3207  H HB3  . MET A 1 87  ? -236.360 -17.655 112.342 1.00 0.00 ? 87  MET A HB3  2  
ATOM 3208  H HG2  . MET A 1 87  ? -237.848 -15.929 110.372 1.00 0.00 ? 87  MET A HG2  2  
ATOM 3209  H HG3  . MET A 1 87  ? -236.116 -15.880 110.707 1.00 0.00 ? 87  MET A HG3  2  
ATOM 3210  H HE1  . MET A 1 87  ? -236.020 -16.065 107.946 1.00 0.00 ? 87  MET A HE1  2  
ATOM 3211  H HE2  . MET A 1 87  ? -236.577 -17.488 107.067 1.00 0.00 ? 87  MET A HE2  2  
ATOM 3212  H HE3  . MET A 1 87  ? -237.748 -16.394 107.804 1.00 0.00 ? 87  MET A HE3  2  
ATOM 3213  N N    . GLN A 1 88  ? -239.185 -18.668 114.295 1.00 0.00 ? 88  GLN A N    2  
ATOM 3214  C CA   . GLN A 1 88  ? -239.237 -19.527 115.469 1.00 0.00 ? 88  GLN A CA   2  
ATOM 3215  C C    . GLN A 1 88  ? -240.075 -20.741 115.121 1.00 0.00 ? 88  GLN A C    2  
ATOM 3216  O O    . GLN A 1 88  ? -239.789 -21.868 115.523 1.00 0.00 ? 88  GLN A O    2  
ATOM 3217  C CB   . GLN A 1 88  ? -239.842 -18.787 116.660 1.00 0.00 ? 88  GLN A CB   2  
ATOM 3218  C CG   . GLN A 1 88  ? -239.138 -17.482 116.968 1.00 0.00 ? 88  GLN A CG   2  
ATOM 3219  C CD   . GLN A 1 88  ? -239.847 -16.666 118.029 1.00 0.00 ? 88  GLN A CD   2  
ATOM 3220  O OE1  . GLN A 1 88  ? -241.061 -16.760 118.192 1.00 0.00 ? 88  GLN A OE1  2  
ATOM 3221  N NE2  . GLN A 1 88  ? -239.098 -15.840 118.741 1.00 0.00 ? 88  GLN A NE2  2  
ATOM 3222  H H    . GLN A 1 88  ? -239.789 -17.889 114.233 1.00 0.00 ? 88  GLN A H    2  
ATOM 3223  H HA   . GLN A 1 88  ? -238.231 -19.835 115.707 1.00 0.00 ? 88  GLN A HA   2  
ATOM 3224  H HB2  . GLN A 1 88  ? -240.879 -18.574 116.450 1.00 0.00 ? 88  GLN A HB2  2  
ATOM 3225  H HB3  . GLN A 1 88  ? -239.780 -19.420 117.533 1.00 0.00 ? 88  GLN A HB3  2  
ATOM 3226  H HG2  . GLN A 1 88  ? -238.137 -17.700 117.311 1.00 0.00 ? 88  GLN A HG2  2  
ATOM 3227  H HG3  . GLN A 1 88  ? -239.088 -16.906 116.060 1.00 0.00 ? 88  GLN A HG3  2  
ATOM 3228  H HE21 . GLN A 1 88  ? -238.140 -15.800 118.548 1.00 0.00 ? 88  GLN A HE21 2  
ATOM 3229  H HE22 . GLN A 1 88  ? -239.538 -15.292 119.424 1.00 0.00 ? 88  GLN A HE22 2  
ATOM 3230  N N    . ILE A 1 89  ? -241.103 -20.469 114.334 1.00 0.00 ? 89  ILE A N    2  
ATOM 3231  C CA   . ILE A 1 89  ? -241.996 -21.486 113.813 1.00 0.00 ? 89  ILE A CA   2  
ATOM 3232  C C    . ILE A 1 89  ? -241.236 -22.458 112.919 1.00 0.00 ? 89  ILE A C    2  
ATOM 3233  O O    . ILE A 1 89  ? -241.300 -23.673 113.089 1.00 0.00 ? 89  ILE A O    2  
ATOM 3234  C CB   . ILE A 1 89  ? -243.109 -20.828 112.994 1.00 0.00 ? 89  ILE A CB   2  
ATOM 3235  C CG1  . ILE A 1 89  ? -243.741 -19.699 113.809 1.00 0.00 ? 89  ILE A CG1  2  
ATOM 3236  C CG2  . ILE A 1 89  ? -244.155 -21.853 112.578 1.00 0.00 ? 89  ILE A CG2  2  
ATOM 3237  C CD1  . ILE A 1 89  ? -244.235 -20.116 115.179 1.00 0.00 ? 89  ILE A CD1  2  
ATOM 3238  H H    . ILE A 1 89  ? -241.274 -19.533 114.097 1.00 0.00 ? 89  ILE A H    2  
ATOM 3239  H HA   . ILE A 1 89  ? -242.450 -22.006 114.637 1.00 0.00 ? 89  ILE A HA   2  
ATOM 3240  H HB   . ILE A 1 89  ? -242.668 -20.412 112.095 1.00 0.00 ? 89  ILE A HB   2  
ATOM 3241  H HG12 . ILE A 1 89  ? -243.013 -18.915 113.947 1.00 0.00 ? 89  ILE A HG12 2  
ATOM 3242  H HG13 . ILE A 1 89  ? -244.569 -19.312 113.265 1.00 0.00 ? 89  ILE A HG13 2  
ATOM 3243  H HG21 . ILE A 1 89  ? -243.687 -22.621 111.979 1.00 0.00 ? 89  ILE A HG21 2  
ATOM 3244  H HG22 . ILE A 1 89  ? -244.592 -22.300 113.459 1.00 0.00 ? 89  ILE A HG22 2  
ATOM 3245  H HG23 . ILE A 1 89  ? -244.927 -21.366 112.000 1.00 0.00 ? 89  ILE A HG23 2  
ATOM 3246  H HD11 . ILE A 1 89  ? -244.940 -20.927 115.078 1.00 0.00 ? 89  ILE A HD11 2  
ATOM 3247  H HD12 . ILE A 1 89  ? -243.396 -20.439 115.780 1.00 0.00 ? 89  ILE A HD12 2  
ATOM 3248  H HD13 . ILE A 1 89  ? -244.716 -19.276 115.658 1.00 0.00 ? 89  ILE A HD13 2  
ATOM 3249  N N    . LEU A 1 90  ? -240.490 -21.893 111.982 1.00 0.00 ? 90  LEU A N    2  
ATOM 3250  C CA   . LEU A 1 90  ? -239.735 -22.670 111.010 1.00 0.00 ? 90  LEU A CA   2  
ATOM 3251  C C    . LEU A 1 90  ? -238.593 -23.437 111.675 1.00 0.00 ? 90  LEU A C    2  
ATOM 3252  O O    . LEU A 1 90  ? -238.149 -24.463 111.165 1.00 0.00 ? 90  LEU A O    2  
ATOM 3253  C CB   . LEU A 1 90  ? -239.198 -21.736 109.925 1.00 0.00 ? 90  LEU A CB   2  
ATOM 3254  C CG   . LEU A 1 90  ? -240.274 -20.989 109.130 1.00 0.00 ? 90  LEU A CG   2  
ATOM 3255  C CD1  . LEU A 1 90  ? -239.703 -19.729 108.507 1.00 0.00 ? 90  LEU A CD1  2  
ATOM 3256  C CD2  . LEU A 1 90  ? -240.867 -21.886 108.055 1.00 0.00 ? 90  LEU A CD2  2  
ATOM 3257  H H    . LEU A 1 90  ? -240.455 -20.913 111.933 1.00 0.00 ? 90  LEU A H    2  
ATOM 3258  H HA   . LEU A 1 90  ? -240.412 -23.379 110.557 1.00 0.00 ? 90  LEU A HA   2  
ATOM 3259  H HB2  . LEU A 1 90  ? -238.552 -21.007 110.393 1.00 0.00 ? 90  LEU A HB2  2  
ATOM 3260  H HB3  . LEU A 1 90  ? -238.611 -22.321 109.232 1.00 0.00 ? 90  LEU A HB3  2  
ATOM 3261  H HG   . LEU A 1 90  ? -241.071 -20.698 109.799 1.00 0.00 ? 90  LEU A HG   2  
ATOM 3262  H HD11 . LEU A 1 90  ? -238.888 -19.989 107.847 1.00 0.00 ? 90  LEU A HD11 2  
ATOM 3263  H HD12 . LEU A 1 90  ? -240.475 -19.223 107.949 1.00 0.00 ? 90  LEU A HD12 2  
ATOM 3264  H HD13 . LEU A 1 90  ? -239.341 -19.078 109.290 1.00 0.00 ? 90  LEU A HD13 2  
ATOM 3265  H HD21 . LEU A 1 90  ? -240.082 -22.223 107.394 1.00 0.00 ? 90  LEU A HD21 2  
ATOM 3266  H HD22 . LEU A 1 90  ? -241.338 -22.739 108.519 1.00 0.00 ? 90  LEU A HD22 2  
ATOM 3267  H HD23 . LEU A 1 90  ? -241.602 -21.332 107.488 1.00 0.00 ? 90  LEU A HD23 2  
ATOM 3268  N N    . SER A 1 91  ? -238.129 -22.945 112.820 1.00 0.00 ? 91  SER A N    2  
ATOM 3269  C CA   . SER A 1 91  ? -237.065 -23.614 113.561 1.00 0.00 ? 91  SER A CA   2  
ATOM 3270  C C    . SER A 1 91  ? -237.598 -24.808 114.354 1.00 0.00 ? 91  SER A C    2  
ATOM 3271  O O    . SER A 1 91  ? -236.824 -25.581 114.914 1.00 0.00 ? 91  SER A O    2  
ATOM 3272  C CB   . SER A 1 91  ? -236.364 -22.633 114.503 1.00 0.00 ? 91  SER A CB   2  
ATOM 3273  O OG   . SER A 1 91  ? -235.715 -21.601 113.779 1.00 0.00 ? 91  SER A OG   2  
ATOM 3274  H H    . SER A 1 91  ? -238.502 -22.109 113.169 1.00 0.00 ? 91  SER A H    2  
ATOM 3275  H HA   . SER A 1 91  ? -236.346 -23.975 112.840 1.00 0.00 ? 91  SER A HA   2  
ATOM 3276  H HB2  . SER A 1 91  ? -237.094 -22.187 115.162 1.00 0.00 ? 91  SER A HB2  2  
ATOM 3277  H HB3  . SER A 1 91  ? -235.627 -23.163 115.089 1.00 0.00 ? 91  SER A HB3  2  
ATOM 3278  H HG   . SER A 1 91  ? -236.373 -20.971 113.461 1.00 0.00 ? 91  SER A HG   2  
ATOM 3279  N N    . SER A 1 92  ? -238.918 -24.953 114.409 1.00 0.00 ? 92  SER A N    2  
ATOM 3280  C CA   . SER A 1 92  ? -239.519 -26.089 115.091 1.00 0.00 ? 92  SER A CA   2  
ATOM 3281  C C    . SER A 1 92  ? -239.313 -27.356 114.263 1.00 0.00 ? 92  SER A C    2  
ATOM 3282  O O    . SER A 1 92  ? -238.835 -28.368 114.778 1.00 0.00 ? 92  SER A O    2  
ATOM 3283  C CB   . SER A 1 92  ? -241.006 -25.832 115.339 1.00 0.00 ? 92  SER A CB   2  
ATOM 3284  O OG   . SER A 1 92  ? -241.192 -24.640 116.087 1.00 0.00 ? 92  SER A OG   2  
ATOM 3285  H H    . SER A 1 92  ? -239.497 -24.291 113.975 1.00 0.00 ? 92  SER A H    2  
ATOM 3286  H HA   . SER A 1 92  ? -239.018 -26.208 116.041 1.00 0.00 ? 92  SER A HA   2  
ATOM 3287  H HB2  . SER A 1 92  ? -241.515 -25.729 114.391 1.00 0.00 ? 92  SER A HB2  2  
ATOM 3288  H HB3  . SER A 1 92  ? -241.429 -26.659 115.889 1.00 0.00 ? 92  SER A HB3  2  
ATOM 3289  H HG   . SER A 1 92  ? -240.503 -24.006 115.860 1.00 0.00 ? 92  SER A HG   2  
ATOM 3290  N N    . TRP A 1 93  ? -239.680 -27.274 112.978 1.00 0.00 ? 93  TRP A N    2  
ATOM 3291  C CA   . TRP A 1 93  ? -239.409 -28.325 111.987 1.00 0.00 ? 93  TRP A CA   2  
ATOM 3292  C C    . TRP A 1 93  ? -240.254 -29.584 112.212 1.00 0.00 ? 93  TRP A C    2  
ATOM 3293  O O    . TRP A 1 93  ? -240.995 -30.007 111.326 1.00 0.00 ? 93  TRP A O    2  
ATOM 3294  C CB   . TRP A 1 93  ? -237.918 -28.686 111.978 1.00 0.00 ? 93  TRP A CB   2  
ATOM 3295  C CG   . TRP A 1 93  ? -237.516 -29.553 110.823 1.00 0.00 ? 93  TRP A CG   2  
ATOM 3296  C CD1  . TRP A 1 93  ? -237.401 -30.915 110.814 1.00 0.00 ? 93  TRP A CD1  2  
ATOM 3297  C CD2  . TRP A 1 93  ? -237.174 -29.113 109.505 1.00 0.00 ? 93  TRP A CD2  2  
ATOM 3298  N NE1  . TRP A 1 93  ? -237.007 -31.346 109.570 1.00 0.00 ? 93  TRP A NE1  2  
ATOM 3299  C CE2  . TRP A 1 93  ? -236.861 -30.258 108.749 1.00 0.00 ? 93  TRP A CE2  2  
ATOM 3300  C CE3  . TRP A 1 93  ? -237.100 -27.857 108.891 1.00 0.00 ? 93  TRP A CE3  2  
ATOM 3301  C CZ2  . TRP A 1 93  ? -236.485 -30.183 107.410 1.00 0.00 ? 93  TRP A CZ2  2  
ATOM 3302  C CZ3  . TRP A 1 93  ? -236.726 -27.787 107.563 1.00 0.00 ? 93  TRP A CZ3  2  
ATOM 3303  C CH2  . TRP A 1 93  ? -236.420 -28.943 106.835 1.00 0.00 ? 93  TRP A CH2  2  
ATOM 3304  H H    . TRP A 1 93  ? -240.152 -26.469 112.683 1.00 0.00 ? 93  TRP A H    2  
ATOM 3305  H HA   . TRP A 1 93  ? -239.664 -27.920 111.019 1.00 0.00 ? 93  TRP A HA   2  
ATOM 3306  H HB2  . TRP A 1 93  ? -237.335 -27.777 111.930 1.00 0.00 ? 93  TRP A HB2  2  
ATOM 3307  H HB3  . TRP A 1 93  ? -237.678 -29.212 112.890 1.00 0.00 ? 93  TRP A HB3  2  
ATOM 3308  H HD1  . TRP A 1 93  ? -237.595 -31.547 111.667 1.00 0.00 ? 93  TRP A HD1  2  
ATOM 3309  H HE1  . TRP A 1 93  ? -236.858 -32.277 109.312 1.00 0.00 ? 93  TRP A HE1  2  
ATOM 3310  H HE3  . TRP A 1 93  ? -237.332 -26.954 109.436 1.00 0.00 ? 93  TRP A HE3  2  
ATOM 3311  H HZ2  . TRP A 1 93  ? -236.246 -31.065 106.834 1.00 0.00 ? 93  TRP A HZ2  2  
ATOM 3312  H HZ3  . TRP A 1 93  ? -236.664 -26.826 107.073 1.00 0.00 ? 93  TRP A HZ3  2  
ATOM 3313  H HH2  . TRP A 1 93  ? -236.132 -28.840 105.799 1.00 0.00 ? 93  TRP A HH2  2  
ATOM 3314  N N    . PHE A 1 94  ? -240.131 -30.176 113.389 1.00 0.00 ? 94  PHE A N    2  
ATOM 3315  C CA   . PHE A 1 94  ? -240.790 -31.439 113.691 1.00 0.00 ? 94  PHE A CA   2  
ATOM 3316  C C    . PHE A 1 94  ? -242.300 -31.258 113.828 1.00 0.00 ? 94  PHE A C    2  
ATOM 3317  O O    . PHE A 1 94  ? -242.770 -30.270 114.392 1.00 0.00 ? 94  PHE A O    2  
ATOM 3318  C CB   . PHE A 1 94  ? -240.208 -32.045 114.970 1.00 0.00 ? 94  PHE A CB   2  
ATOM 3319  C CG   . PHE A 1 94  ? -238.740 -32.353 114.870 1.00 0.00 ? 94  PHE A CG   2  
ATOM 3320  C CD1  . PHE A 1 94  ? -238.300 -33.491 114.212 1.00 0.00 ? 94  PHE A CD1  2  
ATOM 3321  C CD2  . PHE A 1 94  ? -237.798 -31.503 115.428 1.00 0.00 ? 94  PHE A CD2  2  
ATOM 3322  C CE1  . PHE A 1 94  ? -236.952 -33.776 114.115 1.00 0.00 ? 94  PHE A CE1  2  
ATOM 3323  C CE2  . PHE A 1 94  ? -236.448 -31.781 115.333 1.00 0.00 ? 94  PHE A CE2  2  
ATOM 3324  C CZ   . PHE A 1 94  ? -236.025 -32.920 114.676 1.00 0.00 ? 94  PHE A CZ   2  
ATOM 3325  H H    . PHE A 1 94  ? -239.585 -29.743 114.084 1.00 0.00 ? 94  PHE A H    2  
ATOM 3326  H HA   . PHE A 1 94  ? -240.596 -32.113 112.870 1.00 0.00 ? 94  PHE A HA   2  
ATOM 3327  H HB2  . PHE A 1 94  ? -240.348 -31.351 115.786 1.00 0.00 ? 94  PHE A HB2  2  
ATOM 3328  H HB3  . PHE A 1 94  ? -240.728 -32.965 115.194 1.00 0.00 ? 94  PHE A HB3  2  
ATOM 3329  H HD1  . PHE A 1 94  ? -239.025 -34.162 113.773 1.00 0.00 ? 94  PHE A HD1  2  
ATOM 3330  H HD2  . PHE A 1 94  ? -238.129 -30.612 115.942 1.00 0.00 ? 94  PHE A HD2  2  
ATOM 3331  H HE1  . PHE A 1 94  ? -236.622 -34.666 113.600 1.00 0.00 ? 94  PHE A HE1  2  
ATOM 3332  H HE2  . PHE A 1 94  ? -235.725 -31.110 115.771 1.00 0.00 ? 94  PHE A HE2  2  
ATOM 3333  H HZ   . PHE A 1 94  ? -234.970 -33.140 114.600 1.00 0.00 ? 94  PHE A HZ   2  
ATOM 3334  N N    . PRO A 1 95  ? -243.076 -32.215 113.295 1.00 0.00 ? 95  PRO A N    2  
ATOM 3335  C CA   . PRO A 1 95  ? -244.540 -32.178 113.347 1.00 0.00 ? 95  PRO A CA   2  
ATOM 3336  C C    . PRO A 1 95  ? -245.078 -32.304 114.770 1.00 0.00 ? 95  PRO A C    2  
ATOM 3337  O O    . PRO A 1 95  ? -244.773 -33.265 115.476 1.00 0.00 ? 95  PRO A O    2  
ATOM 3338  C CB   . PRO A 1 95  ? -244.971 -33.392 112.509 1.00 0.00 ? 95  PRO A CB   2  
ATOM 3339  C CG   . PRO A 1 95  ? -243.761 -33.787 111.734 1.00 0.00 ? 95  PRO A CG   2  
ATOM 3340  C CD   . PRO A 1 95  ? -242.589 -33.407 112.588 1.00 0.00 ? 95  PRO A CD   2  
ATOM 3341  H HA   . PRO A 1 95  ? -244.927 -31.275 112.898 1.00 0.00 ? 95  PRO A HA   2  
ATOM 3342  H HB2  . PRO A 1 95  ? -245.293 -34.187 113.166 1.00 0.00 ? 95  PRO A HB2  2  
ATOM 3343  H HB3  . PRO A 1 95  ? -245.782 -33.110 111.855 1.00 0.00 ? 95  PRO A HB3  2  
ATOM 3344  H HG2  . PRO A 1 95  ? -243.768 -34.852 111.557 1.00 0.00 ? 95  PRO A HG2  2  
ATOM 3345  H HG3  . PRO A 1 95  ? -243.732 -33.249 110.798 1.00 0.00 ? 95  PRO A HG3  2  
ATOM 3346  H HD2  . PRO A 1 95  ? -242.352 -34.201 113.282 1.00 0.00 ? 95  PRO A HD2  2  
ATOM 3347  H HD3  . PRO A 1 95  ? -241.733 -33.170 111.974 1.00 0.00 ? 95  PRO A HD3  2  
ATOM 3348  N N    . GLU A 1 96  ? -245.868 -31.317 115.179 1.00 0.00 ? 96  GLU A N    2  
ATOM 3349  C CA   . GLU A 1 96  ? -246.525 -31.336 116.485 1.00 0.00 ? 96  GLU A CA   2  
ATOM 3350  C C    . GLU A 1 96  ? -247.532 -32.476 116.538 1.00 0.00 ? 96  GLU A C    2  
ATOM 3351  O O    . GLU A 1 96  ? -247.616 -33.221 117.514 1.00 0.00 ? 96  GLU A O    2  
ATOM 3352  C CB   . GLU A 1 96  ? -247.272 -30.024 116.704 1.00 0.00 ? 96  GLU A CB   2  
ATOM 3353  C CG   . GLU A 1 96  ? -246.513 -28.798 116.241 1.00 0.00 ? 96  GLU A CG   2  
ATOM 3354  C CD   . GLU A 1 96  ? -247.405 -27.582 116.167 1.00 0.00 ? 96  GLU A CD   2  
ATOM 3355  O OE1  . GLU A 1 96  ? -247.577 -26.908 117.199 1.00 0.00 ? 96  GLU A OE1  2  
ATOM 3356  O OE2  . GLU A 1 96  ? -247.944 -27.297 115.072 1.00 0.00 ? 96  GLU A OE2  2  
ATOM 3357  H H    . GLU A 1 96  ? -246.002 -30.545 114.594 1.00 0.00 ? 96  GLU A H    2  
ATOM 3358  H HA   . GLU A 1 96  ? -245.780 -31.468 117.254 1.00 0.00 ? 96  GLU A HA   2  
ATOM 3359  H HB2  . GLU A 1 96  ? -248.208 -30.064 116.167 1.00 0.00 ? 96  GLU A HB2  2  
ATOM 3360  H HB3  . GLU A 1 96  ? -247.479 -29.914 117.759 1.00 0.00 ? 96  GLU A HB3  2  
ATOM 3361  H HG2  . GLU A 1 96  ? -245.710 -28.599 116.934 1.00 0.00 ? 96  GLU A HG2  2  
ATOM 3362  H HG3  . GLU A 1 96  ? -246.106 -28.989 115.259 1.00 0.00 ? 96  GLU A HG3  2  
ATOM 3363  N N    . GLU A 1 97  ? -248.300 -32.574 115.468 1.00 0.00 ? 97  GLU A N    2  
ATOM 3364  C CA   . GLU A 1 97  ? -249.320 -33.594 115.321 1.00 0.00 ? 97  GLU A CA   2  
ATOM 3365  C C    . GLU A 1 97  ? -249.190 -34.188 113.926 1.00 0.00 ? 97  GLU A C    2  
ATOM 3366  O O    . GLU A 1 97  ? -248.895 -35.370 113.760 1.00 0.00 ? 97  GLU A O    2  
ATOM 3367  C CB   . GLU A 1 97  ? -250.703 -32.959 115.552 1.00 0.00 ? 97  GLU A CB   2  
ATOM 3368  C CG   . GLU A 1 97  ? -251.886 -33.918 115.478 1.00 0.00 ? 97  GLU A CG   2  
ATOM 3369  C CD   . GLU A 1 97  ? -252.336 -34.197 114.057 1.00 0.00 ? 97  GLU A CD   2  
ATOM 3370  O OE1  . GLU A 1 97  ? -252.420 -33.237 113.261 1.00 0.00 ? 97  GLU A OE1  2  
ATOM 3371  O OE2  . GLU A 1 97  ? -252.617 -35.371 113.744 1.00 0.00 ? 97  GLU A OE2  2  
ATOM 3372  H H    . GLU A 1 97  ? -248.169 -31.937 114.740 1.00 0.00 ? 97  GLU A H    2  
ATOM 3373  H HA   . GLU A 1 97  ? -249.144 -34.363 116.057 1.00 0.00 ? 97  GLU A HA   2  
ATOM 3374  H HB2  . GLU A 1 97  ? -250.710 -32.503 116.530 1.00 0.00 ? 97  GLU A HB2  2  
ATOM 3375  H HB3  . GLU A 1 97  ? -250.853 -32.186 114.812 1.00 0.00 ? 97  GLU A HB3  2  
ATOM 3376  H HG2  . GLU A 1 97  ? -251.602 -34.853 115.937 1.00 0.00 ? 97  GLU A HG2  2  
ATOM 3377  H HG3  . GLU A 1 97  ? -252.713 -33.488 116.023 1.00 0.00 ? 97  GLU A HG3  2  
ATOM 3378  N N    . GLY A 1 98  ? -249.375 -33.339 112.928 1.00 0.00 ? 98  GLY A N    2  
ATOM 3379  C CA   . GLY A 1 98  ? -249.136 -33.731 111.560 1.00 0.00 ? 98  GLY A CA   2  
ATOM 3380  C C    . GLY A 1 98  ? -248.200 -32.763 110.869 1.00 0.00 ? 98  GLY A C    2  
ATOM 3381  O O    . GLY A 1 98  ? -247.790 -31.763 111.463 1.00 0.00 ? 98  GLY A O    2  
ATOM 3382  H H    . GLY A 1 98  ? -249.699 -32.438 113.123 1.00 0.00 ? 98  GLY A H    2  
ATOM 3383  H HA2  . GLY A 1 98  ? -248.697 -34.719 111.547 1.00 0.00 ? 98  GLY A HA2  2  
ATOM 3384  H HA3  . GLY A 1 98  ? -250.075 -33.752 111.029 1.00 0.00 ? 98  GLY A HA3  2  
ATOM 3385  N N    . TYR A 1 99  ? -247.869 -33.045 109.619 1.00 0.00 ? 99  TYR A N    2  
ATOM 3386  C CA   . TYR A 1 99  ? -246.966 -32.190 108.850 1.00 0.00 ? 99  TYR A CA   2  
ATOM 3387  C C    . TYR A 1 99  ? -247.765 -31.168 108.050 1.00 0.00 ? 99  TYR A C    2  
ATOM 3388  O O    . TYR A 1 99  ? -247.211 -30.357 107.312 1.00 0.00 ? 99  TYR A O    2  
ATOM 3389  C CB   . TYR A 1 99  ? -246.105 -33.039 107.902 1.00 0.00 ? 99  TYR A CB   2  
ATOM 3390  C CG   . TYR A 1 99  ? -246.899 -33.744 106.819 1.00 0.00 ? 99  TYR A CG   2  
ATOM 3391  C CD1  . TYR A 1 99  ? -247.529 -34.958 107.066 1.00 0.00 ? 99  TYR A CD1  2  
ATOM 3392  C CD2  . TYR A 1 99  ? -247.024 -33.187 105.551 1.00 0.00 ? 99  TYR A CD2  2  
ATOM 3393  C CE1  . TYR A 1 99  ? -248.258 -35.596 106.080 1.00 0.00 ? 99  TYR A CE1  2  
ATOM 3394  C CE2  . TYR A 1 99  ? -247.753 -33.818 104.563 1.00 0.00 ? 99  TYR A CE2  2  
ATOM 3395  C CZ   . TYR A 1 99  ? -248.368 -35.020 104.832 1.00 0.00 ? 99  TYR A CZ   2  
ATOM 3396  O OH   . TYR A 1 99  ? -249.097 -35.649 103.852 1.00 0.00 ? 99  TYR A OH   2  
ATOM 3397  H H    . TYR A 1 99  ? -248.247 -33.844 109.195 1.00 0.00 ? 99  TYR A H    2  
ATOM 3398  H HA   . TYR A 1 99  ? -246.323 -31.670 109.546 1.00 0.00 ? 99  TYR A HA   2  
ATOM 3399  H HB2  . TYR A 1 99  ? -245.381 -32.401 107.418 1.00 0.00 ? 99  TYR A HB2  2  
ATOM 3400  H HB3  . TYR A 1 99  ? -245.585 -33.792 108.478 1.00 0.00 ? 99  TYR A HB3  2  
ATOM 3401  H HD1  . TYR A 1 99  ? -247.442 -35.405 108.045 1.00 0.00 ? 99  TYR A HD1  2  
ATOM 3402  H HD2  . TYR A 1 99  ? -246.540 -32.243 105.343 1.00 0.00 ? 99  TYR A HD2  2  
ATOM 3403  H HE1  . TYR A 1 99  ? -248.740 -36.538 106.291 1.00 0.00 ? 99  TYR A HE1  2  
ATOM 3404  H HE2  . TYR A 1 99  ? -247.837 -33.367 103.585 1.00 0.00 ? 99  TYR A HE2  2  
ATOM 3405  H HH   . TYR A 1 99  ? -248.603 -35.637 103.028 1.00 0.00 ? 99  TYR A HH   2  
ATOM 3406  N N    . MET A 1 100 ? -249.076 -31.225 108.206 1.00 0.00 ? 100 MET A N    2  
ATOM 3407  C CA   . MET A 1 100 ? -249.985 -30.399 107.432 1.00 0.00 ? 100 MET A CA   2  
ATOM 3408  C C    . MET A 1 100 ? -250.069 -28.991 108.005 1.00 0.00 ? 100 MET A C    2  
ATOM 3409  O O    . MET A 1 100 ? -250.472 -28.805 109.152 1.00 0.00 ? 100 MET A O    2  
ATOM 3410  C CB   . MET A 1 100 ? -251.384 -31.023 107.411 1.00 0.00 ? 100 MET A CB   2  
ATOM 3411  C CG   . MET A 1 100 ? -251.425 -32.457 106.903 1.00 0.00 ? 100 MET A CG   2  
ATOM 3412  S SD   . MET A 1 100 ? -250.793 -33.659 108.095 1.00 0.00 ? 100 MET A SD   2  
ATOM 3413  C CE   . MET A 1 100 ? -251.981 -33.492 109.431 1.00 0.00 ? 100 MET A CE   2  
ATOM 3414  H H    . MET A 1 100 ? -249.447 -31.846 108.868 1.00 0.00 ? 100 MET A H    2  
ATOM 3415  H HA   . MET A 1 100 ? -249.609 -30.344 106.421 1.00 0.00 ? 100 MET A HA   2  
ATOM 3416  H HB2  . MET A 1 100 ? -251.780 -31.012 108.415 1.00 0.00 ? 100 MET A HB2  2  
ATOM 3417  H HB3  . MET A 1 100 ? -252.021 -30.422 106.779 1.00 0.00 ? 100 MET A HB3  2  
ATOM 3418  H HG2  . MET A 1 100 ? -252.448 -32.710 106.671 1.00 0.00 ? 100 MET A HG2  2  
ATOM 3419  H HG3  . MET A 1 100 ? -250.830 -32.520 106.002 1.00 0.00 ? 100 MET A HG3  2  
ATOM 3420  H HE1  . MET A 1 100 ? -252.973 -33.705 109.060 1.00 0.00 ? 100 MET A HE1  2  
ATOM 3421  H HE2  . MET A 1 100 ? -251.734 -34.186 110.220 1.00 0.00 ? 100 MET A HE2  2  
ATOM 3422  H HE3  . MET A 1 100 ? -251.950 -32.484 109.816 1.00 0.00 ? 100 MET A HE3  2  
ATOM 3423  N N    . GLY A 1 101 ? -249.687 -28.005 107.208 1.00 0.00 ? 101 GLY A N    2  
ATOM 3424  C CA   . GLY A 1 101 ? -249.805 -26.628 107.634 1.00 0.00 ? 101 GLY A CA   2  
ATOM 3425  C C    . GLY A 1 101 ? -249.486 -25.648 106.526 1.00 0.00 ? 101 GLY A C    2  
ATOM 3426  O O    . GLY A 1 101 ? -248.788 -25.988 105.572 1.00 0.00 ? 101 GLY A O    2  
ATOM 3427  H H    . GLY A 1 101 ? -249.298 -28.211 106.330 1.00 0.00 ? 101 GLY A H    2  
ATOM 3428  H HA2  . GLY A 1 101 ? -250.817 -26.454 107.973 1.00 0.00 ? 101 GLY A HA2  2  
ATOM 3429  H HA3  . GLY A 1 101 ? -249.128 -26.458 108.456 1.00 0.00 ? 101 GLY A HA3  2  
ATOM 3430  N N    . ARG A 1 102 ? -250.032 -24.444 106.634 1.00 0.00 ? 102 ARG A N    2  
ATOM 3431  C CA   . ARG A 1 102 ? -249.704 -23.356 105.722 1.00 0.00 ? 102 ARG A CA   2  
ATOM 3432  C C    . ARG A 1 102 ? -250.072 -22.029 106.360 1.00 0.00 ? 102 ARG A C    2  
ATOM 3433  O O    . ARG A 1 102 ? -251.008 -21.963 107.160 1.00 0.00 ? 102 ARG A O    2  
ATOM 3434  C CB   . ARG A 1 102 ? -250.413 -23.496 104.361 1.00 0.00 ? 102 ARG A CB   2  
ATOM 3435  C CG   . ARG A 1 102 ? -251.921 -23.229 104.373 1.00 0.00 ? 102 ARG A CG   2  
ATOM 3436  C CD   . ARG A 1 102 ? -252.689 -24.333 105.082 1.00 0.00 ? 102 ARG A CD   2  
ATOM 3437  N NE   . ARG A 1 102 ? -252.494 -25.643 104.449 1.00 0.00 ? 102 ARG A NE   2  
ATOM 3438  C CZ   . ARG A 1 102 ? -253.242 -26.715 104.715 1.00 0.00 ? 102 ARG A CZ   2  
ATOM 3439  N NH1  . ARG A 1 102 ? -254.224 -26.636 105.606 1.00 0.00 ? 102 ARG A NH1  2  
ATOM 3440  N NH2  . ARG A 1 102 ? -253.000 -27.869 104.097 1.00 0.00 ? 102 ARG A NH2  2  
ATOM 3441  H H    . ARG A 1 102 ? -250.675 -24.277 107.357 1.00 0.00 ? 102 ARG A H    2  
ATOM 3442  H HA   . ARG A 1 102 ? -248.635 -23.376 105.563 1.00 0.00 ? 102 ARG A HA   2  
ATOM 3443  H HB2  . ARG A 1 102 ? -249.962 -22.803 103.668 1.00 0.00 ? 102 ARG A HB2  2  
ATOM 3444  H HB3  . ARG A 1 102 ? -250.253 -24.499 103.995 1.00 0.00 ? 102 ARG A HB3  2  
ATOM 3445  H HG2  . ARG A 1 102 ? -252.115 -22.285 104.876 1.00 0.00 ? 102 ARG A HG2  2  
ATOM 3446  H HG3  . ARG A 1 102 ? -252.267 -23.166 103.351 1.00 0.00 ? 102 ARG A HG3  2  
ATOM 3447  H HD2  . ARG A 1 102 ? -252.350 -24.388 106.106 1.00 0.00 ? 102 ARG A HD2  2  
ATOM 3448  H HD3  . ARG A 1 102 ? -253.742 -24.089 105.065 1.00 0.00 ? 102 ARG A HD3  2  
ATOM 3449  H HE   . ARG A 1 102 ? -251.764 -25.722 103.798 1.00 0.00 ? 102 ARG A HE   2  
ATOM 3450  H HH11 . ARG A 1 102 ? -254.403 -25.770 106.081 1.00 0.00 ? 102 ARG A HH11 2  
ATOM 3451  H HH12 . ARG A 1 102 ? -254.786 -27.436 105.820 1.00 0.00 ? 102 ARG A HH12 2  
ATOM 3452  H HH21 . ARG A 1 102 ? -252.254 -27.936 103.430 1.00 0.00 ? 102 ARG A HH21 2  
ATOM 3453  H HH22 . ARG A 1 102 ? -253.560 -28.675 104.293 1.00 0.00 ? 102 ARG A HH22 2  
ATOM 3454  N N    . ILE A 1 103 ? -249.335 -20.985 106.013 1.00 0.00 ? 103 ILE A N    2  
ATOM 3455  C CA   . ILE A 1 103 ? -249.614 -19.660 106.538 1.00 0.00 ? 103 ILE A CA   2  
ATOM 3456  C C    . ILE A 1 103 ? -250.717 -19.005 105.772 1.00 0.00 ? 103 ILE A C    2  
ATOM 3457  O O    . ILE A 1 103 ? -250.712 -18.949 104.542 1.00 0.00 ? 103 ILE A O    2  
ATOM 3458  C CB   . ILE A 1 103 ? -248.387 -18.723 106.515 1.00 0.00 ? 103 ILE A CB   2  
ATOM 3459  C CG1  . ILE A 1 103 ? -247.212 -19.350 107.271 1.00 0.00 ? 103 ILE A CG1  2  
ATOM 3460  C CG2  . ILE A 1 103 ? -248.743 -17.368 107.117 1.00 0.00 ? 103 ILE A CG2  2  
ATOM 3461  C CD1  . ILE A 1 103 ? -246.049 -18.402 107.475 1.00 0.00 ? 103 ILE A CD1  2  
ATOM 3462  H H    . ILE A 1 103 ? -248.591 -21.108 105.390 1.00 0.00 ? 103 ILE A H    2  
ATOM 3463  H HA   . ILE A 1 103 ? -249.953 -19.758 107.557 1.00 0.00 ? 103 ILE A HA   2  
ATOM 3464  H HB   . ILE A 1 103 ? -248.109 -18.561 105.481 1.00 0.00 ? 103 ILE A HB   2  
ATOM 3465  H HG12 . ILE A 1 103 ? -247.550 -19.674 108.243 1.00 0.00 ? 103 ILE A HG12 2  
ATOM 3466  H HG13 . ILE A 1 103 ? -246.852 -20.205 106.717 1.00 0.00 ? 103 ILE A HG13 2  
ATOM 3467  H HG21 . ILE A 1 103 ? -249.551 -16.925 106.556 1.00 0.00 ? 103 ILE A HG21 2  
ATOM 3468  H HG22 . ILE A 1 103 ? -249.048 -17.499 108.146 1.00 0.00 ? 103 ILE A HG22 2  
ATOM 3469  H HG23 . ILE A 1 103 ? -247.880 -16.718 107.078 1.00 0.00 ? 103 ILE A HG23 2  
ATOM 3470  H HD11 . ILE A 1 103 ? -246.398 -17.517 107.992 1.00 0.00 ? 103 ILE A HD11 2  
ATOM 3471  H HD12 . ILE A 1 103 ? -245.286 -18.889 108.064 1.00 0.00 ? 103 ILE A HD12 2  
ATOM 3472  H HD13 . ILE A 1 103 ? -245.642 -18.121 106.515 1.00 0.00 ? 103 ILE A HD13 2  
ATOM 3473  N N    . VAL A 1 104 ? -251.659 -18.509 106.523 1.00 0.00 ? 104 VAL A N    2  
ATOM 3474  C CA   . VAL A 1 104 ? -252.699 -17.716 105.980 1.00 0.00 ? 104 VAL A CA   2  
ATOM 3475  C C    . VAL A 1 104 ? -252.520 -16.324 106.491 1.00 0.00 ? 104 VAL A C    2  
ATOM 3476  O O    . VAL A 1 104 ? -252.396 -16.125 107.700 1.00 0.00 ? 104 VAL A O    2  
ATOM 3477  C CB   . VAL A 1 104 ? -254.102 -18.175 106.406 1.00 0.00 ? 104 VAL A CB   2  
ATOM 3478  C CG1  . VAL A 1 104 ? -255.114 -17.264 105.787 1.00 0.00 ? 104 VAL A CG1  2  
ATOM 3479  C CG2  . VAL A 1 104 ? -254.407 -19.575 105.979 1.00 0.00 ? 104 VAL A CG2  2  
ATOM 3480  H H    . VAL A 1 104 ? -251.621 -18.644 107.493 1.00 0.00 ? 104 VAL A H    2  
ATOM 3481  H HA   . VAL A 1 104 ? -252.630 -17.729 104.901 1.00 0.00 ? 104 VAL A HA   2  
ATOM 3482  H HB   . VAL A 1 104 ? -254.190 -18.116 107.491 1.00 0.00 ? 104 VAL A HB   2  
ATOM 3483  H HG11 . VAL A 1 104 ? -254.907 -16.253 106.093 1.00 0.00 ? 104 VAL A HG11 2  
ATOM 3484  H HG12 . VAL A 1 104 ? -255.039 -17.345 104.716 1.00 0.00 ? 104 VAL A HG12 2  
ATOM 3485  H HG13 . VAL A 1 104 ? -256.099 -17.554 106.108 1.00 0.00 ? 104 VAL A HG13 2  
ATOM 3486  H HG21 . VAL A 1 104 ? -254.252 -19.665 104.918 1.00 0.00 ? 104 VAL A HG21 2  
ATOM 3487  H HG22 . VAL A 1 104 ? -253.771 -20.263 106.508 1.00 0.00 ? 104 VAL A HG22 2  
ATOM 3488  H HG23 . VAL A 1 104 ? -255.443 -19.776 106.214 1.00 0.00 ? 104 VAL A HG23 2  
ATOM 3489  N N    . LEU A 1 105 ? -252.469 -15.364 105.610 1.00 0.00 ? 105 LEU A N    2  
ATOM 3490  C CA   . LEU A 1 105 ? -252.671 -14.027 106.055 1.00 0.00 ? 105 LEU A CA   2  
ATOM 3491  C C    . LEU A 1 105 ? -254.151 -13.925 106.342 1.00 0.00 ? 105 LEU A C    2  
ATOM 3492  O O    . LEU A 1 105 ? -254.980 -13.900 105.437 1.00 0.00 ? 105 LEU A O    2  
ATOM 3493  C CB   . LEU A 1 105 ? -252.259 -13.013 105.008 1.00 0.00 ? 105 LEU A CB   2  
ATOM 3494  C CG   . LEU A 1 105 ? -252.007 -11.629 105.569 1.00 0.00 ? 105 LEU A CG   2  
ATOM 3495  C CD1  . LEU A 1 105 ? -250.882 -11.712 106.575 1.00 0.00 ? 105 LEU A CD1  2  
ATOM 3496  C CD2  . LEU A 1 105 ? -251.682 -10.639 104.463 1.00 0.00 ? 105 LEU A CD2  2  
ATOM 3497  H H    . LEU A 1 105 ? -252.321 -15.557 104.666 1.00 0.00 ? 105 LEU A H    2  
ATOM 3498  H HA   . LEU A 1 105 ? -252.101 -13.870 106.976 1.00 0.00 ? 105 LEU A HA   2  
ATOM 3499  H HB2  . LEU A 1 105 ? -251.359 -13.363 104.524 1.00 0.00 ? 105 LEU A HB2  2  
ATOM 3500  H HB3  . LEU A 1 105 ? -253.048 -12.951 104.280 1.00 0.00 ? 105 LEU A HB3  2  
ATOM 3501  H HG   . LEU A 1 105 ? -252.894 -11.286 106.085 1.00 0.00 ? 105 LEU A HG   2  
ATOM 3502  H HD11 . LEU A 1 105 ? -251.142 -12.424 107.349 1.00 0.00 ? 105 LEU A HD11 2  
ATOM 3503  H HD12 . LEU A 1 105 ? -249.981 -12.039 106.079 1.00 0.00 ? 105 LEU A HD12 2  
ATOM 3504  H HD13 . LEU A 1 105 ? -250.721 -10.741 107.017 1.00 0.00 ? 105 LEU A HD13 2  
ATOM 3505  H HD21 . LEU A 1 105 ? -250.822 -10.987 103.909 1.00 0.00 ? 105 LEU A HD21 2  
ATOM 3506  H HD22 . LEU A 1 105 ? -252.528 -10.552 103.797 1.00 0.00 ? 105 LEU A HD22 2  
ATOM 3507  H HD23 . LEU A 1 105 ? -251.463 -9.673  104.896 1.00 0.00 ? 105 LEU A HD23 2  
ATOM 3508  N N    . LYS A 1 106 ? -254.470 -13.931 107.598 1.00 0.00 ? 106 LYS A N    2  
ATOM 3509  C CA   . LYS A 1 106 ? -255.839 -13.976 108.030 1.00 0.00 ? 106 LYS A CA   2  
ATOM 3510  C C    . LYS A 1 106 ? -256.335 -12.552 108.243 1.00 0.00 ? 106 LYS A C    2  
ATOM 3511  O O    . LYS A 1 106 ? -255.597 -11.588 108.020 1.00 0.00 ? 106 LYS A O    2  
ATOM 3512  C CB   . LYS A 1 106 ? -255.961 -14.762 109.331 1.00 0.00 ? 106 LYS A CB   2  
ATOM 3513  C CG   . LYS A 1 106 ? -255.815 -16.264 109.166 1.00 0.00 ? 106 LYS A CG   2  
ATOM 3514  C CD   . LYS A 1 106 ? -257.068 -16.901 108.580 1.00 0.00 ? 106 LYS A CD   2  
ATOM 3515  C CE   . LYS A 1 106 ? -256.976 -18.419 108.619 1.00 0.00 ? 106 LYS A CE   2  
ATOM 3516  N NZ   . LYS A 1 106 ? -258.200 -19.085 108.098 1.00 0.00 ? 106 LYS A NZ   2  
ATOM 3517  H H    . LYS A 1 106 ? -253.755 -13.874 108.260 1.00 0.00 ? 106 LYS A H    2  
ATOM 3518  H HA   . LYS A 1 106 ? -256.413 -14.487 107.253 1.00 0.00 ? 106 LYS A HA   2  
ATOM 3519  H HB2  . LYS A 1 106 ? -255.195 -14.423 110.014 1.00 0.00 ? 106 LYS A HB2  2  
ATOM 3520  H HB3  . LYS A 1 106 ? -256.929 -14.563 109.766 1.00 0.00 ? 106 LYS A HB3  2  
ATOM 3521  H HG2  . LYS A 1 106 ? -254.983 -16.464 108.506 1.00 0.00 ? 106 LYS A HG2  2  
ATOM 3522  H HG3  . LYS A 1 106 ? -255.618 -16.703 110.134 1.00 0.00 ? 106 LYS A HG3  2  
ATOM 3523  H HD2  . LYS A 1 106 ? -257.926 -16.585 109.154 1.00 0.00 ? 106 LYS A HD2  2  
ATOM 3524  H HD3  . LYS A 1 106 ? -257.178 -16.583 107.553 1.00 0.00 ? 106 LYS A HD3  2  
ATOM 3525  H HE2  . LYS A 1 106 ? -256.132 -18.728 108.022 1.00 0.00 ? 106 LYS A HE2  2  
ATOM 3526  H HE3  . LYS A 1 106 ? -256.820 -18.727 109.642 1.00 0.00 ? 106 LYS A HE3  2  
ATOM 3527  H HZ1  . LYS A 1 106 ? -258.387 -18.787 107.123 1.00 0.00 ? 106 LYS A HZ1  2  
ATOM 3528  H HZ2  . LYS A 1 106 ? -258.070 -20.129 108.112 1.00 0.00 ? 106 LYS A HZ2  2  
ATOM 3529  H HZ3  . LYS A 1 106 ? -259.019 -18.847 108.689 1.00 0.00 ? 106 LYS A HZ3  2  
ATOM 3530  N N    . THR A 1 107 ? -257.551 -12.421 108.723 1.00 0.00 ? 107 THR A N    2  
ATOM 3531  C CA   . THR A 1 107 ? -258.130 -11.138 109.003 1.00 0.00 ? 107 THR A CA   2  
ATOM 3532  C C    . THR A 1 107 ? -258.738 -11.185 110.400 1.00 0.00 ? 107 THR A C    2  
ATOM 3533  O O    . THR A 1 107 ? -259.428 -12.141 110.752 1.00 0.00 ? 107 THR A O    2  
ATOM 3534  C CB   . THR A 1 107 ? -259.240 -10.789 107.986 1.00 0.00 ? 107 THR A CB   2  
ATOM 3535  O OG1  . THR A 1 107 ? -260.188 -11.862 107.912 1.00 0.00 ? 107 THR A OG1  2  
ATOM 3536  C CG2  . THR A 1 107 ? -258.664 -10.534 106.606 1.00 0.00 ? 107 THR A CG2  2  
ATOM 3537  H H    . THR A 1 107 ? -258.074 -13.211 108.927 1.00 0.00 ? 107 THR A H    2  
ATOM 3538  H HA   . THR A 1 107 ? -257.341 -10.374 108.949 1.00 0.00 ? 107 THR A HA   2  
ATOM 3539  H HB   . THR A 1 107 ? -259.744 -9.894  108.321 1.00 0.00 ? 107 THR A HB   2  
ATOM 3540  H HG1  . THR A 1 107 ? -261.037 -11.572 108.282 1.00 0.00 ? 107 THR A HG1  2  
ATOM 3541  H HG21 . THR A 1 107 ? -258.099 -11.397 106.285 1.00 0.00 ? 107 THR A HG21 2  
ATOM 3542  H HG22 . THR A 1 107 ? -259.468 -10.351 105.908 1.00 0.00 ? 107 THR A HG22 2  
ATOM 3543  H HG23 . THR A 1 107 ? -258.015 -9.672  106.642 1.00 0.00 ? 107 THR A HG23 2  
ATOM 3544  N N    . GLN A 1 108 ? -258.460 -10.175 111.192 1.00 0.00 ? 108 GLN A N    2  
ATOM 3545  C CA   . GLN A 1 108 ? -259.081 -10.004 112.512 1.00 0.00 ? 108 GLN A CA   2  
ATOM 3546  C C    . GLN A 1 108 ? -260.522 -9.521  112.322 1.00 0.00 ? 108 GLN A C    2  
ATOM 3547  O O    . GLN A 1 108 ? -261.214 -9.135  113.257 1.00 0.00 ? 108 GLN A O    2  
ATOM 3548  C CB   . GLN A 1 108 ? -258.256 -8.986  113.313 1.00 0.00 ? 108 GLN A CB   2  
ATOM 3549  C CG   . GLN A 1 108 ? -258.197 -9.221  114.811 1.00 0.00 ? 108 GLN A CG   2  
ATOM 3550  C CD   . GLN A 1 108 ? -259.382 -8.651  115.571 1.00 0.00 ? 108 GLN A CD   2  
ATOM 3551  O OE1  . GLN A 1 108 ? -259.813 -9.215  116.577 1.00 0.00 ? 108 GLN A OE1  2  
ATOM 3552  N NE2  . GLN A 1 108 ? -259.890 -7.511  115.127 1.00 0.00 ? 108 GLN A NE2  2  
ATOM 3553  H H    . GLN A 1 108 ? -257.787 -9.531  110.898 1.00 0.00 ? 108 GLN A H    2  
ATOM 3554  H HA   . GLN A 1 108 ? -259.082 -10.957 113.017 1.00 0.00 ? 108 GLN A HA   2  
ATOM 3555  H HB2  . GLN A 1 108 ? -257.245 -8.996  112.938 1.00 0.00 ? 108 GLN A HB2  2  
ATOM 3556  H HB3  . GLN A 1 108 ? -258.674 -8.003  113.146 1.00 0.00 ? 108 GLN A HB3  2  
ATOM 3557  H HG2  . GLN A 1 108 ? -258.150 -10.283 114.993 1.00 0.00 ? 108 GLN A HG2  2  
ATOM 3558  H HG3  . GLN A 1 108 ? -257.294 -8.754  115.184 1.00 0.00 ? 108 GLN A HG3  2  
ATOM 3559  H HE21 . GLN A 1 108 ? -259.478 -7.086  114.331 1.00 0.00 ? 108 GLN A HE21 2  
ATOM 3560  H HE22 . GLN A 1 108 ? -260.659 -7.137  115.597 1.00 0.00 ? 108 GLN A HE22 2  
ATOM 3561  N N    . GLN A 1 109 ? -260.963 -9.616  111.087 1.00 0.00 ? 109 GLN A N    2  
ATOM 3562  C CA   . GLN A 1 109 ? -262.205 -9.032  110.642 1.00 0.00 ? 109 GLN A CA   2  
ATOM 3563  C C    . GLN A 1 109 ? -262.985 -10.037 109.801 1.00 0.00 ? 109 GLN A C    2  
ATOM 3564  O O    . GLN A 1 109 ? -262.401 -10.967 109.239 1.00 0.00 ? 109 GLN A O    2  
ATOM 3565  C CB   . GLN A 1 109 ? -261.878 -7.764  109.842 1.00 0.00 ? 109 GLN A CB   2  
ATOM 3566  C CG   . GLN A 1 109 ? -262.745 -7.548  108.614 1.00 0.00 ? 109 GLN A CG   2  
ATOM 3567  C CD   . GLN A 1 109 ? -262.438 -6.247  107.904 1.00 0.00 ? 109 GLN A CD   2  
ATOM 3568  O OE1  . GLN A 1 109 ? -261.576 -6.192  107.026 1.00 0.00 ? 109 GLN A OE1  2  
ATOM 3569  N NE2  . GLN A 1 109 ? -263.149 -5.196  108.271 1.00 0.00 ? 109 GLN A NE2  2  
ATOM 3570  H H    . GLN A 1 109 ? -260.435 -10.129 110.448 1.00 0.00 ? 109 GLN A H    2  
ATOM 3571  H HA   . GLN A 1 109 ? -262.787 -8.766  111.511 1.00 0.00 ? 109 GLN A HA   2  
ATOM 3572  H HB2  . GLN A 1 109 ? -261.992 -6.913  110.490 1.00 0.00 ? 109 GLN A HB2  2  
ATOM 3573  H HB3  . GLN A 1 109 ? -260.849 -7.820  109.519 1.00 0.00 ? 109 GLN A HB3  2  
ATOM 3574  H HG2  . GLN A 1 109 ? -262.576 -8.365  107.928 1.00 0.00 ? 109 GLN A HG2  2  
ATOM 3575  H HG3  . GLN A 1 109 ? -263.781 -7.541  108.918 1.00 0.00 ? 109 GLN A HG3  2  
ATOM 3576  H HE21 . GLN A 1 109 ? -263.827 -5.318  108.970 1.00 0.00 ? 109 GLN A HE21 2  
ATOM 3577  H HE22 . GLN A 1 109 ? -262.970 -4.342  107.831 1.00 0.00 ? 109 GLN A HE22 2  
ATOM 3578  N N    . GLU A 1 110 ? -264.294 -9.849  109.723 1.00 0.00 ? 110 GLU A N    2  
ATOM 3579  C CA   . GLU A 1 110 ? -265.154 -10.710 108.925 1.00 0.00 ? 110 GLU A CA   2  
ATOM 3580  C C    . GLU A 1 110 ? -265.228 -10.224 107.477 1.00 0.00 ? 110 GLU A C    2  
ATOM 3581  O O    . GLU A 1 110 ? -264.432 -10.639 106.632 1.00 0.00 ? 110 GLU A O    2  
ATOM 3582  C CB   . GLU A 1 110 ? -266.562 -10.782 109.537 1.00 0.00 ? 110 GLU A CB   2  
ATOM 3583  C CG   . GLU A 1 110 ? -267.027 -9.498  110.221 1.00 0.00 ? 110 GLU A CG   2  
ATOM 3584  C CD   . GLU A 1 110 ? -266.879 -8.265  109.352 1.00 0.00 ? 110 GLU A CD   2  
ATOM 3585  O OE1  . GLU A 1 110 ? -267.717 -8.064  108.455 1.00 0.00 ? 110 GLU A OE1  2  
ATOM 3586  O OE2  . GLU A 1 110 ? -265.909 -7.505  109.569 1.00 0.00 ? 110 GLU A OE2  2  
ATOM 3587  H H    . GLU A 1 110 ? -264.697 -9.084  110.195 1.00 0.00 ? 110 GLU A H    2  
ATOM 3588  H HA   . GLU A 1 110 ? -264.722 -11.700 108.933 1.00 0.00 ? 110 GLU A HA   2  
ATOM 3589  H HB2  . GLU A 1 110 ? -267.265 -11.014 108.753 1.00 0.00 ? 110 GLU A HB2  2  
ATOM 3590  H HB3  . GLU A 1 110 ? -266.580 -11.578 110.267 1.00 0.00 ? 110 GLU A HB3  2  
ATOM 3591  H HG2  . GLU A 1 110 ? -268.067 -9.606  110.485 1.00 0.00 ? 110 GLU A HG2  2  
ATOM 3592  H HG3  . GLU A 1 110 ? -266.445 -9.357  111.121 1.00 0.00 ? 110 GLU A HG3  2  
ATOM 3593  N N    . GLY A 1 1   ? -229.326 -11.429 102.025 1.00 0.00 ? 1   GLY A N    3  
ATOM 3594  C CA   . GLY A 1 1   ? -228.068 -11.250 101.265 1.00 0.00 ? 1   GLY A CA   3  
ATOM 3595  C C    . GLY A 1 1   ? -226.877 -11.615 102.112 1.00 0.00 ? 1   GLY A C    3  
ATOM 3596  O O    . GLY A 1 1   ? -226.802 -11.201 103.266 1.00 0.00 ? 1   GLY A O    3  
ATOM 3597  H H1   . GLY A 1 1   ? -229.318 -10.830 102.874 1.00 0.00 ? 1   GLY A H1   3  
ATOM 3598  H H2   . GLY A 1 1   ? -230.144 -11.180 101.439 1.00 0.00 ? 1   GLY A H2   3  
ATOM 3599  H H3   . GLY A 1 1   ? -229.418 -12.429 102.325 1.00 0.00 ? 1   GLY A H3   3  
ATOM 3600  H HA2  . GLY A 1 1   ? -228.086 -11.884 100.392 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3601  H HA3  . GLY A 1 1   ? -227.984 -10.218 100.954 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3602  N N    . GLU A 1 2   ? -225.956 -12.388 101.544 1.00 0.00 ? 2   GLU A N    3  
ATOM 3603  C CA   . GLU A 1 2   ? -224.810 -12.893 102.294 1.00 0.00 ? 2   GLU A CA   3  
ATOM 3604  C C    . GLU A 1 2   ? -225.289 -13.682 103.507 1.00 0.00 ? 2   GLU A C    3  
ATOM 3605  O O    . GLU A 1 2   ? -224.878 -13.413 104.637 1.00 0.00 ? 2   GLU A O    3  
ATOM 3606  C CB   . GLU A 1 2   ? -223.892 -11.743 102.724 1.00 0.00 ? 2   GLU A CB   3  
ATOM 3607  C CG   . GLU A 1 2   ? -223.261 -11.006 101.557 1.00 0.00 ? 2   GLU A CG   3  
ATOM 3608  C CD   . GLU A 1 2   ? -222.398 -11.912 100.707 1.00 0.00 ? 2   GLU A CD   3  
ATOM 3609  O OE1  . GLU A 1 2   ? -221.196 -12.054 101.014 1.00 0.00 ? 2   GLU A OE1  3  
ATOM 3610  O OE2  . GLU A 1 2   ? -222.917 -12.497 99.736  1.00 0.00 ? 2   GLU A OE2  3  
ATOM 3611  H H    . GLU A 1 2   ? -226.045 -12.621 100.594 1.00 0.00 ? 2   GLU A H    3  
ATOM 3612  H HA   . GLU A 1 2   ? -224.259 -13.557 101.644 1.00 0.00 ? 2   GLU A HA   3  
ATOM 3613  H HB2  . GLU A 1 2   ? -224.468 -11.036 103.301 1.00 0.00 ? 2   GLU A HB2  3  
ATOM 3614  H HB3  . GLU A 1 2   ? -223.099 -12.141 103.341 1.00 0.00 ? 2   GLU A HB3  3  
ATOM 3615  H HG2  . GLU A 1 2   ? -224.044 -10.593 100.939 1.00 0.00 ? 2   GLU A HG2  3  
ATOM 3616  H HG3  . GLU A 1 2   ? -222.647 -10.204 101.942 1.00 0.00 ? 2   GLU A HG3  3  
ATOM 3617  N N    . GLU A 1 3   ? -226.161 -14.654 103.240 1.00 0.00 ? 3   GLU A N    3  
ATOM 3618  C CA   . GLU A 1 3   ? -226.825 -15.446 104.277 1.00 0.00 ? 3   GLU A CA   3  
ATOM 3619  C C    . GLU A 1 3   ? -225.823 -16.111 105.223 1.00 0.00 ? 3   GLU A C    3  
ATOM 3620  O O    . GLU A 1 3   ? -225.355 -17.223 104.969 1.00 0.00 ? 3   GLU A O    3  
ATOM 3621  C CB   . GLU A 1 3   ? -227.703 -16.522 103.629 1.00 0.00 ? 3   GLU A CB   3  
ATOM 3622  C CG   . GLU A 1 3   ? -228.695 -15.990 102.607 1.00 0.00 ? 3   GLU A CG   3  
ATOM 3623  C CD   . GLU A 1 3   ? -229.722 -15.056 103.212 1.00 0.00 ? 3   GLU A CD   3  
ATOM 3624  O OE1  . GLU A 1 3   ? -230.505 -15.510 104.069 1.00 0.00 ? 3   GLU A OE1  3  
ATOM 3625  O OE2  . GLU A 1 3   ? -229.753 -13.865 102.835 1.00 0.00 ? 3   GLU A OE2  3  
ATOM 3626  H H    . GLU A 1 3   ? -226.372 -14.843 102.304 1.00 0.00 ? 3   GLU A H    3  
ATOM 3627  H HA   . GLU A 1 3   ? -227.454 -14.779 104.845 1.00 0.00 ? 3   GLU A HA   3  
ATOM 3628  H HB2  . GLU A 1 3   ? -227.064 -17.239 103.136 1.00 0.00 ? 3   GLU A HB2  3  
ATOM 3629  H HB3  . GLU A 1 3   ? -228.259 -17.028 104.404 1.00 0.00 ? 3   GLU A HB3  3  
ATOM 3630  H HG2  . GLU A 1 3   ? -228.151 -15.454 101.845 1.00 0.00 ? 3   GLU A HG2  3  
ATOM 3631  H HG3  . GLU A 1 3   ? -229.210 -16.827 102.157 1.00 0.00 ? 3   GLU A HG3  3  
ATOM 3632  N N    . ARG A 1 4   ? -225.502 -15.423 106.311 1.00 0.00 ? 4   ARG A N    3  
ATOM 3633  C CA   . ARG A 1 4   ? -224.570 -15.930 107.315 1.00 0.00 ? 4   ARG A CA   3  
ATOM 3634  C C    . ARG A 1 4   ? -224.944 -15.398 108.694 1.00 0.00 ? 4   ARG A C    3  
ATOM 3635  O O    . ARG A 1 4   ? -225.438 -16.138 109.544 1.00 0.00 ? 4   ARG A O    3  
ATOM 3636  C CB   . ARG A 1 4   ? -223.124 -15.530 106.977 1.00 0.00 ? 4   ARG A CB   3  
ATOM 3637  C CG   . ARG A 1 4   ? -222.551 -16.235 105.756 1.00 0.00 ? 4   ARG A CG   3  
ATOM 3638  C CD   . ARG A 1 4   ? -221.146 -15.757 105.431 1.00 0.00 ? 4   ARG A CD   3  
ATOM 3639  N NE   . ARG A 1 4   ? -221.103 -14.335 105.100 1.00 0.00 ? 4   ARG A NE   3  
ATOM 3640  C CZ   . ARG A 1 4   ? -220.990 -13.862 103.854 1.00 0.00 ? 4   ARG A CZ   3  
ATOM 3641  N NH1  . ARG A 1 4   ? -220.977 -14.692 102.814 1.00 0.00 ? 4   ARG A NH1  3  
ATOM 3642  N NH2  . ARG A 1 4   ? -220.906 -12.553 103.646 1.00 0.00 ? 4   ARG A NH2  3  
ATOM 3643  H H    . ARG A 1 4   ? -225.905 -14.535 106.442 1.00 0.00 ? 4   ARG A H    3  
ATOM 3644  H HA   . ARG A 1 4   ? -224.644 -17.008 107.324 1.00 0.00 ? 4   ARG A HA   3  
ATOM 3645  H HB2  . ARG A 1 4   ? -223.094 -14.466 106.795 1.00 0.00 ? 4   ARG A HB2  3  
ATOM 3646  H HB3  . ARG A 1 4   ? -222.494 -15.756 107.824 1.00 0.00 ? 4   ARG A HB3  3  
ATOM 3647  H HG2  . ARG A 1 4   ? -222.522 -17.297 105.948 1.00 0.00 ? 4   ARG A HG2  3  
ATOM 3648  H HG3  . ARG A 1 4   ? -223.193 -16.040 104.908 1.00 0.00 ? 4   ARG A HG3  3  
ATOM 3649  H HD2  . ARG A 1 4   ? -220.511 -15.937 106.286 1.00 0.00 ? 4   ARG A HD2  3  
ATOM 3650  H HD3  . ARG A 1 4   ? -220.775 -16.323 104.587 1.00 0.00 ? 4   ARG A HD3  3  
ATOM 3651  H HE   . ARG A 1 4   ? -221.138 -13.702 105.848 1.00 0.00 ? 4   ARG A HE   3  
ATOM 3652  H HH11 . ARG A 1 4   ? -221.055 -15.688 102.955 1.00 0.00 ? 4   ARG A HH11 3  
ATOM 3653  H HH12 . ARG A 1 4   ? -220.890 -14.329 101.880 1.00 0.00 ? 4   ARG A HH12 3  
ATOM 3654  H HH21 . ARG A 1 4   ? -220.926 -11.915 104.415 1.00 0.00 ? 4   ARG A HH21 3  
ATOM 3655  H HH22 . ARG A 1 4   ? -220.825 -12.197 102.703 1.00 0.00 ? 4   ARG A HH22 3  
ATOM 3656  N N    . LYS A 1 5   ? -224.708 -14.109 108.909 1.00 0.00 ? 5   LYS A N    3  
ATOM 3657  C CA   . LYS A 1 5   ? -225.064 -13.458 110.166 1.00 0.00 ? 5   LYS A CA   3  
ATOM 3658  C C    . LYS A 1 5   ? -225.267 -11.963 109.931 1.00 0.00 ? 5   LYS A C    3  
ATOM 3659  O O    . LYS A 1 5   ? -224.952 -11.131 110.785 1.00 0.00 ? 5   LYS A O    3  
ATOM 3660  C CB   . LYS A 1 5   ? -223.972 -13.676 111.221 1.00 0.00 ? 5   LYS A CB   3  
ATOM 3661  C CG   . LYS A 1 5   ? -224.433 -13.358 112.639 1.00 0.00 ? 5   LYS A CG   3  
ATOM 3662  C CD   . LYS A 1 5   ? -223.262 -13.095 113.572 1.00 0.00 ? 5   LYS A CD   3  
ATOM 3663  C CE   . LYS A 1 5   ? -222.472 -11.866 113.148 1.00 0.00 ? 5   LYS A CE   3  
ATOM 3664  N NZ   . LYS A 1 5   ? -223.331 -10.653 113.052 1.00 0.00 ? 5   LYS A NZ   3  
ATOM 3665  H H    . LYS A 1 5   ? -224.285 -13.580 108.202 1.00 0.00 ? 5   LYS A H    3  
ATOM 3666  H HA   . LYS A 1 5   ? -225.990 -13.889 110.517 1.00 0.00 ? 5   LYS A HA   3  
ATOM 3667  H HB2  . LYS A 1 5   ? -223.656 -14.709 111.192 1.00 0.00 ? 5   LYS A HB2  3  
ATOM 3668  H HB3  . LYS A 1 5   ? -223.128 -13.044 110.991 1.00 0.00 ? 5   LYS A HB3  3  
ATOM 3669  H HG2  . LYS A 1 5   ? -225.059 -12.479 112.612 1.00 0.00 ? 5   LYS A HG2  3  
ATOM 3670  H HG3  . LYS A 1 5   ? -225.004 -14.195 113.018 1.00 0.00 ? 5   LYS A HG3  3  
ATOM 3671  H HD2  . LYS A 1 5   ? -223.640 -12.938 114.572 1.00 0.00 ? 5   LYS A HD2  3  
ATOM 3672  H HD3  . LYS A 1 5   ? -222.608 -13.954 113.565 1.00 0.00 ? 5   LYS A HD3  3  
ATOM 3673  H HE2  . LYS A 1 5   ? -221.693 -11.688 113.874 1.00 0.00 ? 5   LYS A HE2  3  
ATOM 3674  H HE3  . LYS A 1 5   ? -222.027 -12.057 112.183 1.00 0.00 ? 5   LYS A HE3  3  
ATOM 3675  H HZ1  . LYS A 1 5   ? -223.830 -10.491 113.955 1.00 0.00 ? 5   LYS A HZ1  3  
ATOM 3676  H HZ2  . LYS A 1 5   ? -222.745 -9.815  112.846 1.00 0.00 ? 5   LYS A HZ2  3  
ATOM 3677  H HZ3  . LYS A 1 5   ? -224.037 -10.762 112.293 1.00 0.00 ? 5   LYS A HZ3  3  
ATOM 3678  N N    . CYS A 1 6   ? -225.806 -11.628 108.771 1.00 0.00 ? 6   CYS A N    3  
ATOM 3679  C CA   . CYS A 1 6   ? -226.035 -10.243 108.407 1.00 0.00 ? 6   CYS A CA   3  
ATOM 3680  C C    . CYS A 1 6   ? -227.105 -10.149 107.330 1.00 0.00 ? 6   CYS A C    3  
ATOM 3681  O O    . CYS A 1 6   ? -226.874 -10.524 106.182 1.00 0.00 ? 6   CYS A O    3  
ATOM 3682  C CB   . CYS A 1 6   ? -224.735 -9.593  107.917 1.00 0.00 ? 6   CYS A CB   3  
ATOM 3683  S SG   . CYS A 1 6   ? -224.873 -7.822  107.578 1.00 0.00 ? 6   CYS A SG   3  
ATOM 3684  H H    . CYS A 1 6   ? -226.084 -12.335 108.145 1.00 0.00 ? 6   CYS A H    3  
ATOM 3685  H HA   . CYS A 1 6   ? -226.379 -9.719  109.288 1.00 0.00 ? 6   CYS A HA   3  
ATOM 3686  H HB2  . CYS A 1 6   ? -223.971 -9.723  108.668 1.00 0.00 ? 6   CYS A HB2  3  
ATOM 3687  H HB3  . CYS A 1 6   ? -224.423 -10.080 107.005 1.00 0.00 ? 6   CYS A HB3  3  
ATOM 3688  H HG   . CYS A 1 6   ? -223.711 -7.259  107.890 1.00 0.00 ? 6   CYS A HG   3  
ATOM 3689  N N    . LEU A 1 7   ? -228.280 -9.666  107.724 1.00 0.00 ? 7   LEU A N    3  
ATOM 3690  C CA   . LEU A 1 7   ? -229.382 -9.425  106.804 1.00 0.00 ? 7   LEU A CA   3  
ATOM 3691  C C    . LEU A 1 7   ? -229.763 -10.664 105.993 1.00 0.00 ? 7   LEU A C    3  
ATOM 3692  O O    . LEU A 1 7   ? -229.826 -10.613 104.760 1.00 0.00 ? 7   LEU A O    3  
ATOM 3693  C CB   . LEU A 1 7   ? -229.013 -8.278  105.878 1.00 0.00 ? 7   LEU A CB   3  
ATOM 3694  C CG   . LEU A 1 7   ? -228.993 -6.896  106.526 1.00 0.00 ? 7   LEU A CG   3  
ATOM 3695  C CD1  . LEU A 1 7   ? -228.504 -5.854  105.535 1.00 0.00 ? 7   LEU A CD1  3  
ATOM 3696  C CD2  . LEU A 1 7   ? -230.376 -6.532  107.049 1.00 0.00 ? 7   LEU A CD2  3  
ATOM 3697  H H    . LEU A 1 7   ? -228.402 -9.448  108.657 1.00 0.00 ? 7   LEU A H    3  
ATOM 3698  H HA   . LEU A 1 7   ? -230.237 -9.125  107.392 1.00 0.00 ? 7   LEU A HA   3  
ATOM 3699  H HB2  . LEU A 1 7   ? -228.026 -8.479  105.491 1.00 0.00 ? 7   LEU A HB2  3  
ATOM 3700  H HB3  . LEU A 1 7   ? -229.712 -8.262  105.059 1.00 0.00 ? 7   LEU A HB3  3  
ATOM 3701  H HG   . LEU A 1 7   ? -228.310 -6.909  107.363 1.00 0.00 ? 7   LEU A HG   3  
ATOM 3702  H HD11 . LEU A 1 7   ? -229.149 -5.850  104.669 1.00 0.00 ? 7   LEU A HD11 3  
ATOM 3703  H HD12 . LEU A 1 7   ? -228.519 -4.878  105.997 1.00 0.00 ? 7   LEU A HD12 3  
ATOM 3704  H HD13 . LEU A 1 7   ? -227.496 -6.090  105.231 1.00 0.00 ? 7   LEU A HD13 3  
ATOM 3705  H HD21 . LEU A 1 7   ? -231.084 -6.540  106.232 1.00 0.00 ? 7   LEU A HD21 3  
ATOM 3706  H HD22 . LEU A 1 7   ? -230.680 -7.253  107.795 1.00 0.00 ? 7   LEU A HD22 3  
ATOM 3707  H HD23 . LEU A 1 7   ? -230.347 -5.546  107.490 1.00 0.00 ? 7   LEU A HD23 3  
ATOM 3708  N N    . GLN A 1 8   ? -230.021 -11.771 106.687 1.00 0.00 ? 8   GLN A N    3  
ATOM 3709  C CA   . GLN A 1 8   ? -230.542 -12.972 106.038 1.00 0.00 ? 8   GLN A CA   3  
ATOM 3710  C C    . GLN A 1 8   ? -231.902 -12.679 105.418 1.00 0.00 ? 8   GLN A C    3  
ATOM 3711  O O    . GLN A 1 8   ? -232.866 -12.374 106.118 1.00 0.00 ? 8   GLN A O    3  
ATOM 3712  C CB   . GLN A 1 8   ? -230.668 -14.137 107.030 1.00 0.00 ? 8   GLN A CB   3  
ATOM 3713  C CG   . GLN A 1 8   ? -229.375 -14.899 107.283 1.00 0.00 ? 8   GLN A CG   3  
ATOM 3714  C CD   . GLN A 1 8   ? -228.351 -14.105 108.064 1.00 0.00 ? 8   GLN A CD   3  
ATOM 3715  O OE1  . GLN A 1 8   ? -227.494 -13.431 107.494 1.00 0.00 ? 8   GLN A OE1  3  
ATOM 3716  N NE2  . GLN A 1 8   ? -228.434 -14.185 109.379 1.00 0.00 ? 8   GLN A NE2  3  
ATOM 3717  H H    . GLN A 1 8   ? -229.844 -11.783 107.650 1.00 0.00 ? 8   GLN A H    3  
ATOM 3718  H HA   . GLN A 1 8   ? -229.853 -13.249 105.255 1.00 0.00 ? 8   GLN A HA   3  
ATOM 3719  H HB2  . GLN A 1 8   ? -231.015 -13.749 107.975 1.00 0.00 ? 8   GLN A HB2  3  
ATOM 3720  H HB3  . GLN A 1 8   ? -231.398 -14.836 106.650 1.00 0.00 ? 8   GLN A HB3  3  
ATOM 3721  H HG2  . GLN A 1 8   ? -229.605 -15.796 107.838 1.00 0.00 ? 8   GLN A HG2  3  
ATOM 3722  H HG3  . GLN A 1 8   ? -228.945 -15.175 106.331 1.00 0.00 ? 8   GLN A HG3  3  
ATOM 3723  H HE21 . GLN A 1 8   ? -229.143 -14.737 109.763 1.00 0.00 ? 8   GLN A HE21 3  
ATOM 3724  H HE22 . GLN A 1 8   ? -227.778 -13.695 109.918 1.00 0.00 ? 8   GLN A HE22 3  
ATOM 3725  N N    . THR A 1 9   ? -231.971 -12.763 104.104 1.00 0.00 ? 9   THR A N    3  
ATOM 3726  C CA   . THR A 1 9   ? -233.192 -12.444 103.385 1.00 0.00 ? 9   THR A CA   3  
ATOM 3727  C C    . THR A 1 9   ? -233.852 -13.716 102.870 1.00 0.00 ? 9   THR A C    3  
ATOM 3728  O O    . THR A 1 9   ? -233.474 -14.251 101.827 1.00 0.00 ? 9   THR A O    3  
ATOM 3729  C CB   . THR A 1 9   ? -232.911 -11.487 102.207 1.00 0.00 ? 9   THR A CB   3  
ATOM 3730  O OG1  . THR A 1 9   ? -231.906 -12.041 101.345 1.00 0.00 ? 9   THR A OG1  3  
ATOM 3731  C CG2  . THR A 1 9   ? -232.448 -10.126 102.708 1.00 0.00 ? 9   THR A CG2  3  
ATOM 3732  H H    . THR A 1 9   ? -231.179 -13.074 103.601 1.00 0.00 ? 9   THR A H    3  
ATOM 3733  H HA   . THR A 1 9   ? -233.875 -11.948 104.070 1.00 0.00 ? 9   THR A HA   3  
ATOM 3734  H HB   . THR A 1 9   ? -233.824 -11.353 101.650 1.00 0.00 ? 9   THR A HB   3  
ATOM 3735  H HG1  . THR A 1 9   ? -232.053 -12.993 101.257 1.00 0.00 ? 9   THR A HG1  3  
ATOM 3736  H HG21 . THR A 1 9   ? -231.546 -10.245 103.289 1.00 0.00 ? 9   THR A HG21 3  
ATOM 3737  H HG22 . THR A 1 9   ? -232.251 -9.482  101.863 1.00 0.00 ? 9   THR A HG22 3  
ATOM 3738  H HG23 . THR A 1 9   ? -233.220 -9.690  103.324 1.00 0.00 ? 9   THR A HG23 3  
ATOM 3739  N N    . HIS A 1 10  ? -234.818 -14.218 103.623 1.00 0.00 ? 10  HIS A N    3  
ATOM 3740  C CA   . HIS A 1 10  ? -235.533 -15.426 103.235 1.00 0.00 ? 10  HIS A CA   3  
ATOM 3741  C C    . HIS A 1 10  ? -236.971 -15.099 102.894 1.00 0.00 ? 10  HIS A C    3  
ATOM 3742  O O    . HIS A 1 10  ? -237.589 -14.255 103.523 1.00 0.00 ? 10  HIS A O    3  
ATOM 3743  C CB   . HIS A 1 10  ? -235.493 -16.476 104.345 1.00 0.00 ? 10  HIS A CB   3  
ATOM 3744  C CG   . HIS A 1 10  ? -234.140 -17.079 104.562 1.00 0.00 ? 10  HIS A CG   3  
ATOM 3745  N ND1  . HIS A 1 10  ? -233.780 -18.310 104.068 1.00 0.00 ? 10  HIS A ND1  3  
ATOM 3746  C CD2  . HIS A 1 10  ? -233.058 -16.608 105.219 1.00 0.00 ? 10  HIS A CD2  3  
ATOM 3747  C CE1  . HIS A 1 10  ? -232.536 -18.571 104.412 1.00 0.00 ? 10  HIS A CE1  3  
ATOM 3748  N NE2  . HIS A 1 10  ? -232.070 -17.553 105.110 1.00 0.00 ? 10  HIS A NE2  3  
ATOM 3749  H H    . HIS A 1 10  ? -235.065 -13.761 104.453 1.00 0.00 ? 10  HIS A H    3  
ATOM 3750  H HA   . HIS A 1 10  ? -235.055 -15.823 102.356 1.00 0.00 ? 10  HIS A HA   3  
ATOM 3751  H HB2  . HIS A 1 10  ? -235.805 -16.021 105.270 1.00 0.00 ? 10  HIS A HB2  3  
ATOM 3752  H HB3  . HIS A 1 10  ? -236.179 -17.274 104.098 1.00 0.00 ? 10  HIS A HB3  3  
ATOM 3753  H HD1  . HIS A 1 10  ? -234.357 -18.906 103.530 1.00 0.00 ? 10  HIS A HD1  3  
ATOM 3754  H HD2  . HIS A 1 10  ? -232.983 -15.660 105.731 1.00 0.00 ? 10  HIS A HD2  3  
ATOM 3755  H HE1  . HIS A 1 10  ? -231.986 -19.467 104.163 1.00 0.00 ? 10  HIS A HE1  3  
ATOM 3756  H HE2  . HIS A 1 10  ? -231.110 -17.369 105.241 1.00 0.00 ? 10  HIS A HE2  3  
ATOM 3757  N N    . ARG A 1 11  ? -237.488 -15.758 101.885 1.00 0.00 ? 11  ARG A N    3  
ATOM 3758  C CA   . ARG A 1 11  ? -238.843 -15.566 101.461 1.00 0.00 ? 11  ARG A CA   3  
ATOM 3759  C C    . ARG A 1 11  ? -239.770 -16.544 102.173 1.00 0.00 ? 11  ARG A C    3  
ATOM 3760  O O    . ARG A 1 11  ? -239.415 -17.703 102.392 1.00 0.00 ? 11  ARG A O    3  
ATOM 3761  C CB   . ARG A 1 11  ? -238.911 -15.746 99.964  1.00 0.00 ? 11  ARG A CB   3  
ATOM 3762  C CG   . ARG A 1 11  ? -239.708 -14.656 99.313  1.00 0.00 ? 11  ARG A CG   3  
ATOM 3763  C CD   . ARG A 1 11  ? -239.272 -14.434 97.886  1.00 0.00 ? 11  ARG A CD   3  
ATOM 3764  N NE   . ARG A 1 11  ? -240.219 -13.615 97.125  1.00 0.00 ? 11  ARG A NE   3  
ATOM 3765  C CZ   . ARG A 1 11  ? -240.009 -13.207 95.875  1.00 0.00 ? 11  ARG A CZ   3  
ATOM 3766  N NH1  . ARG A 1 11  ? -238.882 -13.531 95.250  1.00 0.00 ? 11  ARG A NH1  3  
ATOM 3767  N NH2  . ARG A 1 11  ? -240.934 -12.483 95.245  1.00 0.00 ? 11  ARG A NH2  3  
ATOM 3768  H H    . ARG A 1 11  ? -236.938 -16.385 101.391 1.00 0.00 ? 11  ARG A H    3  
ATOM 3769  H HA   . ARG A 1 11  ? -239.132 -14.555 101.699 1.00 0.00 ? 11  ARG A HA   3  
ATOM 3770  H HB2  . ARG A 1 11  ? -237.909 -15.734 99.559  1.00 0.00 ? 11  ARG A HB2  3  
ATOM 3771  H HB3  . ARG A 1 11  ? -239.378 -16.692 99.741  1.00 0.00 ? 11  ARG A HB3  3  
ATOM 3772  H HG2  . ARG A 1 11  ? -240.749 -14.920 99.336  1.00 0.00 ? 11  ARG A HG2  3  
ATOM 3773  H HG3  . ARG A 1 11  ? -239.557 -13.747 99.880  1.00 0.00 ? 11  ARG A HG3  3  
ATOM 3774  H HD2  . ARG A 1 11  ? -238.315 -13.939 97.904  1.00 0.00 ? 11  ARG A HD2  3  
ATOM 3775  H HD3  . ARG A 1 11  ? -239.169 -15.395 97.406  1.00 0.00 ? 11  ARG A HD3  3  
ATOM 3776  H HE   . ARG A 1 11  ? -241.065 -13.365 97.570  1.00 0.00 ? 11  ARG A HE   3  
ATOM 3777  H HH11 . ARG A 1 11  ? -238.187 -14.086 95.717  1.00 0.00 ? 11  ARG A HH11 3  
ATOM 3778  H HH12 . ARG A 1 11  ? -238.718 -13.223 94.303  1.00 0.00 ? 11  ARG A HH12 3  
ATOM 3779  H HH21 . ARG A 1 11  ? -241.790 -12.239 95.710  1.00 0.00 ? 11  ARG A HH21 3  
ATOM 3780  H HH22 . ARG A 1 11  ? -240.789 -12.190 94.294  1.00 0.00 ? 11  ARG A HH22 3  
ATOM 3781  N N    . VAL A 1 12  ? -240.950 -16.070 102.532 1.00 0.00 ? 12  VAL A N    3  
ATOM 3782  C CA   . VAL A 1 12  ? -241.921 -16.880 103.244 1.00 0.00 ? 12  VAL A CA   3  
ATOM 3783  C C    . VAL A 1 12  ? -243.235 -16.893 102.471 1.00 0.00 ? 12  VAL A C    3  
ATOM 3784  O O    . VAL A 1 12  ? -243.806 -15.842 102.164 1.00 0.00 ? 12  VAL A O    3  
ATOM 3785  C CB   . VAL A 1 12  ? -242.123 -16.364 104.688 1.00 0.00 ? 12  VAL A CB   3  
ATOM 3786  C CG1  . VAL A 1 12  ? -242.304 -14.850 104.700 1.00 0.00 ? 12  VAL A CG1  3  
ATOM 3787  C CG2  . VAL A 1 12  ? -243.302 -17.064 105.351 1.00 0.00 ? 12  VAL A CG2  3  
ATOM 3788  H H    . VAL A 1 12  ? -241.188 -15.144 102.298 1.00 0.00 ? 12  VAL A H    3  
ATOM 3789  H HA   . VAL A 1 12  ? -241.538 -17.891 103.296 1.00 0.00 ? 12  VAL A HA   3  
ATOM 3790  H HB   . VAL A 1 12  ? -241.232 -16.598 105.257 1.00 0.00 ? 12  VAL A HB   3  
ATOM 3791  H HG11 . VAL A 1 12  ? -241.424 -14.383 104.275 1.00 0.00 ? 12  VAL A HG11 3  
ATOM 3792  H HG12 . VAL A 1 12  ? -243.170 -14.585 104.113 1.00 0.00 ? 12  VAL A HG12 3  
ATOM 3793  H HG13 . VAL A 1 12  ? -242.437 -14.510 105.717 1.00 0.00 ? 12  VAL A HG13 3  
ATOM 3794  H HG21 . VAL A 1 12  ? -244.196 -16.893 104.770 1.00 0.00 ? 12  VAL A HG21 3  
ATOM 3795  H HG22 . VAL A 1 12  ? -243.105 -18.125 105.404 1.00 0.00 ? 12  VAL A HG22 3  
ATOM 3796  H HG23 . VAL A 1 12  ? -243.440 -16.674 106.348 1.00 0.00 ? 12  VAL A HG23 3  
ATOM 3797  N N    . THR A 1 13  ? -243.676 -18.088 102.099 1.00 0.00 ? 13  THR A N    3  
ATOM 3798  C CA   . THR A 1 13  ? -244.839 -18.230 101.240 1.00 0.00 ? 13  THR A CA   3  
ATOM 3799  C C    . THR A 1 13  ? -246.121 -17.976 102.039 1.00 0.00 ? 13  THR A C    3  
ATOM 3800  O O    . THR A 1 13  ? -246.386 -18.649 103.035 1.00 0.00 ? 13  THR A O    3  
ATOM 3801  C CB   . THR A 1 13  ? -244.910 -19.645 100.646 1.00 0.00 ? 13  THR A CB   3  
ATOM 3802  O OG1  . THR A 1 13  ? -243.645 -19.992 100.068 1.00 0.00 ? 13  THR A OG1  3  
ATOM 3803  C CG2  . THR A 1 13  ? -246.005 -19.731 99.591  1.00 0.00 ? 13  THR A CG2  3  
ATOM 3804  H H    . THR A 1 13  ? -243.217 -18.890 102.417 1.00 0.00 ? 13  THR A H    3  
ATOM 3805  H HA   . THR A 1 13  ? -244.742 -17.509 100.415 1.00 0.00 ? 13  THR A HA   3  
ATOM 3806  H HB   . THR A 1 13  ? -245.139 -20.340 101.439 1.00 0.00 ? 13  THR A HB   3  
ATOM 3807  H HG1  . THR A 1 13  ? -243.055 -19.235 100.116 1.00 0.00 ? 13  THR A HG1  3  
ATOM 3808  H HG21 . THR A 1 13  ? -245.858 -18.952 98.859  1.00 0.00 ? 13  THR A HG21 3  
ATOM 3809  H HG22 . THR A 1 13  ? -245.966 -20.697 99.108  1.00 0.00 ? 13  THR A HG22 3  
ATOM 3810  H HG23 . THR A 1 13  ? -246.969 -19.605 100.062 1.00 0.00 ? 13  THR A HG23 3  
ATOM 3811  N N    . VAL A 1 14  ? -246.909 -17.016 101.599 1.00 0.00 ? 14  VAL A N    3  
ATOM 3812  C CA   . VAL A 1 14  ? -248.127 -16.641 102.297 1.00 0.00 ? 14  VAL A CA   3  
ATOM 3813  C C    . VAL A 1 14  ? -249.358 -17.148 101.541 1.00 0.00 ? 14  VAL A C    3  
ATOM 3814  O O    . VAL A 1 14  ? -249.486 -16.937 100.337 1.00 0.00 ? 14  VAL A O    3  
ATOM 3815  C CB   . VAL A 1 14  ? -248.166 -15.104 102.468 1.00 0.00 ? 14  VAL A CB   3  
ATOM 3816  C CG1  . VAL A 1 14  ? -249.458 -14.617 103.100 1.00 0.00 ? 14  VAL A CG1  3  
ATOM 3817  C CG2  . VAL A 1 14  ? -246.975 -14.648 103.288 1.00 0.00 ? 14  VAL A CG2  3  
ATOM 3818  H H    . VAL A 1 14  ? -246.667 -16.536 100.775 1.00 0.00 ? 14  VAL A H    3  
ATOM 3819  H HA   . VAL A 1 14  ? -248.105 -17.095 103.277 1.00 0.00 ? 14  VAL A HA   3  
ATOM 3820  H HB   . VAL A 1 14  ? -248.085 -14.656 101.489 1.00 0.00 ? 14  VAL A HB   3  
ATOM 3821  H HG11 . VAL A 1 14  ? -249.638 -15.149 104.021 1.00 0.00 ? 14  VAL A HG11 3  
ATOM 3822  H HG12 . VAL A 1 14  ? -249.370 -13.558 103.304 1.00 0.00 ? 14  VAL A HG12 3  
ATOM 3823  H HG13 . VAL A 1 14  ? -250.277 -14.777 102.413 1.00 0.00 ? 14  VAL A HG13 3  
ATOM 3824  H HG21 . VAL A 1 14  ? -246.063 -14.945 102.794 1.00 0.00 ? 14  VAL A HG21 3  
ATOM 3825  H HG22 . VAL A 1 14  ? -246.997 -13.573 103.388 1.00 0.00 ? 14  VAL A HG22 3  
ATOM 3826  H HG23 . VAL A 1 14  ? -247.018 -15.101 104.269 1.00 0.00 ? 14  VAL A HG23 3  
ATOM 3827  N N    . HIS A 1 15  ? -250.244 -17.845 102.251 1.00 0.00 ? 15  HIS A N    3  
ATOM 3828  C CA   . HIS A 1 15  ? -251.427 -18.457 101.633 1.00 0.00 ? 15  HIS A CA   3  
ATOM 3829  C C    . HIS A 1 15  ? -252.696 -17.658 101.907 1.00 0.00 ? 15  HIS A C    3  
ATOM 3830  O O    . HIS A 1 15  ? -253.783 -18.065 101.509 1.00 0.00 ? 15  HIS A O    3  
ATOM 3831  C CB   . HIS A 1 15  ? -251.610 -19.894 102.138 1.00 0.00 ? 15  HIS A CB   3  
ATOM 3832  C CG   . HIS A 1 15  ? -250.980 -20.926 101.255 1.00 0.00 ? 15  HIS A CG   3  
ATOM 3833  N ND1  . HIS A 1 15  ? -251.709 -21.835 100.518 1.00 0.00 ? 15  HIS A ND1  3  
ATOM 3834  C CD2  . HIS A 1 15  ? -249.678 -21.194 100.997 1.00 0.00 ? 15  HIS A CD2  3  
ATOM 3835  C CE1  . HIS A 1 15  ? -250.884 -22.617 99.845  1.00 0.00 ? 15  HIS A CE1  3  
ATOM 3836  N NE2  . HIS A 1 15  ? -249.649 -22.245 100.117 1.00 0.00 ? 15  HIS A NE2  3  
ATOM 3837  H H    . HIS A 1 15  ? -250.101 -17.957 103.217 1.00 0.00 ? 15  HIS A H    3  
ATOM 3838  H HA   . HIS A 1 15  ? -251.261 -18.484 100.567 1.00 0.00 ? 15  HIS A HA   3  
ATOM 3839  H HB2  . HIS A 1 15  ? -251.158 -19.980 103.116 1.00 0.00 ? 15  HIS A HB2  3  
ATOM 3840  H HB3  . HIS A 1 15  ? -252.667 -20.113 102.221 1.00 0.00 ? 15  HIS A HB3  3  
ATOM 3841  H HD1  . HIS A 1 15  ? -252.699 -21.907 100.500 1.00 0.00 ? 15  HIS A HD1  3  
ATOM 3842  H HD2  . HIS A 1 15  ? -248.822 -20.671 101.401 1.00 0.00 ? 15  HIS A HD2  3  
ATOM 3843  H HE1  . HIS A 1 15  ? -251.170 -23.412 99.174  1.00 0.00 ? 15  HIS A HE1  3  
ATOM 3844  H HE2  . HIS A 1 15  ? -248.834 -22.657 99.734  1.00 0.00 ? 15  HIS A HE2  3  
ATOM 3845  N N    . GLY A 1 16  ? -252.563 -16.539 102.600 1.00 0.00 ? 16  GLY A N    3  
ATOM 3846  C CA   . GLY A 1 16  ? -253.723 -15.695 102.851 1.00 0.00 ? 16  GLY A CA   3  
ATOM 3847  C C    . GLY A 1 16  ? -253.509 -14.269 102.382 1.00 0.00 ? 16  GLY A C    3  
ATOM 3848  O O    . GLY A 1 16  ? -254.095 -13.334 102.926 1.00 0.00 ? 16  GLY A O    3  
ATOM 3849  H H    . GLY A 1 16  ? -251.681 -16.293 102.954 1.00 0.00 ? 16  GLY A H    3  
ATOM 3850  H HA2  . GLY A 1 16  ? -254.576 -16.112 102.336 1.00 0.00 ? 16  GLY A HA2  3  
ATOM 3851  H HA3  . GLY A 1 16  ? -253.923 -15.687 103.913 1.00 0.00 ? 16  GLY A HA3  3  
ATOM 3852  N N    . VAL A 1 17  ? -252.668 -14.114 101.372 1.00 0.00 ? 17  VAL A N    3  
ATOM 3853  C CA   . VAL A 1 17  ? -252.257 -12.807 100.880 1.00 0.00 ? 17  VAL A CA   3  
ATOM 3854  C C    . VAL A 1 17  ? -253.443 -11.942 100.442 1.00 0.00 ? 17  VAL A C    3  
ATOM 3855  O O    . VAL A 1 17  ? -254.520 -12.446 100.113 1.00 0.00 ? 17  VAL A O    3  
ATOM 3856  C CB   . VAL A 1 17  ? -251.275 -12.949 99.697  1.00 0.00 ? 17  VAL A CB   3  
ATOM 3857  C CG1  . VAL A 1 17  ? -250.177 -13.932 100.022 1.00 0.00 ? 17  VAL A CG1  3  
ATOM 3858  C CG2  . VAL A 1 17  ? -251.993 -13.353 98.416  1.00 0.00 ? 17  VAL A CG2  3  
ATOM 3859  H H    . VAL A 1 17  ? -252.312 -14.903 100.936 1.00 0.00 ? 17  VAL A H    3  
ATOM 3860  H HA   . VAL A 1 17  ? -251.740 -12.300 101.681 1.00 0.00 ? 17  VAL A HA   3  
ATOM 3861  H HB   . VAL A 1 17  ? -250.813 -11.996 99.541  1.00 0.00 ? 17  VAL A HB   3  
ATOM 3862  H HG11 . VAL A 1 17  ? -250.610 -14.880 100.300 1.00 0.00 ? 17  VAL A HG11 3  
ATOM 3863  H HG12 . VAL A 1 17  ? -249.545 -14.065 99.155  1.00 0.00 ? 17  VAL A HG12 3  
ATOM 3864  H HG13 . VAL A 1 17  ? -249.584 -13.551 100.841 1.00 0.00 ? 17  VAL A HG13 3  
ATOM 3865  H HG21 . VAL A 1 17  ? -252.507 -14.291 98.571  1.00 0.00 ? 17  VAL A HG21 3  
ATOM 3866  H HG22 . VAL A 1 17  ? -252.710 -12.589 98.148  1.00 0.00 ? 17  VAL A HG22 3  
ATOM 3867  H HG23 . VAL A 1 17  ? -251.272 -13.465 97.618  1.00 0.00 ? 17  VAL A HG23 3  
ATOM 3868  N N    . PRO A 1 18  ? -253.239 -10.614 100.432 1.00 0.00 ? 18  PRO A N    3  
ATOM 3869  C CA   . PRO A 1 18  ? -254.252 -9.647  99.976  1.00 0.00 ? 18  PRO A CA   3  
ATOM 3870  C C    . PRO A 1 18  ? -254.350 -9.628  98.467  1.00 0.00 ? 18  PRO A C    3  
ATOM 3871  O O    . PRO A 1 18  ? -255.341 -9.199  97.868  1.00 0.00 ? 18  PRO A O    3  
ATOM 3872  C CB   . PRO A 1 18  ? -253.699 -8.325  100.494 1.00 0.00 ? 18  PRO A CB   3  
ATOM 3873  C CG   . PRO A 1 18  ? -252.225 -8.525  100.432 1.00 0.00 ? 18  PRO A CG   3  
ATOM 3874  C CD   . PRO A 1 18  ? -252.004 -9.942  100.876 1.00 0.00 ? 18  PRO A CD   3  
ATOM 3875  H HA   . PRO A 1 18  ? -255.204 -9.846  100.391 1.00 0.00 ? 18  PRO A HA   3  
ATOM 3876  H HB2  . PRO A 1 18  ? -254.020 -7.515  99.854  1.00 0.00 ? 18  PRO A HB2  3  
ATOM 3877  H HB3  . PRO A 1 18  ? -254.034 -8.157  101.506 1.00 0.00 ? 18  PRO A HB3  3  
ATOM 3878  H HG2  . PRO A 1 18  ? -251.877 -8.392  99.418  1.00 0.00 ? 18  PRO A HG2  3  
ATOM 3879  H HG3  . PRO A 1 18  ? -251.728 -7.845  101.089 1.00 0.00 ? 18  PRO A HG3  3  
ATOM 3880  H HD2  . PRO A 1 18  ? -251.136 -10.360 100.386 1.00 0.00 ? 18  PRO A HD2  3  
ATOM 3881  H HD3  . PRO A 1 18  ? -251.898 -9.995  101.950 1.00 0.00 ? 18  PRO A HD3  3  
ATOM 3882  N N    . GLY A 1 19  ? -253.273 -10.083 97.894  1.00 0.00 ? 19  GLY A N    3  
ATOM 3883  C CA   . GLY A 1 19  ? -253.146 -10.231 96.455  1.00 0.00 ? 19  GLY A CA   3  
ATOM 3884  C C    . GLY A 1 19  ? -254.192 -11.147 95.855  1.00 0.00 ? 19  GLY A C    3  
ATOM 3885  O O    . GLY A 1 19  ? -254.872 -11.881 96.573  1.00 0.00 ? 19  GLY A O    3  
ATOM 3886  H H    . GLY A 1 19  ? -252.532 -10.315 98.486  1.00 0.00 ? 19  GLY A H    3  
ATOM 3887  H HA2  . GLY A 1 19  ? -253.231 -9.265  95.989  1.00 0.00 ? 19  GLY A HA2  3  
ATOM 3888  H HA3  . GLY A 1 19  ? -252.170 -10.636 96.235  1.00 0.00 ? 19  GLY A HA3  3  
ATOM 3889  N N    . PRO A 1 20  ? -254.334 -11.123 94.525  1.00 0.00 ? 20  PRO A N    3  
ATOM 3890  C CA   . PRO A 1 20  ? -255.289 -11.974 93.810  1.00 0.00 ? 20  PRO A CA   3  
ATOM 3891  C C    . PRO A 1 20  ? -254.851 -13.426 93.840  1.00 0.00 ? 20  PRO A C    3  
ATOM 3892  O O    . PRO A 1 20  ? -255.666 -14.348 93.784  1.00 0.00 ? 20  PRO A O    3  
ATOM 3893  C CB   . PRO A 1 20  ? -255.220 -11.441 92.381  1.00 0.00 ? 20  PRO A CB   3  
ATOM 3894  C CG   . PRO A 1 20  ? -253.841 -10.909 92.269  1.00 0.00 ? 20  PRO A CG   3  
ATOM 3895  C CD   . PRO A 1 20  ? -253.560 -10.283 93.597  1.00 0.00 ? 20  PRO A CD   3  
ATOM 3896  H HA   . PRO A 1 20  ? -256.284 -11.875 94.198  1.00 0.00 ? 20  PRO A HA   3  
ATOM 3897  H HB2  . PRO A 1 20  ? -255.392 -12.243 91.682  1.00 0.00 ? 20  PRO A HB2  3  
ATOM 3898  H HB3  . PRO A 1 20  ? -255.956 -10.663 92.244  1.00 0.00 ? 20  PRO A HB3  3  
ATOM 3899  H HG2  . PRO A 1 20  ? -253.150 -11.718 92.083  1.00 0.00 ? 20  PRO A HG2  3  
ATOM 3900  H HG3  . PRO A 1 20  ? -253.784 -10.182 91.489  1.00 0.00 ? 20  PRO A HG3  3  
ATOM 3901  H HD2  . PRO A 1 20  ? -252.513 -10.339 93.817  1.00 0.00 ? 20  PRO A HD2  3  
ATOM 3902  H HD3  . PRO A 1 20  ? -253.905 -9.259  93.619  1.00 0.00 ? 20  PRO A HD3  3  
ATOM 3903  N N    . GLU A 1 21  ? -253.543 -13.596 93.916  1.00 0.00 ? 21  GLU A N    3  
ATOM 3904  C CA   . GLU A 1 21  ? -252.931 -14.910 93.976  1.00 0.00 ? 21  GLU A CA   3  
ATOM 3905  C C    . GLU A 1 21  ? -253.382 -15.668 95.210  1.00 0.00 ? 21  GLU A C    3  
ATOM 3906  O O    . GLU A 1 21  ? -253.746 -15.081 96.227  1.00 0.00 ? 21  GLU A O    3  
ATOM 3907  C CB   . GLU A 1 21  ? -251.405 -14.790 93.978  1.00 0.00 ? 21  GLU A CB   3  
ATOM 3908  C CG   . GLU A 1 21  ? -250.863 -13.804 92.957  1.00 0.00 ? 21  GLU A CG   3  
ATOM 3909  C CD   . GLU A 1 21  ? -249.376 -13.969 92.723  1.00 0.00 ? 21  GLU A CD   3  
ATOM 3910  O OE1  . GLU A 1 21  ? -249.003 -14.805 91.875  1.00 0.00 ? 21  GLU A OE1  3  
ATOM 3911  O OE2  . GLU A 1 21  ? -248.576 -13.260 93.367  1.00 0.00 ? 21  GLU A OE2  3  
ATOM 3912  H H    . GLU A 1 21  ? -252.968 -12.797 93.920  1.00 0.00 ? 21  GLU A H    3  
ATOM 3913  H HA   . GLU A 1 21  ? -253.240 -15.473 93.104  1.00 0.00 ? 21  GLU A HA   3  
ATOM 3914  H HB2  . GLU A 1 21  ? -251.080 -14.484 94.961  1.00 0.00 ? 21  GLU A HB2  3  
ATOM 3915  H HB3  . GLU A 1 21  ? -250.988 -15.758 93.761  1.00 0.00 ? 21  GLU A HB3  3  
ATOM 3916  H HG2  . GLU A 1 21  ? -251.377 -13.955 92.019  1.00 0.00 ? 21  GLU A HG2  3  
ATOM 3917  H HG3  . GLU A 1 21  ? -251.049 -12.799 93.310  1.00 0.00 ? 21  GLU A HG3  3  
ATOM 3918  N N    . PRO A 1 22  ? -253.338 -16.994 95.130  1.00 0.00 ? 22  PRO A N    3  
ATOM 3919  C CA   . PRO A 1 22  ? -253.765 -17.873 96.211  1.00 0.00 ? 22  PRO A CA   3  
ATOM 3920  C C    . PRO A 1 22  ? -252.672 -17.981 97.239  1.00 0.00 ? 22  PRO A C    3  
ATOM 3921  O O    . PRO A 1 22  ? -252.898 -18.079 98.443  1.00 0.00 ? 22  PRO A O    3  
ATOM 3922  C CB   . PRO A 1 22  ? -253.956 -19.223 95.521  1.00 0.00 ? 22  PRO A CB   3  
ATOM 3923  C CG   . PRO A 1 22  ? -253.656 -18.990 94.075  1.00 0.00 ? 22  PRO A CG   3  
ATOM 3924  C CD   . PRO A 1 22  ? -252.844 -17.753 93.983  1.00 0.00 ? 22  PRO A CD   3  
ATOM 3925  H HA   . PRO A 1 22  ? -254.684 -17.548 96.665  1.00 0.00 ? 22  PRO A HA   3  
ATOM 3926  H HB2  . PRO A 1 22  ? -253.276 -19.944 95.951  1.00 0.00 ? 22  PRO A HB2  3  
ATOM 3927  H HB3  . PRO A 1 22  ? -254.973 -19.559 95.661  1.00 0.00 ? 22  PRO A HB3  3  
ATOM 3928  H HG2  . PRO A 1 22  ? -253.116 -19.822 93.669  1.00 0.00 ? 22  PRO A HG2  3  
ATOM 3929  H HG3  . PRO A 1 22  ? -254.558 -18.839 93.553  1.00 0.00 ? 22  PRO A HG3  3  
ATOM 3930  H HD2  . PRO A 1 22  ? -251.792 -17.976 94.069  1.00 0.00 ? 22  PRO A HD2  3  
ATOM 3931  H HD3  . PRO A 1 22  ? -253.050 -17.236 93.059  1.00 0.00 ? 22  PRO A HD3  3  
ATOM 3932  N N    . PHE A 1 23  ? -251.479 -17.974 96.710  1.00 0.00 ? 23  PHE A N    3  
ATOM 3933  C CA   . PHE A 1 23  ? -250.275 -18.003 97.514  1.00 0.00 ? 23  PHE A CA   3  
ATOM 3934  C C    . PHE A 1 23  ? -249.158 -17.246 96.816  1.00 0.00 ? 23  PHE A C    3  
ATOM 3935  O O    . PHE A 1 23  ? -248.918 -17.432 95.624  1.00 0.00 ? 23  PHE A O    3  
ATOM 3936  C CB   . PHE A 1 23  ? -249.843 -19.449 97.822  1.00 0.00 ? 23  PHE A CB   3  
ATOM 3937  C CG   . PHE A 1 23  ? -249.513 -20.283 96.613  1.00 0.00 ? 23  PHE A CG   3  
ATOM 3938  C CD1  . PHE A 1 23  ? -250.515 -20.899 95.879  1.00 0.00 ? 23  PHE A CD1  3  
ATOM 3939  C CD2  . PHE A 1 23  ? -248.194 -20.459 96.214  1.00 0.00 ? 23  PHE A CD2  3  
ATOM 3940  C CE1  . PHE A 1 23  ? -250.212 -21.671 94.774  1.00 0.00 ? 23  PHE A CE1  3  
ATOM 3941  C CE2  . PHE A 1 23  ? -247.886 -21.231 95.109  1.00 0.00 ? 23  PHE A CE2  3  
ATOM 3942  C CZ   . PHE A 1 23  ? -248.896 -21.838 94.389  1.00 0.00 ? 23  PHE A CZ   3  
ATOM 3943  H H    . PHE A 1 23  ? -251.418 -17.937 95.722  1.00 0.00 ? 23  PHE A H    3  
ATOM 3944  H HA   . PHE A 1 23  ? -250.497 -17.502 98.445  1.00 0.00 ? 23  PHE A HA   3  
ATOM 3945  H HB2  . PHE A 1 23  ? -248.965 -19.422 98.447  1.00 0.00 ? 23  PHE A HB2  3  
ATOM 3946  H HB3  . PHE A 1 23  ? -250.640 -19.942 98.359  1.00 0.00 ? 23  PHE A HB3  3  
ATOM 3947  H HD1  . PHE A 1 23  ? -251.544 -20.770 96.180  1.00 0.00 ? 23  PHE A HD1  3  
ATOM 3948  H HD2  . PHE A 1 23  ? -247.403 -19.986 96.776  1.00 0.00 ? 23  PHE A HD2  3  
ATOM 3949  H HE1  . PHE A 1 23  ? -251.003 -22.145 94.212  1.00 0.00 ? 23  PHE A HE1  3  
ATOM 3950  H HE2  . PHE A 1 23  ? -246.856 -21.360 94.810  1.00 0.00 ? 23  PHE A HE2  3  
ATOM 3951  H HZ   . PHE A 1 23  ? -248.657 -22.441 93.525  1.00 0.00 ? 23  PHE A HZ   3  
ATOM 3952  N N    . THR A 1 24  ? -248.502 -16.375 97.559  1.00 0.00 ? 24  THR A N    3  
ATOM 3953  C CA   . THR A 1 24  ? -247.335 -15.677 97.061  1.00 0.00 ? 24  THR A CA   3  
ATOM 3954  C C    . THR A 1 24  ? -246.369 -15.441 98.215  1.00 0.00 ? 24  THR A C    3  
ATOM 3955  O O    . THR A 1 24  ? -246.770 -15.419 99.376  1.00 0.00 ? 24  THR A O    3  
ATOM 3956  C CB   . THR A 1 24  ? -247.699 -14.350 96.346  1.00 0.00 ? 24  THR A CB   3  
ATOM 3957  O OG1  . THR A 1 24  ? -246.543 -13.800 95.706  1.00 0.00 ? 24  THR A OG1  3  
ATOM 3958  C CG2  . THR A 1 24  ? -248.272 -13.330 97.313  1.00 0.00 ? 24  THR A CG2  3  
ATOM 3959  H H    . THR A 1 24  ? -248.807 -16.201 98.476  1.00 0.00 ? 24  THR A H    3  
ATOM 3960  H HA   . THR A 1 24  ? -246.853 -16.327 96.343  1.00 0.00 ? 24  THR A HA   3  
ATOM 3961  H HB   . THR A 1 24  ? -248.445 -14.560 95.593  1.00 0.00 ? 24  THR A HB   3  
ATOM 3962  H HG1  . THR A 1 24  ? -246.752 -13.617 94.781  1.00 0.00 ? 24  THR A HG1  3  
ATOM 3963  H HG21 . THR A 1 24  ? -249.138 -13.749 97.804  1.00 0.00 ? 24  THR A HG21 3  
ATOM 3964  H HG22 . THR A 1 24  ? -247.528 -13.075 98.051  1.00 0.00 ? 24  THR A HG22 3  
ATOM 3965  H HG23 . THR A 1 24  ? -248.560 -12.441 96.769  1.00 0.00 ? 24  THR A HG23 3  
ATOM 3966  N N    . VAL A 1 25  ? -245.107 -15.278 97.888  1.00 0.00 ? 25  VAL A N    3  
ATOM 3967  C CA   . VAL A 1 25  ? -244.029 -15.360 98.865  1.00 0.00 ? 25  VAL A CA   3  
ATOM 3968  C C    . VAL A 1 25  ? -243.262 -14.032 98.926  1.00 0.00 ? 25  VAL A C    3  
ATOM 3969  O O    . VAL A 1 25  ? -242.834 -13.525 97.892  1.00 0.00 ? 25  VAL A O    3  
ATOM 3970  C CB   . VAL A 1 25  ? -243.063 -16.483 98.440  1.00 0.00 ? 25  VAL A CB   3  
ATOM 3971  C CG1  . VAL A 1 25  ? -242.132 -16.883 99.554  1.00 0.00 ? 25  VAL A CG1  3  
ATOM 3972  C CG2  . VAL A 1 25  ? -243.814 -17.689 97.897  1.00 0.00 ? 25  VAL A CG2  3  
ATOM 3973  H H    . VAL A 1 25  ? -244.885 -15.067 96.955  1.00 0.00 ? 25  VAL A H    3  
ATOM 3974  H HA   . VAL A 1 25  ? -244.439 -15.604 99.839  1.00 0.00 ? 25  VAL A HA   3  
ATOM 3975  H HB   . VAL A 1 25  ? -242.469 -16.101 97.658  1.00 0.00 ? 25  VAL A HB   3  
ATOM 3976  H HG11 . VAL A 1 25  ? -242.710 -17.214 100.403 1.00 0.00 ? 25  VAL A HG11 3  
ATOM 3977  H HG12 . VAL A 1 25  ? -241.489 -17.683 99.219  1.00 0.00 ? 25  VAL A HG12 3  
ATOM 3978  H HG13 . VAL A 1 25  ? -241.531 -16.031 99.839  1.00 0.00 ? 25  VAL A HG13 3  
ATOM 3979  H HG21 . VAL A 1 25  ? -244.417 -17.388 97.054  1.00 0.00 ? 25  VAL A HG21 3  
ATOM 3980  H HG22 . VAL A 1 25  ? -243.106 -18.441 97.583  1.00 0.00 ? 25  VAL A HG22 3  
ATOM 3981  H HG23 . VAL A 1 25  ? -244.451 -18.094 98.669  1.00 0.00 ? 25  VAL A HG23 3  
ATOM 3982  N N    . PHE A 1 26  ? -243.079 -13.467 100.122 1.00 0.00 ? 26  PHE A N    3  
ATOM 3983  C CA   . PHE A 1 26  ? -242.353 -12.192 100.246 1.00 0.00 ? 26  PHE A CA   3  
ATOM 3984  C C    . PHE A 1 26  ? -241.049 -12.370 100.994 1.00 0.00 ? 26  PHE A C    3  
ATOM 3985  O O    . PHE A 1 26  ? -240.956 -13.179 101.919 1.00 0.00 ? 26  PHE A O    3  
ATOM 3986  C CB   . PHE A 1 26  ? -243.191 -11.107 100.929 1.00 0.00 ? 26  PHE A CB   3  
ATOM 3987  C CG   . PHE A 1 26  ? -244.555 -10.936 100.316 1.00 0.00 ? 26  PHE A CG   3  
ATOM 3988  C CD1  . PHE A 1 26  ? -245.623 -11.730 100.713 1.00 0.00 ? 26  PHE A CD1  3  
ATOM 3989  C CD2  . PHE A 1 26  ? -244.766 -9.982  99.333  1.00 0.00 ? 26  PHE A CD2  3  
ATOM 3990  C CE1  . PHE A 1 26  ? -246.870 -11.573 100.141 1.00 0.00 ? 26  PHE A CE1  3  
ATOM 3991  C CE2  . PHE A 1 26  ? -246.013 -9.823  98.757  1.00 0.00 ? 26  PHE A CE2  3  
ATOM 3992  C CZ   . PHE A 1 26  ? -247.065 -10.619 99.162  1.00 0.00 ? 26  PHE A CZ   3  
ATOM 3993  H H    . PHE A 1 26  ? -243.422 -13.913 100.927 1.00 0.00 ? 26  PHE A H    3  
ATOM 3994  H HA   . PHE A 1 26  ? -242.118 -11.865 99.250  1.00 0.00 ? 26  PHE A HA   3  
ATOM 3995  H HB2  . PHE A 1 26  ? -243.304 -11.333 101.974 1.00 0.00 ? 26  PHE A HB2  3  
ATOM 3996  H HB3  . PHE A 1 26  ? -242.671 -10.163 100.840 1.00 0.00 ? 26  PHE A HB3  3  
ATOM 3997  H HD1  . PHE A 1 26  ? -245.474 -12.478 101.482 1.00 0.00 ? 26  PHE A HD1  3  
ATOM 3998  H HD2  . PHE A 1 26  ? -243.941 -9.360  99.017  1.00 0.00 ? 26  PHE A HD2  3  
ATOM 3999  H HE1  . PHE A 1 26  ? -247.692 -12.199 100.459 1.00 0.00 ? 26  PHE A HE1  3  
ATOM 4000  H HE2  . PHE A 1 26  ? -246.163 -9.075  97.992  1.00 0.00 ? 26  PHE A HE2  3  
ATOM 4001  H HZ   . PHE A 1 26  ? -248.041 -10.495 98.713  1.00 0.00 ? 26  PHE A HZ   3  
ATOM 4002  N N    . THR A 1 27  ? -240.041 -11.630 100.564 1.00 0.00 ? 27  THR A N    3  
ATOM 4003  C CA   . THR A 1 27  ? -238.710 -11.745 101.126 1.00 0.00 ? 27  THR A CA   3  
ATOM 4004  C C    . THR A 1 27  ? -238.577 -10.939 102.410 1.00 0.00 ? 27  THR A C    3  
ATOM 4005  O O    . THR A 1 27  ? -239.115 -9.841  102.527 1.00 0.00 ? 27  THR A O    3  
ATOM 4006  C CB   . THR A 1 27  ? -237.651 -11.268 100.121 1.00 0.00 ? 27  THR A CB   3  
ATOM 4007  O OG1  . THR A 1 27  ? -238.238 -11.155 98.814  1.00 0.00 ? 27  THR A OG1  3  
ATOM 4008  C CG2  . THR A 1 27  ? -236.489 -12.247 100.078 1.00 0.00 ? 27  THR A CG2  3  
ATOM 4009  H H    . THR A 1 27  ? -240.191 -10.986 99.841  1.00 0.00 ? 27  THR A H    3  
ATOM 4010  H HA   . THR A 1 27  ? -238.525 -12.787 101.344 1.00 0.00 ? 27  THR A HA   3  
ATOM 4011  H HB   . THR A 1 27  ? -237.285 -10.302 100.432 1.00 0.00 ? 27  THR A HB   3  
ATOM 4012  H HG1  . THR A 1 27  ? -238.148 -10.241 98.504  1.00 0.00 ? 27  THR A HG1  3  
ATOM 4013  H HG21 . THR A 1 27  ? -236.866 -13.235 99.845  1.00 0.00 ? 27  THR A HG21 3  
ATOM 4014  H HG22 . THR A 1 27  ? -235.786 -11.941 99.318  1.00 0.00 ? 27  THR A HG22 3  
ATOM 4015  H HG23 . THR A 1 27  ? -235.996 -12.268 101.044 1.00 0.00 ? 27  THR A HG23 3  
ATOM 4016  N N    . ILE A 1 28  ? -237.863 -11.500 103.363 1.00 0.00 ? 28  ILE A N    3  
ATOM 4017  C CA   . ILE A 1 28  ? -237.616 -10.848 104.633 1.00 0.00 ? 28  ILE A CA   3  
ATOM 4018  C C    . ILE A 1 28  ? -236.154 -10.414 104.699 1.00 0.00 ? 28  ILE A C    3  
ATOM 4019  O O    . ILE A 1 28  ? -235.440 -10.517 103.704 1.00 0.00 ? 28  ILE A O    3  
ATOM 4020  C CB   . ILE A 1 28  ? -237.935 -11.797 105.802 1.00 0.00 ? 28  ILE A CB   3  
ATOM 4021  C CG1  . ILE A 1 28  ? -236.804 -12.808 106.000 1.00 0.00 ? 28  ILE A CG1  3  
ATOM 4022  C CG2  . ILE A 1 28  ? -239.252 -12.523 105.529 1.00 0.00 ? 28  ILE A CG2  3  
ATOM 4023  C CD1  . ILE A 1 28  ? -236.988 -13.673 107.214 1.00 0.00 ? 28  ILE A CD1  3  
ATOM 4024  H H    . ILE A 1 28  ? -237.492 -12.398 103.213 1.00 0.00 ? 28  ILE A H    3  
ATOM 4025  H HA   . ILE A 1 28  ? -238.254 -9.985  104.707 1.00 0.00 ? 28  ILE A HA   3  
ATOM 4026  H HB   . ILE A 1 28  ? -238.054 -11.207 106.705 1.00 0.00 ? 28  ILE A HB   3  
ATOM 4027  H HG12 . ILE A 1 28  ? -236.749 -13.455 105.137 1.00 0.00 ? 28  ILE A HG12 3  
ATOM 4028  H HG13 . ILE A 1 28  ? -235.869 -12.277 106.107 1.00 0.00 ? 28  ILE A HG13 3  
ATOM 4029  H HG21 . ILE A 1 28  ? -239.999 -11.810 105.186 1.00 0.00 ? 28  ILE A HG21 3  
ATOM 4030  H HG22 . ILE A 1 28  ? -239.109 -13.287 104.781 1.00 0.00 ? 28  ILE A HG22 3  
ATOM 4031  H HG23 . ILE A 1 28  ? -239.602 -12.972 106.450 1.00 0.00 ? 28  ILE A HG23 3  
ATOM 4032  H HD11 . ILE A 1 28  ? -237.043 -13.043 108.089 1.00 0.00 ? 28  ILE A HD11 3  
ATOM 4033  H HD12 . ILE A 1 28  ? -237.903 -14.234 107.116 1.00 0.00 ? 28  ILE A HD12 3  
ATOM 4034  H HD13 . ILE A 1 28  ? -236.152 -14.349 107.307 1.00 0.00 ? 28  ILE A HD13 3  
ATOM 4035  N N    . ASN A 1 29  ? -235.715 -9.923  105.851 1.00 0.00 ? 29  ASN A N    3  
ATOM 4036  C CA   . ASN A 1 29  ? -234.314 -9.576  106.053 1.00 0.00 ? 29  ASN A CA   3  
ATOM 4037  C C    . ASN A 1 29  ? -233.998 -9.561  107.544 1.00 0.00 ? 29  ASN A C    3  
ATOM 4038  O O    . ASN A 1 29  ? -234.801 -9.089  108.350 1.00 0.00 ? 29  ASN A O    3  
ATOM 4039  C CB   . ASN A 1 29  ? -233.975 -8.219  105.419 1.00 0.00 ? 29  ASN A CB   3  
ATOM 4040  C CG   . ASN A 1 29  ? -234.721 -7.057  106.045 1.00 0.00 ? 29  ASN A CG   3  
ATOM 4041  O OD1  . ASN A 1 29  ? -234.220 -6.394  106.954 1.00 0.00 ? 29  ASN A OD1  3  
ATOM 4042  N ND2  . ASN A 1 29  ? -235.920 -6.802  105.559 1.00 0.00 ? 29  ASN A ND2  3  
ATOM 4043  H H    . ASN A 1 29  ? -236.340 -9.815  106.594 1.00 0.00 ? 29  ASN A H    3  
ATOM 4044  H HA   . ASN A 1 29  ? -233.719 -10.339 105.576 1.00 0.00 ? 29  ASN A HA   3  
ATOM 4045  H HB2  . ASN A 1 29  ? -232.915 -8.037  105.528 1.00 0.00 ? 29  ASN A HB2  3  
ATOM 4046  H HB3  . ASN A 1 29  ? -234.221 -8.256  104.368 1.00 0.00 ? 29  ASN A HB3  3  
ATOM 4047  H HD21 . ASN A 1 29  ? -236.254 -7.364  104.833 1.00 0.00 ? 29  ASN A HD21 3  
ATOM 4048  H HD22 . ASN A 1 29  ? -236.428 -6.057  105.947 1.00 0.00 ? 29  ASN A HD22 3  
ATOM 4049  N N    . GLY A 1 30  ? -232.840 -10.090 107.904 1.00 0.00 ? 30  GLY A N    3  
ATOM 4050  C CA   . GLY A 1 30  ? -232.445 -10.141 109.301 1.00 0.00 ? 30  GLY A CA   3  
ATOM 4051  C C    . GLY A 1 30  ? -233.369 -11.016 110.127 1.00 0.00 ? 30  GLY A C    3  
ATOM 4052  O O    . GLY A 1 30  ? -233.867 -12.035 109.645 1.00 0.00 ? 30  GLY A O    3  
ATOM 4053  H H    . GLY A 1 30  ? -232.258 -10.475 107.219 1.00 0.00 ? 30  GLY A H    3  
ATOM 4054  H HA2  . GLY A 1 30  ? -231.440 -10.533 109.369 1.00 0.00 ? 30  GLY A HA2  3  
ATOM 4055  H HA3  . GLY A 1 30  ? -232.458 -9.139  109.704 1.00 0.00 ? 30  GLY A HA3  3  
ATOM 4056  N N    . GLY A 1 31  ? -233.600 -10.618 111.371 1.00 0.00 ? 31  GLY A N    3  
ATOM 4057  C CA   . GLY A 1 31  ? -234.493 -11.362 112.236 1.00 0.00 ? 31  GLY A CA   3  
ATOM 4058  C C    . GLY A 1 31  ? -235.875 -10.746 112.288 1.00 0.00 ? 31  GLY A C    3  
ATOM 4059  O O    . GLY A 1 31  ? -236.230 -10.082 113.264 1.00 0.00 ? 31  GLY A O    3  
ATOM 4060  H H    . GLY A 1 31  ? -233.163 -9.810  111.706 1.00 0.00 ? 31  GLY A H    3  
ATOM 4061  H HA2  . GLY A 1 31  ? -234.572 -12.377 111.874 1.00 0.00 ? 31  GLY A HA2  3  
ATOM 4062  H HA3  . GLY A 1 31  ? -234.080 -11.377 113.235 1.00 0.00 ? 31  GLY A HA3  3  
ATOM 4063  N N    . THR A 1 32  ? -236.649 -10.947 111.230 1.00 0.00 ? 32  THR A N    3  
ATOM 4064  C CA   . THR A 1 32  ? -237.986 -10.385 111.138 1.00 0.00 ? 32  THR A CA   3  
ATOM 4065  C C    . THR A 1 32  ? -238.968 -11.073 112.072 1.00 0.00 ? 32  THR A C    3  
ATOM 4066  O O    . THR A 1 32  ? -239.049 -12.306 112.103 1.00 0.00 ? 32  THR A O    3  
ATOM 4067  C CB   . THR A 1 32  ? -238.541 -10.494 109.726 1.00 0.00 ? 32  THR A CB   3  
ATOM 4068  O OG1  . THR A 1 32  ? -238.277 -11.803 109.216 1.00 0.00 ? 32  THR A OG1  3  
ATOM 4069  C CG2  . THR A 1 32  ? -237.927 -9.436  108.823 1.00 0.00 ? 32  THR A CG2  3  
ATOM 4070  H H    . THR A 1 32  ? -236.307 -11.487 110.483 1.00 0.00 ? 32  THR A H    3  
ATOM 4071  H HA   . THR A 1 32  ? -237.930 -9.345  111.378 1.00 0.00 ? 32  THR A HA   3  
ATOM 4072  H HB   . THR A 1 32  ? -239.619 -10.338 109.771 1.00 0.00 ? 32  THR A HB   3  
ATOM 4073  H HG1  . THR A 1 32  ? -238.456 -12.453 109.904 1.00 0.00 ? 32  THR A HG1  3  
ATOM 4074  H HG21 . THR A 1 32  ? -238.126 -8.457  109.233 1.00 0.00 ? 32  THR A HG21 3  
ATOM 4075  H HG22 . THR A 1 32  ? -236.860 -9.590  108.760 1.00 0.00 ? 32  THR A HG22 3  
ATOM 4076  H HG23 . THR A 1 32  ? -238.361 -9.509  107.836 1.00 0.00 ? 32  THR A HG23 3  
ATOM 4077  N N    . LYS A 1 33  ? -239.710 -10.284 112.835 1.00 0.00 ? 33  LYS A N    3  
ATOM 4078  C CA   . LYS A 1 33  ? -240.866 -10.809 113.536 1.00 0.00 ? 33  LYS A CA   3  
ATOM 4079  C C    . LYS A 1 33  ? -241.961 -11.104 112.541 1.00 0.00 ? 33  LYS A C    3  
ATOM 4080  O O    . LYS A 1 33  ? -241.862 -10.737 111.376 1.00 0.00 ? 33  LYS A O    3  
ATOM 4081  C CB   . LYS A 1 33  ? -241.411 -9.826  114.569 1.00 0.00 ? 33  LYS A CB   3  
ATOM 4082  C CG   . LYS A 1 33  ? -240.505 -9.620  115.755 1.00 0.00 ? 33  LYS A CG   3  
ATOM 4083  C CD   . LYS A 1 33  ? -239.617 -8.403  115.579 1.00 0.00 ? 33  LYS A CD   3  
ATOM 4084  C CE   . LYS A 1 33  ? -238.404 -8.461  116.496 1.00 0.00 ? 33  LYS A CE   3  
ATOM 4085  N NZ   . LYS A 1 33  ? -237.501 -9.601  116.171 1.00 0.00 ? 33  LYS A NZ   3  
ATOM 4086  H H    . LYS A 1 33  ? -239.464 -9.340  112.942 1.00 0.00 ? 33  LYS A H    3  
ATOM 4087  H HA   . LYS A 1 33  ? -240.576 -11.725 114.028 1.00 0.00 ? 33  LYS A HA   3  
ATOM 4088  H HB2  . LYS A 1 33  ? -241.565 -8.869  114.092 1.00 0.00 ? 33  LYS A HB2  3  
ATOM 4089  H HB3  . LYS A 1 33  ? -242.361 -10.193 114.929 1.00 0.00 ? 33  LYS A HB3  3  
ATOM 4090  H HG2  . LYS A 1 33  ? -241.120 -9.493  116.625 1.00 0.00 ? 33  LYS A HG2  3  
ATOM 4091  H HG3  . LYS A 1 33  ? -239.884 -10.496 115.878 1.00 0.00 ? 33  LYS A HG3  3  
ATOM 4092  H HD2  . LYS A 1 33  ? -239.287 -8.359  114.551 1.00 0.00 ? 33  LYS A HD2  3  
ATOM 4093  H HD3  . LYS A 1 33  ? -240.189 -7.519  115.812 1.00 0.00 ? 33  LYS A HD3  3  
ATOM 4094  H HE2  . LYS A 1 33  ? -237.850 -7.539  116.393 1.00 0.00 ? 33  LYS A HE2  3  
ATOM 4095  H HE3  . LYS A 1 33  ? -238.745 -8.562  117.517 1.00 0.00 ? 33  LYS A HE3  3  
ATOM 4096  H HZ1  . LYS A 1 33  ? -238.037 -10.500 116.163 1.00 0.00 ? 33  LYS A HZ1  3  
ATOM 4097  H HZ2  . LYS A 1 33  ? -237.071 -9.464  115.236 1.00 0.00 ? 33  LYS A HZ2  3  
ATOM 4098  H HZ3  . LYS A 1 33  ? -236.744 -9.669  116.885 1.00 0.00 ? 33  LYS A HZ3  3  
ATOM 4099  N N    . ALA A 1 34  ? -243.020 -11.730 113.007 1.00 0.00 ? 34  ALA A N    3  
ATOM 4100  C CA   . ALA A 1 34  ? -244.176 -11.971 112.159 1.00 0.00 ? 34  ALA A CA   3  
ATOM 4101  C C    . ALA A 1 34  ? -244.886 -10.653 111.871 1.00 0.00 ? 34  ALA A C    3  
ATOM 4102  O O    . ALA A 1 34  ? -245.634 -10.529 110.910 1.00 0.00 ? 34  ALA A O    3  
ATOM 4103  C CB   . ALA A 1 34  ? -245.122 -12.965 112.813 1.00 0.00 ? 34  ALA A CB   3  
ATOM 4104  H H    . ALA A 1 34  ? -243.032 -12.033 113.947 1.00 0.00 ? 34  ALA A H    3  
ATOM 4105  H HA   . ALA A 1 34  ? -243.819 -12.395 111.222 1.00 0.00 ? 34  ALA A HA   3  
ATOM 4106  H HB1  . ALA A 1 34  ? -245.972 -13.130 112.170 1.00 0.00 ? 34  ALA A HB1  3  
ATOM 4107  H HB2  . ALA A 1 34  ? -244.606 -13.900 112.973 1.00 0.00 ? 34  ALA A HB2  3  
ATOM 4108  H HB3  . ALA A 1 34  ? -245.457 -12.572 113.762 1.00 0.00 ? 34  ALA A HB3  3  
ATOM 4109  N N    . LYS A 1 35  ? -244.633 -9.670  112.727 1.00 0.00 ? 35  LYS A N    3  
ATOM 4110  C CA   . LYS A 1 35  ? -245.252 -8.348  112.594 1.00 0.00 ? 35  LYS A CA   3  
ATOM 4111  C C    . LYS A 1 35  ? -244.495 -7.530  111.557 1.00 0.00 ? 35  LYS A C    3  
ATOM 4112  O O    . LYS A 1 35  ? -245.090 -6.966  110.638 1.00 0.00 ? 35  LYS A O    3  
ATOM 4113  C CB   . LYS A 1 35  ? -245.310 -7.602  113.943 1.00 0.00 ? 35  LYS A CB   3  
ATOM 4114  C CG   . LYS A 1 35  ? -243.948 -7.277  114.552 1.00 0.00 ? 35  LYS A CG   3  
ATOM 4115  C CD   . LYS A 1 35  ? -244.065 -6.405  115.801 1.00 0.00 ? 35  LYS A CD   3  
ATOM 4116  C CE   . LYS A 1 35  ? -244.588 -7.187  116.996 1.00 0.00 ? 35  LYS A CE   3  
ATOM 4117  N NZ   . LYS A 1 35  ? -244.615 -6.367  118.239 1.00 0.00 ? 35  LYS A NZ   3  
ATOM 4118  H H    . LYS A 1 35  ? -243.970 -9.825  113.424 1.00 0.00 ? 35  LYS A H    3  
ATOM 4119  H HA   . LYS A 1 35  ? -246.267 -8.493  112.228 1.00 0.00 ? 35  LYS A HA   3  
ATOM 4120  H HB2  . LYS A 1 35  ? -245.842 -6.674  113.803 1.00 0.00 ? 35  LYS A HB2  3  
ATOM 4121  H HB3  . LYS A 1 35  ? -245.857 -8.212  114.649 1.00 0.00 ? 35  LYS A HB3  3  
ATOM 4122  H HG2  . LYS A 1 35  ? -243.456 -8.201  114.821 1.00 0.00 ? 35  LYS A HG2  3  
ATOM 4123  H HG3  . LYS A 1 35  ? -243.355 -6.756  113.815 1.00 0.00 ? 35  LYS A HG3  3  
ATOM 4124  H HD2  . LYS A 1 35  ? -243.090 -6.009  116.043 1.00 0.00 ? 35  LYS A HD2  3  
ATOM 4125  H HD3  . LYS A 1 35  ? -244.742 -5.588  115.592 1.00 0.00 ? 35  LYS A HD3  3  
ATOM 4126  H HE2  . LYS A 1 35  ? -245.590 -7.524  116.779 1.00 0.00 ? 35  LYS A HE2  3  
ATOM 4127  H HE3  . LYS A 1 35  ? -243.949 -8.044  117.156 1.00 0.00 ? 35  LYS A HE3  3  
ATOM 4128  H HZ1  . LYS A 1 35  ? -243.697 -5.891  118.378 1.00 0.00 ? 35  LYS A HZ1  3  
ATOM 4129  H HZ2  . LYS A 1 35  ? -245.363 -5.638  118.174 1.00 0.00 ? 35  LYS A HZ2  3  
ATOM 4130  H HZ3  . LYS A 1 35  ? -244.808 -6.978  119.065 1.00 0.00 ? 35  LYS A HZ3  3  
ATOM 4131  N N    . GLN A 1 36  ? -243.170 -7.496  111.698 1.00 0.00 ? 36  GLN A N    3  
ATOM 4132  C CA   . GLN A 1 36  ? -242.308 -6.854  110.726 1.00 0.00 ? 36  GLN A CA   3  
ATOM 4133  C C    . GLN A 1 36  ? -242.456 -7.563  109.398 1.00 0.00 ? 36  GLN A C    3  
ATOM 4134  O O    . GLN A 1 36  ? -242.195 -7.006  108.332 1.00 0.00 ? 36  GLN A O    3  
ATOM 4135  C CB   . GLN A 1 36  ? -240.853 -6.917  111.193 1.00 0.00 ? 36  GLN A CB   3  
ATOM 4136  C CG   . GLN A 1 36  ? -240.619 -6.302  112.561 1.00 0.00 ? 36  GLN A CG   3  
ATOM 4137  C CD   . GLN A 1 36  ? -240.987 -4.838  112.606 1.00 0.00 ? 36  GLN A CD   3  
ATOM 4138  O OE1  . GLN A 1 36  ? -242.127 -4.486  112.889 1.00 0.00 ? 36  GLN A OE1  3  
ATOM 4139  N NE2  . GLN A 1 36  ? -240.022 -3.982  112.329 1.00 0.00 ? 36  GLN A NE2  3  
ATOM 4140  H H    . GLN A 1 36  ? -242.761 -7.909  112.487 1.00 0.00 ? 36  GLN A H    3  
ATOM 4141  H HA   . GLN A 1 36  ? -242.614 -5.823  110.622 1.00 0.00 ? 36  GLN A HA   3  
ATOM 4142  H HB2  . GLN A 1 36  ? -240.540 -7.949  111.230 1.00 0.00 ? 36  GLN A HB2  3  
ATOM 4143  H HB3  . GLN A 1 36  ? -240.239 -6.392  110.481 1.00 0.00 ? 36  GLN A HB3  3  
ATOM 4144  H HG2  . GLN A 1 36  ? -241.220 -6.825  113.288 1.00 0.00 ? 36  GLN A HG2  3  
ATOM 4145  H HG3  . GLN A 1 36  ? -239.573 -6.402  112.816 1.00 0.00 ? 36  GLN A HG3  3  
ATOM 4146  H HE21 . GLN A 1 36  ? -239.126 -4.340  112.116 1.00 0.00 ? 36  GLN A HE21 3  
ATOM 4147  H HE22 . GLN A 1 36  ? -240.241 -3.020  112.344 1.00 0.00 ? 36  GLN A HE22 3  
ATOM 4148  N N    . LEU A 1 37  ? -242.858 -8.813  109.473 1.00 0.00 ? 37  LEU A N    3  
ATOM 4149  C CA   . LEU A 1 37  ? -243.045 -9.595  108.297 1.00 0.00 ? 37  LEU A CA   3  
ATOM 4150  C C    . LEU A 1 37  ? -244.393 -9.414  107.664 1.00 0.00 ? 37  LEU A C    3  
ATOM 4151  O O    . LEU A 1 37  ? -244.487 -9.414  106.450 1.00 0.00 ? 37  LEU A O    3  
ATOM 4152  C CB   . LEU A 1 37  ? -242.792 -11.049 108.568 1.00 0.00 ? 37  LEU A CB   3  
ATOM 4153  C CG   . LEU A 1 37  ? -241.869 -11.607 107.536 1.00 0.00 ? 37  LEU A CG   3  
ATOM 4154  C CD1  . LEU A 1 37  ? -242.597 -11.661 106.213 1.00 0.00 ? 37  LEU A CD1  3  
ATOM 4155  C CD2  . LEU A 1 37  ? -240.683 -10.676 107.414 1.00 0.00 ? 37  LEU A CD2  3  
ATOM 4156  H H    . LEU A 1 37  ? -243.002 -9.224  110.346 1.00 0.00 ? 37  LEU A H    3  
ATOM 4157  H HA   . LEU A 1 37  ? -242.307 -9.261  107.583 1.00 0.00 ? 37  LEU A HA   3  
ATOM 4158  H HB2  . LEU A 1 37  ? -242.347 -11.157 109.549 1.00 0.00 ? 37  LEU A HB2  3  
ATOM 4159  H HB3  . LEU A 1 37  ? -243.723 -11.588 108.531 1.00 0.00 ? 37  LEU A HB3  3  
ATOM 4160  H HG   . LEU A 1 37  ? -241.535 -12.591 107.820 1.00 0.00 ? 37  LEU A HG   3  
ATOM 4161  H HD11 . LEU A 1 37  ? -243.045 -10.679 106.028 1.00 0.00 ? 37  LEU A HD11 3  
ATOM 4162  H HD12 . LEU A 1 37  ? -241.902 -11.900 105.421 1.00 0.00 ? 37  LEU A HD12 3  
ATOM 4163  H HD13 . LEU A 1 37  ? -243.376 -12.403 106.256 1.00 0.00 ? 37  LEU A HD13 3  
ATOM 4164  H HD21 . LEU A 1 37  ? -240.487 -10.209 108.366 1.00 0.00 ? 37  LEU A HD21 3  
ATOM 4165  H HD22 . LEU A 1 37  ? -239.816 -11.237 107.097 1.00 0.00 ? 37  LEU A HD22 3  
ATOM 4166  H HD23 . LEU A 1 37  ? -240.901 -9.915  106.675 1.00 0.00 ? 37  LEU A HD23 3  
ATOM 4167  N N    . LEU A 1 38  ? -245.435 -9.288  108.454 1.00 0.00 ? 38  LEU A N    3  
ATOM 4168  C CA   . LEU A 1 38  ? -246.735 -8.984  107.896 1.00 0.00 ? 38  LEU A CA   3  
ATOM 4169  C C    . LEU A 1 38  ? -246.571 -7.768  106.981 1.00 0.00 ? 38  LEU A C    3  
ATOM 4170  O O    . LEU A 1 38  ? -247.104 -7.725  105.891 1.00 0.00 ? 38  LEU A O    3  
ATOM 4171  C CB   . LEU A 1 38  ? -247.747 -8.751  109.029 1.00 0.00 ? 38  LEU A CB   3  
ATOM 4172  C CG   . LEU A 1 38  ? -249.226 -8.812  108.627 1.00 0.00 ? 38  LEU A CG   3  
ATOM 4173  C CD1  . LEU A 1 38  ? -249.918 -7.495  108.931 1.00 0.00 ? 38  LEU A CD1  3  
ATOM 4174  C CD2  . LEU A 1 38  ? -249.382 -9.187  107.157 1.00 0.00 ? 38  LEU A CD2  3  
ATOM 4175  H H    . LEU A 1 38  ? -245.336 -9.417  109.422 1.00 0.00 ? 38  LEU A H    3  
ATOM 4176  H HA   . LEU A 1 38  ? -247.052 -9.833  107.292 1.00 0.00 ? 38  LEU A HA   3  
ATOM 4177  H HB2  . LEU A 1 38  ? -247.576 -9.513  109.781 1.00 0.00 ? 38  LEU A HB2  3  
ATOM 4178  H HB3  . LEU A 1 38  ? -247.549 -7.789  109.478 1.00 0.00 ? 38  LEU A HB3  3  
ATOM 4179  H HG   . LEU A 1 38  ? -249.713 -9.578  109.216 1.00 0.00 ? 38  LEU A HG   3  
ATOM 4180  H HD11 . LEU A 1 38  ? -249.837 -7.280  109.987 1.00 0.00 ? 38  LEU A HD11 3  
ATOM 4181  H HD12 . LEU A 1 38  ? -249.449 -6.704  108.364 1.00 0.00 ? 38  LEU A HD12 3  
ATOM 4182  H HD13 . LEU A 1 38  ? -250.961 -7.565  108.656 1.00 0.00 ? 38  LEU A HD13 3  
ATOM 4183  H HD21 . LEU A 1 38  ? -248.842 -10.107 106.956 1.00 0.00 ? 38  LEU A HD21 3  
ATOM 4184  H HD22 . LEU A 1 38  ? -250.428 -9.328  106.927 1.00 0.00 ? 38  LEU A HD22 3  
ATOM 4185  H HD23 . LEU A 1 38  ? -248.980 -8.398  106.539 1.00 0.00 ? 38  LEU A HD23 3  
ATOM 4186  N N    . GLN A 1 39  ? -245.726 -6.852  107.412 1.00 0.00 ? 39  GLN A N    3  
ATOM 4187  C CA   . GLN A 1 39  ? -245.256 -5.756  106.621 1.00 0.00 ? 39  GLN A CA   3  
ATOM 4188  C C    . GLN A 1 39  ? -244.651 -6.219  105.321 1.00 0.00 ? 39  GLN A C    3  
ATOM 4189  O O    . GLN A 1 39  ? -245.026 -5.760  104.270 1.00 0.00 ? 39  GLN A O    3  
ATOM 4190  C CB   . GLN A 1 39  ? -244.139 -5.134  107.399 1.00 0.00 ? 39  GLN A CB   3  
ATOM 4191  C CG   . GLN A 1 39  ? -243.639 -3.882  106.770 1.00 0.00 ? 39  GLN A CG   3  
ATOM 4192  C CD   . GLN A 1 39  ? -242.464 -3.264  107.509 1.00 0.00 ? 39  GLN A CD   3  
ATOM 4193  O OE1  . GLN A 1 39  ? -242.286 -2.046  107.501 1.00 0.00 ? 39  GLN A OE1  3  
ATOM 4194  N NE2  . GLN A 1 39  ? -241.650 -4.097  108.142 1.00 0.00 ? 39  GLN A NE2  3  
ATOM 4195  H H    . GLN A 1 39  ? -245.410 -6.896  108.320 1.00 0.00 ? 39  GLN A H    3  
ATOM 4196  H HA   . GLN A 1 39  ? -246.056 -5.037  106.439 1.00 0.00 ? 39  GLN A HA   3  
ATOM 4197  H HB2  . GLN A 1 39  ? -244.455 -4.963  108.397 1.00 0.00 ? 39  GLN A HB2  3  
ATOM 4198  H HB3  . GLN A 1 39  ? -243.319 -5.837  107.423 1.00 0.00 ? 39  GLN A HB3  3  
ATOM 4199  H HG2  . GLN A 1 39  ? -243.327 -4.148  105.767 1.00 0.00 ? 39  GLN A HG2  3  
ATOM 4200  H HG3  . GLN A 1 39  ? -244.451 -3.177  106.730 1.00 0.00 ? 39  GLN A HG3  3  
ATOM 4201  H HE21 . GLN A 1 39  ? -241.842 -5.059  108.100 1.00 0.00 ? 39  GLN A HE21 3  
ATOM 4202  H HE22 . GLN A 1 39  ? -240.887 -3.715  108.627 1.00 0.00 ? 39  GLN A HE22 3  
ATOM 4203  N N    . GLN A 1 40  ? -243.667 -7.089  105.415 1.00 0.00 ? 40  GLN A N    3  
ATOM 4204  C CA   . GLN A 1 40  ? -243.006 -7.618  104.238 1.00 0.00 ? 40  GLN A CA   3  
ATOM 4205  C C    . GLN A 1 40  ? -243.999 -8.267  103.279 1.00 0.00 ? 40  GLN A C    3  
ATOM 4206  O O    . GLN A 1 40  ? -243.784 -8.300  102.071 1.00 0.00 ? 40  GLN A O    3  
ATOM 4207  C CB   . GLN A 1 40  ? -241.923 -8.601  104.657 1.00 0.00 ? 40  GLN A CB   3  
ATOM 4208  C CG   . GLN A 1 40  ? -240.597 -7.920  104.904 1.00 0.00 ? 40  GLN A CG   3  
ATOM 4209  C CD   . GLN A 1 40  ? -240.197 -7.077  103.714 1.00 0.00 ? 40  GLN A CD   3  
ATOM 4210  O OE1  . GLN A 1 40  ? -239.473 -6.087  103.838 1.00 0.00 ? 40  GLN A OE1  3  
ATOM 4211  N NE2  . GLN A 1 40  ? -240.716 -7.449  102.555 1.00 0.00 ? 40  GLN A NE2  3  
ATOM 4212  H H    . GLN A 1 40  ? -243.369 -7.382  106.305 1.00 0.00 ? 40  GLN A H    3  
ATOM 4213  H HA   . GLN A 1 40  ? -242.536 -6.791  103.730 1.00 0.00 ? 40  GLN A HA   3  
ATOM 4214  H HB2  . GLN A 1 40  ? -242.231 -9.096  105.569 1.00 0.00 ? 40  GLN A HB2  3  
ATOM 4215  H HB3  . GLN A 1 40  ? -241.791 -9.340  103.881 1.00 0.00 ? 40  GLN A HB3  3  
ATOM 4216  H HG2  . GLN A 1 40  ? -240.686 -7.283  105.771 1.00 0.00 ? 40  GLN A HG2  3  
ATOM 4217  H HG3  . GLN A 1 40  ? -239.847 -8.669  105.077 1.00 0.00 ? 40  GLN A HG3  3  
ATOM 4218  H HE21 . GLN A 1 40  ? -241.312 -8.235  102.550 1.00 0.00 ? 40  GLN A HE21 3  
ATOM 4219  H HE22 . GLN A 1 40  ? -240.509 -6.930  101.762 1.00 0.00 ? 40  GLN A HE22 3  
ATOM 4220  N N    . ILE A 1 41  ? -245.082 -8.750  103.843 1.00 0.00 ? 41  ILE A N    3  
ATOM 4221  C CA   . ILE A 1 41  ? -246.175 -9.364  103.106 1.00 0.00 ? 41  ILE A CA   3  
ATOM 4222  C C    . ILE A 1 41  ? -247.042 -8.284  102.450 1.00 0.00 ? 41  ILE A C    3  
ATOM 4223  O O    . ILE A 1 41  ? -247.688 -8.499  101.425 1.00 0.00 ? 41  ILE A O    3  
ATOM 4224  C CB   . ILE A 1 41  ? -247.019 -10.215 104.086 1.00 0.00 ? 41  ILE A CB   3  
ATOM 4225  C CG1  . ILE A 1 41  ? -246.119 -11.214 104.836 1.00 0.00 ? 41  ILE A CG1  3  
ATOM 4226  C CG2  . ILE A 1 41  ? -248.152 -10.940 103.391 1.00 0.00 ? 41  ILE A CG2  3  
ATOM 4227  C CD1  . ILE A 1 41  ? -245.070 -11.901 103.969 1.00 0.00 ? 41  ILE A CD1  3  
ATOM 4228  H H    . ILE A 1 41  ? -245.152 -8.706  104.822 1.00 0.00 ? 41  ILE A H    3  
ATOM 4229  H HA   . ILE A 1 41  ? -245.763 -10.013 102.346 1.00 0.00 ? 41  ILE A HA   3  
ATOM 4230  H HB   . ILE A 1 41  ? -247.461 -9.540  104.811 1.00 0.00 ? 41  ILE A HB   3  
ATOM 4231  H HG12 . ILE A 1 41  ? -245.600 -10.693 105.624 1.00 0.00 ? 41  ILE A HG12 3  
ATOM 4232  H HG13 . ILE A 1 41  ? -246.740 -11.982 105.272 1.00 0.00 ? 41  ILE A HG13 3  
ATOM 4233  H HG21 . ILE A 1 41  ? -248.768 -10.227 102.864 1.00 0.00 ? 41  ILE A HG21 3  
ATOM 4234  H HG22 . ILE A 1 41  ? -247.751 -11.659 102.693 1.00 0.00 ? 41  ILE A HG22 3  
ATOM 4235  H HG23 . ILE A 1 41  ? -248.747 -11.451 104.134 1.00 0.00 ? 41  ILE A HG23 3  
ATOM 4236  H HD11 . ILE A 1 41  ? -244.557 -11.163 103.369 1.00 0.00 ? 41  ILE A HD11 3  
ATOM 4237  H HD12 . ILE A 1 41  ? -244.348 -12.404 104.602 1.00 0.00 ? 41  ILE A HD12 3  
ATOM 4238  H HD13 . ILE A 1 41  ? -245.545 -12.621 103.324 1.00 0.00 ? 41  ILE A HD13 3  
ATOM 4239  N N    . LEU A 1 42  ? -247.029 -7.123  103.074 1.00 0.00 ? 42  LEU A N    3  
ATOM 4240  C CA   . LEU A 1 42  ? -247.896 -6.004  102.737 1.00 0.00 ? 42  LEU A CA   3  
ATOM 4241  C C    . LEU A 1 42  ? -247.227 -4.995  101.808 1.00 0.00 ? 42  LEU A C    3  
ATOM 4242  O O    . LEU A 1 42  ? -247.872 -4.383  100.956 1.00 0.00 ? 42  LEU A O    3  
ATOM 4243  C CB   . LEU A 1 42  ? -248.236 -5.322  104.047 1.00 0.00 ? 42  LEU A CB   3  
ATOM 4244  C CG   . LEU A 1 42  ? -249.104 -6.175  104.957 1.00 0.00 ? 42  LEU A CG   3  
ATOM 4245  C CD1  . LEU A 1 42  ? -249.360 -5.468  106.253 1.00 0.00 ? 42  LEU A CD1  3  
ATOM 4246  C CD2  . LEU A 1 42  ? -250.405 -6.531  104.280 1.00 0.00 ? 42  LEU A CD2  3  
ATOM 4247  H H    . LEU A 1 42  ? -246.399 -7.009  103.816 1.00 0.00 ? 42  LEU A H    3  
ATOM 4248  H HA   . LEU A 1 42  ? -248.804 -6.374  102.302 1.00 0.00 ? 42  LEU A HA   3  
ATOM 4249  H HB2  . LEU A 1 42  ? -247.306 -5.097  104.553 1.00 0.00 ? 42  LEU A HB2  3  
ATOM 4250  H HB3  . LEU A 1 42  ? -248.737 -4.399  103.856 1.00 0.00 ? 42  LEU A HB3  3  
ATOM 4251  H HG   . LEU A 1 42  ? -248.584 -7.096  105.180 1.00 0.00 ? 42  LEU A HG   3  
ATOM 4252  H HD11 . LEU A 1 42  ? -249.855 -4.533  106.053 1.00 0.00 ? 42  LEU A HD11 3  
ATOM 4253  H HD12 . LEU A 1 42  ? -249.987 -6.085  106.877 1.00 0.00 ? 42  LEU A HD12 3  
ATOM 4254  H HD13 . LEU A 1 42  ? -248.420 -5.288  106.746 1.00 0.00 ? 42  LEU A HD13 3  
ATOM 4255  H HD21 . LEU A 1 42  ? -250.195 -7.044  103.355 1.00 0.00 ? 42  LEU A HD21 3  
ATOM 4256  H HD22 . LEU A 1 42  ? -250.980 -7.170  104.929 1.00 0.00 ? 42  LEU A HD22 3  
ATOM 4257  H HD23 . LEU A 1 42  ? -250.960 -5.628  104.075 1.00 0.00 ? 42  LEU A HD23 3  
ATOM 4258  N N    . THR A 1 43  ? -245.926 -4.866  101.986 1.00 0.00 ? 43  THR A N    3  
ATOM 4259  C CA   . THR A 1 43  ? -245.157 -3.728  101.556 1.00 0.00 ? 43  THR A CA   3  
ATOM 4260  C C    . THR A 1 43  ? -245.408 -3.333  100.114 1.00 0.00 ? 43  THR A C    3  
ATOM 4261  O O    . THR A 1 43  ? -245.119 -4.051  99.155  1.00 0.00 ? 43  THR A O    3  
ATOM 4262  C CB   . THR A 1 43  ? -243.645 -3.935  101.814 1.00 0.00 ? 43  THR A CB   3  
ATOM 4263  O OG1  . THR A 1 43  ? -242.915 -2.752  101.468 1.00 0.00 ? 43  THR A OG1  3  
ATOM 4264  C CG2  . THR A 1 43  ? -243.097 -5.121  101.038 1.00 0.00 ? 43  THR A CG2  3  
ATOM 4265  H H    . THR A 1 43  ? -245.459 -5.572  102.447 1.00 0.00 ? 43  THR A H    3  
ATOM 4266  H HA   . THR A 1 43  ? -245.476 -2.901  102.180 1.00 0.00 ? 43  THR A HA   3  
ATOM 4267  H HB   . THR A 1 43  ? -243.506 -4.125  102.867 1.00 0.00 ? 43  THR A HB   3  
ATOM 4268  H HG1  . THR A 1 43  ? -242.044 -2.778  101.898 1.00 0.00 ? 43  THR A HG1  3  
ATOM 4269  H HG21 . THR A 1 43  ? -243.623 -6.018  101.330 1.00 0.00 ? 43  THR A HG21 3  
ATOM 4270  H HG22 . THR A 1 43  ? -243.233 -4.953  99.981  1.00 0.00 ? 43  THR A HG22 3  
ATOM 4271  H HG23 . THR A 1 43  ? -242.045 -5.237  101.251 1.00 0.00 ? 43  THR A HG23 3  
ATOM 4272  N N    . ASN A 1 44  ? -245.994 -2.171  100.011 1.00 0.00 ? 44  ASN A N    3  
ATOM 4273  C CA   . ASN A 1 44  ? -246.175 -1.485  98.744  1.00 0.00 ? 44  ASN A CA   3  
ATOM 4274  C C    . ASN A 1 44  ? -244.893 -0.766  98.388  1.00 0.00 ? 44  ASN A C    3  
ATOM 4275  O O    . ASN A 1 44  ? -244.735 -0.257  97.280  1.00 0.00 ? 44  ASN A O    3  
ATOM 4276  C CB   . ASN A 1 44  ? -247.318 -0.476  98.831  1.00 0.00 ? 44  ASN A CB   3  
ATOM 4277  C CG   . ASN A 1 44  ? -248.681 -1.082  98.557  1.00 0.00 ? 44  ASN A CG   3  
ATOM 4278  O OD1  . ASN A 1 44  ? -249.568 -0.404  98.045  1.00 0.00 ? 44  ASN A OD1  3  
ATOM 4279  N ND2  . ASN A 1 44  ? -248.865 -2.351  98.895  1.00 0.00 ? 44  ASN A ND2  3  
ATOM 4280  H H    . ASN A 1 44  ? -246.309 -1.760  100.833 1.00 0.00 ? 44  ASN A H    3  
ATOM 4281  H HA   . ASN A 1 44  ? -246.396 -2.218  97.984  1.00 0.00 ? 44  ASN A HA   3  
ATOM 4282  H HB2  . ASN A 1 44  ? -247.327 -0.053  99.825  1.00 0.00 ? 44  ASN A HB2  3  
ATOM 4283  H HB3  . ASN A 1 44  ? -247.141 0.314   98.115  1.00 0.00 ? 44  ASN A HB3  3  
ATOM 4284  H HD21 . ASN A 1 44  ? -248.115 -2.840  99.306  1.00 0.00 ? 44  ASN A HD21 3  
ATOM 4285  H HD22 . ASN A 1 44  ? -249.741 -2.756  98.719  1.00 0.00 ? 44  ASN A HD22 3  
ATOM 4286  N N    . GLU A 1 45  ? -244.006 -0.686  99.383  1.00 0.00 ? 45  GLU A N    3  
ATOM 4287  C CA   . GLU A 1 45  ? -242.658 -0.167  99.208  1.00 0.00 ? 45  GLU A CA   3  
ATOM 4288  C C    . GLU A 1 45  ? -242.637 1.334   98.910  1.00 0.00 ? 45  GLU A C    3  
ATOM 4289  O O    . GLU A 1 45  ? -241.575 1.906   98.672  1.00 0.00 ? 45  GLU A O    3  
ATOM 4290  C CB   . GLU A 1 45  ? -241.955 -0.951  98.112  1.00 0.00 ? 45  GLU A CB   3  
ATOM 4291  C CG   . GLU A 1 45  ? -241.547 -2.354  98.533  1.00 0.00 ? 45  GLU A CG   3  
ATOM 4292  C CD   . GLU A 1 45  ? -240.759 -3.081  97.463  1.00 0.00 ? 45  GLU A CD   3  
ATOM 4293  O OE1  . GLU A 1 45  ? -241.356 -3.466  96.436  1.00 0.00 ? 45  GLU A OE1  3  
ATOM 4294  O OE2  . GLU A 1 45  ? -239.537 -3.280  97.650  1.00 0.00 ? 45  GLU A OE2  3  
ATOM 4295  H H    . GLU A 1 45  ? -244.268 -1.014  100.264 1.00 0.00 ? 45  GLU A H    3  
ATOM 4296  H HA   . GLU A 1 45  ? -242.130 -0.332  100.135 1.00 0.00 ? 45  GLU A HA   3  
ATOM 4297  H HB2  . GLU A 1 45  ? -242.640 -1.041  97.284  1.00 0.00 ? 45  GLU A HB2  3  
ATOM 4298  H HB3  . GLU A 1 45  ? -241.078 -0.414  97.800  1.00 0.00 ? 45  GLU A HB3  3  
ATOM 4299  H HG2  . GLU A 1 45  ? -240.937 -2.289  99.423  1.00 0.00 ? 45  GLU A HG2  3  
ATOM 4300  H HG3  . GLU A 1 45  ? -242.438 -2.923  98.751  1.00 0.00 ? 45  GLU A HG3  3  
ATOM 4301  N N    . GLN A 1 46  ? -243.806 1.966   98.936  1.00 0.00 ? 46  GLN A N    3  
ATOM 4302  C CA   . GLN A 1 46  ? -243.903 3.410   98.801  1.00 0.00 ? 46  GLN A CA   3  
ATOM 4303  C C    . GLN A 1 46  ? -243.327 4.071   100.025 1.00 0.00 ? 46  GLN A C    3  
ATOM 4304  O O    . GLN A 1 46  ? -242.120 4.252   100.158 1.00 0.00 ? 46  GLN A O    3  
ATOM 4305  C CB   . GLN A 1 46  ? -245.361 3.822   98.614  1.00 0.00 ? 46  GLN A CB   3  
ATOM 4306  C CG   . GLN A 1 46  ? -246.036 3.136   97.446  1.00 0.00 ? 46  GLN A CG   3  
ATOM 4307  C CD   . GLN A 1 46  ? -247.381 3.736   97.097  1.00 0.00 ? 46  GLN A CD   3  
ATOM 4308  O OE1  . GLN A 1 46  ? -247.470 4.663   96.290  1.00 0.00 ? 46  GLN A OE1  3  
ATOM 4309  N NE2  . GLN A 1 46  ? -248.439 3.217   97.699  1.00 0.00 ? 46  GLN A NE2  3  
ATOM 4310  H H    . GLN A 1 46  ? -244.626 1.445   99.029  1.00 0.00 ? 46  GLN A H    3  
ATOM 4311  H HA   . GLN A 1 46  ? -243.345 3.715   97.958  1.00 0.00 ? 46  GLN A HA   3  
ATOM 4312  H HB2  . GLN A 1 46  ? -245.909 3.579   99.514  1.00 0.00 ? 46  GLN A HB2  3  
ATOM 4313  H HB3  . GLN A 1 46  ? -245.399 4.882   98.459  1.00 0.00 ? 46  GLN A HB3  3  
ATOM 4314  H HG2  . GLN A 1 46  ? -245.392 3.209   96.583  1.00 0.00 ? 46  GLN A HG2  3  
ATOM 4315  H HG3  . GLN A 1 46  ? -246.179 2.097   97.701  1.00 0.00 ? 46  GLN A HG3  3  
ATOM 4316  H HE21 . GLN A 1 46  ? -248.301 2.480   98.329  1.00 0.00 ? 46  GLN A HE21 3  
ATOM 4317  H HE22 . GLN A 1 46  ? -249.322 3.594   97.495  1.00 0.00 ? 46  GLN A HE22 3  
ATOM 4318  N N    . ASP A 1 47  ? -244.212 4.398   100.921 1.00 0.00 ? 47  ASP A N    3  
ATOM 4319  C CA   . ASP A 1 47  ? -243.834 4.712   102.294 1.00 0.00 ? 47  ASP A CA   3  
ATOM 4320  C C    . ASP A 1 47  ? -243.773 3.392   103.057 1.00 0.00 ? 47  ASP A C    3  
ATOM 4321  O O    . ASP A 1 47  ? -243.790 3.339   104.290 1.00 0.00 ? 47  ASP A O    3  
ATOM 4322  C CB   . ASP A 1 47  ? -244.834 5.674   102.941 1.00 0.00 ? 47  ASP A CB   3  
ATOM 4323  C CG   . ASP A 1 47  ? -244.312 6.257   104.244 1.00 0.00 ? 47  ASP A CG   3  
ATOM 4324  O OD1  . ASP A 1 47  ? -243.287 6.975   104.212 1.00 0.00 ? 47  ASP A OD1  3  
ATOM 4325  O OD2  . ASP A 1 47  ? -244.922 6.010   105.304 1.00 0.00 ? 47  ASP A OD2  3  
ATOM 4326  H H    . ASP A 1 47  ? -245.146 4.439   100.642 1.00 0.00 ? 47  ASP A H    3  
ATOM 4327  H HA   . ASP A 1 47  ? -242.852 5.160   102.279 1.00 0.00 ? 47  ASP A HA   3  
ATOM 4328  H HB2  . ASP A 1 47  ? -245.038 6.486   102.260 1.00 0.00 ? 47  ASP A HB2  3  
ATOM 4329  H HB3  . ASP A 1 47  ? -245.750 5.144   103.149 1.00 0.00 ? 47  ASP A HB3  3  
ATOM 4330  N N    . ILE A 1 48  ? -243.719 2.323   102.257 1.00 0.00 ? 48  ILE A N    3  
ATOM 4331  C CA   . ILE A 1 48  ? -243.648 0.944   102.717 1.00 0.00 ? 48  ILE A CA   3  
ATOM 4332  C C    . ILE A 1 48  ? -244.994 0.427   103.166 1.00 0.00 ? 48  ILE A C    3  
ATOM 4333  O O    . ILE A 1 48  ? -245.435 -0.641  102.749 1.00 0.00 ? 48  ILE A O    3  
ATOM 4334  C CB   . ILE A 1 48  ? -242.607 0.750   103.833 1.00 0.00 ? 48  ILE A CB   3  
ATOM 4335  C CG1  . ILE A 1 48  ? -241.199 1.057   103.309 1.00 0.00 ? 48  ILE A CG1  3  
ATOM 4336  C CG2  . ILE A 1 48  ? -242.679 -0.669  104.385 1.00 0.00 ? 48  ILE A CG2  3  
ATOM 4337  C CD1  . ILE A 1 48  ? -240.127 1.015   104.379 1.00 0.00 ? 48  ILE A CD1  3  
ATOM 4338  H H    . ILE A 1 48  ? -243.719 2.482   101.293 1.00 0.00 ? 48  ILE A H    3  
ATOM 4339  H HA   . ILE A 1 48  ? -243.352 0.363   101.890 1.00 0.00 ? 48  ILE A HA   3  
ATOM 4340  H HB   . ILE A 1 48  ? -242.847 1.439   104.626 1.00 0.00 ? 48  ILE A HB   3  
ATOM 4341  H HG12 . ILE A 1 48  ? -240.938 0.330   102.553 1.00 0.00 ? 48  ILE A HG12 3  
ATOM 4342  H HG13 . ILE A 1 48  ? -241.192 2.043   102.871 1.00 0.00 ? 48  ILE A HG13 3  
ATOM 4343  H HG21 . ILE A 1 48  ? -242.487 -1.371  103.589 1.00 0.00 ? 48  ILE A HG21 3  
ATOM 4344  H HG22 . ILE A 1 48  ? -241.942 -0.790  105.163 1.00 0.00 ? 48  ILE A HG22 3  
ATOM 4345  H HG23 . ILE A 1 48  ? -243.666 -0.847  104.790 1.00 0.00 ? 48  ILE A HG23 3  
ATOM 4346  H HD11 . ILE A 1 48  ? -240.112 0.038   104.838 1.00 0.00 ? 48  ILE A HD11 3  
ATOM 4347  H HD12 . ILE A 1 48  ? -239.166 1.218   103.934 1.00 0.00 ? 48  ILE A HD12 3  
ATOM 4348  H HD13 . ILE A 1 48  ? -240.342 1.762   105.130 1.00 0.00 ? 48  ILE A HD13 3  
ATOM 4349  N N    . LYS A 1 49  ? -245.631 1.229   103.963 1.00 0.00 ? 49  LYS A N    3  
ATOM 4350  C CA   . LYS A 1 49  ? -246.851 0.860   104.663 1.00 0.00 ? 49  LYS A CA   3  
ATOM 4351  C C    . LYS A 1 49  ? -248.115 1.092   103.825 1.00 0.00 ? 49  LYS A C    3  
ATOM 4352  O O    . LYS A 1 49  ? -248.495 2.228   103.539 1.00 0.00 ? 49  LYS A O    3  
ATOM 4353  C CB   . LYS A 1 49  ? -246.938 1.643   105.976 1.00 0.00 ? 49  LYS A CB   3  
ATOM 4354  C CG   . LYS A 1 49  ? -246.923 3.155   105.796 1.00 0.00 ? 49  LYS A CG   3  
ATOM 4355  C CD   . LYS A 1 49  ? -246.969 3.882   107.130 1.00 0.00 ? 49  LYS A CD   3  
ATOM 4356  C CE   . LYS A 1 49  ? -245.694 3.667   107.926 1.00 0.00 ? 49  LYS A CE   3  
ATOM 4357  N NZ   . LYS A 1 49  ? -244.500 4.197   107.220 1.00 0.00 ? 49  LYS A NZ   3  
ATOM 4358  H H    . LYS A 1 49  ? -245.257 2.113   104.092 1.00 0.00 ? 49  LYS A H    3  
ATOM 4359  H HA   . LYS A 1 49  ? -246.784 -0.191  104.897 1.00 0.00 ? 49  LYS A HA   3  
ATOM 4360  H HB2  . LYS A 1 49  ? -247.851 1.377   106.474 1.00 0.00 ? 49  LYS A HB2  3  
ATOM 4361  H HB3  . LYS A 1 49  ? -246.103 1.369   106.604 1.00 0.00 ? 49  LYS A HB3  3  
ATOM 4362  H HG2  . LYS A 1 49  ? -246.020 3.435   105.275 1.00 0.00 ? 49  LYS A HG2  3  
ATOM 4363  H HG3  . LYS A 1 49  ? -247.782 3.445   105.207 1.00 0.00 ? 49  LYS A HG3  3  
ATOM 4364  H HD2  . LYS A 1 49  ? -247.093 4.940   106.947 1.00 0.00 ? 49  LYS A HD2  3  
ATOM 4365  H HD3  . LYS A 1 49  ? -247.808 3.512   107.700 1.00 0.00 ? 49  LYS A HD3  3  
ATOM 4366  H HE2  . LYS A 1 49  ? -245.789 4.173   108.877 1.00 0.00 ? 49  LYS A HE2  3  
ATOM 4367  H HE3  . LYS A 1 49  ? -245.563 2.609   108.094 1.00 0.00 ? 49  LYS A HE3  3  
ATOM 4368  H HZ1  . LYS A 1 49  ? -244.665 5.186   106.930 1.00 0.00 ? 49  LYS A HZ1  3  
ATOM 4369  H HZ2  . LYS A 1 49  ? -243.670 4.166   107.850 1.00 0.00 ? 49  LYS A HZ2  3  
ATOM 4370  H HZ3  . LYS A 1 49  ? -244.300 3.632   106.372 1.00 0.00 ? 49  LYS A HZ3  3  
ATOM 4371  N N    . PRO A 1 50  ? -248.744 -0.003  103.377 1.00 0.00 ? 50  PRO A N    3  
ATOM 4372  C CA   . PRO A 1 50  ? -250.108 0.002   102.827 1.00 0.00 ? 50  PRO A CA   3  
ATOM 4373  C C    . PRO A 1 50  ? -251.170 0.400   103.837 1.00 0.00 ? 50  PRO A C    3  
ATOM 4374  O O    . PRO A 1 50  ? -250.950 1.200   104.748 1.00 0.00 ? 50  PRO A O    3  
ATOM 4375  C CB   . PRO A 1 50  ? -250.326 -1.474  102.514 1.00 0.00 ? 50  PRO A CB   3  
ATOM 4376  C CG   . PRO A 1 50  ? -248.986 -1.975  102.230 1.00 0.00 ? 50  PRO A CG   3  
ATOM 4377  C CD   . PRO A 1 50  ? -248.150 -1.347  103.282 1.00 0.00 ? 50  PRO A CD   3  
ATOM 4378  H HA   . PRO A 1 50  ? -250.196 0.590   101.928 1.00 0.00 ? 50  PRO A HA   3  
ATOM 4379  H HB2  . PRO A 1 50  ? -250.755 -1.965  103.372 1.00 0.00 ? 50  PRO A HB2  3  
ATOM 4380  H HB3  . PRO A 1 50  ? -250.966 -1.582  101.687 1.00 0.00 ? 50  PRO A HB3  3  
ATOM 4381  H HG2  . PRO A 1 50  ? -248.975 -3.051  102.313 1.00 0.00 ? 50  PRO A HG2  3  
ATOM 4382  H HG3  . PRO A 1 50  ? -248.676 -1.658  101.252 1.00 0.00 ? 50  PRO A HG3  3  
ATOM 4383  H HD2  . PRO A 1 50  ? -248.258 -1.887  104.200 1.00 0.00 ? 50  PRO A HD2  3  
ATOM 4384  H HD3  . PRO A 1 50  ? -247.117 -1.299  102.978 1.00 0.00 ? 50  PRO A HD3  3  
ATOM 4385  N N    . VAL A 1 51  ? -252.325 -0.218  103.669 1.00 0.00 ? 51  VAL A N    3  
ATOM 4386  C CA   . VAL A 1 51  ? -253.399 -0.125  104.639 1.00 0.00 ? 51  VAL A CA   3  
ATOM 4387  C C    . VAL A 1 51  ? -253.220 -1.263  105.631 1.00 0.00 ? 51  VAL A C    3  
ATOM 4388  O O    . VAL A 1 51  ? -254.028 -2.187  105.713 1.00 0.00 ? 51  VAL A O    3  
ATOM 4389  C CB   . VAL A 1 51  ? -254.797 -0.214  103.990 1.00 0.00 ? 51  VAL A CB   3  
ATOM 4390  C CG1  . VAL A 1 51  ? -255.885 0.180   104.983 1.00 0.00 ? 51  VAL A CG1  3  
ATOM 4391  C CG2  . VAL A 1 51  ? -254.868 0.651   102.741 1.00 0.00 ? 51  VAL A CG2  3  
ATOM 4392  H H    . VAL A 1 51  ? -252.438 -0.787  102.871 1.00 0.00 ? 51  VAL A H    3  
ATOM 4393  H HA   . VAL A 1 51  ? -253.309 0.821   105.158 1.00 0.00 ? 51  VAL A HA   3  
ATOM 4394  H HB   . VAL A 1 51  ? -254.967 -1.242  103.698 1.00 0.00 ? 51  VAL A HB   3  
ATOM 4395  H HG11 . VAL A 1 51  ? -255.711 1.189   105.325 1.00 0.00 ? 51  VAL A HG11 3  
ATOM 4396  H HG12 . VAL A 1 51  ? -256.849 0.125   104.499 1.00 0.00 ? 51  VAL A HG12 3  
ATOM 4397  H HG13 . VAL A 1 51  ? -255.864 -0.496  105.826 1.00 0.00 ? 51  VAL A HG13 3  
ATOM 4398  H HG21 . VAL A 1 51  ? -254.629 1.673   102.996 1.00 0.00 ? 51  VAL A HG21 3  
ATOM 4399  H HG22 . VAL A 1 51  ? -254.160 0.287   102.011 1.00 0.00 ? 51  VAL A HG22 3  
ATOM 4400  H HG23 . VAL A 1 51  ? -255.864 0.607   102.328 1.00 0.00 ? 51  VAL A HG23 3  
ATOM 4401  N N    . THR A 1 52  ? -252.110 -1.204  106.339 1.00 0.00 ? 52  THR A N    3  
ATOM 4402  C CA   . THR A 1 52  ? -251.674 -2.279  107.196 1.00 0.00 ? 52  THR A CA   3  
ATOM 4403  C C    . THR A 1 52  ? -252.533 -2.360  108.455 1.00 0.00 ? 52  THR A C    3  
ATOM 4404  O O    . THR A 1 52  ? -252.350 -1.592  109.403 1.00 0.00 ? 52  THR A O    3  
ATOM 4405  C CB   . THR A 1 52  ? -250.188 -2.074  107.529 1.00 0.00 ? 52  THR A CB   3  
ATOM 4406  O OG1  . THR A 1 52  ? -249.981 -0.774  108.096 1.00 0.00 ? 52  THR A OG1  3  
ATOM 4407  C CG2  . THR A 1 52  ? -249.355 -2.206  106.260 1.00 0.00 ? 52  THR A CG2  3  
ATOM 4408  H H    . THR A 1 52  ? -251.553 -0.397  106.283 1.00 0.00 ? 52  THR A H    3  
ATOM 4409  H HA   . THR A 1 52  ? -251.773 -3.205  106.647 1.00 0.00 ? 52  THR A HA   3  
ATOM 4410  H HB   . THR A 1 52  ? -249.876 -2.830  108.232 1.00 0.00 ? 52  THR A HB   3  
ATOM 4411  H HG1  . THR A 1 52  ? -250.675 -0.589  108.741 1.00 0.00 ? 52  THR A HG1  3  
ATOM 4412  H HG21 . THR A 1 52  ? -249.804 -1.619  105.461 1.00 0.00 ? 52  THR A HG21 3  
ATOM 4413  H HG22 . THR A 1 52  ? -248.351 -1.857  106.449 1.00 0.00 ? 52  THR A HG22 3  
ATOM 4414  H HG23 . THR A 1 52  ? -249.322 -3.243  105.958 1.00 0.00 ? 52  THR A HG23 3  
ATOM 4415  N N    . THR A 1 53  ? -253.487 -3.276  108.434 1.00 0.00 ? 53  THR A N    3  
ATOM 4416  C CA   . THR A 1 53  ? -254.513 -3.331  109.453 1.00 0.00 ? 53  THR A CA   3  
ATOM 4417  C C    . THR A 1 53  ? -254.472 -4.638  110.256 1.00 0.00 ? 53  THR A C    3  
ATOM 4418  O O    . THR A 1 53  ? -253.410 -5.219  110.460 1.00 0.00 ? 53  THR A O    3  
ATOM 4419  C CB   . THR A 1 53  ? -255.899 -3.103  108.787 1.00 0.00 ? 53  THR A CB   3  
ATOM 4420  O OG1  . THR A 1 53  ? -256.943 -3.048  109.762 1.00 0.00 ? 53  THR A OG1  3  
ATOM 4421  C CG2  . THR A 1 53  ? -256.212 -4.189  107.764 1.00 0.00 ? 53  THR A CG2  3  
ATOM 4422  H H    . THR A 1 53  ? -253.510 -3.923  107.700 1.00 0.00 ? 53  THR A H    3  
ATOM 4423  H HA   . THR A 1 53  ? -254.338 -2.524  110.134 1.00 0.00 ? 53  THR A HA   3  
ATOM 4424  H HB   . THR A 1 53  ? -255.866 -2.156  108.267 1.00 0.00 ? 53  THR A HB   3  
ATOM 4425  H HG1  . THR A 1 53  ? -257.378 -2.185  109.726 1.00 0.00 ? 53  THR A HG1  3  
ATOM 4426  H HG21 . THR A 1 53  ? -255.446 -4.199  107.005 1.00 0.00 ? 53  THR A HG21 3  
ATOM 4427  H HG22 . THR A 1 53  ? -256.244 -5.150  108.258 1.00 0.00 ? 53  THR A HG22 3  
ATOM 4428  H HG23 . THR A 1 53  ? -257.168 -3.988  107.307 1.00 0.00 ? 53  THR A HG23 3  
ATOM 4429  N N    . ASP A 1 54  ? -255.653 -5.067  110.694 1.00 0.00 ? 54  ASP A N    3  
ATOM 4430  C CA   . ASP A 1 54  ? -255.872 -6.178  111.632 1.00 0.00 ? 54  ASP A CA   3  
ATOM 4431  C C    . ASP A 1 54  ? -255.408 -7.534  111.120 1.00 0.00 ? 54  ASP A C    3  
ATOM 4432  O O    . ASP A 1 54  ? -255.755 -8.571  111.680 1.00 0.00 ? 54  ASP A O    3  
ATOM 4433  C CB   . ASP A 1 54  ? -257.355 -6.276  111.882 1.00 0.00 ? 54  ASP A CB   3  
ATOM 4434  C CG   . ASP A 1 54  ? -257.893 -5.140  112.729 1.00 0.00 ? 54  ASP A CG   3  
ATOM 4435  O OD1  . ASP A 1 54  ? -258.259 -4.088  112.161 1.00 0.00 ? 54  ASP A OD1  3  
ATOM 4436  O OD2  . ASP A 1 54  ? -257.947 -5.292  113.966 1.00 0.00 ? 54  ASP A OD2  3  
ATOM 4437  H H    . ASP A 1 54  ? -256.449 -4.593  110.360 1.00 0.00 ? 54  ASP A H    3  
ATOM 4438  H HA   . ASP A 1 54  ? -255.377 -5.954  112.562 1.00 0.00 ? 54  ASP A HA   3  
ATOM 4439  H HB2  . ASP A 1 54  ? -257.858 -6.264  110.926 1.00 0.00 ? 54  ASP A HB2  3  
ATOM 4440  H HB3  . ASP A 1 54  ? -257.557 -7.207  112.375 1.00 0.00 ? 54  ASP A HB3  3  
ATOM 4441  N N    . TYR A 1 55  ? -254.669 -7.522  110.055 1.00 0.00 ? 55  TYR A N    3  
ATOM 4442  C CA   . TYR A 1 55  ? -254.143 -8.750  109.471 1.00 0.00 ? 55  TYR A CA   3  
ATOM 4443  C C    . TYR A 1 55  ? -253.130 -9.431  110.390 1.00 0.00 ? 55  TYR A C    3  
ATOM 4444  O O    . TYR A 1 55  ? -252.376 -8.770  111.102 1.00 0.00 ? 55  TYR A O    3  
ATOM 4445  C CB   . TYR A 1 55  ? -253.473 -8.455  108.141 1.00 0.00 ? 55  TYR A CB   3  
ATOM 4446  C CG   . TYR A 1 55  ? -254.416 -8.082  107.033 1.00 0.00 ? 55  TYR A CG   3  
ATOM 4447  C CD1  . TYR A 1 55  ? -255.443 -8.932  106.667 1.00 0.00 ? 55  TYR A CD1  3  
ATOM 4448  C CD2  . TYR A 1 55  ? -254.272 -6.888  106.345 1.00 0.00 ? 55  TYR A CD2  3  
ATOM 4449  C CE1  . TYR A 1 55  ? -256.304 -8.609  105.645 1.00 0.00 ? 55  TYR A CE1  3  
ATOM 4450  C CE2  . TYR A 1 55  ? -255.130 -6.550  105.320 1.00 0.00 ? 55  TYR A CE2  3  
ATOM 4451  C CZ   . TYR A 1 55  ? -256.149 -7.414  104.971 1.00 0.00 ? 55  TYR A CZ   3  
ATOM 4452  O OH   . TYR A 1 55  ? -257.008 -7.085  103.947 1.00 0.00 ? 55  TYR A OH   3  
ATOM 4453  H H    . TYR A 1 55  ? -254.469 -6.657  109.648 1.00 0.00 ? 55  TYR A H    3  
ATOM 4454  H HA   . TYR A 1 55  ? -254.972 -9.421  109.302 1.00 0.00 ? 55  TYR A HA   3  
ATOM 4455  H HB2  . TYR A 1 55  ? -252.801 -7.633  108.281 1.00 0.00 ? 55  TYR A HB2  3  
ATOM 4456  H HB3  . TYR A 1 55  ? -252.915 -9.319  107.830 1.00 0.00 ? 55  TYR A HB3  3  
ATOM 4457  H HD1  . TYR A 1 55  ? -255.566 -9.865  107.199 1.00 0.00 ? 55  TYR A HD1  3  
ATOM 4458  H HD2  . TYR A 1 55  ? -253.471 -6.216  106.622 1.00 0.00 ? 55  TYR A HD2  3  
ATOM 4459  H HE1  . TYR A 1 55  ? -257.100 -9.288  105.383 1.00 0.00 ? 55  TYR A HE1  3  
ATOM 4460  H HE2  . TYR A 1 55  ? -255.002 -5.615  104.797 1.00 0.00 ? 55  TYR A HE2  3  
ATOM 4461  H HH   . TYR A 1 55  ? -257.907 -7.382  104.172 1.00 0.00 ? 55  TYR A HH   3  
ATOM 4462  N N    . PHE A 1 56  ? -253.122 -10.756 110.346 1.00 0.00 ? 56  PHE A N    3  
ATOM 4463  C CA   . PHE A 1 56  ? -252.131 -11.563 111.053 1.00 0.00 ? 56  PHE A CA   3  
ATOM 4464  C C    . PHE A 1 56  ? -252.012 -12.916 110.364 1.00 0.00 ? 56  PHE A C    3  
ATOM 4465  O O    . PHE A 1 56  ? -252.730 -13.186 109.420 1.00 0.00 ? 56  PHE A O    3  
ATOM 4466  C CB   . PHE A 1 56  ? -252.480 -11.735 112.541 1.00 0.00 ? 56  PHE A CB   3  
ATOM 4467  C CG   . PHE A 1 56  ? -253.816 -12.373 112.802 1.00 0.00 ? 56  PHE A CG   3  
ATOM 4468  C CD1  . PHE A 1 56  ? -254.965 -11.602 112.840 1.00 0.00 ? 56  PHE A CD1  3  
ATOM 4469  C CD2  . PHE A 1 56  ? -253.925 -13.741 113.013 1.00 0.00 ? 56  PHE A CD2  3  
ATOM 4470  C CE1  . PHE A 1 56  ? -256.195 -12.177 113.080 1.00 0.00 ? 56  PHE A CE1  3  
ATOM 4471  C CE2  . PHE A 1 56  ? -255.158 -14.320 113.253 1.00 0.00 ? 56  PHE A CE2  3  
ATOM 4472  C CZ   . PHE A 1 56  ? -256.294 -13.534 113.286 1.00 0.00 ? 56  PHE A CZ   3  
ATOM 4473  H H    . PHE A 1 56  ? -253.801 -11.214 109.804 1.00 0.00 ? 56  PHE A H    3  
ATOM 4474  H HA   . PHE A 1 56  ? -251.181 -11.052 110.971 1.00 0.00 ? 56  PHE A HA   3  
ATOM 4475  H HB2  . PHE A 1 56  ? -251.724 -12.351 113.004 1.00 0.00 ? 56  PHE A HB2  3  
ATOM 4476  H HB3  . PHE A 1 56  ? -252.477 -10.763 113.014 1.00 0.00 ? 56  PHE A HB3  3  
ATOM 4477  H HD1  . PHE A 1 56  ? -254.890 -10.537 112.679 1.00 0.00 ? 56  PHE A HD1  3  
ATOM 4478  H HD2  . PHE A 1 56  ? -253.030 -14.358 112.990 1.00 0.00 ? 56  PHE A HD2  3  
ATOM 4479  H HE1  . PHE A 1 56  ? -257.082 -11.560 113.104 1.00 0.00 ? 56  PHE A HE1  3  
ATOM 4480  H HE2  . PHE A 1 56  ? -255.234 -15.387 113.413 1.00 0.00 ? 56  PHE A HE2  3  
ATOM 4481  H HZ   . PHE A 1 56  ? -257.262 -13.981 113.471 1.00 0.00 ? 56  PHE A HZ   3  
ATOM 4482  N N    . LEU A 1 57  ? -251.115 -13.760 110.834 1.00 0.00 ? 57  LEU A N    3  
ATOM 4483  C CA   . LEU A 1 57  ? -250.835 -15.034 110.170 1.00 0.00 ? 57  LEU A CA   3  
ATOM 4484  C C    . LEU A 1 57  ? -251.523 -16.130 110.952 1.00 0.00 ? 57  LEU A C    3  
ATOM 4485  O O    . LEU A 1 57  ? -251.958 -15.883 112.062 1.00 0.00 ? 57  LEU A O    3  
ATOM 4486  C CB   . LEU A 1 57  ? -249.319 -15.314 110.102 1.00 0.00 ? 57  LEU A CB   3  
ATOM 4487  C CG   . LEU A 1 57  ? -248.448 -14.284 109.361 1.00 0.00 ? 57  LEU A CG   3  
ATOM 4488  C CD1  . LEU A 1 57  ? -248.637 -12.910 109.951 1.00 0.00 ? 57  LEU A CD1  3  
ATOM 4489  C CD2  . LEU A 1 57  ? -246.980 -14.670 109.429 1.00 0.00 ? 57  LEU A CD2  3  
ATOM 4490  H H    . LEU A 1 57  ? -250.635 -13.537 111.657 1.00 0.00 ? 57  LEU A H    3  
ATOM 4491  H HA   . LEU A 1 57  ? -251.240 -14.999 109.168 1.00 0.00 ? 57  LEU A HA   3  
ATOM 4492  H HB2  . LEU A 1 57  ? -248.952 -15.389 111.115 1.00 0.00 ? 57  LEU A HB2  3  
ATOM 4493  H HB3  . LEU A 1 57  ? -249.180 -16.273 109.623 1.00 0.00 ? 57  LEU A HB3  3  
ATOM 4494  H HG   . LEU A 1 57  ? -248.741 -14.248 108.323 1.00 0.00 ? 57  LEU A HG   3  
ATOM 4495  H HD11 . LEU A 1 57  ? -248.581 -12.985 111.037 1.00 0.00 ? 57  LEU A HD11 3  
ATOM 4496  H HD12 . LEU A 1 57  ? -247.872 -12.244 109.586 1.00 0.00 ? 57  LEU A HD12 3  
ATOM 4497  H HD13 . LEU A 1 57  ? -249.622 -12.545 109.665 1.00 0.00 ? 57  LEU A HD13 3  
ATOM 4498  H HD21 . LEU A 1 57  ? -246.841 -15.648 108.995 1.00 0.00 ? 57  LEU A HD21 3  
ATOM 4499  H HD22 . LEU A 1 57  ? -246.393 -13.945 108.881 1.00 0.00 ? 57  LEU A HD22 3  
ATOM 4500  H HD23 . LEU A 1 57  ? -246.659 -14.679 110.464 1.00 0.00 ? 57  LEU A HD23 3  
ATOM 4501  N N    . MET A 1 58  ? -251.643 -17.319 110.380 1.00 0.00 ? 58  MET A N    3  
ATOM 4502  C CA   . MET A 1 58  ? -252.224 -18.466 111.083 1.00 0.00 ? 58  MET A CA   3  
ATOM 4503  C C    . MET A 1 58  ? -251.805 -19.752 110.400 1.00 0.00 ? 58  MET A C    3  
ATOM 4504  O O    . MET A 1 58  ? -251.434 -19.738 109.231 1.00 0.00 ? 58  MET A O    3  
ATOM 4505  C CB   . MET A 1 58  ? -253.753 -18.447 111.106 1.00 0.00 ? 58  MET A CB   3  
ATOM 4506  C CG   . MET A 1 58  ? -254.397 -17.222 111.730 1.00 0.00 ? 58  MET A CG   3  
ATOM 4507  S SD   . MET A 1 58  ? -256.160 -17.455 112.008 1.00 0.00 ? 58  MET A SD   3  
ATOM 4508  C CE   . MET A 1 58  ? -256.432 -18.876 110.960 1.00 0.00 ? 58  MET A CE   3  
ATOM 4509  H H    . MET A 1 58  ? -251.341 -17.432 109.454 1.00 0.00 ? 58  MET A H    3  
ATOM 4510  H HA   . MET A 1 58  ? -251.853 -18.465 112.097 1.00 0.00 ? 58  MET A HA   3  
ATOM 4511  H HB2  . MET A 1 58  ? -254.111 -18.526 110.091 1.00 0.00 ? 58  MET A HB2  3  
ATOM 4512  H HB3  . MET A 1 58  ? -254.088 -19.313 111.655 1.00 0.00 ? 58  MET A HB3  3  
ATOM 4513  H HG2  . MET A 1 58  ? -253.918 -17.021 112.676 1.00 0.00 ? 58  MET A HG2  3  
ATOM 4514  H HG3  . MET A 1 58  ? -254.258 -16.379 111.066 1.00 0.00 ? 58  MET A HG3  3  
ATOM 4515  H HE1  . MET A 1 58  ? -256.153 -18.631 109.934 1.00 0.00 ? 58  MET A HE1  3  
ATOM 4516  H HE2  . MET A 1 58  ? -255.815 -19.687 111.319 1.00 0.00 ? 58  MET A HE2  3  
ATOM 4517  H HE3  . MET A 1 58  ? -257.471 -19.162 110.998 1.00 0.00 ? 58  MET A HE3  3  
ATOM 4518  N N    . GLU A 1 59  ? -251.853 -20.855 111.128 1.00 0.00 ? 59  GLU A N    3  
ATOM 4519  C CA   . GLU A 1 59  ? -251.622 -22.158 110.532 1.00 0.00 ? 59  GLU A CA   3  
ATOM 4520  C C    . GLU A 1 59  ? -252.931 -22.857 110.203 1.00 0.00 ? 59  GLU A C    3  
ATOM 4521  O O    . GLU A 1 59  ? -253.814 -22.976 111.053 1.00 0.00 ? 59  GLU A O    3  
ATOM 4522  C CB   . GLU A 1 59  ? -250.806 -23.049 111.456 1.00 0.00 ? 59  GLU A CB   3  
ATOM 4523  C CG   . GLU A 1 59  ? -249.320 -22.774 111.412 1.00 0.00 ? 59  GLU A CG   3  
ATOM 4524  C CD   . GLU A 1 59  ? -248.541 -23.825 112.164 1.00 0.00 ? 59  GLU A CD   3  
ATOM 4525  O OE1  . GLU A 1 59  ? -248.816 -25.027 111.954 1.00 0.00 ? 59  GLU A OE1  3  
ATOM 4526  O OE2  . GLU A 1 59  ? -247.670 -23.456 112.970 1.00 0.00 ? 59  GLU A OE2  3  
ATOM 4527  H H    . GLU A 1 59  ? -252.056 -20.793 112.087 1.00 0.00 ? 59  GLU A H    3  
ATOM 4528  H HA   . GLU A 1 59  ? -251.068 -22.007 109.618 1.00 0.00 ? 59  GLU A HA   3  
ATOM 4529  H HB2  . GLU A 1 59  ? -251.147 -22.901 112.470 1.00 0.00 ? 59  GLU A HB2  3  
ATOM 4530  H HB3  . GLU A 1 59  ? -250.969 -24.080 111.178 1.00 0.00 ? 59  GLU A HB3  3  
ATOM 4531  H HG2  . GLU A 1 59  ? -248.996 -22.767 110.382 1.00 0.00 ? 59  GLU A HG2  3  
ATOM 4532  H HG3  . GLU A 1 59  ? -249.126 -21.811 111.861 1.00 0.00 ? 59  GLU A HG3  3  
ATOM 4533  N N    . GLU A 1 60  ? -253.040 -23.327 108.969 1.00 0.00 ? 60  GLU A N    3  
ATOM 4534  C CA   . GLU A 1 60  ? -254.168 -24.145 108.550 1.00 0.00 ? 60  GLU A CA   3  
ATOM 4535  C C    . GLU A 1 60  ? -253.805 -25.621 108.665 1.00 0.00 ? 60  GLU A C    3  
ATOM 4536  O O    . GLU A 1 60  ? -252.938 -26.111 107.936 1.00 0.00 ? 60  GLU A O    3  
ATOM 4537  C CB   . GLU A 1 60  ? -254.548 -23.841 107.097 1.00 0.00 ? 60  GLU A CB   3  
ATOM 4538  C CG   . GLU A 1 60  ? -255.027 -22.421 106.850 1.00 0.00 ? 60  GLU A CG   3  
ATOM 4539  C CD   . GLU A 1 60  ? -256.460 -22.180 107.287 1.00 0.00 ? 60  GLU A CD   3  
ATOM 4540  O OE1  . GLU A 1 60  ? -257.385 -22.676 106.604 1.00 0.00 ? 60  GLU A OE1  3  
ATOM 4541  O OE2  . GLU A 1 60  ? -256.675 -21.481 108.299 1.00 0.00 ? 60  GLU A OE2  3  
ATOM 4542  H H    . GLU A 1 60  ? -252.347 -23.099 108.312 1.00 0.00 ? 60  GLU A H    3  
ATOM 4543  H HA   . GLU A 1 60  ? -255.006 -23.930 109.197 1.00 0.00 ? 60  GLU A HA   3  
ATOM 4544  H HB2  . GLU A 1 60  ? -253.685 -24.016 106.474 1.00 0.00 ? 60  GLU A HB2  3  
ATOM 4545  H HB3  . GLU A 1 60  ? -255.335 -24.519 106.797 1.00 0.00 ? 60  GLU A HB3  3  
ATOM 4546  H HG2  . GLU A 1 60  ? -254.387 -21.741 107.391 1.00 0.00 ? 60  GLU A HG2  3  
ATOM 4547  H HG3  . GLU A 1 60  ? -254.952 -22.213 105.792 1.00 0.00 ? 60  GLU A HG3  3  
ATOM 4548  N N    . LYS A 1 61  ? -254.442 -26.321 109.587 1.00 0.00 ? 61  LYS A N    3  
ATOM 4549  C CA   . LYS A 1 61  ? -254.233 -27.752 109.722 1.00 0.00 ? 61  LYS A CA   3  
ATOM 4550  C C    . LYS A 1 61  ? -255.210 -28.502 108.824 1.00 0.00 ? 61  LYS A C    3  
ATOM 4551  O O    . LYS A 1 61  ? -256.426 -28.404 108.992 1.00 0.00 ? 61  LYS A O    3  
ATOM 4552  C CB   . LYS A 1 61  ? -254.385 -28.202 111.182 1.00 0.00 ? 61  LYS A CB   3  
ATOM 4553  C CG   . LYS A 1 61  ? -253.142 -27.983 112.048 1.00 0.00 ? 61  LYS A CG   3  
ATOM 4554  C CD   . LYS A 1 61  ? -252.789 -26.509 112.200 1.00 0.00 ? 61  LYS A CD   3  
ATOM 4555  C CE   . LYS A 1 61  ? -251.748 -26.291 113.294 1.00 0.00 ? 61  LYS A CE   3  
ATOM 4556  N NZ   . LYS A 1 61  ? -250.418 -26.877 112.957 1.00 0.00 ? 61  LYS A NZ   3  
ATOM 4557  H H    . LYS A 1 61  ? -255.078 -25.868 110.189 1.00 0.00 ? 61  LYS A H    3  
ATOM 4558  H HA   . LYS A 1 61  ? -253.225 -27.970 109.394 1.00 0.00 ? 61  LYS A HA   3  
ATOM 4559  H HB2  . LYS A 1 61  ? -255.205 -27.656 111.626 1.00 0.00 ? 61  LYS A HB2  3  
ATOM 4560  H HB3  . LYS A 1 61  ? -254.623 -29.256 111.194 1.00 0.00 ? 61  LYS A HB3  3  
ATOM 4561  H HG2  . LYS A 1 61  ? -253.323 -28.395 113.029 1.00 0.00 ? 61  LYS A HG2  3  
ATOM 4562  H HG3  . LYS A 1 61  ? -252.307 -28.495 111.593 1.00 0.00 ? 61  LYS A HG3  3  
ATOM 4563  H HD2  . LYS A 1 61  ? -252.392 -26.145 111.262 1.00 0.00 ? 61  LYS A HD2  3  
ATOM 4564  H HD3  . LYS A 1 61  ? -253.683 -25.958 112.451 1.00 0.00 ? 61  LYS A HD3  3  
ATOM 4565  H HE2  . LYS A 1 61  ? -251.629 -25.230 113.448 1.00 0.00 ? 61  LYS A HE2  3  
ATOM 4566  H HE3  . LYS A 1 61  ? -252.109 -26.744 114.207 1.00 0.00 ? 61  LYS A HE3  3  
ATOM 4567  H HZ1  . LYS A 1 61  ? -250.537 -27.759 112.430 1.00 0.00 ? 61  LYS A HZ1  3  
ATOM 4568  H HZ2  . LYS A 1 61  ? -249.862 -26.209 112.372 1.00 0.00 ? 61  LYS A HZ2  3  
ATOM 4569  H HZ3  . LYS A 1 61  ? -249.880 -27.079 113.834 1.00 0.00 ? 61  LYS A HZ3  3  
ATOM 4570  N N    . TYR A 1 62  ? -254.667 -29.224 107.852 1.00 0.00 ? 62  TYR A N    3  
ATOM 4571  C CA   . TYR A 1 62  ? -255.478 -29.965 106.894 1.00 0.00 ? 62  TYR A CA   3  
ATOM 4572  C C    . TYR A 1 62  ? -255.864 -31.327 107.471 1.00 0.00 ? 62  TYR A C    3  
ATOM 4573  O O    . TYR A 1 62  ? -255.054 -31.977 108.135 1.00 0.00 ? 62  TYR A O    3  
ATOM 4574  C CB   . TYR A 1 62  ? -254.701 -30.130 105.582 1.00 0.00 ? 62  TYR A CB   3  
ATOM 4575  C CG   . TYR A 1 62  ? -255.526 -30.671 104.432 1.00 0.00 ? 62  TYR A CG   3  
ATOM 4576  C CD1  . TYR A 1 62  ? -256.297 -29.823 103.647 1.00 0.00 ? 62  TYR A CD1  3  
ATOM 4577  C CD2  . TYR A 1 62  ? -255.527 -32.026 104.130 1.00 0.00 ? 62  TYR A CD2  3  
ATOM 4578  C CE1  . TYR A 1 62  ? -257.049 -30.313 102.593 1.00 0.00 ? 62  TYR A CE1  3  
ATOM 4579  C CE2  . TYR A 1 62  ? -256.275 -32.523 103.081 1.00 0.00 ? 62  TYR A CE2  3  
ATOM 4580  C CZ   . TYR A 1 62  ? -257.032 -31.667 102.316 1.00 0.00 ? 62  TYR A CZ   3  
ATOM 4581  O OH   . TYR A 1 62  ? -257.779 -32.167 101.275 1.00 0.00 ? 62  TYR A OH   3  
ATOM 4582  H H    . TYR A 1 62  ? -253.694 -29.263 107.781 1.00 0.00 ? 62  TYR A H    3  
ATOM 4583  H HA   . TYR A 1 62  ? -256.374 -29.395 106.706 1.00 0.00 ? 62  TYR A HA   3  
ATOM 4584  H HB2  . TYR A 1 62  ? -254.312 -29.169 105.284 1.00 0.00 ? 62  TYR A HB2  3  
ATOM 4585  H HB3  . TYR A 1 62  ? -253.875 -30.807 105.747 1.00 0.00 ? 62  TYR A HB3  3  
ATOM 4586  H HD1  . TYR A 1 62  ? -256.308 -28.766 103.868 1.00 0.00 ? 62  TYR A HD1  3  
ATOM 4587  H HD2  . TYR A 1 62  ? -254.934 -32.699 104.731 1.00 0.00 ? 62  TYR A HD2  3  
ATOM 4588  H HE1  . TYR A 1 62  ? -257.644 -29.641 101.994 1.00 0.00 ? 62  TYR A HE1  3  
ATOM 4589  H HE2  . TYR A 1 62  ? -256.260 -33.579 102.862 1.00 0.00 ? 62  TYR A HE2  3  
ATOM 4590  H HH   . TYR A 1 62  ? -258.302 -32.910 101.593 1.00 0.00 ? 62  TYR A HH   3  
ATOM 4591  N N    . PHE A 1 63  ? -257.096 -31.755 107.224 1.00 0.00 ? 63  PHE A N    3  
ATOM 4592  C CA   . PHE A 1 63  ? -257.602 -32.998 107.796 1.00 0.00 ? 63  PHE A CA   3  
ATOM 4593  C C    . PHE A 1 63  ? -257.047 -34.218 107.064 1.00 0.00 ? 63  PHE A C    3  
ATOM 4594  O O    . PHE A 1 63  ? -257.533 -34.594 105.997 1.00 0.00 ? 63  PHE A O    3  
ATOM 4595  C CB   . PHE A 1 63  ? -259.135 -33.013 107.772 1.00 0.00 ? 63  PHE A CB   3  
ATOM 4596  C CG   . PHE A 1 63  ? -259.743 -34.230 108.421 1.00 0.00 ? 63  PHE A CG   3  
ATOM 4597  C CD1  . PHE A 1 63  ? -259.842 -34.318 109.801 1.00 0.00 ? 63  PHE A CD1  3  
ATOM 4598  C CD2  . PHE A 1 63  ? -260.215 -35.281 107.650 1.00 0.00 ? 63  PHE A CD2  3  
ATOM 4599  C CE1  . PHE A 1 63  ? -260.400 -35.432 110.399 1.00 0.00 ? 63  PHE A CE1  3  
ATOM 4600  C CE2  . PHE A 1 63  ? -260.773 -36.397 108.244 1.00 0.00 ? 63  PHE A CE2  3  
ATOM 4601  C CZ   . PHE A 1 63  ? -260.864 -36.472 109.620 1.00 0.00 ? 63  PHE A CZ   3  
ATOM 4602  H H    . PHE A 1 63  ? -257.683 -31.225 106.638 1.00 0.00 ? 63  PHE A H    3  
ATOM 4603  H HA   . PHE A 1 63  ? -257.274 -33.037 108.823 1.00 0.00 ? 63  PHE A HA   3  
ATOM 4604  H HB2  . PHE A 1 63  ? -259.505 -32.145 108.294 1.00 0.00 ? 63  PHE A HB2  3  
ATOM 4605  H HB3  . PHE A 1 63  ? -259.472 -32.980 106.745 1.00 0.00 ? 63  PHE A HB3  3  
ATOM 4606  H HD1  . PHE A 1 63  ? -259.478 -33.505 110.410 1.00 0.00 ? 63  PHE A HD1  3  
ATOM 4607  H HD2  . PHE A 1 63  ? -260.142 -35.224 106.574 1.00 0.00 ? 63  PHE A HD2  3  
ATOM 4608  H HE1  . PHE A 1 63  ? -260.470 -35.489 111.477 1.00 0.00 ? 63  PHE A HE1  3  
ATOM 4609  H HE2  . PHE A 1 63  ? -261.138 -37.209 107.631 1.00 0.00 ? 63  PHE A HE2  3  
ATOM 4610  H HZ   . PHE A 1 63  ? -261.300 -37.344 110.086 1.00 0.00 ? 63  PHE A HZ   3  
ATOM 4611  N N    . ILE A 1 64  ? -256.000 -34.798 107.632 1.00 0.00 ? 64  ILE A N    3  
ATOM 4612  C CA   . ILE A 1 64  ? -255.468 -36.076 107.164 1.00 0.00 ? 64  ILE A CA   3  
ATOM 4613  C C    . ILE A 1 64  ? -255.414 -37.040 108.354 1.00 0.00 ? 64  ILE A C    3  
ATOM 4614  O O    . ILE A 1 64  ? -254.746 -38.081 108.338 1.00 0.00 ? 64  ILE A O    3  
ATOM 4615  C CB   . ILE A 1 64  ? -254.067 -35.913 106.515 1.00 0.00 ? 64  ILE A CB   3  
ATOM 4616  C CG1  . ILE A 1 64  ? -254.092 -34.783 105.482 1.00 0.00 ? 64  ILE A CG1  3  
ATOM 4617  C CG2  . ILE A 1 64  ? -253.623 -37.211 105.847 1.00 0.00 ? 64  ILE A CG2  3  
ATOM 4618  C CD1  . ILE A 1 64  ? -252.784 -34.602 104.739 1.00 0.00 ? 64  ILE A CD1  3  
ATOM 4619  H H    . ILE A 1 64  ? -255.558 -34.347 108.386 1.00 0.00 ? 64  ILE A H    3  
ATOM 4620  H HA   . ILE A 1 64  ? -256.152 -36.471 106.426 1.00 0.00 ? 64  ILE A HA   3  
ATOM 4621  H HB   . ILE A 1 64  ? -253.356 -35.669 107.290 1.00 0.00 ? 64  ILE A HB   3  
ATOM 4622  H HG12 . ILE A 1 64  ? -254.859 -34.988 104.751 1.00 0.00 ? 64  ILE A HG12 3  
ATOM 4623  H HG13 . ILE A 1 64  ? -254.321 -33.852 105.982 1.00 0.00 ? 64  ILE A HG13 3  
ATOM 4624  H HG21 . ILE A 1 64  ? -253.598 -38.004 106.583 1.00 0.00 ? 64  ILE A HG21 3  
ATOM 4625  H HG22 . ILE A 1 64  ? -254.318 -37.469 105.062 1.00 0.00 ? 64  ILE A HG22 3  
ATOM 4626  H HG23 . ILE A 1 64  ? -252.637 -37.081 105.426 1.00 0.00 ? 64  ILE A HG23 3  
ATOM 4627  H HD11 . ILE A 1 64  ? -251.998 -34.373 105.443 1.00 0.00 ? 64  ILE A HD11 3  
ATOM 4628  H HD12 . ILE A 1 64  ? -252.541 -35.510 104.211 1.00 0.00 ? 64  ILE A HD12 3  
ATOM 4629  H HD13 . ILE A 1 64  ? -252.879 -33.790 104.031 1.00 0.00 ? 64  ILE A HD13 3  
ATOM 4630  N N    . SER A 1 65  ? -256.149 -36.667 109.394 1.00 0.00 ? 65  SER A N    3  
ATOM 4631  C CA   . SER A 1 65  ? -256.239 -37.458 110.610 1.00 0.00 ? 65  SER A CA   3  
ATOM 4632  C C    . SER A 1 65  ? -256.909 -38.804 110.330 1.00 0.00 ? 65  SER A C    3  
ATOM 4633  O O    . SER A 1 65  ? -257.963 -38.866 109.691 1.00 0.00 ? 65  SER A O    3  
ATOM 4634  C CB   . SER A 1 65  ? -257.034 -36.685 111.660 1.00 0.00 ? 65  SER A CB   3  
ATOM 4635  O OG   . SER A 1 65  ? -256.540 -35.358 111.788 1.00 0.00 ? 65  SER A OG   3  
ATOM 4636  H H    . SER A 1 65  ? -256.650 -35.828 109.339 1.00 0.00 ? 65  SER A H    3  
ATOM 4637  H HA   . SER A 1 65  ? -255.239 -37.630 110.977 1.00 0.00 ? 65  SER A HA   3  
ATOM 4638  H HB2  . SER A 1 65  ? -258.074 -36.643 111.369 1.00 0.00 ? 65  SER A HB2  3  
ATOM 4639  H HB3  . SER A 1 65  ? -256.947 -37.182 112.615 1.00 0.00 ? 65  SER A HB3  3  
ATOM 4640  H HG   . SER A 1 65  ? -256.165 -35.238 112.673 1.00 0.00 ? 65  SER A HG   3  
ATOM 4641  N N    . LYS A 1 66  ? -256.287 -39.874 110.800 1.00 0.00 ? 66  LYS A N    3  
ATOM 4642  C CA   . LYS A 1 66  ? -256.796 -41.219 110.571 1.00 0.00 ? 66  LYS A CA   3  
ATOM 4643  C C    . LYS A 1 66  ? -257.134 -41.912 111.888 1.00 0.00 ? 66  LYS A C    3  
ATOM 4644  O O    . LYS A 1 66  ? -257.755 -42.973 111.892 1.00 0.00 ? 66  LYS A O    3  
ATOM 4645  C CB   . LYS A 1 66  ? -255.769 -42.035 109.780 1.00 0.00 ? 66  LYS A CB   3  
ATOM 4646  C CG   . LYS A 1 66  ? -255.546 -41.519 108.365 1.00 0.00 ? 66  LYS A CG   3  
ATOM 4647  C CD   . LYS A 1 66  ? -254.419 -42.265 107.665 1.00 0.00 ? 66  LYS A CD   3  
ATOM 4648  C CE   . LYS A 1 66  ? -253.063 -41.939 108.274 1.00 0.00 ? 66  LYS A CE   3  
ATOM 4649  N NZ   . LYS A 1 66  ? -252.677 -40.518 108.050 1.00 0.00 ? 66  LYS A NZ   3  
ATOM 4650  H H    . LYS A 1 66  ? -255.458 -39.756 111.313 1.00 0.00 ? 66  LYS A H    3  
ATOM 4651  H HA   . LYS A 1 66  ? -257.698 -41.131 109.986 1.00 0.00 ? 66  LYS A HA   3  
ATOM 4652  H HB2  . LYS A 1 66  ? -254.825 -42.010 110.303 1.00 0.00 ? 66  LYS A HB2  3  
ATOM 4653  H HB3  . LYS A 1 66  ? -256.110 -43.059 109.718 1.00 0.00 ? 66  LYS A HB3  3  
ATOM 4654  H HG2  . LYS A 1 66  ? -256.457 -41.648 107.798 1.00 0.00 ? 66  LYS A HG2  3  
ATOM 4655  H HG3  . LYS A 1 66  ? -255.297 -40.469 108.412 1.00 0.00 ? 66  LYS A HG3  3  
ATOM 4656  H HD2  . LYS A 1 66  ? -254.594 -43.326 107.755 1.00 0.00 ? 66  LYS A HD2  3  
ATOM 4657  H HD3  . LYS A 1 66  ? -254.411 -41.988 106.621 1.00 0.00 ? 66  LYS A HD3  3  
ATOM 4658  H HE2  . LYS A 1 66  ? -253.106 -42.126 109.335 1.00 0.00 ? 66  LYS A HE2  3  
ATOM 4659  H HE3  . LYS A 1 66  ? -252.318 -42.581 107.826 1.00 0.00 ? 66  LYS A HE3  3  
ATOM 4660  H HZ1  . LYS A 1 66  ? -253.400 -39.883 108.441 1.00 0.00 ? 66  LYS A HZ1  3  
ATOM 4661  H HZ2  . LYS A 1 66  ? -251.763 -40.316 108.516 1.00 0.00 ? 66  LYS A HZ2  3  
ATOM 4662  H HZ3  . LYS A 1 66  ? -252.575 -40.328 107.029 1.00 0.00 ? 66  LYS A HZ3  3  
ATOM 4663  N N    . GLU A 1 67  ? -256.724 -41.294 113.001 1.00 0.00 ? 67  GLU A N    3  
ATOM 4664  C CA   . GLU A 1 67  ? -256.985 -41.830 114.339 1.00 0.00 ? 67  GLU A CA   3  
ATOM 4665  C C    . GLU A 1 67  ? -256.344 -43.210 114.524 1.00 0.00 ? 67  GLU A C    3  
ATOM 4666  O O    . GLU A 1 67  ? -255.457 -43.600 113.761 1.00 0.00 ? 67  GLU A O    3  
ATOM 4667  C CB   . GLU A 1 67  ? -258.498 -41.901 114.592 1.00 0.00 ? 67  GLU A CB   3  
ATOM 4668  C CG   . GLU A 1 67  ? -259.145 -40.549 114.838 1.00 0.00 ? 67  GLU A CG   3  
ATOM 4669  C CD   . GLU A 1 67  ? -258.775 -39.956 116.183 1.00 0.00 ? 67  GLU A CD   3  
ATOM 4670  O OE1  . GLU A 1 67  ? -259.365 -40.377 117.205 1.00 0.00 ? 67  GLU A OE1  3  
ATOM 4671  O OE2  . GLU A 1 67  ? -257.901 -39.067 116.232 1.00 0.00 ? 67  GLU A OE2  3  
ATOM 4672  H H    . GLU A 1 67  ? -256.229 -40.455 112.918 1.00 0.00 ? 67  GLU A H    3  
ATOM 4673  H HA   . GLU A 1 67  ? -256.546 -41.149 115.055 1.00 0.00 ? 67  GLU A HA   3  
ATOM 4674  H HB2  . GLU A 1 67  ? -258.973 -42.349 113.732 1.00 0.00 ? 67  GLU A HB2  3  
ATOM 4675  H HB3  . GLU A 1 67  ? -258.683 -42.524 115.455 1.00 0.00 ? 67  GLU A HB3  3  
ATOM 4676  H HG2  . GLU A 1 67  ? -258.827 -39.867 114.063 1.00 0.00 ? 67  GLU A HG2  3  
ATOM 4677  H HG3  . GLU A 1 67  ? -260.218 -40.663 114.795 1.00 0.00 ? 67  GLU A HG3  3  
ATOM 4678  N N    . LYS A 1 68  ? -256.781 -43.909 115.569 1.00 0.00 ? 68  LYS A N    3  
ATOM 4679  C CA   . LYS A 1 68  ? -256.368 -45.283 115.862 1.00 0.00 ? 68  LYS A CA   3  
ATOM 4680  C C    . LYS A 1 68  ? -254.940 -45.356 116.395 1.00 0.00 ? 68  LYS A C    3  
ATOM 4681  O O    . LYS A 1 68  ? -254.732 -45.529 117.598 1.00 0.00 ? 68  LYS A O    3  
ATOM 4682  C CB   . LYS A 1 68  ? -256.538 -46.204 114.646 1.00 0.00 ? 68  LYS A CB   3  
ATOM 4683  C CG   . LYS A 1 68  ? -257.968 -46.280 114.121 1.00 0.00 ? 68  LYS A CG   3  
ATOM 4684  C CD   . LYS A 1 68  ? -258.974 -46.563 115.234 1.00 0.00 ? 68  LYS A CD   3  
ATOM 4685  C CE   . LYS A 1 68  ? -258.713 -47.896 115.921 1.00 0.00 ? 68  LYS A CE   3  
ATOM 4686  N NZ   . LYS A 1 68  ? -258.932 -49.054 115.013 1.00 0.00 ? 68  LYS A NZ   3  
ATOM 4687  H H    . LYS A 1 68  ? -257.402 -43.474 116.194 1.00 0.00 ? 68  LYS A H    3  
ATOM 4688  H HA   . LYS A 1 68  ? -257.020 -45.639 116.639 1.00 0.00 ? 68  LYS A HA   3  
ATOM 4689  H HB2  . LYS A 1 68  ? -255.904 -45.847 113.848 1.00 0.00 ? 68  LYS A HB2  3  
ATOM 4690  H HB3  . LYS A 1 68  ? -256.224 -47.200 114.919 1.00 0.00 ? 68  LYS A HB3  3  
ATOM 4691  H HG2  . LYS A 1 68  ? -258.217 -45.338 113.658 1.00 0.00 ? 68  LYS A HG2  3  
ATOM 4692  H HG3  . LYS A 1 68  ? -258.026 -47.070 113.388 1.00 0.00 ? 68  LYS A HG3  3  
ATOM 4693  H HD2  . LYS A 1 68  ? -258.905 -45.777 115.969 1.00 0.00 ? 68  LYS A HD2  3  
ATOM 4694  H HD3  . LYS A 1 68  ? -259.968 -46.573 114.811 1.00 0.00 ? 68  LYS A HD3  3  
ATOM 4695  H HE2  . LYS A 1 68  ? -257.692 -47.913 116.266 1.00 0.00 ? 68  LYS A HE2  3  
ATOM 4696  H HE3  . LYS A 1 68  ? -259.379 -47.986 116.766 1.00 0.00 ? 68  LYS A HE3  3  
ATOM 4697  H HZ1  . LYS A 1 68  ? -259.863 -48.979 114.551 1.00 0.00 ? 68  LYS A HZ1  3  
ATOM 4698  H HZ2  . LYS A 1 68  ? -258.190 -49.088 114.279 1.00 0.00 ? 68  LYS A HZ2  3  
ATOM 4699  H HZ3  . LYS A 1 68  ? -258.910 -49.942 115.562 1.00 0.00 ? 68  LYS A HZ3  3  
ATOM 4700  N N    . ASN A 1 69  ? -253.963 -45.218 115.520 1.00 0.00 ? 69  ASN A N    3  
ATOM 4701  C CA   . ASN A 1 69  ? -252.569 -45.353 115.927 1.00 0.00 ? 69  ASN A CA   3  
ATOM 4702  C C    . ASN A 1 69  ? -251.943 -43.993 116.107 1.00 0.00 ? 69  ASN A C    3  
ATOM 4703  O O    . ASN A 1 69  ? -251.309 -43.446 115.204 1.00 0.00 ? 69  ASN A O    3  
ATOM 4704  C CB   . ASN A 1 69  ? -251.785 -46.209 114.927 1.00 0.00 ? 69  ASN A CB   3  
ATOM 4705  C CG   . ASN A 1 69  ? -250.467 -46.727 115.480 1.00 0.00 ? 69  ASN A CG   3  
ATOM 4706  O OD1  . ASN A 1 69  ? -249.817 -46.084 116.307 1.00 0.00 ? 69  ASN A OD1  3  
ATOM 4707  N ND2  . ASN A 1 69  ? -250.073 -47.911 115.035 1.00 0.00 ? 69  ASN A ND2  3  
ATOM 4708  H H    . ASN A 1 69  ? -254.182 -45.004 114.588 1.00 0.00 ? 69  ASN A H    3  
ATOM 4709  H HA   . ASN A 1 69  ? -252.563 -45.830 116.895 1.00 0.00 ? 69  ASN A HA   3  
ATOM 4710  H HB2  . ASN A 1 69  ? -252.390 -47.058 114.644 1.00 0.00 ? 69  ASN A HB2  3  
ATOM 4711  H HB3  . ASN A 1 69  ? -251.575 -45.618 114.047 1.00 0.00 ? 69  ASN A HB3  3  
ATOM 4712  H HD21 . ASN A 1 69  ? -250.654 -48.377 114.388 1.00 0.00 ? 69  ASN A HD21 3  
ATOM 4713  H HD22 . ASN A 1 69  ? -249.226 -48.279 115.367 1.00 0.00 ? 69  ASN A HD22 3  
ATOM 4714  N N    . GLU A 1 70  ? -252.151 -43.489 117.310 1.00 0.00 ? 70  GLU A N    3  
ATOM 4715  C CA   . GLU A 1 70  ? -251.764 -42.159 117.733 1.00 0.00 ? 70  GLU A CA   3  
ATOM 4716  C C    . GLU A 1 70  ? -251.908 -41.117 116.620 1.00 0.00 ? 70  GLU A C    3  
ATOM 4717  O O    . GLU A 1 70  ? -250.945 -40.789 115.921 1.00 0.00 ? 70  GLU A O    3  
ATOM 4718  C CB   . GLU A 1 70  ? -250.350 -42.120 118.311 1.00 0.00 ? 70  GLU A CB   3  
ATOM 4719  C CG   . GLU A 1 70  ? -250.050 -40.806 119.018 1.00 0.00 ? 70  GLU A CG   3  
ATOM 4720  C CD   . GLU A 1 70  ? -248.607 -40.674 119.444 1.00 0.00 ? 70  GLU A CD   3  
ATOM 4721  O OE1  . GLU A 1 70  ? -248.243 -41.225 120.502 1.00 0.00 ? 70  GLU A OE1  3  
ATOM 4722  O OE2  . GLU A 1 70  ? -247.833 -40.011 118.725 1.00 0.00 ? 70  GLU A OE2  3  
ATOM 4723  H H    . GLU A 1 70  ? -252.606 -44.059 117.965 1.00 0.00 ? 70  GLU A H    3  
ATOM 4724  H HA   . GLU A 1 70  ? -252.452 -41.907 118.515 1.00 0.00 ? 70  GLU A HA   3  
ATOM 4725  H HB2  . GLU A 1 70  ? -250.239 -42.926 119.023 1.00 0.00 ? 70  GLU A HB2  3  
ATOM 4726  H HB3  . GLU A 1 70  ? -249.636 -42.249 117.511 1.00 0.00 ? 70  GLU A HB3  3  
ATOM 4727  H HG2  . GLU A 1 70  ? -250.286 -39.991 118.349 1.00 0.00 ? 70  GLU A HG2  3  
ATOM 4728  H HG3  . GLU A 1 70  ? -250.675 -40.738 119.896 1.00 0.00 ? 70  GLU A HG3  3  
ATOM 4729  N N    . CYS A 1 71  ? -253.117 -40.622 116.453 1.00 0.00 ? 71  CYS A N    3  
ATOM 4730  C CA   . CYS A 1 71  ? -253.389 -39.558 115.505 1.00 0.00 ? 71  CYS A CA   3  
ATOM 4731  C C    . CYS A 1 71  ? -254.386 -38.601 116.133 1.00 0.00 ? 71  CYS A C    3  
ATOM 4732  O O    . CYS A 1 71  ? -255.166 -39.000 116.999 1.00 0.00 ? 71  CYS A O    3  
ATOM 4733  C CB   . CYS A 1 71  ? -253.932 -40.142 114.199 1.00 0.00 ? 71  CYS A CB   3  
ATOM 4734  S SG   . CYS A 1 71  ? -254.228 -38.924 112.895 1.00 0.00 ? 71  CYS A SG   3  
ATOM 4735  H H    . CYS A 1 71  ? -253.863 -40.983 116.986 1.00 0.00 ? 71  CYS A H    3  
ATOM 4736  H HA   . CYS A 1 71  ? -252.466 -39.032 115.310 1.00 0.00 ? 71  CYS A HA   3  
ATOM 4737  H HB2  . CYS A 1 71  ? -253.225 -40.861 113.816 1.00 0.00 ? 71  CYS A HB2  3  
ATOM 4738  H HB3  . CYS A 1 71  ? -254.868 -40.642 114.399 1.00 0.00 ? 71  CYS A HB3  3  
ATOM 4739  H HG   . CYS A 1 71  ? -253.044 -38.556 112.407 1.00 0.00 ? 71  CYS A HG   3  
ATOM 4740  N N    . ARG A 1 72  ? -254.354 -37.341 115.742 1.00 0.00 ? 72  ARG A N    3  
ATOM 4741  C CA   . ARG A 1 72  ? -255.234 -36.368 116.342 1.00 0.00 ? 72  ARG A CA   3  
ATOM 4742  C C    . ARG A 1 72  ? -256.268 -35.856 115.351 1.00 0.00 ? 72  ARG A C    3  
ATOM 4743  O O    . ARG A 1 72  ? -255.969 -35.037 114.483 1.00 0.00 ? 72  ARG A O    3  
ATOM 4744  C CB   . ARG A 1 72  ? -254.433 -35.204 116.922 1.00 0.00 ? 72  ARG A CB   3  
ATOM 4745  C CG   . ARG A 1 72  ? -255.294 -34.204 117.667 1.00 0.00 ? 72  ARG A CG   3  
ATOM 4746  C CD   . ARG A 1 72  ? -256.063 -34.873 118.796 1.00 0.00 ? 72  ARG A CD   3  
ATOM 4747  N NE   . ARG A 1 72  ? -257.003 -33.962 119.450 1.00 0.00 ? 72  ARG A NE   3  
ATOM 4748  C CZ   . ARG A 1 72  ? -258.158 -34.349 119.993 1.00 0.00 ? 72  ARG A CZ   3  
ATOM 4749  N NH1  . ARG A 1 72  ? -258.536 -35.618 119.919 1.00 0.00 ? 72  ARG A NH1  3  
ATOM 4750  N NH2  . ARG A 1 72  ? -258.938 -33.458 120.600 1.00 0.00 ? 72  ARG A NH2  3  
ATOM 4751  H H    . ARG A 1 72  ? -253.732 -37.059 115.042 1.00 0.00 ? 72  ARG A H    3  
ATOM 4752  H HA   . ARG A 1 72  ? -255.757 -36.862 117.151 1.00 0.00 ? 72  ARG A HA   3  
ATOM 4753  H HB2  . ARG A 1 72  ? -253.696 -35.595 117.609 1.00 0.00 ? 72  ARG A HB2  3  
ATOM 4754  H HB3  . ARG A 1 72  ? -253.929 -34.688 116.118 1.00 0.00 ? 72  ARG A HB3  3  
ATOM 4755  H HG2  . ARG A 1 72  ? -254.661 -33.434 118.079 1.00 0.00 ? 72  ARG A HG2  3  
ATOM 4756  H HG3  . ARG A 1 72  ? -255.995 -33.770 116.973 1.00 0.00 ? 72  ARG A HG3  3  
ATOM 4757  H HD2  . ARG A 1 72  ? -256.616 -35.707 118.391 1.00 0.00 ? 72  ARG A HD2  3  
ATOM 4758  H HD3  . ARG A 1 72  ? -255.357 -35.234 119.529 1.00 0.00 ? 72  ARG A HD3  3  
ATOM 4759  H HE   . ARG A 1 72  ? -256.755 -33.007 119.493 1.00 0.00 ? 72  ARG A HE   3  
ATOM 4760  H HH11 . ARG A 1 72  ? -257.949 -36.295 119.453 1.00 0.00 ? 72  ARG A HH11 3  
ATOM 4761  H HH12 . ARG A 1 72  ? -259.413 -35.912 120.318 1.00 0.00 ? 72  ARG A HH12 3  
ATOM 4762  H HH21 . ARG A 1 72  ? -258.658 -32.493 120.649 1.00 0.00 ? 72  ARG A HH21 3  
ATOM 4763  H HH22 . ARG A 1 72  ? -259.808 -33.742 121.017 1.00 0.00 ? 72  ARG A HH22 3  
ATOM 4764  N N    . LYS A 1 73  ? -257.478 -36.381 115.465 1.00 0.00 ? 73  LYS A N    3  
ATOM 4765  C CA   . LYS A 1 73  ? -258.616 -35.845 114.745 1.00 0.00 ? 73  LYS A CA   3  
ATOM 4766  C C    . LYS A 1 73  ? -259.049 -34.529 115.388 1.00 0.00 ? 73  LYS A C    3  
ATOM 4767  O O    . LYS A 1 73  ? -259.817 -34.513 116.354 1.00 0.00 ? 73  LYS A O    3  
ATOM 4768  C CB   . LYS A 1 73  ? -259.763 -36.868 114.738 1.00 0.00 ? 73  LYS A CB   3  
ATOM 4769  C CG   . LYS A 1 73  ? -261.086 -36.343 114.201 1.00 0.00 ? 73  LYS A CG   3  
ATOM 4770  C CD   . LYS A 1 73  ? -262.132 -36.273 115.304 1.00 0.00 ? 73  LYS A CD   3  
ATOM 4771  C CE   . LYS A 1 73  ? -263.442 -35.703 114.800 1.00 0.00 ? 73  LYS A CE   3  
ATOM 4772  N NZ   . LYS A 1 73  ? -264.440 -35.568 115.894 1.00 0.00 ? 73  LYS A NZ   3  
ATOM 4773  H H    . LYS A 1 73  ? -257.607 -37.171 116.038 1.00 0.00 ? 73  LYS A H    3  
ATOM 4774  H HA   . LYS A 1 73  ? -258.306 -35.652 113.728 1.00 0.00 ? 73  LYS A HA   3  
ATOM 4775  H HB2  . LYS A 1 73  ? -259.470 -37.711 114.129 1.00 0.00 ? 73  LYS A HB2  3  
ATOM 4776  H HB3  . LYS A 1 73  ? -259.926 -37.212 115.749 1.00 0.00 ? 73  LYS A HB3  3  
ATOM 4777  H HG2  . LYS A 1 73  ? -260.933 -35.354 113.797 1.00 0.00 ? 73  LYS A HG2  3  
ATOM 4778  H HG3  . LYS A 1 73  ? -261.437 -37.004 113.424 1.00 0.00 ? 73  LYS A HG3  3  
ATOM 4779  H HD2  . LYS A 1 73  ? -262.307 -37.270 115.680 1.00 0.00 ? 73  LYS A HD2  3  
ATOM 4780  H HD3  . LYS A 1 73  ? -261.758 -35.647 116.099 1.00 0.00 ? 73  LYS A HD3  3  
ATOM 4781  H HE2  . LYS A 1 73  ? -263.258 -34.730 114.370 1.00 0.00 ? 73  LYS A HE2  3  
ATOM 4782  H HE3  . LYS A 1 73  ? -263.839 -36.361 114.040 1.00 0.00 ? 73  LYS A HE3  3  
ATOM 4783  H HZ1  . LYS A 1 73  ? -264.569 -36.483 116.380 1.00 0.00 ? 73  LYS A HZ1  3  
ATOM 4784  H HZ2  . LYS A 1 73  ? -264.118 -34.866 116.593 1.00 0.00 ? 73  LYS A HZ2  3  
ATOM 4785  H HZ3  . LYS A 1 73  ? -265.361 -35.263 115.505 1.00 0.00 ? 73  LYS A HZ3  3  
ATOM 4786  N N    . GLN A 1 74  ? -258.508 -33.432 114.882 1.00 0.00 ? 74  GLN A N    3  
ATOM 4787  C CA   . GLN A 1 74  ? -258.836 -32.110 115.391 1.00 0.00 ? 74  GLN A CA   3  
ATOM 4788  C C    . GLN A 1 74  ? -258.291 -31.036 114.459 1.00 0.00 ? 74  GLN A C    3  
ATOM 4789  O O    . GLN A 1 74  ? -257.092 -30.991 114.195 1.00 0.00 ? 74  GLN A O    3  
ATOM 4790  C CB   . GLN A 1 74  ? -258.251 -31.908 116.792 1.00 0.00 ? 74  GLN A CB   3  
ATOM 4791  C CG   . GLN A 1 74  ? -258.727 -30.636 117.476 1.00 0.00 ? 74  GLN A CG   3  
ATOM 4792  C CD   . GLN A 1 74  ? -257.988 -30.351 118.769 1.00 0.00 ? 74  GLN A CD   3  
ATOM 4793  O OE1  . GLN A 1 74  ? -257.511 -31.263 119.440 1.00 0.00 ? 74  GLN A OE1  3  
ATOM 4794  N NE2  . GLN A 1 74  ? -257.899 -29.083 119.134 1.00 0.00 ? 74  GLN A NE2  3  
ATOM 4795  H H    . GLN A 1 74  ? -257.859 -33.512 114.150 1.00 0.00 ? 74  GLN A H    3  
ATOM 4796  H HA   . GLN A 1 74  ? -259.910 -32.025 115.439 1.00 0.00 ? 74  GLN A HA   3  
ATOM 4797  H HB2  . GLN A 1 74  ? -258.530 -32.749 117.409 1.00 0.00 ? 74  GLN A HB2  3  
ATOM 4798  H HB3  . GLN A 1 74  ? -257.174 -31.869 116.718 1.00 0.00 ? 74  GLN A HB3  3  
ATOM 4799  H HG2  . GLN A 1 74  ? -258.575 -29.805 116.804 1.00 0.00 ? 74  GLN A HG2  3  
ATOM 4800  H HG3  . GLN A 1 74  ? -259.780 -30.732 117.694 1.00 0.00 ? 74  GLN A HG3  3  
ATOM 4801  H HE21 . GLN A 1 74  ? -258.308 -28.403 118.560 1.00 0.00 ? 74  GLN A HE21 3  
ATOM 4802  H HE22 . GLN A 1 74  ? -257.427 -28.875 119.972 1.00 0.00 ? 74  GLN A HE22 3  
ATOM 4803  N N    . PRO A 1 75  ? -259.160 -30.168 113.939 1.00 0.00 ? 75  PRO A N    3  
ATOM 4804  C CA   . PRO A 1 75  ? -258.748 -29.025 113.135 1.00 0.00 ? 75  PRO A CA   3  
ATOM 4805  C C    . PRO A 1 75  ? -258.314 -27.857 114.020 1.00 0.00 ? 75  PRO A C    3  
ATOM 4806  O O    . PRO A 1 75  ? -258.919 -26.784 113.996 1.00 0.00 ? 75  PRO A O    3  
ATOM 4807  C CB   . PRO A 1 75  ? -260.016 -28.662 112.339 1.00 0.00 ? 75  PRO A CB   3  
ATOM 4808  C CG   . PRO A 1 75  ? -261.079 -29.630 112.772 1.00 0.00 ? 75  PRO A CG   3  
ATOM 4809  C CD   . PRO A 1 75  ? -260.615 -30.226 114.071 1.00 0.00 ? 75  PRO A CD   3  
ATOM 4810  H HA   . PRO A 1 75  ? -257.949 -29.284 112.459 1.00 0.00 ? 75  PRO A HA   3  
ATOM 4811  H HB2  . PRO A 1 75  ? -260.301 -27.644 112.566 1.00 0.00 ? 75  PRO A HB2  3  
ATOM 4812  H HB3  . PRO A 1 75  ? -259.811 -28.752 111.284 1.00 0.00 ? 75  PRO A HB3  3  
ATOM 4813  H HG2  . PRO A 1 75  ? -262.013 -29.107 112.915 1.00 0.00 ? 75  PRO A HG2  3  
ATOM 4814  H HG3  . PRO A 1 75  ? -261.195 -30.403 112.026 1.00 0.00 ? 75  PRO A HG3  3  
ATOM 4815  H HD2  . PRO A 1 75  ? -260.955 -29.629 114.905 1.00 0.00 ? 75  PRO A HD2  3  
ATOM 4816  H HD3  . PRO A 1 75  ? -260.956 -31.246 114.167 1.00 0.00 ? 75  PRO A HD3  3  
ATOM 4817  N N    . PHE A 1 76  ? -257.271 -28.078 114.813 1.00 0.00 ? 76  PHE A N    3  
ATOM 4818  C CA   . PHE A 1 76  ? -256.811 -27.067 115.757 1.00 0.00 ? 76  PHE A CA   3  
ATOM 4819  C C    . PHE A 1 76  ? -256.038 -25.962 115.044 1.00 0.00 ? 76  PHE A C    3  
ATOM 4820  O O    . PHE A 1 76  ? -254.889 -26.131 114.636 1.00 0.00 ? 76  PHE A O    3  
ATOM 4821  C CB   . PHE A 1 76  ? -255.984 -27.692 116.897 1.00 0.00 ? 76  PHE A CB   3  
ATOM 4822  C CG   . PHE A 1 76  ? -254.812 -28.539 116.469 1.00 0.00 ? 76  PHE A CG   3  
ATOM 4823  C CD1  . PHE A 1 76  ? -254.996 -29.852 116.067 1.00 0.00 ? 76  PHE A CD1  3  
ATOM 4824  C CD2  . PHE A 1 76  ? -253.525 -28.024 116.492 1.00 0.00 ? 76  PHE A CD2  3  
ATOM 4825  C CE1  . PHE A 1 76  ? -253.920 -30.633 115.689 1.00 0.00 ? 76  PHE A CE1  3  
ATOM 4826  C CE2  . PHE A 1 76  ? -252.447 -28.800 116.113 1.00 0.00 ? 76  PHE A CE2  3  
ATOM 4827  C CZ   . PHE A 1 76  ? -252.644 -30.106 115.712 1.00 0.00 ? 76  PHE A CZ   3  
ATOM 4828  H H    . PHE A 1 76  ? -256.796 -28.935 114.753 1.00 0.00 ? 76  PHE A H    3  
ATOM 4829  H HA   . PHE A 1 76  ? -257.695 -26.620 116.188 1.00 0.00 ? 76  PHE A HA   3  
ATOM 4830  H HB2  . PHE A 1 76  ? -255.598 -26.899 117.518 1.00 0.00 ? 76  PHE A HB2  3  
ATOM 4831  H HB3  . PHE A 1 76  ? -256.638 -28.311 117.495 1.00 0.00 ? 76  PHE A HB3  3  
ATOM 4832  H HD1  . PHE A 1 76  ? -255.993 -30.263 116.044 1.00 0.00 ? 76  PHE A HD1  3  
ATOM 4833  H HD2  . PHE A 1 76  ? -253.368 -27.003 116.808 1.00 0.00 ? 76  PHE A HD2  3  
ATOM 4834  H HE1  . PHE A 1 76  ? -254.079 -31.654 115.377 1.00 0.00 ? 76  PHE A HE1  3  
ATOM 4835  H HE2  . PHE A 1 76  ? -251.449 -28.386 116.132 1.00 0.00 ? 76  PHE A HE2  3  
ATOM 4836  H HZ   . PHE A 1 76  ? -251.803 -30.715 115.416 1.00 0.00 ? 76  PHE A HZ   3  
ATOM 4837  N N    . GLN A 1 77  ? -256.696 -24.829 114.885 1.00 0.00 ? 77  GLN A N    3  
ATOM 4838  C CA   . GLN A 1 77  ? -256.108 -23.689 114.208 1.00 0.00 ? 77  GLN A CA   3  
ATOM 4839  C C    . GLN A 1 77  ? -255.437 -22.767 115.212 1.00 0.00 ? 77  GLN A C    3  
ATOM 4840  O O    . GLN A 1 77  ? -256.096 -22.222 116.101 1.00 0.00 ? 77  GLN A O    3  
ATOM 4841  C CB   . GLN A 1 77  ? -257.188 -22.922 113.444 1.00 0.00 ? 77  GLN A CB   3  
ATOM 4842  C CG   . GLN A 1 77  ? -257.924 -23.765 112.416 1.00 0.00 ? 77  GLN A CG   3  
ATOM 4843  C CD   . GLN A 1 77  ? -257.024 -24.237 111.296 1.00 0.00 ? 77  GLN A CD   3  
ATOM 4844  O OE1  . GLN A 1 77  ? -256.414 -25.304 111.375 1.00 0.00 ? 77  GLN A OE1  3  
ATOM 4845  N NE2  . GLN A 1 77  ? -256.937 -23.442 110.249 1.00 0.00 ? 77  GLN A NE2  3  
ATOM 4846  H H    . GLN A 1 77  ? -257.611 -24.757 115.235 1.00 0.00 ? 77  GLN A H    3  
ATOM 4847  H HA   . GLN A 1 77  ? -255.368 -24.055 113.512 1.00 0.00 ? 77  GLN A HA   3  
ATOM 4848  H HB2  . GLN A 1 77  ? -257.911 -22.542 114.148 1.00 0.00 ? 77  GLN A HB2  3  
ATOM 4849  H HB3  . GLN A 1 77  ? -256.727 -22.090 112.930 1.00 0.00 ? 77  GLN A HB3  3  
ATOM 4850  H HG2  . GLN A 1 77  ? -258.344 -24.629 112.909 1.00 0.00 ? 77  GLN A HG2  3  
ATOM 4851  H HG3  . GLN A 1 77  ? -258.721 -23.172 111.989 1.00 0.00 ? 77  GLN A HG3  3  
ATOM 4852  H HE21 . GLN A 1 77  ? -257.452 -22.607 110.255 1.00 0.00 ? 77  GLN A HE21 3  
ATOM 4853  H HE22 . GLN A 1 77  ? -256.362 -23.712 109.510 1.00 0.00 ? 77  GLN A HE22 3  
ATOM 4854  N N    . ARG A 1 78  ? -254.130 -22.602 115.085 1.00 0.00 ? 78  ARG A N    3  
ATOM 4855  C CA   . ARG A 1 78  ? -253.414 -21.677 115.944 1.00 0.00 ? 78  ARG A CA   3  
ATOM 4856  C C    . ARG A 1 78  ? -253.042 -20.419 115.166 1.00 0.00 ? 78  ARG A C    3  
ATOM 4857  O O    . ARG A 1 78  ? -252.512 -20.484 114.053 1.00 0.00 ? 78  ARG A O    3  
ATOM 4858  C CB   . ARG A 1 78  ? -252.181 -22.333 116.592 1.00 0.00 ? 78  ARG A CB   3  
ATOM 4859  C CG   . ARG A 1 78  ? -251.086 -22.776 115.631 1.00 0.00 ? 78  ARG A CG   3  
ATOM 4860  C CD   . ARG A 1 78  ? -249.927 -23.400 116.398 1.00 0.00 ? 78  ARG A CD   3  
ATOM 4861  N NE   . ARG A 1 78  ? -248.749 -23.627 115.563 1.00 0.00 ? 78  ARG A NE   3  
ATOM 4862  C CZ   . ARG A 1 78  ? -247.557 -23.990 116.040 1.00 0.00 ? 78  ARG A CZ   3  
ATOM 4863  N NH1  . ARG A 1 78  ? -247.397 -24.231 117.336 1.00 0.00 ? 78  ARG A NH1  3  
ATOM 4864  N NH2  . ARG A 1 78  ? -246.534 -24.127 115.210 1.00 0.00 ? 78  ARG A NH2  3  
ATOM 4865  H H    . ARG A 1 78  ? -253.641 -23.101 114.397 1.00 0.00 ? 78  ARG A H    3  
ATOM 4866  H HA   . ARG A 1 78  ? -254.098 -21.387 116.730 1.00 0.00 ? 78  ARG A HA   3  
ATOM 4867  H HB2  . ARG A 1 78  ? -251.743 -21.628 117.283 1.00 0.00 ? 78  ARG A HB2  3  
ATOM 4868  H HB3  . ARG A 1 78  ? -252.509 -23.199 117.148 1.00 0.00 ? 78  ARG A HB3  3  
ATOM 4869  H HG2  . ARG A 1 78  ? -251.490 -23.506 114.943 1.00 0.00 ? 78  ARG A HG2  3  
ATOM 4870  H HG3  . ARG A 1 78  ? -250.727 -21.918 115.086 1.00 0.00 ? 78  ARG A HG3  3  
ATOM 4871  H HD2  . ARG A 1 78  ? -249.654 -22.737 117.205 1.00 0.00 ? 78  ARG A HD2  3  
ATOM 4872  H HD3  . ARG A 1 78  ? -250.250 -24.346 116.808 1.00 0.00 ? 78  ARG A HD3  3  
ATOM 4873  H HE   . ARG A 1 78  ? -248.843 -23.484 114.589 1.00 0.00 ? 78  ARG A HE   3  
ATOM 4874  H HH11 . ARG A 1 78  ? -248.177 -24.150 117.962 1.00 0.00 ? 78  ARG A HH11 3  
ATOM 4875  H HH12 . ARG A 1 78  ? -246.493 -24.491 117.695 1.00 0.00 ? 78  ARG A HH12 3  
ATOM 4876  H HH21 . ARG A 1 78  ? -246.668 -23.954 114.218 1.00 0.00 ? 78  ARG A HH21 3  
ATOM 4877  H HH22 . ARG A 1 78  ? -245.635 -24.400 115.552 1.00 0.00 ? 78  ARG A HH22 3  
ATOM 4878  N N    . ALA A 1 79  ? -253.355 -19.274 115.750 1.00 0.00 ? 79  ALA A N    3  
ATOM 4879  C CA   . ALA A 1 79  ? -253.166 -17.992 115.093 1.00 0.00 ? 79  ALA A CA   3  
ATOM 4880  C C    . ALA A 1 79  ? -251.792 -17.401 115.436 1.00 0.00 ? 79  ALA A C    3  
ATOM 4881  O O    . ALA A 1 79  ? -251.298 -17.563 116.552 1.00 0.00 ? 79  ALA A O    3  
ATOM 4882  C CB   . ALA A 1 79  ? -254.271 -17.034 115.512 1.00 0.00 ? 79  ALA A CB   3  
ATOM 4883  H H    . ALA A 1 79  ? -253.712 -19.289 116.667 1.00 0.00 ? 79  ALA A H    3  
ATOM 4884  H HA   . ALA A 1 79  ? -253.250 -18.152 114.015 1.00 0.00 ? 79  ALA A HA   3  
ATOM 4885  H HB1  . ALA A 1 79  ? -254.194 -16.837 116.571 1.00 0.00 ? 79  ALA A HB1  3  
ATOM 4886  H HB2  . ALA A 1 79  ? -255.229 -17.479 115.297 1.00 0.00 ? 79  ALA A HB2  3  
ATOM 4887  H HB3  . ALA A 1 79  ? -254.172 -16.108 114.965 1.00 0.00 ? 79  ALA A HB3  3  
ATOM 4888  N N    . ILE A 1 80  ? -251.175 -16.746 114.466 1.00 0.00 ? 80  ILE A N    3  
ATOM 4889  C CA   . ILE A 1 80  ? -249.889 -16.080 114.654 1.00 0.00 ? 80  ILE A CA   3  
ATOM 4890  C C    . ILE A 1 80  ? -250.034 -14.768 115.407 1.00 0.00 ? 80  ILE A C    3  
ATOM 4891  O O    . ILE A 1 80  ? -250.722 -13.848 114.961 1.00 0.00 ? 80  ILE A O    3  
ATOM 4892  C CB   . ILE A 1 80  ? -249.176 -15.821 113.309 1.00 0.00 ? 80  ILE A CB   3  
ATOM 4893  C CG1  . ILE A 1 80  ? -248.492 -17.098 112.832 1.00 0.00 ? 80  ILE A CG1  3  
ATOM 4894  C CG2  . ILE A 1 80  ? -248.159 -14.687 113.422 1.00 0.00 ? 80  ILE A CG2  3  
ATOM 4895  C CD1  . ILE A 1 80  ? -247.394 -17.559 113.757 1.00 0.00 ? 80  ILE A CD1  3  
ATOM 4896  H H    . ILE A 1 80  ? -251.609 -16.688 113.589 1.00 0.00 ? 80  ILE A H    3  
ATOM 4897  H HA   . ILE A 1 80  ? -249.261 -16.728 115.223 1.00 0.00 ? 80  ILE A HA   3  
ATOM 4898  H HB   . ILE A 1 80  ? -249.921 -15.532 112.584 1.00 0.00 ? 80  ILE A HB   3  
ATOM 4899  H HG12 . ILE A 1 80  ? -249.225 -17.889 112.763 1.00 0.00 ? 80  ILE A HG12 3  
ATOM 4900  H HG13 . ILE A 1 80  ? -248.059 -16.927 111.858 1.00 0.00 ? 80  ILE A HG13 3  
ATOM 4901  H HG21 . ILE A 1 80  ? -247.430 -14.934 114.178 1.00 0.00 ? 80  ILE A HG21 3  
ATOM 4902  H HG22 . ILE A 1 80  ? -247.663 -14.553 112.473 1.00 0.00 ? 80  ILE A HG22 3  
ATOM 4903  H HG23 . ILE A 1 80  ? -248.668 -13.774 113.696 1.00 0.00 ? 80  ILE A HG23 3  
ATOM 4904  H HD11 . ILE A 1 80  ? -247.810 -17.739 114.737 1.00 0.00 ? 80  ILE A HD11 3  
ATOM 4905  H HD12 . ILE A 1 80  ? -246.959 -18.468 113.375 1.00 0.00 ? 80  ILE A HD12 3  
ATOM 4906  H HD13 . ILE A 1 80  ? -246.635 -16.789 113.822 1.00 0.00 ? 80  ILE A HD13 3  
ATOM 4907  N N    . GLY A 1 81  ? -249.399 -14.706 116.564 1.00 0.00 ? 81  GLY A N    3  
ATOM 4908  C CA   . GLY A 1 81  ? -249.229 -13.449 117.243 1.00 0.00 ? 81  GLY A CA   3  
ATOM 4909  C C    . GLY A 1 81  ? -247.926 -12.809 116.820 1.00 0.00 ? 81  GLY A C    3  
ATOM 4910  O O    . GLY A 1 81  ? -246.946 -13.515 116.615 1.00 0.00 ? 81  GLY A O    3  
ATOM 4911  H H    . GLY A 1 81  ? -249.034 -15.526 116.957 1.00 0.00 ? 81  GLY A H    3  
ATOM 4912  H HA2  . GLY A 1 81  ? -250.053 -12.793 116.994 1.00 0.00 ? 81  GLY A HA2  3  
ATOM 4913  H HA3  . GLY A 1 81  ? -249.212 -13.616 118.309 1.00 0.00 ? 81  GLY A HA3  3  
ATOM 4914  N N    . PRO A 1 82  ? -247.883 -11.482 116.660 1.00 0.00 ? 82  PRO A N    3  
ATOM 4915  C CA   . PRO A 1 82  ? -246.691 -10.766 116.206 1.00 0.00 ? 82  PRO A CA   3  
ATOM 4916  C C    . PRO A 1 82  ? -245.442 -11.079 117.018 1.00 0.00 ? 82  PRO A C    3  
ATOM 4917  O O    . PRO A 1 82  ? -244.328 -11.051 116.491 1.00 0.00 ? 82  PRO A O    3  
ATOM 4918  C CB   . PRO A 1 82  ? -247.088 -9.299  116.355 1.00 0.00 ? 82  PRO A CB   3  
ATOM 4919  C CG   . PRO A 1 82  ? -248.559 -9.316  116.190 1.00 0.00 ? 82  PRO A CG   3  
ATOM 4920  C CD   . PRO A 1 82  ? -248.997 -10.564 116.889 1.00 0.00 ? 82  PRO A CD   3  
ATOM 4921  H HA   . PRO A 1 82  ? -246.501 -10.975 115.185 1.00 0.00 ? 82  PRO A HA   3  
ATOM 4922  H HB2  . PRO A 1 82  ? -246.798 -8.941  117.332 1.00 0.00 ? 82  PRO A HB2  3  
ATOM 4923  H HB3  . PRO A 1 82  ? -246.607 -8.711  115.588 1.00 0.00 ? 82  PRO A HB3  3  
ATOM 4924  H HG2  . PRO A 1 82  ? -248.995 -8.444  116.652 1.00 0.00 ? 82  PRO A HG2  3  
ATOM 4925  H HG3  . PRO A 1 82  ? -248.814 -9.362  115.141 1.00 0.00 ? 82  PRO A HG3  3  
ATOM 4926  H HD2  . PRO A 1 82  ? -249.100 -10.378 117.929 1.00 0.00 ? 82  PRO A HD2  3  
ATOM 4927  H HD3  . PRO A 1 82  ? -249.914 -10.946 116.466 1.00 0.00 ? 82  PRO A HD3  3  
ATOM 4928  N N    . GLU A 1 83  ? -245.634 -11.359 118.295 1.00 0.00 ? 83  GLU A N    3  
ATOM 4929  C CA   . GLU A 1 83  ? -244.551 -11.754 119.171 1.00 0.00 ? 83  GLU A CA   3  
ATOM 4930  C C    . GLU A 1 83  ? -243.970 -13.104 118.772 1.00 0.00 ? 83  GLU A C    3  
ATOM 4931  O O    . GLU A 1 83  ? -242.755 -13.318 118.829 1.00 0.00 ? 83  GLU A O    3  
ATOM 4932  C CB   . GLU A 1 83  ? -245.069 -11.800 120.586 1.00 0.00 ? 83  GLU A CB   3  
ATOM 4933  C CG   . GLU A 1 83  ? -245.491 -10.434 121.072 1.00 0.00 ? 83  GLU A CG   3  
ATOM 4934  C CD   . GLU A 1 83  ? -244.397 -9.405  120.890 1.00 0.00 ? 83  GLU A CD   3  
ATOM 4935  O OE1  . GLU A 1 83  ? -243.307 -9.583  121.476 1.00 0.00 ? 83  GLU A OE1  3  
ATOM 4936  O OE2  . GLU A 1 83  ? -244.618 -8.419  120.149 1.00 0.00 ? 83  GLU A OE2  3  
ATOM 4937  H H    . GLU A 1 83  ? -246.536 -11.283 118.670 1.00 0.00 ? 83  GLU A H    3  
ATOM 4938  H HA   . GLU A 1 83  ? -243.780 -11.003 119.113 1.00 0.00 ? 83  GLU A HA   3  
ATOM 4939  H HB2  . GLU A 1 83  ? -245.923 -12.463 120.627 1.00 0.00 ? 83  GLU A HB2  3  
ATOM 4940  H HB3  . GLU A 1 83  ? -244.298 -12.175 121.233 1.00 0.00 ? 83  GLU A HB3  3  
ATOM 4941  H HG2  . GLU A 1 83  ? -246.363 -10.119 120.520 1.00 0.00 ? 83  GLU A HG2  3  
ATOM 4942  H HG3  . GLU A 1 83  ? -245.732 -10.503 122.109 1.00 0.00 ? 83  GLU A HG3  3  
ATOM 4943  N N    . GLU A 1 84  ? -244.851 -14.011 118.385 1.00 0.00 ? 84  GLU A N    3  
ATOM 4944  C CA   . GLU A 1 84  ? -244.454 -15.325 117.910 1.00 0.00 ? 84  GLU A CA   3  
ATOM 4945  C C    . GLU A 1 84  ? -243.958 -15.229 116.472 1.00 0.00 ? 84  GLU A C    3  
ATOM 4946  O O    . GLU A 1 84  ? -244.741 -15.111 115.530 1.00 0.00 ? 84  GLU A O    3  
ATOM 4947  C CB   . GLU A 1 84  ? -245.622 -16.302 118.015 1.00 0.00 ? 84  GLU A CB   3  
ATOM 4948  C CG   . GLU A 1 84  ? -246.114 -16.458 119.441 1.00 0.00 ? 84  GLU A CG   3  
ATOM 4949  C CD   . GLU A 1 84  ? -247.269 -17.424 119.567 1.00 0.00 ? 84  GLU A CD   3  
ATOM 4950  O OE1  . GLU A 1 84  ? -248.405 -17.064 119.193 1.00 0.00 ? 84  GLU A OE1  3  
ATOM 4951  O OE2  . GLU A 1 84  ? -247.050 -18.548 120.065 1.00 0.00 ? 84  GLU A OE2  3  
ATOM 4952  H H    . GLU A 1 84  ? -245.801 -13.783 118.410 1.00 0.00 ? 84  GLU A H    3  
ATOM 4953  H HA   . GLU A 1 84  ? -243.649 -15.672 118.540 1.00 0.00 ? 84  GLU A HA   3  
ATOM 4954  H HB2  . GLU A 1 84  ? -246.438 -15.940 117.404 1.00 0.00 ? 84  GLU A HB2  3  
ATOM 4955  H HB3  . GLU A 1 84  ? -245.308 -17.269 117.651 1.00 0.00 ? 84  GLU A HB3  3  
ATOM 4956  H HG2  . GLU A 1 84  ? -245.299 -16.822 120.046 1.00 0.00 ? 84  GLU A HG2  3  
ATOM 4957  H HG3  . GLU A 1 84  ? -246.424 -15.493 119.805 1.00 0.00 ? 84  GLU A HG3  3  
ATOM 4958  N N    . GLU A 1 85  ? -242.651 -15.266 116.315 1.00 0.00 ? 85  GLU A N    3  
ATOM 4959  C CA   . GLU A 1 85  ? -242.030 -15.005 115.033 1.00 0.00 ? 85  GLU A CA   3  
ATOM 4960  C C    . GLU A 1 85  ? -241.953 -16.261 114.176 1.00 0.00 ? 85  GLU A C    3  
ATOM 4961  O O    . GLU A 1 85  ? -241.678 -17.357 114.668 1.00 0.00 ? 85  GLU A O    3  
ATOM 4962  C CB   . GLU A 1 85  ? -240.640 -14.427 115.257 1.00 0.00 ? 85  GLU A CB   3  
ATOM 4963  C CG   . GLU A 1 85  ? -240.662 -13.181 116.124 1.00 0.00 ? 85  GLU A CG   3  
ATOM 4964  C CD   . GLU A 1 85  ? -239.271 -12.678 116.452 1.00 0.00 ? 85  GLU A CD   3  
ATOM 4965  O OE1  . GLU A 1 85  ? -238.674 -11.971 115.616 1.00 0.00 ? 85  GLU A OE1  3  
ATOM 4966  O OE2  . GLU A 1 85  ? -238.765 -12.986 117.548 1.00 0.00 ? 85  GLU A OE2  3  
ATOM 4967  H H    . GLU A 1 85  ? -242.082 -15.477 117.088 1.00 0.00 ? 85  GLU A H    3  
ATOM 4968  H HA   . GLU A 1 85  ? -242.633 -14.272 114.520 1.00 0.00 ? 85  GLU A HA   3  
ATOM 4969  H HB2  . GLU A 1 85  ? -240.023 -15.170 115.740 1.00 0.00 ? 85  GLU A HB2  3  
ATOM 4970  H HB3  . GLU A 1 85  ? -240.208 -14.170 114.302 1.00 0.00 ? 85  GLU A HB3  3  
ATOM 4971  H HG2  . GLU A 1 85  ? -241.205 -12.402 115.602 1.00 0.00 ? 85  GLU A HG2  3  
ATOM 4972  H HG3  . GLU A 1 85  ? -241.176 -13.410 117.047 1.00 0.00 ? 85  GLU A HG3  3  
ATOM 4973  N N    . ILE A 1 86  ? -242.179 -16.084 112.884 1.00 0.00 ? 86  ILE A N    3  
ATOM 4974  C CA   . ILE A 1 86  ? -242.157 -17.185 111.930 1.00 0.00 ? 86  ILE A CA   3  
ATOM 4975  C C    . ILE A 1 86  ? -240.793 -17.858 111.884 1.00 0.00 ? 86  ILE A C    3  
ATOM 4976  O O    . ILE A 1 86  ? -240.696 -19.062 111.664 1.00 0.00 ? 86  ILE A O    3  
ATOM 4977  C CB   . ILE A 1 86  ? -242.539 -16.697 110.524 1.00 0.00 ? 86  ILE A CB   3  
ATOM 4978  C CG1  . ILE A 1 86  ? -241.670 -15.500 110.114 1.00 0.00 ? 86  ILE A CG1  3  
ATOM 4979  C CG2  . ILE A 1 86  ? -244.011 -16.333 110.504 1.00 0.00 ? 86  ILE A CG2  3  
ATOM 4980  C CD1  . ILE A 1 86  ? -242.063 -14.877 108.794 1.00 0.00 ? 86  ILE A CD1  3  
ATOM 4981  H H    . ILE A 1 86  ? -242.378 -15.182 112.559 1.00 0.00 ? 86  ILE A H    3  
ATOM 4982  H HA   . ILE A 1 86  ? -242.893 -17.911 112.246 1.00 0.00 ? 86  ILE A HA   3  
ATOM 4983  H HB   . ILE A 1 86  ? -242.380 -17.507 109.827 1.00 0.00 ? 86  ILE A HB   3  
ATOM 4984  H HG12 . ILE A 1 86  ? -241.743 -14.738 110.874 1.00 0.00 ? 86  ILE A HG12 3  
ATOM 4985  H HG13 . ILE A 1 86  ? -240.641 -15.824 110.037 1.00 0.00 ? 86  ILE A HG13 3  
ATOM 4986  H HG21 . ILE A 1 86  ? -244.204 -15.594 111.265 1.00 0.00 ? 86  ILE A HG21 3  
ATOM 4987  H HG22 . ILE A 1 86  ? -244.272 -15.934 109.534 1.00 0.00 ? 86  ILE A HG22 3  
ATOM 4988  H HG23 . ILE A 1 86  ? -244.599 -17.217 110.702 1.00 0.00 ? 86  ILE A HG23 3  
ATOM 4989  H HD11 . ILE A 1 86  ? -242.025 -15.627 108.019 1.00 0.00 ? 86  ILE A HD11 3  
ATOM 4990  H HD12 . ILE A 1 86  ? -243.065 -14.483 108.869 1.00 0.00 ? 86  ILE A HD12 3  
ATOM 4991  H HD13 . ILE A 1 86  ? -241.379 -14.076 108.556 1.00 0.00 ? 86  ILE A HD13 3  
ATOM 4992  N N    . MET A 1 87  ? -239.743 -17.087 112.121 1.00 0.00 ? 87  MET A N    3  
ATOM 4993  C CA   . MET A 1 87  ? -238.400 -17.635 112.140 1.00 0.00 ? 87  MET A CA   3  
ATOM 4994  C C    . MET A 1 87  ? -238.182 -18.486 113.380 1.00 0.00 ? 87  MET A C    3  
ATOM 4995  O O    . MET A 1 87  ? -237.287 -19.325 113.410 1.00 0.00 ? 87  MET A O    3  
ATOM 4996  C CB   . MET A 1 87  ? -237.343 -16.538 112.023 1.00 0.00 ? 87  MET A CB   3  
ATOM 4997  C CG   . MET A 1 87  ? -237.067 -16.163 110.576 1.00 0.00 ? 87  MET A CG   3  
ATOM 4998  S SD   . MET A 1 87  ? -236.555 -17.594 109.601 1.00 0.00 ? 87  MET A SD   3  
ATOM 4999  C CE   . MET A 1 87  ? -236.717 -16.971 107.934 1.00 0.00 ? 87  MET A CE   3  
ATOM 5000  H H    . MET A 1 87  ? -239.876 -16.132 112.290 1.00 0.00 ? 87  MET A H    3  
ATOM 5001  H HA   . MET A 1 87  ? -238.313 -18.283 111.278 1.00 0.00 ? 87  MET A HA   3  
ATOM 5002  H HB2  . MET A 1 87  ? -237.687 -15.657 112.548 1.00 0.00 ? 87  MET A HB2  3  
ATOM 5003  H HB3  . MET A 1 87  ? -236.424 -16.882 112.469 1.00 0.00 ? 87  MET A HB3  3  
ATOM 5004  H HG2  . MET A 1 87  ? -237.967 -15.753 110.143 1.00 0.00 ? 87  MET A HG2  3  
ATOM 5005  H HG3  . MET A 1 87  ? -236.280 -15.424 110.549 1.00 0.00 ? 87  MET A HG3  3  
ATOM 5006  H HE1  . MET A 1 87  ? -237.742 -16.673 107.760 1.00 0.00 ? 87  MET A HE1  3  
ATOM 5007  H HE2  . MET A 1 87  ? -236.071 -16.117 107.805 1.00 0.00 ? 87  MET A HE2  3  
ATOM 5008  H HE3  . MET A 1 87  ? -236.440 -17.743 107.230 1.00 0.00 ? 87  MET A HE3  3  
ATOM 5009  N N    . GLN A 1 88  ? -239.021 -18.296 114.392 1.00 0.00 ? 88  GLN A N    3  
ATOM 5010  C CA   . GLN A 1 88  ? -238.959 -19.145 115.575 1.00 0.00 ? 88  GLN A CA   3  
ATOM 5011  C C    . GLN A 1 88  ? -239.582 -20.479 115.224 1.00 0.00 ? 88  GLN A C    3  
ATOM 5012  O O    . GLN A 1 88  ? -239.151 -21.540 115.679 1.00 0.00 ? 88  GLN A O    3  
ATOM 5013  C CB   . GLN A 1 88  ? -239.708 -18.518 116.753 1.00 0.00 ? 88  GLN A CB   3  
ATOM 5014  C CG   . GLN A 1 88  ? -239.113 -17.208 117.229 1.00 0.00 ? 88  GLN A CG   3  
ATOM 5015  C CD   . GLN A 1 88  ? -239.934 -16.549 118.324 1.00 0.00 ? 88  GLN A CD   3  
ATOM 5016  O OE1  . GLN A 1 88  ? -241.158 -16.672 118.364 1.00 0.00 ? 88  GLN A OE1  3  
ATOM 5017  N NE2  . GLN A 1 88  ? -239.261 -15.852 119.225 1.00 0.00 ? 88  GLN A NE2  3  
ATOM 5018  H H    . GLN A 1 88  ? -239.730 -17.611 114.319 1.00 0.00 ? 88  GLN A H    3  
ATOM 5019  H HA   . GLN A 1 88  ? -237.921 -19.289 115.836 1.00 0.00 ? 88  GLN A HA   3  
ATOM 5020  H HB2  . GLN A 1 88  ? -240.732 -18.336 116.457 1.00 0.00 ? 88  GLN A HB2  3  
ATOM 5021  H HB3  . GLN A 1 88  ? -239.701 -19.214 117.579 1.00 0.00 ? 88  GLN A HB3  3  
ATOM 5022  H HG2  . GLN A 1 88  ? -238.118 -17.396 117.607 1.00 0.00 ? 88  GLN A HG2  3  
ATOM 5023  H HG3  . GLN A 1 88  ? -239.058 -16.537 116.388 1.00 0.00 ? 88  GLN A HG3  3  
ATOM 5024  H HE21 . GLN A 1 88  ? -238.284 -15.801 119.139 1.00 0.00 ? 88  GLN A HE21 3  
ATOM 5025  H HE22 . GLN A 1 88  ? -239.765 -15.415 119.939 1.00 0.00 ? 88  GLN A HE22 3  
ATOM 5026  N N    . ILE A 1 89  ? -240.599 -20.393 114.385 1.00 0.00 ? 89  ILE A N    3  
ATOM 5027  C CA   . ILE A 1 89  ? -241.326 -21.554 113.902 1.00 0.00 ? 89  ILE A CA   3  
ATOM 5028  C C    . ILE A 1 89  ? -240.458 -22.390 112.964 1.00 0.00 ? 89  ILE A C    3  
ATOM 5029  O O    . ILE A 1 89  ? -240.305 -23.600 113.141 1.00 0.00 ? 89  ILE A O    3  
ATOM 5030  C CB   . ILE A 1 89  ? -242.582 -21.104 113.152 1.00 0.00 ? 89  ILE A CB   3  
ATOM 5031  C CG1  . ILE A 1 89  ? -243.324 -20.072 113.999 1.00 0.00 ? 89  ILE A CG1  3  
ATOM 5032  C CG2  . ILE A 1 89  ? -243.482 -22.290 112.821 1.00 0.00 ? 89  ILE A CG2  3  
ATOM 5033  C CD1  . ILE A 1 89  ? -243.640 -20.530 115.410 1.00 0.00 ? 89  ILE A CD1  3  
ATOM 5034  H H    . ILE A 1 89  ? -240.887 -19.499 114.091 1.00 0.00 ? 89  ILE A H    3  
ATOM 5035  H HA   . ILE A 1 89  ? -241.634 -22.141 114.747 1.00 0.00 ? 89  ILE A HA   3  
ATOM 5036  H HB   . ILE A 1 89  ? -242.274 -20.641 112.221 1.00 0.00 ? 89  ILE A HB   3  
ATOM 5037  H HG12 . ILE A 1 89  ? -242.723 -19.177 114.071 1.00 0.00 ? 89  ILE A HG12 3  
ATOM 5038  H HG13 . ILE A 1 89  ? -244.242 -19.836 113.517 1.00 0.00 ? 89  ILE A HG13 3  
ATOM 5039  H HG21 . ILE A 1 89  ? -242.933 -23.006 112.231 1.00 0.00 ? 89  ILE A HG21 3  
ATOM 5040  H HG22 . ILE A 1 89  ? -243.815 -22.758 113.737 1.00 0.00 ? 89  ILE A HG22 3  
ATOM 5041  H HG23 . ILE A 1 89  ? -244.340 -21.947 112.261 1.00 0.00 ? 89  ILE A HG23 3  
ATOM 5042  H HD11 . ILE A 1 89  ? -244.249 -21.419 115.373 1.00 0.00 ? 89  ILE A HD11 3  
ATOM 5043  H HD12 . ILE A 1 89  ? -242.718 -20.745 115.932 1.00 0.00 ? 89  ILE A HD12 3  
ATOM 5044  H HD13 . ILE A 1 89  ? -244.172 -19.748 115.932 1.00 0.00 ? 89  ILE A HD13 3  
ATOM 5045  N N    . LEU A 1 90  ? -239.875 -21.716 111.983 1.00 0.00 ? 90  LEU A N    3  
ATOM 5046  C CA   . LEU A 1 90  ? -239.078 -22.364 110.949 1.00 0.00 ? 90  LEU A CA   3  
ATOM 5047  C C    . LEU A 1 90  ? -237.795 -22.957 111.521 1.00 0.00 ? 90  LEU A C    3  
ATOM 5048  O O    . LEU A 1 90  ? -237.327 -23.997 111.059 1.00 0.00 ? 90  LEU A O    3  
ATOM 5049  C CB   . LEU A 1 90  ? -238.765 -21.352 109.848 1.00 0.00 ? 90  LEU A CB   3  
ATOM 5050  C CG   . LEU A 1 90  ? -239.999 -20.799 109.128 1.00 0.00 ? 90  LEU A CG   3  
ATOM 5051  C CD1  . LEU A 1 90  ? -239.678 -19.472 108.463 1.00 0.00 ? 90  LEU A CD1  3  
ATOM 5052  C CD2  . LEU A 1 90  ? -240.509 -21.797 108.098 1.00 0.00 ? 90  LEU A CD2  3  
ATOM 5053  H H    . LEU A 1 90  ? -239.999 -20.741 111.941 1.00 0.00 ? 90  LEU A H    3  
ATOM 5054  H HA   . LEU A 1 90  ? -239.670 -23.163 110.529 1.00 0.00 ? 90  LEU A HA   3  
ATOM 5055  H HB2  . LEU A 1 90  ? -238.224 -20.526 110.286 1.00 0.00 ? 90  LEU A HB2  3  
ATOM 5056  H HB3  . LEU A 1 90  ? -238.131 -21.829 109.115 1.00 0.00 ? 90  LEU A HB3  3  
ATOM 5057  H HG   . LEU A 1 90  ? -240.785 -20.630 109.851 1.00 0.00 ? 90  LEU A HG   3  
ATOM 5058  H HD11 . LEU A 1 90  ? -238.864 -19.605 107.767 1.00 0.00 ? 90  LEU A HD11 3  
ATOM 5059  H HD12 . LEU A 1 90  ? -240.550 -19.116 107.936 1.00 0.00 ? 90  LEU A HD12 3  
ATOM 5060  H HD13 . LEU A 1 90  ? -239.395 -18.754 109.219 1.00 0.00 ? 90  LEU A HD13 3  
ATOM 5061  H HD21 . LEU A 1 90  ? -239.716 -22.033 107.402 1.00 0.00 ? 90  LEU A HD21 3  
ATOM 5062  H HD22 . LEU A 1 90  ? -240.831 -22.700 108.597 1.00 0.00 ? 90  LEU A HD22 3  
ATOM 5063  H HD23 . LEU A 1 90  ? -241.341 -21.368 107.560 1.00 0.00 ? 90  LEU A HD23 3  
ATOM 5064  N N    . SER A 1 91  ? -237.232 -22.307 112.532 1.00 0.00 ? 91  SER A N    3  
ATOM 5065  C CA   . SER A 1 91  ? -236.038 -22.825 113.185 1.00 0.00 ? 91  SER A CA   3  
ATOM 5066  C C    . SER A 1 91  ? -236.368 -24.058 114.025 1.00 0.00 ? 91  SER A C    3  
ATOM 5067  O O    . SER A 1 91  ? -235.507 -24.902 114.269 1.00 0.00 ? 91  SER A O    3  
ATOM 5068  C CB   . SER A 1 91  ? -235.391 -21.751 114.062 1.00 0.00 ? 91  SER A CB   3  
ATOM 5069  O OG   . SER A 1 91  ? -234.963 -20.644 113.285 1.00 0.00 ? 91  SER A OG   3  
ATOM 5070  H H    . SER A 1 91  ? -237.618 -21.459 112.835 1.00 0.00 ? 91  SER A H    3  
ATOM 5071  H HA   . SER A 1 91  ? -235.340 -23.113 112.414 1.00 0.00 ? 91  SER A HA   3  
ATOM 5072  H HB2  . SER A 1 91  ? -236.109 -21.406 114.792 1.00 0.00 ? 91  SER A HB2  3  
ATOM 5073  H HB3  . SER A 1 91  ? -234.536 -22.173 114.571 1.00 0.00 ? 91  SER A HB3  3  
ATOM 5074  H HG   . SER A 1 91  ? -235.701 -20.031 113.170 1.00 0.00 ? 91  SER A HG   3  
ATOM 5075  N N    . SER A 1 92  ? -237.617 -24.156 114.460 1.00 0.00 ? 92  SER A N    3  
ATOM 5076  C CA   . SER A 1 92  ? -238.059 -25.306 115.230 1.00 0.00 ? 92  SER A CA   3  
ATOM 5077  C C    . SER A 1 92  ? -238.326 -26.488 114.302 1.00 0.00 ? 92  SER A C    3  
ATOM 5078  O O    . SER A 1 92  ? -238.022 -27.633 114.646 1.00 0.00 ? 92  SER A O    3  
ATOM 5079  C CB   . SER A 1 92  ? -239.310 -24.955 116.035 1.00 0.00 ? 92  SER A CB   3  
ATOM 5080  O OG   . SER A 1 92  ? -239.042 -23.903 116.954 1.00 0.00 ? 92  SER A OG   3  
ATOM 5081  H H    . SER A 1 92  ? -238.257 -23.446 114.250 1.00 0.00 ? 92  SER A H    3  
ATOM 5082  H HA   . SER A 1 92  ? -237.266 -25.572 115.911 1.00 0.00 ? 92  SER A HA   3  
ATOM 5083  H HB2  . SER A 1 92  ? -240.093 -24.637 115.362 1.00 0.00 ? 92  SER A HB2  3  
ATOM 5084  H HB3  . SER A 1 92  ? -239.638 -25.823 116.587 1.00 0.00 ? 92  SER A HB3  3  
ATOM 5085  H HG   . SER A 1 92  ? -239.100 -23.051 116.494 1.00 0.00 ? 92  SER A HG   3  
ATOM 5086  N N    . TRP A 1 93  ? -238.894 -26.184 113.130 1.00 0.00 ? 93  TRP A N    3  
ATOM 5087  C CA   . TRP A 1 93  ? -239.110 -27.159 112.053 1.00 0.00 ? 93  TRP A CA   3  
ATOM 5088  C C    . TRP A 1 93  ? -240.223 -28.163 112.382 1.00 0.00 ? 93  TRP A C    3  
ATOM 5089  O O    . TRP A 1 93  ? -241.200 -28.276 111.644 1.00 0.00 ? 93  TRP A O    3  
ATOM 5090  C CB   . TRP A 1 93  ? -237.802 -27.891 111.721 1.00 0.00 ? 93  TRP A CB   3  
ATOM 5091  C CG   . TRP A 1 93  ? -237.937 -28.925 110.641 1.00 0.00 ? 93  TRP A CG   3  
ATOM 5092  C CD1  . TRP A 1 93  ? -237.974 -30.279 110.807 1.00 0.00 ? 93  TRP A CD1  3  
ATOM 5093  C CD2  . TRP A 1 93  ? -238.056 -28.693 109.231 1.00 0.00 ? 93  TRP A CD2  3  
ATOM 5094  N NE1  . TRP A 1 93  ? -238.103 -30.903 109.591 1.00 0.00 ? 93  TRP A NE1  3  
ATOM 5095  C CE2  . TRP A 1 93  ? -238.160 -29.952 108.608 1.00 0.00 ? 93  TRP A CE2  3  
ATOM 5096  C CE3  . TRP A 1 93  ? -238.087 -27.544 108.436 1.00 0.00 ? 93  TRP A CE3  3  
ATOM 5097  C CZ2  . TRP A 1 93  ? -238.288 -30.091 107.228 1.00 0.00 ? 93  TRP A CZ2  3  
ATOM 5098  C CZ3  . TRP A 1 93  ? -238.217 -27.685 107.068 1.00 0.00 ? 93  TRP A CZ3  3  
ATOM 5099  C CH2  . TRP A 1 93  ? -238.318 -28.949 106.475 1.00 0.00 ? 93  TRP A CH2  3  
ATOM 5100  H H    . TRP A 1 93  ? -239.187 -25.258 112.981 1.00 0.00 ? 93  TRP A H    3  
ATOM 5101  H HA   . TRP A 1 93  ? -239.417 -26.602 111.181 1.00 0.00 ? 93  TRP A HA   3  
ATOM 5102  H HB2  . TRP A 1 93  ? -237.067 -27.170 111.397 1.00 0.00 ? 93  TRP A HB2  3  
ATOM 5103  H HB3  . TRP A 1 93  ? -237.442 -28.385 112.611 1.00 0.00 ? 93  TRP A HB3  3  
ATOM 5104  H HD1  . TRP A 1 93  ? -237.904 -30.776 111.763 1.00 0.00 ? 93  TRP A HD1  3  
ATOM 5105  H HE1  . TRP A 1 93  ? -238.145 -31.876 109.451 1.00 0.00 ? 93  TRP A HE1  3  
ATOM 5106  H HE3  . TRP A 1 93  ? -238.012 -26.560 108.875 1.00 0.00 ? 93  TRP A HE3  3  
ATOM 5107  H HZ2  . TRP A 1 93  ? -238.369 -31.060 106.757 1.00 0.00 ? 93  TRP A HZ2  3  
ATOM 5108  H HZ3  . TRP A 1 93  ? -238.245 -26.808 106.439 1.00 0.00 ? 93  TRP A HZ3  3  
ATOM 5109  H HH2  . TRP A 1 93  ? -238.419 -29.010 105.403 1.00 0.00 ? 93  TRP A HH2  3  
ATOM 5110  N N    . PHE A 1 94  ? -240.067 -28.880 113.483 1.00 0.00 ? 94  PHE A N    3  
ATOM 5111  C CA   . PHE A 1 94  ? -240.984 -29.953 113.843 1.00 0.00 ? 94  PHE A CA   3  
ATOM 5112  C C    . PHE A 1 94  ? -242.312 -29.398 114.354 1.00 0.00 ? 94  PHE A C    3  
ATOM 5113  O O    . PHE A 1 94  ? -242.356 -28.680 115.359 1.00 0.00 ? 94  PHE A O    3  
ATOM 5114  C CB   . PHE A 1 94  ? -240.347 -30.854 114.902 1.00 0.00 ? 94  PHE A CB   3  
ATOM 5115  C CG   . PHE A 1 94  ? -239.004 -31.389 114.489 1.00 0.00 ? 94  PHE A CG   3  
ATOM 5116  C CD1  . PHE A 1 94  ? -238.910 -32.431 113.581 1.00 0.00 ? 94  PHE A CD1  3  
ATOM 5117  C CD2  . PHE A 1 94  ? -237.838 -30.840 114.998 1.00 0.00 ? 94  PHE A CD2  3  
ATOM 5118  C CE1  . PHE A 1 94  ? -237.678 -32.914 113.189 1.00 0.00 ? 94  PHE A CE1  3  
ATOM 5119  C CE2  . PHE A 1 94  ? -236.604 -31.320 114.608 1.00 0.00 ? 94  PHE A CE2  3  
ATOM 5120  C CZ   . PHE A 1 94  ? -236.523 -32.359 113.703 1.00 0.00 ? 94  PHE A CZ   3  
ATOM 5121  H H    . PHE A 1 94  ? -239.312 -28.679 114.078 1.00 0.00 ? 94  PHE A H    3  
ATOM 5122  H HA   . PHE A 1 94  ? -241.173 -30.537 112.954 1.00 0.00 ? 94  PHE A HA   3  
ATOM 5123  H HB2  . PHE A 1 94  ? -240.215 -30.289 115.812 1.00 0.00 ? 94  PHE A HB2  3  
ATOM 5124  H HB3  . PHE A 1 94  ? -240.998 -31.693 115.094 1.00 0.00 ? 94  PHE A HB3  3  
ATOM 5125  H HD1  . PHE A 1 94  ? -239.814 -32.867 113.179 1.00 0.00 ? 94  PHE A HD1  3  
ATOM 5126  H HD2  . PHE A 1 94  ? -237.901 -30.029 115.708 1.00 0.00 ? 94  PHE A HD2  3  
ATOM 5127  H HE1  . PHE A 1 94  ? -237.618 -33.728 112.482 1.00 0.00 ? 94  PHE A HE1  3  
ATOM 5128  H HE2  . PHE A 1 94  ? -235.701 -30.881 115.012 1.00 0.00 ? 94  PHE A HE2  3  
ATOM 5129  H HZ   . PHE A 1 94  ? -235.559 -32.736 113.395 1.00 0.00 ? 94  PHE A HZ   3  
ATOM 5130  N N    . PRO A 1 95  ? -243.409 -29.713 113.651 1.00 0.00 ? 95  PRO A N    3  
ATOM 5131  C CA   . PRO A 1 95  ? -244.749 -29.313 114.034 1.00 0.00 ? 95  PRO A CA   3  
ATOM 5132  C C    . PRO A 1 95  ? -245.428 -30.360 114.915 1.00 0.00 ? 95  PRO A C    3  
ATOM 5133  O O    . PRO A 1 95  ? -244.776 -31.270 115.432 1.00 0.00 ? 95  PRO A O    3  
ATOM 5134  C CB   . PRO A 1 95  ? -245.472 -29.189 112.687 1.00 0.00 ? 95  PRO A CB   3  
ATOM 5135  C CG   . PRO A 1 95  ? -244.672 -29.993 111.702 1.00 0.00 ? 95  PRO A CG   3  
ATOM 5136  C CD   . PRO A 1 95  ? -243.431 -30.489 112.407 1.00 0.00 ? 95  PRO A CD   3  
ATOM 5137  H HA   . PRO A 1 95  ? -244.753 -28.357 114.539 1.00 0.00 ? 95  PRO A HA   3  
ATOM 5138  H HB2  . PRO A 1 95  ? -246.473 -29.579 112.783 1.00 0.00 ? 95  PRO A HB2  3  
ATOM 5139  H HB3  . PRO A 1 95  ? -245.516 -28.150 112.397 1.00 0.00 ? 95  PRO A HB3  3  
ATOM 5140  H HG2  . PRO A 1 95  ? -245.256 -30.832 111.361 1.00 0.00 ? 95  PRO A HG2  3  
ATOM 5141  H HG3  . PRO A 1 95  ? -244.396 -29.369 110.864 1.00 0.00 ? 95  PRO A HG3  3  
ATOM 5142  H HD2  . PRO A 1 95  ? -243.510 -31.543 112.616 1.00 0.00 ? 95  PRO A HD2  3  
ATOM 5143  H HD3  . PRO A 1 95  ? -242.551 -30.286 111.812 1.00 0.00 ? 95  PRO A HD3  3  
ATOM 5144  N N    . GLU A 1 96  ? -246.735 -30.233 115.082 1.00 0.00 ? 96  GLU A N    3  
ATOM 5145  C CA   . GLU A 1 96  ? -247.497 -31.154 115.913 1.00 0.00 ? 96  GLU A CA   3  
ATOM 5146  C C    . GLU A 1 96  ? -247.815 -32.424 115.136 1.00 0.00 ? 96  GLU A C    3  
ATOM 5147  O O    . GLU A 1 96  ? -247.907 -33.512 115.701 1.00 0.00 ? 96  GLU A O    3  
ATOM 5148  C CB   . GLU A 1 96  ? -248.804 -30.504 116.380 1.00 0.00 ? 96  GLU A CB   3  
ATOM 5149  C CG   . GLU A 1 96  ? -248.688 -29.015 116.682 1.00 0.00 ? 96  GLU A CG   3  
ATOM 5150  C CD   . GLU A 1 96  ? -248.996 -28.141 115.478 1.00 0.00 ? 96  GLU A CD   3  
ATOM 5151  O OE1  . GLU A 1 96  ? -248.561 -28.479 114.356 1.00 0.00 ? 96  GLU A OE1  3  
ATOM 5152  O OE2  . GLU A 1 96  ? -249.700 -27.125 115.643 1.00 0.00 ? 96  GLU A OE2  3  
ATOM 5153  H H    . GLU A 1 96  ? -247.209 -29.488 114.636 1.00 0.00 ? 96  GLU A H    3  
ATOM 5154  H HA   . GLU A 1 96  ? -246.899 -31.408 116.774 1.00 0.00 ? 96  GLU A HA   3  
ATOM 5155  H HB2  . GLU A 1 96  ? -249.551 -30.632 115.610 1.00 0.00 ? 96  GLU A HB2  3  
ATOM 5156  H HB3  . GLU A 1 96  ? -249.140 -31.004 117.276 1.00 0.00 ? 96  GLU A HB3  3  
ATOM 5157  H HG2  . GLU A 1 96  ? -249.379 -28.765 117.474 1.00 0.00 ? 96  GLU A HG2  3  
ATOM 5158  H HG3  . GLU A 1 96  ? -247.680 -28.806 117.010 1.00 0.00 ? 96  GLU A HG3  3  
ATOM 5159  N N    . GLU A 1 97  ? -247.969 -32.270 113.832 1.00 0.00 ? 97  GLU A N    3  
ATOM 5160  C CA   . GLU A 1 97  ? -248.336 -33.378 112.967 1.00 0.00 ? 97  GLU A CA   3  
ATOM 5161  C C    . GLU A 1 97  ? -247.319 -33.559 111.842 1.00 0.00 ? 97  GLU A C    3  
ATOM 5162  O O    . GLU A 1 97  ? -246.225 -32.994 111.887 1.00 0.00 ? 97  GLU A O    3  
ATOM 5163  C CB   . GLU A 1 97  ? -249.733 -33.145 112.389 1.00 0.00 ? 97  GLU A CB   3  
ATOM 5164  C CG   . GLU A 1 97  ? -250.795 -34.064 112.976 1.00 0.00 ? 97  GLU A CG   3  
ATOM 5165  C CD   . GLU A 1 97  ? -250.511 -35.526 112.696 1.00 0.00 ? 97  GLU A CD   3  
ATOM 5166  O OE1  . GLU A 1 97  ? -249.860 -35.823 111.672 1.00 0.00 ? 97  GLU A OE1  3  
ATOM 5167  O OE2  . GLU A 1 97  ? -250.934 -36.389 113.493 1.00 0.00 ? 97  GLU A OE2  3  
ATOM 5168  H H    . GLU A 1 97  ? -247.824 -31.386 113.438 1.00 0.00 ? 97  GLU A H    3  
ATOM 5169  H HA   . GLU A 1 97  ? -248.351 -34.274 113.569 1.00 0.00 ? 97  GLU A HA   3  
ATOM 5170  H HB2  . GLU A 1 97  ? -250.025 -32.124 112.586 1.00 0.00 ? 97  GLU A HB2  3  
ATOM 5171  H HB3  . GLU A 1 97  ? -249.703 -33.301 111.320 1.00 0.00 ? 97  GLU A HB3  3  
ATOM 5172  H HG2  . GLU A 1 97  ? -250.829 -33.919 114.045 1.00 0.00 ? 97  GLU A HG2  3  
ATOM 5173  H HG3  . GLU A 1 97  ? -251.753 -33.810 112.548 1.00 0.00 ? 97  GLU A HG3  3  
ATOM 5174  N N    . GLY A 1 98  ? -247.692 -34.363 110.851 1.00 0.00 ? 98  GLY A N    3  
ATOM 5175  C CA   . GLY A 1 98  ? -246.816 -34.648 109.727 1.00 0.00 ? 98  GLY A CA   3  
ATOM 5176  C C    . GLY A 1 98  ? -246.436 -33.414 108.923 1.00 0.00 ? 98  GLY A C    3  
ATOM 5177  O O    . GLY A 1 98  ? -245.368 -32.838 109.130 1.00 0.00 ? 98  GLY A O    3  
ATOM 5178  H H    . GLY A 1 98  ? -248.580 -34.793 110.898 1.00 0.00 ? 98  GLY A H    3  
ATOM 5179  H HA2  . GLY A 1 98  ? -245.913 -35.107 110.101 1.00 0.00 ? 98  GLY A HA2  3  
ATOM 5180  H HA3  . GLY A 1 98  ? -247.312 -35.350 109.072 1.00 0.00 ? 98  GLY A HA3  3  
ATOM 5181  N N    . TYR A 1 99  ? -247.300 -33.013 107.999 1.00 0.00 ? 99  TYR A N    3  
ATOM 5182  C CA   . TYR A 1 99  ? -246.995 -31.891 107.114 1.00 0.00 ? 99  TYR A CA   3  
ATOM 5183  C C    . TYR A 1 99  ? -248.216 -31.004 106.899 1.00 0.00 ? 99  TYR A C    3  
ATOM 5184  O O    . TYR A 1 99  ? -248.251 -30.186 105.978 1.00 0.00 ? 99  TYR A O    3  
ATOM 5185  C CB   . TYR A 1 99  ? -246.465 -32.403 105.766 1.00 0.00 ? 99  TYR A CB   3  
ATOM 5186  C CG   . TYR A 1 99  ? -247.375 -33.399 105.068 1.00 0.00 ? 99  TYR A CG   3  
ATOM 5187  C CD1  . TYR A 1 99  ? -247.273 -34.761 105.328 1.00 0.00 ? 99  TYR A CD1  3  
ATOM 5188  C CD2  . TYR A 1 99  ? -248.324 -32.979 104.144 1.00 0.00 ? 99  TYR A CD2  3  
ATOM 5189  C CE1  . TYR A 1 99  ? -248.092 -35.673 104.691 1.00 0.00 ? 99  TYR A CE1  3  
ATOM 5190  C CE2  . TYR A 1 99  ? -249.145 -33.885 103.502 1.00 0.00 ? 99  TYR A CE2  3  
ATOM 5191  C CZ   . TYR A 1 99  ? -249.026 -35.231 103.779 1.00 0.00 ? 99  TYR A CZ   3  
ATOM 5192  O OH   . TYR A 1 99  ? -249.837 -36.134 103.136 1.00 0.00 ? 99  TYR A OH   3  
ATOM 5193  H H    . TYR A 1 99  ? -248.158 -33.482 107.901 1.00 0.00 ? 99  TYR A H    3  
ATOM 5194  H HA   . TYR A 1 99  ? -246.223 -31.302 107.587 1.00 0.00 ? 99  TYR A HA   3  
ATOM 5195  H HB2  . TYR A 1 99  ? -246.329 -31.562 105.100 1.00 0.00 ? 99  TYR A HB2  3  
ATOM 5196  H HB3  . TYR A 1 99  ? -245.511 -32.882 105.925 1.00 0.00 ? 99  TYR A HB3  3  
ATOM 5197  H HD1  . TYR A 1 99  ? -246.541 -35.106 106.042 1.00 0.00 ? 99  TYR A HD1  3  
ATOM 5198  H HD2  . TYR A 1 99  ? -248.418 -31.925 103.929 1.00 0.00 ? 99  TYR A HD2  3  
ATOM 5199  H HE1  . TYR A 1 99  ? -247.998 -36.729 104.907 1.00 0.00 ? 99  TYR A HE1  3  
ATOM 5200  H HE2  . TYR A 1 99  ? -249.876 -33.539 102.785 1.00 0.00 ? 99  TYR A HE2  3  
ATOM 5201  H HH   . TYR A 1 99  ? -249.852 -35.930 102.186 1.00 0.00 ? 99  TYR A HH   3  
ATOM 5202  N N    . MET A 1 100 ? -249.212 -31.151 107.756 1.00 0.00 ? 100 MET A N    3  
ATOM 5203  C CA   . MET A 1 100 ? -250.439 -30.385 107.613 1.00 0.00 ? 100 MET A CA   3  
ATOM 5204  C C    . MET A 1 100 ? -250.324 -29.030 108.302 1.00 0.00 ? 100 MET A C    3  
ATOM 5205  O O    . MET A 1 100 ? -250.755 -28.860 109.445 1.00 0.00 ? 100 MET A O    3  
ATOM 5206  C CB   . MET A 1 100 ? -251.640 -31.161 108.159 1.00 0.00 ? 100 MET A CB   3  
ATOM 5207  C CG   . MET A 1 100 ? -251.957 -32.422 107.371 1.00 0.00 ? 100 MET A CG   3  
ATOM 5208  S SD   . MET A 1 100 ? -250.774 -33.754 107.656 1.00 0.00 ? 100 MET A SD   3  
ATOM 5209  C CE   . MET A 1 100 ? -251.278 -34.302 109.286 1.00 0.00 ? 100 MET A CE   3  
ATOM 5210  H H    . MET A 1 100 ? -249.120 -31.783 108.498 1.00 0.00 ? 100 MET A H    3  
ATOM 5211  H HA   . MET A 1 100 ? -250.590 -30.216 106.557 1.00 0.00 ? 100 MET A HA   3  
ATOM 5212  H HB2  . MET A 1 100 ? -251.436 -31.443 109.181 1.00 0.00 ? 100 MET A HB2  3  
ATOM 5213  H HB3  . MET A 1 100 ? -252.511 -30.521 108.138 1.00 0.00 ? 100 MET A HB3  3  
ATOM 5214  H HG2  . MET A 1 100 ? -252.938 -32.772 107.656 1.00 0.00 ? 100 MET A HG2  3  
ATOM 5215  H HG3  . MET A 1 100 ? -251.958 -32.181 106.317 1.00 0.00 ? 100 MET A HG3  3  
ATOM 5216  H HE1  . MET A 1 100 ? -251.194 -33.482 109.984 1.00 0.00 ? 100 MET A HE1  3  
ATOM 5217  H HE2  . MET A 1 100 ? -252.301 -34.643 109.250 1.00 0.00 ? 100 MET A HE2  3  
ATOM 5218  H HE3  . MET A 1 100 ? -250.640 -35.114 109.609 1.00 0.00 ? 100 MET A HE3  3  
ATOM 5219  N N    . GLY A 1 101 ? -249.706 -28.084 107.609 1.00 0.00 ? 101 GLY A N    3  
ATOM 5220  C CA   . GLY A 1 101 ? -249.573 -26.737 108.126 1.00 0.00 ? 101 GLY A CA   3  
ATOM 5221  C C    . GLY A 1 101 ? -249.192 -25.755 107.037 1.00 0.00 ? 101 GLY A C    3  
ATOM 5222  O O    . GLY A 1 101 ? -248.423 -26.093 106.137 1.00 0.00 ? 101 GLY A O    3  
ATOM 5223  H H    . GLY A 1 101 ? -249.317 -28.308 106.735 1.00 0.00 ? 101 GLY A H    3  
ATOM 5224  H HA2  . GLY A 1 101 ? -250.512 -26.432 108.563 1.00 0.00 ? 101 GLY A HA2  3  
ATOM 5225  H HA3  . GLY A 1 101 ? -248.812 -26.728 108.890 1.00 0.00 ? 101 GLY A HA3  3  
ATOM 5226  N N    . ARG A 1 102 ? -249.763 -24.556 107.095 1.00 0.00 ? 102 ARG A N    3  
ATOM 5227  C CA   . ARG A 1 102 ? -249.435 -23.485 106.153 1.00 0.00 ? 102 ARG A CA   3  
ATOM 5228  C C    . ARG A 1 102 ? -249.999 -22.162 106.653 1.00 0.00 ? 102 ARG A C    3  
ATOM 5229  O O    . ARG A 1 102 ? -251.018 -22.142 107.342 1.00 0.00 ? 102 ARG A O    3  
ATOM 5230  C CB   . ARG A 1 102 ? -249.941 -23.783 104.727 1.00 0.00 ? 102 ARG A CB   3  
ATOM 5231  C CG   . ARG A 1 102 ? -251.443 -24.024 104.594 1.00 0.00 ? 102 ARG A CG   3  
ATOM 5232  C CD   . ARG A 1 102 ? -251.834 -25.440 104.997 1.00 0.00 ? 102 ARG A CD   3  
ATOM 5233  N NE   . ARG A 1 102 ? -250.982 -26.449 104.362 1.00 0.00 ? 102 ARG A NE   3  
ATOM 5234  C CZ   . ARG A 1 102 ? -251.422 -27.387 103.520 1.00 0.00 ? 102 ARG A CZ   3  
ATOM 5235  N NH1  . ARG A 1 102 ? -252.703 -27.434 103.176 1.00 0.00 ? 102 ARG A NH1  3  
ATOM 5236  N NH2  . ARG A 1 102 ? -250.570 -28.277 103.018 1.00 0.00 ? 102 ARG A NH2  3  
ATOM 5237  H H    . ARG A 1 102 ? -250.420 -24.378 107.802 1.00 0.00 ? 102 ARG A H    3  
ATOM 5238  H HA   . ARG A 1 102 ? -248.356 -23.405 106.128 1.00 0.00 ? 102 ARG A HA   3  
ATOM 5239  H HB2  . ARG A 1 102 ? -249.681 -22.950 104.092 1.00 0.00 ? 102 ARG A HB2  3  
ATOM 5240  H HB3  . ARG A 1 102 ? -249.429 -24.664 104.364 1.00 0.00 ? 102 ARG A HB3  3  
ATOM 5241  H HG2  . ARG A 1 102 ? -251.964 -23.326 105.232 1.00 0.00 ? 102 ARG A HG2  3  
ATOM 5242  H HG3  . ARG A 1 102 ? -251.733 -23.858 103.567 1.00 0.00 ? 102 ARG A HG3  3  
ATOM 5243  H HD2  . ARG A 1 102 ? -251.743 -25.534 106.069 1.00 0.00 ? 102 ARG A HD2  3  
ATOM 5244  H HD3  . ARG A 1 102 ? -252.861 -25.614 104.708 1.00 0.00 ? 102 ARG A HD3  3  
ATOM 5245  H HE   . ARG A 1 102 ? -250.025 -26.431 104.590 1.00 0.00 ? 102 ARG A HE   3  
ATOM 5246  H HH11 . ARG A 1 102 ? -253.355 -26.759 103.549 1.00 0.00 ? 102 ARG A HH11 3  
ATOM 5247  H HH12 . ARG A 1 102 ? -253.032 -28.140 102.533 1.00 0.00 ? 102 ARG A HH12 3  
ATOM 5248  H HH21 . ARG A 1 102 ? -249.604 -28.246 103.274 1.00 0.00 ? 102 ARG A HH21 3  
ATOM 5249  H HH22 . ARG A 1 102 ? -250.892 -28.985 102.370 1.00 0.00 ? 102 ARG A HH22 3  
ATOM 5250  N N    . ILE A 1 103 ? -249.334 -21.067 106.298 1.00 0.00 ? 103 ILE A N    3  
ATOM 5251  C CA   . ILE A 1 103 ? -249.700 -19.750 106.810 1.00 0.00 ? 103 ILE A CA   3  
ATOM 5252  C C    . ILE A 1 103 ? -250.817 -19.106 106.002 1.00 0.00 ? 103 ILE A C    3  
ATOM 5253  O O    . ILE A 1 103 ? -250.717 -18.964 104.787 1.00 0.00 ? 103 ILE A O    3  
ATOM 5254  C CB   . ILE A 1 103 ? -248.501 -18.780 106.807 1.00 0.00 ? 103 ILE A CB   3  
ATOM 5255  C CG1  . ILE A 1 103 ? -247.353 -19.340 107.655 1.00 0.00 ? 103 ILE A CG1  3  
ATOM 5256  C CG2  . ILE A 1 103 ? -248.926 -17.411 107.318 1.00 0.00 ? 103 ILE A CG2  3  
ATOM 5257  C CD1  . ILE A 1 103 ? -246.186 -18.387 107.804 1.00 0.00 ? 103 ILE A CD1  3  
ATOM 5258  H H    . ILE A 1 103 ? -248.577 -21.145 105.682 1.00 0.00 ? 103 ILE A H    3  
ATOM 5259  H HA   . ILE A 1 103 ? -250.032 -19.872 107.829 1.00 0.00 ? 103 ILE A HA   3  
ATOM 5260  H HB   . ILE A 1 103 ? -248.169 -18.663 105.785 1.00 0.00 ? 103 ILE A HB   3  
ATOM 5261  H HG12 . ILE A 1 103 ? -247.722 -19.566 108.644 1.00 0.00 ? 103 ILE A HG12 3  
ATOM 5262  H HG13 . ILE A 1 103 ? -246.984 -20.246 107.198 1.00 0.00 ? 103 ILE A HG13 3  
ATOM 5263  H HG21 . ILE A 1 103 ? -249.718 -17.024 106.694 1.00 0.00 ? 103 ILE A HG21 3  
ATOM 5264  H HG22 . ILE A 1 103 ? -249.279 -17.501 108.335 1.00 0.00 ? 103 ILE A HG22 3  
ATOM 5265  H HG23 . ILE A 1 103 ? -248.081 -16.739 107.289 1.00 0.00 ? 103 ILE A HG23 3  
ATOM 5266  H HD11 . ILE A 1 103 ? -246.533 -17.464 108.251 1.00 0.00 ? 103 ILE A HD11 3  
ATOM 5267  H HD12 . ILE A 1 103 ? -245.434 -18.834 108.439 1.00 0.00 ? 103 ILE A HD12 3  
ATOM 5268  H HD13 . ILE A 1 103 ? -245.765 -18.180 106.833 1.00 0.00 ? 103 ILE A HD13 3  
ATOM 5269  N N    . VAL A 1 104 ? -251.860 -18.689 106.698 1.00 0.00 ? 104 VAL A N    3  
ATOM 5270  C CA   . VAL A 1 104 ? -252.920 -17.910 106.113 1.00 0.00 ? 104 VAL A CA   3  
ATOM 5271  C C    . VAL A 1 104 ? -252.899 -16.535 106.717 1.00 0.00 ? 104 VAL A C    3  
ATOM 5272  O O    . VAL A 1 104 ? -252.986 -16.380 107.936 1.00 0.00 ? 104 VAL A O    3  
ATOM 5273  C CB   . VAL A 1 104 ? -254.312 -18.525 106.349 1.00 0.00 ? 104 VAL A CB   3  
ATOM 5274  C CG1  . VAL A 1 104 ? -254.639 -19.546 105.275 1.00 0.00 ? 104 VAL A CG1  3  
ATOM 5275  C CG2  . VAL A 1 104 ? -254.397 -19.138 107.724 1.00 0.00 ? 104 VAL A CG2  3  
ATOM 5276  H H    . VAL A 1 104 ? -251.905 -18.887 107.656 1.00 0.00 ? 104 VAL A H    3  
ATOM 5277  H HA   . VAL A 1 104 ? -252.746 -17.837 105.048 1.00 0.00 ? 104 VAL A HA   3  
ATOM 5278  H HB   . VAL A 1 104 ? -255.043 -17.736 106.312 1.00 0.00 ? 104 VAL A HB   3  
ATOM 5279  H HG11 . VAL A 1 104 ? -253.891 -20.326 105.281 1.00 0.00 ? 104 VAL A HG11 3  
ATOM 5280  H HG12 . VAL A 1 104 ? -255.611 -19.975 105.471 1.00 0.00 ? 104 VAL A HG12 3  
ATOM 5281  H HG13 . VAL A 1 104 ? -254.648 -19.065 104.310 1.00 0.00 ? 104 VAL A HG13 3  
ATOM 5282  H HG21 . VAL A 1 104 ? -253.561 -19.803 107.875 1.00 0.00 ? 104 VAL A HG21 3  
ATOM 5283  H HG22 . VAL A 1 104 ? -254.382 -18.347 108.461 1.00 0.00 ? 104 VAL A HG22 3  
ATOM 5284  H HG23 . VAL A 1 104 ? -255.322 -19.688 107.809 1.00 0.00 ? 104 VAL A HG23 3  
ATOM 5285  N N    . LEU A 1 105 ? -252.738 -15.544 105.882 1.00 0.00 ? 105 LEU A N    3  
ATOM 5286  C CA   . LEU A 1 105 ? -252.876 -14.192 106.338 1.00 0.00 ? 105 LEU A CA   3  
ATOM 5287  C C    . LEU A 1 105 ? -254.358 -13.929 106.537 1.00 0.00 ? 105 LEU A C    3  
ATOM 5288  O O    . LEU A 1 105 ? -255.126 -13.840 105.582 1.00 0.00 ? 105 LEU A O    3  
ATOM 5289  C CB   . LEU A 1 105 ? -252.302 -13.218 105.331 1.00 0.00 ? 105 LEU A CB   3  
ATOM 5290  C CG   . LEU A 1 105 ? -252.001 -11.846 105.899 1.00 0.00 ? 105 LEU A CG   3  
ATOM 5291  C CD1  . LEU A 1 105 ? -251.006 -11.990 107.036 1.00 0.00 ? 105 LEU A CD1  3  
ATOM 5292  C CD2  . LEU A 1 105 ? -251.470 -10.924 104.813 1.00 0.00 ? 105 LEU A CD2  3  
ATOM 5293  H H    . LEU A 1 105 ? -252.539 -15.724 104.944 1.00 0.00 ? 105 LEU A H    3  
ATOM 5294  H HA   . LEU A 1 105 ? -252.346 -14.090 107.289 1.00 0.00 ? 105 LEU A HA   3  
ATOM 5295  H HB2  . LEU A 1 105 ? -251.389 -13.635 104.928 1.00 0.00 ? 105 LEU A HB2  3  
ATOM 5296  H HB3  . LEU A 1 105 ? -253.015 -13.107 104.534 1.00 0.00 ? 105 LEU A HB3  3  
ATOM 5297  H HG   . LEU A 1 105 ? -252.910 -11.416 106.298 1.00 0.00 ? 105 LEU A HG   3  
ATOM 5298  H HD11 . LEU A 1 105 ? -251.412 -12.653 107.787 1.00 0.00 ? 105 LEU A HD11 3  
ATOM 5299  H HD12 . LEU A 1 105 ? -250.083 -12.402 106.656 1.00 0.00 ? 105 LEU A HD12 3  
ATOM 5300  H HD13 . LEU A 1 105 ? -250.817 -11.021 107.476 1.00 0.00 ? 105 LEU A HD13 3  
ATOM 5301  H HD21 . LEU A 1 105 ? -250.563 -11.341 104.400 1.00 0.00 ? 105 LEU A HD21 3  
ATOM 5302  H HD22 . LEU A 1 105 ? -252.207 -10.823 104.032 1.00 0.00 ? 105 LEU A HD22 3  
ATOM 5303  H HD23 . LEU A 1 105 ? -251.259 -9.952  105.236 1.00 0.00 ? 105 LEU A HD23 3  
ATOM 5304  N N    . LYS A 1 106 ? -254.745 -13.853 107.777 1.00 0.00 ? 106 LYS A N    3  
ATOM 5305  C CA   . LYS A 1 106 ? -256.130 -13.724 108.149 1.00 0.00 ? 106 LYS A CA   3  
ATOM 5306  C C    . LYS A 1 106 ? -256.421 -12.291 108.575 1.00 0.00 ? 106 LYS A C    3  
ATOM 5307  O O    . LYS A 1 106 ? -255.545 -11.429 108.522 1.00 0.00 ? 106 LYS A O    3  
ATOM 5308  C CB   . LYS A 1 106 ? -256.455 -14.687 109.290 1.00 0.00 ? 106 LYS A CB   3  
ATOM 5309  C CG   . LYS A 1 106 ? -256.456 -16.149 108.871 1.00 0.00 ? 106 LYS A CG   3  
ATOM 5310  C CD   . LYS A 1 106 ? -257.677 -16.494 108.034 1.00 0.00 ? 106 LYS A CD   3  
ATOM 5311  C CE   . LYS A 1 106 ? -257.700 -17.969 107.671 1.00 0.00 ? 106 LYS A CE   3  
ATOM 5312  N NZ   . LYS A 1 106 ? -258.997 -18.366 107.071 1.00 0.00 ? 106 LYS A NZ   3  
ATOM 5313  H H    . LYS A 1 106 ? -254.059 -13.859 108.475 1.00 0.00 ? 106 LYS A H    3  
ATOM 5314  H HA   . LYS A 1 106 ? -256.729 -13.985 107.292 1.00 0.00 ? 106 LYS A HA   3  
ATOM 5315  H HB2  . LYS A 1 106 ? -255.723 -14.562 110.074 1.00 0.00 ? 106 LYS A HB2  3  
ATOM 5316  H HB3  . LYS A 1 106 ? -257.433 -14.448 109.683 1.00 0.00 ? 106 LYS A HB3  3  
ATOM 5317  H HG2  . LYS A 1 106 ? -255.566 -16.350 108.292 1.00 0.00 ? 106 LYS A HG2  3  
ATOM 5318  H HG3  . LYS A 1 106 ? -256.456 -16.766 109.758 1.00 0.00 ? 106 LYS A HG3  3  
ATOM 5319  H HD2  . LYS A 1 106 ? -258.568 -16.261 108.597 1.00 0.00 ? 106 LYS A HD2  3  
ATOM 5320  H HD3  . LYS A 1 106 ? -257.658 -15.912 107.125 1.00 0.00 ? 106 LYS A HD3  3  
ATOM 5321  H HE2  . LYS A 1 106 ? -256.908 -18.167 106.964 1.00 0.00 ? 106 LYS A HE2  3  
ATOM 5322  H HE3  . LYS A 1 106 ? -257.536 -18.547 108.569 1.00 0.00 ? 106 LYS A HE3  3  
ATOM 5323  H HZ1  . LYS A 1 106 ? -259.192 -17.790 106.224 1.00 0.00 ? 106 LYS A HZ1  3  
ATOM 5324  H HZ2  . LYS A 1 106 ? -258.976 -19.374 106.797 1.00 0.00 ? 106 LYS A HZ2  3  
ATOM 5325  H HZ3  . LYS A 1 106 ? -259.766 -18.221 107.762 1.00 0.00 ? 106 LYS A HZ3  3  
ATOM 5326  N N    . THR A 1 107 ? -257.640 -12.047 109.018 1.00 0.00 ? 107 THR A N    3  
ATOM 5327  C CA   . THR A 1 107 ? -258.033 -10.760 109.503 1.00 0.00 ? 107 THR A CA   3  
ATOM 5328  C C    . THR A 1 107 ? -258.459 -10.940 110.949 1.00 0.00 ? 107 THR A C    3  
ATOM 5329  O O    . THR A 1 107 ? -258.897 -12.021 111.348 1.00 0.00 ? 107 THR A O    3  
ATOM 5330  C CB   . THR A 1 107 ? -259.218 -10.180 108.698 1.00 0.00 ? 107 THR A CB   3  
ATOM 5331  O OG1  . THR A 1 107 ? -260.365 -11.024 108.843 1.00 0.00 ? 107 THR A OG1  3  
ATOM 5332  C CG2  . THR A 1 107 ? -258.875 -10.051 107.222 1.00 0.00 ? 107 THR A CG2  3  
ATOM 5333  H H    . THR A 1 107 ? -258.286 -12.763 109.067 1.00 0.00 ? 107 THR A H    3  
ATOM 5334  H HA   . THR A 1 107 ? -257.181 -10.080 109.432 1.00 0.00 ? 107 THR A HA   3  
ATOM 5335  H HB   . THR A 1 107 ? -259.454 -9.199  109.085 1.00 0.00 ? 107 THR A HB   3  
ATOM 5336  H HG1  . THR A 1 107 ? -260.397 -11.656 108.111 1.00 0.00 ? 107 THR A HG1  3  
ATOM 5337  H HG21 . THR A 1 107 ? -258.624 -11.022 106.825 1.00 0.00 ? 107 THR A HG21 3  
ATOM 5338  H HG22 . THR A 1 107 ? -259.726 -9.653  106.688 1.00 0.00 ? 107 THR A HG22 3  
ATOM 5339  H HG23 . THR A 1 107 ? -258.032 -9.386  107.106 1.00 0.00 ? 107 THR A HG23 3  
ATOM 5340  N N    . GLN A 1 108 ? -258.326 -9.898  111.717 1.00 0.00 ? 108 GLN A N    3  
ATOM 5341  C CA   . GLN A 1 108 ? -258.755 -9.888  113.118 1.00 0.00 ? 108 GLN A CA   3  
ATOM 5342  C C    . GLN A 1 108 ? -260.280 -9.730  113.197 1.00 0.00 ? 108 GLN A C    3  
ATOM 5343  O O    . GLN A 1 108 ? -260.828 -9.237  114.177 1.00 0.00 ? 108 GLN A O    3  
ATOM 5344  C CB   . GLN A 1 108 ? -258.041 -8.745  113.850 1.00 0.00 ? 108 GLN A CB   3  
ATOM 5345  C CG   . GLN A 1 108 ? -257.722 -9.020  115.312 1.00 0.00 ? 108 GLN A CG   3  
ATOM 5346  C CD   . GLN A 1 108 ? -258.833 -8.603  116.262 1.00 0.00 ? 108 GLN A CD   3  
ATOM 5347  O OE1  . GLN A 1 108 ? -259.044 -9.233  117.298 1.00 0.00 ? 108 GLN A OE1  3  
ATOM 5348  N NE2  . GLN A 1 108 ? -259.524 -7.520  115.935 1.00 0.00 ? 108 GLN A NE2  3  
ATOM 5349  H H    . GLN A 1 108 ? -257.901 -9.116  111.341 1.00 0.00 ? 108 GLN A H    3  
ATOM 5350  H HA   . GLN A 1 108 ? -258.475 -10.831 113.563 1.00 0.00 ? 108 GLN A HA   3  
ATOM 5351  H HB2  . GLN A 1 108 ? -257.112 -8.536  113.340 1.00 0.00 ? 108 GLN A HB2  3  
ATOM 5352  H HB3  . GLN A 1 108 ? -258.666 -7.867  113.802 1.00 0.00 ? 108 GLN A HB3  3  
ATOM 5353  H HG2  . GLN A 1 108 ? -257.546 -10.078 115.435 1.00 0.00 ? 108 GLN A HG2  3  
ATOM 5354  H HG3  . GLN A 1 108 ? -256.824 -8.475  115.571 1.00 0.00 ? 108 GLN A HG3  3  
ATOM 5355  H HE21 . GLN A 1 108 ? -259.283 -7.048  115.109 1.00 0.00 ? 108 GLN A HE21 3  
ATOM 5356  H HE22 . GLN A 1 108 ? -260.253 -7.241  116.526 1.00 0.00 ? 108 GLN A HE22 3  
ATOM 5357  N N    . GLN A 1 109 ? -260.959 -10.186 112.161 1.00 0.00 ? 109 GLN A N    3  
ATOM 5358  C CA   . GLN A 1 109 ? -262.387 -10.030 112.045 1.00 0.00 ? 109 GLN A CA   3  
ATOM 5359  C C    . GLN A 1 109 ? -263.044 -11.391 111.834 1.00 0.00 ? 109 GLN A C    3  
ATOM 5360  O O    . GLN A 1 109 ? -262.404 -12.334 111.364 1.00 0.00 ? 109 GLN A O    3  
ATOM 5361  C CB   . GLN A 1 109 ? -262.685 -9.065  110.892 1.00 0.00 ? 109 GLN A CB   3  
ATOM 5362  C CG   . GLN A 1 109 ? -263.937 -9.389  110.103 1.00 0.00 ? 109 GLN A CG   3  
ATOM 5363  C CD   . GLN A 1 109 ? -264.198 -8.402  108.983 1.00 0.00 ? 109 GLN A CD   3  
ATOM 5364  O OE1  . GLN A 1 109 ? -264.765 -8.757  107.948 1.00 0.00 ? 109 GLN A OE1  3  
ATOM 5365  N NE2  . GLN A 1 109 ? -263.795 -7.156  109.178 1.00 0.00 ? 109 GLN A NE2  3  
ATOM 5366  H H    . GLN A 1 109 ? -260.482 -10.666 111.451 1.00 0.00 ? 109 GLN A H    3  
ATOM 5367  H HA   . GLN A 1 109 ? -262.750 -9.604  112.969 1.00 0.00 ? 109 GLN A HA   3  
ATOM 5368  H HB2  . GLN A 1 109 ? -262.796 -8.071  111.297 1.00 0.00 ? 109 GLN A HB2  3  
ATOM 5369  H HB3  . GLN A 1 109 ? -261.846 -9.071  110.212 1.00 0.00 ? 109 GLN A HB3  3  
ATOM 5370  H HG2  . GLN A 1 109 ? -263.820 -10.373 109.677 1.00 0.00 ? 109 GLN A HG2  3  
ATOM 5371  H HG3  . GLN A 1 109 ? -264.781 -9.385  110.777 1.00 0.00 ? 109 GLN A HG3  3  
ATOM 5372  H HE21 . GLN A 1 109 ? -263.354 -6.939  110.027 1.00 0.00 ? 109 GLN A HE21 3  
ATOM 5373  H HE22 . GLN A 1 109 ? -263.955 -6.495  108.465 1.00 0.00 ? 109 GLN A HE22 3  
ATOM 5374  N N    . GLU A 1 110 ? -264.314 -11.486 112.210 1.00 0.00 ? 110 GLU A N    3  
ATOM 5375  C CA   . GLU A 1 110 ? -265.078 -12.718 112.087 1.00 0.00 ? 110 GLU A CA   3  
ATOM 5376  C C    . GLU A 1 110 ? -265.223 -13.145 110.626 1.00 0.00 ? 110 GLU A C    3  
ATOM 5377  O O    . GLU A 1 110 ? -265.157 -12.317 109.713 1.00 0.00 ? 110 GLU A O    3  
ATOM 5378  C CB   . GLU A 1 110 ? -266.454 -12.521 112.720 1.00 0.00 ? 110 GLU A CB   3  
ATOM 5379  C CG   . GLU A 1 110 ? -267.248 -11.370 112.119 1.00 0.00 ? 110 GLU A CG   3  
ATOM 5380  C CD   . GLU A 1 110 ? -268.478 -11.025 112.930 1.00 0.00 ? 110 GLU A CD   3  
ATOM 5381  O OE1  . GLU A 1 110 ? -269.523 -11.687 112.754 1.00 0.00 ? 110 GLU A OE1  3  
ATOM 5382  O OE2  . GLU A 1 110 ? -268.401 -10.091 113.755 1.00 0.00 ? 110 GLU A OE2  3  
ATOM 5383  H H    . GLU A 1 110 ? -264.759 -10.696 112.577 1.00 0.00 ? 110 GLU A H    3  
ATOM 5384  H HA   . GLU A 1 110 ? -264.552 -13.489 112.627 1.00 0.00 ? 110 GLU A HA   3  
ATOM 5385  H HB2  . GLU A 1 110 ? -267.025 -13.426 112.597 1.00 0.00 ? 110 GLU A HB2  3  
ATOM 5386  H HB3  . GLU A 1 110 ? -266.328 -12.327 113.775 1.00 0.00 ? 110 GLU A HB3  3  
ATOM 5387  H HG2  . GLU A 1 110 ? -266.613 -10.499 112.071 1.00 0.00 ? 110 GLU A HG2  3  
ATOM 5388  H HG3  . GLU A 1 110 ? -267.557 -11.645 111.120 1.00 0.00 ? 110 GLU A HG3  3  
ATOM 5389  N N    . GLY A 1 1   ? -229.252 -11.643 102.079 1.00 0.00 ? 1   GLY A N    4  
ATOM 5390  C CA   . GLY A 1 1   ? -228.003 -11.427 101.307 1.00 0.00 ? 1   GLY A CA   4  
ATOM 5391  C C    . GLY A 1 1   ? -226.795 -11.831 102.113 1.00 0.00 ? 1   GLY A C    4  
ATOM 5392  O O    . GLY A 1 1   ? -226.586 -11.306 103.200 1.00 0.00 ? 1   GLY A O    4  
ATOM 5393  H H1   . GLY A 1 1   ? -229.223 -11.091 102.961 1.00 0.00 ? 1   GLY A H1   4  
ATOM 5394  H H2   . GLY A 1 1   ? -230.077 -11.345 101.524 1.00 0.00 ? 1   GLY A H2   4  
ATOM 5395  H H3   . GLY A 1 1   ? -229.352 -12.654 102.321 1.00 0.00 ? 1   GLY A H3   4  
ATOM 5396  H HA2  . GLY A 1 1   ? -228.036 -12.018 100.403 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5397  H HA3  . GLY A 1 1   ? -227.927 -10.382 101.045 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5398  N N    . GLU A 1 2   ? -225.999 -12.751 101.571 1.00 0.00 ? 2   GLU A N    4  
ATOM 5399  C CA   . GLU A 1 2   ? -224.925 -13.390 102.327 1.00 0.00 ? 2   GLU A CA   4  
ATOM 5400  C C    . GLU A 1 2   ? -225.535 -14.174 103.479 1.00 0.00 ? 2   GLU A C    4  
ATOM 5401  O O    . GLU A 1 2   ? -225.470 -13.764 104.642 1.00 0.00 ? 2   GLU A O    4  
ATOM 5402  C CB   . GLU A 1 2   ? -223.898 -12.372 102.835 1.00 0.00 ? 2   GLU A CB   4  
ATOM 5403  C CG   . GLU A 1 2   ? -223.142 -11.663 101.723 1.00 0.00 ? 2   GLU A CG   4  
ATOM 5404  C CD   . GLU A 1 2   ? -222.429 -12.632 100.806 1.00 0.00 ? 2   GLU A CD   4  
ATOM 5405  O OE1  . GLU A 1 2   ? -221.448 -13.264 101.249 1.00 0.00 ? 2   GLU A OE1  4  
ATOM 5406  O OE2  . GLU A 1 2   ? -222.844 -12.769 99.638  1.00 0.00 ? 2   GLU A OE2  4  
ATOM 5407  H H    . GLU A 1 2   ? -226.142 -13.013 100.636 1.00 0.00 ? 2   GLU A H    4  
ATOM 5408  H HA   . GLU A 1 2   ? -224.431 -14.087 101.663 1.00 0.00 ? 2   GLU A HA   4  
ATOM 5409  H HB2  . GLU A 1 2   ? -224.412 -11.626 103.423 1.00 0.00 ? 2   GLU A HB2  4  
ATOM 5410  H HB3  . GLU A 1 2   ? -223.181 -12.881 103.463 1.00 0.00 ? 2   GLU A HB3  4  
ATOM 5411  H HG2  . GLU A 1 2   ? -223.845 -11.088 101.139 1.00 0.00 ? 2   GLU A HG2  4  
ATOM 5412  H HG3  . GLU A 1 2   ? -222.412 -11.001 102.163 1.00 0.00 ? 2   GLU A HG3  4  
ATOM 5413  N N    . GLU A 1 3   ? -226.150 -15.295 103.134 1.00 0.00 ? 3   GLU A N    4  
ATOM 5414  C CA   . GLU A 1 3   ? -226.933 -16.071 104.081 1.00 0.00 ? 3   GLU A CA   4  
ATOM 5415  C C    . GLU A 1 3   ? -226.049 -16.806 105.080 1.00 0.00 ? 3   GLU A C    4  
ATOM 5416  O O    . GLU A 1 3   ? -225.718 -17.980 104.900 1.00 0.00 ? 3   GLU A O    4  
ATOM 5417  C CB   . GLU A 1 3   ? -227.835 -17.058 103.342 1.00 0.00 ? 3   GLU A CB   4  
ATOM 5418  C CG   . GLU A 1 3   ? -228.876 -16.385 102.463 1.00 0.00 ? 3   GLU A CG   4  
ATOM 5419  C CD   . GLU A 1 3   ? -229.767 -15.441 103.246 1.00 0.00 ? 3   GLU A CD   4  
ATOM 5420  O OE1  . GLU A 1 3   ? -230.404 -15.901 104.216 1.00 0.00 ? 3   GLU A OE1  4  
ATOM 5421  O OE2  . GLU A 1 3   ? -229.822 -14.234 102.902 1.00 0.00 ? 3   GLU A OE2  4  
ATOM 5422  H H    . GLU A 1 3   ? -226.076 -15.610 102.204 1.00 0.00 ? 3   GLU A H    4  
ATOM 5423  H HA   . GLU A 1 3   ? -227.555 -15.379 104.626 1.00 0.00 ? 3   GLU A HA   4  
ATOM 5424  H HB2  . GLU A 1 3   ? -227.222 -17.692 102.718 1.00 0.00 ? 3   GLU A HB2  4  
ATOM 5425  H HB3  . GLU A 1 3   ? -228.350 -17.670 104.068 1.00 0.00 ? 3   GLU A HB3  4  
ATOM 5426  H HG2  . GLU A 1 3   ? -228.371 -15.824 101.688 1.00 0.00 ? 3   GLU A HG2  4  
ATOM 5427  H HG3  . GLU A 1 3   ? -229.492 -17.149 102.010 1.00 0.00 ? 3   GLU A HG3  4  
ATOM 5428  N N    . ARG A 1 4   ? -225.636 -16.084 106.110 1.00 0.00 ? 4   ARG A N    4  
ATOM 5429  C CA   . ARG A 1 4   ? -224.885 -16.653 107.215 1.00 0.00 ? 4   ARG A CA   4  
ATOM 5430  C C    . ARG A 1 4   ? -225.340 -16.000 108.513 1.00 0.00 ? 4   ARG A C    4  
ATOM 5431  O O    . ARG A 1 4   ? -226.093 -16.589 109.291 1.00 0.00 ? 4   ARG A O    4  
ATOM 5432  C CB   . ARG A 1 4   ? -223.379 -16.442 107.028 1.00 0.00 ? 4   ARG A CB   4  
ATOM 5433  C CG   . ARG A 1 4   ? -222.818 -17.039 105.748 1.00 0.00 ? 4   ARG A CG   4  
ATOM 5434  C CD   . ARG A 1 4   ? -221.356 -16.669 105.556 1.00 0.00 ? 4   ARG A CD   4  
ATOM 5435  N NE   . ARG A 1 4   ? -221.144 -15.219 105.602 1.00 0.00 ? 4   ARG A NE   4  
ATOM 5436  C CZ   . ARG A 1 4   ? -221.106 -14.436 104.524 1.00 0.00 ? 4   ARG A CZ   4  
ATOM 5437  N NH1  . ARG A 1 4   ? -221.300 -14.951 103.317 1.00 0.00 ? 4   ARG A NH1  4  
ATOM 5438  N NH2  . ARG A 1 4   ? -220.873 -13.135 104.656 1.00 0.00 ? 4   ARG A NH2  4  
ATOM 5439  H H    . ARG A 1 4   ? -225.840 -15.122 106.119 1.00 0.00 ? 4   ARG A H    4  
ATOM 5440  H HA   . ARG A 1 4   ? -225.097 -17.711 107.259 1.00 0.00 ? 4   ARG A HA   4  
ATOM 5441  H HB2  . ARG A 1 4   ? -223.176 -15.383 107.020 1.00 0.00 ? 4   ARG A HB2  4  
ATOM 5442  H HB3  . ARG A 1 4   ? -222.864 -16.891 107.864 1.00 0.00 ? 4   ARG A HB3  4  
ATOM 5443  H HG2  . ARG A 1 4   ? -222.903 -18.113 105.794 1.00 0.00 ? 4   ARG A HG2  4  
ATOM 5444  H HG3  . ARG A 1 4   ? -223.387 -16.666 104.909 1.00 0.00 ? 4   ARG A HG3  4  
ATOM 5445  H HD2  . ARG A 1 4   ? -220.774 -17.129 106.341 1.00 0.00 ? 4   ARG A HD2  4  
ATOM 5446  H HD3  . ARG A 1 4   ? -221.025 -17.041 104.597 1.00 0.00 ? 4   ARG A HD3  4  
ATOM 5447  H HE   . ARG A 1 4   ? -221.014 -14.811 106.488 1.00 0.00 ? 4   ARG A HE   4  
ATOM 5448  H HH11 . ARG A 1 4   ? -221.475 -15.939 103.205 1.00 0.00 ? 4   ARG A HH11 4  
ATOM 5449  H HH12 . ARG A 1 4   ? -221.275 -14.354 102.500 1.00 0.00 ? 4   ARG A HH12 4  
ATOM 5450  H HH21 . ARG A 1 4   ? -220.717 -12.739 105.572 1.00 0.00 ? 4   ARG A HH21 4  
ATOM 5451  H HH22 . ARG A 1 4   ? -220.856 -12.541 103.850 1.00 0.00 ? 4   ARG A HH22 4  
ATOM 5452  N N    . LYS A 1 5   ? -224.900 -14.766 108.728 1.00 0.00 ? 5   LYS A N    4  
ATOM 5453  C CA   . LYS A 1 5   ? -225.304 -14.003 109.899 1.00 0.00 ? 5   LYS A CA   4  
ATOM 5454  C C    . LYS A 1 5   ? -225.324 -12.509 109.564 1.00 0.00 ? 5   LYS A C    4  
ATOM 5455  O O    . LYS A 1 5   ? -225.170 -11.650 110.435 1.00 0.00 ? 5   LYS A O    4  
ATOM 5456  C CB   . LYS A 1 5   ? -224.353 -14.292 111.066 1.00 0.00 ? 5   LYS A CB   4  
ATOM 5457  C CG   . LYS A 1 5   ? -224.903 -13.882 112.425 1.00 0.00 ? 5   LYS A CG   4  
ATOM 5458  C CD   . LYS A 1 5   ? -223.993 -14.340 113.552 1.00 0.00 ? 5   LYS A CD   4  
ATOM 5459  C CE   . LYS A 1 5   ? -222.647 -13.633 113.513 1.00 0.00 ? 5   LYS A CE   4  
ATOM 5460  N NZ   . LYS A 1 5   ? -222.755 -12.205 113.914 1.00 0.00 ? 5   LYS A NZ   4  
ATOM 5461  H H    . LYS A 1 5   ? -224.272 -14.360 108.085 1.00 0.00 ? 5   LYS A H    4  
ATOM 5462  H HA   . LYS A 1 5   ? -226.302 -14.314 110.169 1.00 0.00 ? 5   LYS A HA   4  
ATOM 5463  H HB2  . LYS A 1 5   ? -224.147 -15.353 111.093 1.00 0.00 ? 5   LYS A HB2  4  
ATOM 5464  H HB3  . LYS A 1 5   ? -223.430 -13.759 110.902 1.00 0.00 ? 5   LYS A HB3  4  
ATOM 5465  H HG2  . LYS A 1 5   ? -224.988 -12.807 112.457 1.00 0.00 ? 5   LYS A HG2  4  
ATOM 5466  H HG3  . LYS A 1 5   ? -225.879 -14.328 112.557 1.00 0.00 ? 5   LYS A HG3  4  
ATOM 5467  H HD2  . LYS A 1 5   ? -224.470 -14.128 114.495 1.00 0.00 ? 5   LYS A HD2  4  
ATOM 5468  H HD3  . LYS A 1 5   ? -223.832 -15.404 113.460 1.00 0.00 ? 5   LYS A HD3  4  
ATOM 5469  H HE2  . LYS A 1 5   ? -221.971 -14.137 114.190 1.00 0.00 ? 5   LYS A HE2  4  
ATOM 5470  H HE3  . LYS A 1 5   ? -222.254 -13.688 112.509 1.00 0.00 ? 5   LYS A HE3  4  
ATOM 5471  H HZ1  . LYS A 1 5   ? -223.152 -12.134 114.877 1.00 0.00 ? 5   LYS A HZ1  4  
ATOM 5472  H HZ2  . LYS A 1 5   ? -221.809 -11.761 113.908 1.00 0.00 ? 5   LYS A HZ2  4  
ATOM 5473  H HZ3  . LYS A 1 5   ? -223.373 -11.688 113.257 1.00 0.00 ? 5   LYS A HZ3  4  
ATOM 5474  N N    . CYS A 1 6   ? -225.525 -12.212 108.289 1.00 0.00 ? 6   CYS A N    4  
ATOM 5475  C CA   . CYS A 1 6   ? -225.647 -10.837 107.831 1.00 0.00 ? 6   CYS A CA   4  
ATOM 5476  C C    . CYS A 1 6   ? -226.934 -10.661 107.036 1.00 0.00 ? 6   CYS A C    4  
ATOM 5477  O O    . CYS A 1 6   ? -226.976 -10.963 105.851 1.00 0.00 ? 6   CYS A O    4  
ATOM 5478  C CB   . CYS A 1 6   ? -224.445 -10.441 106.966 1.00 0.00 ? 6   CYS A CB   4  
ATOM 5479  S SG   . CYS A 1 6   ? -222.854 -10.498 107.827 1.00 0.00 ? 6   CYS A SG   4  
ATOM 5480  H H    . CYS A 1 6   ? -225.603 -12.936 107.635 1.00 0.00 ? 6   CYS A H    4  
ATOM 5481  H HA   . CYS A 1 6   ? -225.681 -10.197 108.701 1.00 0.00 ? 6   CYS A HA   4  
ATOM 5482  H HB2  . CYS A 1 6   ? -224.383 -11.110 106.122 1.00 0.00 ? 6   CYS A HB2  4  
ATOM 5483  H HB3  . CYS A 1 6   ? -224.587 -9.431  106.608 1.00 0.00 ? 6   CYS A HB3  4  
ATOM 5484  H HG   . CYS A 1 6   ? -222.477 -9.248  108.072 1.00 0.00 ? 6   CYS A HG   4  
ATOM 5485  N N    . LEU A 1 7   ? -227.981 -10.189 107.710 1.00 0.00 ? 7   LEU A N    4  
ATOM 5486  C CA   . LEU A 1 7   ? -229.279 -9.969  107.090 1.00 0.00 ? 7   LEU A CA   4  
ATOM 5487  C C    . LEU A 1 7   ? -229.746 -11.189 106.295 1.00 0.00 ? 7   LEU A C    4  
ATOM 5488  O O    . LEU A 1 7   ? -229.877 -11.135 105.069 1.00 0.00 ? 7   LEU A O    4  
ATOM 5489  C CB   . LEU A 1 7   ? -229.214 -8.734  106.200 1.00 0.00 ? 7   LEU A CB   4  
ATOM 5490  C CG   . LEU A 1 7   ? -229.096 -7.402  106.944 1.00 0.00 ? 7   LEU A CG   4  
ATOM 5491  C CD1  . LEU A 1 7   ? -228.956 -6.256  105.955 1.00 0.00 ? 7   LEU A CD1  4  
ATOM 5492  C CD2  . LEU A 1 7   ? -230.301 -7.189  107.847 1.00 0.00 ? 7   LEU A CD2  4  
ATOM 5493  H H    . LEU A 1 7   ? -227.872 -9.964  108.650 1.00 0.00 ? 7   LEU A H    4  
ATOM 5494  H HA   . LEU A 1 7   ? -229.989 -9.785  107.881 1.00 0.00 ? 7   LEU A HA   4  
ATOM 5495  H HB2  . LEU A 1 7   ? -228.349 -8.838  105.566 1.00 0.00 ? 7   LEU A HB2  4  
ATOM 5496  H HB3  . LEU A 1 7   ? -230.097 -8.706  105.586 1.00 0.00 ? 7   LEU A HB3  4  
ATOM 5497  H HG   . LEU A 1 7   ? -228.211 -7.419  107.564 1.00 0.00 ? 7   LEU A HG   4  
ATOM 5498  H HD11 . LEU A 1 7   ? -228.111 -6.442  105.309 1.00 0.00 ? 7   LEU A HD11 4  
ATOM 5499  H HD12 . LEU A 1 7   ? -229.854 -6.175  105.363 1.00 0.00 ? 7   LEU A HD12 4  
ATOM 5500  H HD13 . LEU A 1 7   ? -228.798 -5.333  106.496 1.00 0.00 ? 7   LEU A HD13 4  
ATOM 5501  H HD21 . LEU A 1 7   ? -231.202 -7.184  107.250 1.00 0.00 ? 7   LEU A HD21 4  
ATOM 5502  H HD22 . LEU A 1 7   ? -230.352 -7.987  108.572 1.00 0.00 ? 7   LEU A HD22 4  
ATOM 5503  H HD23 . LEU A 1 7   ? -230.204 -6.243  108.358 1.00 0.00 ? 7   LEU A HD23 4  
ATOM 5504  N N    . GLN A 1 8   ? -229.983 -12.287 107.006 1.00 0.00 ? 8   GLN A N    4  
ATOM 5505  C CA   . GLN A 1 8   ? -230.469 -13.518 106.389 1.00 0.00 ? 8   GLN A CA   4  
ATOM 5506  C C    . GLN A 1 8   ? -231.831 -13.287 105.746 1.00 0.00 ? 8   GLN A C    4  
ATOM 5507  O O    . GLN A 1 8   ? -232.841 -13.132 106.435 1.00 0.00 ? 8   GLN A O    4  
ATOM 5508  C CB   . GLN A 1 8   ? -230.569 -14.657 107.417 1.00 0.00 ? 8   GLN A CB   4  
ATOM 5509  C CG   . GLN A 1 8   ? -229.273 -14.955 108.163 1.00 0.00 ? 8   GLN A CG   4  
ATOM 5510  C CD   . GLN A 1 8   ? -229.028 -14.010 109.325 1.00 0.00 ? 8   GLN A CD   4  
ATOM 5511  O OE1  . GLN A 1 8   ? -228.410 -12.959 109.172 1.00 0.00 ? 8   GLN A OE1  4  
ATOM 5512  N NE2  . GLN A 1 8   ? -229.506 -14.382 110.498 1.00 0.00 ? 8   GLN A NE2  4  
ATOM 5513  H H    . GLN A 1 8   ? -229.804 -12.275 107.969 1.00 0.00 ? 8   GLN A H    4  
ATOM 5514  H HA   . GLN A 1 8   ? -229.765 -13.799 105.622 1.00 0.00 ? 8   GLN A HA   4  
ATOM 5515  H HB2  . GLN A 1 8   ? -231.324 -14.400 108.146 1.00 0.00 ? 8   GLN A HB2  4  
ATOM 5516  H HB3  . GLN A 1 8   ? -230.874 -15.556 106.903 1.00 0.00 ? 8   GLN A HB3  4  
ATOM 5517  H HG2  . GLN A 1 8   ? -229.317 -15.964 108.544 1.00 0.00 ? 8   GLN A HG2  4  
ATOM 5518  H HG3  . GLN A 1 8   ? -228.449 -14.872 107.469 1.00 0.00 ? 8   GLN A HG3  4  
ATOM 5519  H HE21 . GLN A 1 8   ? -229.980 -15.237 110.554 1.00 0.00 ? 8   GLN A HE21 4  
ATOM 5520  H HE22 . GLN A 1 8   ? -229.377 -13.778 111.267 1.00 0.00 ? 8   GLN A HE22 4  
ATOM 5521  N N    . THR A 1 9   ? -231.856 -13.262 104.429 1.00 0.00 ? 9   THR A N    4  
ATOM 5522  C CA   . THR A 1 9   ? -233.070 -12.976 103.695 1.00 0.00 ? 9   THR A CA   4  
ATOM 5523  C C    . THR A 1 9   ? -233.743 -14.264 103.247 1.00 0.00 ? 9   THR A C    4  
ATOM 5524  O O    . THR A 1 9   ? -233.215 -14.991 102.407 1.00 0.00 ? 9   THR A O    4  
ATOM 5525  C CB   . THR A 1 9   ? -232.783 -12.100 102.462 1.00 0.00 ? 9   THR A CB   4  
ATOM 5526  O OG1  . THR A 1 9   ? -231.772 -12.707 101.641 1.00 0.00 ? 9   THR A OG1  4  
ATOM 5527  C CG2  . THR A 1 9   ? -232.334 -10.705 102.871 1.00 0.00 ? 9   THR A CG2  4  
ATOM 5528  H H    . THR A 1 9   ? -231.027 -13.471 103.930 1.00 0.00 ? 9   THR A H    4  
ATOM 5529  H HA   . THR A 1 9   ? -233.745 -12.434 104.353 1.00 0.00 ? 9   THR A HA   4  
ATOM 5530  H HB   . THR A 1 9   ? -233.695 -12.010 101.893 1.00 0.00 ? 9   THR A HB   4  
ATOM 5531  H HG1  . THR A 1 9   ? -231.477 -13.538 102.053 1.00 0.00 ? 9   THR A HG1  4  
ATOM 5532  H HG21 . THR A 1 9   ? -233.108 -10.235 103.458 1.00 0.00 ? 9   THR A HG21 4  
ATOM 5533  H HG22 . THR A 1 9   ? -231.429 -10.774 103.456 1.00 0.00 ? 9   THR A HG22 4  
ATOM 5534  H HG23 . THR A 1 9   ? -232.147 -10.115 101.985 1.00 0.00 ? 9   THR A HG23 4  
ATOM 5535  N N    . HIS A 1 10  ? -234.893 -14.560 103.824 1.00 0.00 ? 10  HIS A N    4  
ATOM 5536  C CA   . HIS A 1 10  ? -235.631 -15.756 103.452 1.00 0.00 ? 10  HIS A CA   4  
ATOM 5537  C C    . HIS A 1 10  ? -237.074 -15.430 103.150 1.00 0.00 ? 10  HIS A C    4  
ATOM 5538  O O    . HIS A 1 10  ? -237.693 -14.611 103.813 1.00 0.00 ? 10  HIS A O    4  
ATOM 5539  C CB   . HIS A 1 10  ? -235.543 -16.828 104.536 1.00 0.00 ? 10  HIS A CB   4  
ATOM 5540  C CG   . HIS A 1 10  ? -234.192 -17.463 104.626 1.00 0.00 ? 10  HIS A CG   4  
ATOM 5541  N ND1  . HIS A 1 10  ? -233.876 -18.642 103.990 1.00 0.00 ? 10  HIS A ND1  4  
ATOM 5542  C CD2  . HIS A 1 10  ? -233.061 -17.059 105.247 1.00 0.00 ? 10  HIS A CD2  4  
ATOM 5543  C CE1  . HIS A 1 10  ? -232.609 -18.934 104.214 1.00 0.00 ? 10  HIS A CE1  4  
ATOM 5544  N NE2  . HIS A 1 10  ? -232.085 -17.986 104.975 1.00 0.00 ? 10  HIS A NE2  4  
ATOM 5545  H H    . HIS A 1 10  ? -235.262 -13.956 104.503 1.00 0.00 ? 10  HIS A H    4  
ATOM 5546  H HA   . HIS A 1 10  ? -235.183 -16.141 102.553 1.00 0.00 ? 10  HIS A HA   4  
ATOM 5547  H HB2  . HIS A 1 10  ? -235.770 -16.383 105.490 1.00 0.00 ? 10  HIS A HB2  4  
ATOM 5548  H HB3  . HIS A 1 10  ? -236.262 -17.604 104.326 1.00 0.00 ? 10  HIS A HB3  4  
ATOM 5549  H HD1  . HIS A 1 10  ? -234.497 -19.185 103.444 1.00 0.00 ? 10  HIS A HD1  4  
ATOM 5550  H HD2  . HIS A 1 10  ? -232.950 -16.169 105.851 1.00 0.00 ? 10  HIS A HD2  4  
ATOM 5551  H HE1  . HIS A 1 10  ? -232.086 -19.801 103.839 1.00 0.00 ? 10  HIS A HE1  4  
ATOM 5552  H HE2  . HIS A 1 10  ? -231.120 -17.788 105.017 1.00 0.00 ? 10  HIS A HE2  4  
ATOM 5553  N N    . ARG A 1 11  ? -237.595 -16.066 102.130 1.00 0.00 ? 11  ARG A N    4  
ATOM 5554  C CA   . ARG A 1 11  ? -238.931 -15.821 101.684 1.00 0.00 ? 11  ARG A CA   4  
ATOM 5555  C C    . ARG A 1 11  ? -239.917 -16.742 102.380 1.00 0.00 ? 11  ARG A C    4  
ATOM 5556  O O    . ARG A 1 11  ? -239.601 -17.894 102.679 1.00 0.00 ? 11  ARG A O    4  
ATOM 5557  C CB   . ARG A 1 11  ? -238.982 -16.010 100.190 1.00 0.00 ? 11  ARG A CB   4  
ATOM 5558  C CG   . ARG A 1 11  ? -239.731 -14.898 99.525  1.00 0.00 ? 11  ARG A CG   4  
ATOM 5559  C CD   . ARG A 1 11  ? -239.295 -14.733 98.090  1.00 0.00 ? 11  ARG A CD   4  
ATOM 5560  N NE   . ARG A 1 11  ? -240.123 -13.774 97.362  1.00 0.00 ? 11  ARG A NE   4  
ATOM 5561  C CZ   . ARG A 1 11  ? -239.662 -12.962 96.413  1.00 0.00 ? 11  ARG A CZ   4  
ATOM 5562  N NH1  . ARG A 1 11  ? -238.370 -12.946 96.115  1.00 0.00 ? 11  ARG A NH1  4  
ATOM 5563  N NH2  . ARG A 1 11  ? -240.496 -12.150 95.775  1.00 0.00 ? 11  ARG A NH2  4  
ATOM 5564  H H    . ARG A 1 11  ? -237.064 -16.714 101.653 1.00 0.00 ? 11  ARG A H    4  
ATOM 5565  H HA   . ARG A 1 11  ? -239.178 -14.795 101.901 1.00 0.00 ? 11  ARG A HA   4  
ATOM 5566  H HB2  . ARG A 1 11  ? -237.976 -16.036 99.797  1.00 0.00 ? 11  ARG A HB2  4  
ATOM 5567  H HB3  . ARG A 1 11  ? -239.479 -16.942 99.966  1.00 0.00 ? 11  ARG A HB3  4  
ATOM 5568  H HG2  . ARG A 1 11  ? -240.783 -15.117 99.560  1.00 0.00 ? 11  ARG A HG2  4  
ATOM 5569  H HG3  . ARG A 1 11  ? -239.537 -13.984 100.071 1.00 0.00 ? 11  ARG A HG3  4  
ATOM 5570  H HD2  . ARG A 1 11  ? -238.273 -14.392 98.090  1.00 0.00 ? 11  ARG A HD2  4  
ATOM 5571  H HD3  . ARG A 1 11  ? -239.353 -15.693 97.601  1.00 0.00 ? 11  ARG A HD3  4  
ATOM 5572  H HE   . ARG A 1 11  ? -241.084 -13.746 97.582  1.00 0.00 ? 11  ARG A HE   4  
ATOM 5573  H HH11 . ARG A 1 11  ? -237.725 -13.553 96.604  1.00 0.00 ? 11  ARG A HH11 4  
ATOM 5574  H HH12 . ARG A 1 11  ? -238.022 -12.329 95.405  1.00 0.00 ? 11  ARG A HH12 4  
ATOM 5575  H HH21 . ARG A 1 11  ? -241.470 -12.144 96.008  1.00 0.00 ? 11  ARG A HH21 4  
ATOM 5576  H HH22 . ARG A 1 11  ? -240.155 -11.544 95.048  1.00 0.00 ? 11  ARG A HH22 4  
ATOM 5577  N N    . VAL A 1 12  ? -241.105 -16.227 102.632 1.00 0.00 ? 12  VAL A N    4  
ATOM 5578  C CA   . VAL A 1 12  ? -242.151 -16.979 103.299 1.00 0.00 ? 12  VAL A CA   4  
ATOM 5579  C C    . VAL A 1 12  ? -243.431 -16.922 102.469 1.00 0.00 ? 12  VAL A C    4  
ATOM 5580  O O    . VAL A 1 12  ? -243.946 -15.838 102.178 1.00 0.00 ? 12  VAL A O    4  
ATOM 5581  C CB   . VAL A 1 12  ? -242.386 -16.445 104.731 1.00 0.00 ? 12  VAL A CB   4  
ATOM 5582  C CG1  . VAL A 1 12  ? -242.451 -14.923 104.738 1.00 0.00 ? 12  VAL A CG1  4  
ATOM 5583  C CG2  . VAL A 1 12  ? -243.644 -17.045 105.332 1.00 0.00 ? 12  VAL A CG2  4  
ATOM 5584  H H    . VAL A 1 12  ? -241.296 -15.303 102.348 1.00 0.00 ? 12  VAL A H    4  
ATOM 5585  H HA   . VAL A 1 12  ? -241.827 -18.010 103.370 1.00 0.00 ? 12  VAL A HA   4  
ATOM 5586  H HB   . VAL A 1 12  ? -241.545 -16.743 105.342 1.00 0.00 ? 12  VAL A HB   4  
ATOM 5587  H HG11 . VAL A 1 12  ? -243.251 -14.593 104.094 1.00 0.00 ? 12  VAL A HG11 4  
ATOM 5588  H HG12 . VAL A 1 12  ? -242.633 -14.577 105.746 1.00 0.00 ? 12  VAL A HG12 4  
ATOM 5589  H HG13 . VAL A 1 12  ? -241.510 -14.522 104.384 1.00 0.00 ? 12  VAL A HG13 4  
ATOM 5590  H HG21 . VAL A 1 12  ? -244.494 -16.788 104.717 1.00 0.00 ? 12  VAL A HG21 4  
ATOM 5591  H HG22 . VAL A 1 12  ? -243.544 -18.119 105.376 1.00 0.00 ? 12  VAL A HG22 4  
ATOM 5592  H HG23 . VAL A 1 12  ? -243.790 -16.657 106.329 1.00 0.00 ? 12  VAL A HG23 4  
ATOM 5593  N N    . THR A 1 13  ? -243.908 -18.086 102.039 1.00 0.00 ? 13  THR A N    4  
ATOM 5594  C CA   . THR A 1 13  ? -245.043 -18.153 101.134 1.00 0.00 ? 13  THR A CA   4  
ATOM 5595  C C    . THR A 1 13  ? -246.338 -17.860 101.892 1.00 0.00 ? 13  THR A C    4  
ATOM 5596  O O    . THR A 1 13  ? -246.724 -18.615 102.786 1.00 0.00 ? 13  THR A O    4  
ATOM 5597  C CB   . THR A 1 13  ? -245.173 -19.548 100.493 1.00 0.00 ? 13  THR A CB   4  
ATOM 5598  O OG1  . THR A 1 13  ? -243.905 -19.961 99.962  1.00 0.00 ? 13  THR A OG1  4  
ATOM 5599  C CG2  . THR A 1 13  ? -246.229 -19.531 99.386  1.00 0.00 ? 13  THR A CG2  4  
ATOM 5600  H H    . THR A 1 13  ? -243.489 -18.917 102.341 1.00 0.00 ? 13  THR A H    4  
ATOM 5601  H HA   . THR A 1 13  ? -244.883 -17.417 100.332 1.00 0.00 ? 13  THR A HA   4  
ATOM 5602  H HB   . THR A 1 13  ? -245.483 -20.250 101.255 1.00 0.00 ? 13  THR A HB   4  
ATOM 5603  H HG1  . THR A 1 13  ? -244.045 -20.562 99.214  1.00 0.00 ? 13  THR A HG1  4  
ATOM 5604  H HG21 . THR A 1 13  ? -247.186 -19.240 99.802  1.00 0.00 ? 13  THR A HG21 4  
ATOM 5605  H HG22 . THR A 1 13  ? -245.939 -18.819 98.627  1.00 0.00 ? 13  THR A HG22 4  
ATOM 5606  H HG23 . THR A 1 13  ? -246.311 -20.514 98.949  1.00 0.00 ? 13  THR A HG23 4  
ATOM 5607  N N    . VAL A 1 14  ? -246.997 -16.781 101.539 1.00 0.00 ? 14  VAL A N    4  
ATOM 5608  C CA   . VAL A 1 14  ? -248.220 -16.385 102.207 1.00 0.00 ? 14  VAL A CA   4  
ATOM 5609  C C    . VAL A 1 14  ? -249.439 -16.872 101.423 1.00 0.00 ? 14  VAL A C    4  
ATOM 5610  O O    . VAL A 1 14  ? -249.550 -16.636 100.223 1.00 0.00 ? 14  VAL A O    4  
ATOM 5611  C CB   . VAL A 1 14  ? -248.254 -14.853 102.375 1.00 0.00 ? 14  VAL A CB   4  
ATOM 5612  C CG1  . VAL A 1 14  ? -249.539 -14.380 103.028 1.00 0.00 ? 14  VAL A CG1  4  
ATOM 5613  C CG2  . VAL A 1 14  ? -247.051 -14.390 103.178 1.00 0.00 ? 14  VAL A CG2  4  
ATOM 5614  H H    . VAL A 1 14  ? -246.658 -16.227 100.798 1.00 0.00 ? 14  VAL A H    4  
ATOM 5615  H HA   . VAL A 1 14  ? -248.227 -16.838 103.188 1.00 0.00 ? 14  VAL A HA   4  
ATOM 5616  H HB   . VAL A 1 14  ? -248.192 -14.403 101.395 1.00 0.00 ? 14  VAL A HB   4  
ATOM 5617  H HG11 . VAL A 1 14  ? -249.659 -14.862 103.986 1.00 0.00 ? 14  VAL A HG11 4  
ATOM 5618  H HG12 . VAL A 1 14  ? -249.492 -13.308 103.163 1.00 0.00 ? 14  VAL A HG12 4  
ATOM 5619  H HG13 . VAL A 1 14  ? -250.376 -14.623 102.387 1.00 0.00 ? 14  VAL A HG13 4  
ATOM 5620  H HG21 . VAL A 1 14  ? -246.144 -14.679 102.666 1.00 0.00 ? 14  VAL A HG21 4  
ATOM 5621  H HG22 . VAL A 1 14  ? -247.079 -13.317 103.282 1.00 0.00 ? 14  VAL A HG22 4  
ATOM 5622  H HG23 . VAL A 1 14  ? -247.074 -14.847 104.155 1.00 0.00 ? 14  VAL A HG23 4  
ATOM 5623  N N    . HIS A 1 15  ? -250.330 -17.582 102.106 1.00 0.00 ? 15  HIS A N    4  
ATOM 5624  C CA   . HIS A 1 15  ? -251.538 -18.111 101.476 1.00 0.00 ? 15  HIS A CA   4  
ATOM 5625  C C    . HIS A 1 15  ? -252.725 -17.179 101.670 1.00 0.00 ? 15  HIS A C    4  
ATOM 5626  O O    . HIS A 1 15  ? -253.731 -17.286 100.974 1.00 0.00 ? 15  HIS A O    4  
ATOM 5627  C CB   . HIS A 1 15  ? -251.872 -19.494 102.044 1.00 0.00 ? 15  HIS A CB   4  
ATOM 5628  C CG   . HIS A 1 15  ? -251.079 -20.606 101.430 1.00 0.00 ? 15  HIS A CG   4  
ATOM 5629  N ND1  . HIS A 1 15  ? -251.485 -21.289 100.305 1.00 0.00 ? 15  HIS A ND1  4  
ATOM 5630  C CD2  . HIS A 1 15  ? -249.897 -21.158 101.794 1.00 0.00 ? 15  HIS A CD2  4  
ATOM 5631  C CE1  . HIS A 1 15  ? -250.590 -22.210 100.003 1.00 0.00 ? 15  HIS A CE1  4  
ATOM 5632  N NE2  . HIS A 1 15  ? -249.618 -22.151 100.893 1.00 0.00 ? 15  HIS A NE2  4  
ATOM 5633  H H    . HIS A 1 15  ? -250.169 -17.767 103.059 1.00 0.00 ? 15  HIS A H    4  
ATOM 5634  H HA   . HIS A 1 15  ? -251.340 -18.207 100.417 1.00 0.00 ? 15  HIS A HA   4  
ATOM 5635  H HB2  . HIS A 1 15  ? -251.661 -19.490 103.105 1.00 0.00 ? 15  HIS A HB2  4  
ATOM 5636  H HB3  . HIS A 1 15  ? -252.921 -19.699 101.897 1.00 0.00 ? 15  HIS A HB3  4  
ATOM 5637  H HD1  . HIS A 1 15  ? -252.314 -21.112 99.787  1.00 0.00 ? 15  HIS A HD1  4  
ATOM 5638  H HD2  . HIS A 1 15  ? -249.291 -20.871 102.641 1.00 0.00 ? 15  HIS A HD2  4  
ATOM 5639  H HE1  . HIS A 1 15  ? -250.648 -22.897 99.171  1.00 0.00 ? 15  HIS A HE1  4  
ATOM 5640  H HE2  . HIS A 1 15  ? -248.761 -22.642 100.834 1.00 0.00 ? 15  HIS A HE2  4  
ATOM 5641  N N    . GLY A 1 16  ? -252.607 -16.264 102.619 1.00 0.00 ? 16  GLY A N    4  
ATOM 5642  C CA   . GLY A 1 16  ? -253.714 -15.365 102.907 1.00 0.00 ? 16  GLY A CA   4  
ATOM 5643  C C    . GLY A 1 16  ? -253.446 -13.945 102.447 1.00 0.00 ? 16  GLY A C    4  
ATOM 5644  O O    . GLY A 1 16  ? -253.968 -12.998 103.024 1.00 0.00 ? 16  GLY A O    4  
ATOM 5645  H H    . GLY A 1 16  ? -251.767 -16.198 103.126 1.00 0.00 ? 16  GLY A H    4  
ATOM 5646  H HA2  . GLY A 1 16  ? -254.599 -15.735 102.418 1.00 0.00 ? 16  GLY A HA2  4  
ATOM 5647  H HA3  . GLY A 1 16  ? -253.884 -15.357 103.973 1.00 0.00 ? 16  GLY A HA3  4  
ATOM 5648  N N    . VAL A 1 17  ? -252.639 -13.804 101.404 1.00 0.00 ? 17  VAL A N    4  
ATOM 5649  C CA   . VAL A 1 17  ? -252.167 -12.501 100.959 1.00 0.00 ? 17  VAL A CA   4  
ATOM 5650  C C    . VAL A 1 17  ? -253.316 -11.521 100.690 1.00 0.00 ? 17  VAL A C    4  
ATOM 5651  O O    . VAL A 1 17  ? -254.418 -11.918 100.304 1.00 0.00 ? 17  VAL A O    4  
ATOM 5652  C CB   . VAL A 1 17  ? -251.297 -12.622 99.692  1.00 0.00 ? 17  VAL A CB   4  
ATOM 5653  C CG1  . VAL A 1 17  ? -250.250 -13.700 99.855  1.00 0.00 ? 17  VAL A CG1  4  
ATOM 5654  C CG2  . VAL A 1 17  ? -252.140 -12.877 98.450  1.00 0.00 ? 17  VAL A CG2  4  
ATOM 5655  H H    . VAL A 1 17  ? -252.354 -14.597 100.918 1.00 0.00 ? 17  VAL A H    4  
ATOM 5656  H HA   . VAL A 1 17  ? -251.550 -12.095 101.748 1.00 0.00 ? 17  VAL A HA   4  
ATOM 5657  H HB   . VAL A 1 17  ? -250.782 -11.691 99.566  1.00 0.00 ? 17  VAL A HB   4  
ATOM 5658  H HG11 . VAL A 1 17  ? -250.734 -14.637 100.080 1.00 0.00 ? 17  VAL A HG11 4  
ATOM 5659  H HG12 . VAL A 1 17  ? -249.686 -13.796 98.938  1.00 0.00 ? 17  VAL A HG12 4  
ATOM 5660  H HG13 . VAL A 1 17  ? -249.583 -13.436 100.662 1.00 0.00 ? 17  VAL A HG13 4  
ATOM 5661  H HG21 . VAL A 1 17  ? -252.839 -12.064 98.317  1.00 0.00 ? 17  VAL A HG21 4  
ATOM 5662  H HG22 . VAL A 1 17  ? -251.495 -12.944 97.585  1.00 0.00 ? 17  VAL A HG22 4  
ATOM 5663  H HG23 . VAL A 1 17  ? -252.682 -13.803 98.569  1.00 0.00 ? 17  VAL A HG23 4  
ATOM 5664  N N    . PRO A 1 18  ? -253.051 -10.218 100.885 1.00 0.00 ? 18  PRO A N    4  
ATOM 5665  C CA   . PRO A 1 18  ? -254.043 -9.155  100.657 1.00 0.00 ? 18  PRO A CA   4  
ATOM 5666  C C    . PRO A 1 18  ? -254.280 -8.938  99.184  1.00 0.00 ? 18  PRO A C    4  
ATOM 5667  O O    . PRO A 1 18  ? -255.307 -8.411  98.750  1.00 0.00 ? 18  PRO A O    4  
ATOM 5668  C CB   . PRO A 1 18  ? -253.372 -7.930  101.274 1.00 0.00 ? 18  PRO A CB   4  
ATOM 5669  C CG   . PRO A 1 18  ? -251.922 -8.200  101.080 1.00 0.00 ? 18  PRO A CG   4  
ATOM 5670  C CD   . PRO A 1 18  ? -251.760 -9.669  101.336 1.00 0.00 ? 18  PRO A CD   4  
ATOM 5671  H HA   . PRO A 1 18  ? -254.961 -9.365  101.137 1.00 0.00 ? 18  PRO A HA   4  
ATOM 5672  H HB2  . PRO A 1 18  ? -253.688 -7.038  100.753 1.00 0.00 ? 18  PRO A HB2  4  
ATOM 5673  H HB3  . PRO A 1 18  ? -253.628 -7.860  102.321 1.00 0.00 ? 18  PRO A HB3  4  
ATOM 5674  H HG2  . PRO A 1 18  ? -251.634 -7.961  100.069 1.00 0.00 ? 18  PRO A HG2  4  
ATOM 5675  H HG3  . PRO A 1 18  ? -251.343 -7.635  101.776 1.00 0.00 ? 18  PRO A HG3  4  
ATOM 5676  H HD2  . PRO A 1 18  ? -250.943 -10.067 100.754 1.00 0.00 ? 18  PRO A HD2  4  
ATOM 5677  H HD3  . PRO A 1 18  ? -251.606 -9.859  102.389 1.00 0.00 ? 18  PRO A HD3  4  
ATOM 5678  N N    . GLY A 1 19  ? -253.281 -9.343  98.453  1.00 0.00 ? 19  GLY A N    4  
ATOM 5679  C CA   . GLY A 1 19  ? -253.294 -9.300  97.005  1.00 0.00 ? 19  GLY A CA   4  
ATOM 5680  C C    . GLY A 1 19  ? -254.366 -10.178 96.389  1.00 0.00 ? 19  GLY A C    4  
ATOM 5681  O O    . GLY A 1 19  ? -255.006 -10.972 97.079  1.00 0.00 ? 19  GLY A O    4  
ATOM 5682  H H    . GLY A 1 19  ? -252.497 -9.676  98.933  1.00 0.00 ? 19  GLY A H    4  
ATOM 5683  H HA2  . GLY A 1 19  ? -253.457 -8.287  96.680  1.00 0.00 ? 19  GLY A HA2  4  
ATOM 5684  H HA3  . GLY A 1 19  ? -252.331 -9.625  96.642  1.00 0.00 ? 19  GLY A HA3  4  
ATOM 5685  N N    . PRO A 1 20  ? -254.569 -10.053 95.072  1.00 0.00 ? 20  PRO A N    4  
ATOM 5686  C CA   . PRO A 1 20  ? -255.537 -10.863 94.331  1.00 0.00 ? 20  PRO A CA   4  
ATOM 5687  C C    . PRO A 1 20  ? -255.055 -12.296 94.208  1.00 0.00 ? 20  PRO A C    4  
ATOM 5688  O O    . PRO A 1 20  ? -255.842 -13.232 94.075  1.00 0.00 ? 20  PRO A O    4  
ATOM 5689  C CB   . PRO A 1 20  ? -255.554 -10.197 92.959  1.00 0.00 ? 20  PRO A CB   4  
ATOM 5690  C CG   . PRO A 1 20  ? -254.188 -9.637  92.827  1.00 0.00 ? 20  PRO A CG   4  
ATOM 5691  C CD   . PRO A 1 20  ? -253.853 -9.123  94.189  1.00 0.00 ? 20  PRO A CD   4  
ATOM 5692  H HA   . PRO A 1 20  ? -256.516 -10.834 94.778  1.00 0.00 ? 20  PRO A HA   4  
ATOM 5693  H HB2  . PRO A 1 20  ? -255.753 -10.936 92.201  1.00 0.00 ? 20  PRO A HB2  4  
ATOM 5694  H HB3  . PRO A 1 20  ? -256.307 -9.423  92.932  1.00 0.00 ? 20  PRO A HB3  4  
ATOM 5695  H HG2  . PRO A 1 20  ? -253.497 -10.415 92.538  1.00 0.00 ? 20  PRO A HG2  4  
ATOM 5696  H HG3  . PRO A 1 20  ? -254.177 -8.842  92.112  1.00 0.00 ? 20  PRO A HG3  4  
ATOM 5697  H HD2  . PRO A 1 20  ? -252.796 -9.180  94.356  1.00 0.00 ? 20  PRO A HD2  4  
ATOM 5698  H HD3  . PRO A 1 20  ? -254.208 -8.111  94.318  1.00 0.00 ? 20  PRO A HD3  4  
ATOM 5699  N N    . GLU A 1 21  ? -253.739 -12.430 94.237  1.00 0.00 ? 21  GLU A N    4  
ATOM 5700  C CA   . GLU A 1 21  ? -253.068 -13.722 94.164  1.00 0.00 ? 21  GLU A CA   4  
ATOM 5701  C C    . GLU A 1 21  ? -253.565 -14.667 95.245  1.00 0.00 ? 21  GLU A C    4  
ATOM 5702  O O    . GLU A 1 21  ? -254.068 -14.254 96.287  1.00 0.00 ? 21  GLU A O    4  
ATOM 5703  C CB   . GLU A 1 21  ? -251.557 -13.526 94.295  1.00 0.00 ? 21  GLU A CB   4  
ATOM 5704  C CG   . GLU A 1 21  ? -251.008 -12.417 93.408  1.00 0.00 ? 21  GLU A CG   4  
ATOM 5705  C CD   . GLU A 1 21  ? -249.549 -12.122 93.673  1.00 0.00 ? 21  GLU A CD   4  
ATOM 5706  O OE1  . GLU A 1 21  ? -248.687 -12.913 93.236  1.00 0.00 ? 21  GLU A OE1  4  
ATOM 5707  O OE2  . GLU A 1 21  ? -249.257 -11.086 94.313  1.00 0.00 ? 21  GLU A OE2  4  
ATOM 5708  H H    . GLU A 1 21  ? -253.196 -11.610 94.295  1.00 0.00 ? 21  GLU A H    4  
ATOM 5709  H HA   . GLU A 1 21  ? -253.285 -14.178 93.203  1.00 0.00 ? 21  GLU A HA   4  
ATOM 5710  H HB2  . GLU A 1 21  ? -251.317 -13.307 95.323  1.00 0.00 ? 21  GLU A HB2  4  
ATOM 5711  H HB3  . GLU A 1 21  ? -251.072 -14.446 94.015  1.00 0.00 ? 21  GLU A HB3  4  
ATOM 5712  H HG2  . GLU A 1 21  ? -251.114 -12.712 92.374  1.00 0.00 ? 21  GLU A HG2  4  
ATOM 5713  H HG3  . GLU A 1 21  ? -251.577 -11.517 93.583  1.00 0.00 ? 21  GLU A HG3  4  
ATOM 5714  N N    . PRO A 1 22  ? -253.413 -15.958 94.984  1.00 0.00 ? 22  PRO A N    4  
ATOM 5715  C CA   . PRO A 1 22  ? -253.889 -17.015 95.856  1.00 0.00 ? 22  PRO A CA   4  
ATOM 5716  C C    . PRO A 1 22  ? -252.866 -17.333 96.923  1.00 0.00 ? 22  PRO A C    4  
ATOM 5717  O O    . PRO A 1 22  ? -253.188 -17.707 98.050  1.00 0.00 ? 22  PRO A O    4  
ATOM 5718  C CB   . PRO A 1 22  ? -254.058 -18.197 94.906  1.00 0.00 ? 22  PRO A CB   4  
ATOM 5719  C CG   . PRO A 1 22  ? -253.311 -17.845 93.653  1.00 0.00 ? 22  PRO A CG   4  
ATOM 5720  C CD   . PRO A 1 22  ? -252.734 -16.486 93.804  1.00 0.00 ? 22  PRO A CD   4  
ATOM 5721  H HA   . PRO A 1 22  ? -254.832 -16.766 96.307  1.00 0.00 ? 22  PRO A HA   4  
ATOM 5722  H HB2  . PRO A 1 22  ? -253.652 -19.086 95.365  1.00 0.00 ? 22  PRO A HB2  4  
ATOM 5723  H HB3  . PRO A 1 22  ? -255.107 -18.345 94.703  1.00 0.00 ? 22  PRO A HB3  4  
ATOM 5724  H HG2  . PRO A 1 22  ? -252.528 -18.557 93.483  1.00 0.00 ? 22  PRO A HG2  4  
ATOM 5725  H HG3  . PRO A 1 22  ? -253.979 -17.833 92.836  1.00 0.00 ? 22  PRO A HG3  4  
ATOM 5726  H HD2  . PRO A 1 22  ? -251.667 -16.540 93.949  1.00 0.00 ? 22  PRO A HD2  4  
ATOM 5727  H HD3  . PRO A 1 22  ? -252.961 -15.892 92.934  1.00 0.00 ? 22  PRO A HD3  4  
ATOM 5728  N N    . PHE A 1 23  ? -251.626 -17.180 96.523  1.00 0.00 ? 23  PHE A N    4  
ATOM 5729  C CA   . PHE A 1 23  ? -250.479 -17.372 97.393  1.00 0.00 ? 23  PHE A CA   4  
ATOM 5730  C C    . PHE A 1 23  ? -249.252 -16.761 96.740  1.00 0.00 ? 23  PHE A C    4  
ATOM 5731  O O    . PHE A 1 23  ? -248.990 -16.976 95.557  1.00 0.00 ? 23  PHE A O    4  
ATOM 5732  C CB   . PHE A 1 23  ? -250.254 -18.861 97.719  1.00 0.00 ? 23  PHE A CB   4  
ATOM 5733  C CG   . PHE A 1 23  ? -249.925 -19.732 96.538  1.00 0.00 ? 23  PHE A CG   4  
ATOM 5734  C CD1  . PHE A 1 23  ? -250.928 -20.236 95.724  1.00 0.00 ? 23  PHE A CD1  4  
ATOM 5735  C CD2  . PHE A 1 23  ? -248.610 -20.064 96.259  1.00 0.00 ? 23  PHE A CD2  4  
ATOM 5736  C CE1  . PHE A 1 23  ? -250.622 -21.048 94.653  1.00 0.00 ? 23  PHE A CE1  4  
ATOM 5737  C CE2  . PHE A 1 23  ? -248.298 -20.875 95.187  1.00 0.00 ? 23  PHE A CE2  4  
ATOM 5738  C CZ   . PHE A 1 23  ? -249.305 -21.368 94.383  1.00 0.00 ? 23  PHE A CZ   4  
ATOM 5739  H H    . PHE A 1 23  ? -251.480 -16.914 95.583  1.00 0.00 ? 23  PHE A H    4  
ATOM 5740  H HA   . PHE A 1 23  ? -250.670 -16.843 98.316  1.00 0.00 ? 23  PHE A HA   4  
ATOM 5741  H HB2  . PHE A 1 23  ? -249.439 -18.946 98.419  1.00 0.00 ? 23  PHE A HB2  4  
ATOM 5742  H HB3  . PHE A 1 23  ? -251.151 -19.251 98.178  1.00 0.00 ? 23  PHE A HB3  4  
ATOM 5743  H HD1  . PHE A 1 23  ? -251.957 -19.983 95.934  1.00 0.00 ? 23  PHE A HD1  4  
ATOM 5744  H HD2  . PHE A 1 23  ? -247.822 -19.677 96.889  1.00 0.00 ? 23  PHE A HD2  4  
ATOM 5745  H HE1  . PHE A 1 23  ? -251.414 -21.435 94.025  1.00 0.00 ? 23  PHE A HE1  4  
ATOM 5746  H HE2  . PHE A 1 23  ? -247.267 -21.124 94.976  1.00 0.00 ? 23  PHE A HE2  4  
ATOM 5747  H HZ   . PHE A 1 23  ? -249.064 -22.006 93.544  1.00 0.00 ? 23  PHE A HZ   4  
ATOM 5748  N N    . THR A 1 24  ? -248.540 -15.961 97.499  1.00 0.00 ? 24  THR A N    4  
ATOM 5749  C CA   . THR A 1 24  ? -247.311 -15.363 97.025  1.00 0.00 ? 24  THR A CA   4  
ATOM 5750  C C    . THR A 1 24  ? -246.345 -15.218 98.186  1.00 0.00 ? 24  THR A C    4  
ATOM 5751  O O    . THR A 1 24  ? -246.752 -15.134 99.344  1.00 0.00 ? 24  THR A O    4  
ATOM 5752  C CB   . THR A 1 24  ? -247.546 -14.004 96.322  1.00 0.00 ? 24  THR A CB   4  
ATOM 5753  O OG1  . THR A 1 24  ? -246.306 -13.475 95.841  1.00 0.00 ? 24  THR A OG1  4  
ATOM 5754  C CG2  . THR A 1 24  ? -248.204 -12.998 97.250  1.00 0.00 ? 24  THR A CG2  4  
ATOM 5755  H H    . THR A 1 24  ? -248.839 -15.775 98.417  1.00 0.00 ? 24  THR A H    4  
ATOM 5756  H HA   . THR A 1 24  ? -246.876 -16.043 96.304  1.00 0.00 ? 24  THR A HA   4  
ATOM 5757  H HB   . THR A 1 24  ? -248.202 -14.172 95.479  1.00 0.00 ? 24  THR A HB   4  
ATOM 5758  H HG1  . THR A 1 24  ? -246.481 -12.806 95.162  1.00 0.00 ? 24  THR A HG1  4  
ATOM 5759  H HG21 . THR A 1 24  ? -249.155 -13.386 97.588  1.00 0.00 ? 24  THR A HG21 4  
ATOM 5760  H HG22 . THR A 1 24  ? -247.565 -12.819 98.101  1.00 0.00 ? 24  THR A HG22 4  
ATOM 5761  H HG23 . THR A 1 24  ? -248.363 -12.071 96.719  1.00 0.00 ? 24  THR A HG23 4  
ATOM 5762  N N    . VAL A 1 25  ? -245.073 -15.201 97.869  1.00 0.00 ? 25  VAL A N    4  
ATOM 5763  C CA   . VAL A 1 25  ? -244.025 -15.333 98.860  1.00 0.00 ? 25  VAL A CA   4  
ATOM 5764  C C    . VAL A 1 25  ? -243.226 -14.032 98.957  1.00 0.00 ? 25  VAL A C    4  
ATOM 5765  O O    . VAL A 1 25  ? -242.746 -13.528 97.942  1.00 0.00 ? 25  VAL A O    4  
ATOM 5766  C CB   . VAL A 1 25  ? -243.088 -16.479 98.442  1.00 0.00 ? 25  VAL A CB   4  
ATOM 5767  C CG1  . VAL A 1 25  ? -242.226 -16.953 99.585  1.00 0.00 ? 25  VAL A CG1  4  
ATOM 5768  C CG2  . VAL A 1 25  ? -243.858 -17.632 97.818  1.00 0.00 ? 25  VAL A CG2  4  
ATOM 5769  H H    . VAL A 1 25  ? -244.823 -15.080 96.927  1.00 0.00 ? 25  VAL A H    4  
ATOM 5770  H HA   . VAL A 1 25  ? -244.466 -15.571 99.818  1.00 0.00 ? 25  VAL A HA   4  
ATOM 5771  H HB   . VAL A 1 25  ? -242.439 -16.093 97.702  1.00 0.00 ? 25  VAL A HB   4  
ATOM 5772  H HG11 . VAL A 1 25  ? -241.647 -16.122 99.964  1.00 0.00 ? 25  VAL A HG11 4  
ATOM 5773  H HG12 . VAL A 1 25  ? -242.855 -17.343 100.371 1.00 0.00 ? 25  VAL A HG12 4  
ATOM 5774  H HG13 . VAL A 1 25  ? -241.560 -17.727 99.237  1.00 0.00 ? 25  VAL A HG13 4  
ATOM 5775  H HG21 . VAL A 1 25  ? -244.572 -18.017 98.531  1.00 0.00 ? 25  VAL A HG21 4  
ATOM 5776  H HG22 . VAL A 1 25  ? -244.380 -17.283 96.940  1.00 0.00 ? 25  VAL A HG22 4  
ATOM 5777  H HG23 . VAL A 1 25  ? -243.169 -18.415 97.540  1.00 0.00 ? 25  VAL A HG23 4  
ATOM 5778  N N    . PHE A 1 26  ? -243.076 -13.488 100.160 1.00 0.00 ? 26  PHE A N    4  
ATOM 5779  C CA   . PHE A 1 26  ? -242.313 -12.249 100.330 1.00 0.00 ? 26  PHE A CA   4  
ATOM 5780  C C    . PHE A 1 26  ? -241.043 -12.510 101.115 1.00 0.00 ? 26  PHE A C    4  
ATOM 5781  O O    . PHE A 1 26  ? -241.015 -13.364 102.001 1.00 0.00 ? 26  PHE A O    4  
ATOM 5782  C CB   . PHE A 1 26  ? -243.131 -11.146 101.010 1.00 0.00 ? 26  PHE A CB   4  
ATOM 5783  C CG   . PHE A 1 26  ? -244.468 -10.907 100.367 1.00 0.00 ? 26  PHE A CG   4  
ATOM 5784  C CD1  . PHE A 1 26  ? -245.583 -11.643 100.739 1.00 0.00 ? 26  PHE A CD1  4  
ATOM 5785  C CD2  . PHE A 1 26  ? -244.603 -9.945  99.386  1.00 0.00 ? 26  PHE A CD2  4  
ATOM 5786  C CE1  . PHE A 1 26  ? -246.807 -11.421 100.138 1.00 0.00 ? 26  PHE A CE1  4  
ATOM 5787  C CE2  . PHE A 1 26  ? -245.822 -9.718  98.777  1.00 0.00 ? 26  PHE A CE2  4  
ATOM 5788  C CZ   . PHE A 1 26  ? -246.926 -10.456 99.156  1.00 0.00 ? 26  PHE A CZ   4  
ATOM 5789  H H    . PHE A 1 26  ? -243.470 -13.929 100.944 1.00 0.00 ? 26  PHE A H    4  
ATOM 5790  H HA   . PHE A 1 26  ? -242.032 -11.915 99.350  1.00 0.00 ? 26  PHE A HA   4  
ATOM 5791  H HB2  . PHE A 1 26  ? -243.287 -11.390 102.045 1.00 0.00 ? 26  PHE A HB2  4  
ATOM 5792  H HB3  . PHE A 1 26  ? -242.574 -10.221 100.956 1.00 0.00 ? 26  PHE A HB3  4  
ATOM 5793  H HD1  . PHE A 1 26  ? -245.492 -12.397 101.513 1.00 0.00 ? 26  PHE A HD1  4  
ATOM 5794  H HD2  . PHE A 1 26  ? -243.740 -9.366  99.092  1.00 0.00 ? 26  PHE A HD2  4  
ATOM 5795  H HE1  . PHE A 1 26  ? -247.669 -11.998 100.434 1.00 0.00 ? 26  PHE A HE1  4  
ATOM 5796  H HE2  . PHE A 1 26  ? -245.911 -8.962  98.012  1.00 0.00 ? 26  PHE A HE2  4  
ATOM 5797  H HZ   . PHE A 1 26  ? -247.881 -10.282 98.682  1.00 0.00 ? 26  PHE A HZ   4  
ATOM 5798  N N    . THR A 1 27  ? -239.992 -11.785 100.771 1.00 0.00 ? 27  THR A N    4  
ATOM 5799  C CA   . THR A 1 27  ? -238.682 -12.034 101.341 1.00 0.00 ? 27  THR A CA   4  
ATOM 5800  C C    . THR A 1 27  ? -238.459 -11.214 102.602 1.00 0.00 ? 27  THR A C    4  
ATOM 5801  O O    . THR A 1 27  ? -238.874 -10.058 102.691 1.00 0.00 ? 27  THR A O    4  
ATOM 5802  C CB   . THR A 1 27  ? -237.570 -11.716 100.331 1.00 0.00 ? 27  THR A CB   4  
ATOM 5803  O OG1  . THR A 1 27  ? -238.092 -11.784 98.997  1.00 0.00 ? 27  THR A OG1  4  
ATOM 5804  C CG2  . THR A 1 27  ? -236.428 -12.713 100.474 1.00 0.00 ? 27  THR A CG2  4  
ATOM 5805  H H    . THR A 1 27  ? -240.099 -11.058 100.119 1.00 0.00 ? 27  THR A H    4  
ATOM 5806  H HA   . THR A 1 27  ? -238.623 -13.082 101.590 1.00 0.00 ? 27  THR A HA   4  
ATOM 5807  H HB   . THR A 1 27  ? -237.194 -10.723 100.520 1.00 0.00 ? 27  THR A HB   4  
ATOM 5808  H HG1  . THR A 1 27  ? -238.668 -11.024 98.836  1.00 0.00 ? 27  THR A HG1  4  
ATOM 5809  H HG21 . THR A 1 27  ? -236.812 -13.717 100.330 1.00 0.00 ? 27  THR A HG21 4  
ATOM 5810  H HG22 . THR A 1 27  ? -235.671 -12.504 99.732  1.00 0.00 ? 27  THR A HG22 4  
ATOM 5811  H HG23 . THR A 1 27  ? -235.998 -12.629 101.463 1.00 0.00 ? 27  THR A HG23 4  
ATOM 5812  N N    . ILE A 1 28  ? -237.812 -11.832 103.570 1.00 0.00 ? 28  ILE A N    4  
ATOM 5813  C CA   . ILE A 1 28  ? -237.512 -11.189 104.832 1.00 0.00 ? 28  ILE A CA   4  
ATOM 5814  C C    . ILE A 1 28  ? -236.017 -10.915 104.921 1.00 0.00 ? 28  ILE A C    4  
ATOM 5815  O O    . ILE A 1 28  ? -235.298 -11.123 103.949 1.00 0.00 ? 28  ILE A O    4  
ATOM 5816  C CB   . ILE A 1 28  ? -237.961 -12.071 106.002 1.00 0.00 ? 28  ILE A CB   4  
ATOM 5817  C CG1  . ILE A 1 28  ? -236.951 -13.190 106.264 1.00 0.00 ? 28  ILE A CG1  4  
ATOM 5818  C CG2  . ILE A 1 28  ? -239.330 -12.662 105.685 1.00 0.00 ? 28  ILE A CG2  4  
ATOM 5819  C CD1  . ILE A 1 28  ? -237.278 -14.018 107.476 1.00 0.00 ? 28  ILE A CD1  4  
ATOM 5820  H H    . ILE A 1 28  ? -237.533 -12.762 103.436 1.00 0.00 ? 28  ILE A H    4  
ATOM 5821  H HA   . ILE A 1 28  ? -238.053 -10.262 104.880 1.00 0.00 ? 28  ILE A HA   4  
ATOM 5822  H HB   . ILE A 1 28  ? -238.052 -11.454 106.887 1.00 0.00 ? 28  ILE A HB   4  
ATOM 5823  H HG12 . ILE A 1 28  ? -236.926 -13.849 105.411 1.00 0.00 ? 28  ILE A HG12 4  
ATOM 5824  H HG13 . ILE A 1 28  ? -235.973 -12.757 106.409 1.00 0.00 ? 28  ILE A HG13 4  
ATOM 5825  H HG21 . ILE A 1 28  ? -239.979 -11.879 105.288 1.00 0.00 ? 28  ILE A HG21 4  
ATOM 5826  H HG22 . ILE A 1 28  ? -239.227 -13.447 104.951 1.00 0.00 ? 28  ILE A HG22 4  
ATOM 5827  H HG23 . ILE A 1 28  ? -239.768 -13.056 106.592 1.00 0.00 ? 28  ILE A HG23 4  
ATOM 5828  H HD11 . ILE A 1 28  ? -237.321 -13.375 108.343 1.00 0.00 ? 28  ILE A HD11 4  
ATOM 5829  H HD12 . ILE A 1 28  ? -238.234 -14.495 107.334 1.00 0.00 ? 28  ILE A HD12 4  
ATOM 5830  H HD13 . ILE A 1 28  ? -236.514 -14.769 107.618 1.00 0.00 ? 28  ILE A HD13 4  
ATOM 5831  N N    . ASN A 1 29  ? -235.550 -10.447 106.071 1.00 0.00 ? 29  ASN A N    4  
ATOM 5832  C CA   . ASN A 1 29  ? -234.124 -10.219 106.278 1.00 0.00 ? 29  ASN A CA   4  
ATOM 5833  C C    . ASN A 1 29  ? -233.794 -10.188 107.767 1.00 0.00 ? 29  ASN A C    4  
ATOM 5834  O O    . ASN A 1 29  ? -234.552 -9.640  108.570 1.00 0.00 ? 29  ASN A O    4  
ATOM 5835  C CB   . ASN A 1 29  ? -233.669 -8.917  105.607 1.00 0.00 ? 29  ASN A CB   4  
ATOM 5836  C CG   . ASN A 1 29  ? -234.371 -7.689  106.149 1.00 0.00 ? 29  ASN A CG   4  
ATOM 5837  O OD1  . ASN A 1 29  ? -233.885 -7.034  107.070 1.00 0.00 ? 29  ASN A OD1  4  
ATOM 5838  N ND2  . ASN A 1 29  ? -235.515 -7.366  105.572 1.00 0.00 ? 29  ASN A ND2  4  
ATOM 5839  H H    . ASN A 1 29  ? -236.171 -10.267 106.807 1.00 0.00 ? 29  ASN A H    4  
ATOM 5840  H HA   . ASN A 1 29  ? -233.597 -11.043 105.823 1.00 0.00 ? 29  ASN A HA   4  
ATOM 5841  H HB2  . ASN A 1 29  ? -232.608 -8.795  105.760 1.00 0.00 ? 29  ASN A HB2  4  
ATOM 5842  H HB3  . ASN A 1 29  ? -233.866 -8.980  104.547 1.00 0.00 ? 29  ASN A HB3  4  
ATOM 5843  H HD21 . ASN A 1 29  ? -235.837 -7.929  104.839 1.00 0.00 ? 29  ASN A HD21 4  
ATOM 5844  H HD22 . ASN A 1 29  ? -235.989 -6.582  105.899 1.00 0.00 ? 29  ASN A HD22 4  
ATOM 5845  N N    . GLY A 1 30  ? -232.669 -10.795 108.126 1.00 0.00 ? 30  GLY A N    4  
ATOM 5846  C CA   . GLY A 1 30  ? -232.218 -10.790 109.505 1.00 0.00 ? 30  GLY A CA   4  
ATOM 5847  C C    . GLY A 1 30  ? -233.114 -11.606 110.418 1.00 0.00 ? 30  GLY A C    4  
ATOM 5848  O O    . GLY A 1 30  ? -233.217 -12.825 110.275 1.00 0.00 ? 30  GLY A O    4  
ATOM 5849  H H    . GLY A 1 30  ? -232.152 -11.276 107.450 1.00 0.00 ? 30  GLY A H    4  
ATOM 5850  H HA2  . GLY A 1 30  ? -231.218 -11.194 109.546 1.00 0.00 ? 30  GLY A HA2  4  
ATOM 5851  H HA3  . GLY A 1 30  ? -232.197 -9.769  109.859 1.00 0.00 ? 30  GLY A HA3  4  
ATOM 5852  N N    . GLY A 1 31  ? -233.773 -10.927 111.344 1.00 0.00 ? 31  GLY A N    4  
ATOM 5853  C CA   . GLY A 1 31  ? -234.653 -11.595 112.280 1.00 0.00 ? 31  GLY A CA   4  
ATOM 5854  C C    . GLY A 1 31  ? -236.012 -10.938 112.337 1.00 0.00 ? 31  GLY A C    4  
ATOM 5855  O O    . GLY A 1 31  ? -236.427 -10.428 113.382 1.00 0.00 ? 31  GLY A O    4  
ATOM 5856  H H    . GLY A 1 31  ? -233.670 -9.949  111.386 1.00 0.00 ? 31  GLY A H    4  
ATOM 5857  H HA2  . GLY A 1 31  ? -234.770 -12.625 111.978 1.00 0.00 ? 31  GLY A HA2  4  
ATOM 5858  H HA3  . GLY A 1 31  ? -234.207 -11.563 113.263 1.00 0.00 ? 31  GLY A HA3  4  
ATOM 5859  N N    . THR A 1 32  ? -236.699 -10.930 111.206 1.00 0.00 ? 32  THR A N    4  
ATOM 5860  C CA   . THR A 1 32  ? -238.012 -10.320 111.116 1.00 0.00 ? 32  THR A CA   4  
ATOM 5861  C C    . THR A 1 32  ? -239.036 -11.036 111.975 1.00 0.00 ? 32  THR A C    4  
ATOM 5862  O O    . THR A 1 32  ? -239.178 -12.259 111.900 1.00 0.00 ? 32  THR A O    4  
ATOM 5863  C CB   . THR A 1 32  ? -238.526 -10.315 109.686 1.00 0.00 ? 32  THR A CB   4  
ATOM 5864  O OG1  . THR A 1 32  ? -238.172 -11.549 109.058 1.00 0.00 ? 32  THR A OG1  4  
ATOM 5865  C CG2  . THR A 1 32  ? -237.957 -9.146  108.900 1.00 0.00 ? 32  THR A CG2  4  
ATOM 5866  H H    . THR A 1 32  ? -236.311 -11.346 110.407 1.00 0.00 ? 32  THR A H    4  
ATOM 5867  H HA   . THR A 1 32  ? -237.929 -9.302  111.428 1.00 0.00 ? 32  THR A HA   4  
ATOM 5868  H HB   . THR A 1 32  ? -239.613 -10.220 109.722 1.00 0.00 ? 32  THR A HB   4  
ATOM 5869  H HG1  . THR A 1 32  ? -238.504 -12.282 109.586 1.00 0.00 ? 32  THR A HG1  4  
ATOM 5870  H HG21 . THR A 1 32  ? -238.209 -8.223  109.398 1.00 0.00 ? 32  THR A HG21 4  
ATOM 5871  H HG22 . THR A 1 32  ? -236.884 -9.243  108.837 1.00 0.00 ? 32  THR A HG22 4  
ATOM 5872  H HG23 . THR A 1 32  ? -238.380 -9.147  107.905 1.00 0.00 ? 32  THR A HG23 4  
ATOM 5873  N N    . LYS A 1 33  ? -239.757 -10.273 112.780 1.00 0.00 ? 33  LYS A N    4  
ATOM 5874  C CA   . LYS A 1 33  ? -240.890 -10.812 113.507 1.00 0.00 ? 33  LYS A CA   4  
ATOM 5875  C C    . LYS A 1 33  ? -242.039 -11.008 112.556 1.00 0.00 ? 33  LYS A C    4  
ATOM 5876  O O    . LYS A 1 33  ? -241.972 -10.590 111.408 1.00 0.00 ? 33  LYS A O    4  
ATOM 5877  C CB   . LYS A 1 33  ? -241.347 -9.878  114.615 1.00 0.00 ? 33  LYS A CB   4  
ATOM 5878  C CG   . LYS A 1 33  ? -240.349 -9.721  115.726 1.00 0.00 ? 33  LYS A CG   4  
ATOM 5879  C CD   . LYS A 1 33  ? -239.405 -8.560  115.474 1.00 0.00 ? 33  LYS A CD   4  
ATOM 5880  C CE   . LYS A 1 33  ? -238.132 -8.686  116.300 1.00 0.00 ? 33  LYS A CE   4  
ATOM 5881  N NZ   . LYS A 1 33  ? -237.364 -9.921  115.972 1.00 0.00 ? 33  LYS A NZ   4  
ATOM 5882  H H    . LYS A 1 33  ? -239.526 -9.329  112.878 1.00 0.00 ? 33  LYS A H    4  
ATOM 5883  H HA   . LYS A 1 33  ? -240.605 -11.765 113.930 1.00 0.00 ? 33  LYS A HA   4  
ATOM 5884  H HB2  . LYS A 1 33  ? -241.535 -8.903  114.190 1.00 0.00 ? 33  LYS A HB2  4  
ATOM 5885  H HB3  . LYS A 1 33  ? -242.266 -10.260 115.036 1.00 0.00 ? 33  LYS A HB3  4  
ATOM 5886  H HG2  . LYS A 1 33  ? -240.891 -9.558  116.638 1.00 0.00 ? 33  LYS A HG2  4  
ATOM 5887  H HG3  . LYS A 1 33  ? -239.772 -10.631 115.806 1.00 0.00 ? 33  LYS A HG3  4  
ATOM 5888  H HD2  . LYS A 1 33  ? -239.151 -8.533  114.426 1.00 0.00 ? 33  LYS A HD2  4  
ATOM 5889  H HD3  . LYS A 1 33  ? -239.908 -7.641  115.745 1.00 0.00 ? 33  LYS A HD3  4  
ATOM 5890  H HE2  . LYS A 1 33  ? -237.508 -7.828  116.108 1.00 0.00 ? 33  LYS A HE2  4  
ATOM 5891  H HE3  . LYS A 1 33  ? -238.399 -8.709  117.347 1.00 0.00 ? 33  LYS A HE3  4  
ATOM 5892  H HZ1  . LYS A 1 33  ? -237.962 -10.769 116.100 1.00 0.00 ? 33  LYS A HZ1  4  
ATOM 5893  H HZ2  . LYS A 1 33  ? -237.036 -9.891  114.983 1.00 0.00 ? 33  LYS A HZ2  4  
ATOM 5894  H HZ3  . LYS A 1 33  ? -236.532 -10.002 116.598 1.00 0.00 ? 33  LYS A HZ3  4  
ATOM 5895  N N    . ALA A 1 34  ? -243.109 -11.589 113.048 1.00 0.00 ? 34  ALA A N    4  
ATOM 5896  C CA   . ALA A 1 34  ? -244.313 -11.745 112.249 1.00 0.00 ? 34  ALA A CA   4  
ATOM 5897  C C    . ALA A 1 34  ? -244.935 -10.378 111.966 1.00 0.00 ? 34  ALA A C    4  
ATOM 5898  O O    . ALA A 1 34  ? -245.723 -10.219 111.045 1.00 0.00 ? 34  ALA A O    4  
ATOM 5899  C CB   . ALA A 1 34  ? -245.302 -12.646 112.961 1.00 0.00 ? 34  ALA A CB   4  
ATOM 5900  H H    . ALA A 1 34  ? -243.095 -11.918 113.981 1.00 0.00 ? 34  ALA A H    4  
ATOM 5901  H HA   . ALA A 1 34  ? -244.035 -12.212 111.306 1.00 0.00 ? 34  ALA A HA   4  
ATOM 5902  H HB1  . ALA A 1 34  ? -245.552 -12.219 113.922 1.00 0.00 ? 34  ALA A HB1  4  
ATOM 5903  H HB2  . ALA A 1 34  ? -246.199 -12.742 112.364 1.00 0.00 ? 34  ALA A HB2  4  
ATOM 5904  H HB3  . ALA A 1 34  ? -244.861 -13.622 113.106 1.00 0.00 ? 34  ALA A HB3  4  
ATOM 5905  N N    . LYS A 1 35  ? -244.571 -9.401  112.785 1.00 0.00 ? 35  LYS A N    4  
ATOM 5906  C CA   . LYS A 1 35  ? -245.106 -8.039  112.670 1.00 0.00 ? 35  LYS A CA   4  
ATOM 5907  C C    . LYS A 1 35  ? -244.368 -7.280  111.576 1.00 0.00 ? 35  LYS A C    4  
ATOM 5908  O O    . LYS A 1 35  ? -244.981 -6.733  110.658 1.00 0.00 ? 35  LYS A O    4  
ATOM 5909  C CB   . LYS A 1 35  ? -245.010 -7.291  114.017 1.00 0.00 ? 35  LYS A CB   4  
ATOM 5910  C CG   . LYS A 1 35  ? -243.590 -7.155  114.564 1.00 0.00 ? 35  LYS A CG   4  
ATOM 5911  C CD   . LYS A 1 35  ? -243.550 -6.497  115.940 1.00 0.00 ? 35  LYS A CD   4  
ATOM 5912  C CE   . LYS A 1 35  ? -244.071 -7.423  117.029 1.00 0.00 ? 35  LYS A CE   4  
ATOM 5913  N NZ   . LYS A 1 35  ? -243.924 -6.836  118.386 1.00 0.00 ? 35  LYS A NZ   4  
ATOM 5914  H H    . LYS A 1 35  ? -243.879 -9.591  113.446 1.00 0.00 ? 35  LYS A H    4  
ATOM 5915  H HA   . LYS A 1 35  ? -246.151 -8.116  112.376 1.00 0.00 ? 35  LYS A HA   4  
ATOM 5916  H HB2  . LYS A 1 35  ? -245.414 -6.298  113.889 1.00 0.00 ? 35  LYS A HB2  4  
ATOM 5917  H HB3  . LYS A 1 35  ? -245.606 -7.816  114.751 1.00 0.00 ? 35  LYS A HB3  4  
ATOM 5918  H HG2  . LYS A 1 35  ? -243.150 -8.139  114.639 1.00 0.00 ? 35  LYS A HG2  4  
ATOM 5919  H HG3  . LYS A 1 35  ? -243.011 -6.557  113.874 1.00 0.00 ? 35  LYS A HG3  4  
ATOM 5920  H HD2  . LYS A 1 35  ? -242.530 -6.230  116.171 1.00 0.00 ? 35  LYS A HD2  4  
ATOM 5921  H HD3  . LYS A 1 35  ? -244.159 -5.604  115.919 1.00 0.00 ? 35  LYS A HD3  4  
ATOM 5922  H HE2  . LYS A 1 35  ? -245.115 -7.619  116.847 1.00 0.00 ? 35  LYS A HE2  4  
ATOM 5923  H HE3  . LYS A 1 35  ? -243.519 -8.351  116.984 1.00 0.00 ? 35  LYS A HE3  4  
ATOM 5924  H HZ1  . LYS A 1 35  ? -244.407 -5.914  118.432 1.00 0.00 ? 35  LYS A HZ1  4  
ATOM 5925  H HZ2  . LYS A 1 35  ? -244.348 -7.473  119.101 1.00 0.00 ? 35  LYS A HZ2  4  
ATOM 5926  H HZ3  . LYS A 1 35  ? -242.914 -6.700  118.612 1.00 0.00 ? 35  LYS A HZ3  4  
ATOM 5927  N N    . GLN A 1 36  ? -243.040 -7.282  111.667 1.00 0.00 ? 36  GLN A N    4  
ATOM 5928  C CA   . GLN A 1 36  ? -242.204 -6.695  110.642 1.00 0.00 ? 36  GLN A CA   4  
ATOM 5929  C C    . GLN A 1 36  ? -242.407 -7.454  109.347 1.00 0.00 ? 36  GLN A C    4  
ATOM 5930  O O    . GLN A 1 36  ? -242.150 -6.947  108.256 1.00 0.00 ? 36  GLN A O    4  
ATOM 5931  C CB   . GLN A 1 36  ? -240.735 -6.756  111.060 1.00 0.00 ? 36  GLN A CB   4  
ATOM 5932  C CG   . GLN A 1 36  ? -240.410 -5.937  112.299 1.00 0.00 ? 36  GLN A CG   4  
ATOM 5933  C CD   . GLN A 1 36  ? -240.597 -4.452  112.078 1.00 0.00 ? 36  GLN A CD   4  
ATOM 5934  O OE1  . GLN A 1 36  ? -241.670 -3.900  112.321 1.00 0.00 ? 36  GLN A OE1  4  
ATOM 5935  N NE2  . GLN A 1 36  ? -239.550 -3.798  111.611 1.00 0.00 ? 36  GLN A NE2  4  
ATOM 5936  H H    . GLN A 1 36  ? -242.608 -7.688  112.448 1.00 0.00 ? 36  GLN A H    4  
ATOM 5937  H HA   . GLN A 1 36  ? -242.499 -5.666  110.507 1.00 0.00 ? 36  GLN A HA   4  
ATOM 5938  H HB2  . GLN A 1 36  ? -240.473 -7.783  111.260 1.00 0.00 ? 36  GLN A HB2  4  
ATOM 5939  H HB3  . GLN A 1 36  ? -240.131 -6.393  110.248 1.00 0.00 ? 36  GLN A HB3  4  
ATOM 5940  H HG2  . GLN A 1 36  ? -241.055 -6.246  113.105 1.00 0.00 ? 36  GLN A HG2  4  
ATOM 5941  H HG3  . GLN A 1 36  ? -239.382 -6.119  112.574 1.00 0.00 ? 36  GLN A HG3  4  
ATOM 5942  H HE21 . GLN A 1 36  ? -238.722 -4.314  111.435 1.00 0.00 ? 36  GLN A HE21 4  
ATOM 5943  H HE22 . GLN A 1 36  ? -239.631 -2.830  111.471 1.00 0.00 ? 36  GLN A HE22 4  
ATOM 5944  N N    . LEU A 1 37  ? -242.840 -8.695  109.482 1.00 0.00 ? 37  LEU A N    4  
ATOM 5945  C CA   . LEU A 1 37  ? -243.071 -9.525  108.340 1.00 0.00 ? 37  LEU A CA   4  
ATOM 5946  C C    . LEU A 1 37  ? -244.423 -9.347  107.721 1.00 0.00 ? 37  LEU A C    4  
ATOM 5947  O O    . LEU A 1 37  ? -244.534 -9.379  106.508 1.00 0.00 ? 37  LEU A O    4  
ATOM 5948  C CB   . LEU A 1 37  ? -242.851 -10.972 108.667 1.00 0.00 ? 37  LEU A CB   4  
ATOM 5949  C CG   . LEU A 1 37  ? -241.947 -11.593 107.660 1.00 0.00 ? 37  LEU A CG   4  
ATOM 5950  C CD1  . LEU A 1 37  ? -242.668 -11.669 106.336 1.00 0.00 ? 37  LEU A CD1  4  
ATOM 5951  C CD2  . LEU A 1 37  ? -240.730 -10.711 107.517 1.00 0.00 ? 37  LEU A CD2  4  
ATOM 5952  H H    . LEU A 1 37  ? -242.969 -9.069  110.375 1.00 0.00 ? 37  LEU A H    4  
ATOM 5953  H HA   . LEU A 1 37  ? -242.344 -9.241  107.602 1.00 0.00 ? 37  LEU A HA   4  
ATOM 5954  H HB2  . LEU A 1 37  ? -242.407 -11.051 109.651 1.00 0.00 ? 37  LEU A HB2  4  
ATOM 5955  H HB3  . LEU A 1 37  ? -243.797 -11.490 108.655 1.00 0.00 ? 37  LEU A HB3  4  
ATOM 5956  H HG   . LEU A 1 37  ? -241.649 -12.577 107.981 1.00 0.00 ? 37  LEU A HG   4  
ATOM 5957  H HD11 . LEU A 1 37  ? -243.105 -10.689 106.125 1.00 0.00 ? 37  LEU A HD11 4  
ATOM 5958  H HD12 . LEU A 1 37  ? -241.971 -11.931 105.553 1.00 0.00 ? 37  LEU A HD12 4  
ATOM 5959  H HD13 . LEU A 1 37  ? -243.454 -12.403 106.390 1.00 0.00 ? 37  LEU A HD13 4  
ATOM 5960  H HD21 . LEU A 1 37  ? -240.499 -10.251 108.467 1.00 0.00 ? 37  LEU A HD21 4  
ATOM 5961  H HD22 . LEU A 1 37  ? -239.893 -11.305 107.187 1.00 0.00 ? 37  LEU A HD22 4  
ATOM 5962  H HD23 . LEU A 1 37  ? -240.929 -9.941  106.782 1.00 0.00 ? 37  LEU A HD23 4  
ATOM 5963  N N    . LEU A 1 38  ? -245.452 -9.198  108.518 1.00 0.00 ? 38  LEU A N    4  
ATOM 5964  C CA   . LEU A 1 38  ? -246.751 -8.903  107.970 1.00 0.00 ? 38  LEU A CA   4  
ATOM 5965  C C    . LEU A 1 38  ? -246.588 -7.701  107.038 1.00 0.00 ? 38  LEU A C    4  
ATOM 5966  O O    . LEU A 1 38  ? -247.126 -7.674  105.946 1.00 0.00 ? 38  LEU A O    4  
ATOM 5967  C CB   . LEU A 1 38  ? -247.752 -8.658  109.112 1.00 0.00 ? 38  LEU A CB   4  
ATOM 5968  C CG   . LEU A 1 38  ? -249.237 -8.705  108.726 1.00 0.00 ? 38  LEU A CG   4  
ATOM 5969  C CD1  . LEU A 1 38  ? -249.937 -7.410  109.099 1.00 0.00 ? 38  LEU A CD1  4  
ATOM 5970  C CD2  . LEU A 1 38  ? -249.413 -9.008  107.243 1.00 0.00 ? 38  LEU A CD2  4  
ATOM 5971  H H    . LEU A 1 38  ? -245.342 -9.308  109.487 1.00 0.00 ? 38  LEU A H    4  
ATOM 5972  H HA   . LEU A 1 38  ? -247.074 -9.759  107.378 1.00 0.00 ? 38  LEU A HA   4  
ATOM 5973  H HB2  . LEU A 1 38  ? -247.582 -9.423  109.859 1.00 0.00 ? 38  LEU A HB2  4  
ATOM 5974  H HB3  . LEU A 1 38  ? -247.538 -7.699  109.567 1.00 0.00 ? 38  LEU A HB3  4  
ATOM 5975  H HG   . LEU A 1 38  ? -249.712 -9.500  109.281 1.00 0.00 ? 38  LEU A HG   4  
ATOM 5976  H HD11 . LEU A 1 38  ? -249.468 -6.585  108.582 1.00 0.00 ? 38  LEU A HD11 4  
ATOM 5977  H HD12 . LEU A 1 38  ? -250.977 -7.469  108.812 1.00 0.00 ? 38  LEU A HD12 4  
ATOM 5978  H HD13 . LEU A 1 38  ? -249.866 -7.255  110.164 1.00 0.00 ? 38  LEU A HD13 4  
ATOM 5979  H HD21 . LEU A 1 38  ? -248.847 -9.901  106.980 1.00 0.00 ? 38  LEU A HD21 4  
ATOM 5980  H HD22 . LEU A 1 38  ? -250.457 -9.168  107.025 1.00 0.00 ? 38  LEU A HD22 4  
ATOM 5981  H HD23 . LEU A 1 38  ? -249.044 -8.175  106.658 1.00 0.00 ? 38  LEU A HD23 4  
ATOM 5982  N N    . GLN A 1 39  ? -245.734 -6.779  107.446 1.00 0.00 ? 39  GLN A N    4  
ATOM 5983  C CA   . GLN A 1 39  ? -245.269 -5.707  106.618 1.00 0.00 ? 39  GLN A CA   4  
ATOM 5984  C C    . GLN A 1 39  ? -244.670 -6.206  105.329 1.00 0.00 ? 39  GLN A C    4  
ATOM 5985  O O    . GLN A 1 39  ? -245.032 -5.757  104.267 1.00 0.00 ? 39  GLN A O    4  
ATOM 5986  C CB   . GLN A 1 39  ? -244.147 -5.054  107.355 1.00 0.00 ? 39  GLN A CB   4  
ATOM 5987  C CG   . GLN A 1 39  ? -243.732 -3.782  106.705 1.00 0.00 ? 39  GLN A CG   4  
ATOM 5988  C CD   . GLN A 1 39  ? -242.494 -3.159  107.325 1.00 0.00 ? 39  GLN A CD   4  
ATOM 5989  O OE1  . GLN A 1 39  ? -242.331 -1.941  107.317 1.00 0.00 ? 39  GLN A OE1  4  
ATOM 5990  N NE2  . GLN A 1 39  ? -241.605 -3.990  107.857 1.00 0.00 ? 39  GLN A NE2  4  
ATOM 5991  H H    . GLN A 1 39  ? -245.417 -6.795  108.357 1.00 0.00 ? 39  GLN A H    4  
ATOM 5992  H HA   . GLN A 1 39  ? -246.071 -4.994  106.422 1.00 0.00 ? 39  GLN A HA   4  
ATOM 5993  H HB2  . GLN A 1 39  ? -244.425 -4.903  108.369 1.00 0.00 ? 39  GLN A HB2  4  
ATOM 5994  H HB3  . GLN A 1 39  ? -243.300 -5.724  107.336 1.00 0.00 ? 39  GLN A HB3  4  
ATOM 5995  H HG2  . GLN A 1 39  ? -243.536 -4.022  105.670 1.00 0.00 ? 39  GLN A HG2  4  
ATOM 5996  H HG3  . GLN A 1 39  ? -244.553 -3.088  106.768 1.00 0.00 ? 39  GLN A HG3  4  
ATOM 5997  H HE21 . GLN A 1 39  ? -241.792 -4.954  107.825 1.00 0.00 ? 39  GLN A HE21 4  
ATOM 5998  H HE22 . GLN A 1 39  ? -240.801 -3.606  108.264 1.00 0.00 ? 39  GLN A HE22 4  
ATOM 5999  N N    . GLN A 1 40  ? -243.702 -7.089  105.443 1.00 0.00 ? 40  GLN A N    4  
ATOM 6000  C CA   . GLN A 1 40  ? -243.044 -7.647  104.279 1.00 0.00 ? 40  GLN A CA   4  
ATOM 6001  C C    . GLN A 1 40  ? -244.048 -8.286  103.326 1.00 0.00 ? 40  GLN A C    4  
ATOM 6002  O O    . GLN A 1 40  ? -243.824 -8.355  102.122 1.00 0.00 ? 40  GLN A O    4  
ATOM 6003  C CB   . GLN A 1 40  ? -241.988 -8.661  104.716 1.00 0.00 ? 40  GLN A CB   4  
ATOM 6004  C CG   . GLN A 1 40  ? -240.629 -8.034  104.945 1.00 0.00 ? 40  GLN A CG   4  
ATOM 6005  C CD   . GLN A 1 40  ? -240.211 -7.197  103.760 1.00 0.00 ? 40  GLN A CD   4  
ATOM 6006  O OE1  . GLN A 1 40  ? -239.424 -6.258  103.880 1.00 0.00 ? 40  GLN A OE1  4  
ATOM 6007  N NE2  . GLN A 1 40  ? -240.794 -7.504  102.615 1.00 0.00 ? 40  GLN A NE2  4  
ATOM 6008  H H    . GLN A 1 40  ? -243.416 -7.374  106.339 1.00 0.00 ? 40  GLN A H    4  
ATOM 6009  H HA   . GLN A 1 40  ? -242.547 -6.839  103.765 1.00 0.00 ? 40  GLN A HA   4  
ATOM 6010  H HB2  . GLN A 1 40  ? -242.303 -9.122  105.639 1.00 0.00 ? 40  GLN A HB2  4  
ATOM 6011  H HB3  . GLN A 1 40  ? -241.889 -9.418  103.954 1.00 0.00 ? 40  GLN A HB3  4  
ATOM 6012  H HG2  . GLN A 1 40  ? -240.674 -7.406  105.821 1.00 0.00 ? 40  GLN A HG2  4  
ATOM 6013  H HG3  . GLN A 1 40  ? -239.904 -8.814  105.093 1.00 0.00 ? 40  GLN A HG3  4  
ATOM 6014  H HE21 . GLN A 1 40  ? -241.443 -8.239  102.615 1.00 0.00 ? 40  GLN A HE21 4  
ATOM 6015  H HE22 . GLN A 1 40  ? -240.579 -6.977  101.831 1.00 0.00 ? 40  GLN A HE22 4  
ATOM 6016  N N    . ILE A 1 41  ? -245.150 -8.719  103.894 1.00 0.00 ? 41  ILE A N    4  
ATOM 6017  C CA   . ILE A 1 41  ? -246.247 -9.336  103.173 1.00 0.00 ? 41  ILE A CA   4  
ATOM 6018  C C    . ILE A 1 41  ? -247.136 -8.258  102.534 1.00 0.00 ? 41  ILE A C    4  
ATOM 6019  O O    . ILE A 1 41  ? -247.790 -8.476  101.515 1.00 0.00 ? 41  ILE A O    4  
ATOM 6020  C CB   . ILE A 1 41  ? -247.067 -10.193 104.164 1.00 0.00 ? 41  ILE A CB   4  
ATOM 6021  C CG1  . ILE A 1 41  ? -246.150 -11.184 104.905 1.00 0.00 ? 41  ILE A CG1  4  
ATOM 6022  C CG2  . ILE A 1 41  ? -248.201 -10.924 103.483 1.00 0.00 ? 41  ILE A CG2  4  
ATOM 6023  C CD1  . ILE A 1 41  ? -245.075 -11.833 104.041 1.00 0.00 ? 41  ILE A CD1  4  
ATOM 6024  H H    . ILE A 1 41  ? -245.232 -8.628  104.871 1.00 0.00 ? 41  ILE A H    4  
ATOM 6025  H HA   . ILE A 1 41  ? -245.842 -9.979  102.404 1.00 0.00 ? 41  ILE A HA   4  
ATOM 6026  H HB   . ILE A 1 41  ? -247.502 -9.519  104.893 1.00 0.00 ? 41  ILE A HB   4  
ATOM 6027  H HG12 . ILE A 1 41  ? -245.649 -10.661 105.708 1.00 0.00 ? 41  ILE A HG12 4  
ATOM 6028  H HG13 . ILE A 1 41  ? -246.757 -11.974 105.322 1.00 0.00 ? 41  ILE A HG13 4  
ATOM 6029  H HG21 . ILE A 1 41  ? -248.818 -10.219 102.948 1.00 0.00 ? 41  ILE A HG21 4  
ATOM 6030  H HG22 . ILE A 1 41  ? -247.800 -11.652 102.795 1.00 0.00 ? 41  ILE A HG22 4  
ATOM 6031  H HG23 . ILE A 1 41  ? -248.796 -11.425 104.235 1.00 0.00 ? 41  ILE A HG23 4  
ATOM 6032  H HD11 . ILE A 1 41  ? -244.543 -11.070 103.491 1.00 0.00 ? 41  ILE A HD11 4  
ATOM 6033  H HD12 . ILE A 1 41  ? -244.375 -12.369 104.670 1.00 0.00 ? 41  ILE A HD12 4  
ATOM 6034  H HD13 . ILE A 1 41  ? -245.532 -12.518 103.348 1.00 0.00 ? 41  ILE A HD13 4  
ATOM 6035  N N    . LEU A 1 42  ? -247.136 -7.101  103.169 1.00 0.00 ? 42  LEU A N    4  
ATOM 6036  C CA   . LEU A 1 42  ? -248.001 -5.977  102.830 1.00 0.00 ? 42  LEU A CA   4  
ATOM 6037  C C    . LEU A 1 42  ? -247.357 -5.019  101.833 1.00 0.00 ? 42  LEU A C    4  
ATOM 6038  O O    . LEU A 1 42  ? -248.004 -4.521  100.911 1.00 0.00 ? 42  LEU A O    4  
ATOM 6039  C CB   . LEU A 1 42  ? -248.276 -5.230  104.119 1.00 0.00 ? 42  LEU A CB   4  
ATOM 6040  C CG   . LEU A 1 42  ? -249.130 -6.020  105.098 1.00 0.00 ? 42  LEU A CG   4  
ATOM 6041  C CD1  . LEU A 1 42  ? -249.124 -5.362  106.439 1.00 0.00 ? 42  LEU A CD1  4  
ATOM 6042  C CD2  . LEU A 1 42  ? -250.547 -6.162  104.589 1.00 0.00 ? 42  LEU A CD2  4  
ATOM 6043  H H    . LEU A 1 42  ? -246.515 -6.990  103.918 1.00 0.00 ? 42  LEU A H    4  
ATOM 6044  H HA   . LEU A 1 42  ? -248.932 -6.351  102.453 1.00 0.00 ? 42  LEU A HA   4  
ATOM 6045  H HB2  . LEU A 1 42  ? -247.325 -4.999  104.582 1.00 0.00 ? 42  LEU A HB2  4  
ATOM 6046  H HB3  . LEU A 1 42  ? -248.767 -4.307  103.903 1.00 0.00 ? 42  LEU A HB3  4  
ATOM 6047  H HG   . LEU A 1 42  ? -248.714 -7.010  105.211 1.00 0.00 ? 42  LEU A HG   4  
ATOM 6048  H HD11 . LEU A 1 42  ? -249.451 -4.344  106.331 1.00 0.00 ? 42  LEU A HD11 4  
ATOM 6049  H HD12 . LEU A 1 42  ? -249.789 -5.895  107.097 1.00 0.00 ? 42  LEU A HD12 4  
ATOM 6050  H HD13 . LEU A 1 42  ? -248.123 -5.383  106.834 1.00 0.00 ? 42  LEU A HD13 4  
ATOM 6051  H HD21 . LEU A 1 42  ? -250.979 -5.183  104.455 1.00 0.00 ? 42  LEU A HD21 4  
ATOM 6052  H HD22 . LEU A 1 42  ? -250.535 -6.687  103.646 1.00 0.00 ? 42  LEU A HD22 4  
ATOM 6053  H HD23 . LEU A 1 42  ? -251.126 -6.719  105.308 1.00 0.00 ? 42  LEU A HD23 4  
ATOM 6054  N N    . THR A 1 43  ? -246.075 -4.801  102.048 1.00 0.00 ? 43  THR A N    4  
ATOM 6055  C CA   . THR A 1 43  ? -245.327 -3.687  101.523 1.00 0.00 ? 43  THR A CA   4  
ATOM 6056  C C    . THR A 1 43  ? -245.568 -3.423  100.046 1.00 0.00 ? 43  THR A C    4  
ATOM 6057  O O    . THR A 1 43  ? -245.202 -4.192  99.157  1.00 0.00 ? 43  THR A O    4  
ATOM 6058  C CB   . THR A 1 43  ? -243.816 -3.851  101.811 1.00 0.00 ? 43  THR A CB   4  
ATOM 6059  O OG1  . THR A 1 43  ? -243.095 -2.698  101.363 1.00 0.00 ? 43  THR A OG1  4  
ATOM 6060  C CG2  . THR A 1 43  ? -243.248 -5.102  101.151 1.00 0.00 ? 43  THR A CG2  4  
ATOM 6061  H H    . THR A 1 43  ? -245.599 -5.429  102.610 1.00 0.00 ? 43  THR A H    4  
ATOM 6062  H HA   . THR A 1 43  ? -245.659 -2.814  102.070 1.00 0.00 ? 43  THR A HA   4  
ATOM 6063  H HB   . THR A 1 43  ? -243.686 -3.943  102.880 1.00 0.00 ? 43  THR A HB   4  
ATOM 6064  H HG1  . THR A 1 43  ? -242.148 -2.828  101.531 1.00 0.00 ? 43  THR A HG1  4  
ATOM 6065  H HG21 . THR A 1 43  ? -243.397 -5.045  100.082 1.00 0.00 ? 43  THR A HG21 4  
ATOM 6066  H HG22 . THR A 1 43  ? -242.191 -5.175  101.366 1.00 0.00 ? 43  THR A HG22 4  
ATOM 6067  H HG23 . THR A 1 43  ? -243.755 -5.972  101.539 1.00 0.00 ? 43  THR A HG23 4  
ATOM 6068  N N    . ASN A 1 44  ? -246.237 -2.319  99.829  1.00 0.00 ? 44  ASN A N    4  
ATOM 6069  C CA   . ASN A 1 44  ? -246.375 -1.735  98.502  1.00 0.00 ? 44  ASN A CA   4  
ATOM 6070  C C    . ASN A 1 44  ? -245.106 -0.974  98.167  1.00 0.00 ? 44  ASN A C    4  
ATOM 6071  O O    . ASN A 1 44  ? -244.862 -0.615  97.014  1.00 0.00 ? 44  ASN A O    4  
ATOM 6072  C CB   . ASN A 1 44  ? -247.577 -0.790  98.438  1.00 0.00 ? 44  ASN A CB   4  
ATOM 6073  C CG   . ASN A 1 44  ? -248.878 -1.484  98.063  1.00 0.00 ? 44  ASN A CG   4  
ATOM 6074  O OD1  . ASN A 1 44  ? -249.740 -0.884  97.423  1.00 0.00 ? 44  ASN A OD1  4  
ATOM 6075  N ND2  . ASN A 1 44  ? -249.040 -2.737  98.457  1.00 0.00 ? 44  ASN A ND2  4  
ATOM 6076  H H    . ASN A 1 44  ? -246.654 -1.889  100.597 1.00 0.00 ? 44  ASN A H    4  
ATOM 6077  H HA   . ASN A 1 44  ? -246.508 -2.535  97.790  1.00 0.00 ? 44  ASN A HA   4  
ATOM 6078  H HB2  . ASN A 1 44  ? -247.708 -0.327  99.404  1.00 0.00 ? 44  ASN A HB2  4  
ATOM 6079  H HB3  . ASN A 1 44  ? -247.377 -0.023  97.705  1.00 0.00 ? 44  ASN A HB3  4  
ATOM 6080  H HD21 . ASN A 1 44  ? -248.319 -3.165  98.968  1.00 0.00 ? 44  ASN A HD21 4  
ATOM 6081  H HD22 . ASN A 1 44  ? -249.877 -3.191  98.215  1.00 0.00 ? 44  ASN A HD22 4  
ATOM 6082  N N    . GLU A 1 45  ? -244.321 -0.705  99.214  1.00 0.00 ? 45  GLU A N    4  
ATOM 6083  C CA   . GLU A 1 45  ? -243.004 -0.090  99.095  1.00 0.00 ? 45  GLU A CA   4  
ATOM 6084  C C    . GLU A 1 45  ? -243.067 1.385   98.693  1.00 0.00 ? 45  GLU A C    4  
ATOM 6085  O O    . GLU A 1 45  ? -242.034 2.031   98.524  1.00 0.00 ? 45  GLU A O    4  
ATOM 6086  C CB   . GLU A 1 45  ? -242.157 -0.888  98.120  1.00 0.00 ? 45  GLU A CB   4  
ATOM 6087  C CG   . GLU A 1 45  ? -241.542 -2.137  98.727  1.00 0.00 ? 45  GLU A CG   4  
ATOM 6088  C CD   . GLU A 1 45  ? -240.719 -2.920  97.730  1.00 0.00 ? 45  GLU A CD   4  
ATOM 6089  O OE1  . GLU A 1 45  ? -239.653 -2.424  97.313  1.00 0.00 ? 45  GLU A OE1  4  
ATOM 6090  O OE2  . GLU A 1 45  ? -241.138 -4.031  97.347  1.00 0.00 ? 45  GLU A OE2  4  
ATOM 6091  H H    . GLU A 1 45  ? -244.634 -0.955  100.102 1.00 0.00 ? 45  GLU A H    4  
ATOM 6092  H HA   . GLU A 1 45  ? -242.540 -0.150  100.068 1.00 0.00 ? 45  GLU A HA   4  
ATOM 6093  H HB2  . GLU A 1 45  ? -242.790 -1.192  97.300  1.00 0.00 ? 45  GLU A HB2  4  
ATOM 6094  H HB3  . GLU A 1 45  ? -241.366 -0.260  97.748  1.00 0.00 ? 45  GLU A HB3  4  
ATOM 6095  H HG2  . GLU A 1 45  ? -240.903 -1.844  99.547  1.00 0.00 ? 45  GLU A HG2  4  
ATOM 6096  H HG3  . GLU A 1 45  ? -242.335 -2.770  99.097  1.00 0.00 ? 45  GLU A HG3  4  
ATOM 6097  N N    . GLN A 1 46  ? -244.275 1.920   98.560  1.00 0.00 ? 46  GLN A N    4  
ATOM 6098  C CA   . GLN A 1 46  ? -244.461 3.339   98.301  1.00 0.00 ? 46  GLN A CA   4  
ATOM 6099  C C    . GLN A 1 46  ? -244.108 4.144   99.523  1.00 0.00 ? 46  GLN A C    4  
ATOM 6100  O O    . GLN A 1 46  ? -242.987 4.615   99.708  1.00 0.00 ? 46  GLN A O    4  
ATOM 6101  C CB   . GLN A 1 46  ? -245.909 3.616   97.906  1.00 0.00 ? 46  GLN A CB   4  
ATOM 6102  C CG   . GLN A 1 46  ? -246.318 2.975   96.596  1.00 0.00 ? 46  GLN A CG   4  
ATOM 6103  C CD   . GLN A 1 46  ? -247.715 3.371   96.157  1.00 0.00 ? 46  GLN A CD   4  
ATOM 6104  O OE1  . GLN A 1 46  ? -247.902 4.378   95.474  1.00 0.00 ? 46  GLN A OE1  4  
ATOM 6105  N NE2  . GLN A 1 46  ? -248.702 2.575   96.537  1.00 0.00 ? 46  GLN A NE2  4  
ATOM 6106  H H    . GLN A 1 46  ? -245.061 1.343   98.626  1.00 0.00 ? 46  GLN A H    4  
ATOM 6107  H HA   . GLN A 1 46  ? -243.824 3.628   97.515  1.00 0.00 ? 46  GLN A HA   4  
ATOM 6108  H HB2  . GLN A 1 46  ? -246.560 3.236   98.681  1.00 0.00 ? 46  GLN A HB2  4  
ATOM 6109  H HB3  . GLN A 1 46  ? -246.046 4.674   97.829  1.00 0.00 ? 46  GLN A HB3  4  
ATOM 6110  H HG2  . GLN A 1 46  ? -245.616 3.272   95.834  1.00 0.00 ? 46  GLN A HG2  4  
ATOM 6111  H HG3  . GLN A 1 46  ? -246.286 1.906   96.720  1.00 0.00 ? 46  GLN A HG3  4  
ATOM 6112  H HE21 . GLN A 1 46  ? -248.483 1.790   97.077  1.00 0.00 ? 46  GLN A HE21 4  
ATOM 6113  H HE22 . GLN A 1 46  ? -249.622 2.803   96.256  1.00 0.00 ? 46  GLN A HE22 4  
ATOM 6114  N N    . ASP A 1 47  ? -245.099 4.275   100.348 1.00 0.00 ? 47  ASP A N    4  
ATOM 6115  C CA   . ASP A 1 47  ? -244.925 4.750   101.712 1.00 0.00 ? 47  ASP A CA   4  
ATOM 6116  C C    . ASP A 1 47  ? -244.660 3.523   102.571 1.00 0.00 ? 47  ASP A C    4  
ATOM 6117  O O    . ASP A 1 47  ? -244.693 3.555   103.806 1.00 0.00 ? 47  ASP A O    4  
ATOM 6118  C CB   . ASP A 1 47  ? -246.172 5.504   102.192 1.00 0.00 ? 47  ASP A CB   4  
ATOM 6119  C CG   . ASP A 1 47  ? -245.940 6.245   103.496 1.00 0.00 ? 47  ASP A CG   4  
ATOM 6120  O OD1  . ASP A 1 47  ? -245.181 7.234   103.494 1.00 0.00 ? 47  ASP A OD1  4  
ATOM 6121  O OD2  . ASP A 1 47  ? -246.510 5.842   104.527 1.00 0.00 ? 47  ASP A OD2  4  
ATOM 6122  H H    . ASP A 1 47  ? -245.987 4.033   100.018 1.00 0.00 ? 47  ASP A H    4  
ATOM 6123  H HA   . ASP A 1 47  ? -244.064 5.402   101.742 1.00 0.00 ? 47  ASP A HA   4  
ATOM 6124  H HB2  . ASP A 1 47  ? -246.461 6.223   101.439 1.00 0.00 ? 47  ASP A HB2  4  
ATOM 6125  H HB3  . ASP A 1 47  ? -246.976 4.799   102.337 1.00 0.00 ? 47  ASP A HB3  4  
ATOM 6126  N N    . ILE A 1 48  ? -244.401 2.428   101.848 1.00 0.00 ? 48  ILE A N    4  
ATOM 6127  C CA   . ILE A 1 48  ? -244.156 1.103   102.401 1.00 0.00 ? 48  ILE A CA   4  
ATOM 6128  C C    . ILE A 1 48  ? -245.426 0.466   102.905 1.00 0.00 ? 48  ILE A C    4  
ATOM 6129  O O    . ILE A 1 48  ? -245.782 -0.647  102.518 1.00 0.00 ? 48  ILE A O    4  
ATOM 6130  C CB   . ILE A 1 48  ? -243.094 1.115   103.514 1.00 0.00 ? 48  ILE A CB   4  
ATOM 6131  C CG1  . ILE A 1 48  ? -241.736 1.547   102.946 1.00 0.00 ? 48  ILE A CG1  4  
ATOM 6132  C CG2  . ILE A 1 48  ? -242.998 -0.259  104.167 1.00 0.00 ? 48  ILE A CG2  4  
ATOM 6133  C CD1  . ILE A 1 48  ? -240.636 1.636   103.983 1.00 0.00 ? 48  ILE A CD1  4  
ATOM 6134  H H    . ILE A 1 48  ? -244.365 2.533   100.876 1.00 0.00 ? 48  ILE A H    4  
ATOM 6135  H HA   . ILE A 1 48  ? -243.796 0.506   101.613 1.00 0.00 ? 48  ILE A HA   4  
ATOM 6136  H HB   . ILE A 1 48  ? -243.409 1.825   104.260 1.00 0.00 ? 48  ILE A HB   4  
ATOM 6137  H HG12 . ILE A 1 48  ? -241.426 0.833   102.198 1.00 0.00 ? 48  ILE A HG12 4  
ATOM 6138  H HG13 . ILE A 1 48  ? -241.840 2.519   102.487 1.00 0.00 ? 48  ILE A HG13 4  
ATOM 6139  H HG21 . ILE A 1 48  ? -243.957 -0.530  104.583 1.00 0.00 ? 48  ILE A HG21 4  
ATOM 6140  H HG22 . ILE A 1 48  ? -242.713 -0.988  103.423 1.00 0.00 ? 48  ILE A HG22 4  
ATOM 6141  H HG23 . ILE A 1 48  ? -242.256 -0.234  104.950 1.00 0.00 ? 48  ILE A HG23 4  
ATOM 6142  H HD11 . ILE A 1 48  ? -240.510 0.676   104.464 1.00 0.00 ? 48  ILE A HD11 4  
ATOM 6143  H HD12 . ILE A 1 48  ? -239.713 1.920   103.501 1.00 0.00 ? 48  ILE A HD12 4  
ATOM 6144  H HD13 . ILE A 1 48  ? -240.898 2.379   104.723 1.00 0.00 ? 48  ILE A HD13 4  
ATOM 6145  N N    . LYS A 1 49  ? -246.106 1.214   103.713 1.00 0.00 ? 49  LYS A N    4  
ATOM 6146  C CA   . LYS A 1 49  ? -247.279 0.749   104.420 1.00 0.00 ? 49  LYS A CA   4  
ATOM 6147  C C    . LYS A 1 49  ? -248.549 0.904   103.581 1.00 0.00 ? 49  LYS A C    4  
ATOM 6148  O O    . LYS A 1 49  ? -248.942 2.009   103.205 1.00 0.00 ? 49  LYS A O    4  
ATOM 6149  C CB   . LYS A 1 49  ? -247.409 1.506   105.746 1.00 0.00 ? 49  LYS A CB   4  
ATOM 6150  C CG   . LYS A 1 49  ? -247.664 2.998   105.595 1.00 0.00 ? 49  LYS A CG   4  
ATOM 6151  C CD   . LYS A 1 49  ? -247.602 3.727   106.931 1.00 0.00 ? 49  LYS A CD   4  
ATOM 6152  C CE   . LYS A 1 49  ? -246.174 3.852   107.435 1.00 0.00 ? 49  LYS A CE   4  
ATOM 6153  N NZ   . LYS A 1 49  ? -245.305 4.544   106.445 1.00 0.00 ? 49  LYS A NZ   4  
ATOM 6154  H H    . LYS A 1 49  ? -245.799 2.123   103.840 1.00 0.00 ? 49  LYS A H    4  
ATOM 6155  H HA   . LYS A 1 49  ? -247.136 -0.298  104.636 1.00 0.00 ? 49  LYS A HA   4  
ATOM 6156  H HB2  . LYS A 1 49  ? -248.224 1.083   106.301 1.00 0.00 ? 49  LYS A HB2  4  
ATOM 6157  H HB3  . LYS A 1 49  ? -246.496 1.376   106.308 1.00 0.00 ? 49  LYS A HB3  4  
ATOM 6158  H HG2  . LYS A 1 49  ? -246.917 3.413   104.936 1.00 0.00 ? 49  LYS A HG2  4  
ATOM 6159  H HG3  . LYS A 1 49  ? -248.644 3.140   105.163 1.00 0.00 ? 49  LYS A HG3  4  
ATOM 6160  H HD2  . LYS A 1 49  ? -248.016 4.715   106.808 1.00 0.00 ? 49  LYS A HD2  4  
ATOM 6161  H HD3  . LYS A 1 49  ? -248.186 3.179   107.658 1.00 0.00 ? 49  LYS A HD3  4  
ATOM 6162  H HE2  . LYS A 1 49  ? -246.178 4.415   108.357 1.00 0.00 ? 49  LYS A HE2  4  
ATOM 6163  H HE3  . LYS A 1 49  ? -245.782 2.863   107.618 1.00 0.00 ? 49  LYS A HE3  4  
ATOM 6164  H HZ1  . LYS A 1 49  ? -245.823 5.340   106.008 1.00 0.00 ? 49  LYS A HZ1  4  
ATOM 6165  H HZ2  . LYS A 1 49  ? -244.449 4.921   106.912 1.00 0.00 ? 49  LYS A HZ2  4  
ATOM 6166  H HZ3  . LYS A 1 49  ? -245.015 3.888   105.694 1.00 0.00 ? 49  LYS A HZ3  4  
ATOM 6167  N N    . PRO A 1 50  ? -249.147 -0.229  103.197 1.00 0.00 ? 50  PRO A N    4  
ATOM 6168  C CA   . PRO A 1 50  ? -250.526 -0.296  102.684 1.00 0.00 ? 50  PRO A CA   4  
ATOM 6169  C C    . PRO A 1 50  ? -251.569 0.204   103.665 1.00 0.00 ? 50  PRO A C    4  
ATOM 6170  O O    . PRO A 1 50  ? -251.331 1.097   104.481 1.00 0.00 ? 50  PRO A O    4  
ATOM 6171  C CB   . PRO A 1 50  ? -250.721 -1.800  102.551 1.00 0.00 ? 50  PRO A CB   4  
ATOM 6172  C CG   . PRO A 1 50  ? -249.400 -2.278  102.187 1.00 0.00 ? 50  PRO A CG   4  
ATOM 6173  C CD   . PRO A 1 50  ? -248.505 -1.556  103.128 1.00 0.00 ? 50  PRO A CD   4  
ATOM 6174  H HA   . PRO A 1 50  ? -250.641 0.179   101.724 1.00 0.00 ? 50  PRO A HA   4  
ATOM 6175  H HB2  . PRO A 1 50  ? -251.042 -2.209  103.499 1.00 0.00 ? 50  PRO A HB2  4  
ATOM 6176  H HB3  . PRO A 1 50  ? -251.435 -2.015  101.809 1.00 0.00 ? 50  PRO A HB3  4  
ATOM 6177  H HG2  . PRO A 1 50  ? -249.343 -3.345  102.331 1.00 0.00 ? 50  PRO A HG2  4  
ATOM 6178  H HG3  . PRO A 1 50  ? -249.182 -2.009  101.170 1.00 0.00 ? 50  PRO A HG3  4  
ATOM 6179  H HD2  . PRO A 1 50  ? -248.515 -2.044  104.080 1.00 0.00 ? 50  PRO A HD2  4  
ATOM 6180  H HD3  . PRO A 1 50  ? -247.502 -1.489  102.735 1.00 0.00 ? 50  PRO A HD3  4  
ATOM 6181  N N    . VAL A 1 51  ? -252.728 -0.416  103.574 1.00 0.00 ? 51  VAL A N    4  
ATOM 6182  C CA   . VAL A 1 51  ? -253.770 -0.250  104.568 1.00 0.00 ? 51  VAL A CA   4  
ATOM 6183  C C    . VAL A 1 51  ? -253.579 -1.338  105.609 1.00 0.00 ? 51  VAL A C    4  
ATOM 6184  O O    . VAL A 1 51  ? -254.343 -2.302  105.689 1.00 0.00 ? 51  VAL A O    4  
ATOM 6185  C CB   . VAL A 1 51  ? -255.191 -0.340  103.971 1.00 0.00 ? 51  VAL A CB   4  
ATOM 6186  C CG1  . VAL A 1 51  ? -256.229 0.088   104.998 1.00 0.00 ? 51  VAL A CG1  4  
ATOM 6187  C CG2  . VAL A 1 51  ? -255.308 0.502   102.710 1.00 0.00 ? 51  VAL A CG2  4  
ATOM 6188  H H    . VAL A 1 51  ? -252.869 -1.037  102.818 1.00 0.00 ? 51  VAL A H    4  
ATOM 6189  H HA   . VAL A 1 51  ? -253.645 0.719   105.035 1.00 0.00 ? 51  VAL A HA   4  
ATOM 6190  H HB   . VAL A 1 51  ? -255.381 -1.373  103.712 1.00 0.00 ? 51  VAL A HB   4  
ATOM 6191  H HG11 . VAL A 1 51  ? -256.017 1.094   105.326 1.00 0.00 ? 51  VAL A HG11 4  
ATOM 6192  H HG12 . VAL A 1 51  ? -257.213 0.054   104.555 1.00 0.00 ? 51  VAL A HG12 4  
ATOM 6193  H HG13 . VAL A 1 51  ? -256.193 -0.581  105.845 1.00 0.00 ? 51  VAL A HG13 4  
ATOM 6194  H HG21 . VAL A 1 51  ? -255.088 1.534   102.945 1.00 0.00 ? 51  VAL A HG21 4  
ATOM 6195  H HG22 . VAL A 1 51  ? -254.607 0.145   101.971 1.00 0.00 ? 51  VAL A HG22 4  
ATOM 6196  H HG23 . VAL A 1 51  ? -256.313 0.429   102.319 1.00 0.00 ? 51  VAL A HG23 4  
ATOM 6197  N N    . THR A 1 52  ? -252.506 -1.204  106.362 1.00 0.00 ? 52  THR A N    4  
ATOM 6198  C CA   . THR A 1 52  ? -252.067 -2.238  107.261 1.00 0.00 ? 52  THR A CA   4  
ATOM 6199  C C    . THR A 1 52  ? -252.954 -2.284  108.503 1.00 0.00 ? 52  THR A C    4  
ATOM 6200  O O    . THR A 1 52  ? -252.835 -1.456  109.406 1.00 0.00 ? 52  THR A O    4  
ATOM 6201  C CB   . THR A 1 52  ? -250.587 -2.001  107.613 1.00 0.00 ? 52  THR A CB   4  
ATOM 6202  O OG1  . THR A 1 52  ? -250.409 -0.681  108.145 1.00 0.00 ? 52  THR A OG1  4  
ATOM 6203  C CG2  . THR A 1 52  ? -249.725 -2.164  106.359 1.00 0.00 ? 52  THR A CG2  4  
ATOM 6204  H H    . THR A 1 52  ? -251.993 -0.369  106.321 1.00 0.00 ? 52  THR A H    4  
ATOM 6205  H HA   . THR A 1 52  ? -252.144 -3.181  106.741 1.00 0.00 ? 52  THR A HA   4  
ATOM 6206  H HB   . THR A 1 52  ? -250.280 -2.728  108.344 1.00 0.00 ? 52  THR A HB   4  
ATOM 6207  H HG1  . THR A 1 52  ? -250.793 -0.638  109.037 1.00 0.00 ? 52  THR A HG1  4  
ATOM 6208  H HG21 . THR A 1 52  ? -250.126 -1.551  105.555 1.00 0.00 ? 52  THR A HG21 4  
ATOM 6209  H HG22 . THR A 1 52  ? -248.706 -1.866  106.571 1.00 0.00 ? 52  THR A HG22 4  
ATOM 6210  H HG23 . THR A 1 52  ? -249.735 -3.200  106.048 1.00 0.00 ? 52  THR A HG23 4  
ATOM 6211  N N    . THR A 1 53  ? -253.876 -3.238  108.514 1.00 0.00 ? 53  THR A N    4  
ATOM 6212  C CA   . THR A 1 53  ? -254.896 -3.300  109.544 1.00 0.00 ? 53  THR A CA   4  
ATOM 6213  C C    . THR A 1 53  ? -254.821 -4.607  110.351 1.00 0.00 ? 53  THR A C    4  
ATOM 6214  O O    . THR A 1 53  ? -253.740 -5.153  110.556 1.00 0.00 ? 53  THR A O    4  
ATOM 6215  C CB   . THR A 1 53  ? -256.292 -3.093  108.892 1.00 0.00 ? 53  THR A CB   4  
ATOM 6216  O OG1  . THR A 1 53  ? -257.329 -3.029  109.878 1.00 0.00 ? 53  THR A OG1  4  
ATOM 6217  C CG2  . THR A 1 53  ? -256.605 -4.194  107.890 1.00 0.00 ? 53  THR A CG2  4  
ATOM 6218  H H    . THR A 1 53  ? -253.884 -3.903  107.799 1.00 0.00 ? 53  THR A H    4  
ATOM 6219  H HA   . THR A 1 53  ? -254.724 -2.489  110.221 1.00 0.00 ? 53  THR A HA   4  
ATOM 6220  H HB   . THR A 1 53  ? -256.271 -2.154  108.358 1.00 0.00 ? 53  THR A HB   4  
ATOM 6221  H HG1  . THR A 1 53  ? -257.026 -2.511  110.634 1.00 0.00 ? 53  THR A HG1  4  
ATOM 6222  H HG21 . THR A 1 53  ? -256.589 -5.152  108.388 1.00 0.00 ? 53  THR A HG21 4  
ATOM 6223  H HG22 . THR A 1 53  ? -257.584 -4.024  107.466 1.00 0.00 ? 53  THR A HG22 4  
ATOM 6224  H HG23 . THR A 1 53  ? -255.865 -4.185  107.102 1.00 0.00 ? 53  THR A HG23 4  
ATOM 6225  N N    . ASP A 1 54  ? -255.987 -5.086  110.784 1.00 0.00 ? 54  ASP A N    4  
ATOM 6226  C CA   . ASP A 1 54  ? -256.150 -6.210  111.719 1.00 0.00 ? 54  ASP A CA   4  
ATOM 6227  C C    . ASP A 1 54  ? -255.695 -7.553  111.170 1.00 0.00 ? 54  ASP A C    4  
ATOM 6228  O O    . ASP A 1 54  ? -256.081 -8.608  111.671 1.00 0.00 ? 54  ASP A O    4  
ATOM 6229  C CB   . ASP A 1 54  ? -257.610 -6.330  112.042 1.00 0.00 ? 54  ASP A CB   4  
ATOM 6230  C CG   . ASP A 1 54  ? -258.089 -5.249  112.982 1.00 0.00 ? 54  ASP A CG   4  
ATOM 6231  O OD1  . ASP A 1 54  ? -257.767 -5.323  114.187 1.00 0.00 ? 54  ASP A OD1  4  
ATOM 6232  O OD2  . ASP A 1 54  ? -258.767 -4.310  112.522 1.00 0.00 ? 54  ASP A OD2  4  
ATOM 6233  H H    . ASP A 1 54  ? -256.805 -4.648  110.451 1.00 0.00 ? 54  ASP A H    4  
ATOM 6234  H HA   . ASP A 1 54  ? -255.612 -5.990  112.627 1.00 0.00 ? 54  ASP A HA   4  
ATOM 6235  H HB2  . ASP A 1 54  ? -258.158 -6.259  111.117 1.00 0.00 ? 54  ASP A HB2  4  
ATOM 6236  H HB3  . ASP A 1 54  ? -257.788 -7.291  112.488 1.00 0.00 ? 54  ASP A HB3  4  
ATOM 6237  N N    . TYR A 1 55  ? -254.928 -7.500  110.127 1.00 0.00 ? 55  TYR A N    4  
ATOM 6238  C CA   . TYR A 1 55  ? -254.345 -8.695  109.534 1.00 0.00 ? 55  TYR A CA   4  
ATOM 6239  C C    . TYR A 1 55  ? -253.333 -9.355  110.469 1.00 0.00 ? 55  TYR A C    4  
ATOM 6240  O O    . TYR A 1 55  ? -252.665 -8.687  111.258 1.00 0.00 ? 55  TYR A O    4  
ATOM 6241  C CB   . TYR A 1 55  ? -253.648 -8.348  108.231 1.00 0.00 ? 55  TYR A CB   4  
ATOM 6242  C CG   . TYR A 1 55  ? -254.578 -8.055  107.091 1.00 0.00 ? 55  TYR A CG   4  
ATOM 6243  C CD1  . TYR A 1 55  ? -255.451 -9.021  106.633 1.00 0.00 ? 55  TYR A CD1  4  
ATOM 6244  C CD2  . TYR A 1 55  ? -254.580 -6.815  106.470 1.00 0.00 ? 55  TYR A CD2  4  
ATOM 6245  C CE1  . TYR A 1 55  ? -256.302 -8.770  105.583 1.00 0.00 ? 55  TYR A CE1  4  
ATOM 6246  C CE2  . TYR A 1 55  ? -255.431 -6.550  105.417 1.00 0.00 ? 55  TYR A CE2  4  
ATOM 6247  C CZ   . TYR A 1 55  ? -256.294 -7.534  104.976 1.00 0.00 ? 55  TYR A CZ   4  
ATOM 6248  O OH   . TYR A 1 55  ? -257.148 -7.280  103.926 1.00 0.00 ? 55  TYR A OH   4  
ATOM 6249  H H    . TYR A 1 55  ? -254.749 -6.620  109.740 1.00 0.00 ? 55  TYR A H    4  
ATOM 6250  H HA   . TYR A 1 55  ? -255.143 -9.392  109.330 1.00 0.00 ? 55  TYR A HA   4  
ATOM 6251  H HB2  . TYR A 1 55  ? -253.050 -7.475  108.392 1.00 0.00 ? 55  TYR A HB2  4  
ATOM 6252  H HB3  . TYR A 1 55  ? -253.012 -9.165  107.943 1.00 0.00 ? 55  TYR A HB3  4  
ATOM 6253  H HD1  . TYR A 1 55  ? -255.460 -9.989  107.110 1.00 0.00 ? 55  TYR A HD1  4  
ATOM 6254  H HD2  . TYR A 1 55  ? -253.902 -6.050  106.821 1.00 0.00 ? 55  TYR A HD2  4  
ATOM 6255  H HE1  . TYR A 1 55  ? -256.978 -9.544  105.250 1.00 0.00 ? 55  TYR A HE1  4  
ATOM 6256  H HE2  . TYR A 1 55  ? -255.418 -5.580  104.946 1.00 0.00 ? 55  TYR A HE2  4  
ATOM 6257  H HH   . TYR A 1 55  ? -258.024 -7.613  104.139 1.00 0.00 ? 55  TYR A HH   4  
ATOM 6258  N N    . PHE A 1 56  ? -253.238 -10.672 110.359 1.00 0.00 ? 56  PHE A N    4  
ATOM 6259  C CA   . PHE A 1 56  ? -252.240 -11.458 111.075 1.00 0.00 ? 56  PHE A CA   4  
ATOM 6260  C C    . PHE A 1 56  ? -252.034 -12.771 110.333 1.00 0.00 ? 56  PHE A C    4  
ATOM 6261  O O    . PHE A 1 56  ? -252.717 -13.039 109.363 1.00 0.00 ? 56  PHE A O    4  
ATOM 6262  C CB   . PHE A 1 56  ? -252.650 -11.713 112.538 1.00 0.00 ? 56  PHE A CB   4  
ATOM 6263  C CG   . PHE A 1 56  ? -253.969 -12.407 112.695 1.00 0.00 ? 56  PHE A CG   4  
ATOM 6264  C CD1  . PHE A 1 56  ? -255.147 -11.686 112.621 1.00 0.00 ? 56  PHE A CD1  4  
ATOM 6265  C CD2  . PHE A 1 56  ? -254.036 -13.776 112.916 1.00 0.00 ? 56  PHE A CD2  4  
ATOM 6266  C CE1  . PHE A 1 56  ? -256.367 -12.307 112.761 1.00 0.00 ? 56  PHE A CE1  4  
ATOM 6267  C CE2  . PHE A 1 56  ? -255.261 -14.405 113.055 1.00 0.00 ? 56  PHE A CE2  4  
ATOM 6268  C CZ   . PHE A 1 56  ? -256.430 -13.666 112.977 1.00 0.00 ? 56  PHE A CZ   4  
ATOM 6269  H H    . PHE A 1 56  ? -253.862 -11.143 109.761 1.00 0.00 ? 56  PHE A H    4  
ATOM 6270  H HA   . PHE A 1 56  ? -251.312 -10.906 111.060 1.00 0.00 ? 56  PHE A HA   4  
ATOM 6271  H HB2  . PHE A 1 56  ? -251.900 -12.328 113.011 1.00 0.00 ? 56  PHE A HB2  4  
ATOM 6272  H HB3  . PHE A 1 56  ? -252.709 -10.767 113.057 1.00 0.00 ? 56  PHE A HB3  4  
ATOM 6273  H HD1  . PHE A 1 56  ? -255.103 -10.620 112.452 1.00 0.00 ? 56  PHE A HD1  4  
ATOM 6274  H HD2  . PHE A 1 56  ? -253.113 -14.355 112.981 1.00 0.00 ? 56  PHE A HD2  4  
ATOM 6275  H HE1  . PHE A 1 56  ? -257.277 -11.729 112.699 1.00 0.00 ? 56  PHE A HE1  4  
ATOM 6276  H HE2  . PHE A 1 56  ? -255.306 -15.473 113.224 1.00 0.00 ? 56  PHE A HE2  4  
ATOM 6277  H HZ   . PHE A 1 56  ? -257.390 -14.150 113.081 1.00 0.00 ? 56  PHE A HZ   4  
ATOM 6278  N N    . LEU A 1 57  ? -251.103 -13.584 110.782 1.00 0.00 ? 57  LEU A N    4  
ATOM 6279  C CA   . LEU A 1 57  ? -250.758 -14.824 110.084 1.00 0.00 ? 57  LEU A CA   4  
ATOM 6280  C C    . LEU A 1 57  ? -251.400 -15.966 110.834 1.00 0.00 ? 57  LEU A C    4  
ATOM 6281  O O    . LEU A 1 57  ? -251.915 -15.739 111.909 1.00 0.00 ? 57  LEU A O    4  
ATOM 6282  C CB   . LEU A 1 57  ? -249.231 -15.039 110.018 1.00 0.00 ? 57  LEU A CB   4  
ATOM 6283  C CG   . LEU A 1 57  ? -248.408 -13.960 109.295 1.00 0.00 ? 57  LEU A CG   4  
ATOM 6284  C CD1  . LEU A 1 57  ? -248.638 -12.606 109.923 1.00 0.00 ? 57  LEU A CD1  4  
ATOM 6285  C CD2  . LEU A 1 57  ? -246.927 -14.298 109.326 1.00 0.00 ? 57  LEU A CD2  4  
ATOM 6286  H H    . LEU A 1 57  ? -250.642 -13.363 111.619 1.00 0.00 ? 57  LEU A H    4  
ATOM 6287  H HA   . LEU A 1 57  ? -251.163 -14.781 109.084 1.00 0.00 ? 57  LEU A HA   4  
ATOM 6288  H HB2  . LEU A 1 57  ? -248.862 -15.116 111.029 1.00 0.00 ? 57  LEU A HB2  4  
ATOM 6289  H HB3  . LEU A 1 57  ? -249.050 -15.981 109.523 1.00 0.00 ? 57  LEU A HB3  4  
ATOM 6290  H HG   . LEU A 1 57  ? -248.719 -13.909 108.263 1.00 0.00 ? 57  LEU A HG   4  
ATOM 6291  H HD11 . LEU A 1 57  ? -248.550 -12.697 111.004 1.00 0.00 ? 57  LEU A HD11 4  
ATOM 6292  H HD12 . LEU A 1 57  ? -247.911 -11.899 109.553 1.00 0.00 ? 57  LEU A HD12 4  
ATOM 6293  H HD13 . LEU A 1 57  ? -249.641 -12.275 109.672 1.00 0.00 ? 57  LEU A HD13 4  
ATOM 6294  H HD21 . LEU A 1 57  ? -246.765 -15.259 108.860 1.00 0.00 ? 57  LEU A HD21 4  
ATOM 6295  H HD22 . LEU A 1 57  ? -246.374 -13.538 108.791 1.00 0.00 ? 57  LEU A HD22 4  
ATOM 6296  H HD23 . LEU A 1 57  ? -246.585 -14.331 110.352 1.00 0.00 ? 57  LEU A HD23 4  
ATOM 6297  N N    . MET A 1 58  ? -251.423 -17.164 110.263 1.00 0.00 ? 58  MET A N    4  
ATOM 6298  C CA   . MET A 1 58  ? -251.891 -18.356 110.981 1.00 0.00 ? 58  MET A CA   4  
ATOM 6299  C C    . MET A 1 58  ? -251.346 -19.615 110.333 1.00 0.00 ? 58  MET A C    4  
ATOM 6300  O O    . MET A 1 58  ? -250.998 -19.608 109.153 1.00 0.00 ? 58  MET A O    4  
ATOM 6301  C CB   . MET A 1 58  ? -253.417 -18.485 110.998 1.00 0.00 ? 58  MET A CB   4  
ATOM 6302  C CG   . MET A 1 58  ? -254.181 -17.337 111.632 1.00 0.00 ? 58  MET A CG   4  
ATOM 6303  S SD   . MET A 1 58  ? -255.888 -17.782 111.982 1.00 0.00 ? 58  MET A SD   4  
ATOM 6304  C CE   . MET A 1 58  ? -256.076 -19.116 110.812 1.00 0.00 ? 58  MET A CE   4  
ATOM 6305  H H    . MET A 1 58  ? -251.122 -17.258 109.335 1.00 0.00 ? 58  MET A H    4  
ATOM 6306  H HA   . MET A 1 58  ? -251.529 -18.297 111.997 1.00 0.00 ? 58  MET A HA   4  
ATOM 6307  H HB2  . MET A 1 58  ? -253.762 -18.583 109.981 1.00 0.00 ? 58  MET A HB2  4  
ATOM 6308  H HB3  . MET A 1 58  ? -253.675 -19.388 111.534 1.00 0.00 ? 58  MET A HB3  4  
ATOM 6309  H HG2  . MET A 1 58  ? -253.692 -17.060 112.556 1.00 0.00 ? 58  MET A HG2  4  
ATOM 6310  H HG3  . MET A 1 58  ? -254.175 -16.495 110.955 1.00 0.00 ? 58  MET A HG3  4  
ATOM 6311  H HE1  . MET A 1 58  ? -255.874 -18.748 109.805 1.00 0.00 ? 58  MET A HE1  4  
ATOM 6312  H HE2  . MET A 1 58  ? -255.365 -19.889 111.064 1.00 0.00 ? 58  MET A HE2  4  
ATOM 6313  H HE3  . MET A 1 58  ? -257.077 -19.508 110.866 1.00 0.00 ? 58  MET A HE3  4  
ATOM 6314  N N    . GLU A 1 59  ? -251.270 -20.688 111.108 1.00 0.00 ? 59  GLU A N    4  
ATOM 6315  C CA   . GLU A 1 59  ? -250.947 -22.000 110.568 1.00 0.00 ? 59  GLU A CA   4  
ATOM 6316  C C    . GLU A 1 59  ? -252.216 -22.783 110.273 1.00 0.00 ? 59  GLU A C    4  
ATOM 6317  O O    . GLU A 1 59  ? -253.088 -22.915 111.131 1.00 0.00 ? 59  GLU A O    4  
ATOM 6318  C CB   . GLU A 1 59  ? -250.096 -22.807 111.538 1.00 0.00 ? 59  GLU A CB   4  
ATOM 6319  C CG   . GLU A 1 59  ? -248.622 -22.469 111.503 1.00 0.00 ? 59  GLU A CG   4  
ATOM 6320  C CD   . GLU A 1 59  ? -247.816 -23.422 112.354 1.00 0.00 ? 59  GLU A CD   4  
ATOM 6321  O OE1  . GLU A 1 59  ? -247.795 -24.634 112.040 1.00 0.00 ? 59  GLU A OE1  4  
ATOM 6322  O OE2  . GLU A 1 59  ? -247.233 -22.978 113.359 1.00 0.00 ? 59  GLU A OE2  4  
ATOM 6323  H H    . GLU A 1 59  ? -251.435 -20.599 112.072 1.00 0.00 ? 59  GLU A H    4  
ATOM 6324  H HA   . GLU A 1 59  ? -250.400 -21.858 109.648 1.00 0.00 ? 59  GLU A HA   4  
ATOM 6325  H HB2  . GLU A 1 59  ? -250.456 -22.636 112.541 1.00 0.00 ? 59  GLU A HB2  4  
ATOM 6326  H HB3  . GLU A 1 59  ? -250.207 -23.857 111.302 1.00 0.00 ? 59  GLU A HB3  4  
ATOM 6327  H HG2  . GLU A 1 59  ? -248.275 -22.531 110.485 1.00 0.00 ? 59  GLU A HG2  4  
ATOM 6328  H HG3  . GLU A 1 59  ? -248.482 -21.465 111.876 1.00 0.00 ? 59  GLU A HG3  4  
ATOM 6329  N N    . GLU A 1 60  ? -252.306 -23.309 109.064 1.00 0.00 ? 60  GLU A N    4  
ATOM 6330  C CA   . GLU A 1 60  ? -253.425 -24.154 108.682 1.00 0.00 ? 60  GLU A CA   4  
ATOM 6331  C C    . GLU A 1 60  ? -253.073 -25.626 108.861 1.00 0.00 ? 60  GLU A C    4  
ATOM 6332  O O    . GLU A 1 60  ? -252.206 -26.155 108.164 1.00 0.00 ? 60  GLU A O    4  
ATOM 6333  C CB   . GLU A 1 60  ? -253.817 -23.905 107.225 1.00 0.00 ? 60  GLU A CB   4  
ATOM 6334  C CG   . GLU A 1 60  ? -254.436 -22.544 106.967 1.00 0.00 ? 60  GLU A CG   4  
ATOM 6335  C CD   . GLU A 1 60  ? -255.821 -22.403 107.566 1.00 0.00 ? 60  GLU A CD   4  
ATOM 6336  O OE1  . GLU A 1 60  ? -256.766 -23.026 107.035 1.00 0.00 ? 60  GLU A OE1  4  
ATOM 6337  O OE2  . GLU A 1 60  ? -255.975 -21.671 108.560 1.00 0.00 ? 60  GLU A OE2  4  
ATOM 6338  H H    . GLU A 1 60  ? -251.611 -23.105 108.404 1.00 0.00 ? 60  GLU A H    4  
ATOM 6339  H HA   . GLU A 1 60  ? -254.261 -23.912 109.320 1.00 0.00 ? 60  GLU A HA   4  
ATOM 6340  H HB2  . GLU A 1 60  ? -252.934 -23.993 106.610 1.00 0.00 ? 60  GLU A HB2  4  
ATOM 6341  H HB3  . GLU A 1 60  ? -254.527 -24.662 106.924 1.00 0.00 ? 60  GLU A HB3  4  
ATOM 6342  H HG2  . GLU A 1 60  ? -253.799 -21.786 107.397 1.00 0.00 ? 60  GLU A HG2  4  
ATOM 6343  H HG3  . GLU A 1 60  ? -254.505 -22.392 105.899 1.00 0.00 ? 60  GLU A HG3  4  
ATOM 6344  N N    . LYS A 1 61  ? -253.728 -26.278 109.810 1.00 0.00 ? 61  LYS A N    4  
ATOM 6345  C CA   . LYS A 1 61  ? -253.597 -27.714 109.962 1.00 0.00 ? 61  LYS A CA   4  
ATOM 6346  C C    . LYS A 1 61  ? -254.734 -28.391 109.216 1.00 0.00 ? 61  LYS A C    4  
ATOM 6347  O O    . LYS A 1 61  ? -255.888 -28.340 109.637 1.00 0.00 ? 61  LYS A O    4  
ATOM 6348  C CB   . LYS A 1 61  ? -253.598 -28.126 111.444 1.00 0.00 ? 61  LYS A CB   4  
ATOM 6349  C CG   . LYS A 1 61  ? -252.276 -27.875 112.168 1.00 0.00 ? 61  LYS A CG   4  
ATOM 6350  C CD   . LYS A 1 61  ? -251.956 -26.392 112.305 1.00 0.00 ? 61  LYS A CD   4  
ATOM 6351  C CE   . LYS A 1 61  ? -250.657 -26.160 113.065 1.00 0.00 ? 61  LYS A CE   4  
ATOM 6352  N NZ   . LYS A 1 61  ? -249.475 -26.735 112.364 1.00 0.00 ? 61  LYS A NZ   4  
ATOM 6353  H H    . LYS A 1 61  ? -254.325 -25.783 110.418 1.00 0.00 ? 61  LYS A H    4  
ATOM 6354  H HA   . LYS A 1 61  ? -252.660 -28.010 109.514 1.00 0.00 ? 61  LYS A HA   4  
ATOM 6355  H HB2  . LYS A 1 61  ? -254.372 -27.574 111.956 1.00 0.00 ? 61  LYS A HB2  4  
ATOM 6356  H HB3  . LYS A 1 61  ? -253.823 -29.182 111.512 1.00 0.00 ? 61  LYS A HB3  4  
ATOM 6357  H HG2  . LYS A 1 61  ? -252.333 -28.306 113.156 1.00 0.00 ? 61  LYS A HG2  4  
ATOM 6358  H HG3  . LYS A 1 61  ? -251.482 -28.352 111.614 1.00 0.00 ? 61  LYS A HG3  4  
ATOM 6359  H HD2  . LYS A 1 61  ? -251.863 -25.961 111.318 1.00 0.00 ? 61  LYS A HD2  4  
ATOM 6360  H HD3  . LYS A 1 61  ? -252.763 -25.908 112.835 1.00 0.00 ? 61  LYS A HD3  4  
ATOM 6361  H HE2  . LYS A 1 61  ? -250.510 -25.097 113.179 1.00 0.00 ? 61  LYS A HE2  4  
ATOM 6362  H HE3  . LYS A 1 61  ? -250.745 -26.615 114.041 1.00 0.00 ? 61  LYS A HE3  4  
ATOM 6363  H HZ1  . LYS A 1 61  ? -249.744 -27.092 111.425 1.00 0.00 ? 61  LYS A HZ1  4  
ATOM 6364  H HZ2  . LYS A 1 61  ? -248.734 -26.004 112.251 1.00 0.00 ? 61  LYS A HZ2  4  
ATOM 6365  H HZ3  . LYS A 1 61  ? -249.077 -27.527 112.927 1.00 0.00 ? 61  LYS A HZ3  4  
ATOM 6366  N N    . TYR A 1 62  ? -254.399 -28.996 108.085 1.00 0.00 ? 62  TYR A N    4  
ATOM 6367  C CA   . TYR A 1 62  ? -255.395 -29.611 107.224 1.00 0.00 ? 62  TYR A CA   4  
ATOM 6368  C C    . TYR A 1 62  ? -256.018 -30.822 107.909 1.00 0.00 ? 62  TYR A C    4  
ATOM 6369  O O    . TYR A 1 62  ? -255.331 -31.576 108.602 1.00 0.00 ? 62  TYR A O    4  
ATOM 6370  C CB   . TYR A 1 62  ? -254.760 -30.015 105.890 1.00 0.00 ? 62  TYR A CB   4  
ATOM 6371  C CG   . TYR A 1 62  ? -255.766 -30.253 104.786 1.00 0.00 ? 62  TYR A CG   4  
ATOM 6372  C CD1  . TYR A 1 62  ? -256.387 -29.185 104.150 1.00 0.00 ? 62  TYR A CD1  4  
ATOM 6373  C CD2  . TYR A 1 62  ? -256.089 -31.540 104.373 1.00 0.00 ? 62  TYR A CD2  4  
ATOM 6374  C CE1  . TYR A 1 62  ? -257.301 -29.392 103.136 1.00 0.00 ? 62  TYR A CE1  4  
ATOM 6375  C CE2  . TYR A 1 62  ? -257.004 -31.755 103.358 1.00 0.00 ? 62  TYR A CE2  4  
ATOM 6376  C CZ   . TYR A 1 62  ? -257.606 -30.676 102.743 1.00 0.00 ? 62  TYR A CZ   4  
ATOM 6377  O OH   . TYR A 1 62  ? -258.512 -30.883 101.730 1.00 0.00 ? 62  TYR A OH   4  
ATOM 6378  H H    . TYR A 1 62  ? -253.461 -29.019 107.820 1.00 0.00 ? 62  TYR A H    4  
ATOM 6379  H HA   . TYR A 1 62  ? -256.168 -28.881 107.038 1.00 0.00 ? 62  TYR A HA   4  
ATOM 6380  H HB2  . TYR A 1 62  ? -254.094 -29.229 105.563 1.00 0.00 ? 62  TYR A HB2  4  
ATOM 6381  H HB3  . TYR A 1 62  ? -254.196 -30.925 106.027 1.00 0.00 ? 62  TYR A HB3  4  
ATOM 6382  H HD1  . TYR A 1 62  ? -256.147 -28.179 104.459 1.00 0.00 ? 62  TYR A HD1  4  
ATOM 6383  H HD2  . TYR A 1 62  ? -255.615 -32.381 104.857 1.00 0.00 ? 62  TYR A HD2  4  
ATOM 6384  H HE1  . TYR A 1 62  ? -257.772 -28.547 102.654 1.00 0.00 ? 62  TYR A HE1  4  
ATOM 6385  H HE2  . TYR A 1 62  ? -257.243 -32.763 103.051 1.00 0.00 ? 62  TYR A HE2  4  
ATOM 6386  H HH   . TYR A 1 62  ? -258.360 -30.230 101.024 1.00 0.00 ? 62  TYR A HH   4  
ATOM 6387  N N    . PHE A 1 63  ? -257.317 -30.993 107.717 1.00 0.00 ? 63  PHE A N    4  
ATOM 6388  C CA   . PHE A 1 63  ? -258.055 -32.060 108.371 1.00 0.00 ? 63  PHE A CA   4  
ATOM 6389  C C    . PHE A 1 63  ? -257.754 -33.413 107.730 1.00 0.00 ? 63  PHE A C    4  
ATOM 6390  O O    . PHE A 1 63  ? -258.339 -33.782 106.714 1.00 0.00 ? 63  PHE A O    4  
ATOM 6391  C CB   . PHE A 1 63  ? -259.558 -31.773 108.323 1.00 0.00 ? 63  PHE A CB   4  
ATOM 6392  C CG   . PHE A 1 63  ? -260.388 -32.740 109.123 1.00 0.00 ? 63  PHE A CG   4  
ATOM 6393  C CD1  . PHE A 1 63  ? -260.510 -32.597 110.496 1.00 0.00 ? 63  PHE A CD1  4  
ATOM 6394  C CD2  . PHE A 1 63  ? -261.048 -33.791 108.502 1.00 0.00 ? 63  PHE A CD2  4  
ATOM 6395  C CE1  . PHE A 1 63  ? -261.271 -33.483 111.232 1.00 0.00 ? 63  PHE A CE1  4  
ATOM 6396  C CE2  . PHE A 1 63  ? -261.812 -34.678 109.237 1.00 0.00 ? 63  PHE A CE2  4  
ATOM 6397  C CZ   . PHE A 1 63  ? -261.924 -34.523 110.602 1.00 0.00 ? 63  PHE A CZ   4  
ATOM 6398  H H    . PHE A 1 63  ? -257.794 -30.385 107.117 1.00 0.00 ? 63  PHE A H    4  
ATOM 6399  H HA   . PHE A 1 63  ? -257.739 -32.092 109.403 1.00 0.00 ? 63  PHE A HA   4  
ATOM 6400  H HB2  . PHE A 1 63  ? -259.741 -30.781 108.709 1.00 0.00 ? 63  PHE A HB2  4  
ATOM 6401  H HB3  . PHE A 1 63  ? -259.893 -31.818 107.296 1.00 0.00 ? 63  PHE A HB3  4  
ATOM 6402  H HD1  . PHE A 1 63  ? -260.000 -31.785 110.991 1.00 0.00 ? 63  PHE A HD1  4  
ATOM 6403  H HD2  . PHE A 1 63  ? -260.961 -33.912 107.434 1.00 0.00 ? 63  PHE A HD2  4  
ATOM 6404  H HE1  . PHE A 1 63  ? -261.358 -33.360 112.302 1.00 0.00 ? 63  PHE A HE1  4  
ATOM 6405  H HE2  . PHE A 1 63  ? -262.323 -35.493 108.742 1.00 0.00 ? 63  PHE A HE2  4  
ATOM 6406  H HZ   . PHE A 1 63  ? -262.522 -35.214 111.177 1.00 0.00 ? 63  PHE A HZ   4  
ATOM 6407  N N    . ILE A 1 64  ? -256.806 -34.127 108.318 1.00 0.00 ? 64  ILE A N    4  
ATOM 6408  C CA   . ILE A 1 64  ? -256.502 -35.492 107.912 1.00 0.00 ? 64  ILE A CA   4  
ATOM 6409  C C    . ILE A 1 64  ? -256.866 -36.434 109.055 1.00 0.00 ? 64  ILE A C    4  
ATOM 6410  O O    . ILE A 1 64  ? -256.645 -37.644 109.009 1.00 0.00 ? 64  ILE A O    4  
ATOM 6411  C CB   . ILE A 1 64  ? -255.005 -35.644 107.530 1.00 0.00 ? 64  ILE A CB   4  
ATOM 6412  C CG1  . ILE A 1 64  ? -254.592 -34.536 106.555 1.00 0.00 ? 64  ILE A CG1  4  
ATOM 6413  C CG2  . ILE A 1 64  ? -254.732 -37.011 106.913 1.00 0.00 ? 64  ILE A CG2  4  
ATOM 6414  C CD1  . ILE A 1 64  ? -253.132 -34.582 106.153 1.00 0.00 ? 64  ILE A CD1  4  
ATOM 6415  H H    . ILE A 1 64  ? -256.285 -33.718 109.043 1.00 0.00 ? 64  ILE A H    4  
ATOM 6416  H HA   . ILE A 1 64  ? -257.111 -35.729 107.056 1.00 0.00 ? 64  ILE A HA   4  
ATOM 6417  H HB   . ILE A 1 64  ? -254.416 -35.558 108.432 1.00 0.00 ? 64  ILE A HB   4  
ATOM 6418  H HG12 . ILE A 1 64  ? -255.183 -34.619 105.655 1.00 0.00 ? 64  ILE A HG12 4  
ATOM 6419  H HG13 . ILE A 1 64  ? -254.780 -33.575 107.014 1.00 0.00 ? 64  ILE A HG13 4  
ATOM 6420  H HG21 . ILE A 1 64  ? -255.337 -37.131 106.027 1.00 0.00 ? 64  ILE A HG21 4  
ATOM 6421  H HG22 . ILE A 1 64  ? -253.688 -37.086 106.649 1.00 0.00 ? 64  ILE A HG22 4  
ATOM 6422  H HG23 . ILE A 1 64  ? -254.980 -37.783 107.626 1.00 0.00 ? 64  ILE A HG23 4  
ATOM 6423  H HD11 . ILE A 1 64  ? -252.918 -35.528 105.679 1.00 0.00 ? 64  ILE A HD11 4  
ATOM 6424  H HD12 . ILE A 1 64  ? -252.921 -33.778 105.465 1.00 0.00 ? 64  ILE A HD12 4  
ATOM 6425  H HD13 . ILE A 1 64  ? -252.513 -34.473 107.033 1.00 0.00 ? 64  ILE A HD13 4  
ATOM 6426  N N    . SER A 1 65  ? -257.476 -35.842 110.064 1.00 0.00 ? 65  SER A N    4  
ATOM 6427  C CA   . SER A 1 65  ? -257.826 -36.528 111.298 1.00 0.00 ? 65  SER A CA   4  
ATOM 6428  C C    . SER A 1 65  ? -258.911 -37.580 111.073 1.00 0.00 ? 65  SER A C    4  
ATOM 6429  O O    . SER A 1 65  ? -259.998 -37.275 110.577 1.00 0.00 ? 65  SER A O    4  
ATOM 6430  C CB   . SER A 1 65  ? -258.306 -35.499 112.312 1.00 0.00 ? 65  SER A CB   4  
ATOM 6431  O OG   . SER A 1 65  ? -257.349 -34.468 112.479 1.00 0.00 ? 65  SER A OG   4  
ATOM 6432  H H    . SER A 1 65  ? -257.708 -34.896 109.970 1.00 0.00 ? 65  SER A H    4  
ATOM 6433  H HA   . SER A 1 65  ? -256.939 -37.008 111.679 1.00 0.00 ? 65  SER A HA   4  
ATOM 6434  H HB2  . SER A 1 65  ? -259.232 -35.062 111.968 1.00 0.00 ? 65  SER A HB2  4  
ATOM 6435  H HB3  . SER A 1 65  ? -258.467 -35.981 113.265 1.00 0.00 ? 65  SER A HB3  4  
ATOM 6436  H HG   . SER A 1 65  ? -256.763 -34.693 113.214 1.00 0.00 ? 65  SER A HG   4  
ATOM 6437  N N    . LYS A 1 66  ? -258.613 -38.821 111.439 1.00 0.00 ? 66  LYS A N    4  
ATOM 6438  C CA   . LYS A 1 66  ? -259.567 -39.909 111.280 1.00 0.00 ? 66  LYS A CA   4  
ATOM 6439  C C    . LYS A 1 66  ? -259.844 -40.599 112.615 1.00 0.00 ? 66  LYS A C    4  
ATOM 6440  O O    . LYS A 1 66  ? -260.682 -41.501 112.688 1.00 0.00 ? 66  LYS A O    4  
ATOM 6441  C CB   . LYS A 1 66  ? -259.041 -40.932 110.269 1.00 0.00 ? 66  LYS A CB   4  
ATOM 6442  C CG   . LYS A 1 66  ? -258.598 -40.317 108.953 1.00 0.00 ? 66  LYS A CG   4  
ATOM 6443  C CD   . LYS A 1 66  ? -258.126 -41.374 107.971 1.00 0.00 ? 66  LYS A CD   4  
ATOM 6444  C CE   . LYS A 1 66  ? -257.533 -40.745 106.722 1.00 0.00 ? 66  LYS A CE   4  
ATOM 6445  N NZ   . LYS A 1 66  ? -258.488 -39.823 106.051 1.00 0.00 ? 66  LYS A NZ   4  
ATOM 6446  H H    . LYS A 1 66  ? -257.724 -39.011 111.813 1.00 0.00 ? 66  LYS A H    4  
ATOM 6447  H HA   . LYS A 1 66  ? -260.489 -39.490 110.906 1.00 0.00 ? 66  LYS A HA   4  
ATOM 6448  H HB2  . LYS A 1 66  ? -258.195 -41.447 110.702 1.00 0.00 ? 66  LYS A HB2  4  
ATOM 6449  H HB3  . LYS A 1 66  ? -259.821 -41.651 110.062 1.00 0.00 ? 66  LYS A HB3  4  
ATOM 6450  H HG2  . LYS A 1 66  ? -259.429 -39.782 108.518 1.00 0.00 ? 66  LYS A HG2  4  
ATOM 6451  H HG3  . LYS A 1 66  ? -257.788 -39.628 109.145 1.00 0.00 ? 66  LYS A HG3  4  
ATOM 6452  H HD2  . LYS A 1 66  ? -257.370 -41.982 108.449 1.00 0.00 ? 66  LYS A HD2  4  
ATOM 6453  H HD3  . LYS A 1 66  ? -258.965 -41.993 107.690 1.00 0.00 ? 66  LYS A HD3  4  
ATOM 6454  H HE2  . LYS A 1 66  ? -256.648 -40.192 106.997 1.00 0.00 ? 66  LYS A HE2  4  
ATOM 6455  H HE3  . LYS A 1 66  ? -257.262 -41.532 106.032 1.00 0.00 ? 66  LYS A HE3  4  
ATOM 6456  H HZ1  . LYS A 1 66  ? -258.778 -39.072 106.706 1.00 0.00 ? 66  LYS A HZ1  4  
ATOM 6457  H HZ2  . LYS A 1 66  ? -258.037 -39.387 105.216 1.00 0.00 ? 66  LYS A HZ2  4  
ATOM 6458  H HZ3  . LYS A 1 66  ? -259.338 -40.346 105.740 1.00 0.00 ? 66  LYS A HZ3  4  
ATOM 6459  N N    . GLU A 1 67  ? -259.140 -40.157 113.664 1.00 0.00 ? 67  GLU A N    4  
ATOM 6460  C CA   . GLU A 1 67  ? -259.210 -40.791 114.984 1.00 0.00 ? 67  GLU A CA   4  
ATOM 6461  C C    . GLU A 1 67  ? -258.785 -42.258 114.890 1.00 0.00 ? 67  GLU A C    4  
ATOM 6462  O O    . GLU A 1 67  ? -258.041 -42.627 113.976 1.00 0.00 ? 67  GLU A O    4  
ATOM 6463  C CB   . GLU A 1 67  ? -260.618 -40.644 115.576 1.00 0.00 ? 67  GLU A CB   4  
ATOM 6464  C CG   . GLU A 1 67  ? -260.831 -39.335 116.320 1.00 0.00 ? 67  GLU A CG   4  
ATOM 6465  C CD   . GLU A 1 67  ? -259.917 -39.188 117.527 1.00 0.00 ? 67  GLU A CD   4  
ATOM 6466  O OE1  . GLU A 1 67  ? -260.057 -39.981 118.482 1.00 0.00 ? 67  GLU A OE1  4  
ATOM 6467  O OE2  . GLU A 1 67  ? -259.060 -38.280 117.531 1.00 0.00 ? 67  GLU A OE2  4  
ATOM 6468  H H    . GLU A 1 67  ? -258.556 -39.379 113.551 1.00 0.00 ? 67  GLU A H    4  
ATOM 6469  H HA   . GLU A 1 67  ? -258.510 -40.275 115.626 1.00 0.00 ? 67  GLU A HA   4  
ATOM 6470  H HB2  . GLU A 1 67  ? -261.337 -40.695 114.774 1.00 0.00 ? 67  GLU A HB2  4  
ATOM 6471  H HB3  . GLU A 1 67  ? -260.804 -41.454 116.261 1.00 0.00 ? 67  GLU A HB3  4  
ATOM 6472  H HG2  . GLU A 1 67  ? -260.638 -38.516 115.642 1.00 0.00 ? 67  GLU A HG2  4  
ATOM 6473  H HG3  . GLU A 1 67  ? -261.856 -39.289 116.654 1.00 0.00 ? 67  GLU A HG3  4  
ATOM 6474  N N    . LYS A 1 68  ? -259.207 -43.070 115.863 1.00 0.00 ? 68  LYS A N    4  
ATOM 6475  C CA   . LYS A 1 68  ? -258.965 -44.512 115.849 1.00 0.00 ? 68  LYS A CA   4  
ATOM 6476  C C    . LYS A 1 68  ? -257.515 -44.835 116.191 1.00 0.00 ? 68  LYS A C    4  
ATOM 6477  O O    . LYS A 1 68  ? -257.206 -45.194 117.325 1.00 0.00 ? 68  LYS A O    4  
ATOM 6478  C CB   . LYS A 1 68  ? -259.347 -45.132 114.495 1.00 0.00 ? 68  LYS A CB   4  
ATOM 6479  C CG   . LYS A 1 68  ? -260.827 -45.014 114.160 1.00 0.00 ? 68  LYS A CG   4  
ATOM 6480  C CD   . LYS A 1 68  ? -261.674 -45.948 115.009 1.00 0.00 ? 68  LYS A CD   4  
ATOM 6481  C CE   . LYS A 1 68  ? -261.422 -47.408 114.656 1.00 0.00 ? 68  LYS A CE   4  
ATOM 6482  N NZ   . LYS A 1 68  ? -261.690 -47.685 113.218 1.00 0.00 ? 68  LYS A NZ   4  
ATOM 6483  H H    . LYS A 1 68  ? -259.676 -42.684 116.629 1.00 0.00 ? 68  LYS A H    4  
ATOM 6484  H HA   . LYS A 1 68  ? -259.590 -44.947 116.610 1.00 0.00 ? 68  LYS A HA   4  
ATOM 6485  H HB2  . LYS A 1 68  ? -258.786 -44.638 113.717 1.00 0.00 ? 68  LYS A HB2  4  
ATOM 6486  H HB3  . LYS A 1 68  ? -259.087 -46.180 114.507 1.00 0.00 ? 68  LYS A HB3  4  
ATOM 6487  H HG2  . LYS A 1 68  ? -261.145 -43.998 114.338 1.00 0.00 ? 68  LYS A HG2  4  
ATOM 6488  H HG3  . LYS A 1 68  ? -260.969 -45.260 113.118 1.00 0.00 ? 68  LYS A HG3  4  
ATOM 6489  H HD2  . LYS A 1 68  ? -261.432 -45.793 116.050 1.00 0.00 ? 68  LYS A HD2  4  
ATOM 6490  H HD3  . LYS A 1 68  ? -262.718 -45.721 114.842 1.00 0.00 ? 68  LYS A HD3  4  
ATOM 6491  H HE2  . LYS A 1 68  ? -260.391 -47.644 114.873 1.00 0.00 ? 68  LYS A HE2  4  
ATOM 6492  H HE3  . LYS A 1 68  ? -262.069 -48.027 115.259 1.00 0.00 ? 68  LYS A HE3  4  
ATOM 6493  H HZ1  . LYS A 1 68  ? -262.648 -47.357 112.963 1.00 0.00 ? 68  LYS A HZ1  4  
ATOM 6494  H HZ2  . LYS A 1 68  ? -260.995 -47.187 112.620 1.00 0.00 ? 68  LYS A HZ2  4  
ATOM 6495  H HZ3  . LYS A 1 68  ? -261.624 -48.709 113.026 1.00 0.00 ? 68  LYS A HZ3  4  
ATOM 6496  N N    . ASN A 1 69  ? -256.626 -44.687 115.228 1.00 0.00 ? 69  ASN A N    4  
ATOM 6497  C CA   . ASN A 1 69  ? -255.233 -45.045 115.446 1.00 0.00 ? 69  ASN A CA   4  
ATOM 6498  C C    . ASN A 1 69  ? -254.349 -43.825 115.443 1.00 0.00 ? 69  ASN A C    4  
ATOM 6499  O O    . ASN A 1 69  ? -253.748 -43.460 114.433 1.00 0.00 ? 69  ASN A O    4  
ATOM 6500  C CB   . ASN A 1 69  ? -254.751 -46.071 114.415 1.00 0.00 ? 69  ASN A CB   4  
ATOM 6501  C CG   . ASN A 1 69  ? -253.404 -46.675 114.778 1.00 0.00 ? 69  ASN A CG   4  
ATOM 6502  O OD1  . ASN A 1 69  ? -253.335 -47.699 115.461 1.00 0.00 ? 69  ASN A OD1  4  
ATOM 6503  N ND2  . ASN A 1 69  ? -252.329 -46.054 114.319 1.00 0.00 ? 69  ASN A ND2  4  
ATOM 6504  H H    . ASN A 1 69  ? -256.911 -44.318 114.364 1.00 0.00 ? 69  ASN A H    4  
ATOM 6505  H HA   . ASN A 1 69  ? -255.164 -45.474 116.432 1.00 0.00 ? 69  ASN A HA   4  
ATOM 6506  H HB2  . ASN A 1 69  ? -255.477 -46.869 114.345 1.00 0.00 ? 69  ASN A HB2  4  
ATOM 6507  H HB3  . ASN A 1 69  ? -254.663 -45.589 113.452 1.00 0.00 ? 69  ASN A HB3  4  
ATOM 6508  H HD21 . ASN A 1 69  ? -252.458 -45.245 113.778 1.00 0.00 ? 69  ASN A HD21 4  
ATOM 6509  H HD22 . ASN A 1 69  ? -251.448 -46.430 114.532 1.00 0.00 ? 69  ASN A HD22 4  
ATOM 6510  N N    . GLU A 1 70  ? -254.332 -43.189 116.599 1.00 0.00 ? 70  GLU A N    4  
ATOM 6511  C CA   . GLU A 1 70  ? -253.433 -42.103 116.922 1.00 0.00 ? 70  GLU A CA   4  
ATOM 6512  C C    . GLU A 1 70  ? -253.516 -40.936 115.923 1.00 0.00 ? 70  GLU A C    4  
ATOM 6513  O O    . GLU A 1 70  ? -252.603 -40.114 115.822 1.00 0.00 ? 70  GLU A O    4  
ATOM 6514  C CB   . GLU A 1 70  ? -252.013 -42.652 117.035 1.00 0.00 ? 70  GLU A CB   4  
ATOM 6515  C CG   . GLU A 1 70  ? -251.031 -41.701 117.694 1.00 0.00 ? 70  GLU A CG   4  
ATOM 6516  C CD   . GLU A 1 70  ? -249.723 -42.373 118.030 1.00 0.00 ? 70  GLU A CD   4  
ATOM 6517  O OE1  . GLU A 1 70  ? -248.865 -42.499 117.137 1.00 0.00 ? 70  GLU A OE1  4  
ATOM 6518  O OE2  . GLU A 1 70  ? -249.553 -42.789 119.196 1.00 0.00 ? 70  GLU A OE2  4  
ATOM 6519  H H    . GLU A 1 70  ? -254.953 -43.483 117.292 1.00 0.00 ? 70  GLU A H    4  
ATOM 6520  H HA   . GLU A 1 70  ? -253.737 -41.751 117.883 1.00 0.00 ? 70  GLU A HA   4  
ATOM 6521  H HB2  . GLU A 1 70  ? -252.038 -43.563 117.615 1.00 0.00 ? 70  GLU A HB2  4  
ATOM 6522  H HB3  . GLU A 1 70  ? -251.654 -42.880 116.046 1.00 0.00 ? 70  GLU A HB3  4  
ATOM 6523  H HG2  . GLU A 1 70  ? -250.835 -40.879 117.024 1.00 0.00 ? 70  GLU A HG2  4  
ATOM 6524  H HG3  . GLU A 1 70  ? -251.473 -41.326 118.605 1.00 0.00 ? 70  GLU A HG3  4  
ATOM 6525  N N    . CYS A 1 71  ? -254.622 -40.844 115.208 1.00 0.00 ? 71  CYS A N    4  
ATOM 6526  C CA   . CYS A 1 71  ? -254.830 -39.745 114.280 1.00 0.00 ? 71  CYS A CA   4  
ATOM 6527  C C    . CYS A 1 71  ? -255.816 -38.754 114.886 1.00 0.00 ? 71  CYS A C    4  
ATOM 6528  O O    . CYS A 1 71  ? -257.006 -38.775 114.579 1.00 0.00 ? 71  CYS A O    4  
ATOM 6529  C CB   . CYS A 1 71  ? -255.332 -40.270 112.932 1.00 0.00 ? 71  CYS A CB   4  
ATOM 6530  S SG   . CYS A 1 71  ? -255.441 -39.010 111.641 1.00 0.00 ? 71  CYS A SG   4  
ATOM 6531  H H    . CYS A 1 71  ? -255.314 -41.527 115.307 1.00 0.00 ? 71  CYS A H    4  
ATOM 6532  H HA   . CYS A 1 71  ? -253.880 -39.247 114.137 1.00 0.00 ? 71  CYS A HA   4  
ATOM 6533  H HB2  . CYS A 1 71  ? -254.660 -41.037 112.582 1.00 0.00 ? 71  CYS A HB2  4  
ATOM 6534  H HB3  . CYS A 1 71  ? -256.318 -40.693 113.065 1.00 0.00 ? 71  CYS A HB3  4  
ATOM 6535  H HG   . CYS A 1 71  ? -254.224 -38.522 111.442 1.00 0.00 ? 71  CYS A HG   4  
ATOM 6536  N N    . ARG A 1 72  ? -255.303 -37.901 115.760 1.00 0.00 ? 72  ARG A N    4  
ATOM 6537  C CA   . ARG A 1 72  ? -256.134 -37.054 116.607 1.00 0.00 ? 72  ARG A CA   4  
ATOM 6538  C C    . ARG A 1 72  ? -257.032 -36.120 115.797 1.00 0.00 ? 72  ARG A C    4  
ATOM 6539  O O    . ARG A 1 72  ? -256.555 -35.309 115.000 1.00 0.00 ? 72  ARG A O    4  
ATOM 6540  C CB   . ARG A 1 72  ? -255.244 -36.238 117.541 1.00 0.00 ? 72  ARG A CB   4  
ATOM 6541  C CG   . ARG A 1 72  ? -255.979 -35.725 118.762 1.00 0.00 ? 72  ARG A CG   4  
ATOM 6542  C CD   . ARG A 1 72  ? -256.609 -36.873 119.533 1.00 0.00 ? 72  ARG A CD   4  
ATOM 6543  N NE   . ARG A 1 72  ? -257.300 -36.414 120.731 1.00 0.00 ? 72  ARG A NE   4  
ATOM 6544  C CZ   . ARG A 1 72  ? -258.576 -36.678 121.002 1.00 0.00 ? 72  ARG A CZ   4  
ATOM 6545  N NH1  . ARG A 1 72  ? -259.315 -37.372 120.145 1.00 0.00 ? 72  ARG A NH1  4  
ATOM 6546  N NH2  . ARG A 1 72  ? -259.111 -36.247 122.134 1.00 0.00 ? 72  ARG A NH2  4  
ATOM 6547  H H    . ARG A 1 72  ? -254.330 -37.836 115.841 1.00 0.00 ? 72  ARG A H    4  
ATOM 6548  H HA   . ARG A 1 72  ? -256.758 -37.700 117.205 1.00 0.00 ? 72  ARG A HA   4  
ATOM 6549  H HB2  . ARG A 1 72  ? -254.421 -36.855 117.873 1.00 0.00 ? 72  ARG A HB2  4  
ATOM 6550  H HB3  . ARG A 1 72  ? -254.853 -35.389 117.000 1.00 0.00 ? 72  ARG A HB3  4  
ATOM 6551  H HG2  . ARG A 1 72  ? -255.281 -35.210 119.404 1.00 0.00 ? 72  ARG A HG2  4  
ATOM 6552  H HG3  . ARG A 1 72  ? -256.756 -35.045 118.446 1.00 0.00 ? 72  ARG A HG3  4  
ATOM 6553  H HD2  . ARG A 1 72  ? -257.317 -37.375 118.893 1.00 0.00 ? 72  ARG A HD2  4  
ATOM 6554  H HD3  . ARG A 1 72  ? -255.831 -37.564 119.822 1.00 0.00 ? 72  ARG A HD3  4  
ATOM 6555  H HE   . ARG A 1 72  ? -256.774 -35.889 121.382 1.00 0.00 ? 72  ARG A HE   4  
ATOM 6556  H HH11 . ARG A 1 72  ? -258.917 -37.708 119.279 1.00 0.00 ? 72  ARG A HH11 4  
ATOM 6557  H HH12 . ARG A 1 72  ? -260.275 -37.568 120.351 1.00 0.00 ? 72  ARG A HH12 4  
ATOM 6558  H HH21 . ARG A 1 72  ? -258.557 -35.726 122.790 1.00 0.00 ? 72  ARG A HH21 4  
ATOM 6559  H HH22 . ARG A 1 72  ? -260.076 -36.441 122.343 1.00 0.00 ? 72  ARG A HH22 4  
ATOM 6560  N N    . LYS A 1 73  ? -258.338 -36.241 116.009 1.00 0.00 ? 73  LYS A N    4  
ATOM 6561  C CA   . LYS A 1 73  ? -259.304 -35.375 115.353 1.00 0.00 ? 73  LYS A CA   4  
ATOM 6562  C C    . LYS A 1 73  ? -259.542 -34.108 116.166 1.00 0.00 ? 73  LYS A C    4  
ATOM 6563  O O    . LYS A 1 73  ? -260.455 -34.041 116.990 1.00 0.00 ? 73  LYS A O    4  
ATOM 6564  C CB   . LYS A 1 73  ? -260.633 -36.101 115.129 1.00 0.00 ? 73  LYS A CB   4  
ATOM 6565  C CG   . LYS A 1 73  ? -261.654 -35.260 114.382 1.00 0.00 ? 73  LYS A CG   4  
ATOM 6566  C CD   . LYS A 1 73  ? -263.027 -35.913 114.366 1.00 0.00 ? 73  LYS A CD   4  
ATOM 6567  C CE   . LYS A 1 73  ? -264.036 -35.044 113.633 1.00 0.00 ? 73  LYS A CE   4  
ATOM 6568  N NZ   . LYS A 1 73  ? -265.422 -35.570 113.749 1.00 0.00 ? 73  LYS A NZ   4  
ATOM 6569  H H    . LYS A 1 73  ? -258.662 -36.950 116.620 1.00 0.00 ? 73  LYS A H    4  
ATOM 6570  H HA   . LYS A 1 73  ? -258.895 -35.095 114.394 1.00 0.00 ? 73  LYS A HA   4  
ATOM 6571  H HB2  . LYS A 1 73  ? -260.452 -37.000 114.559 1.00 0.00 ? 73  LYS A HB2  4  
ATOM 6572  H HB3  . LYS A 1 73  ? -261.050 -36.368 116.088 1.00 0.00 ? 73  LYS A HB3  4  
ATOM 6573  H HG2  . LYS A 1 73  ? -261.734 -34.298 114.866 1.00 0.00 ? 73  LYS A HG2  4  
ATOM 6574  H HG3  . LYS A 1 73  ? -261.319 -35.125 113.365 1.00 0.00 ? 73  LYS A HG3  4  
ATOM 6575  H HD2  . LYS A 1 73  ? -262.956 -36.869 113.865 1.00 0.00 ? 73  LYS A HD2  4  
ATOM 6576  H HD3  . LYS A 1 73  ? -263.359 -36.057 115.383 1.00 0.00 ? 73  LYS A HD3  4  
ATOM 6577  H HE2  . LYS A 1 73  ? -264.004 -34.050 114.053 1.00 0.00 ? 73  LYS A HE2  4  
ATOM 6578  H HE3  . LYS A 1 73  ? -263.763 -35.003 112.589 1.00 0.00 ? 73  LYS A HE3  4  
ATOM 6579  H HZ1  . LYS A 1 73  ? -265.460 -36.561 113.424 1.00 0.00 ? 73  LYS A HZ1  4  
ATOM 6580  H HZ2  . LYS A 1 73  ? -265.741 -35.526 114.744 1.00 0.00 ? 73  LYS A HZ2  4  
ATOM 6581  H HZ3  . LYS A 1 73  ? -266.073 -35.001 113.163 1.00 0.00 ? 73  LYS A HZ3  4  
ATOM 6582  N N    . GLN A 1 74  ? -258.697 -33.116 115.947 1.00 0.00 ? 74  GLN A N    4  
ATOM 6583  C CA   . GLN A 1 74  ? -258.872 -31.815 116.568 1.00 0.00 ? 74  GLN A CA   4  
ATOM 6584  C C    . GLN A 1 74  ? -258.018 -30.782 115.850 1.00 0.00 ? 74  GLN A C    4  
ATOM 6585  O O    . GLN A 1 74  ? -256.806 -30.722 116.053 1.00 0.00 ? 74  GLN A O    4  
ATOM 6586  C CB   . GLN A 1 74  ? -258.512 -31.865 118.059 1.00 0.00 ? 74  GLN A CB   4  
ATOM 6587  C CG   . GLN A 1 74  ? -258.901 -30.605 118.818 1.00 0.00 ? 74  GLN A CG   4  
ATOM 6588  C CD   . GLN A 1 74  ? -258.603 -30.694 120.301 1.00 0.00 ? 74  GLN A CD   4  
ATOM 6589  O OE1  . GLN A 1 74  ? -258.613 -31.778 120.888 1.00 0.00 ? 74  GLN A OE1  4  
ATOM 6590  N NE2  . GLN A 1 74  ? -258.344 -29.554 120.921 1.00 0.00 ? 74  GLN A NE2  4  
ATOM 6591  H H    . GLN A 1 74  ? -257.930 -33.264 115.355 1.00 0.00 ? 74  GLN A H    4  
ATOM 6592  H HA   . GLN A 1 74  ? -259.911 -31.538 116.467 1.00 0.00 ? 74  GLN A HA   4  
ATOM 6593  H HB2  . GLN A 1 74  ? -259.021 -32.703 118.512 1.00 0.00 ? 74  GLN A HB2  4  
ATOM 6594  H HB3  . GLN A 1 74  ? -257.446 -32.005 118.156 1.00 0.00 ? 74  GLN A HB3  4  
ATOM 6595  H HG2  . GLN A 1 74  ? -258.353 -29.770 118.407 1.00 0.00 ? 74  GLN A HG2  4  
ATOM 6596  H HG3  . GLN A 1 74  ? -259.960 -30.437 118.688 1.00 0.00 ? 74  GLN A HG3  4  
ATOM 6597  H HE21 . GLN A 1 74  ? -258.356 -28.727 120.395 1.00 0.00 ? 74  GLN A HE21 4  
ATOM 6598  H HE22 . GLN A 1 74  ? -258.162 -29.580 121.887 1.00 0.00 ? 74  GLN A HE22 4  
ATOM 6599  N N    . PRO A 1 75  ? -258.634 -29.982 114.972 1.00 0.00 ? 75  PRO A N    4  
ATOM 6600  C CA   . PRO A 1 75  ? -257.931 -28.949 114.218 1.00 0.00 ? 75  PRO A CA   4  
ATOM 6601  C C    . PRO A 1 75  ? -257.559 -27.761 115.097 1.00 0.00 ? 75  PRO A C    4  
ATOM 6602  O O    . PRO A 1 75  ? -258.335 -26.812 115.241 1.00 0.00 ? 75  PRO A O    4  
ATOM 6603  C CB   . PRO A 1 75  ? -258.934 -28.524 113.132 1.00 0.00 ? 75  PRO A CB   4  
ATOM 6604  C CG   . PRO A 1 75  ? -260.074 -29.486 113.231 1.00 0.00 ? 75  PRO A CG   4  
ATOM 6605  C CD   . PRO A 1 75  ? -260.060 -30.014 114.635 1.00 0.00 ? 75  PRO A CD   4  
ATOM 6606  H HA   . PRO A 1 75  ? -257.039 -29.343 113.754 1.00 0.00 ? 75  PRO A HA   4  
ATOM 6607  H HB2  . PRO A 1 75  ? -259.258 -27.511 113.321 1.00 0.00 ? 75  PRO A HB2  4  
ATOM 6608  H HB3  . PRO A 1 75  ? -258.460 -28.577 112.165 1.00 0.00 ? 75  PRO A HB3  4  
ATOM 6609  H HG2  . PRO A 1 75  ? -261.005 -28.971 113.033 1.00 0.00 ? 75  PRO A HG2  4  
ATOM 6610  H HG3  . PRO A 1 75  ? -259.936 -30.292 112.526 1.00 0.00 ? 75  PRO A HG3  4  
ATOM 6611  H HD2  . PRO A 1 75  ? -260.628 -29.368 115.290 1.00 0.00 ? 75  PRO A HD2  4  
ATOM 6612  H HD3  . PRO A 1 75  ? -260.443 -31.022 114.668 1.00 0.00 ? 75  PRO A HD3  4  
ATOM 6613  N N    . PHE A 1 76  ? -256.391 -27.831 115.712 1.00 0.00 ? 76  PHE A N    4  
ATOM 6614  C CA   . PHE A 1 76  ? -255.920 -26.753 116.562 1.00 0.00 ? 76  PHE A CA   4  
ATOM 6615  C C    . PHE A 1 76  ? -255.237 -25.679 115.721 1.00 0.00 ? 76  PHE A C    4  
ATOM 6616  O O    . PHE A 1 76  ? -254.020 -25.676 115.538 1.00 0.00 ? 76  PHE A O    4  
ATOM 6617  C CB   . PHE A 1 76  ? -254.996 -27.281 117.677 1.00 0.00 ? 76  PHE A CB   4  
ATOM 6618  C CG   . PHE A 1 76  ? -253.822 -28.106 117.207 1.00 0.00 ? 76  PHE A CG   4  
ATOM 6619  C CD1  . PHE A 1 76  ? -254.002 -29.397 116.735 1.00 0.00 ? 76  PHE A CD1  4  
ATOM 6620  C CD2  . PHE A 1 76  ? -252.535 -27.591 117.258 1.00 0.00 ? 76  PHE A CD2  4  
ATOM 6621  C CE1  . PHE A 1 76  ? -252.924 -30.154 116.319 1.00 0.00 ? 76  PHE A CE1  4  
ATOM 6622  C CE2  . PHE A 1 76  ? -251.454 -28.344 116.840 1.00 0.00 ? 76  PHE A CE2  4  
ATOM 6623  C CZ   . PHE A 1 76  ? -251.649 -29.627 116.370 1.00 0.00 ? 76  PHE A CZ   4  
ATOM 6624  H H    . PHE A 1 76  ? -255.832 -28.628 115.592 1.00 0.00 ? 76  PHE A H    4  
ATOM 6625  H HA   . PHE A 1 76  ? -256.792 -26.308 117.022 1.00 0.00 ? 76  PHE A HA   4  
ATOM 6626  H HB2  . PHE A 1 76  ? -254.602 -26.441 118.226 1.00 0.00 ? 76  PHE A HB2  4  
ATOM 6627  H HB3  . PHE A 1 76  ? -255.580 -27.894 118.348 1.00 0.00 ? 76  PHE A HB3  4  
ATOM 6628  H HD1  . PHE A 1 76  ? -254.999 -29.808 116.689 1.00 0.00 ? 76  PHE A HD1  4  
ATOM 6629  H HD2  . PHE A 1 76  ? -252.382 -26.588 117.626 1.00 0.00 ? 76  PHE A HD2  4  
ATOM 6630  H HE1  . PHE A 1 76  ? -253.079 -31.159 115.954 1.00 0.00 ? 76  PHE A HE1  4  
ATOM 6631  H HE2  . PHE A 1 76  ? -250.457 -27.926 116.883 1.00 0.00 ? 76  PHE A HE2  4  
ATOM 6632  H HZ   . PHE A 1 76  ? -250.805 -30.219 116.047 1.00 0.00 ? 76  PHE A HZ   4  
ATOM 6633  N N    . GLN A 1 77  ? -256.044 -24.795 115.164 1.00 0.00 ? 77  GLN A N    4  
ATOM 6634  C CA   . GLN A 1 77  ? -255.533 -23.694 114.369 1.00 0.00 ? 77  GLN A CA   4  
ATOM 6635  C C    . GLN A 1 77  ? -254.906 -22.654 115.278 1.00 0.00 ? 77  GLN A C    4  
ATOM 6636  O O    . GLN A 1 77  ? -255.587 -22.060 116.111 1.00 0.00 ? 77  GLN A O    4  
ATOM 6637  C CB   . GLN A 1 77  ? -256.659 -23.058 113.549 1.00 0.00 ? 77  GLN A CB   4  
ATOM 6638  C CG   . GLN A 1 77  ? -257.315 -24.015 112.567 1.00 0.00 ? 77  GLN A CG   4  
ATOM 6639  C CD   . GLN A 1 77  ? -256.347 -24.519 111.516 1.00 0.00 ? 77  GLN A CD   4  
ATOM 6640  O OE1  . GLN A 1 77  ? -255.691 -25.540 111.699 1.00 0.00 ? 77  GLN A OE1  4  
ATOM 6641  N NE2  . GLN A 1 77  ? -256.246 -23.800 110.412 1.00 0.00 ? 77  GLN A NE2  4  
ATOM 6642  H H    . GLN A 1 77  ? -257.011 -24.886 115.290 1.00 0.00 ? 77  GLN A H    4  
ATOM 6643  H HA   . GLN A 1 77  ? -254.779 -24.083 113.701 1.00 0.00 ? 77  GLN A HA   4  
ATOM 6644  H HB2  . GLN A 1 77  ? -257.418 -22.692 114.225 1.00 0.00 ? 77  GLN A HB2  4  
ATOM 6645  H HB3  . GLN A 1 77  ? -256.255 -22.227 112.991 1.00 0.00 ? 77  GLN A HB3  4  
ATOM 6646  H HG2  . GLN A 1 77  ? -257.701 -24.862 113.113 1.00 0.00 ? 77  GLN A HG2  4  
ATOM 6647  H HG3  . GLN A 1 77  ? -258.129 -23.505 112.074 1.00 0.00 ? 77  GLN A HG3  4  
ATOM 6648  H HE21 . GLN A 1 77  ? -256.791 -22.986 110.329 1.00 0.00 ? 77  GLN A HE21 4  
ATOM 6649  H HE22 . GLN A 1 77  ? -255.628 -24.103 109.719 1.00 0.00 ? 77  GLN A HE22 4  
ATOM 6650  N N    . ARG A 1 78  ? -253.610 -22.440 115.129 1.00 0.00 ? 78  ARG A N    4  
ATOM 6651  C CA   . ARG A 1 78  ? -252.931 -21.446 115.932 1.00 0.00 ? 78  ARG A CA   4  
ATOM 6652  C C    . ARG A 1 78  ? -252.642 -20.209 115.103 1.00 0.00 ? 78  ARG A C    4  
ATOM 6653  O O    . ARG A 1 78  ? -251.998 -20.272 114.051 1.00 0.00 ? 78  ARG A O    4  
ATOM 6654  C CB   . ARG A 1 78  ? -251.651 -22.002 116.573 1.00 0.00 ? 78  ARG A CB   4  
ATOM 6655  C CG   . ARG A 1 78  ? -250.663 -22.619 115.600 1.00 0.00 ? 78  ARG A CG   4  
ATOM 6656  C CD   . ARG A 1 78  ? -249.439 -23.152 116.329 1.00 0.00 ? 78  ARG A CD   4  
ATOM 6657  N NE   . ARG A 1 78  ? -248.540 -23.867 115.434 1.00 0.00 ? 78  ARG A NE   4  
ATOM 6658  C CZ   . ARG A 1 78  ? -248.252 -25.162 115.546 1.00 0.00 ? 78  ARG A CZ   4  
ATOM 6659  N NH1  . ARG A 1 78  ? -248.706 -25.865 116.572 1.00 0.00 ? 78  ARG A NH1  4  
ATOM 6660  N NH2  . ARG A 1 78  ? -247.481 -25.743 114.641 1.00 0.00 ? 78  ARG A NH2  4  
ATOM 6661  H H    . ARG A 1 78  ? -253.109 -22.952 114.461 1.00 0.00 ? 78  ARG A H    4  
ATOM 6662  H HA   . ARG A 1 78  ? -253.610 -21.161 116.724 1.00 0.00 ? 78  ARG A HA   4  
ATOM 6663  H HB2  . ARG A 1 78  ? -251.149 -21.198 117.092 1.00 0.00 ? 78  ARG A HB2  4  
ATOM 6664  H HB3  . ARG A 1 78  ? -251.929 -22.758 117.294 1.00 0.00 ? 78  ARG A HB3  4  
ATOM 6665  H HG2  . ARG A 1 78  ? -251.144 -23.432 115.080 1.00 0.00 ? 78  ARG A HG2  4  
ATOM 6666  H HG3  . ARG A 1 78  ? -250.352 -21.865 114.892 1.00 0.00 ? 78  ARG A HG3  4  
ATOM 6667  H HD2  . ARG A 1 78  ? -248.909 -22.319 116.767 1.00 0.00 ? 78  ARG A HD2  4  
ATOM 6668  H HD3  . ARG A 1 78  ? -249.766 -23.821 117.111 1.00 0.00 ? 78  ARG A HD3  4  
ATOM 6669  H HE   . ARG A 1 78  ? -248.137 -23.352 114.682 1.00 0.00 ? 78  ARG A HE   4  
ATOM 6670  H HH11 . ARG A 1 78  ? -249.267 -25.427 117.283 1.00 0.00 ? 78  ARG A HH11 4  
ATOM 6671  H HH12 . ARG A 1 78  ? -248.504 -26.858 116.633 1.00 0.00 ? 78  ARG A HH12 4  
ATOM 6672  H HH21 . ARG A 1 78  ? -247.111 -25.208 113.871 1.00 0.00 ? 78  ARG A HH21 4  
ATOM 6673  H HH22 . ARG A 1 78  ? -247.274 -26.724 114.715 1.00 0.00 ? 78  ARG A HH22 4  
ATOM 6674  N N    . ALA A 1 79  ? -253.158 -19.091 115.575 1.00 0.00 ? 79  ALA A N    4  
ATOM 6675  C CA   . ALA A 1 79  ? -253.019 -17.827 114.886 1.00 0.00 ? 79  ALA A CA   4  
ATOM 6676  C C    . ALA A 1 79  ? -251.676 -17.185 115.235 1.00 0.00 ? 79  ALA A C    4  
ATOM 6677  O O    . ALA A 1 79  ? -251.220 -17.262 116.374 1.00 0.00 ? 79  ALA A O    4  
ATOM 6678  C CB   . ALA A 1 79  ? -254.156 -16.896 115.268 1.00 0.00 ? 79  ALA A CB   4  
ATOM 6679  H H    . ALA A 1 79  ? -253.645 -19.117 116.430 1.00 0.00 ? 79  ALA A H    4  
ATOM 6680  H HA   . ALA A 1 79  ? -253.078 -18.019 113.811 1.00 0.00 ? 79  ALA A HA   4  
ATOM 6681  H HB1  . ALA A 1 79  ? -254.128 -16.713 116.333 1.00 0.00 ? 79  ALA A HB1  4  
ATOM 6682  H HB2  . ALA A 1 79  ? -255.100 -17.351 115.004 1.00 0.00 ? 79  ALA A HB2  4  
ATOM 6683  H HB3  . ALA A 1 79  ? -254.047 -15.960 114.740 1.00 0.00 ? 79  ALA A HB3  4  
ATOM 6684  N N    . ILE A 1 80  ? -251.055 -16.564 114.255 1.00 0.00 ? 80  ILE A N    4  
ATOM 6685  C CA   . ILE A 1 80  ? -249.793 -15.862 114.435 1.00 0.00 ? 80  ILE A CA   4  
ATOM 6686  C C    . ILE A 1 80  ? -250.006 -14.436 114.910 1.00 0.00 ? 80  ILE A C    4  
ATOM 6687  O O    . ILE A 1 80  ? -250.552 -13.596 114.192 1.00 0.00 ? 80  ILE A O    4  
ATOM 6688  C CB   . ILE A 1 80  ? -248.952 -15.854 113.140 1.00 0.00 ? 80  ILE A CB   4  
ATOM 6689  C CG1  . ILE A 1 80  ? -248.304 -17.218 112.938 1.00 0.00 ? 80  ILE A CG1  4  
ATOM 6690  C CG2  . ILE A 1 80  ? -247.886 -14.769 113.182 1.00 0.00 ? 80  ILE A CG2  4  
ATOM 6691  C CD1  . ILE A 1 80  ? -247.358 -17.571 114.057 1.00 0.00 ? 80  ILE A CD1  4  
ATOM 6692  H H    . ILE A 1 80  ? -251.467 -16.562 113.367 1.00 0.00 ? 80  ILE A H    4  
ATOM 6693  H HA   . ILE A 1 80  ? -249.229 -16.380 115.179 1.00 0.00 ? 80  ILE A HA   4  
ATOM 6694  H HB   . ILE A 1 80  ? -249.609 -15.649 112.308 1.00 0.00 ? 80  ILE A HB   4  
ATOM 6695  H HG12 . ILE A 1 80  ? -249.069 -17.977 112.890 1.00 0.00 ? 80  ILE A HG12 4  
ATOM 6696  H HG13 . ILE A 1 80  ? -247.743 -17.213 112.016 1.00 0.00 ? 80  ILE A HG13 4  
ATOM 6697  H HG21 . ILE A 1 80  ? -247.240 -14.932 114.031 1.00 0.00 ? 80  ILE A HG21 4  
ATOM 6698  H HG22 . ILE A 1 80  ? -247.301 -14.803 112.274 1.00 0.00 ? 80  ILE A HG22 4  
ATOM 6699  H HG23 . ILE A 1 80  ? -248.360 -13.803 113.269 1.00 0.00 ? 80  ILE A HG23 4  
ATOM 6700  H HD11 . ILE A 1 80  ? -246.588 -16.812 114.128 1.00 0.00 ? 80  ILE A HD11 4  
ATOM 6701  H HD12 . ILE A 1 80  ? -247.912 -17.608 114.984 1.00 0.00 ? 80  ILE A HD12 4  
ATOM 6702  H HD13 . ILE A 1 80  ? -246.909 -18.531 113.864 1.00 0.00 ? 80  ILE A HD13 4  
ATOM 6703  N N    . GLY A 1 81  ? -249.586 -14.188 116.136 1.00 0.00 ? 81  GLY A N    4  
ATOM 6704  C CA   . GLY A 1 81  ? -249.499 -12.837 116.618 1.00 0.00 ? 81  GLY A CA   4  
ATOM 6705  C C    . GLY A 1 81  ? -248.107 -12.296 116.381 1.00 0.00 ? 81  GLY A C    4  
ATOM 6706  O O    . GLY A 1 81  ? -247.155 -13.072 116.351 1.00 0.00 ? 81  GLY A O    4  
ATOM 6707  H H    . GLY A 1 81  ? -249.323 -14.933 116.718 1.00 0.00 ? 81  GLY A H    4  
ATOM 6708  H HA2  . GLY A 1 81  ? -250.216 -12.222 116.095 1.00 0.00 ? 81  GLY A HA2  4  
ATOM 6709  H HA3  . GLY A 1 81  ? -249.710 -12.818 117.676 1.00 0.00 ? 81  GLY A HA3  4  
ATOM 6710  N N    . PRO A 1 82  ? -247.962 -10.982 116.182 1.00 0.00 ? 82  PRO A N    4  
ATOM 6711  C CA   . PRO A 1 82  ? -246.671 -10.331 115.959 1.00 0.00 ? 82  PRO A CA   4  
ATOM 6712  C C    . PRO A 1 82  ? -245.567 -10.768 116.920 1.00 0.00 ? 82  PRO A C    4  
ATOM 6713  O O    . PRO A 1 82  ? -244.388 -10.767 116.556 1.00 0.00 ? 82  PRO A O    4  
ATOM 6714  C CB   . PRO A 1 82  ? -247.005 -8.857  116.153 1.00 0.00 ? 82  PRO A CB   4  
ATOM 6715  C CG   . PRO A 1 82  ? -248.395 -8.752  115.659 1.00 0.00 ? 82  PRO A CG   4  
ATOM 6716  C CD   . PRO A 1 82  ? -249.057 -10.013 116.127 1.00 0.00 ? 82  PRO A CD   4  
ATOM 6717  H HA   . PRO A 1 82  ? -246.345 -10.485 114.960 1.00 0.00 ? 82  PRO A HA   4  
ATOM 6718  H HB2  . PRO A 1 82  ? -246.931 -8.601  117.200 1.00 0.00 ? 82  PRO A HB2  4  
ATOM 6719  H HB3  . PRO A 1 82  ? -246.330 -8.246  115.574 1.00 0.00 ? 82  PRO A HB3  4  
ATOM 6720  H HG2  . PRO A 1 82  ? -248.878 -7.886  116.088 1.00 0.00 ? 82  PRO A HG2  4  
ATOM 6721  H HG3  . PRO A 1 82  ? -248.403 -8.698  114.580 1.00 0.00 ? 82  PRO A HG3  4  
ATOM 6722  H HD2  . PRO A 1 82  ? -249.458 -9.868  117.098 1.00 0.00 ? 82  PRO A HD2  4  
ATOM 6723  H HD3  . PRO A 1 82  ? -249.823 -10.327 115.434 1.00 0.00 ? 82  PRO A HD3  4  
ATOM 6724  N N    . GLU A 1 83  ? -245.949 -11.115 118.144 1.00 0.00 ? 83  GLU A N    4  
ATOM 6725  C CA   . GLU A 1 83  ? -245.011 -11.593 119.145 1.00 0.00 ? 83  GLU A CA   4  
ATOM 6726  C C    . GLU A 1 83  ? -244.411 -12.942 118.753 1.00 0.00 ? 83  GLU A C    4  
ATOM 6727  O O    . GLU A 1 83  ? -243.201 -13.148 118.844 1.00 0.00 ? 83  GLU A O    4  
ATOM 6728  C CB   . GLU A 1 83  ? -245.725 -11.695 120.477 1.00 0.00 ? 83  GLU A CB   4  
ATOM 6729  C CG   . GLU A 1 83  ? -246.269 -10.359 120.932 1.00 0.00 ? 83  GLU A CG   4  
ATOM 6730  C CD   . GLU A 1 83  ? -245.205 -9.280  120.955 1.00 0.00 ? 83  GLU A CD   4  
ATOM 6731  O OE1  . GLU A 1 83  ? -244.351 -9.307  121.864 1.00 0.00 ? 83  GLU A OE1  4  
ATOM 6732  O OE2  . GLU A 1 83  ? -245.215 -8.406  120.064 1.00 0.00 ? 83  GLU A OE2  4  
ATOM 6733  H H    . GLU A 1 83  ? -246.895 -11.032 118.391 1.00 0.00 ? 83  GLU A H    4  
ATOM 6734  H HA   . GLU A 1 83  ? -244.224 -10.867 119.238 1.00 0.00 ? 83  GLU A HA   4  
ATOM 6735  H HB2  . GLU A 1 83  ? -246.550 -12.389 120.385 1.00 0.00 ? 83  GLU A HB2  4  
ATOM 6736  H HB3  . GLU A 1 83  ? -245.036 -12.055 121.220 1.00 0.00 ? 83  GLU A HB3  4  
ATOM 6737  H HG2  . GLU A 1 83  ? -247.057 -10.056 120.259 1.00 0.00 ? 83  GLU A HG2  4  
ATOM 6738  H HG3  . GLU A 1 83  ? -246.664 -10.473 121.915 1.00 0.00 ? 83  GLU A HG3  4  
ATOM 6739  N N    . GLU A 1 84  ? -245.268 -13.851 118.316 1.00 0.00 ? 84  GLU A N    4  
ATOM 6740  C CA   . GLU A 1 84  ? -244.840 -15.174 117.885 1.00 0.00 ? 84  GLU A CA   4  
ATOM 6741  C C    . GLU A 1 84  ? -244.220 -15.098 116.494 1.00 0.00 ? 84  GLU A C    4  
ATOM 6742  O O    . GLU A 1 84  ? -244.919 -14.996 115.486 1.00 0.00 ? 84  GLU A O    4  
ATOM 6743  C CB   . GLU A 1 84  ? -246.028 -16.134 117.898 1.00 0.00 ? 84  GLU A CB   4  
ATOM 6744  C CG   . GLU A 1 84  ? -246.685 -16.235 119.264 1.00 0.00 ? 84  GLU A CG   4  
ATOM 6745  C CD   . GLU A 1 84  ? -247.975 -17.027 119.243 1.00 0.00 ? 84  GLU A CD   4  
ATOM 6746  O OE1  . GLU A 1 84  ? -249.033 -16.430 118.966 1.00 0.00 ? 84  GLU A OE1  4  
ATOM 6747  O OE2  . GLU A 1 84  ? -247.944 -18.243 119.529 1.00 0.00 ? 84  GLU A OE2  4  
ATOM 6748  H H    . GLU A 1 84  ? -246.219 -13.624 118.273 1.00 0.00 ? 84  GLU A H    4  
ATOM 6749  H HA   . GLU A 1 84  ? -244.093 -15.524 118.582 1.00 0.00 ? 84  GLU A HA   4  
ATOM 6750  H HB2  . GLU A 1 84  ? -246.765 -15.791 117.188 1.00 0.00 ? 84  GLU A HB2  4  
ATOM 6751  H HB3  . GLU A 1 84  ? -245.686 -17.117 117.611 1.00 0.00 ? 84  GLU A HB3  4  
ATOM 6752  H HG2  . GLU A 1 84  ? -245.998 -16.715 119.942 1.00 0.00 ? 84  GLU A HG2  4  
ATOM 6753  H HG3  . GLU A 1 84  ? -246.898 -15.238 119.619 1.00 0.00 ? 84  GLU A HG3  4  
ATOM 6754  N N    . GLU A 1 85  ? -242.898 -15.141 116.451 1.00 0.00 ? 85  GLU A N    4  
ATOM 6755  C CA   . GLU A 1 85  ? -242.163 -14.919 115.220 1.00 0.00 ? 85  GLU A CA   4  
ATOM 6756  C C    . GLU A 1 85  ? -242.118 -16.169 114.346 1.00 0.00 ? 85  GLU A C    4  
ATOM 6757  O O    . GLU A 1 85  ? -241.882 -17.286 114.821 1.00 0.00 ? 85  GLU A O    4  
ATOM 6758  C CB   . GLU A 1 85  ? -240.760 -14.423 115.546 1.00 0.00 ? 85  GLU A CB   4  
ATOM 6759  C CG   . GLU A 1 85  ? -240.771 -13.127 116.335 1.00 0.00 ? 85  GLU A CG   4  
ATOM 6760  C CD   . GLU A 1 85  ? -239.381 -12.645 116.706 1.00 0.00 ? 85  GLU A CD   4  
ATOM 6761  O OE1  . GLU A 1 85  ? -238.597 -12.310 115.793 1.00 0.00 ? 85  GLU A OE1  4  
ATOM 6762  O OE2  . GLU A 1 85  ? -239.077 -12.562 117.913 1.00 0.00 ? 85  GLU A OE2  4  
ATOM 6763  H H    . GLU A 1 85  ? -242.399 -15.323 117.277 1.00 0.00 ? 85  GLU A H    4  
ATOM 6764  H HA   . GLU A 1 85  ? -242.680 -14.146 114.674 1.00 0.00 ? 85  GLU A HA   4  
ATOM 6765  H HB2  . GLU A 1 85  ? -240.247 -15.176 116.128 1.00 0.00 ? 85  GLU A HB2  4  
ATOM 6766  H HB3  . GLU A 1 85  ? -240.219 -14.259 114.625 1.00 0.00 ? 85  GLU A HB3  4  
ATOM 6767  H HG2  . GLU A 1 85  ? -241.259 -12.364 115.741 1.00 0.00 ? 85  GLU A HG2  4  
ATOM 6768  H HG3  . GLU A 1 85  ? -241.337 -13.281 117.242 1.00 0.00 ? 85  GLU A HG3  4  
ATOM 6769  N N    . ILE A 1 86  ? -242.328 -15.956 113.057 1.00 0.00 ? 86  ILE A N    4  
ATOM 6770  C CA   . ILE A 1 86  ? -242.414 -17.042 112.090 1.00 0.00 ? 86  ILE A CA   4  
ATOM 6771  C C    . ILE A 1 86  ? -241.118 -17.830 112.004 1.00 0.00 ? 86  ILE A C    4  
ATOM 6772  O O    . ILE A 1 86  ? -241.135 -19.029 111.765 1.00 0.00 ? 86  ILE A O    4  
ATOM 6773  C CB   . ILE A 1 86  ? -242.787 -16.511 110.697 1.00 0.00 ? 86  ILE A CB   4  
ATOM 6774  C CG1  . ILE A 1 86  ? -241.787 -15.442 110.237 1.00 0.00 ? 86  ILE A CG1  4  
ATOM 6775  C CG2  . ILE A 1 86  ? -244.195 -15.951 110.739 1.00 0.00 ? 86  ILE A CG2  4  
ATOM 6776  C CD1  . ILE A 1 86  ? -242.106 -14.845 108.884 1.00 0.00 ? 86  ILE A CD1  4  
ATOM 6777  H H    . ILE A 1 86  ? -242.437 -15.035 112.743 1.00 0.00 ? 86  ILE A H    4  
ATOM 6778  H HA   . ILE A 1 86  ? -243.200 -17.707 112.415 1.00 0.00 ? 86  ILE A HA   4  
ATOM 6779  H HB   . ILE A 1 86  ? -242.772 -17.337 110.001 1.00 0.00 ? 86  ILE A HB   4  
ATOM 6780  H HG12 . ILE A 1 86  ? -241.779 -14.637 110.959 1.00 0.00 ? 86  ILE A HG12 4  
ATOM 6781  H HG13 . ILE A 1 86  ? -240.800 -15.879 110.185 1.00 0.00 ? 86  ILE A HG13 4  
ATOM 6782  H HG21 . ILE A 1 86  ? -244.237 -15.154 111.465 1.00 0.00 ? 86  ILE A HG21 4  
ATOM 6783  H HG22 . ILE A 1 86  ? -244.462 -15.569 109.766 1.00 0.00 ? 86  ILE A HG22 4  
ATOM 6784  H HG23 . ILE A 1 86  ? -244.883 -16.732 111.023 1.00 0.00 ? 86  ILE A HG23 4  
ATOM 6785  H HD11 . ILE A 1 86  ? -242.133 -15.628 108.141 1.00 0.00 ? 86  ILE A HD11 4  
ATOM 6786  H HD12 . ILE A 1 86  ? -243.067 -14.356 108.927 1.00 0.00 ? 86  ILE A HD12 4  
ATOM 6787  H HD13 . ILE A 1 86  ? -241.348 -14.124 108.623 1.00 0.00 ? 86  ILE A HD13 4  
ATOM 6788  N N    . MET A 1 87  ? -239.995 -17.165 112.222 1.00 0.00 ? 87  MET A N    4  
ATOM 6789  C CA   . MET A 1 87  ? -238.711 -17.842 112.191 1.00 0.00 ? 87  MET A CA   4  
ATOM 6790  C C    . MET A 1 87  ? -238.540 -18.743 113.402 1.00 0.00 ? 87  MET A C    4  
ATOM 6791  O O    . MET A 1 87  ? -237.724 -19.659 113.382 1.00 0.00 ? 87  MET A O    4  
ATOM 6792  C CB   . MET A 1 87  ? -237.549 -16.857 112.061 1.00 0.00 ? 87  MET A CB   4  
ATOM 6793  C CG   . MET A 1 87  ? -237.247 -16.521 110.611 1.00 0.00 ? 87  MET A CG   4  
ATOM 6794  S SD   . MET A 1 87  ? -236.851 -17.994 109.645 1.00 0.00 ? 87  MET A SD   4  
ATOM 6795  C CE   . MET A 1 87  ? -237.061 -17.389 107.975 1.00 0.00 ? 87  MET A CE   4  
ATOM 6796  H H    . MET A 1 87  ? -240.031 -16.204 112.407 1.00 0.00 ? 87  MET A H    4  
ATOM 6797  H HA   . MET A 1 87  ? -238.715 -18.474 111.313 1.00 0.00 ? 87  MET A HA   4  
ATOM 6798  H HB2  . MET A 1 87  ? -237.797 -15.944 112.584 1.00 0.00 ? 87  MET A HB2  4  
ATOM 6799  H HB3  . MET A 1 87  ? -236.665 -17.292 112.500 1.00 0.00 ? 87  MET A HB3  4  
ATOM 6800  H HG2  . MET A 1 87  ? -238.114 -16.042 110.177 1.00 0.00 ? 87  MET A HG2  4  
ATOM 6801  H HG3  . MET A 1 87  ? -236.405 -15.845 110.575 1.00 0.00 ? 87  MET A HG3  4  
ATOM 6802  H HE1  . MET A 1 87  ? -236.405 -16.547 107.812 1.00 0.00 ? 87  MET A HE1  4  
ATOM 6803  H HE2  . MET A 1 87  ? -236.819 -18.174 107.272 1.00 0.00 ? 87  MET A HE2  4  
ATOM 6804  H HE3  . MET A 1 87  ? -238.087 -17.079 107.830 1.00 0.00 ? 87  MET A HE3  4  
ATOM 6805  N N    . GLN A 1 88  ? -239.325 -18.501 114.444 1.00 0.00 ? 88  GLN A N    4  
ATOM 6806  C CA   . GLN A 1 88  ? -239.289 -19.362 115.618 1.00 0.00 ? 88  GLN A CA   4  
ATOM 6807  C C    . GLN A 1 88  ? -240.055 -20.629 115.291 1.00 0.00 ? 88  GLN A C    4  
ATOM 6808  O O    . GLN A 1 88  ? -239.721 -21.729 115.726 1.00 0.00 ? 88  GLN A O    4  
ATOM 6809  C CB   . GLN A 1 88  ? -239.915 -18.657 116.825 1.00 0.00 ? 88  GLN A CB   4  
ATOM 6810  C CG   . GLN A 1 88  ? -239.196 -17.377 117.208 1.00 0.00 ? 88  GLN A CG   4  
ATOM 6811  C CD   . GLN A 1 88  ? -239.907 -16.602 118.301 1.00 0.00 ? 88  GLN A CD   4  
ATOM 6812  O OE1  . GLN A 1 88  ? -241.136 -16.620 118.400 1.00 0.00 ? 88  GLN A OE1  4  
ATOM 6813  N NE2  . GLN A 1 88  ? -239.135 -15.924 119.133 1.00 0.00 ? 88  GLN A NE2  4  
ATOM 6814  H H    . GLN A 1 88  ? -239.983 -17.768 114.401 1.00 0.00 ? 88  GLN A H    4  
ATOM 6815  H HA   . GLN A 1 88  ? -238.261 -19.607 115.832 1.00 0.00 ? 88  GLN A HA   4  
ATOM 6816  H HB2  . GLN A 1 88  ? -240.942 -18.414 116.595 1.00 0.00 ? 88  GLN A HB2  4  
ATOM 6817  H HB3  . GLN A 1 88  ? -239.893 -19.325 117.673 1.00 0.00 ? 88  GLN A HB3  4  
ATOM 6818  H HG2  . GLN A 1 88  ? -238.204 -17.626 117.555 1.00 0.00 ? 88  GLN A HG2  4  
ATOM 6819  H HG3  . GLN A 1 88  ? -239.125 -16.756 116.332 1.00 0.00 ? 88  GLN A HG3  4  
ATOM 6820  H HE21 . GLN A 1 88  ? -238.158 -15.970 119.001 1.00 0.00 ? 88  GLN A HE21 4  
ATOM 6821  H HE22 . GLN A 1 88  ? -239.563 -15.399 119.844 1.00 0.00 ? 88  GLN A HE22 4  
ATOM 6822  N N    . ILE A 1 89  ? -241.077 -20.439 114.477 1.00 0.00 ? 89  ILE A N    4  
ATOM 6823  C CA   . ILE A 1 89  ? -241.940 -21.518 114.035 1.00 0.00 ? 89  ILE A CA   4  
ATOM 6824  C C    . ILE A 1 89  ? -241.244 -22.403 113.004 1.00 0.00 ? 89  ILE A C    4  
ATOM 6825  O O    . ILE A 1 89  ? -241.165 -23.624 113.153 1.00 0.00 ? 89  ILE A O    4  
ATOM 6826  C CB   . ILE A 1 89  ? -243.209 -20.932 113.413 1.00 0.00 ? 89  ILE A CB   4  
ATOM 6827  C CG1  . ILE A 1 89  ? -243.796 -19.882 114.356 1.00 0.00 ? 89  ILE A CG1  4  
ATOM 6828  C CG2  . ILE A 1 89  ? -244.218 -22.028 113.108 1.00 0.00 ? 89  ILE A CG2  4  
ATOM 6829  C CD1  . ILE A 1 89  ? -244.048 -20.378 115.766 1.00 0.00 ? 89  ILE A CD1  4  
ATOM 6830  H H    . ILE A 1 89  ? -241.272 -19.519 114.173 1.00 0.00 ? 89  ILE A H    4  
ATOM 6831  H HA   . ILE A 1 89  ? -242.231 -22.100 114.892 1.00 0.00 ? 89  ILE A HA   4  
ATOM 6832  H HB   . ILE A 1 89  ? -242.939 -20.456 112.478 1.00 0.00 ? 89  ILE A HB   4  
ATOM 6833  H HG12 . ILE A 1 89  ? -243.117 -19.048 114.420 1.00 0.00 ? 89  ILE A HG12 4  
ATOM 6834  H HG13 . ILE A 1 89  ? -244.720 -19.547 113.955 1.00 0.00 ? 89  ILE A HG13 4  
ATOM 6835  H HG21 . ILE A 1 89  ? -244.473 -22.547 114.021 1.00 0.00 ? 89  ILE A HG21 4  
ATOM 6836  H HG22 . ILE A 1 89  ? -245.109 -21.590 112.681 1.00 0.00 ? 89  ILE A HG22 4  
ATOM 6837  H HG23 . ILE A 1 89  ? -243.788 -22.727 112.403 1.00 0.00 ? 89  ILE A HG23 4  
ATOM 6838  H HD11 . ILE A 1 89  ? -243.116 -20.713 116.201 1.00 0.00 ? 89  ILE A HD11 4  
ATOM 6839  H HD12 . ILE A 1 89  ? -244.453 -19.571 116.362 1.00 0.00 ? 89  ILE A HD12 4  
ATOM 6840  H HD13 . ILE A 1 89  ? -244.750 -21.196 115.742 1.00 0.00 ? 89  ILE A HD13 4  
ATOM 6841  N N    . LEU A 1 90  ? -240.703 -21.760 111.982 1.00 0.00 ? 90  LEU A N    4  
ATOM 6842  C CA   . LEU A 1 90  ? -240.126 -22.449 110.837 1.00 0.00 ? 90  LEU A CA   4  
ATOM 6843  C C    . LEU A 1 90  ? -238.814 -23.137 111.188 1.00 0.00 ? 90  LEU A C    4  
ATOM 6844  O O    . LEU A 1 90  ? -238.515 -24.208 110.664 1.00 0.00 ? 90  LEU A O    4  
ATOM 6845  C CB   . LEU A 1 90  ? -239.915 -21.452 109.698 1.00 0.00 ? 90  LEU A CB   4  
ATOM 6846  C CG   . LEU A 1 90  ? -241.195 -20.794 109.178 1.00 0.00 ? 90  LEU A CG   4  
ATOM 6847  C CD1  . LEU A 1 90  ? -240.870 -19.529 108.403 1.00 0.00 ? 90  LEU A CD1  4  
ATOM 6848  C CD2  . LEU A 1 90  ? -241.975 -21.765 108.305 1.00 0.00 ? 90  LEU A CD2  4  
ATOM 6849  H H    . LEU A 1 90  ? -240.703 -20.777 111.992 1.00 0.00 ? 90  LEU A H    4  
ATOM 6850  H HA   . LEU A 1 90  ? -240.834 -23.198 110.513 1.00 0.00 ? 90  LEU A HA   4  
ATOM 6851  H HB2  . LEU A 1 90  ? -239.249 -20.674 110.046 1.00 0.00 ? 90  LEU A HB2  4  
ATOM 6852  H HB3  . LEU A 1 90  ? -239.443 -21.969 108.877 1.00 0.00 ? 90  LEU A HB3  4  
ATOM 6853  H HG   . LEU A 1 90  ? -241.820 -20.521 110.016 1.00 0.00 ? 90  LEU A HG   4  
ATOM 6854  H HD11 . LEU A 1 90  ? -240.198 -19.763 107.591 1.00 0.00 ? 90  LEU A HD11 4  
ATOM 6855  H HD12 . LEU A 1 90  ? -241.782 -19.105 108.009 1.00 0.00 ? 90  LEU A HD12 4  
ATOM 6856  H HD13 . LEU A 1 90  ? -240.401 -18.816 109.066 1.00 0.00 ? 90  LEU A HD13 4  
ATOM 6857  H HD21 . LEU A 1 90  ? -242.228 -22.642 108.881 1.00 0.00 ? 90  LEU A HD21 4  
ATOM 6858  H HD22 . LEU A 1 90  ? -242.878 -21.289 107.954 1.00 0.00 ? 90  LEU A HD22 4  
ATOM 6859  H HD23 . LEU A 1 90  ? -241.368 -22.055 107.458 1.00 0.00 ? 90  LEU A HD23 4  
ATOM 6860  N N    . SER A 1 91  ? -238.037 -22.537 112.084 1.00 0.00 ? 91  SER A N    4  
ATOM 6861  C CA   . SER A 1 91  ? -236.750 -23.109 112.464 1.00 0.00 ? 91  SER A CA   4  
ATOM 6862  C C    . SER A 1 91  ? -236.934 -24.294 113.412 1.00 0.00 ? 91  SER A C    4  
ATOM 6863  O O    . SER A 1 91  ? -235.975 -24.996 113.730 1.00 0.00 ? 91  SER A O    4  
ATOM 6864  C CB   . SER A 1 91  ? -235.856 -22.049 113.106 1.00 0.00 ? 91  SER A CB   4  
ATOM 6865  O OG   . SER A 1 91  ? -235.684 -20.935 112.239 1.00 0.00 ? 91  SER A OG   4  
ATOM 6866  H H    . SER A 1 91  ? -238.329 -21.695 112.490 1.00 0.00 ? 91  SER A H    4  
ATOM 6867  H HA   . SER A 1 91  ? -236.274 -23.465 111.563 1.00 0.00 ? 91  SER A HA   4  
ATOM 6868  H HB2  . SER A 1 91  ? -236.309 -21.709 114.025 1.00 0.00 ? 91  SER A HB2  4  
ATOM 6869  H HB3  . SER A 1 91  ? -234.887 -22.476 113.319 1.00 0.00 ? 91  SER A HB3  4  
ATOM 6870  H HG   . SER A 1 91  ? -236.345 -20.264 112.458 1.00 0.00 ? 91  SER A HG   4  
ATOM 6871  N N    . SER A 1 92  ? -238.164 -24.513 113.864 1.00 0.00 ? 92  SER A N    4  
ATOM 6872  C CA   . SER A 1 92  ? -238.472 -25.676 114.680 1.00 0.00 ? 92  SER A CA   4  
ATOM 6873  C C    . SER A 1 92  ? -238.565 -26.914 113.795 1.00 0.00 ? 92  SER A C    4  
ATOM 6874  O O    . SER A 1 92  ? -237.861 -27.899 114.026 1.00 0.00 ? 92  SER A O    4  
ATOM 6875  C CB   . SER A 1 92  ? -239.773 -25.461 115.459 1.00 0.00 ? 92  SER A CB   4  
ATOM 6876  O OG   . SER A 1 92  ? -239.634 -24.401 116.392 1.00 0.00 ? 92  SER A OG   4  
ATOM 6877  H H    . SER A 1 92  ? -238.879 -23.884 113.632 1.00 0.00 ? 92  SER A H    4  
ATOM 6878  H HA   . SER A 1 92  ? -237.660 -25.811 115.383 1.00 0.00 ? 92  SER A HA   4  
ATOM 6879  H HB2  . SER A 1 92  ? -240.568 -25.216 114.771 1.00 0.00 ? 92  SER A HB2  4  
ATOM 6880  H HB3  . SER A 1 92  ? -240.025 -26.364 115.995 1.00 0.00 ? 92  SER A HB3  4  
ATOM 6881  H HG   . SER A 1 92  ? -239.885 -23.564 115.974 1.00 0.00 ? 92  SER A HG   4  
ATOM 6882  N N    . TRP A 1 93  ? -239.434 -26.842 112.780 1.00 0.00 ? 93  TRP A N    4  
ATOM 6883  C CA   . TRP A 1 93  ? -239.540 -27.863 111.725 1.00 0.00 ? 93  TRP A CA   4  
ATOM 6884  C C    . TRP A 1 93  ? -240.164 -29.177 112.203 1.00 0.00 ? 93  TRP A C    4  
ATOM 6885  O O    . TRP A 1 93  ? -241.107 -29.665 111.579 1.00 0.00 ? 93  TRP A O    4  
ATOM 6886  C CB   . TRP A 1 93  ? -238.173 -28.137 111.081 1.00 0.00 ? 93  TRP A CB   4  
ATOM 6887  C CG   . TRP A 1 93  ? -238.192 -29.287 110.116 1.00 0.00 ? 93  TRP A CG   4  
ATOM 6888  C CD1  . TRP A 1 93  ? -237.660 -30.529 110.313 1.00 0.00 ? 93  TRP A CD1  4  
ATOM 6889  C CD2  . TRP A 1 93  ? -238.782 -29.306 108.812 1.00 0.00 ? 93  TRP A CD2  4  
ATOM 6890  N NE1  . TRP A 1 93  ? -237.880 -31.315 109.210 1.00 0.00 ? 93  TRP A NE1  4  
ATOM 6891  C CE2  . TRP A 1 93  ? -238.568 -30.587 108.274 1.00 0.00 ? 93  TRP A CE2  4  
ATOM 6892  C CE3  . TRP A 1 93  ? -239.473 -28.360 108.045 1.00 0.00 ? 93  TRP A CE3  4  
ATOM 6893  C CZ2  . TRP A 1 93  ? -239.017 -30.947 107.005 1.00 0.00 ? 93  TRP A CZ2  4  
ATOM 6894  C CZ3  . TRP A 1 93  ? -239.919 -28.719 106.788 1.00 0.00 ? 93  TRP A CZ3  4  
ATOM 6895  C CH2  . TRP A 1 93  ? -239.691 -30.001 106.280 1.00 0.00 ? 93  TRP A CH2  4  
ATOM 6896  H H    . TRP A 1 93  ? -240.035 -26.067 112.736 1.00 0.00 ? 93  TRP A H    4  
ATOM 6897  H HA   . TRP A 1 93  ? -240.188 -27.453 110.963 1.00 0.00 ? 93  TRP A HA   4  
ATOM 6898  H HB2  . TRP A 1 93  ? -237.853 -27.255 110.545 1.00 0.00 ? 93  TRP A HB2  4  
ATOM 6899  H HB3  . TRP A 1 93  ? -237.455 -28.361 111.856 1.00 0.00 ? 93  TRP A HB3  4  
ATOM 6900  H HD1  . TRP A 1 93  ? -237.141 -30.832 111.209 1.00 0.00 ? 93  TRP A HD1  4  
ATOM 6901  H HE1  . TRP A 1 93  ? -237.591 -32.253 109.110 1.00 0.00 ? 93  TRP A HE1  4  
ATOM 6902  H HE3  . TRP A 1 93  ? -239.658 -27.364 108.421 1.00 0.00 ? 93  TRP A HE3  4  
ATOM 6903  H HZ2  . TRP A 1 93  ? -238.851 -31.933 106.596 1.00 0.00 ? 93  TRP A HZ2  4  
ATOM 6904  H HZ3  . TRP A 1 93  ? -240.453 -28.002 106.181 1.00 0.00 ? 93  TRP A HZ3  4  
ATOM 6905  H HH2  . TRP A 1 93  ? -240.057 -30.236 105.292 1.00 0.00 ? 93  TRP A HH2  4  
ATOM 6906  N N    . PHE A 1 94  ? -239.623 -29.746 113.286 1.00 0.00 ? 94  PHE A N    4  
ATOM 6907  C CA   . PHE A 1 94  ? -240.020 -31.074 113.762 1.00 0.00 ? 94  PHE A CA   4  
ATOM 6908  C C    . PHE A 1 94  ? -241.537 -31.250 113.762 1.00 0.00 ? 94  PHE A C    4  
ATOM 6909  O O    . PHE A 1 94  ? -242.261 -30.532 114.458 1.00 0.00 ? 94  PHE A O    4  
ATOM 6910  C CB   . PHE A 1 94  ? -239.445 -31.347 115.155 1.00 0.00 ? 94  PHE A CB   4  
ATOM 6911  C CG   . PHE A 1 94  ? -237.949 -31.483 115.160 1.00 0.00 ? 94  PHE A CG   4  
ATOM 6912  C CD1  . PHE A 1 94  ? -237.341 -32.606 114.628 1.00 0.00 ? 94  PHE A CD1  4  
ATOM 6913  C CD2  . PHE A 1 94  ? -237.151 -30.486 115.691 1.00 0.00 ? 94  PHE A CD2  4  
ATOM 6914  C CE1  . PHE A 1 94  ? -235.964 -32.732 114.625 1.00 0.00 ? 94  PHE A CE1  4  
ATOM 6915  C CE2  . PHE A 1 94  ? -235.775 -30.603 115.692 1.00 0.00 ? 94  PHE A CE2  4  
ATOM 6916  C CZ   . PHE A 1 94  ? -235.182 -31.728 115.159 1.00 0.00 ? 94  PHE A CZ   4  
ATOM 6917  H H    . PHE A 1 94  ? -238.930 -29.255 113.778 1.00 0.00 ? 94  PHE A H    4  
ATOM 6918  H HA   . PHE A 1 94  ? -239.600 -31.795 113.075 1.00 0.00 ? 94  PHE A HA   4  
ATOM 6919  H HB2  . PHE A 1 94  ? -239.705 -30.533 115.815 1.00 0.00 ? 94  PHE A HB2  4  
ATOM 6920  H HB3  . PHE A 1 94  ? -239.865 -32.265 115.540 1.00 0.00 ? 94  PHE A HB3  4  
ATOM 6921  H HD1  . PHE A 1 94  ? -237.952 -33.391 114.209 1.00 0.00 ? 94  PHE A HD1  4  
ATOM 6922  H HD2  . PHE A 1 94  ? -237.614 -29.604 116.110 1.00 0.00 ? 94  PHE A HD2  4  
ATOM 6923  H HE1  . PHE A 1 94  ? -235.502 -33.613 114.205 1.00 0.00 ? 94  PHE A HE1  4  
ATOM 6924  H HE2  . PHE A 1 94  ? -235.166 -29.815 116.110 1.00 0.00 ? 94  PHE A HE2  4  
ATOM 6925  H HZ   . PHE A 1 94  ? -234.106 -31.823 115.157 1.00 0.00 ? 94  PHE A HZ   4  
ATOM 6926  N N    . PRO A 1 95  ? -242.014 -32.218 112.963 1.00 0.00 ? 95  PRO A N    4  
ATOM 6927  C CA   . PRO A 1 95  ? -243.443 -32.439 112.726 1.00 0.00 ? 95  PRO A CA   4  
ATOM 6928  C C    . PRO A 1 95  ? -244.217 -32.792 113.989 1.00 0.00 ? 95  PRO A C    4  
ATOM 6929  O O    . PRO A 1 95  ? -243.767 -33.592 114.814 1.00 0.00 ? 95  PRO A O    4  
ATOM 6930  C CB   . PRO A 1 95  ? -243.475 -33.615 111.741 1.00 0.00 ? 95  PRO A CB   4  
ATOM 6931  C CG   . PRO A 1 95  ? -242.153 -34.281 111.886 1.00 0.00 ? 95  PRO A CG   4  
ATOM 6932  C CD   . PRO A 1 95  ? -241.184 -33.187 112.225 1.00 0.00 ? 95  PRO A CD   4  
ATOM 6933  H HA   . PRO A 1 95  ? -243.900 -31.577 112.264 1.00 0.00 ? 95  PRO A HA   4  
ATOM 6934  H HB2  . PRO A 1 95  ? -244.283 -34.281 111.999 1.00 0.00 ? 95  PRO A HB2  4  
ATOM 6935  H HB3  . PRO A 1 95  ? -243.618 -33.241 110.737 1.00 0.00 ? 95  PRO A HB3  4  
ATOM 6936  H HG2  . PRO A 1 95  ? -242.193 -35.008 112.685 1.00 0.00 ? 95  PRO A HG2  4  
ATOM 6937  H HG3  . PRO A 1 95  ? -241.873 -34.755 110.957 1.00 0.00 ? 95  PRO A HG3  4  
ATOM 6938  H HD2  . PRO A 1 95  ? -240.387 -33.567 112.849 1.00 0.00 ? 95  PRO A HD2  4  
ATOM 6939  H HD3  . PRO A 1 95  ? -240.783 -32.743 111.326 1.00 0.00 ? 95  PRO A HD3  4  
ATOM 6940  N N    . GLU A 1 96  ? -245.384 -32.181 114.126 1.00 0.00 ? 96  GLU A N    4  
ATOM 6941  C CA   . GLU A 1 96  ? -246.273 -32.446 115.245 1.00 0.00 ? 96  GLU A CA   4  
ATOM 6942  C C    . GLU A 1 96  ? -246.867 -33.844 115.112 1.00 0.00 ? 96  GLU A C    4  
ATOM 6943  O O    . GLU A 1 96  ? -246.463 -34.779 115.804 1.00 0.00 ? 96  GLU A O    4  
ATOM 6944  C CB   . GLU A 1 96  ? -247.388 -31.400 115.265 1.00 0.00 ? 96  GLU A CB   4  
ATOM 6945  C CG   . GLU A 1 96  ? -246.881 -29.978 115.082 1.00 0.00 ? 96  GLU A CG   4  
ATOM 6946  C CD   . GLU A 1 96  ? -247.995 -28.961 114.971 1.00 0.00 ? 96  GLU A CD   4  
ATOM 6947  O OE1  . GLU A 1 96  ? -248.474 -28.710 113.842 1.00 0.00 ? 96  GLU A OE1  4  
ATOM 6948  O OE2  . GLU A 1 96  ? -248.379 -28.392 116.007 1.00 0.00 ? 96  GLU A OE2  4  
ATOM 6949  H H    . GLU A 1 96  ? -245.652 -31.521 113.454 1.00 0.00 ? 96  GLU A H    4  
ATOM 6950  H HA   . GLU A 1 96  ? -245.703 -32.382 116.160 1.00 0.00 ? 96  GLU A HA   4  
ATOM 6951  H HB2  . GLU A 1 96  ? -248.086 -31.618 114.472 1.00 0.00 ? 96  GLU A HB2  4  
ATOM 6952  H HB3  . GLU A 1 96  ? -247.900 -31.457 116.212 1.00 0.00 ? 96  GLU A HB3  4  
ATOM 6953  H HG2  . GLU A 1 96  ? -246.269 -29.721 115.930 1.00 0.00 ? 96  GLU A HG2  4  
ATOM 6954  H HG3  . GLU A 1 96  ? -246.285 -29.937 114.182 1.00 0.00 ? 96  GLU A HG3  4  
ATOM 6955  N N    . GLU A 1 97  ? -247.810 -33.976 114.193 1.00 0.00 ? 97  GLU A N    4  
ATOM 6956  C CA   . GLU A 1 97  ? -248.401 -35.263 113.872 1.00 0.00 ? 97  GLU A CA   4  
ATOM 6957  C C    . GLU A 1 97  ? -248.070 -35.599 112.425 1.00 0.00 ? 97  GLU A C    4  
ATOM 6958  O O    . GLU A 1 97  ? -247.340 -36.547 112.144 1.00 0.00 ? 97  GLU A O    4  
ATOM 6959  C CB   . GLU A 1 97  ? -249.921 -35.216 114.107 1.00 0.00 ? 97  GLU A CB   4  
ATOM 6960  C CG   . GLU A 1 97  ? -250.623 -36.571 114.064 1.00 0.00 ? 97  GLU A CG   4  
ATOM 6961  C CD   . GLU A 1 97  ? -250.821 -37.100 112.654 1.00 0.00 ? 97  GLU A CD   4  
ATOM 6962  O OE1  . GLU A 1 97  ? -251.444 -36.397 111.838 1.00 0.00 ? 97  GLU A OE1  4  
ATOM 6963  O OE2  . GLU A 1 97  ? -250.345 -38.217 112.360 1.00 0.00 ? 97  GLU A OE2  4  
ATOM 6964  H H    . GLU A 1 97  ? -248.117 -33.182 113.713 1.00 0.00 ? 97  GLU A H    4  
ATOM 6965  H HA   . GLU A 1 97  ? -247.961 -36.008 114.518 1.00 0.00 ? 97  GLU A HA   4  
ATOM 6966  H HB2  . GLU A 1 97  ? -250.106 -34.775 115.073 1.00 0.00 ? 97  GLU A HB2  4  
ATOM 6967  H HB3  . GLU A 1 97  ? -250.364 -34.586 113.348 1.00 0.00 ? 97  GLU A HB3  4  
ATOM 6968  H HG2  . GLU A 1 97  ? -250.030 -37.283 114.616 1.00 0.00 ? 97  GLU A HG2  4  
ATOM 6969  H HG3  . GLU A 1 97  ? -251.591 -36.472 114.533 1.00 0.00 ? 97  GLU A HG3  4  
ATOM 6970  N N    . GLY A 1 98  ? -248.586 -34.792 111.509 1.00 0.00 ? 98  GLY A N    4  
ATOM 6971  C CA   . GLY A 1 98  ? -248.278 -34.974 110.106 1.00 0.00 ? 98  GLY A CA   4  
ATOM 6972  C C    . GLY A 1 98  ? -247.348 -33.901 109.582 1.00 0.00 ? 98  GLY A C    4  
ATOM 6973  O O    . GLY A 1 98  ? -246.259 -33.696 110.116 1.00 0.00 ? 98  GLY A O    4  
ATOM 6974  H H    . GLY A 1 98  ? -249.190 -34.076 111.785 1.00 0.00 ? 98  GLY A H    4  
ATOM 6975  H HA2  . GLY A 1 98  ? -247.811 -35.940 109.975 1.00 0.00 ? 98  GLY A HA2  4  
ATOM 6976  H HA3  . GLY A 1 98  ? -249.197 -34.952 109.537 1.00 0.00 ? 98  GLY A HA3  4  
ATOM 6977  N N    . TYR A 1 99  ? -247.787 -33.202 108.546 1.00 0.00 ? 99  TYR A N    4  
ATOM 6978  C CA   . TYR A 1 99  ? -246.976 -32.170 107.910 1.00 0.00 ? 99  TYR A CA   4  
ATOM 6979  C C    . TYR A 1 99  ? -247.818 -30.927 107.644 1.00 0.00 ? 99  TYR A C    4  
ATOM 6980  O O    . TYR A 1 99  ? -247.450 -30.068 106.842 1.00 0.00 ? 99  TYR A O    4  
ATOM 6981  C CB   . TYR A 1 99  ? -246.399 -32.701 106.590 1.00 0.00 ? 99  TYR A CB   4  
ATOM 6982  C CG   . TYR A 1 99  ? -247.461 -33.143 105.602 1.00 0.00 ? 99  TYR A CG   4  
ATOM 6983  C CD1  . TYR A 1 99  ? -248.002 -34.423 105.658 1.00 0.00 ? 99  TYR A CD1  4  
ATOM 6984  C CD2  . TYR A 1 99  ? -247.939 -32.275 104.625 1.00 0.00 ? 99  TYR A CD2  4  
ATOM 6985  C CE1  . TYR A 1 99  ? -248.983 -34.824 104.772 1.00 0.00 ? 99  TYR A CE1  4  
ATOM 6986  C CE2  . TYR A 1 99  ? -248.923 -32.668 103.740 1.00 0.00 ? 99  TYR A CE2  4  
ATOM 6987  C CZ   . TYR A 1 99  ? -249.439 -33.943 103.817 1.00 0.00 ? 99  TYR A CZ   4  
ATOM 6988  O OH   . TYR A 1 99  ? -250.420 -34.332 102.938 1.00 0.00 ? 99  TYR A OH   4  
ATOM 6989  H H    . TYR A 1 99  ? -248.686 -33.386 108.194 1.00 0.00 ? 99  TYR A H    4  
ATOM 6990  H HA   . TYR A 1 99  ? -246.166 -31.916 108.578 1.00 0.00 ? 99  TYR A HA   4  
ATOM 6991  H HB2  . TYR A 1 99  ? -245.813 -31.922 106.124 1.00 0.00 ? 99  TYR A HB2  4  
ATOM 6992  H HB3  . TYR A 1 99  ? -245.762 -33.548 106.799 1.00 0.00 ? 99  TYR A HB3  4  
ATOM 6993  H HD1  . TYR A 1 99  ? -247.641 -35.109 106.411 1.00 0.00 ? 99  TYR A HD1  4  
ATOM 6994  H HD2  . TYR A 1 99  ? -247.532 -31.276 104.565 1.00 0.00 ? 99  TYR A HD2  4  
ATOM 6995  H HE1  . TYR A 1 99  ? -249.389 -35.823 104.835 1.00 0.00 ? 99  TYR A HE1  4  
ATOM 6996  H HE2  . TYR A 1 99  ? -249.279 -31.979 102.990 1.00 0.00 ? 99  TYR A HE2  4  
ATOM 6997  H HH   . TYR A 1 99  ? -250.172 -34.058 102.044 1.00 0.00 ? 99  TYR A HH   4  
ATOM 6998  N N    . MET A 1 100 ? -248.946 -30.833 108.331 1.00 0.00 ? 100 MET A N    4  
ATOM 6999  C CA   . MET A 1 100 ? -249.908 -29.766 108.088 1.00 0.00 ? 100 MET A CA   4  
ATOM 7000  C C    . MET A 1 100 ? -249.427 -28.436 108.659 1.00 0.00 ? 100 MET A C    4  
ATOM 7001  O O    . MET A 1 100 ? -249.676 -28.117 109.826 1.00 0.00 ? 100 MET A O    4  
ATOM 7002  C CB   . MET A 1 100 ? -251.274 -30.131 108.678 1.00 0.00 ? 100 MET A CB   4  
ATOM 7003  C CG   . MET A 1 100 ? -251.873 -31.403 108.093 1.00 0.00 ? 100 MET A CG   4  
ATOM 7004  S SD   . MET A 1 100 ? -251.057 -32.902 108.684 1.00 0.00 ? 100 MET A SD   4  
ATOM 7005  C CE   . MET A 1 100 ? -251.573 -32.919 110.401 1.00 0.00 ? 100 MET A CE   4  
ATOM 7006  H H    . MET A 1 100 ? -249.138 -31.500 109.024 1.00 0.00 ? 100 MET A H    4  
ATOM 7007  H HA   . MET A 1 100 ? -250.011 -29.662 107.018 1.00 0.00 ? 100 MET A HA   4  
ATOM 7008  H HB2  . MET A 1 100 ? -251.163 -30.269 109.743 1.00 0.00 ? 100 MET A HB2  4  
ATOM 7009  H HB3  . MET A 1 100 ? -251.961 -29.317 108.499 1.00 0.00 ? 100 MET A HB3  4  
ATOM 7010  H HG2  . MET A 1 100 ? -252.917 -31.451 108.363 1.00 0.00 ? 100 MET A HG2  4  
ATOM 7011  H HG3  . MET A 1 100 ? -251.784 -31.361 107.016 1.00 0.00 ? 100 MET A HG3  4  
ATOM 7012  H HE1  . MET A 1 100 ? -251.235 -32.017 110.891 1.00 0.00 ? 100 MET A HE1  4  
ATOM 7013  H HE2  . MET A 1 100 ? -252.651 -32.975 110.452 1.00 0.00 ? 100 MET A HE2  4  
ATOM 7014  H HE3  . MET A 1 100 ? -251.144 -33.776 110.897 1.00 0.00 ? 100 MET A HE3  4  
ATOM 7015  N N    . GLY A 1 101 ? -248.710 -27.679 107.839 1.00 0.00 ? 101 GLY A N    4  
ATOM 7016  C CA   . GLY A 1 101 ? -248.246 -26.369 108.239 1.00 0.00 ? 101 GLY A CA   4  
ATOM 7017  C C    . GLY A 1 101 ? -248.098 -25.432 107.058 1.00 0.00 ? 101 GLY A C    4  
ATOM 7018  O O    . GLY A 1 101 ? -247.407 -25.750 106.090 1.00 0.00 ? 101 GLY A O    4  
ATOM 7019  H H    . GLY A 1 101 ? -248.471 -28.029 106.952 1.00 0.00 ? 101 GLY A H    4  
ATOM 7020  H HA2  . GLY A 1 101 ? -248.950 -25.945 108.940 1.00 0.00 ? 101 GLY A HA2  4  
ATOM 7021  H HA3  . GLY A 1 101 ? -247.286 -26.470 108.726 1.00 0.00 ? 101 GLY A HA3  4  
ATOM 7022  N N    . ARG A 1 102 ? -248.789 -24.298 107.119 1.00 0.00 ? 102 ARG A N    4  
ATOM 7023  C CA   . ARG A 1 102 ? -248.681 -23.256 106.101 1.00 0.00 ? 102 ARG A CA   4  
ATOM 7024  C C    . ARG A 1 102 ? -249.359 -21.988 106.599 1.00 0.00 ? 102 ARG A C    4  
ATOM 7025  O O    . ARG A 1 102 ? -250.315 -22.063 107.371 1.00 0.00 ? 102 ARG A O    4  
ATOM 7026  C CB   . ARG A 1 102 ? -249.283 -23.689 104.750 1.00 0.00 ? 102 ARG A CB   4  
ATOM 7027  C CG   . ARG A 1 102 ? -250.768 -24.039 104.772 1.00 0.00 ? 102 ARG A CG   4  
ATOM 7028  C CD   . ARG A 1 102 ? -251.028 -25.427 105.337 1.00 0.00 ? 102 ARG A CD   4  
ATOM 7029  N NE   . ARG A 1 102 ? -250.217 -26.448 104.671 1.00 0.00 ? 102 ARG A NE   4  
ATOM 7030  C CZ   . ARG A 1 102 ? -250.721 -27.489 104.006 1.00 0.00 ? 102 ARG A CZ   4  
ATOM 7031  N NH1  . ARG A 1 102 ? -252.035 -27.628 103.869 1.00 0.00 ? 102 ARG A NH1  4  
ATOM 7032  N NH2  . ARG A 1 102 ? -249.910 -28.390 103.465 1.00 0.00 ? 102 ARG A NH2  4  
ATOM 7033  H H    . ARG A 1 102 ? -249.383 -24.148 107.883 1.00 0.00 ? 102 ARG A H    4  
ATOM 7034  H HA   . ARG A 1 102 ? -247.628 -23.049 105.964 1.00 0.00 ? 102 ARG A HA   4  
ATOM 7035  H HB2  . ARG A 1 102 ? -249.145 -22.886 104.044 1.00 0.00 ? 102 ARG A HB2  4  
ATOM 7036  H HB3  . ARG A 1 102 ? -248.740 -24.555 104.399 1.00 0.00 ? 102 ARG A HB3  4  
ATOM 7037  H HG2  . ARG A 1 102 ? -251.288 -23.315 105.380 1.00 0.00 ? 102 ARG A HG2  4  
ATOM 7038  H HG3  . ARG A 1 102 ? -251.147 -23.998 103.762 1.00 0.00 ? 102 ARG A HG3  4  
ATOM 7039  H HD2  . ARG A 1 102 ? -250.794 -25.426 106.393 1.00 0.00 ? 102 ARG A HD2  4  
ATOM 7040  H HD3  . ARG A 1 102 ? -252.072 -25.668 105.203 1.00 0.00 ? 102 ARG A HD3  4  
ATOM 7041  H HE   . ARG A 1 102 ? -249.239 -26.355 104.736 1.00 0.00 ? 102 ARG A HE   4  
ATOM 7042  H HH11 . ARG A 1 102 ? -252.666 -26.946 104.268 1.00 0.00 ? 102 ARG A HH11 4  
ATOM 7043  H HH12 . ARG A 1 102 ? -252.407 -28.408 103.363 1.00 0.00 ? 102 ARG A HH12 4  
ATOM 7044  H HH21 . ARG A 1 102 ? -248.918 -28.296 103.555 1.00 0.00 ? 102 ARG A HH21 4  
ATOM 7045  H HH22 . ARG A 1 102 ? -250.292 -29.170 102.942 1.00 0.00 ? 102 ARG A HH22 4  
ATOM 7046  N N    . ILE A 1 103 ? -248.868 -20.833 106.159 1.00 0.00 ? 103 ILE A N    4  
ATOM 7047  C CA   . ILE A 1 103 ? -249.346 -19.557 106.680 1.00 0.00 ? 103 ILE A CA   4  
ATOM 7048  C C    . ILE A 1 103 ? -250.502 -18.995 105.871 1.00 0.00 ? 103 ILE A C    4  
ATOM 7049  O O    . ILE A 1 103 ? -250.439 -18.899 104.643 1.00 0.00 ? 103 ILE A O    4  
ATOM 7050  C CB   . ILE A 1 103 ? -248.228 -18.494 106.723 1.00 0.00 ? 103 ILE A CB   4  
ATOM 7051  C CG1  . ILE A 1 103 ? -247.046 -18.997 107.560 1.00 0.00 ? 103 ILE A CG1  4  
ATOM 7052  C CG2  . ILE A 1 103 ? -248.761 -17.182 107.289 1.00 0.00 ? 103 ILE A CG2  4  
ATOM 7053  C CD1  . ILE A 1 103 ? -245.972 -17.955 107.793 1.00 0.00 ? 103 ILE A CD1  4  
ATOM 7054  H H    . ILE A 1 103 ? -248.169 -20.838 105.471 1.00 0.00 ? 103 ILE A H    4  
ATOM 7055  H HA   . ILE A 1 103 ? -249.684 -19.724 107.691 1.00 0.00 ? 103 ILE A HA   4  
ATOM 7056  H HB   . ILE A 1 103 ? -247.902 -18.308 105.709 1.00 0.00 ? 103 ILE A HB   4  
ATOM 7057  H HG12 . ILE A 1 103 ? -247.409 -19.317 108.527 1.00 0.00 ? 103 ILE A HG12 4  
ATOM 7058  H HG13 . ILE A 1 103 ? -246.589 -19.838 107.059 1.00 0.00 ? 103 ILE A HG13 4  
ATOM 7059  H HG21 . ILE A 1 103 ? -249.569 -16.824 106.668 1.00 0.00 ? 103 ILE A HG21 4  
ATOM 7060  H HG22 . ILE A 1 103 ? -249.123 -17.343 108.294 1.00 0.00 ? 103 ILE A HG22 4  
ATOM 7061  H HG23 . ILE A 1 103 ? -247.968 -16.450 107.305 1.00 0.00 ? 103 ILE A HG23 4  
ATOM 7062  H HD11 . ILE A 1 103 ? -245.581 -17.623 106.844 1.00 0.00 ? 103 ILE A HD11 4  
ATOM 7063  H HD12 . ILE A 1 103 ? -246.398 -17.114 108.323 1.00 0.00 ? 103 ILE A HD12 4  
ATOM 7064  H HD13 . ILE A 1 103 ? -245.175 -18.384 108.380 1.00 0.00 ? 103 ILE A HD13 4  
ATOM 7065  N N    . VAL A 1 104 ? -251.544 -18.603 106.581 1.00 0.00 ? 104 VAL A N    4  
ATOM 7066  C CA   . VAL A 1 104 ? -252.648 -17.877 106.008 1.00 0.00 ? 104 VAL A CA   4  
ATOM 7067  C C    . VAL A 1 104 ? -252.730 -16.520 106.656 1.00 0.00 ? 104 VAL A C    4  
ATOM 7068  O O    . VAL A 1 104 ? -252.952 -16.411 107.860 1.00 0.00 ? 104 VAL A O    4  
ATOM 7069  C CB   . VAL A 1 104 ? -253.993 -18.595 106.210 1.00 0.00 ? 104 VAL A CB   4  
ATOM 7070  C CG1  . VAL A 1 104 ? -254.232 -19.630 105.123 1.00 0.00 ? 104 VAL A CG1  4  
ATOM 7071  C CG2  . VAL A 1 104 ? -254.055 -19.226 107.574 1.00 0.00 ? 104 VAL A CG2  4  
ATOM 7072  H H    . VAL A 1 104 ? -251.567 -18.796 107.543 1.00 0.00 ? 104 VAL A H    4  
ATOM 7073  H HA   . VAL A 1 104 ? -252.468 -17.760 104.950 1.00 0.00 ? 104 VAL A HA   4  
ATOM 7074  H HB   . VAL A 1 104 ? -254.778 -17.861 106.171 1.00 0.00 ? 104 VAL A HB   4  
ATOM 7075  H HG11 . VAL A 1 104 ? -254.237 -19.146 104.157 1.00 0.00 ? 104 VAL A HG11 4  
ATOM 7076  H HG12 . VAL A 1 104 ? -253.445 -20.369 105.150 1.00 0.00 ? 104 VAL A HG12 4  
ATOM 7077  H HG13 . VAL A 1 104 ? -255.184 -20.113 105.290 1.00 0.00 ? 104 VAL A HG13 4  
ATOM 7078  H HG21 . VAL A 1 104 ? -253.174 -19.828 107.733 1.00 0.00 ? 104 VAL A HG21 4  
ATOM 7079  H HG22 . VAL A 1 104 ? -254.106 -18.443 108.318 1.00 0.00 ? 104 VAL A HG22 4  
ATOM 7080  H HG23 . VAL A 1 104 ? -254.936 -19.844 107.638 1.00 0.00 ? 104 VAL A HG23 4  
ATOM 7081  N N    . LEU A 1 105 ? -252.487 -15.490 105.880 1.00 0.00 ? 105 LEU A N    4  
ATOM 7082  C CA   . LEU A 1 105 ? -252.723 -14.155 106.362 1.00 0.00 ? 105 LEU A CA   4  
ATOM 7083  C C    . LEU A 1 105 ? -254.226 -13.993 106.529 1.00 0.00 ? 105 LEU A C    4  
ATOM 7084  O O    . LEU A 1 105 ? -254.979 -13.949 105.557 1.00 0.00 ? 105 LEU A O    4  
ATOM 7085  C CB   . LEU A 1 105 ? -252.194 -13.120 105.388 1.00 0.00 ? 105 LEU A CB   4  
ATOM 7086  C CG   . LEU A 1 105 ? -251.954 -11.756 106.004 1.00 0.00 ? 105 LEU A CG   4  
ATOM 7087  C CD1  . LEU A 1 105 ? -250.909 -11.885 107.089 1.00 0.00 ? 105 LEU A CD1  4  
ATOM 7088  C CD2  . LEU A 1 105 ? -251.525 -10.757 104.943 1.00 0.00 ? 105 LEU A CD2  4  
ATOM 7089  H H    . LEU A 1 105 ? -252.158 -15.630 104.973 1.00 0.00 ? 105 LEU A H    4  
ATOM 7090  H HA   . LEU A 1 105 ? -252.225 -14.036 107.329 1.00 0.00 ? 105 LEU A HA   4  
ATOM 7091  H HB2  . LEU A 1 105 ? -251.265 -13.480 104.968 1.00 0.00 ? 105 LEU A HB2  4  
ATOM 7092  H HB3  . LEU A 1 105 ? -252.915 -13.012 104.598 1.00 0.00 ? 105 LEU A HB3  4  
ATOM 7093  H HG   . LEU A 1 105 ? -252.870 -11.401 106.456 1.00 0.00 ? 105 LEU A HG   4  
ATOM 7094  H HD11 . LEU A 1 105 ? -251.249 -12.598 107.830 1.00 0.00 ? 105 LEU A HD11 4  
ATOM 7095  H HD12 . LEU A 1 105 ? -249.984 -12.233 106.657 1.00 0.00 ? 105 LEU A HD12 4  
ATOM 7096  H HD13 . LEU A 1 105 ? -250.752 -10.925 107.558 1.00 0.00 ? 105 LEU A HD13 4  
ATOM 7097  H HD21 . LEU A 1 105 ? -252.297 -10.671 104.193 1.00 0.00 ? 105 LEU A HD21 4  
ATOM 7098  H HD22 . LEU A 1 105 ? -251.359 -9.792  105.400 1.00 0.00 ? 105 LEU A HD22 4  
ATOM 7099  H HD23 . LEU A 1 105 ? -250.609 -11.096 104.479 1.00 0.00 ? 105 LEU A HD23 4  
ATOM 7100  N N    . LYS A 1 106 ? -254.643 -13.960 107.761 1.00 0.00 ? 106 LYS A N    4  
ATOM 7101  C CA   . LYS A 1 106 ? -256.039 -13.889 108.102 1.00 0.00 ? 106 LYS A CA   4  
ATOM 7102  C C    . LYS A 1 106 ? -256.403 -12.465 108.493 1.00 0.00 ? 106 LYS A C    4  
ATOM 7103  O O    . LYS A 1 106 ? -255.567 -11.560 108.447 1.00 0.00 ? 106 LYS A O    4  
ATOM 7104  C CB   . LYS A 1 106 ? -256.354 -14.846 109.251 1.00 0.00 ? 106 LYS A CB   4  
ATOM 7105  C CG   . LYS A 1 106 ? -256.282 -16.314 108.862 1.00 0.00 ? 106 LYS A CG   4  
ATOM 7106  C CD   . LYS A 1 106 ? -257.453 -16.727 107.978 1.00 0.00 ? 106 LYS A CD   4  
ATOM 7107  C CE   . LYS A 1 106 ? -257.437 -18.226 107.698 1.00 0.00 ? 106 LYS A CE   4  
ATOM 7108  N NZ   . LYS A 1 106 ? -258.650 -18.675 106.963 1.00 0.00 ? 106 LYS A NZ   4  
ATOM 7109  H H    . LYS A 1 106 ? -253.975 -13.951 108.475 1.00 0.00 ? 106 LYS A H    4  
ATOM 7110  H HA   . LYS A 1 106 ? -256.606 -14.189 107.234 1.00 0.00 ? 106 LYS A HA   4  
ATOM 7111  H HB2  . LYS A 1 106 ? -255.647 -14.674 110.050 1.00 0.00 ? 106 LYS A HB2  4  
ATOM 7112  H HB3  . LYS A 1 106 ? -257.350 -14.639 109.613 1.00 0.00 ? 106 LYS A HB3  4  
ATOM 7113  H HG2  . LYS A 1 106 ? -255.362 -16.488 108.325 1.00 0.00 ? 106 LYS A HG2  4  
ATOM 7114  H HG3  . LYS A 1 106 ? -256.295 -16.912 109.761 1.00 0.00 ? 106 LYS A HG3  4  
ATOM 7115  H HD2  . LYS A 1 106 ? -258.376 -16.474 108.476 1.00 0.00 ? 106 LYS A HD2  4  
ATOM 7116  H HD3  . LYS A 1 106 ? -257.389 -16.196 107.039 1.00 0.00 ? 106 LYS A HD3  4  
ATOM 7117  H HE2  . LYS A 1 106 ? -256.566 -18.458 107.104 1.00 0.00 ? 106 LYS A HE2  4  
ATOM 7118  H HE3  . LYS A 1 106 ? -257.381 -18.755 108.638 1.00 0.00 ? 106 LYS A HE3  4  
ATOM 7119  H HZ1  . LYS A 1 106 ? -258.738 -18.158 106.061 1.00 0.00 ? 106 LYS A HZ1  4  
ATOM 7120  H HZ2  . LYS A 1 106 ? -258.587 -19.698 106.756 1.00 0.00 ? 106 LYS A HZ2  4  
ATOM 7121  H HZ3  . LYS A 1 106 ? -259.504 -18.502 107.538 1.00 0.00 ? 106 LYS A HZ3  4  
ATOM 7122  N N    . THR A 1 107 ? -257.633 -12.279 108.911 1.00 0.00 ? 107 THR A N    4  
ATOM 7123  C CA   . THR A 1 107 ? -258.115 -11.000 109.315 1.00 0.00 ? 107 THR A CA   4  
ATOM 7124  C C    . THR A 1 107 ? -258.706 -11.159 110.706 1.00 0.00 ? 107 THR A C    4  
ATOM 7125  O O    . THR A 1 107 ? -259.152 -12.248 111.073 1.00 0.00 ? 107 THR A O    4  
ATOM 7126  C CB   . THR A 1 107 ? -259.220 -10.488 108.369 1.00 0.00 ? 107 THR A CB   4  
ATOM 7127  O OG1  . THR A 1 107 ? -260.353 -11.362 108.424 1.00 0.00 ? 107 THR A OG1  4  
ATOM 7128  C CG2  . THR A 1 107 ? -258.735 -10.405 106.934 1.00 0.00 ? 107 THR A CG2  4  
ATOM 7129  H H    . THR A 1 107 ? -258.232 -13.036 108.996 1.00 0.00 ? 107 THR A H    4  
ATOM 7130  H HA   . THR A 1 107 ? -257.284 -10.289 109.318 1.00 0.00 ? 107 THR A HA   4  
ATOM 7131  H HB   . THR A 1 107 ? -259.520 -9.501  108.689 1.00 0.00 ? 107 THR A HB   4  
ATOM 7132  H HG1  . THR A 1 107 ? -260.056 -12.283 108.374 1.00 0.00 ? 107 THR A HG1  4  
ATOM 7133  H HG21 . THR A 1 107 ? -257.874 -9.755  106.882 1.00 0.00 ? 107 THR A HG21 4  
ATOM 7134  H HG22 . THR A 1 107 ? -258.463 -11.392 106.588 1.00 0.00 ? 107 THR A HG22 4  
ATOM 7135  H HG23 . THR A 1 107 ? -259.522 -10.010 106.309 1.00 0.00 ? 107 THR A HG23 4  
ATOM 7136  N N    . GLN A 1 108 ? -258.714 -10.096 111.464 1.00 0.00 ? 108 GLN A N    4  
ATOM 7137  C CA   . GLN A 1 108 ? -259.404 -10.062 112.758 1.00 0.00 ? 108 GLN A CA   4  
ATOM 7138  C C    . GLN A 1 108 ? -260.910 -9.922  112.548 1.00 0.00 ? 108 GLN A C    4  
ATOM 7139  O O    . GLN A 1 108 ? -261.622 -9.327  113.358 1.00 0.00 ? 108 GLN A O    4  
ATOM 7140  C CB   . GLN A 1 108 ? -258.876 -8.909  113.618 1.00 0.00 ? 108 GLN A CB   4  
ATOM 7141  C CG   . GLN A 1 108 ? -257.737 -9.306  114.544 1.00 0.00 ? 108 GLN A CG   4  
ATOM 7142  C CD   . GLN A 1 108 ? -258.181 -10.261 115.637 1.00 0.00 ? 108 GLN A CD   4  
ATOM 7143  O OE1  . GLN A 1 108 ? -257.407 -11.100 116.097 1.00 0.00 ? 108 GLN A OE1  4  
ATOM 7144  N NE2  . GLN A 1 108 ? -259.431 -10.135 116.067 1.00 0.00 ? 108 GLN A NE2  4  
ATOM 7145  H H    . GLN A 1 108 ? -258.236 -9.319  111.154 1.00 0.00 ? 108 GLN A H    4  
ATOM 7146  H HA   . GLN A 1 108 ? -259.209 -10.998 113.261 1.00 0.00 ? 108 GLN A HA   4  
ATOM 7147  H HB2  . GLN A 1 108 ? -258.518 -8.126  112.965 1.00 0.00 ? 108 GLN A HB2  4  
ATOM 7148  H HB3  . GLN A 1 108 ? -259.680 -8.518  114.219 1.00 0.00 ? 108 GLN A HB3  4  
ATOM 7149  H HG2  . GLN A 1 108 ? -256.962 -9.783  113.961 1.00 0.00 ? 108 GLN A HG2  4  
ATOM 7150  H HG3  . GLN A 1 108 ? -257.339 -8.415  115.009 1.00 0.00 ? 108 GLN A HG3  4  
ATOM 7151  H HE21 . GLN A 1 108 ? -259.995 -9.441  115.662 1.00 0.00 ? 108 GLN A HE21 4  
ATOM 7152  H HE22 . GLN A 1 108 ? -259.742 -10.735 116.781 1.00 0.00 ? 108 GLN A HE22 4  
ATOM 7153  N N    . GLN A 1 109 ? -261.381 -10.514 111.465 1.00 0.00 ? 109 GLN A N    4  
ATOM 7154  C CA   . GLN A 1 109 ? -262.771 -10.437 111.065 1.00 0.00 ? 109 GLN A CA   4  
ATOM 7155  C C    . GLN A 1 109 ? -263.420 -11.818 111.132 1.00 0.00 ? 109 GLN A C    4  
ATOM 7156  O O    . GLN A 1 109 ? -262.750 -12.835 110.950 1.00 0.00 ? 109 GLN A O    4  
ATOM 7157  C CB   . GLN A 1 109 ? -262.851 -9.842  109.651 1.00 0.00 ? 109 GLN A CB   4  
ATOM 7158  C CG   . GLN A 1 109 ? -263.885 -10.491 108.748 1.00 0.00 ? 109 GLN A CG   4  
ATOM 7159  C CD   . GLN A 1 109 ? -263.819 -9.993  107.316 1.00 0.00 ? 109 GLN A CD   4  
ATOM 7160  O OE1  . GLN A 1 109 ? -264.120 -10.728 106.377 1.00 0.00 ? 109 GLN A OE1  4  
ATOM 7161  N NE2  . GLN A 1 109 ? -263.427 -8.740  107.135 1.00 0.00 ? 109 GLN A NE2  4  
ATOM 7162  H H    . GLN A 1 109 ? -260.760 -11.050 110.916 1.00 0.00 ? 109 GLN A H    4  
ATOM 7163  H HA   . GLN A 1 109 ? -263.277 -9.777  111.754 1.00 0.00 ? 109 GLN A HA   4  
ATOM 7164  H HB2  . GLN A 1 109 ? -263.093 -8.794  109.735 1.00 0.00 ? 109 GLN A HB2  4  
ATOM 7165  H HB3  . GLN A 1 109 ? -261.883 -9.939  109.180 1.00 0.00 ? 109 GLN A HB3  4  
ATOM 7166  H HG2  . GLN A 1 109 ? -263.718 -11.557 108.748 1.00 0.00 ? 109 GLN A HG2  4  
ATOM 7167  H HG3  . GLN A 1 109 ? -264.869 -10.282 109.141 1.00 0.00 ? 109 GLN A HG3  4  
ATOM 7168  H HE21 . GLN A 1 109 ? -263.205 -8.207  107.921 1.00 0.00 ? 109 GLN A HE21 4  
ATOM 7169  H HE22 . GLN A 1 109 ? -263.375 -8.400  106.209 1.00 0.00 ? 109 GLN A HE22 4  
ATOM 7170  N N    . GLU A 1 110 ? -264.718 -11.838 111.405 1.00 0.00 ? 110 GLU A N    4  
ATOM 7171  C CA   . GLU A 1 110 ? -265.469 -13.082 111.524 1.00 0.00 ? 110 GLU A CA   4  
ATOM 7172  C C    . GLU A 1 110 ? -265.608 -13.785 110.172 1.00 0.00 ? 110 GLU A C    4  
ATOM 7173  O O    . GLU A 1 110 ? -265.672 -13.135 109.127 1.00 0.00 ? 110 GLU A O    4  
ATOM 7174  C CB   . GLU A 1 110 ? -266.848 -12.785 112.110 1.00 0.00 ? 110 GLU A CB   4  
ATOM 7175  C CG   . GLU A 1 110 ? -267.623 -11.728 111.339 1.00 0.00 ? 110 GLU A CG   4  
ATOM 7176  C CD   . GLU A 1 110 ? -268.929 -11.371 112.006 1.00 0.00 ? 110 GLU A CD   4  
ATOM 7177  O OE1  . GLU A 1 110 ? -268.925 -10.490 112.891 1.00 0.00 ? 110 GLU A OE1  4  
ATOM 7178  O OE2  . GLU A 1 110 ? -269.966 -11.972 111.661 1.00 0.00 ? 110 GLU A OE2  4  
ATOM 7179  H H    . GLU A 1 110 ? -265.191 -10.992 111.524 1.00 0.00 ? 110 GLU A H    4  
ATOM 7180  H HA   . GLU A 1 110 ? -264.936 -13.729 112.200 1.00 0.00 ? 110 GLU A HA   4  
ATOM 7181  H HB2  . GLU A 1 110 ? -267.427 -13.693 112.114 1.00 0.00 ? 110 GLU A HB2  4  
ATOM 7182  H HB3  . GLU A 1 110 ? -266.727 -12.439 113.126 1.00 0.00 ? 110 GLU A HB3  4  
ATOM 7183  H HG2  . GLU A 1 110 ? -267.018 -10.836 111.269 1.00 0.00 ? 110 GLU A HG2  4  
ATOM 7184  H HG3  . GLU A 1 110 ? -267.828 -12.099 110.346 1.00 0.00 ? 110 GLU A HG3  4  
ATOM 7185  N N    . GLY A 1 1   ? -229.605 -10.521 102.209 1.00 0.00 ? 1   GLY A N    5  
ATOM 7186  C CA   . GLY A 1 1   ? -228.441 -9.998  101.452 1.00 0.00 ? 1   GLY A CA   5  
ATOM 7187  C C    . GLY A 1 1   ? -227.145 -10.343 102.138 1.00 0.00 ? 1   GLY A C    5  
ATOM 7188  O O    . GLY A 1 1   ? -226.673 -9.583  102.981 1.00 0.00 ? 1   GLY A O    5  
ATOM 7189  H H1   . GLY A 1 1   ? -229.516 -11.557 102.334 1.00 0.00 ? 1   GLY A H1   5  
ATOM 7190  H H2   . GLY A 1 1   ? -229.653 -10.075 103.149 1.00 0.00 ? 1   GLY A H2   5  
ATOM 7191  H H3   . GLY A 1 1   ? -230.487 -10.318 101.700 1.00 0.00 ? 1   GLY A H3   5  
ATOM 7192  H HA2  . GLY A 1 1   ? -228.441 -10.431 100.462 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7193  H HA3  . GLY A 1 1   ? -228.527 -8.925  101.371 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7194  N N    . GLU A 1 2   ? -226.563 -11.479 101.745 1.00 0.00 ? 2   GLU A N    5  
ATOM 7195  C CA   . GLU A 1 2   ? -225.446 -12.091 102.466 1.00 0.00 ? 2   GLU A CA   5  
ATOM 7196  C C    . GLU A 1 2   ? -225.966 -12.684 103.765 1.00 0.00 ? 2   GLU A C    5  
ATOM 7197  O O    . GLU A 1 2   ? -225.962 -12.041 104.818 1.00 0.00 ? 2   GLU A O    5  
ATOM 7198  C CB   . GLU A 1 2   ? -224.300 -11.101 102.724 1.00 0.00 ? 2   GLU A CB   5  
ATOM 7199  C CG   . GLU A 1 2   ? -223.577 -10.678 101.458 1.00 0.00 ? 2   GLU A CG   5  
ATOM 7200  C CD   . GLU A 1 2   ? -222.957 -11.853 100.735 1.00 0.00 ? 2   GLU A CD   5  
ATOM 7201  O OE1  . GLU A 1 2   ? -221.786 -12.183 101.023 1.00 0.00 ? 2   GLU A OE1  5  
ATOM 7202  O OE2  . GLU A 1 2   ? -223.643 -12.461 99.885  1.00 0.00 ? 2   GLU A OE2  5  
ATOM 7203  H H    . GLU A 1 2   ? -226.905 -11.928 100.941 1.00 0.00 ? 2   GLU A H    5  
ATOM 7204  H HA   . GLU A 1 2   ? -225.073 -12.899 101.851 1.00 0.00 ? 2   GLU A HA   5  
ATOM 7205  H HB2  . GLU A 1 2   ? -224.704 -10.215 103.195 1.00 0.00 ? 2   GLU A HB2  5  
ATOM 7206  H HB3  . GLU A 1 2   ? -223.584 -11.559 103.389 1.00 0.00 ? 2   GLU A HB3  5  
ATOM 7207  H HG2  . GLU A 1 2   ? -224.283 -10.198 100.798 1.00 0.00 ? 2   GLU A HG2  5  
ATOM 7208  H HG3  . GLU A 1 2   ? -222.795 -9.979  101.719 1.00 0.00 ? 2   GLU A HG3  5  
ATOM 7209  N N    . GLU A 1 3   ? -226.438 -13.917 103.665 1.00 0.00 ? 3   GLU A N    5  
ATOM 7210  C CA   . GLU A 1 3   ? -227.179 -14.553 104.743 1.00 0.00 ? 3   GLU A CA   5  
ATOM 7211  C C    . GLU A 1 3   ? -226.254 -15.022 105.860 1.00 0.00 ? 3   GLU A C    5  
ATOM 7212  O O    . GLU A 1 3   ? -225.886 -16.196 105.936 1.00 0.00 ? 3   GLU A O    5  
ATOM 7213  C CB   . GLU A 1 3   ? -227.989 -15.727 104.193 1.00 0.00 ? 3   GLU A CB   5  
ATOM 7214  C CG   . GLU A 1 3   ? -228.886 -15.347 103.024 1.00 0.00 ? 3   GLU A CG   5  
ATOM 7215  C CD   . GLU A 1 3   ? -229.920 -14.301 103.392 1.00 0.00 ? 3   GLU A CD   5  
ATOM 7216  O OE1  . GLU A 1 3   ? -230.801 -14.612 104.214 1.00 0.00 ? 3   GLU A OE1  5  
ATOM 7217  O OE2  . GLU A 1 3   ? -229.853 -13.165 102.866 1.00 0.00 ? 3   GLU A OE2  5  
ATOM 7218  H H    . GLU A 1 3   ? -226.272 -14.424 102.840 1.00 0.00 ? 3   GLU A H    5  
ATOM 7219  H HA   . GLU A 1 3   ? -227.862 -13.821 105.147 1.00 0.00 ? 3   GLU A HA   5  
ATOM 7220  H HB2  . GLU A 1 3   ? -227.305 -16.496 103.862 1.00 0.00 ? 3   GLU A HB2  5  
ATOM 7221  H HB3  . GLU A 1 3   ? -228.608 -16.123 104.984 1.00 0.00 ? 3   GLU A HB3  5  
ATOM 7222  H HG2  . GLU A 1 3   ? -228.269 -14.955 102.228 1.00 0.00 ? 3   GLU A HG2  5  
ATOM 7223  H HG3  . GLU A 1 3   ? -229.396 -16.234 102.678 1.00 0.00 ? 3   GLU A HG3  5  
ATOM 7224  N N    . ARG A 1 4   ? -225.860 -14.081 106.705 1.00 0.00 ? 4   ARG A N    5  
ATOM 7225  C CA   . ARG A 1 4   ? -225.009 -14.364 107.851 1.00 0.00 ? 4   ARG A CA   5  
ATOM 7226  C C    . ARG A 1 4   ? -225.452 -13.522 109.041 1.00 0.00 ? 4   ARG A C    5  
ATOM 7227  O O    . ARG A 1 4   ? -226.018 -14.038 110.004 1.00 0.00 ? 4   ARG A O    5  
ATOM 7228  C CB   . ARG A 1 4   ? -223.539 -14.084 107.518 1.00 0.00 ? 4   ARG A CB   5  
ATOM 7229  C CG   . ARG A 1 4   ? -222.955 -15.040 106.491 1.00 0.00 ? 4   ARG A CG   5  
ATOM 7230  C CD   . ARG A 1 4   ? -221.531 -14.668 106.109 1.00 0.00 ? 4   ARG A CD   5  
ATOM 7231  N NE   . ARG A 1 4   ? -221.455 -13.353 105.472 1.00 0.00 ? 4   ARG A NE   5  
ATOM 7232  C CZ   . ARG A 1 4   ? -221.426 -13.165 104.153 1.00 0.00 ? 4   ARG A CZ   5  
ATOM 7233  N NH1  . ARG A 1 4   ? -221.493 -14.195 103.320 1.00 0.00 ? 4   ARG A NH1  5  
ATOM 7234  N NH2  . ARG A 1 4   ? -221.329 -11.940 103.660 1.00 0.00 ? 4   ARG A NH2  5  
ATOM 7235  H H    . ARG A 1 4   ? -226.155 -13.158 106.548 1.00 0.00 ? 4   ARG A H    5  
ATOM 7236  H HA   . ARG A 1 4   ? -225.124 -15.411 108.100 1.00 0.00 ? 4   ARG A HA   5  
ATOM 7237  H HB2  . ARG A 1 4   ? -223.456 -13.079 107.131 1.00 0.00 ? 4   ARG A HB2  5  
ATOM 7238  H HB3  . ARG A 1 4   ? -222.955 -14.160 108.424 1.00 0.00 ? 4   ARG A HB3  5  
ATOM 7239  H HG2  . ARG A 1 4   ? -222.955 -16.037 106.907 1.00 0.00 ? 4   ARG A HG2  5  
ATOM 7240  H HG3  . ARG A 1 4   ? -223.572 -15.019 105.605 1.00 0.00 ? 4   ARG A HG3  5  
ATOM 7241  H HD2  . ARG A 1 4   ? -220.922 -14.660 107.000 1.00 0.00 ? 4   ARG A HD2  5  
ATOM 7242  H HD3  . ARG A 1 4   ? -221.152 -15.409 105.423 1.00 0.00 ? 4   ARG A HD3  5  
ATOM 7243  H HE   . ARG A 1 4   ? -221.414 -12.570 106.062 1.00 0.00 ? 4   ARG A HE   5  
ATOM 7244  H HH11 . ARG A 1 4   ? -221.566 -15.140 103.679 1.00 0.00 ? 4   ARG A HH11 5  
ATOM 7245  H HH12 . ARG A 1 4   ? -221.480 -14.042 102.329 1.00 0.00 ? 4   ARG A HH12 5  
ATOM 7246  H HH21 . ARG A 1 4   ? -221.276 -11.145 104.278 1.00 0.00 ? 4   ARG A HH21 5  
ATOM 7247  H HH22 . ARG A 1 4   ? -221.316 -11.801 102.657 1.00 0.00 ? 4   ARG A HH22 5  
ATOM 7248  N N    . LYS A 1 5   ? -225.199 -12.221 108.963 1.00 0.00 ? 5   LYS A N    5  
ATOM 7249  C CA   . LYS A 1 5   ? -225.657 -11.291 109.984 1.00 0.00 ? 5   LYS A CA   5  
ATOM 7250  C C    . LYS A 1 5   ? -225.987 -9.951  109.334 1.00 0.00 ? 5   LYS A C    5  
ATOM 7251  O O    . LYS A 1 5   ? -225.968 -8.903  109.981 1.00 0.00 ? 5   LYS A O    5  
ATOM 7252  C CB   . LYS A 1 5   ? -224.588 -11.098 111.064 1.00 0.00 ? 5   LYS A CB   5  
ATOM 7253  C CG   . LYS A 1 5   ? -225.158 -10.644 112.400 1.00 0.00 ? 5   LYS A CG   5  
ATOM 7254  C CD   . LYS A 1 5   ? -224.127 -9.899  113.229 1.00 0.00 ? 5   LYS A CD   5  
ATOM 7255  C CE   . LYS A 1 5   ? -223.774 -8.562  112.598 1.00 0.00 ? 5   LYS A CE   5  
ATOM 7256  N NZ   . LYS A 1 5   ? -224.967 -7.686  112.443 1.00 0.00 ? 5   LYS A NZ   5  
ATOM 7257  H H    . LYS A 1 5   ? -224.684 -11.878 108.202 1.00 0.00 ? 5   LYS A H    5  
ATOM 7258  H HA   . LYS A 1 5   ? -226.553 -11.697 110.433 1.00 0.00 ? 5   LYS A HA   5  
ATOM 7259  H HB2  . LYS A 1 5   ? -224.072 -12.034 111.216 1.00 0.00 ? 5   LYS A HB2  5  
ATOM 7260  H HB3  . LYS A 1 5   ? -223.880 -10.355 110.727 1.00 0.00 ? 5   LYS A HB3  5  
ATOM 7261  H HG2  . LYS A 1 5   ? -225.996 -9.988  112.218 1.00 0.00 ? 5   LYS A HG2  5  
ATOM 7262  H HG3  . LYS A 1 5   ? -225.492 -11.510 112.951 1.00 0.00 ? 5   LYS A HG3  5  
ATOM 7263  H HD2  . LYS A 1 5   ? -224.528 -9.726  114.215 1.00 0.00 ? 5   LYS A HD2  5  
ATOM 7264  H HD3  . LYS A 1 5   ? -223.233 -10.503 113.299 1.00 0.00 ? 5   LYS A HD3  5  
ATOM 7265  H HE2  . LYS A 1 5   ? -223.053 -8.061  113.225 1.00 0.00 ? 5   LYS A HE2  5  
ATOM 7266  H HE3  . LYS A 1 5   ? -223.341 -8.740  111.624 1.00 0.00 ? 5   LYS A HE3  5  
ATOM 7267  H HZ1  . LYS A 1 5   ? -225.717 -8.185  111.916 1.00 0.00 ? 5   LYS A HZ1  5  
ATOM 7268  H HZ2  . LYS A 1 5   ? -225.342 -7.420  113.381 1.00 0.00 ? 5   LYS A HZ2  5  
ATOM 7269  H HZ3  . LYS A 1 5   ? -224.712 -6.818  111.924 1.00 0.00 ? 5   LYS A HZ3  5  
ATOM 7270  N N    . CYS A 1 6   ? -226.301 -10.001 108.049 1.00 0.00 ? 6   CYS A N    5  
ATOM 7271  C CA   . CYS A 1 6   ? -226.587 -8.803  107.285 1.00 0.00 ? 6   CYS A CA   5  
ATOM 7272  C C    . CYS A 1 6   ? -227.904 -8.955  106.545 1.00 0.00 ? 6   CYS A C    5  
ATOM 7273  O O    . CYS A 1 6   ? -227.932 -9.441  105.418 1.00 0.00 ? 6   CYS A O    5  
ATOM 7274  C CB   . CYS A 1 6   ? -225.460 -8.520  106.293 1.00 0.00 ? 6   CYS A CB   5  
ATOM 7275  S SG   . CYS A 1 6   ? -225.695 -7.022  105.303 1.00 0.00 ? 6   CYS A SG   5  
ATOM 7276  H H    . CYS A 1 6   ? -226.371 -10.874 107.609 1.00 0.00 ? 6   CYS A H    5  
ATOM 7277  H HA   . CYS A 1 6   ? -226.666 -7.977  107.977 1.00 0.00 ? 6   CYS A HA   5  
ATOM 7278  H HB2  . CYS A 1 6   ? -224.533 -8.410  106.835 1.00 0.00 ? 6   CYS A HB2  5  
ATOM 7279  H HB3  . CYS A 1 6   ? -225.372 -9.355  105.612 1.00 0.00 ? 6   CYS A HB3  5  
ATOM 7280  H HG   . CYS A 1 6   ? -226.410 -7.355  104.236 1.00 0.00 ? 6   CYS A HG   5  
ATOM 7281  N N    . LEU A 1 7   ? -228.986 -8.545  107.203 1.00 0.00 ? 7   LEU A N    5  
ATOM 7282  C CA   . LEU A 1 7   ? -230.325 -8.629  106.649 1.00 0.00 ? 7   LEU A CA   5  
ATOM 7283  C C    . LEU A 1 7   ? -230.594 -9.981  105.995 1.00 0.00 ? 7   LEU A C    5  
ATOM 7284  O O    . LEU A 1 7   ? -230.527 -10.113 104.771 1.00 0.00 ? 7   LEU A O    5  
ATOM 7285  C CB   . LEU A 1 7   ? -230.548 -7.497  105.653 1.00 0.00 ? 7   LEU A CB   5  
ATOM 7286  C CG   . LEU A 1 7   ? -230.668 -6.098  106.264 1.00 0.00 ? 7   LEU A CG   5  
ATOM 7287  C CD1  . LEU A 1 7   ? -230.861 -5.057  105.171 1.00 0.00 ? 7   LEU A CD1  5  
ATOM 7288  C CD2  . LEU A 1 7   ? -231.815 -6.047  107.263 1.00 0.00 ? 7   LEU A CD2  5  
ATOM 7289  H H    . LEU A 1 7   ? -228.875 -8.149  108.089 1.00 0.00 ? 7   LEU A H    5  
ATOM 7290  H HA   . LEU A 1 7   ? -231.020 -8.505  107.467 1.00 0.00 ? 7   LEU A HA   5  
ATOM 7291  H HB2  . LEU A 1 7   ? -229.712 -7.492  104.973 1.00 0.00 ? 7   LEU A HB2  5  
ATOM 7292  H HB3  . LEU A 1 7   ? -231.448 -7.705  105.097 1.00 0.00 ? 7   LEU A HB3  5  
ATOM 7293  H HG   . LEU A 1 7   ? -229.754 -5.865  106.791 1.00 0.00 ? 7   LEU A HG   5  
ATOM 7294  H HD11 . LEU A 1 7   ? -231.757 -5.282  104.613 1.00 0.00 ? 7   LEU A HD11 5  
ATOM 7295  H HD12 . LEU A 1 7   ? -230.951 -4.076  105.619 1.00 0.00 ? 7   LEU A HD12 5  
ATOM 7296  H HD13 . LEU A 1 7   ? -230.010 -5.071  104.506 1.00 0.00 ? 7   LEU A HD13 5  
ATOM 7297  H HD21 . LEU A 1 7   ? -231.645 -6.775  108.044 1.00 0.00 ? 7   LEU A HD21 5  
ATOM 7298  H HD22 . LEU A 1 7   ? -231.873 -5.059  107.697 1.00 0.00 ? 7   LEU A HD22 5  
ATOM 7299  H HD23 . LEU A 1 7   ? -232.742 -6.273  106.758 1.00 0.00 ? 7   LEU A HD23 5  
ATOM 7300  N N    . GLN A 1 8   ? -230.874 -10.983 106.819 1.00 0.00 ? 8   GLN A N    5  
ATOM 7301  C CA   . GLN A 1 8   ? -231.235 -12.306 106.326 1.00 0.00 ? 8   GLN A CA   5  
ATOM 7302  C C    . GLN A 1 8   ? -232.522 -12.219 105.511 1.00 0.00 ? 8   GLN A C    5  
ATOM 7303  O O    . GLN A 1 8   ? -233.617 -12.107 106.065 1.00 0.00 ? 8   GLN A O    5  
ATOM 7304  C CB   . GLN A 1 8   ? -231.414 -13.296 107.487 1.00 0.00 ? 8   GLN A CB   5  
ATOM 7305  C CG   . GLN A 1 8   ? -230.116 -13.736 108.160 1.00 0.00 ? 8   GLN A CG   5  
ATOM 7306  C CD   . GLN A 1 8   ? -229.365 -12.597 108.829 1.00 0.00 ? 8   GLN A CD   5  
ATOM 7307  O OE1  . GLN A 1 8   ? -228.502 -11.968 108.224 1.00 0.00 ? 8   GLN A OE1  5  
ATOM 7308  N NE2  . GLN A 1 8   ? -229.699 -12.319 110.083 1.00 0.00 ? 8   GLN A NE2  5  
ATOM 7309  H H    . GLN A 1 8   ? -230.821 -10.835 107.785 1.00 0.00 ? 8   GLN A H    5  
ATOM 7310  H HA   . GLN A 1 8   ? -230.437 -12.653 105.685 1.00 0.00 ? 8   GLN A HA   5  
ATOM 7311  H HB2  . GLN A 1 8   ? -232.039 -12.835 108.238 1.00 0.00 ? 8   GLN A HB2  5  
ATOM 7312  H HB3  . GLN A 1 8   ? -231.915 -14.178 107.114 1.00 0.00 ? 8   GLN A HB3  5  
ATOM 7313  H HG2  . GLN A 1 8   ? -230.349 -14.476 108.910 1.00 0.00 ? 8   GLN A HG2  5  
ATOM 7314  H HG3  . GLN A 1 8   ? -229.475 -14.179 107.412 1.00 0.00 ? 8   GLN A HG3  5  
ATOM 7315  H HE21 . GLN A 1 8   ? -230.403 -12.855 110.506 1.00 0.00 ? 8   GLN A HE21 5  
ATOM 7316  H HE22 . GLN A 1 8   ? -229.223 -11.594 110.539 1.00 0.00 ? 8   GLN A HE22 5  
ATOM 7317  N N    . THR A 1 9   ? -232.386 -12.265 104.199 1.00 0.00 ? 9   THR A N    5  
ATOM 7318  C CA   . THR A 1 9   ? -233.514 -12.060 103.316 1.00 0.00 ? 9   THR A CA   5  
ATOM 7319  C C    . THR A 1 9   ? -234.063 -13.390 102.798 1.00 0.00 ? 9   THR A C    5  
ATOM 7320  O O    . THR A 1 9   ? -233.615 -13.912 101.775 1.00 0.00 ? 9   THR A O    5  
ATOM 7321  C CB   . THR A 1 9   ? -233.135 -11.145 102.133 1.00 0.00 ? 9   THR A CB   5  
ATOM 7322  O OG1  . THR A 1 9   ? -231.989 -11.670 101.446 1.00 0.00 ? 9   THR A OG1  5  
ATOM 7323  C CG2  . THR A 1 9   ? -232.829 -9.733  102.611 1.00 0.00 ? 9   THR A CG2  5  
ATOM 7324  H H    . THR A 1 9   ? -231.499 -12.466 103.815 1.00 0.00 ? 9   THR A H    5  
ATOM 7325  H HA   . THR A 1 9   ? -234.292 -11.558 103.883 1.00 0.00 ? 9   THR A HA   5  
ATOM 7326  H HB   . THR A 1 9   ? -233.972 -11.102 101.457 1.00 0.00 ? 9   THR A HB   5  
ATOM 7327  H HG1  . THR A 1 9   ? -231.838 -12.583 101.723 1.00 0.00 ? 9   THR A HG1  5  
ATOM 7328  H HG21 . THR A 1 9   ? -233.692 -9.333  103.125 1.00 0.00 ? 9   THR A HG21 5  
ATOM 7329  H HG22 . THR A 1 9   ? -231.987 -9.757  103.287 1.00 0.00 ? 9   THR A HG22 5  
ATOM 7330  H HG23 . THR A 1 9   ? -232.593 -9.109  101.763 1.00 0.00 ? 9   THR A HG23 5  
ATOM 7331  N N    . HIS A 1 10  ? -235.013 -13.951 103.537 1.00 0.00 ? 10  HIS A N    5  
ATOM 7332  C CA   . HIS A 1 10  ? -235.653 -15.210 103.157 1.00 0.00 ? 10  HIS A CA   5  
ATOM 7333  C C    . HIS A 1 10  ? -237.116 -14.980 102.817 1.00 0.00 ? 10  HIS A C    5  
ATOM 7334  O O    . HIS A 1 10  ? -237.772 -14.151 103.423 1.00 0.00 ? 10  HIS A O    5  
ATOM 7335  C CB   . HIS A 1 10  ? -235.546 -16.248 104.283 1.00 0.00 ? 10  HIS A CB   5  
ATOM 7336  C CG   . HIS A 1 10  ? -234.140 -16.628 104.634 1.00 0.00 ? 10  HIS A CG   5  
ATOM 7337  N ND1  . HIS A 1 10  ? -233.541 -17.788 104.201 1.00 0.00 ? 10  HIS A ND1  5  
ATOM 7338  C CD2  . HIS A 1 10  ? -233.220 -15.995 105.395 1.00 0.00 ? 10  HIS A CD2  5  
ATOM 7339  C CE1  . HIS A 1 10  ? -232.313 -17.851 104.679 1.00 0.00 ? 10  HIS A CE1  5  
ATOM 7340  N NE2  . HIS A 1 10  ? -232.087 -16.771 105.406 1.00 0.00 ? 10  HIS A NE2  5  
ATOM 7341  H H    . HIS A 1 10  ? -235.294 -13.505 104.361 1.00 0.00 ? 10  HIS A H    5  
ATOM 7342  H HA   . HIS A 1 10  ? -235.153 -15.585 102.280 1.00 0.00 ? 10  HIS A HA   5  
ATOM 7343  H HB2  . HIS A 1 10  ? -236.013 -15.852 105.171 1.00 0.00 ? 10  HIS A HB2  5  
ATOM 7344  H HB3  . HIS A 1 10  ? -236.065 -17.146 103.981 1.00 0.00 ? 10  HIS A HB3  5  
ATOM 7345  H HD1  . HIS A 1 10  ? -233.954 -18.467 103.608 1.00 0.00 ? 10  HIS A HD1  5  
ATOM 7346  H HD2  . HIS A 1 10  ? -233.352 -15.050 105.904 1.00 0.00 ? 10  HIS A HD2  5  
ATOM 7347  H HE1  . HIS A 1 10  ? -231.613 -18.654 104.511 1.00 0.00 ? 10  HIS A HE1  5  
ATOM 7348  H HE2  . HIS A 1 10  ? -231.189 -16.429 105.608 1.00 0.00 ? 10  HIS A HE2  5  
ATOM 7349  N N    . ARG A 1 11  ? -237.616 -15.692 101.834 1.00 0.00 ? 11  ARG A N    5  
ATOM 7350  C CA   . ARG A 1 11  ? -238.991 -15.575 101.447 1.00 0.00 ? 11  ARG A CA   5  
ATOM 7351  C C    . ARG A 1 11  ? -239.869 -16.541 102.231 1.00 0.00 ? 11  ARG A C    5  
ATOM 7352  O O    . ARG A 1 11  ? -239.431 -17.626 102.607 1.00 0.00 ? 11  ARG A O    5  
ATOM 7353  C CB   . ARG A 1 11  ? -239.103 -15.832 99.969  1.00 0.00 ? 11  ARG A CB   5  
ATOM 7354  C CG   . ARG A 1 11  ? -239.981 -14.816 99.304  1.00 0.00 ? 11  ARG A CG   5  
ATOM 7355  C CD   . ARG A 1 11  ? -239.639 -14.685 97.838  1.00 0.00 ? 11  ARG A CD   5  
ATOM 7356  N NE   . ARG A 1 11  ? -240.591 -13.854 97.102  1.00 0.00 ? 11  ARG A NE   5  
ATOM 7357  C CZ   . ARG A 1 11  ? -240.353 -13.341 95.896  1.00 0.00 ? 11  ARG A CZ   5  
ATOM 7358  N NH1  . ARG A 1 11  ? -239.186 -13.549 95.297  1.00 0.00 ? 11  ARG A NH1  5  
ATOM 7359  N NH2  . ARG A 1 11  ? -241.285 -12.612 95.292  1.00 0.00 ? 11  ARG A NH2  5  
ATOM 7360  H H    . ARG A 1 11  ? -237.046 -16.294 101.329 1.00 0.00 ? 11  ARG A H    5  
ATOM 7361  H HA   . ARG A 1 11  ? -239.309 -14.564 101.636 1.00 0.00 ? 11  ARG A HA   5  
ATOM 7362  H HB2  . ARG A 1 11  ? -238.118 -15.790 99.524  1.00 0.00 ? 11  ARG A HB2  5  
ATOM 7363  H HB3  . ARG A 1 11  ? -239.528 -16.812 99.809  1.00 0.00 ? 11  ARG A HB3  5  
ATOM 7364  H HG2  . ARG A 1 11  ? -241.008 -15.118 99.412  1.00 0.00 ? 11  ARG A HG2  5  
ATOM 7365  H HG3  . ARG A 1 11  ? -239.837 -13.865 99.800  1.00 0.00 ? 11  ARG A HG3  5  
ATOM 7366  H HD2  . ARG A 1 11  ? -238.660 -14.239 97.766  1.00 0.00 ? 11  ARG A HD2  5  
ATOM 7367  H HD3  . ARG A 1 11  ? -239.617 -15.670 97.402  1.00 0.00 ? 11  ARG A HD3  5  
ATOM 7368  H HE   . ARG A 1 11  ? -241.464 -13.679 97.528  1.00 0.00 ? 11  ARG A HE   5  
ATOM 7369  H HH11 . ARG A 1 11  ? -238.467 -14.098 95.752  1.00 0.00 ? 11  ARG A HH11 5  
ATOM 7370  H HH12 . ARG A 1 11  ? -239.010 -13.164 94.388  1.00 0.00 ? 11  ARG A HH12 5  
ATOM 7371  H HH21 . ARG A 1 11  ? -242.165 -12.448 95.738  1.00 0.00 ? 11  ARG A HH21 5  
ATOM 7372  H HH22 . ARG A 1 11  ? -241.109 -12.225 94.373  1.00 0.00 ? 11  ARG A HH22 5  
ATOM 7373  N N    . VAL A 1 12  ? -241.104 -16.135 102.469 1.00 0.00 ? 12  VAL A N    5  
ATOM 7374  C CA   . VAL A 1 12  ? -242.057 -16.947 103.207 1.00 0.00 ? 12  VAL A CA   5  
ATOM 7375  C C    . VAL A 1 12  ? -243.404 -16.933 102.486 1.00 0.00 ? 12  VAL A C    5  
ATOM 7376  O O    . VAL A 1 12  ? -243.961 -15.869 102.205 1.00 0.00 ? 12  VAL A O    5  
ATOM 7377  C CB   . VAL A 1 12  ? -242.203 -16.434 104.653 1.00 0.00 ? 12  VAL A CB   5  
ATOM 7378  C CG1  . VAL A 1 12  ? -242.450 -14.934 104.659 1.00 0.00 ? 12  VAL A CG1  5  
ATOM 7379  C CG2  . VAL A 1 12  ? -243.311 -17.172 105.385 1.00 0.00 ? 12  VAL A CG2  5  
ATOM 7380  H H    . VAL A 1 12  ? -241.392 -15.256 102.138 1.00 0.00 ? 12  VAL A H    5  
ATOM 7381  H HA   . VAL A 1 12  ? -241.684 -17.964 103.238 1.00 0.00 ? 12  VAL A HA   5  
ATOM 7382  H HB   . VAL A 1 12  ? -241.272 -16.622 105.174 1.00 0.00 ? 12  VAL A HB   5  
ATOM 7383  H HG11 . VAL A 1 12  ? -241.626 -14.434 104.167 1.00 0.00 ? 12  VAL A HG11 5  
ATOM 7384  H HG12 . VAL A 1 12  ? -243.369 -14.719 104.131 1.00 0.00 ? 12  VAL A HG12 5  
ATOM 7385  H HG13 . VAL A 1 12  ? -242.529 -14.585 105.678 1.00 0.00 ? 12  VAL A HG13 5  
ATOM 7386  H HG21 . VAL A 1 12  ? -244.244 -17.026 104.862 1.00 0.00 ? 12  VAL A HG21 5  
ATOM 7387  H HG22 . VAL A 1 12  ? -243.079 -18.227 105.424 1.00 0.00 ? 12  VAL A HG22 5  
ATOM 7388  H HG23 . VAL A 1 12  ? -243.398 -16.785 106.390 1.00 0.00 ? 12  VAL A HG23 5  
ATOM 7389  N N    . THR A 1 13  ? -243.892 -18.115 102.136 1.00 0.00 ? 13  THR A N    5  
ATOM 7390  C CA   . THR A 1 13  ? -245.087 -18.231 101.313 1.00 0.00 ? 13  THR A CA   5  
ATOM 7391  C C    . THR A 1 13  ? -246.346 -17.921 102.136 1.00 0.00 ? 13  THR A C    5  
ATOM 7392  O O    . THR A 1 13  ? -246.553 -18.486 103.213 1.00 0.00 ? 13  THR A O    5  
ATOM 7393  C CB   . THR A 1 13  ? -245.222 -19.656 100.737 1.00 0.00 ? 13  THR A CB   5  
ATOM 7394  O OG1  . THR A 1 13  ? -243.979 -20.064 100.145 1.00 0.00 ? 13  THR A OG1  5  
ATOM 7395  C CG2  . THR A 1 13  ? -246.338 -19.716 99.699  1.00 0.00 ? 13  THR A CG2  5  
ATOM 7396  H H    . THR A 1 13  ? -243.435 -18.928 102.431 1.00 0.00 ? 13  THR A H    5  
ATOM 7397  H HA   . THR A 1 13  ? -244.986 -17.526 100.473 1.00 0.00 ? 13  THR A HA   5  
ATOM 7398  H HB   . THR A 1 13  ? -245.466 -20.332 101.545 1.00 0.00 ? 13  THR A HB   5  
ATOM 7399  H HG1  . THR A 1 13  ? -243.995 -21.012 99.990  1.00 0.00 ? 13  THR A HG1  5  
ATOM 7400  H HG21 . THR A 1 13  ? -246.135 -19.001 98.913  1.00 0.00 ? 13  THR A HG21 5  
ATOM 7401  H HG22 . THR A 1 13  ? -246.391 -20.708 99.281  1.00 0.00 ? 13  THR A HG22 5  
ATOM 7402  H HG23 . THR A 1 13  ? -247.281 -19.471 100.168 1.00 0.00 ? 13  THR A HG23 5  
ATOM 7403  N N    . VAL A 1 14  ? -247.186 -17.044 101.621 1.00 0.00 ? 14  VAL A N    5  
ATOM 7404  C CA   . VAL A 1 14  ? -248.408 -16.647 102.299 1.00 0.00 ? 14  VAL A CA   5  
ATOM 7405  C C    . VAL A 1 14  ? -249.635 -17.121 101.512 1.00 0.00 ? 14  VAL A C    5  
ATOM 7406  O O    . VAL A 1 14  ? -249.774 -16.823 100.328 1.00 0.00 ? 14  VAL A O    5  
ATOM 7407  C CB   . VAL A 1 14  ? -248.424 -15.107 102.490 1.00 0.00 ? 14  VAL A CB   5  
ATOM 7408  C CG1  . VAL A 1 14  ? -249.776 -14.593 102.959 1.00 0.00 ? 14  VAL A CG1  5  
ATOM 7409  C CG2  . VAL A 1 14  ? -247.332 -14.689 103.461 1.00 0.00 ? 14  VAL A CG2  5  
ATOM 7410  H H    . VAL A 1 14  ? -246.977 -16.637 100.749 1.00 0.00 ? 14  VAL A H    5  
ATOM 7411  H HA   . VAL A 1 14  ? -248.416 -17.111 103.276 1.00 0.00 ? 14  VAL A HA   5  
ATOM 7412  H HB   . VAL A 1 14  ? -248.211 -14.651 101.536 1.00 0.00 ? 14  VAL A HB   5  
ATOM 7413  H HG11 . VAL A 1 14  ? -250.160 -15.226 103.743 1.00 0.00 ? 14  VAL A HG11 5  
ATOM 7414  H HG12 . VAL A 1 14  ? -249.660 -13.583 103.326 1.00 0.00 ? 14  VAL A HG12 5  
ATOM 7415  H HG13 . VAL A 1 14  ? -250.466 -14.583 102.121 1.00 0.00 ? 14  VAL A HG13 5  
ATOM 7416  H HG21 . VAL A 1 14  ? -247.485 -15.180 104.412 1.00 0.00 ? 14  VAL A HG21 5  
ATOM 7417  H HG22 . VAL A 1 14  ? -246.368 -14.970 103.063 1.00 0.00 ? 14  VAL A HG22 5  
ATOM 7418  H HG23 . VAL A 1 14  ? -247.366 -13.618 103.600 1.00 0.00 ? 14  VAL A HG23 5  
ATOM 7419  N N    . HIS A 1 15  ? -250.504 -17.888 102.170 1.00 0.00 ? 15  HIS A N    5  
ATOM 7420  C CA   . HIS A 1 15  ? -251.700 -18.436 101.521 1.00 0.00 ? 15  HIS A CA   5  
ATOM 7421  C C    . HIS A 1 15  ? -252.898 -17.503 101.654 1.00 0.00 ? 15  HIS A C    5  
ATOM 7422  O O    . HIS A 1 15  ? -253.894 -17.664 100.958 1.00 0.00 ? 15  HIS A O    5  
ATOM 7423  C CB   . HIS A 1 15  ? -252.065 -19.798 102.119 1.00 0.00 ? 15  HIS A CB   5  
ATOM 7424  C CG   . HIS A 1 15  ? -251.490 -20.971 101.388 1.00 0.00 ? 15  HIS A CG   5  
ATOM 7425  N ND1  . HIS A 1 15  ? -251.990 -21.439 100.194 1.00 0.00 ? 15  HIS A ND1  5  
ATOM 7426  C CD2  . HIS A 1 15  ? -250.457 -21.786 101.702 1.00 0.00 ? 15  HIS A CD2  5  
ATOM 7427  C CE1  . HIS A 1 15  ? -251.294 -22.490 99.810  1.00 0.00 ? 15  HIS A CE1  5  
ATOM 7428  N NE2  . HIS A 1 15  ? -250.355 -22.727 100.708 1.00 0.00 ? 15  HIS A NE2  5  
ATOM 7429  H H    . HIS A 1 15  ? -250.335 -18.102 103.115 1.00 0.00 ? 15  HIS A H    5  
ATOM 7430  H HA   . HIS A 1 15  ? -251.477 -18.565 100.472 1.00 0.00 ? 15  HIS A HA   5  
ATOM 7431  H HB2  . HIS A 1 15  ? -251.698 -19.838 103.135 1.00 0.00 ? 15  HIS A HB2  5  
ATOM 7432  H HB3  . HIS A 1 15  ? -253.142 -19.903 102.134 1.00 0.00 ? 15  HIS A HB3  5  
ATOM 7433  H HD1  . HIS A 1 15  ? -252.755 -21.063 99.696  1.00 0.00 ? 15  HIS A HD1  5  
ATOM 7434  H HD2  . HIS A 1 15  ? -249.830 -21.714 102.581 1.00 0.00 ? 15  HIS A HD2  5  
ATOM 7435  H HE1  . HIS A 1 15  ? -251.462 -23.063 98.910  1.00 0.00 ? 15  HIS A HE1  5  
ATOM 7436  H HE2  . HIS A 1 15  ? -249.893 -23.597 100.807 1.00 0.00 ? 15  HIS A HE2  5  
ATOM 7437  N N    . GLY A 1 16  ? -252.806 -16.535 102.551 1.00 0.00 ? 16  GLY A N    5  
ATOM 7438  C CA   . GLY A 1 16  ? -253.945 -15.663 102.797 1.00 0.00 ? 16  GLY A CA   5  
ATOM 7439  C C    . GLY A 1 16  ? -253.745 -14.261 102.259 1.00 0.00 ? 16  GLY A C    5  
ATOM 7440  O O    . GLY A 1 16  ? -254.257 -13.295 102.818 1.00 0.00 ? 16  GLY A O    5  
ATOM 7441  H H    . GLY A 1 16  ? -251.964 -16.411 103.044 1.00 0.00 ? 16  GLY A H    5  
ATOM 7442  H HA2  . GLY A 1 16  ? -254.817 -16.093 102.329 1.00 0.00 ? 16  GLY A HA2  5  
ATOM 7443  H HA3  . GLY A 1 16  ? -254.113 -15.606 103.862 1.00 0.00 ? 16  GLY A HA3  5  
ATOM 7444  N N    . VAL A 1 17  ? -253.006 -14.149 101.167 1.00 0.00 ? 17  VAL A N    5  
ATOM 7445  C CA   . VAL A 1 17  ? -252.659 -12.856 100.607 1.00 0.00 ? 17  VAL A CA   5  
ATOM 7446  C C    . VAL A 1 17  ? -253.894 -12.117 100.079 1.00 0.00 ? 17  VAL A C    5  
ATOM 7447  O O    . VAL A 1 17  ? -254.888 -12.736 99.704  1.00 0.00 ? 17  VAL A O    5  
ATOM 7448  C CB   . VAL A 1 17  ? -251.624 -12.997 99.470  1.00 0.00 ? 17  VAL A CB   5  
ATOM 7449  C CG1  . VAL A 1 17  ? -250.438 -13.821 99.912  1.00 0.00 ? 17  VAL A CG1  5  
ATOM 7450  C CG2  . VAL A 1 17  ? -252.249 -13.589 98.215  1.00 0.00 ? 17  VAL A CG2  5  
ATOM 7451  H H    . VAL A 1 17  ? -252.696 -14.956 100.717 1.00 0.00 ? 17  VAL A H    5  
ATOM 7452  H HA   . VAL A 1 17  ? -252.213 -12.266 101.396 1.00 0.00 ? 17  VAL A HA   5  
ATOM 7453  H HB   . VAL A 1 17  ? -251.262 -12.022 99.241  1.00 0.00 ? 17  VAL A HB   5  
ATOM 7454  H HG11 . VAL A 1 17  ? -250.773 -14.800 100.216 1.00 0.00 ? 17  VAL A HG11 5  
ATOM 7455  H HG12 . VAL A 1 17  ? -249.741 -13.917 99.092  1.00 0.00 ? 17  VAL A HG12 5  
ATOM 7456  H HG13 . VAL A 1 17  ? -249.950 -13.332 100.743 1.00 0.00 ? 17  VAL A HG13 5  
ATOM 7457  H HG21 . VAL A 1 17  ? -253.060 -12.957 97.883  1.00 0.00 ? 17  VAL A HG21 5  
ATOM 7458  H HG22 . VAL A 1 17  ? -251.502 -13.652 97.436  1.00 0.00 ? 17  VAL A HG22 5  
ATOM 7459  H HG23 . VAL A 1 17  ? -252.627 -14.576 98.432  1.00 0.00 ? 17  VAL A HG23 5  
ATOM 7460  N N    . PRO A 1 18  ? -253.834 -10.772 100.050 1.00 0.00 ? 18  PRO A N    5  
ATOM 7461  C CA   . PRO A 1 18  ? -254.913 -9.929  99.516  1.00 0.00 ? 18  PRO A CA   5  
ATOM 7462  C C    . PRO A 1 18  ? -254.850 -9.840  98.007  1.00 0.00 ? 18  PRO A C    5  
ATOM 7463  O O    . PRO A 1 18  ? -255.792 -9.427  97.326  1.00 0.00 ? 18  PRO A O    5  
ATOM 7464  C CB   . PRO A 1 18  ? -254.600 -8.575  100.132 1.00 0.00 ? 18  PRO A CB   5  
ATOM 7465  C CG   . PRO A 1 18  ? -253.111 -8.563  100.152 1.00 0.00 ? 18  PRO A CG   5  
ATOM 7466  C CD   . PRO A 1 18  ? -252.710 -9.956  100.551 1.00 0.00 ? 18  PRO A CD   5  
ATOM 7467  H HA   . PRO A 1 18  ? -255.868 -10.273 99.815  1.00 0.00 ? 18  PRO A HA   5  
ATOM 7468  H HB2  . PRO A 1 18  ? -255.004 -7.785  99.516  1.00 0.00 ? 18  PRO A HB2  5  
ATOM 7469  H HB3  . PRO A 1 18  ? -255.010 -8.521  101.129 1.00 0.00 ? 18  PRO A HB3  5  
ATOM 7470  H HG2  . PRO A 1 18  ? -252.731 -8.329  99.169  1.00 0.00 ? 18  PRO A HG2  5  
ATOM 7471  H HG3  . PRO A 1 18  ? -252.758 -7.857  100.864 1.00 0.00 ? 18  PRO A HG3  5  
ATOM 7472  H HD2  . PRO A 1 18  ? -251.782 -10.235 100.072 1.00 0.00 ? 18  PRO A HD2  5  
ATOM 7473  H HD3  . PRO A 1 18  ? -252.625 -10.032 101.623 1.00 0.00 ? 18  PRO A HD3  5  
ATOM 7474  N N    . GLY A 1 19  ? -253.690 -10.206 97.532  1.00 0.00 ? 19  GLY A N    5  
ATOM 7475  C CA   . GLY A 1 19  ? -253.402 -10.271 96.109  1.00 0.00 ? 19  GLY A CA   5  
ATOM 7476  C C    . GLY A 1 19  ? -254.351 -11.179 95.350  1.00 0.00 ? 19  GLY A C    5  
ATOM 7477  O O    . GLY A 1 19  ? -255.127 -11.925 95.947  1.00 0.00 ? 19  GLY A O    5  
ATOM 7478  H H    . GLY A 1 19  ? -253.001 -10.425 98.191  1.00 0.00 ? 19  GLY A H    5  
ATOM 7479  H HA2  . GLY A 1 19  ? -253.463 -9.284  95.688  1.00 0.00 ? 19  GLY A HA2  5  
ATOM 7480  H HA3  . GLY A 1 19  ? -252.396 -10.641 95.980  1.00 0.00 ? 19  GLY A HA3  5  
ATOM 7481  N N    . PRO A 1 20  ? -254.308 -11.132 94.015  1.00 0.00 ? 20  PRO A N    5  
ATOM 7482  C CA   . PRO A 1 20  ? -255.134 -11.984 93.158  1.00 0.00 ? 20  PRO A CA   5  
ATOM 7483  C C    . PRO A 1 20  ? -254.689 -13.431 93.252  1.00 0.00 ? 20  PRO A C    5  
ATOM 7484  O O    . PRO A 1 20  ? -255.468 -14.366 93.058  1.00 0.00 ? 20  PRO A O    5  
ATOM 7485  C CB   . PRO A 1 20  ? -254.850 -11.443 91.758  1.00 0.00 ? 20  PRO A CB   5  
ATOM 7486  C CG   . PRO A 1 20  ? -253.481 -10.883 91.867  1.00 0.00 ? 20  PRO A CG   5  
ATOM 7487  C CD   . PRO A 1 20  ? -253.429 -10.259 93.225  1.00 0.00 ? 20  PRO A CD   5  
ATOM 7488  H HA   . PRO A 1 20  ? -256.179 -11.897 93.389  1.00 0.00 ? 20  PRO A HA   5  
ATOM 7489  H HB2  . PRO A 1 20  ? -254.891 -12.247 91.045  1.00 0.00 ? 20  PRO A HB2  5  
ATOM 7490  H HB3  . PRO A 1 20  ? -255.571 -10.681 91.502  1.00 0.00 ? 20  PRO A HB3  5  
ATOM 7491  H HG2  . PRO A 1 20  ? -252.751 -11.676 91.789  1.00 0.00 ? 20  PRO A HG2  5  
ATOM 7492  H HG3  . PRO A 1 20  ? -253.316 -10.148 91.110  1.00 0.00 ? 20  PRO A HG3  5  
ATOM 7493  H HD2  . PRO A 1 20  ? -252.429 -10.283 93.607  1.00 0.00 ? 20  PRO A HD2  5  
ATOM 7494  H HD3  . PRO A 1 20  ? -253.808 -9.247  93.196  1.00 0.00 ? 20  PRO A HD3  5  
ATOM 7495  N N    . GLU A 1 21  ? -253.405 -13.585 93.529  1.00 0.00 ? 21  GLU A N    5  
ATOM 7496  C CA   . GLU A 1 21  ? -252.779 -14.890 93.691  1.00 0.00 ? 21  GLU A CA   5  
ATOM 7497  C C    . GLU A 1 21  ? -253.402 -15.654 94.847  1.00 0.00 ? 21  GLU A C    5  
ATOM 7498  O O    . GLU A 1 21  ? -253.952 -15.073 95.782  1.00 0.00 ? 21  GLU A O    5  
ATOM 7499  C CB   . GLU A 1 21  ? -251.280 -14.716 93.940  1.00 0.00 ? 21  GLU A CB   5  
ATOM 7500  C CG   . GLU A 1 21  ? -250.613 -13.731 92.990  1.00 0.00 ? 21  GLU A CG   5  
ATOM 7501  C CD   . GLU A 1 21  ? -249.260 -13.261 93.482  1.00 0.00 ? 21  GLU A CD   5  
ATOM 7502  O OE1  . GLU A 1 21  ? -248.254 -13.955 93.233  1.00 0.00 ? 21  GLU A OE1  5  
ATOM 7503  O OE2  . GLU A 1 21  ? -249.201 -12.185 94.114  1.00 0.00 ? 21  GLU A OE2  5  
ATOM 7504  H H    . GLU A 1 21  ? -252.854 -12.771 93.624  1.00 0.00 ? 21  GLU A H    5  
ATOM 7505  H HA   . GLU A 1 21  ? -252.930 -15.463 92.784  1.00 0.00 ? 21  GLU A HA   5  
ATOM 7506  H HB2  . GLU A 1 21  ? -251.127 -14.388 94.955  1.00 0.00 ? 21  GLU A HB2  5  
ATOM 7507  H HB3  . GLU A 1 21  ? -250.804 -15.674 93.812  1.00 0.00 ? 21  GLU A HB3  5  
ATOM 7508  H HG2  . GLU A 1 21  ? -250.481 -14.210 92.032  1.00 0.00 ? 21  GLU A HG2  5  
ATOM 7509  H HG3  . GLU A 1 21  ? -251.255 -12.872 92.873  1.00 0.00 ? 21  GLU A HG3  5  
ATOM 7510  N N    . PRO A 1 22  ? -253.308 -16.978 94.787  1.00 0.00 ? 22  PRO A N    5  
ATOM 7511  C CA   . PRO A 1 22  ? -253.861 -17.865 95.803  1.00 0.00 ? 22  PRO A CA   5  
ATOM 7512  C C    . PRO A 1 22  ? -252.908 -17.974 96.966  1.00 0.00 ? 22  PRO A C    5  
ATOM 7513  O O    . PRO A 1 22  ? -253.283 -18.066 98.134  1.00 0.00 ? 22  PRO A O    5  
ATOM 7514  C CB   . PRO A 1 22  ? -253.965 -19.207 95.083  1.00 0.00 ? 22  PRO A CB   5  
ATOM 7515  C CG   . PRO A 1 22  ? -253.364 -19.006 93.723  1.00 0.00 ? 22  PRO A CG   5  
ATOM 7516  C CD   . PRO A 1 22  ? -252.629 -17.722 93.727  1.00 0.00 ? 22  PRO A CD   5  
ATOM 7517  H HA   . PRO A 1 22  ? -254.829 -17.545 96.137  1.00 0.00 ? 22  PRO A HA   5  
ATOM 7518  H HB2  . PRO A 1 22  ? -253.420 -19.955 95.642  1.00 0.00 ? 22  PRO A HB2  5  
ATOM 7519  H HB3  . PRO A 1 22  ? -255.003 -19.495 95.013  1.00 0.00 ? 22  PRO A HB3  5  
ATOM 7520  H HG2  . PRO A 1 22  ? -252.696 -19.812 93.496  1.00 0.00 ? 22  PRO A HG2  5  
ATOM 7521  H HG3  . PRO A 1 22  ? -254.134 -18.948 93.004  1.00 0.00 ? 22  PRO A HG3  5  
ATOM 7522  H HD2  . PRO A 1 22  ? -251.586 -17.880 93.947  1.00 0.00 ? 22  PRO A HD2  5  
ATOM 7523  H HD3  . PRO A 1 22  ? -252.741 -17.225 92.778  1.00 0.00 ? 22  PRO A HD3  5  
ATOM 7524  N N    . PHE A 1 23  ? -251.657 -17.960 96.590  1.00 0.00 ? 23  PHE A N    5  
ATOM 7525  C CA   . PHE A 1 23  ? -250.550 -17.986 97.518  1.00 0.00 ? 23  PHE A CA   5  
ATOM 7526  C C    . PHE A 1 23  ? -249.353 -17.319 96.871  1.00 0.00 ? 23  PHE A C    5  
ATOM 7527  O O    . PHE A 1 23  ? -249.000 -17.628 95.733  1.00 0.00 ? 23  PHE A O    5  
ATOM 7528  C CB   . PHE A 1 23  ? -250.216 -19.425 97.950  1.00 0.00 ? 23  PHE A CB   5  
ATOM 7529  C CG   . PHE A 1 23  ? -249.862 -20.361 96.822  1.00 0.00 ? 23  PHE A CG   5  
ATOM 7530  C CD1  . PHE A 1 23  ? -250.854 -20.984 96.083  1.00 0.00 ? 23  PHE A CD1  5  
ATOM 7531  C CD2  . PHE A 1 23  ? -248.536 -20.620 96.507  1.00 0.00 ? 23  PHE A CD2  5  
ATOM 7532  C CE1  . PHE A 1 23  ? -250.533 -21.845 95.052  1.00 0.00 ? 23  PHE A CE1  5  
ATOM 7533  C CE2  . PHE A 1 23  ? -248.210 -21.480 95.477  1.00 0.00 ? 23  PHE A CE2  5  
ATOM 7534  C CZ   . PHE A 1 23  ? -249.209 -22.093 94.747  1.00 0.00 ? 23  PHE A CZ   5  
ATOM 7535  H H    . PHE A 1 23  ? -251.477 -17.913 95.620  1.00 0.00 ? 23  PHE A H    5  
ATOM 7536  H HA   . PHE A 1 23  ? -250.832 -17.414 98.389  1.00 0.00 ? 23  PHE A HA   5  
ATOM 7537  H HB2  . PHE A 1 23  ? -249.374 -19.398 98.625  1.00 0.00 ? 23  PHE A HB2  5  
ATOM 7538  H HB3  . PHE A 1 23  ? -251.067 -19.841 98.471  1.00 0.00 ? 23  PHE A HB3  5  
ATOM 7539  H HD1  . PHE A 1 23  ? -251.889 -20.789 96.317  1.00 0.00 ? 23  PHE A HD1  5  
ATOM 7540  H HD2  . PHE A 1 23  ? -247.752 -20.139 97.077  1.00 0.00 ? 23  PHE A HD2  5  
ATOM 7541  H HE1  . PHE A 1 23  ? -251.318 -22.323 94.483  1.00 0.00 ? 23  PHE A HE1  5  
ATOM 7542  H HE2  . PHE A 1 23  ? -247.173 -21.671 95.242  1.00 0.00 ? 23  PHE A HE2  5  
ATOM 7543  H HZ   . PHE A 1 23  ? -248.956 -22.765 93.942  1.00 0.00 ? 23  PHE A HZ   5  
ATOM 7544  N N    . THR A 1 24  ? -248.756 -16.385 97.577  1.00 0.00 ? 24  THR A N    5  
ATOM 7545  C CA   . THR A 1 24  ? -247.577 -15.716 97.084  1.00 0.00 ? 24  THR A CA   5  
ATOM 7546  C C    . THR A 1 24  ? -246.604 -15.506 98.232  1.00 0.00 ? 24  THR A C    5  
ATOM 7547  O O    . THR A 1 24  ? -246.996 -15.467 99.395  1.00 0.00 ? 24  THR A O    5  
ATOM 7548  C CB   . THR A 1 24  ? -247.910 -14.377 96.393  1.00 0.00 ? 24  THR A CB   5  
ATOM 7549  O OG1  . THR A 1 24  ? -246.802 -13.943 95.594  1.00 0.00 ? 24  THR A OG1  5  
ATOM 7550  C CG2  . THR A 1 24  ? -248.256 -13.298 97.401  1.00 0.00 ? 24  THR A CG2  5  
ATOM 7551  H H    . THR A 1 24  ? -249.113 -16.144 98.458  1.00 0.00 ? 24  THR A H    5  
ATOM 7552  H HA   . THR A 1 24  ? -247.112 -16.366 96.356  1.00 0.00 ? 24  THR A HA   5  
ATOM 7553  H HB   . THR A 1 24  ? -248.763 -14.530 95.748  1.00 0.00 ? 24  THR A HB   5  
ATOM 7554  H HG1  . THR A 1 24  ? -247.081 -13.908 94.663  1.00 0.00 ? 24  THR A HG1  5  
ATOM 7555  H HG21 . THR A 1 24  ? -247.432 -13.169 98.088  1.00 0.00 ? 24  THR A HG21 5  
ATOM 7556  H HG22 . THR A 1 24  ? -248.441 -12.368 96.883  1.00 0.00 ? 24  THR A HG22 5  
ATOM 7557  H HG23 . THR A 1 24  ? -249.140 -13.587 97.948  1.00 0.00 ? 24  THR A HG23 5  
ATOM 7558  N N    . VAL A 1 25  ? -245.344 -15.376 97.896  1.00 0.00 ? 25  VAL A N    5  
ATOM 7559  C CA   . VAL A 1 25  ? -244.274 -15.447 98.873  1.00 0.00 ? 25  VAL A CA   5  
ATOM 7560  C C    . VAL A 1 25  ? -243.525 -14.112 98.934  1.00 0.00 ? 25  VAL A C    5  
ATOM 7561  O O    . VAL A 1 25  ? -243.126 -13.583 97.895  1.00 0.00 ? 25  VAL A O    5  
ATOM 7562  C CB   . VAL A 1 25  ? -243.303 -16.571 98.461  1.00 0.00 ? 25  VAL A CB   5  
ATOM 7563  C CG1  . VAL A 1 25  ? -242.363 -16.953 99.572  1.00 0.00 ? 25  VAL A CG1  5  
ATOM 7564  C CG2  . VAL A 1 25  ? -244.050 -17.785 97.938  1.00 0.00 ? 25  VAL A CG2  5  
ATOM 7565  H H    . VAL A 1 25  ? -245.122 -15.206 96.956  1.00 0.00 ? 25  VAL A H    5  
ATOM 7566  H HA   . VAL A 1 25  ? -244.691 -15.682 99.843  1.00 0.00 ? 25  VAL A HA   5  
ATOM 7567  H HB   . VAL A 1 25  ? -242.713 -16.196 97.671  1.00 0.00 ? 25  VAL A HB   5  
ATOM 7568  H HG11 . VAL A 1 25  ? -241.816 -16.078 99.894  1.00 0.00 ? 25  VAL A HG11 5  
ATOM 7569  H HG12 . VAL A 1 25  ? -242.931 -17.346 100.403 1.00 0.00 ? 25  VAL A HG12 5  
ATOM 7570  H HG13 . VAL A 1 25  ? -241.672 -17.704 99.221  1.00 0.00 ? 25  VAL A HG13 5  
ATOM 7571  H HG21 . VAL A 1 25  ? -244.637 -17.504 97.078  1.00 0.00 ? 25  VAL A HG21 5  
ATOM 7572  H HG22 . VAL A 1 25  ? -243.340 -18.550 97.657  1.00 0.00 ? 25  VAL A HG22 5  
ATOM 7573  H HG23 . VAL A 1 25  ? -244.702 -18.166 98.711  1.00 0.00 ? 25  VAL A HG23 5  
ATOM 7574  N N    . PHE A 1 26  ? -243.331 -13.560 100.132 1.00 0.00 ? 26  PHE A N    5  
ATOM 7575  C CA   . PHE A 1 26  ? -242.622 -12.281 100.262 1.00 0.00 ? 26  PHE A CA   5  
ATOM 7576  C C    . PHE A 1 26  ? -241.272 -12.459 100.920 1.00 0.00 ? 26  PHE A C    5  
ATOM 7577  O O    . PHE A 1 26  ? -241.133 -13.198 101.894 1.00 0.00 ? 26  PHE A O    5  
ATOM 7578  C CB   . PHE A 1 26  ? -243.434 -11.236 101.034 1.00 0.00 ? 26  PHE A CB   5  
ATOM 7579  C CG   . PHE A 1 26  ? -244.748 -10.907 100.377 1.00 0.00 ? 26  PHE A CG   5  
ATOM 7580  C CD1  . PHE A 1 26  ? -245.882 -11.672 100.615 1.00 0.00 ? 26  PHE A CD1  5  
ATOM 7581  C CD2  . PHE A 1 26  ? -244.846 -9.825  99.514  1.00 0.00 ? 26  PHE A CD2  5  
ATOM 7582  C CE1  . PHE A 1 26  ? -247.084 -11.364 100.007 1.00 0.00 ? 26  PHE A CE1  5  
ATOM 7583  C CE2  . PHE A 1 26  ? -246.046 -9.512  98.904  1.00 0.00 ? 26  PHE A CE2  5  
ATOM 7584  C CZ   . PHE A 1 26  ? -247.167 -10.283 99.151  1.00 0.00 ? 26  PHE A CZ   5  
ATOM 7585  H H    . PHE A 1 26  ? -243.660 -14.019 100.936 1.00 0.00 ? 26  PHE A H    5  
ATOM 7586  H HA   . PHE A 1 26  ? -242.455 -11.914 99.267  1.00 0.00 ? 26  PHE A HA   5  
ATOM 7587  H HB2  . PHE A 1 26  ? -243.620 -11.585 102.030 1.00 0.00 ? 26  PHE A HB2  5  
ATOM 7588  H HB3  . PHE A 1 26  ? -242.857 -10.327 101.104 1.00 0.00 ? 26  PHE A HB3  5  
ATOM 7589  H HD1  . PHE A 1 26  ? -245.823 -12.520 101.286 1.00 0.00 ? 26  PHE A HD1  5  
ATOM 7590  H HD2  . PHE A 1 26  ? -243.972 -9.223  99.322  1.00 0.00 ? 26  PHE A HD2  5  
ATOM 7591  H HE1  . PHE A 1 26  ? -247.959 -11.968 100.201 1.00 0.00 ? 26  PHE A HE1  5  
ATOM 7592  H HE2  . PHE A 1 26  ? -246.107 -8.666  98.237  1.00 0.00 ? 26  PHE A HE2  5  
ATOM 7593  H HZ   . PHE A 1 26  ? -248.107 -10.039 98.674  1.00 0.00 ? 26  PHE A HZ   5  
ATOM 7594  N N    . THR A 1 27  ? -240.276 -11.791 100.358 1.00 0.00 ? 27  THR A N    5  
ATOM 7595  C CA   . THR A 1 27  ? -238.918 -11.885 100.849 1.00 0.00 ? 27  THR A CA   5  
ATOM 7596  C C    . THR A 1 27  ? -238.708 -10.923 102.002 1.00 0.00 ? 27  THR A C    5  
ATOM 7597  O O    . THR A 1 27  ? -239.086 -9.757  101.926 1.00 0.00 ? 27  THR A O    5  
ATOM 7598  C CB   . THR A 1 27  ? -237.902 -11.584 99.736  1.00 0.00 ? 27  THR A CB   5  
ATOM 7599  O OG1  . THR A 1 27  ? -238.514 -11.790 98.456  1.00 0.00 ? 27  THR A OG1  5  
ATOM 7600  C CG2  . THR A 1 27  ? -236.696 -12.499 99.871  1.00 0.00 ? 27  THR A CG2  5  
ATOM 7601  H H    . THR A 1 27  ? -240.462 -11.216 99.587  1.00 0.00 ? 27  THR A H    5  
ATOM 7602  H HA   . THR A 1 27  ? -238.756 -12.896 101.198 1.00 0.00 ? 27  THR A HA   5  
ATOM 7603  H HB   . THR A 1 27  ? -237.578 -10.560 99.820  1.00 0.00 ? 27  THR A HB   5  
ATOM 7604  H HG1  . THR A 1 27  ? -237.938 -11.429 97.763  1.00 0.00 ? 27  THR A HG1  5  
ATOM 7605  H HG21 . THR A 1 27  ? -237.025 -13.529 99.821  1.00 0.00 ? 27  THR A HG21 5  
ATOM 7606  H HG22 . THR A 1 27  ? -236.002 -12.300 99.068  1.00 0.00 ? 27  THR A HG22 5  
ATOM 7607  H HG23 . THR A 1 27  ? -236.213 -12.322 100.823 1.00 0.00 ? 27  THR A HG23 5  
ATOM 7608  N N    . ILE A 1 28  ? -238.081 -11.414 103.046 1.00 0.00 ? 28  ILE A N    5  
ATOM 7609  C CA   . ILE A 1 28  ? -237.943 -10.674 104.285 1.00 0.00 ? 28  ILE A CA   5  
ATOM 7610  C C    . ILE A 1 28  ? -236.521 -10.171 104.428 1.00 0.00 ? 28  ILE A C    5  
ATOM 7611  O O    . ILE A 1 28  ? -235.742 -10.268 103.487 1.00 0.00 ? 28  ILE A O    5  
ATOM 7612  C CB   . ILE A 1 28  ? -238.301 -11.565 105.475 1.00 0.00 ? 28  ILE A CB   5  
ATOM 7613  C CG1  . ILE A 1 28  ? -237.180 -12.566 105.755 1.00 0.00 ? 28  ILE A CG1  5  
ATOM 7614  C CG2  . ILE A 1 28  ? -239.598 -12.297 105.169 1.00 0.00 ? 28  ILE A CG2  5  
ATOM 7615  C CD1  . ILE A 1 28  ? -237.513 -13.552 106.838 1.00 0.00 ? 28  ILE A CD1  5  
ATOM 7616  H H    . ILE A 1 28  ? -237.705 -12.319 102.992 1.00 0.00 ? 28  ILE A H    5  
ATOM 7617  H HA   . ILE A 1 28  ? -238.620 -9.844  104.268 1.00 0.00 ? 28  ILE A HA   5  
ATOM 7618  H HB   . ILE A 1 28  ? -238.454 -10.941 106.348 1.00 0.00 ? 28  ILE A HB   5  
ATOM 7619  H HG12 . ILE A 1 28  ? -236.977 -13.124 104.855 1.00 0.00 ? 28  ILE A HG12 5  
ATOM 7620  H HG13 . ILE A 1 28  ? -236.289 -12.030 106.053 1.00 0.00 ? 28  ILE A HG13 5  
ATOM 7621  H HG21 . ILE A 1 28  ? -240.366 -11.580 104.901 1.00 0.00 ? 28  ILE A HG21 5  
ATOM 7622  H HG22 . ILE A 1 28  ? -239.440 -12.985 104.352 1.00 0.00 ? 28  ILE A HG22 5  
ATOM 7623  H HG23 . ILE A 1 28  ? -239.914 -12.841 106.049 1.00 0.00 ? 28  ILE A HG23 5  
ATOM 7624  H HD11 . ILE A 1 28  ? -237.718 -13.017 107.752 1.00 0.00 ? 28  ILE A HD11 5  
ATOM 7625  H HD12 . ILE A 1 28  ? -238.385 -14.116 106.549 1.00 0.00 ? 28  ILE A HD12 5  
ATOM 7626  H HD13 . ILE A 1 28  ? -236.680 -14.222 106.989 1.00 0.00 ? 28  ILE A HD13 5  
ATOM 7627  N N    . ASN A 1 29  ? -236.190 -9.616  105.582 1.00 0.00 ? 29  ASN A N    5  
ATOM 7628  C CA   . ASN A 1 29  ? -234.842 -9.131  105.821 1.00 0.00 ? 29  ASN A CA   5  
ATOM 7629  C C    . ASN A 1 29  ? -234.559 -9.050  107.316 1.00 0.00 ? 29  ASN A C    5  
ATOM 7630  O O    . ASN A 1 29  ? -235.435 -8.693  108.100 1.00 0.00 ? 29  ASN A O    5  
ATOM 7631  C CB   . ASN A 1 29  ? -234.633 -7.757  105.177 1.00 0.00 ? 29  ASN A CB   5  
ATOM 7632  C CG   . ASN A 1 29  ? -235.542 -6.689  105.753 1.00 0.00 ? 29  ASN A CG   5  
ATOM 7633  O OD1  . ASN A 1 29  ? -235.192 -6.002  106.715 1.00 0.00 ? 29  ASN A OD1  5  
ATOM 7634  N ND2  . ASN A 1 29  ? -236.714 -6.538  105.165 1.00 0.00 ? 29  ASN A ND2  5  
ATOM 7635  H H    . ASN A 1 29  ? -236.858 -9.546  106.299 1.00 0.00 ? 29  ASN A H    5  
ATOM 7636  H HA   . ASN A 1 29  ? -234.160 -9.833  105.364 1.00 0.00 ? 29  ASN A HA   5  
ATOM 7637  H HB2  . ASN A 1 29  ? -233.609 -7.450  105.330 1.00 0.00 ? 29  ASN A HB2  5  
ATOM 7638  H HB3  . ASN A 1 29  ? -234.825 -7.839  104.118 1.00 0.00 ? 29  ASN A HB3  5  
ATOM 7639  H HD21 . ASN A 1 29  ? -236.929 -7.111  104.398 1.00 0.00 ? 29  ASN A HD21 5  
ATOM 7640  H HD22 . ASN A 1 29  ? -237.326 -5.871  105.523 1.00 0.00 ? 29  ASN A HD22 5  
ATOM 7641  N N    . GLY A 1 30  ? -233.345 -9.408  107.701 1.00 0.00 ? 30  GLY A N    5  
ATOM 7642  C CA   . GLY A 1 30  ? -232.930 -9.282  109.086 1.00 0.00 ? 30  GLY A CA   5  
ATOM 7643  C C    . GLY A 1 30  ? -233.576 -10.318 109.982 1.00 0.00 ? 30  GLY A C    5  
ATOM 7644  O O    . GLY A 1 30  ? -233.477 -11.519 109.726 1.00 0.00 ? 30  GLY A O    5  
ATOM 7645  H H    . GLY A 1 30  ? -232.727 -9.786  107.040 1.00 0.00 ? 30  GLY A H    5  
ATOM 7646  H HA2  . GLY A 1 30  ? -231.856 -9.394  109.140 1.00 0.00 ? 30  GLY A HA2  5  
ATOM 7647  H HA3  . GLY A 1 30  ? -233.195 -8.297  109.441 1.00 0.00 ? 30  GLY A HA3  5  
ATOM 7648  N N    . GLY A 1 31  ? -234.239 -9.855  111.030 1.00 0.00 ? 31  GLY A N    5  
ATOM 7649  C CA   . GLY A 1 31  ? -234.908 -10.749 111.949 1.00 0.00 ? 31  GLY A CA   5  
ATOM 7650  C C    . GLY A 1 31  ? -236.388 -10.445 112.036 1.00 0.00 ? 31  GLY A C    5  
ATOM 7651  O O    . GLY A 1 31  ? -236.908 -10.130 113.110 1.00 0.00 ? 31  GLY A O    5  
ATOM 7652  H H    . GLY A 1 31  ? -234.282 -8.884  111.181 1.00 0.00 ? 31  GLY A H    5  
ATOM 7653  H HA2  . GLY A 1 31  ? -234.775 -11.766 111.611 1.00 0.00 ? 31  GLY A HA2  5  
ATOM 7654  H HA3  . GLY A 1 31  ? -234.471 -10.643 112.929 1.00 0.00 ? 31  GLY A HA3  5  
ATOM 7655  N N    . THR A 1 32  ? -237.058 -10.525 110.893 1.00 0.00 ? 32  THR A N    5  
ATOM 7656  C CA   . THR A 1 32  ? -238.473 -10.212 110.805 1.00 0.00 ? 32  THR A CA   5  
ATOM 7657  C C    . THR A 1 32  ? -239.321 -11.078 111.726 1.00 0.00 ? 32  THR A C    5  
ATOM 7658  O O    . THR A 1 32  ? -239.338 -12.305 111.597 1.00 0.00 ? 32  THR A O    5  
ATOM 7659  C CB   . THR A 1 32  ? -238.991 -10.395 109.385 1.00 0.00 ? 32  THR A CB   5  
ATOM 7660  O OG1  . THR A 1 32  ? -238.456 -11.601 108.844 1.00 0.00 ? 32  THR A OG1  5  
ATOM 7661  C CG2  . THR A 1 32  ? -238.613 -9.217  108.503 1.00 0.00 ? 32  THR A CG2  5  
ATOM 7662  H H    . THR A 1 32  ? -236.586 -10.811 110.083 1.00 0.00 ? 32  THR A H    5  
ATOM 7663  H HA   . THR A 1 32  ? -238.601 -9.182  111.059 1.00 0.00 ? 32  THR A HA   5  
ATOM 7664  H HB   . THR A 1 32  ? -240.077 -10.468 109.430 1.00 0.00 ? 32  THR A HB   5  
ATOM 7665  H HG1  . THR A 1 32  ? -238.541 -12.308 109.493 1.00 0.00 ? 32  THR A HG1  5  
ATOM 7666  H HG21 . THR A 1 32  ? -239.029 -8.311  108.919 1.00 0.00 ? 32  THR A HG21 5  
ATOM 7667  H HG22 . THR A 1 32  ? -237.538 -9.133  108.458 1.00 0.00 ? 32  THR A HG22 5  
ATOM 7668  H HG23 . THR A 1 32  ? -239.005 -9.372  107.510 1.00 0.00 ? 32  THR A HG23 5  
ATOM 7669  N N    . LYS A 1 33  ? -240.016 -10.443 112.657 1.00 0.00 ? 33  LYS A N    5  
ATOM 7670  C CA   . LYS A 1 33  ? -241.053 -11.125 113.409 1.00 0.00 ? 33  LYS A CA   5  
ATOM 7671  C C    . LYS A 1 33  ? -242.274 -11.269 112.535 1.00 0.00 ? 33  LYS A C    5  
ATOM 7672  O O    . LYS A 1 33  ? -242.253 -10.876 111.376 1.00 0.00 ? 33  LYS A O    5  
ATOM 7673  C CB   . LYS A 1 33  ? -241.440 -10.355 114.669 1.00 0.00 ? 33  LYS A CB   5  
ATOM 7674  C CG   . LYS A 1 33  ? -240.352 -10.301 115.708 1.00 0.00 ? 33  LYS A CG   5  
ATOM 7675  C CD   . LYS A 1 33  ? -239.445 -9.101  115.515 1.00 0.00 ? 33  LYS A CD   5  
ATOM 7676  C CE   . LYS A 1 33  ? -238.149 -9.254  116.300 1.00 0.00 ? 33  LYS A CE   5  
ATOM 7677  N NZ   . LYS A 1 33  ? -237.352 -10.422 115.838 1.00 0.00 ? 33  LYS A NZ   5  
ATOM 7678  H H    . LYS A 1 33  ? -239.822 -9.505  112.846 1.00 0.00 ? 33  LYS A H    5  
ATOM 7679  H HA   . LYS A 1 33  ? -240.688 -12.102 113.681 1.00 0.00 ? 33  LYS A HA   5  
ATOM 7680  H HB2  . LYS A 1 33  ? -241.697 -9.342  114.394 1.00 0.00 ? 33  LYS A HB2  5  
ATOM 7681  H HB3  . LYS A 1 33  ? -242.306 -10.826 115.111 1.00 0.00 ? 33  LYS A HB3  5  
ATOM 7682  H HG2  . LYS A 1 33  ? -240.814 -10.244 116.675 1.00 0.00 ? 33  LYS A HG2  5  
ATOM 7683  H HG3  . LYS A 1 33  ? -239.761 -11.203 115.642 1.00 0.00 ? 33  LYS A HG3  5  
ATOM 7684  H HD2  . LYS A 1 33  ? -239.220 -8.999  114.461 1.00 0.00 ? 33  LYS A HD2  5  
ATOM 7685  H HD3  . LYS A 1 33  ? -239.962 -8.219  115.859 1.00 0.00 ? 33  LYS A HD3  5  
ATOM 7686  H HE2  . LYS A 1 33  ? -237.560 -8.357  116.175 1.00 0.00 ? 33  LYS A HE2  5  
ATOM 7687  H HE3  . LYS A 1 33  ? -238.388 -9.384  117.345 1.00 0.00 ? 33  LYS A HE3  5  
ATOM 7688  H HZ1  . LYS A 1 33  ? -237.127 -10.325 114.824 1.00 0.00 ? 33  LYS A HZ1  5  
ATOM 7689  H HZ2  . LYS A 1 33  ? -236.460 -10.483 116.372 1.00 0.00 ? 33  LYS A HZ2  5  
ATOM 7690  H HZ3  . LYS A 1 33  ? -237.889 -11.309 115.980 1.00 0.00 ? 33  LYS A HZ3  5  
ATOM 7691  N N    . ALA A 1 34  ? -243.344 -11.796 113.095 1.00 0.00 ? 34  ALA A N    5  
ATOM 7692  C CA   . ALA A 1 34  ? -244.605 -11.875 112.376 1.00 0.00 ? 34  ALA A CA   5  
ATOM 7693  C C    . ALA A 1 34  ? -245.114 -10.478 112.018 1.00 0.00 ? 34  ALA A C    5  
ATOM 7694  O O    . ALA A 1 34  ? -245.866 -10.303 111.066 1.00 0.00 ? 34  ALA A O    5  
ATOM 7695  C CB   . ALA A 1 34  ? -245.627 -12.615 113.214 1.00 0.00 ? 34  ALA A CB   5  
ATOM 7696  H H    . ALA A 1 34  ? -243.287 -12.154 114.010 1.00 0.00 ? 34  ALA A H    5  
ATOM 7697  H HA   . ALA A 1 34  ? -244.440 -12.435 111.465 1.00 0.00 ? 34  ALA A HA   5  
ATOM 7698  H HB1  . ALA A 1 34  ? -245.810 -12.067 114.126 1.00 0.00 ? 34  ALA A HB1  5  
ATOM 7699  H HB2  . ALA A 1 34  ? -246.549 -12.707 112.658 1.00 0.00 ? 34  ALA A HB2  5  
ATOM 7700  H HB3  . ALA A 1 34  ? -245.252 -13.599 113.453 1.00 0.00 ? 34  ALA A HB3  5  
ATOM 7701  N N    . LYS A 1 35  ? -244.669 -9.487  112.782 1.00 0.00 ? 35  LYS A N    5  
ATOM 7702  C CA   . LYS A 1 35  ? -245.082 -8.098  112.572 1.00 0.00 ? 35  LYS A CA   5  
ATOM 7703  C C    . LYS A 1 35  ? -244.267 -7.491  111.446 1.00 0.00 ? 35  LYS A C    5  
ATOM 7704  O O    . LYS A 1 35  ? -244.809 -6.878  110.526 1.00 0.00 ? 35  LYS A O    5  
ATOM 7705  C CB   . LYS A 1 35  ? -244.927 -7.268  113.862 1.00 0.00 ? 35  LYS A CB   5  
ATOM 7706  C CG   . LYS A 1 35  ? -243.518 -7.276  114.453 1.00 0.00 ? 35  LYS A CG   5  
ATOM 7707  C CD   . LYS A 1 35  ? -243.360 -6.279  115.593 1.00 0.00 ? 35  LYS A CD   5  
ATOM 7708  C CE   . LYS A 1 35  ? -244.283 -6.592  116.757 1.00 0.00 ? 35  LYS A CE   5  
ATOM 7709  N NZ   . LYS A 1 35  ? -244.091 -5.654  117.891 1.00 0.00 ? 35  LYS A NZ   5  
ATOM 7710  H H    . LYS A 1 35  ? -244.004 -9.692  113.465 1.00 0.00 ? 35  LYS A H    5  
ATOM 7711  H HA   . LYS A 1 35  ? -246.124 -8.104  112.271 1.00 0.00 ? 35  LYS A HA   5  
ATOM 7712  H HB2  . LYS A 1 35  ? -245.195 -6.244  113.650 1.00 0.00 ? 35  LYS A HB2  5  
ATOM 7713  H HB3  . LYS A 1 35  ? -245.606 -7.659  114.605 1.00 0.00 ? 35  LYS A HB3  5  
ATOM 7714  H HG2  . LYS A 1 35  ? -243.302 -8.266  114.825 1.00 0.00 ? 35  LYS A HG2  5  
ATOM 7715  H HG3  . LYS A 1 35  ? -242.813 -7.026  113.673 1.00 0.00 ? 35  LYS A HG3  5  
ATOM 7716  H HD2  . LYS A 1 35  ? -242.339 -6.308  115.944 1.00 0.00 ? 35  LYS A HD2  5  
ATOM 7717  H HD3  . LYS A 1 35  ? -243.584 -5.288  115.226 1.00 0.00 ? 35  LYS A HD3  5  
ATOM 7718  H HE2  . LYS A 1 35  ? -245.305 -6.525  116.415 1.00 0.00 ? 35  LYS A HE2  5  
ATOM 7719  H HE3  . LYS A 1 35  ? -244.085 -7.599  117.095 1.00 0.00 ? 35  LYS A HE3  5  
ATOM 7720  H HZ1  . LYS A 1 35  ? -243.109 -5.705  118.236 1.00 0.00 ? 35  LYS A HZ1  5  
ATOM 7721  H HZ2  . LYS A 1 35  ? -244.291 -4.675  117.590 1.00 0.00 ? 35  LYS A HZ2  5  
ATOM 7722  H HZ3  . LYS A 1 35  ? -244.735 -5.904  118.675 1.00 0.00 ? 35  LYS A HZ3  5  
ATOM 7723  N N    . GLN A 1 36  ? -242.954 -7.694  111.516 1.00 0.00 ? 36  GLN A N    5  
ATOM 7724  C CA   . GLN A 1 36  ? -242.058 -7.264  110.470 1.00 0.00 ? 36  GLN A CA   5  
ATOM 7725  C C    . GLN A 1 36  ? -242.355 -8.046  109.206 1.00 0.00 ? 36  GLN A C    5  
ATOM 7726  O O    . GLN A 1 36  ? -241.998 -7.635  108.103 1.00 0.00 ? 36  GLN A O    5  
ATOM 7727  C CB   . GLN A 1 36  ? -240.605 -7.468  110.895 1.00 0.00 ? 36  GLN A CB   5  
ATOM 7728  C CG   . GLN A 1 36  ? -240.178 -6.592  112.062 1.00 0.00 ? 36  GLN A CG   5  
ATOM 7729  C CD   . GLN A 1 36  ? -240.317 -5.115  111.758 1.00 0.00 ? 36  GLN A CD   5  
ATOM 7730  O OE1  . GLN A 1 36  ? -241.369 -4.523  111.985 1.00 0.00 ? 36  GLN A OE1  5  
ATOM 7731  N NE2  . GLN A 1 36  ? -239.256 -4.509  111.253 1.00 0.00 ? 36  GLN A NE2  5  
ATOM 7732  H H    . GLN A 1 36  ? -242.579 -8.153  112.295 1.00 0.00 ? 36  GLN A H    5  
ATOM 7733  H HA   . GLN A 1 36  ? -242.234 -6.215  110.285 1.00 0.00 ? 36  GLN A HA   5  
ATOM 7734  H HB2  . GLN A 1 36  ? -240.465 -8.501  111.181 1.00 0.00 ? 36  GLN A HB2  5  
ATOM 7735  H HB3  . GLN A 1 36  ? -239.964 -7.249  110.057 1.00 0.00 ? 36  GLN A HB3  5  
ATOM 7736  H HG2  . GLN A 1 36  ? -240.795 -6.822  112.914 1.00 0.00 ? 36  GLN A HG2  5  
ATOM 7737  H HG3  . GLN A 1 36  ? -239.145 -6.801  112.297 1.00 0.00 ? 36  GLN A HG3  5  
ATOM 7738  H HE21 . GLN A 1 36  ? -238.440 -5.040  111.101 1.00 0.00 ? 36  GLN A HE21 5  
ATOM 7739  H HE22 . GLN A 1 36  ? -239.324 -3.547  111.062 1.00 0.00 ? 36  GLN A HE22 5  
ATOM 7740  N N    . LEU A 1 37  ? -242.977 -9.202  109.384 1.00 0.00 ? 37  LEU A N    5  
ATOM 7741  C CA   . LEU A 1 37  ? -243.336 -10.034 108.267 1.00 0.00 ? 37  LEU A CA   5  
ATOM 7742  C C    . LEU A 1 37  ? -244.631 -9.630  107.635 1.00 0.00 ? 37  LEU A C    5  
ATOM 7743  O O    . LEU A 1 37  ? -244.705 -9.541  106.423 1.00 0.00 ? 37  LEU A O    5  
ATOM 7744  C CB   . LEU A 1 37  ? -243.416 -11.493 108.642 1.00 0.00 ? 37  LEU A CB   5  
ATOM 7745  C CG   . LEU A 1 37  ? -242.684 -12.344 107.645 1.00 0.00 ? 37  LEU A CG   5  
ATOM 7746  C CD1  . LEU A 1 37  ? -243.260 -12.140 106.254 1.00 0.00 ? 37  LEU A CD1  5  
ATOM 7747  C CD2  . LEU A 1 37  ? -241.256 -11.910 107.664 1.00 0.00 ? 37  LEU A CD2  5  
ATOM 7748  H H    . LEU A 1 37  ? -243.179 -9.507  110.291 1.00 0.00 ? 37  LEU A H    5  
ATOM 7749  H HA   . LEU A 1 37  ? -242.562 -9.916  107.528 1.00 0.00 ? 37  LEU A HA   5  
ATOM 7750  H HB2  . LEU A 1 37  ? -242.977 -11.628 109.621 1.00 0.00 ? 37  LEU A HB2  5  
ATOM 7751  H HB3  . LEU A 1 37  ? -244.449 -11.799 108.669 1.00 0.00 ? 37  LEU A HB3  5  
ATOM 7752  H HG   . LEU A 1 37  ? -242.744 -13.384 107.918 1.00 0.00 ? 37  LEU A HG   5  
ATOM 7753  H HD11 . LEU A 1 37  ? -243.374 -11.071 106.074 1.00 0.00 ? 37  LEU A HD11 5  
ATOM 7754  H HD12 . LEU A 1 37  ? -242.591 -12.558 105.514 1.00 0.00 ? 37  LEU A HD12 5  
ATOM 7755  H HD13 . LEU A 1 37  ? -244.226 -12.615 106.185 1.00 0.00 ? 37  LEU A HD13 5  
ATOM 7756  H HD21 . LEU A 1 37  ? -240.893 -11.904 108.679 1.00 0.00 ? 37  LEU A HD21 5  
ATOM 7757  H HD22 . LEU A 1 37  ? -240.666 -12.581 107.062 1.00 0.00 ? 37  LEU A HD22 5  
ATOM 7758  H HD23 . LEU A 1 37  ? -241.192 -10.905 107.255 1.00 0.00 ? 37  LEU A HD23 5  
ATOM 7759  N N    . LEU A 1 38  ? -245.658 -9.423  108.428 1.00 0.00 ? 38  LEU A N    5  
ATOM 7760  C CA   . LEU A 1 38  ? -246.911 -8.967  107.878 1.00 0.00 ? 38  LEU A CA   5  
ATOM 7761  C C    . LEU A 1 38  ? -246.615 -7.723  107.038 1.00 0.00 ? 38  LEU A C    5  
ATOM 7762  O O    . LEU A 1 38  ? -247.165 -7.548  105.966 1.00 0.00 ? 38  LEU A O    5  
ATOM 7763  C CB   . LEU A 1 38  ? -247.918 -8.706  109.010 1.00 0.00 ? 38  LEU A CB   5  
ATOM 7764  C CG   . LEU A 1 38  ? -249.387 -8.570  108.583 1.00 0.00 ? 38  LEU A CG   5  
ATOM 7765  C CD1  . LEU A 1 38  ? -249.914 -7.181  108.905 1.00 0.00 ? 38  LEU A CD1  5  
ATOM 7766  C CD2  . LEU A 1 38  ? -249.556 -8.887  107.099 1.00 0.00 ? 38  LEU A CD2  5  
ATOM 7767  H H    . LEU A 1 38  ? -245.577 -9.584  109.395 1.00 0.00 ? 38  LEU A H    5  
ATOM 7768  H HA   . LEU A 1 38  ? -247.291 -9.748  107.219 1.00 0.00 ? 38  LEU A HA   5  
ATOM 7769  H HB2  . LEU A 1 38  ? -247.853 -9.531  109.705 1.00 0.00 ? 38  LEU A HB2  5  
ATOM 7770  H HB3  . LEU A 1 38  ? -247.625 -7.803  109.534 1.00 0.00 ? 38  LEU A HB3  5  
ATOM 7771  H HG   . LEU A 1 38  ? -249.978 -9.280  109.142 1.00 0.00 ? 38  LEU A HG   5  
ATOM 7772  H HD11 . LEU A 1 38  ? -249.314 -6.444  108.394 1.00 0.00 ? 38  LEU A HD11 5  
ATOM 7773  H HD12 . LEU A 1 38  ? -250.939 -7.100  108.580 1.00 0.00 ? 38  LEU A HD12 5  
ATOM 7774  H HD13 . LEU A 1 38  ? -249.860 -7.015  109.971 1.00 0.00 ? 38  LEU A HD13 5  
ATOM 7775  H HD21 . LEU A 1 38  ? -249.127 -9.860  106.883 1.00 0.00 ? 38  LEU A HD21 5  
ATOM 7776  H HD22 . LEU A 1 38  ? -250.604 -8.892  106.847 1.00 0.00 ? 38  LEU A HD22 5  
ATOM 7777  H HD23 . LEU A 1 38  ? -249.045 -8.138  106.510 1.00 0.00 ? 38  LEU A HD23 5  
ATOM 7778  N N    . GLN A 1 39  ? -245.644 -6.945  107.499 1.00 0.00 ? 39  GLN A N    5  
ATOM 7779  C CA   . GLN A 1 39  ? -245.058 -5.864  106.764 1.00 0.00 ? 39  GLN A CA   5  
ATOM 7780  C C    . GLN A 1 39  ? -244.554 -6.320  105.422 1.00 0.00 ? 39  GLN A C    5  
ATOM 7781  O O    . GLN A 1 39  ? -244.877 -5.747  104.405 1.00 0.00 ? 39  GLN A O    5  
ATOM 7782  C CB   . GLN A 1 39  ? -243.838 -5.432  107.527 1.00 0.00 ? 39  GLN A CB   5  
ATOM 7783  C CG   . GLN A 1 39  ? -243.329 -4.110  107.073 1.00 0.00 ? 39  GLN A CG   5  
ATOM 7784  C CD   . GLN A 1 39  ? -242.098 -3.641  107.829 1.00 0.00 ? 39  GLN A CD   5  
ATOM 7785  O OE1  . GLN A 1 39  ? -241.886 -2.442  108.014 1.00 0.00 ? 39  GLN A OE1  5  
ATOM 7786  N NE2  . GLN A 1 39  ? -241.271 -4.582  108.261 1.00 0.00 ? 39  GLN A NE2  5  
ATOM 7787  H H    . GLN A 1 39  ? -245.308 -7.090  108.391 1.00 0.00 ? 39  GLN A H    5  
ATOM 7788  H HA   . GLN A 1 39  ? -245.765 -5.043  106.654 1.00 0.00 ? 39  GLN A HA   5  
ATOM 7789  H HB2  . GLN A 1 39  ? -244.040 -5.438  108.577 1.00 0.00 ? 39  GLN A HB2  5  
ATOM 7790  H HB3  . GLN A 1 39  ? -243.058 -6.159  107.338 1.00 0.00 ? 39  GLN A HB3  5  
ATOM 7791  H HG2  . GLN A 1 39  ? -243.080 -4.231  106.028 1.00 0.00 ? 39  GLN A HG2  5  
ATOM 7792  H HG3  . GLN A 1 39  ? -244.116 -3.380  107.184 1.00 0.00 ? 39  GLN A HG3  5  
ATOM 7793  H HE21 . GLN A 1 39  ? -241.492 -5.519  108.066 1.00 0.00 ? 39  GLN A HE21 5  
ATOM 7794  H HE22 . GLN A 1 39  ? -240.476 -4.303  108.761 1.00 0.00 ? 39  GLN A HE22 5  
ATOM 7795  N N    . GLN A 1 40  ? -243.716 -7.331  105.454 1.00 0.00 ? 40  GLN A N    5  
ATOM 7796  C CA   . GLN A 1 40  ? -243.143 -7.891  104.252 1.00 0.00 ? 40  GLN A CA   5  
ATOM 7797  C C    . GLN A 1 40  ? -244.212 -8.343  103.278 1.00 0.00 ? 40  GLN A C    5  
ATOM 7798  O O    . GLN A 1 40  ? -244.010 -8.350  102.069 1.00 0.00 ? 40  GLN A O    5  
ATOM 7799  C CB   . GLN A 1 40  ? -242.227 -9.052  104.611 1.00 0.00 ? 40  GLN A CB   5  
ATOM 7800  C CG   . GLN A 1 40  ? -240.810 -8.609  104.896 1.00 0.00 ? 40  GLN A CG   5  
ATOM 7801  C CD   . GLN A 1 40  ? -240.300 -7.703  103.800 1.00 0.00 ? 40  GLN A CD   5  
ATOM 7802  O OE1  . GLN A 1 40  ? -239.401 -6.888  104.003 1.00 0.00 ? 40  GLN A OE1  5  
ATOM 7803  N NE2  . GLN A 1 40  ? -240.933 -7.812  102.643 1.00 0.00 ? 40  GLN A NE2  5  
ATOM 7804  H H    . GLN A 1 40  ? -243.477 -7.725  106.321 1.00 0.00 ? 40  GLN A H    5  
ATOM 7805  H HA   . GLN A 1 40  ? -242.549 -7.121  103.784 1.00 0.00 ? 40  GLN A HA   5  
ATOM 7806  H HB2  . GLN A 1 40  ? -242.614 -9.541  105.491 1.00 0.00 ? 40  GLN A HB2  5  
ATOM 7807  H HB3  . GLN A 1 40  ? -242.210 -9.752  103.790 1.00 0.00 ? 40  GLN A HB3  5  
ATOM 7808  H HG2  . GLN A 1 40  ? -240.788 -8.074  105.834 1.00 0.00 ? 40  GLN A HG2  5  
ATOM 7809  H HG3  . GLN A 1 40  ? -240.176 -9.476  104.958 1.00 0.00 ? 40  GLN A HG3  5  
ATOM 7810  H HE21 . GLN A 1 40  ? -241.671 -8.453  102.587 1.00 0.00 ? 40  GLN A HE21 5  
ATOM 7811  H HE22 . GLN A 1 40  ? -240.663 -7.250  101.912 1.00 0.00 ? 40  GLN A HE22 5  
ATOM 7812  N N    . ILE A 1 41  ? -245.335 -8.711  103.833 1.00 0.00 ? 41  ILE A N    5  
ATOM 7813  C CA   . ILE A 1 41  ? -246.484 -9.171  103.088 1.00 0.00 ? 41  ILE A CA   5  
ATOM 7814  C C    . ILE A 1 41  ? -247.278 -7.968  102.553 1.00 0.00 ? 41  ILE A C    5  
ATOM 7815  O O    . ILE A 1 41  ? -247.952 -8.035  101.527 1.00 0.00 ? 41  ILE A O    5  
ATOM 7816  C CB   . ILE A 1 41  ? -247.348 -10.040 104.027 1.00 0.00 ? 41  ILE A CB   5  
ATOM 7817  C CG1  . ILE A 1 41  ? -246.482 -11.122 104.713 1.00 0.00 ? 41  ILE A CG1  5  
ATOM 7818  C CG2  . ILE A 1 41  ? -248.515 -10.673 103.302 1.00 0.00 ? 41  ILE A CG2  5  
ATOM 7819  C CD1  . ILE A 1 41  ? -245.461 -11.808 103.808 1.00 0.00 ? 41  ILE A CD1  5  
ATOM 7820  H H    . ILE A 1 41  ? -245.398 -8.683  104.813 1.00 0.00 ? 41  ILE A H    5  
ATOM 7821  H HA   . ILE A 1 41  ? -246.145 -9.779  102.262 1.00 0.00 ? 41  ILE A HA   5  
ATOM 7822  H HB   . ILE A 1 41  ? -247.750 -9.385  104.795 1.00 0.00 ? 41  ILE A HB   5  
ATOM 7823  H HG12 . ILE A 1 41  ? -245.939 -10.668 105.529 1.00 0.00 ? 41  ILE A HG12 5  
ATOM 7824  H HG13 . ILE A 1 41  ? -247.133 -11.885 105.110 1.00 0.00 ? 41  ILE A HG13 5  
ATOM 7825  H HG21 . ILE A 1 41  ? -249.098 -9.905  102.817 1.00 0.00 ? 41  ILE A HG21 5  
ATOM 7826  H HG22 . ILE A 1 41  ? -248.150 -11.371 102.565 1.00 0.00 ? 41  ILE A HG22 5  
ATOM 7827  H HG23 . ILE A 1 41  ? -249.129 -11.192 104.022 1.00 0.00 ? 41  ILE A HG23 5  
ATOM 7828  H HD11 . ILE A 1 41  ? -244.869 -11.064 103.293 1.00 0.00 ? 41  ILE A HD11 5  
ATOM 7829  H HD12 . ILE A 1 41  ? -244.799 -12.428 104.404 1.00 0.00 ? 41  ILE A HD12 5  
ATOM 7830  H HD13 . ILE A 1 41  ? -245.973 -12.421 103.084 1.00 0.00 ? 41  ILE A HD13 5  
ATOM 7831  N N    . LEU A 1 42  ? -247.164 -6.874  103.286 1.00 0.00 ? 42  LEU A N    5  
ATOM 7832  C CA   . LEU A 1 42  ? -247.868 -5.629  103.011 1.00 0.00 ? 42  LEU A CA   5  
ATOM 7833  C C    . LEU A 1 42  ? -247.148 -4.760  101.985 1.00 0.00 ? 42  LEU A C    5  
ATOM 7834  O O    . LEU A 1 42  ? -247.767 -4.207  101.075 1.00 0.00 ? 42  LEU A O    5  
ATOM 7835  C CB   . LEU A 1 42  ? -247.947 -4.859  104.311 1.00 0.00 ? 42  LEU A CB   5  
ATOM 7836  C CG   . LEU A 1 42  ? -248.896 -5.473  105.325 1.00 0.00 ? 42  LEU A CG   5  
ATOM 7837  C CD1  . LEU A 1 42  ? -248.530 -5.011  106.699 1.00 0.00 ? 42  LEU A CD1  5  
ATOM 7838  C CD2  . LEU A 1 42  ? -250.335 -5.115  105.013 1.00 0.00 ? 42  LEU A CD2  5  
ATOM 7839  H H    . LEU A 1 42  ? -246.570 -6.904  104.064 1.00 0.00 ? 42  LEU A H    5  
ATOM 7840  H HA   . LEU A 1 42  ? -248.864 -5.852  102.691 1.00 0.00 ? 42  LEU A HA   5  
ATOM 7841  H HB2  . LEU A 1 42  ? -246.950 -4.813  104.731 1.00 0.00 ? 42  LEU A HB2  5  
ATOM 7842  H HB3  . LEU A 1 42  ? -248.261 -3.857  104.115 1.00 0.00 ? 42  LEU A HB3  5  
ATOM 7843  H HG   . LEU A 1 42  ? -248.802 -6.549  105.297 1.00 0.00 ? 42  LEU A HG   5  
ATOM 7844  H HD11 . LEU A 1 42  ? -248.518 -3.936  106.721 1.00 0.00 ? 42  LEU A HD11 5  
ATOM 7845  H HD12 . LEU A 1 42  ? -249.249 -5.388  107.406 1.00 0.00 ? 42  LEU A HD12 5  
ATOM 7846  H HD13 . LEU A 1 42  ? -247.548 -5.389  106.941 1.00 0.00 ? 42  LEU A HD13 5  
ATOM 7847  H HD21 . LEU A 1 42  ? -250.589 -5.479  104.030 1.00 0.00 ? 42  LEU A HD21 5  
ATOM 7848  H HD22 . LEU A 1 42  ? -250.982 -5.572  105.748 1.00 0.00 ? 42  LEU A HD22 5  
ATOM 7849  H HD23 . LEU A 1 42  ? -250.452 -4.043  105.046 1.00 0.00 ? 42  LEU A HD23 5  
ATOM 7850  N N    . THR A 1 43  ? -245.841 -4.667  102.169 1.00 0.00 ? 43  THR A N    5  
ATOM 7851  C CA   . THR A 1 43  ? -244.991 -3.669  101.558 1.00 0.00 ? 43  THR A CA   5  
ATOM 7852  C C    . THR A 1 43  ? -245.274 -3.468  100.078 1.00 0.00 ? 43  THR A C    5  
ATOM 7853  O O    . THR A 1 43  ? -244.948 -4.286  99.218  1.00 0.00 ? 43  THR A O    5  
ATOM 7854  C CB   . THR A 1 43  ? -243.493 -4.001  101.785 1.00 0.00 ? 43  THR A CB   5  
ATOM 7855  O OG1  . THR A 1 43  ? -242.659 -3.042  101.119 1.00 0.00 ? 43  THR A OG1  5  
ATOM 7856  C CG2  . THR A 1 43  ? -243.155 -5.406  101.302 1.00 0.00 ? 43  THR A CG2  5  
ATOM 7857  H H    . THR A 1 43  ? -245.419 -5.314  102.758 1.00 0.00 ? 43  THR A H    5  
ATOM 7858  H HA   . THR A 1 43  ? -245.201 -2.733  102.071 1.00 0.00 ? 43  THR A HA   5  
ATOM 7859  H HB   . THR A 1 43  ? -243.295 -3.951  102.847 1.00 0.00 ? 43  THR A HB   5  
ATOM 7860  H HG1  . THR A 1 43  ? -241.826 -3.468  100.864 1.00 0.00 ? 43  THR A HG1  5  
ATOM 7861  H HG21 . THR A 1 43  ? -243.756 -6.125  101.838 1.00 0.00 ? 43  THR A HG21 5  
ATOM 7862  H HG22 . THR A 1 43  ? -243.363 -5.483  100.245 1.00 0.00 ? 43  THR A HG22 5  
ATOM 7863  H HG23 . THR A 1 43  ? -242.112 -5.606  101.479 1.00 0.00 ? 43  THR A HG23 5  
ATOM 7864  N N    . ASN A 1 44  ? -245.927 -2.360  99.819  1.00 0.00 ? 44  ASN A N    5  
ATOM 7865  C CA   . ASN A 1 44  ? -246.125 -1.873  98.456  1.00 0.00 ? 44  ASN A CA   5  
ATOM 7866  C C    . ASN A 1 44  ? -244.794 -1.420  97.866  1.00 0.00 ? 44  ASN A C    5  
ATOM 7867  O O    . ASN A 1 44  ? -244.672 -1.228  96.659  1.00 0.00 ? 44  ASN A O    5  
ATOM 7868  C CB   . ASN A 1 44  ? -247.123 -0.712  98.425  1.00 0.00 ? 44  ASN A CB   5  
ATOM 7869  C CG   . ASN A 1 44  ? -248.572 -1.156  98.540  1.00 0.00 ? 44  ASN A CG   5  
ATOM 7870  O OD1  . ASN A 1 44  ? -249.467 -0.513  97.997  1.00 0.00 ? 44  ASN A OD1  5  
ATOM 7871  N ND2  . ASN A 1 44  ? -248.820 -2.256  99.239  1.00 0.00 ? 44  ASN A ND2  5  
ATOM 7872  H H    . ASN A 1 44  ? -246.308 -1.866  100.579 1.00 0.00 ? 44  ASN A H    5  
ATOM 7873  H HA   . ASN A 1 44  ? -246.511 -2.689  97.862  1.00 0.00 ? 44  ASN A HA   5  
ATOM 7874  H HB2  . ASN A 1 44  ? -246.908 -0.050  99.250  1.00 0.00 ? 44  ASN A HB2  5  
ATOM 7875  H HB3  . ASN A 1 44  ? -247.002 -0.170  97.498  1.00 0.00 ? 44  ASN A HB3  5  
ATOM 7876  H HD21 . ASN A 1 44  ? -248.062 -2.737  99.643  1.00 0.00 ? 44  ASN A HD21 5  
ATOM 7877  H HD22 . ASN A 1 44  ? -249.750 -2.546  99.326  1.00 0.00 ? 44  ASN A HD22 5  
ATOM 7878  N N    . GLU A 1 45  ? -243.818 -1.214  98.753  1.00 0.00 ? 45  GLU A N    5  
ATOM 7879  C CA   . GLU A 1 45  ? -242.431 -0.901  98.390  1.00 0.00 ? 45  GLU A CA   5  
ATOM 7880  C C    . GLU A 1 45  ? -242.258 0.498   97.790  1.00 0.00 ? 45  GLU A C    5  
ATOM 7881  O O    . GLU A 1 45  ? -241.144 1.025   97.763  1.00 0.00 ? 45  GLU A O    5  
ATOM 7882  C CB   . GLU A 1 45  ? -241.863 -1.966  97.458  1.00 0.00 ? 45  GLU A CB   5  
ATOM 7883  C CG   . GLU A 1 45  ? -240.604 -2.607  98.008  1.00 0.00 ? 45  GLU A CG   5  
ATOM 7884  C CD   . GLU A 1 45  ? -240.118 -3.771  97.176  1.00 0.00 ? 45  GLU A CD   5  
ATOM 7885  O OE1  . GLU A 1 45  ? -239.415 -3.535  96.170  1.00 0.00 ? 45  GLU A OE1  5  
ATOM 7886  O OE2  . GLU A 1 45  ? -240.432 -4.927  97.532  1.00 0.00 ? 45  GLU A OE2  5  
ATOM 7887  H H    . GLU A 1 45  ? -244.035 -1.297  99.704  1.00 0.00 ? 45  GLU A H    5  
ATOM 7888  H HA   . GLU A 1 45  ? -241.860 -0.928  99.307  1.00 0.00 ? 45  GLU A HA   5  
ATOM 7889  H HB2  . GLU A 1 45  ? -242.608 -2.736  97.314  1.00 0.00 ? 45  GLU A HB2  5  
ATOM 7890  H HB3  . GLU A 1 45  ? -241.631 -1.515  96.503  1.00 0.00 ? 45  GLU A HB3  5  
ATOM 7891  H HG2  . GLU A 1 45  ? -239.826 -1.861  98.047  1.00 0.00 ? 45  GLU A HG2  5  
ATOM 7892  H HG3  . GLU A 1 45  ? -240.815 -2.960  99.008  1.00 0.00 ? 45  GLU A HG3  5  
ATOM 7893  N N    . GLN A 1 46  ? -243.341 1.096   97.307  1.00 0.00 ? 46  GLN A N    5  
ATOM 7894  C CA   . GLN A 1 46  ? -243.318 2.477   96.846  1.00 0.00 ? 46  GLN A CA   5  
ATOM 7895  C C    . GLN A 1 46  ? -242.951 3.403   97.979  1.00 0.00 ? 46  GLN A C    5  
ATOM 7896  O O    . GLN A 1 46  ? -241.783 3.671   98.258  1.00 0.00 ? 46  GLN A O    5  
ATOM 7897  C CB   . GLN A 1 46  ? -244.684 2.860   96.287  1.00 0.00 ? 46  GLN A CB   5  
ATOM 7898  C CG   . GLN A 1 46  ? -245.131 1.997   95.128  1.00 0.00 ? 46  GLN A CG   5  
ATOM 7899  C CD   . GLN A 1 46  ? -246.463 2.438   94.557  1.00 0.00 ? 46  GLN A CD   5  
ATOM 7900  O OE1  . GLN A 1 46  ? -246.519 3.270   93.650  1.00 0.00 ? 46  GLN A OE1  5  
ATOM 7901  N NE2  . GLN A 1 46  ? -247.549 1.884   95.077  1.00 0.00 ? 46  GLN A NE2  5  
ATOM 7902  H H    . GLN A 1 46  ? -244.171 0.583   97.231  1.00 0.00 ? 46  GLN A H    5  
ATOM 7903  H HA   . GLN A 1 46  ? -242.593 2.573   96.089  1.00 0.00 ? 46  GLN A HA   5  
ATOM 7904  H HB2  . GLN A 1 46  ? -245.419 2.776   97.074  1.00 0.00 ? 46  GLN A HB2  5  
ATOM 7905  H HB3  . GLN A 1 46  ? -244.644 3.880   95.959  1.00 0.00 ? 46  GLN A HB3  5  
ATOM 7906  H HG2  . GLN A 1 46  ? -244.386 2.047   94.351  1.00 0.00 ? 46  GLN A HG2  5  
ATOM 7907  H HG3  . GLN A 1 46  ? -245.223 0.981   95.477  1.00 0.00 ? 46  GLN A HG3  5  
ATOM 7908  H HE21 . GLN A 1 46  ? -247.435 1.226   95.791  1.00 0.00 ? 46  GLN A HE21 5  
ATOM 7909  H HE22 . GLN A 1 46  ? -248.429 2.164   94.730  1.00 0.00 ? 46  GLN A HE22 5  
ATOM 7910  N N    . ASP A 1 47  ? -243.974 3.863   98.630  1.00 0.00 ? 47  ASP A N    5  
ATOM 7911  C CA   . ASP A 1 47  ? -243.830 4.515   99.926  1.00 0.00 ? 47  ASP A CA   5  
ATOM 7912  C C    . ASP A 1 47  ? -243.767 3.421   100.980 1.00 0.00 ? 47  ASP A C    5  
ATOM 7913  O O    . ASP A 1 47  ? -243.740 3.669   102.184 1.00 0.00 ? 47  ASP A O    5  
ATOM 7914  C CB   . ASP A 1 47  ? -244.996 5.475   100.195 1.00 0.00 ? 47  ASP A CB   5  
ATOM 7915  C CG   . ASP A 1 47  ? -244.778 6.340   101.423 1.00 0.00 ? 47  ASP A CG   5  
ATOM 7916  O OD1  . ASP A 1 47  ? -243.652 6.850   101.609 1.00 0.00 ? 47  ASP A OD1  5  
ATOM 7917  O OD2  . ASP A 1 47  ? -245.735 6.527   102.204 1.00 0.00 ? 47  ASP A OD2  5  
ATOM 7918  H H    . ASP A 1 47  ? -244.852 3.769   98.216  1.00 0.00 ? 47  ASP A H    5  
ATOM 7919  H HA   . ASP A 1 47  ? -242.899 5.059   99.926  1.00 0.00 ? 47  ASP A HA   5  
ATOM 7920  H HB2  . ASP A 1 47  ? -245.122 6.124   99.341  1.00 0.00 ? 47  ASP A HB2  5  
ATOM 7921  H HB3  . ASP A 1 47  ? -245.899 4.899   100.339 1.00 0.00 ? 47  ASP A HB3  5  
ATOM 7922  N N    . ILE A 1 48  ? -243.703 2.195   100.466 1.00 0.00 ? 48  ILE A N    5  
ATOM 7923  C CA   . ILE A 1 48  ? -243.680 0.971   101.254 1.00 0.00 ? 48  ILE A CA   5  
ATOM 7924  C C    . ILE A 1 48  ? -244.972 0.738   101.996 1.00 0.00 ? 48  ILE A C    5  
ATOM 7925  O O    . ILE A 1 48  ? -245.754 -0.137  101.641 1.00 0.00 ? 48  ILE A O    5  
ATOM 7926  C CB   . ILE A 1 48  ? -242.497 0.922   102.243 1.00 0.00 ? 48  ILE A CB   5  
ATOM 7927  C CG1  . ILE A 1 48  ? -241.164 0.940   101.486 1.00 0.00 ? 48  ILE A CG1  5  
ATOM 7928  C CG2  . ILE A 1 48  ? -242.598 -0.324  103.120 1.00 0.00 ? 48  ILE A CG2  5  
ATOM 7929  C CD1  . ILE A 1 48  ? -239.952 0.907   102.391 1.00 0.00 ? 48  ILE A CD1  5  
ATOM 7930  H H    . ILE A 1 48  ? -243.650 2.120   99.491  1.00 0.00 ? 48  ILE A H    5  
ATOM 7931  H HA   . ILE A 1 48  ? -243.563 0.173   100.582 1.00 0.00 ? 48  ILE A HA   5  
ATOM 7932  H HB   . ILE A 1 48  ? -242.556 1.790   102.877 1.00 0.00 ? 48  ILE A HB   5  
ATOM 7933  H HG12 . ILE A 1 48  ? -241.114 0.079   100.837 1.00 0.00 ? 48  ILE A HG12 5  
ATOM 7934  H HG13 . ILE A 1 48  ? -241.109 1.841   100.889 1.00 0.00 ? 48  ILE A HG13 5  
ATOM 7935  H HG21 . ILE A 1 48  ? -243.544 -0.319  103.646 1.00 0.00 ? 48  ILE A HG21 5  
ATOM 7936  H HG22 . ILE A 1 48  ? -242.542 -1.206  102.498 1.00 0.00 ? 48  ILE A HG22 5  
ATOM 7937  H HG23 . ILE A 1 48  ? -241.789 -0.334  103.834 1.00 0.00 ? 48  ILE A HG23 5  
ATOM 7938  H HD11 . ILE A 1 48  ? -239.981 0.011   102.993 1.00 0.00 ? 48  ILE A HD11 5  
ATOM 7939  H HD12 . ILE A 1 48  ? -239.053 0.911   101.792 1.00 0.00 ? 48  ILE A HD12 5  
ATOM 7940  H HD13 . ILE A 1 48  ? -239.959 1.775   103.036 1.00 0.00 ? 48  ILE A HD13 5  
ATOM 7941  N N    . LYS A 1 49  ? -245.166 1.559   102.985 1.00 0.00 ? 49  LYS A N    5  
ATOM 7942  C CA   . LYS A 1 49  ? -246.212 1.408   103.988 1.00 0.00 ? 49  LYS A CA   5  
ATOM 7943  C C    . LYS A 1 49  ? -247.627 1.441   103.402 1.00 0.00 ? 49  LYS A C    5  
ATOM 7944  O O    . LYS A 1 49  ? -248.104 2.474   102.936 1.00 0.00 ? 49  LYS A O    5  
ATOM 7945  C CB   . LYS A 1 49  ? -246.060 2.500   105.051 1.00 0.00 ? 49  LYS A CB   5  
ATOM 7946  C CG   . LYS A 1 49  ? -246.148 3.913   104.493 1.00 0.00 ? 49  LYS A CG   5  
ATOM 7947  C CD   . LYS A 1 49  ? -245.996 4.971   105.573 1.00 0.00 ? 49  LYS A CD   5  
ATOM 7948  C CE   . LYS A 1 49  ? -244.590 4.991   106.155 1.00 0.00 ? 49  LYS A CE   5  
ATOM 7949  N NZ   . LYS A 1 49  ? -244.348 6.213   106.969 1.00 0.00 ? 49  LYS A NZ   5  
ATOM 7950  H H    . LYS A 1 49  ? -244.566 2.319   103.039 1.00 0.00 ? 49  LYS A H    5  
ATOM 7951  H HA   . LYS A 1 49  ? -246.067 0.451   104.465 1.00 0.00 ? 49  LYS A HA   5  
ATOM 7952  H HB2  . LYS A 1 49  ? -246.837 2.377   105.784 1.00 0.00 ? 49  LYS A HB2  5  
ATOM 7953  H HB3  . LYS A 1 49  ? -245.101 2.385   105.536 1.00 0.00 ? 49  LYS A HB3  5  
ATOM 7954  H HG2  . LYS A 1 49  ? -245.367 4.047   103.760 1.00 0.00 ? 49  LYS A HG2  5  
ATOM 7955  H HG3  . LYS A 1 49  ? -247.110 4.034   104.017 1.00 0.00 ? 49  LYS A HG3  5  
ATOM 7956  H HD2  . LYS A 1 49  ? -246.212 5.939   105.147 1.00 0.00 ? 49  LYS A HD2  5  
ATOM 7957  H HD3  . LYS A 1 49  ? -246.700 4.762   106.366 1.00 0.00 ? 49  LYS A HD3  5  
ATOM 7958  H HE2  . LYS A 1 49  ? -244.461 4.122   106.782 1.00 0.00 ? 49  LYS A HE2  5  
ATOM 7959  H HE3  . LYS A 1 49  ? -243.876 4.961   105.344 1.00 0.00 ? 49  LYS A HE3  5  
ATOM 7960  H HZ1  . LYS A 1 49  ? -245.039 6.273   107.749 1.00 0.00 ? 49  LYS A HZ1  5  
ATOM 7961  H HZ2  . LYS A 1 49  ? -243.386 6.189   107.372 1.00 0.00 ? 49  LYS A HZ2  5  
ATOM 7962  H HZ3  . LYS A 1 49  ? -244.444 7.064   106.374 1.00 0.00 ? 49  LYS A HZ3  5  
ATOM 7963  N N    . PRO A 1 50  ? -248.289 0.278   103.373 1.00 0.00 ? 50  PRO A N    5  
ATOM 7964  C CA   . PRO A 1 50  ? -249.733 0.168   103.119 1.00 0.00 ? 50  PRO A CA   5  
ATOM 7965  C C    . PRO A 1 50  ? -250.604 0.825   104.169 1.00 0.00 ? 50  PRO A C    5  
ATOM 7966  O O    . PRO A 1 50  ? -250.211 1.750   104.879 1.00 0.00 ? 50  PRO A O    5  
ATOM 7967  C CB   . PRO A 1 50  ? -249.957 -1.335  103.241 1.00 0.00 ? 50  PRO A CB   5  
ATOM 7968  C CG   . PRO A 1 50  ? -248.696 -1.906  102.797 1.00 0.00 ? 50  PRO A CG   5  
ATOM 7969  C CD   . PRO A 1 50  ? -247.678 -1.060  103.473 1.00 0.00 ? 50  PRO A CD   5  
ATOM 7970  H HA   . PRO A 1 50  ? -250.009 0.503   102.132 1.00 0.00 ? 50  PRO A HA   5  
ATOM 7971  H HB2  . PRO A 1 50  ? -250.161 -1.588  104.271 1.00 0.00 ? 50  PRO A HB2  5  
ATOM 7972  H HB3  . PRO A 1 50  ? -250.763 -1.640  102.634 1.00 0.00 ? 50  PRO A HB3  5  
ATOM 7973  H HG2  . PRO A 1 50  ? -248.629 -2.931  103.115 1.00 0.00 ? 50  PRO A HG2  5  
ATOM 7974  H HG3  . PRO A 1 50  ? -248.617 -1.821  101.729 1.00 0.00 ? 50  PRO A HG3  5  
ATOM 7975  H HD2  . PRO A 1 50  ? -247.566 -1.368  104.489 1.00 0.00 ? 50  PRO A HD2  5  
ATOM 7976  H HD3  . PRO A 1 50  ? -246.736 -1.098  102.950 1.00 0.00 ? 50  PRO A HD3  5  
ATOM 7977  N N    . VAL A 1 51  ? -251.797 0.277   104.257 1.00 0.00 ? 51  VAL A N    5  
ATOM 7978  C CA   . VAL A 1 51  ? -252.716 0.580   105.335 1.00 0.00 ? 51  VAL A CA   5  
ATOM 7979  C C    . VAL A 1 51  ? -252.694 -0.609  106.276 1.00 0.00 ? 51  VAL A C    5  
ATOM 7980  O O    . VAL A 1 51  ? -253.569 -1.476  106.241 1.00 0.00 ? 51  VAL A O    5  
ATOM 7981  C CB   . VAL A 1 51  ? -254.157 0.834   104.839 1.00 0.00 ? 51  VAL A CB   5  
ATOM 7982  C CG1  . VAL A 1 51  ? -255.044 1.312   105.981 1.00 0.00 ? 51  VAL A CG1  5  
ATOM 7983  C CG2  . VAL A 1 51  ? -254.166 1.838   103.695 1.00 0.00 ? 51  VAL A CG2  5  
ATOM 7984  H H    . VAL A 1 51  ? -252.046 -0.394  103.586 1.00 0.00 ? 51  VAL A H    5  
ATOM 7985  H HA   . VAL A 1 51  ? -252.356 1.459   105.854 1.00 0.00 ? 51  VAL A HA   5  
ATOM 7986  H HB   . VAL A 1 51  ? -254.557 -0.101  104.474 1.00 0.00 ? 51  VAL A HB   5  
ATOM 7987  H HG11 . VAL A 1 51  ? -254.633 2.219   106.401 1.00 0.00 ? 51  VAL A HG11 5  
ATOM 7988  H HG12 . VAL A 1 51  ? -256.040 1.506   105.609 1.00 0.00 ? 51  VAL A HG12 5  
ATOM 7989  H HG13 . VAL A 1 51  ? -255.089 0.550   106.746 1.00 0.00 ? 51  VAL A HG13 5  
ATOM 7990  H HG21 . VAL A 1 51  ? -253.569 1.457   102.879 1.00 0.00 ? 51  VAL A HG21 5  
ATOM 7991  H HG22 . VAL A 1 51  ? -255.181 1.994   103.358 1.00 0.00 ? 51  VAL A HG22 5  
ATOM 7992  H HG23 . VAL A 1 51  ? -253.752 2.775   104.038 1.00 0.00 ? 51  VAL A HG23 5  
ATOM 7993  N N    . THR A 1 52  ? -251.634 -0.679  107.055 1.00 0.00 ? 52  THR A N    5  
ATOM 7994  C CA   . THR A 1 52  ? -251.324 -1.857  107.830 1.00 0.00 ? 52  THR A CA   5  
ATOM 7995  C C    . THR A 1 52  ? -252.274 -2.008  109.021 1.00 0.00 ? 52  THR A C    5  
ATOM 7996  O O    . THR A 1 52  ? -252.109 -1.368  110.060 1.00 0.00 ? 52  THR A O    5  
ATOM 7997  C CB   . THR A 1 52  ? -249.853 -1.787  108.266 1.00 0.00 ? 52  THR A CB   5  
ATOM 7998  O OG1  . THR A 1 52  ? -249.617 -0.585  109.013 1.00 0.00 ? 52  THR A OG1  5  
ATOM 7999  C CG2  . THR A 1 52  ? -248.950 -1.796  107.031 1.00 0.00 ? 52  THR A CG2  5  
ATOM 8000  H H    . THR A 1 52  ? -251.035 0.096   107.121 1.00 0.00 ? 52  THR A H    5  
ATOM 8001  H HA   . THR A 1 52  ? -251.441 -2.716  107.185 1.00 0.00 ? 52  THR A HA   5  
ATOM 8002  H HB   . THR A 1 52  ? -249.623 -2.642  108.875 1.00 0.00 ? 52  THR A HB   5  
ATOM 8003  H HG1  . THR A 1 52  ? -248.880 -0.725  109.618 1.00 0.00 ? 52  THR A HG1  5  
ATOM 8004  H HG21 . THR A 1 52  ? -249.147 -2.685  106.446 1.00 0.00 ? 52  THR A HG21 5  
ATOM 8005  H HG22 . THR A 1 52  ? -249.154 -0.923  106.423 1.00 0.00 ? 52  THR A HG22 5  
ATOM 8006  H HG23 . THR A 1 52  ? -247.913 -1.793  107.337 1.00 0.00 ? 52  THR A HG23 5  
ATOM 8007  N N    . THR A 1 53  ? -253.286 -2.851  108.843 1.00 0.00 ? 53  THR A N    5  
ATOM 8008  C CA   . THR A 1 53  ? -254.379 -2.953  109.787 1.00 0.00 ? 53  THR A CA   5  
ATOM 8009  C C    . THR A 1 53  ? -254.313 -4.246  110.610 1.00 0.00 ? 53  THR A C    5  
ATOM 8010  O O    . THR A 1 53  ? -253.240 -4.794  110.850 1.00 0.00 ? 53  THR A O    5  
ATOM 8011  C CB   . THR A 1 53  ? -255.728 -2.826  109.021 1.00 0.00 ? 53  THR A CB   5  
ATOM 8012  O OG1  . THR A 1 53  ? -256.846 -2.801  109.919 1.00 0.00 ? 53  THR A OG1  5  
ATOM 8013  C CG2  . THR A 1 53  ? -255.906 -3.959  108.019 1.00 0.00 ? 53  THR A CG2  5  
ATOM 8014  H H    . THR A 1 53  ? -253.305 -3.408  108.041 1.00 0.00 ? 53  THR A H    5  
ATOM 8015  H HA   . THR A 1 53  ? -254.304 -2.131  110.462 1.00 0.00 ? 53  THR A HA   5  
ATOM 8016  H HB   . THR A 1 53  ? -255.712 -1.896  108.470 1.00 0.00 ? 53  THR A HB   5  
ATOM 8017  H HG1  . THR A 1 53  ? -256.882 -1.940  110.367 1.00 0.00 ? 53  THR A HG1  5  
ATOM 8018  H HG21 . THR A 1 53  ? -255.870 -4.906  108.539 1.00 0.00 ? 53  THR A HG21 5  
ATOM 8019  H HG22 . THR A 1 53  ? -256.861 -3.857  107.526 1.00 0.00 ? 53  THR A HG22 5  
ATOM 8020  H HG23 . THR A 1 53  ? -255.115 -3.922  107.287 1.00 0.00 ? 53  THR A HG23 5  
ATOM 8021  N N    . ASP A 1 54  ? -255.481 -4.704  111.034 1.00 0.00 ? 54  ASP A N    5  
ATOM 8022  C CA   . ASP A 1 54  ? -255.656 -5.821  111.971 1.00 0.00 ? 54  ASP A CA   5  
ATOM 8023  C C    . ASP A 1 54  ? -255.364 -7.171  111.348 1.00 0.00 ? 54  ASP A C    5  
ATOM 8024  O O    . ASP A 1 54  ? -255.818 -8.208  111.829 1.00 0.00 ? 54  ASP A O    5  
ATOM 8025  C CB   . ASP A 1 54  ? -257.084 -5.829  112.430 1.00 0.00 ? 54  ASP A CB   5  
ATOM 8026  C CG   . ASP A 1 54  ? -257.396 -4.735  113.432 1.00 0.00 ? 54  ASP A CG   5  
ATOM 8027  O OD1  . ASP A 1 54  ? -257.656 -3.588  113.002 1.00 0.00 ? 54  ASP A OD1  5  
ATOM 8028  O OD2  . ASP A 1 54  ? -257.386 -5.012  114.647 1.00 0.00 ? 54  ASP A OD2  5  
ATOM 8029  H H    . ASP A 1 54  ? -256.288 -4.258  110.690 1.00 0.00 ? 54  ASP A H    5  
ATOM 8030  H HA   . ASP A 1 54  ? -255.015 -5.668  112.821 1.00 0.00 ? 54  ASP A HA   5  
ATOM 8031  H HB2  . ASP A 1 54  ? -257.705 -5.693  111.559 1.00 0.00 ? 54  ASP A HB2  5  
ATOM 8032  H HB3  . ASP A 1 54  ? -257.294 -6.783  112.871 1.00 0.00 ? 54  ASP A HB3  5  
ATOM 8033  N N    . TYR A 1 55  ? -254.650 -7.143  110.265 1.00 0.00 ? 55  TYR A N    5  
ATOM 8034  C CA   . TYR A 1 55  ? -254.195 -8.359  109.607 1.00 0.00 ? 55  TYR A CA   5  
ATOM 8035  C C    . TYR A 1 55  ? -253.211 -9.123  110.490 1.00 0.00 ? 55  TYR A C    5  
ATOM 8036  O O    . TYR A 1 55  ? -252.470 -8.526  111.268 1.00 0.00 ? 55  TYR A O    5  
ATOM 8037  C CB   . TYR A 1 55  ? -253.500 -8.030  108.293 1.00 0.00 ? 55  TYR A CB   5  
ATOM 8038  C CG   . TYR A 1 55  ? -254.391 -7.469  107.215 1.00 0.00 ? 55  TYR A CG   5  
ATOM 8039  C CD1  . TYR A 1 55  ? -255.702 -7.891  107.080 1.00 0.00 ? 55  TYR A CD1  5  
ATOM 8040  C CD2  . TYR A 1 55  ? -253.906 -6.530  106.317 1.00 0.00 ? 55  TYR A CD2  5  
ATOM 8041  C CE1  . TYR A 1 55  ? -256.508 -7.393  106.077 1.00 0.00 ? 55  TYR A CE1  5  
ATOM 8042  C CE2  . TYR A 1 55  ? -254.703 -6.024  105.313 1.00 0.00 ? 55  TYR A CE2  5  
ATOM 8043  C CZ   . TYR A 1 55  ? -256.006 -6.458  105.197 1.00 0.00 ? 55  TYR A CZ   5  
ATOM 8044  O OH   . TYR A 1 55  ? -256.804 -5.961  104.193 1.00 0.00 ? 55  TYR A OH   5  
ATOM 8045  H H    . TYR A 1 55  ? -254.436 -6.268  109.890 1.00 0.00 ? 55  TYR A H    5  
ATOM 8046  H HA   . TYR A 1 55  ? -255.054 -8.981  109.409 1.00 0.00 ? 55  TYR A HA   5  
ATOM 8047  H HB2  . TYR A 1 55  ? -252.735 -7.303  108.485 1.00 0.00 ? 55  TYR A HB2  5  
ATOM 8048  H HB3  . TYR A 1 55  ? -253.043 -8.924  107.911 1.00 0.00 ? 55  TYR A HB3  5  
ATOM 8049  H HD1  . TYR A 1 55  ? -256.095 -8.622  107.771 1.00 0.00 ? 55  TYR A HD1  5  
ATOM 8050  H HD2  . TYR A 1 55  ? -252.883 -6.192  106.413 1.00 0.00 ? 55  TYR A HD2  5  
ATOM 8051  H HE1  . TYR A 1 55  ? -257.528 -7.736  105.991 1.00 0.00 ? 55  TYR A HE1  5  
ATOM 8052  H HE2  . TYR A 1 55  ? -254.304 -5.295  104.627 1.00 0.00 ? 55  TYR A HE2  5  
ATOM 8053  H HH   . TYR A 1 55  ? -257.690 -5.804  104.531 1.00 0.00 ? 55  TYR A HH   5  
ATOM 8054  N N    . PHE A 1 56  ? -253.216 -10.440 110.356 1.00 0.00 ? 56  PHE A N    5  
ATOM 8055  C CA   . PHE A 1 56  ? -252.268 -11.297 111.057 1.00 0.00 ? 56  PHE A CA   5  
ATOM 8056  C C    . PHE A 1 56  ? -252.102 -12.601 110.292 1.00 0.00 ? 56  PHE A C    5  
ATOM 8057  O O    . PHE A 1 56  ? -252.763 -12.819 109.293 1.00 0.00 ? 56  PHE A O    5  
ATOM 8058  C CB   . PHE A 1 56  ? -252.713 -11.572 112.505 1.00 0.00 ? 56  PHE A CB   5  
ATOM 8059  C CG   . PHE A 1 56  ? -254.091 -12.163 112.624 1.00 0.00 ? 56  PHE A CG   5  
ATOM 8060  C CD1  . PHE A 1 56  ? -255.205 -11.340 112.626 1.00 0.00 ? 56  PHE A CD1  5  
ATOM 8061  C CD2  . PHE A 1 56  ? -254.275 -13.535 112.722 1.00 0.00 ? 56  PHE A CD2  5  
ATOM 8062  C CE1  . PHE A 1 56  ? -256.474 -11.867 112.723 1.00 0.00 ? 56  PHE A CE1  5  
ATOM 8063  C CE2  . PHE A 1 56  ? -255.550 -14.068 112.815 1.00 0.00 ? 56  PHE A CE2  5  
ATOM 8064  C CZ   . PHE A 1 56  ? -256.649 -13.229 112.816 1.00 0.00 ? 56  PHE A CZ   5  
ATOM 8065  H H    . PHE A 1 56  ? -253.871 -10.857 109.755 1.00 0.00 ? 56  PHE A H    5  
ATOM 8066  H HA   . PHE A 1 56  ? -251.317 -10.785 111.075 1.00 0.00 ? 56  PHE A HA   5  
ATOM 8067  H HB2  . PHE A 1 56  ? -252.020 -12.262 112.960 1.00 0.00 ? 56  PHE A HB2  5  
ATOM 8068  H HB3  . PHE A 1 56  ? -252.702 -10.642 113.055 1.00 0.00 ? 56  PHE A HB3  5  
ATOM 8069  H HD1  . PHE A 1 56  ? -255.072 -10.272 112.553 1.00 0.00 ? 56  PHE A HD1  5  
ATOM 8070  H HD2  . PHE A 1 56  ? -253.408 -14.194 112.729 1.00 0.00 ? 56  PHE A HD2  5  
ATOM 8071  H HE1  . PHE A 1 56  ? -257.332 -11.211 112.725 1.00 0.00 ? 56  PHE A HE1  5  
ATOM 8072  H HE2  . PHE A 1 56  ? -255.687 -15.138 112.887 1.00 0.00 ? 56  PHE A HE2  5  
ATOM 8073  H HZ   . PHE A 1 56  ? -257.650 -13.636 112.883 1.00 0.00 ? 56  PHE A HZ   5  
ATOM 8074  N N    . LEU A 1 57  ? -251.219 -13.460 110.759 1.00 0.00 ? 57  LEU A N    5  
ATOM 8075  C CA   . LEU A 1 57  ? -250.920 -14.716 110.073 1.00 0.00 ? 57  LEU A CA   5  
ATOM 8076  C C    . LEU A 1 57  ? -251.597 -15.828 110.836 1.00 0.00 ? 57  LEU A C    5  
ATOM 8077  O O    . LEU A 1 57  ? -252.122 -15.574 111.904 1.00 0.00 ? 57  LEU A O    5  
ATOM 8078  C CB   . LEU A 1 57  ? -249.402 -14.994 110.009 1.00 0.00 ? 57  LEU A CB   5  
ATOM 8079  C CG   . LEU A 1 57  ? -248.531 -13.966 109.273 1.00 0.00 ? 57  LEU A CG   5  
ATOM 8080  C CD1  . LEU A 1 57  ? -248.734 -12.594 109.861 1.00 0.00 ? 57  LEU A CD1  5  
ATOM 8081  C CD2  . LEU A 1 57  ? -247.060 -14.348 109.355 1.00 0.00 ? 57  LEU A CD2  5  
ATOM 8082  H H    . LEU A 1 57  ? -250.757 -13.256 111.600 1.00 0.00 ? 57  LEU A H    5  
ATOM 8083  H HA   . LEU A 1 57  ? -251.325 -14.666 109.072 1.00 0.00 ? 57  LEU A HA   5  
ATOM 8084  H HB2  . LEU A 1 57  ? -249.038 -15.069 111.022 1.00 0.00 ? 57  LEU A HB2  5  
ATOM 8085  H HB3  . LEU A 1 57  ? -249.261 -15.952 109.530 1.00 0.00 ? 57  LEU A HB3  5  
ATOM 8086  H HG   . LEU A 1 57  ? -248.815 -13.934 108.231 1.00 0.00 ? 57  LEU A HG   5  
ATOM 8087  H HD11 . LEU A 1 57  ? -248.707 -12.672 110.948 1.00 0.00 ? 57  LEU A HD11 5  
ATOM 8088  H HD12 . LEU A 1 57  ? -247.961 -11.925 109.516 1.00 0.00 ? 57  LEU A HD12 5  
ATOM 8089  H HD13 . LEU A 1 57  ? -249.710 -12.232 109.552 1.00 0.00 ? 57  LEU A HD13 5  
ATOM 8090  H HD21 . LEU A 1 57  ? -246.913 -15.317 108.904 1.00 0.00 ? 57  LEU A HD21 5  
ATOM 8091  H HD22 . LEU A 1 57  ? -246.467 -13.612 108.832 1.00 0.00 ? 57  LEU A HD22 5  
ATOM 8092  H HD23 . LEU A 1 57  ? -246.755 -14.382 110.393 1.00 0.00 ? 57  LEU A HD23 5  
ATOM 8093  N N    . MET A 1 58  ? -251.642 -17.025 110.283 1.00 0.00 ? 58  MET A N    5  
ATOM 8094  C CA   . MET A 1 58  ? -252.102 -18.194 111.031 1.00 0.00 ? 58  MET A CA   5  
ATOM 8095  C C    . MET A 1 58  ? -251.492 -19.458 110.452 1.00 0.00 ? 58  MET A C    5  
ATOM 8096  O O    . MET A 1 58  ? -251.086 -19.475 109.290 1.00 0.00 ? 58  MET A O    5  
ATOM 8097  C CB   . MET A 1 58  ? -253.623 -18.346 111.014 1.00 0.00 ? 58  MET A CB   5  
ATOM 8098  C CG   . MET A 1 58  ? -254.406 -17.179 111.589 1.00 0.00 ? 58  MET A CG   5  
ATOM 8099  S SD   . MET A 1 58  ? -256.117 -17.617 111.915 1.00 0.00 ? 58  MET A SD   5  
ATOM 8100  C CE   . MET A 1 58  ? -256.272 -18.987 110.774 1.00 0.00 ? 58  MET A CE   5  
ATOM 8101  H H    . MET A 1 58  ? -251.367 -17.134 109.350 1.00 0.00 ? 58  MET A H    5  
ATOM 8102  H HA   . MET A 1 58  ? -251.769 -18.085 112.051 1.00 0.00 ? 58  MET A HA   5  
ATOM 8103  H HB2  . MET A 1 58  ? -253.939 -18.483 109.992 1.00 0.00 ? 58  MET A HB2  5  
ATOM 8104  H HB3  . MET A 1 58  ? -253.881 -19.230 111.577 1.00 0.00 ? 58  MET A HB3  5  
ATOM 8105  H HG2  . MET A 1 58  ? -253.941 -16.867 112.515 1.00 0.00 ? 58  MET A HG2  5  
ATOM 8106  H HG3  . MET A 1 58  ? -254.385 -16.365 110.879 1.00 0.00 ? 58  MET A HG3  5  
ATOM 8107  H HE1  . MET A 1 58  ? -256.035 -18.649 109.765 1.00 0.00 ? 58  MET A HE1  5  
ATOM 8108  H HE2  . MET A 1 58  ? -255.571 -19.757 111.067 1.00 0.00 ? 58  MET A HE2  5  
ATOM 8109  H HE3  . MET A 1 58  ? -257.278 -19.375 110.804 1.00 0.00 ? 58  MET A HE3  5  
ATOM 8110  N N    . GLU A 1 59  ? -251.419 -20.500 111.265 1.00 0.00 ? 59  GLU A N    5  
ATOM 8111  C CA   . GLU A 1 59  ? -250.932 -21.793 110.809 1.00 0.00 ? 59  GLU A CA   5  
ATOM 8112  C C    . GLU A 1 59  ? -252.087 -22.727 110.470 1.00 0.00 ? 59  GLU A C    5  
ATOM 8113  O O    . GLU A 1 59  ? -252.882 -23.083 111.340 1.00 0.00 ? 59  GLU A O    5  
ATOM 8114  C CB   . GLU A 1 59  ? -250.062 -22.453 111.871 1.00 0.00 ? 59  GLU A CB   5  
ATOM 8115  C CG   . GLU A 1 59  ? -248.679 -21.850 112.010 1.00 0.00 ? 59  GLU A CG   5  
ATOM 8116  C CD   . GLU A 1 59  ? -247.860 -22.591 113.038 1.00 0.00 ? 59  GLU A CD   5  
ATOM 8117  O OE1  . GLU A 1 59  ? -247.681 -23.819 112.884 1.00 0.00 ? 59  GLU A OE1  5  
ATOM 8118  O OE2  . GLU A 1 59  ? -247.424 -21.964 114.022 1.00 0.00 ? 59  GLU A OE2  5  
ATOM 8119  H H    . GLU A 1 59  ? -251.717 -20.402 112.195 1.00 0.00 ? 59  GLU A H    5  
ATOM 8120  H HA   . GLU A 1 59  ? -250.343 -21.630 109.919 1.00 0.00 ? 59  GLU A HA   5  
ATOM 8121  H HB2  . GLU A 1 59  ? -250.557 -22.370 112.827 1.00 0.00 ? 59  GLU A HB2  5  
ATOM 8122  H HB3  . GLU A 1 59  ? -249.949 -23.500 111.626 1.00 0.00 ? 59  GLU A HB3  5  
ATOM 8123  H HG2  . GLU A 1 59  ? -248.175 -21.903 111.056 1.00 0.00 ? 59  GLU A HG2  5  
ATOM 8124  H HG3  . GLU A 1 59  ? -248.773 -20.819 112.315 1.00 0.00 ? 59  GLU A HG3  5  
ATOM 8125  N N    . GLU A 1 60  ? -252.165 -23.124 109.211 1.00 0.00 ? 60  GLU A N    5  
ATOM 8126  C CA   . GLU A 1 60  ? -253.155 -24.100 108.785 1.00 0.00 ? 60  GLU A CA   5  
ATOM 8127  C C    . GLU A 1 60  ? -252.548 -25.496 108.762 1.00 0.00 ? 60  GLU A C    5  
ATOM 8128  O O    . GLU A 1 60  ? -251.710 -25.808 107.913 1.00 0.00 ? 60  GLU A O    5  
ATOM 8129  C CB   . GLU A 1 60  ? -253.701 -23.761 107.397 1.00 0.00 ? 60  GLU A CB   5  
ATOM 8130  C CG   . GLU A 1 60  ? -254.598 -22.535 107.357 1.00 0.00 ? 60  GLU A CG   5  
ATOM 8131  C CD   . GLU A 1 60  ? -255.933 -22.741 108.049 1.00 0.00 ? 60  GLU A CD   5  
ATOM 8132  O OE1  . GLU A 1 60  ? -256.464 -23.869 108.010 1.00 0.00 ? 60  GLU A OE1  5  
ATOM 8133  O OE2  . GLU A 1 60  ? -256.478 -21.762 108.599 1.00 0.00 ? 60  GLU A OE2  5  
ATOM 8134  H H    . GLU A 1 60  ? -251.546 -22.745 108.549 1.00 0.00 ? 60  GLU A H    5  
ATOM 8135  H HA   . GLU A 1 60  ? -253.966 -24.083 109.498 1.00 0.00 ? 60  GLU A HA   5  
ATOM 8136  H HB2  . GLU A 1 60  ? -252.870 -23.586 106.730 1.00 0.00 ? 60  GLU A HB2  5  
ATOM 8137  H HB3  . GLU A 1 60  ? -254.269 -24.604 107.034 1.00 0.00 ? 60  GLU A HB3  5  
ATOM 8138  H HG2  . GLU A 1 60  ? -254.085 -21.720 107.844 1.00 0.00 ? 60  GLU A HG2  5  
ATOM 8139  H HG3  . GLU A 1 60  ? -254.782 -22.276 106.324 1.00 0.00 ? 60  GLU A HG3  5  
ATOM 8140  N N    . LYS A 1 61  ? -252.942 -26.316 109.723 1.00 0.00 ? 61  LYS A N    5  
ATOM 8141  C CA   . LYS A 1 61  ? -252.572 -27.720 109.722 1.00 0.00 ? 61  LYS A CA   5  
ATOM 8142  C C    . LYS A 1 61  ? -253.605 -28.495 108.906 1.00 0.00 ? 61  LYS A C    5  
ATOM 8143  O O    . LYS A 1 61  ? -254.763 -28.087 108.827 1.00 0.00 ? 61  LYS A O    5  
ATOM 8144  C CB   . LYS A 1 61  ? -252.493 -28.282 111.153 1.00 0.00 ? 61  LYS A CB   5  
ATOM 8145  C CG   . LYS A 1 61  ? -251.291 -27.813 111.980 1.00 0.00 ? 61  LYS A CG   5  
ATOM 8146  C CD   . LYS A 1 61  ? -251.399 -26.350 112.394 1.00 0.00 ? 61  LYS A CD   5  
ATOM 8147  C CE   . LYS A 1 61  ? -250.427 -26.004 113.523 1.00 0.00 ? 61  LYS A CE   5  
ATOM 8148  N NZ   . LYS A 1 61  ? -249.000 -26.155 113.122 1.00 0.00 ? 61  LYS A NZ   5  
ATOM 8149  H H    . LYS A 1 61  ? -253.507 -25.971 110.445 1.00 0.00 ? 61  LYS A H    5  
ATOM 8150  H HA   . LYS A 1 61  ? -251.606 -27.810 109.248 1.00 0.00 ? 61  LYS A HA   5  
ATOM 8151  H HB2  . LYS A 1 61  ? -253.389 -27.990 111.683 1.00 0.00 ? 61  LYS A HB2  5  
ATOM 8152  H HB3  . LYS A 1 61  ? -252.461 -29.359 111.099 1.00 0.00 ? 61  LYS A HB3  5  
ATOM 8153  H HG2  . LYS A 1 61  ? -251.224 -28.419 112.870 1.00 0.00 ? 61  LYS A HG2  5  
ATOM 8154  H HG3  . LYS A 1 61  ? -250.395 -27.941 111.390 1.00 0.00 ? 61  LYS A HG3  5  
ATOM 8155  H HD2  . LYS A 1 61  ? -251.175 -25.731 111.539 1.00 0.00 ? 61  LYS A HD2  5  
ATOM 8156  H HD3  . LYS A 1 61  ? -252.408 -26.156 112.726 1.00 0.00 ? 61  LYS A HD3  5  
ATOM 8157  H HE2  . LYS A 1 61  ? -250.597 -24.982 113.820 1.00 0.00 ? 61  LYS A HE2  5  
ATOM 8158  H HE3  . LYS A 1 61  ? -250.627 -26.656 114.363 1.00 0.00 ? 61  LYS A HE3  5  
ATOM 8159  H HZ1  . LYS A 1 61  ? -248.916 -26.826 112.337 1.00 0.00 ? 61  LYS A HZ1  5  
ATOM 8160  H HZ2  . LYS A 1 61  ? -248.607 -25.232 112.817 1.00 0.00 ? 61  LYS A HZ2  5  
ATOM 8161  H HZ3  . LYS A 1 61  ? -248.433 -26.507 113.931 1.00 0.00 ? 61  LYS A HZ3  5  
ATOM 8162  N N    . TYR A 1 62  ? -253.194 -29.593 108.287 1.00 0.00 ? 62  TYR A N    5  
ATOM 8163  C CA   . TYR A 1 62  ? -254.090 -30.335 107.408 1.00 0.00 ? 62  TYR A CA   5  
ATOM 8164  C C    . TYR A 1 62  ? -254.691 -31.547 108.121 1.00 0.00 ? 62  TYR A C    5  
ATOM 8165  O O    . TYR A 1 62  ? -254.057 -32.156 108.984 1.00 0.00 ? 62  TYR A O    5  
ATOM 8166  C CB   . TYR A 1 62  ? -253.354 -30.769 106.133 1.00 0.00 ? 62  TYR A CB   5  
ATOM 8167  C CG   . TYR A 1 62  ? -254.249 -31.436 105.110 1.00 0.00 ? 62  TYR A CG   5  
ATOM 8168  C CD1  . TYR A 1 62  ? -255.224 -30.711 104.432 1.00 0.00 ? 62  TYR A CD1  5  
ATOM 8169  C CD2  . TYR A 1 62  ? -254.127 -32.789 104.828 1.00 0.00 ? 62  TYR A CD2  5  
ATOM 8170  C CE1  . TYR A 1 62  ? -256.050 -31.320 103.508 1.00 0.00 ? 62  TYR A CE1  5  
ATOM 8171  C CE2  . TYR A 1 62  ? -254.948 -33.404 103.901 1.00 0.00 ? 62  TYR A CE2  5  
ATOM 8172  C CZ   . TYR A 1 62  ? -255.910 -32.666 103.245 1.00 0.00 ? 62  TYR A CZ   5  
ATOM 8173  O OH   . TYR A 1 62  ? -256.736 -33.278 102.331 1.00 0.00 ? 62  TYR A OH   5  
ATOM 8174  H H    . TYR A 1 62  ? -252.283 -29.915 108.433 1.00 0.00 ? 62  TYR A H    5  
ATOM 8175  H HA   . TYR A 1 62  ? -254.896 -29.669 107.131 1.00 0.00 ? 62  TYR A HA   5  
ATOM 8176  H HB2  . TYR A 1 62  ? -252.910 -29.901 105.671 1.00 0.00 ? 62  TYR A HB2  5  
ATOM 8177  H HB3  . TYR A 1 62  ? -252.576 -31.468 106.396 1.00 0.00 ? 62  TYR A HB3  5  
ATOM 8178  H HD1  . TYR A 1 62  ? -255.333 -29.657 104.638 1.00 0.00 ? 62  TYR A HD1  5  
ATOM 8179  H HD2  . TYR A 1 62  ? -253.373 -33.366 105.343 1.00 0.00 ? 62  TYR A HD2  5  
ATOM 8180  H HE1  . TYR A 1 62  ? -256.800 -30.740 102.990 1.00 0.00 ? 62  TYR A HE1  5  
ATOM 8181  H HE2  . TYR A 1 62  ? -254.837 -34.458 103.699 1.00 0.00 ? 62  TYR A HE2  5  
ATOM 8182  H HH   . TYR A 1 62  ? -257.121 -34.064 102.732 1.00 0.00 ? 62  TYR A HH   5  
ATOM 8183  N N    . PHE A 1 63  ? -255.917 -31.885 107.744 1.00 0.00 ? 63  PHE A N    5  
ATOM 8184  C CA   . PHE A 1 63  ? -256.650 -32.983 108.359 1.00 0.00 ? 63  PHE A CA   5  
ATOM 8185  C C    . PHE A 1 63  ? -256.323 -34.305 107.664 1.00 0.00 ? 63  PHE A C    5  
ATOM 8186  O O    . PHE A 1 63  ? -256.774 -34.561 106.550 1.00 0.00 ? 63  PHE A O    5  
ATOM 8187  C CB   . PHE A 1 63  ? -258.155 -32.690 108.276 1.00 0.00 ? 63  PHE A CB   5  
ATOM 8188  C CG   . PHE A 1 63  ? -259.032 -33.668 109.012 1.00 0.00 ? 63  PHE A CG   5  
ATOM 8189  C CD1  . PHE A 1 63  ? -259.509 -34.807 108.381 1.00 0.00 ? 63  PHE A CD1  5  
ATOM 8190  C CD2  . PHE A 1 63  ? -259.392 -33.437 110.328 1.00 0.00 ? 63  PHE A CD2  5  
ATOM 8191  C CE1  . PHE A 1 63  ? -260.323 -35.699 109.051 1.00 0.00 ? 63  PHE A CE1  5  
ATOM 8192  C CE2  . PHE A 1 63  ? -260.207 -34.325 111.006 1.00 0.00 ? 63  PHE A CE2  5  
ATOM 8193  C CZ   . PHE A 1 63  ? -260.674 -35.458 110.366 1.00 0.00 ? 63  PHE A CZ   5  
ATOM 8194  H H    . PHE A 1 63  ? -256.345 -31.377 107.023 1.00 0.00 ? 63  PHE A H    5  
ATOM 8195  H HA   . PHE A 1 63  ? -256.355 -33.045 109.394 1.00 0.00 ? 63  PHE A HA   5  
ATOM 8196  H HB2  . PHE A 1 63  ? -258.344 -31.711 108.690 1.00 0.00 ? 63  PHE A HB2  5  
ATOM 8197  H HB3  . PHE A 1 63  ? -258.454 -32.695 107.238 1.00 0.00 ? 63  PHE A HB3  5  
ATOM 8198  H HD1  . PHE A 1 63  ? -259.233 -34.997 107.354 1.00 0.00 ? 63  PHE A HD1  5  
ATOM 8199  H HD2  . PHE A 1 63  ? -259.028 -32.552 110.831 1.00 0.00 ? 63  PHE A HD2  5  
ATOM 8200  H HE1  . PHE A 1 63  ? -260.688 -36.583 108.547 1.00 0.00 ? 63  PHE A HE1  5  
ATOM 8201  H HE2  . PHE A 1 63  ? -260.479 -34.133 112.033 1.00 0.00 ? 63  PHE A HE2  5  
ATOM 8202  H HZ   . PHE A 1 63  ? -261.310 -36.153 110.893 1.00 0.00 ? 63  PHE A HZ   5  
ATOM 8203  N N    . ILE A 1 64  ? -255.511 -35.123 108.320 1.00 0.00 ? 64  ILE A N    5  
ATOM 8204  C CA   . ILE A 1 64  ? -255.201 -36.466 107.830 1.00 0.00 ? 64  ILE A CA   5  
ATOM 8205  C C    . ILE A 1 64  ? -255.570 -37.484 108.909 1.00 0.00 ? 64  ILE A C    5  
ATOM 8206  O O    . ILE A 1 64  ? -255.074 -38.609 108.933 1.00 0.00 ? 64  ILE A O    5  
ATOM 8207  C CB   . ILE A 1 64  ? -253.700 -36.620 107.466 1.00 0.00 ? 64  ILE A CB   5  
ATOM 8208  C CG1  . ILE A 1 64  ? -253.198 -35.381 106.726 1.00 0.00 ? 64  ILE A CG1  5  
ATOM 8209  C CG2  . ILE A 1 64  ? -253.483 -37.858 106.601 1.00 0.00 ? 64  ILE A CG2  5  
ATOM 8210  C CD1  . ILE A 1 64  ? -251.734 -35.447 106.341 1.00 0.00 ? 64  ILE A CD1  5  
ATOM 8211  H H    . ILE A 1 64  ? -255.104 -34.817 109.159 1.00 0.00 ? 64  ILE A H    5  
ATOM 8212  H HA   . ILE A 1 64  ? -255.795 -36.651 106.946 1.00 0.00 ? 64  ILE A HA   5  
ATOM 8213  H HB   . ILE A 1 64  ? -253.138 -36.741 108.381 1.00 0.00 ? 64  ILE A HB   5  
ATOM 8214  H HG12 . ILE A 1 64  ? -253.772 -35.258 105.820 1.00 0.00 ? 64  ILE A HG12 5  
ATOM 8215  H HG13 . ILE A 1 64  ? -253.339 -34.513 107.356 1.00 0.00 ? 64  ILE A HG13 5  
ATOM 8216  H HG21 . ILE A 1 64  ? -253.838 -38.733 107.127 1.00 0.00 ? 64  ILE A HG21 5  
ATOM 8217  H HG22 . ILE A 1 64  ? -254.028 -37.749 105.676 1.00 0.00 ? 64  ILE A HG22 5  
ATOM 8218  H HG23 . ILE A 1 64  ? -252.431 -37.969 106.387 1.00 0.00 ? 64  ILE A HG23 5  
ATOM 8219  H HD11 . ILE A 1 64  ? -251.133 -35.554 107.231 1.00 0.00 ? 64  ILE A HD11 5  
ATOM 8220  H HD12 . ILE A 1 64  ? -251.570 -36.296 105.691 1.00 0.00 ? 64  ILE A HD12 5  
ATOM 8221  H HD13 . ILE A 1 64  ? -251.455 -34.541 105.824 1.00 0.00 ? 64  ILE A HD13 5  
ATOM 8222  N N    . SER A 1 65  ? -256.466 -37.067 109.795 1.00 0.00 ? 65  SER A N    5  
ATOM 8223  C CA   . SER A 1 65  ? -256.863 -37.865 110.948 1.00 0.00 ? 65  SER A CA   5  
ATOM 8224  C C    . SER A 1 65  ? -257.443 -39.215 110.535 1.00 0.00 ? 65  SER A C    5  
ATOM 8225  O O    . SER A 1 65  ? -258.516 -39.289 109.936 1.00 0.00 ? 65  SER A O    5  
ATOM 8226  C CB   . SER A 1 65  ? -257.891 -37.087 111.760 1.00 0.00 ? 65  SER A CB   5  
ATOM 8227  O OG   . SER A 1 65  ? -257.442 -35.760 111.999 1.00 0.00 ? 65  SER A OG   5  
ATOM 8228  H H    . SER A 1 65  ? -256.878 -36.189 109.668 1.00 0.00 ? 65  SER A H    5  
ATOM 8229  H HA   . SER A 1 65  ? -255.988 -38.030 111.557 1.00 0.00 ? 65  SER A HA   5  
ATOM 8230  H HB2  . SER A 1 65  ? -258.823 -37.047 111.215 1.00 0.00 ? 65  SER A HB2  5  
ATOM 8231  H HB3  . SER A 1 65  ? -258.045 -37.579 112.709 1.00 0.00 ? 65  SER A HB3  5  
ATOM 8232  H HG   . SER A 1 65  ? -256.648 -35.789 112.555 1.00 0.00 ? 65  SER A HG   5  
ATOM 8233  N N    . LYS A 1 66  ? -256.724 -40.280 110.856 1.00 0.00 ? 66  LYS A N    5  
ATOM 8234  C CA   . LYS A 1 66  ? -257.183 -41.622 110.553 1.00 0.00 ? 66  LYS A CA   5  
ATOM 8235  C C    . LYS A 1 66  ? -257.673 -42.314 111.820 1.00 0.00 ? 66  LYS A C    5  
ATOM 8236  O O    . LYS A 1 66  ? -258.707 -42.988 111.805 1.00 0.00 ? 66  LYS A O    5  
ATOM 8237  C CB   . LYS A 1 66  ? -256.068 -42.441 109.902 1.00 0.00 ? 66  LYS A CB   5  
ATOM 8238  C CG   . LYS A 1 66  ? -255.530 -41.813 108.626 1.00 0.00 ? 66  LYS A CG   5  
ATOM 8239  C CD   . LYS A 1 66  ? -254.511 -42.708 107.941 1.00 0.00 ? 66  LYS A CD   5  
ATOM 8240  C CE   . LYS A 1 66  ? -253.929 -42.044 106.701 1.00 0.00 ? 66  LYS A CE   5  
ATOM 8241  N NZ   . LYS A 1 66  ? -254.979 -41.662 105.720 1.00 0.00 ? 66  LYS A NZ   5  
ATOM 8242  H H    . LYS A 1 66  ? -255.859 -40.154 111.303 1.00 0.00 ? 66  LYS A H    5  
ATOM 8243  H HA   . LYS A 1 66  ? -258.009 -41.541 109.861 1.00 0.00 ? 66  LYS A HA   5  
ATOM 8244  H HB2  . LYS A 1 66  ? -255.250 -42.539 110.603 1.00 0.00 ? 66  LYS A HB2  5  
ATOM 8245  H HB3  . LYS A 1 66  ? -256.447 -43.423 109.664 1.00 0.00 ? 66  LYS A HB3  5  
ATOM 8246  H HG2  . LYS A 1 66  ? -256.352 -41.642 107.949 1.00 0.00 ? 66  LYS A HG2  5  
ATOM 8247  H HG3  . LYS A 1 66  ? -255.061 -40.871 108.872 1.00 0.00 ? 66  LYS A HG3  5  
ATOM 8248  H HD2  . LYS A 1 66  ? -253.708 -42.918 108.634 1.00 0.00 ? 66  LYS A HD2  5  
ATOM 8249  H HD3  . LYS A 1 66  ? -254.991 -43.630 107.652 1.00 0.00 ? 66  LYS A HD3  5  
ATOM 8250  H HE2  . LYS A 1 66  ? -253.395 -41.156 107.005 1.00 0.00 ? 66  LYS A HE2  5  
ATOM 8251  H HE3  . LYS A 1 66  ? -253.243 -42.731 106.228 1.00 0.00 ? 66  LYS A HE3  5  
ATOM 8252  H HZ1  . LYS A 1 66  ? -255.573 -42.489 105.483 1.00 0.00 ? 66  LYS A HZ1  5  
ATOM 8253  H HZ2  . LYS A 1 66  ? -255.591 -40.912 106.117 1.00 0.00 ? 66  LYS A HZ2  5  
ATOM 8254  H HZ3  . LYS A 1 66  ? -254.540 -41.305 104.843 1.00 0.00 ? 66  LYS A HZ3  5  
ATOM 8255  N N    . GLU A 1 67  ? -256.932 -42.109 112.907 1.00 0.00 ? 67  GLU A N    5  
ATOM 8256  C CA   . GLU A 1 67  ? -257.215 -42.727 114.204 1.00 0.00 ? 67  GLU A CA   5  
ATOM 8257  C C    . GLU A 1 67  ? -257.039 -44.247 114.147 1.00 0.00 ? 67  GLU A C    5  
ATOM 8258  O O    . GLU A 1 67  ? -256.806 -44.810 113.071 1.00 0.00 ? 67  GLU A O    5  
ATOM 8259  C CB   . GLU A 1 67  ? -258.614 -42.351 114.709 1.00 0.00 ? 67  GLU A CB   5  
ATOM 8260  C CG   . GLU A 1 67  ? -258.838 -40.848 114.789 1.00 0.00 ? 67  GLU A CG   5  
ATOM 8261  C CD   . GLU A 1 67  ? -257.686 -40.123 115.462 1.00 0.00 ? 67  GLU A CD   5  
ATOM 8262  O OE1  . GLU A 1 67  ? -257.690 -40.013 116.707 1.00 0.00 ? 67  GLU A OE1  5  
ATOM 8263  O OE2  . GLU A 1 67  ? -256.775 -39.664 114.748 1.00 0.00 ? 67  GLU A OE2  5  
ATOM 8264  H H    . GLU A 1 67  ? -256.164 -41.507 112.841 1.00 0.00 ? 67  GLU A H    5  
ATOM 8265  H HA   . GLU A 1 67  ? -256.487 -42.337 114.901 1.00 0.00 ? 67  GLU A HA   5  
ATOM 8266  H HB2  . GLU A 1 67  ? -259.350 -42.770 114.041 1.00 0.00 ? 67  GLU A HB2  5  
ATOM 8267  H HB3  . GLU A 1 67  ? -258.754 -42.769 115.696 1.00 0.00 ? 67  GLU A HB3  5  
ATOM 8268  H HG2  . GLU A 1 67  ? -258.952 -40.459 113.787 1.00 0.00 ? 67  GLU A HG2  5  
ATOM 8269  H HG3  . GLU A 1 67  ? -259.741 -40.660 115.352 1.00 0.00 ? 67  GLU A HG3  5  
ATOM 8270  N N    . LYS A 1 68  ? -257.136 -44.894 115.316 1.00 0.00 ? 68  LYS A N    5  
ATOM 8271  C CA   . LYS A 1 68  ? -256.819 -46.322 115.477 1.00 0.00 ? 68  LYS A CA   5  
ATOM 8272  C C    . LYS A 1 68  ? -255.312 -46.525 115.371 1.00 0.00 ? 68  LYS A C    5  
ATOM 8273  O O    . LYS A 1 68  ? -254.669 -47.023 116.294 1.00 0.00 ? 68  LYS A O    5  
ATOM 8274  C CB   . LYS A 1 68  ? -257.578 -47.198 114.470 1.00 0.00 ? 68  LYS A CB   5  
ATOM 8275  C CG   . LYS A 1 68  ? -259.081 -47.230 114.712 1.00 0.00 ? 68  LYS A CG   5  
ATOM 8276  C CD   . LYS A 1 68  ? -259.419 -47.885 116.043 1.00 0.00 ? 68  LYS A CD   5  
ATOM 8277  C CE   . LYS A 1 68  ? -259.184 -49.389 116.012 1.00 0.00 ? 68  LYS A CE   5  
ATOM 8278  N NZ   . LYS A 1 68  ? -260.212 -50.101 115.207 1.00 0.00 ? 68  LYS A NZ   5  
ATOM 8279  H H    . LYS A 1 68  ? -257.413 -44.385 116.113 1.00 0.00 ? 68  LYS A H    5  
ATOM 8280  H HA   . LYS A 1 68  ? -257.122 -46.602 116.474 1.00 0.00 ? 68  LYS A HA   5  
ATOM 8281  H HB2  . LYS A 1 68  ? -257.403 -46.816 113.473 1.00 0.00 ? 68  LYS A HB2  5  
ATOM 8282  H HB3  . LYS A 1 68  ? -257.202 -48.207 114.534 1.00 0.00 ? 68  LYS A HB3  5  
ATOM 8283  H HG2  . LYS A 1 68  ? -259.461 -46.219 114.714 1.00 0.00 ? 68  LYS A HG2  5  
ATOM 8284  H HG3  . LYS A 1 68  ? -259.553 -47.791 113.918 1.00 0.00 ? 68  LYS A HG3  5  
ATOM 8285  H HD2  . LYS A 1 68  ? -258.797 -47.451 116.812 1.00 0.00 ? 68  LYS A HD2  5  
ATOM 8286  H HD3  . LYS A 1 68  ? -260.458 -47.696 116.272 1.00 0.00 ? 68  LYS A HD3  5  
ATOM 8287  H HE2  . LYS A 1 68  ? -258.211 -49.581 115.583 1.00 0.00 ? 68  LYS A HE2  5  
ATOM 8288  H HE3  . LYS A 1 68  ? -259.209 -49.764 117.024 1.00 0.00 ? 68  LYS A HE3  5  
ATOM 8289  H HZ1  . LYS A 1 68  ? -260.226 -49.738 114.229 1.00 0.00 ? 68  LYS A HZ1  5  
ATOM 8290  H HZ2  . LYS A 1 68  ? -260.008 -51.122 115.183 1.00 0.00 ? 68  LYS A HZ2  5  
ATOM 8291  H HZ3  . LYS A 1 68  ? -261.156 -49.961 115.631 1.00 0.00 ? 68  LYS A HZ3  5  
ATOM 8292  N N    . ASN A 1 69  ? -254.755 -46.127 114.247 1.00 0.00 ? 69  ASN A N    5  
ATOM 8293  C CA   . ASN A 1 69  ? -253.319 -45.969 114.124 1.00 0.00 ? 69  ASN A CA   5  
ATOM 8294  C C    . ASN A 1 69  ? -252.969 -44.598 114.660 1.00 0.00 ? 69  ASN A C    5  
ATOM 8295  O O    . ASN A 1 69  ? -253.703 -43.642 114.408 1.00 0.00 ? 69  ASN A O    5  
ATOM 8296  C CB   . ASN A 1 69  ? -252.874 -46.118 112.665 1.00 0.00 ? 69  ASN A CB   5  
ATOM 8297  C CG   . ASN A 1 69  ? -251.369 -46.007 112.495 1.00 0.00 ? 69  ASN A CG   5  
ATOM 8298  O OD1  . ASN A 1 69  ? -250.833 -44.912 112.332 1.00 0.00 ? 69  ASN A OD1  5  
ATOM 8299  N ND2  . ASN A 1 69  ? -250.678 -47.135 112.503 1.00 0.00 ? 69  ASN A ND2  5  
ATOM 8300  H H    . ASN A 1 69  ? -255.334 -45.909 113.485 1.00 0.00 ? 69  ASN A H    5  
ATOM 8301  H HA   . ASN A 1 69  ? -252.837 -46.711 114.739 1.00 0.00 ? 69  ASN A HA   5  
ATOM 8302  H HB2  . ASN A 1 69  ? -253.191 -47.082 112.297 1.00 0.00 ? 69  ASN A HB2  5  
ATOM 8303  H HB3  . ASN A 1 69  ? -253.343 -45.343 112.075 1.00 0.00 ? 69  ASN A HB3  5  
ATOM 8304  H HD21 . ASN A 1 69  ? -251.166 -47.983 112.617 1.00 0.00 ? 69  ASN A HD21 5  
ATOM 8305  H HD22 . ASN A 1 69  ? -249.704 -47.082 112.401 1.00 0.00 ? 69  ASN A HD22 5  
ATOM 8306  N N    . GLU A 1 70  ? -251.874 -44.507 115.412 1.00 0.00 ? 70  GLU A N    5  
ATOM 8307  C CA   . GLU A 1 70  ? -251.577 -43.302 116.170 1.00 0.00 ? 70  GLU A CA   5  
ATOM 8308  C C    . GLU A 1 70  ? -251.651 -42.055 115.296 1.00 0.00 ? 70  GLU A C    5  
ATOM 8309  O O    . GLU A 1 70  ? -250.844 -41.868 114.385 1.00 0.00 ? 70  GLU A O    5  
ATOM 8310  C CB   . GLU A 1 70  ? -250.210 -43.381 116.848 1.00 0.00 ? 70  GLU A CB   5  
ATOM 8311  C CG   . GLU A 1 70  ? -249.880 -42.124 117.636 1.00 0.00 ? 70  GLU A CG   5  
ATOM 8312  C CD   . GLU A 1 70  ? -248.525 -42.177 118.301 1.00 0.00 ? 70  GLU A CD   5  
ATOM 8313  O OE1  . GLU A 1 70  ? -247.523 -41.833 117.639 1.00 0.00 ? 70  GLU A OE1  5  
ATOM 8314  O OE2  . GLU A 1 70  ? -248.462 -42.532 119.494 1.00 0.00 ? 70  GLU A OE2  5  
ATOM 8315  H H    . GLU A 1 70  ? -251.257 -45.265 115.454 1.00 0.00 ? 70  GLU A H    5  
ATOM 8316  H HA   . GLU A 1 70  ? -252.334 -43.229 116.932 1.00 0.00 ? 70  GLU A HA   5  
ATOM 8317  H HB2  . GLU A 1 70  ? -250.200 -44.223 117.525 1.00 0.00 ? 70  GLU A HB2  5  
ATOM 8318  H HB3  . GLU A 1 70  ? -249.450 -43.519 116.095 1.00 0.00 ? 70  GLU A HB3  5  
ATOM 8319  H HG2  . GLU A 1 70  ? -249.895 -41.282 116.962 1.00 0.00 ? 70  GLU A HG2  5  
ATOM 8320  H HG3  . GLU A 1 70  ? -250.634 -41.983 118.397 1.00 0.00 ? 70  GLU A HG3  5  
ATOM 8321  N N    . CYS A 1 71  ? -252.635 -41.218 115.582 1.00 0.00 ? 71  CYS A N    5  
ATOM 8322  C CA   . CYS A 1 71  ? -252.857 -39.999 114.832 1.00 0.00 ? 71  CYS A CA   5  
ATOM 8323  C C    . CYS A 1 71  ? -253.579 -38.987 115.716 1.00 0.00 ? 71  CYS A C    5  
ATOM 8324  O O    . CYS A 1 71  ? -253.800 -39.235 116.907 1.00 0.00 ? 71  CYS A O    5  
ATOM 8325  C CB   . CYS A 1 71  ? -253.684 -40.310 113.576 1.00 0.00 ? 71  CYS A CB   5  
ATOM 8326  S SG   . CYS A 1 71  ? -253.725 -38.980 112.348 1.00 0.00 ? 71  CYS A SG   5  
ATOM 8327  H H    . CYS A 1 71  ? -253.236 -41.430 116.324 1.00 0.00 ? 71  CYS A H    5  
ATOM 8328  H HA   . CYS A 1 71  ? -251.898 -39.600 114.541 1.00 0.00 ? 71  CYS A HA   5  
ATOM 8329  H HB2  . CYS A 1 71  ? -253.272 -41.184 113.093 1.00 0.00 ? 71  CYS A HB2  5  
ATOM 8330  H HB3  . CYS A 1 71  ? -254.703 -40.518 113.869 1.00 0.00 ? 71  CYS A HB3  5  
ATOM 8331  H HG   . CYS A 1 71  ? -252.466 -38.689 112.030 1.00 0.00 ? 71  CYS A HG   5  
ATOM 8332  N N    . ARG A 1 72  ? -253.939 -37.853 115.144 1.00 0.00 ? 72  ARG A N    5  
ATOM 8333  C CA   . ARG A 1 72  ? -254.660 -36.823 115.868 1.00 0.00 ? 72  ARG A CA   5  
ATOM 8334  C C    . ARG A 1 72  ? -255.901 -36.399 115.093 1.00 0.00 ? 72  ARG A C    5  
ATOM 8335  O O    . ARG A 1 72  ? -255.794 -35.758 114.044 1.00 0.00 ? 72  ARG A O    5  
ATOM 8336  C CB   . ARG A 1 72  ? -253.749 -35.616 116.121 1.00 0.00 ? 72  ARG A CB   5  
ATOM 8337  C CG   . ARG A 1 72  ? -254.489 -34.361 116.565 1.00 0.00 ? 72  ARG A CG   5  
ATOM 8338  C CD   . ARG A 1 72  ? -255.244 -34.572 117.867 1.00 0.00 ? 72  ARG A CD   5  
ATOM 8339  N NE   . ARG A 1 72  ? -256.100 -33.429 118.181 1.00 0.00 ? 72  ARG A NE   5  
ATOM 8340  C CZ   . ARG A 1 72  ? -256.223 -32.898 119.394 1.00 0.00 ? 72  ARG A CZ   5  
ATOM 8341  N NH1  . ARG A 1 72  ? -255.588 -33.431 120.432 1.00 0.00 ? 72  ARG A NH1  5  
ATOM 8342  N NH2  . ARG A 1 72  ? -256.995 -31.834 119.568 1.00 0.00 ? 72  ARG A NH2  5  
ATOM 8343  H H    . ARG A 1 72  ? -253.725 -37.709 114.197 1.00 0.00 ? 72  ARG A H    5  
ATOM 8344  H HA   . ARG A 1 72  ? -254.967 -37.239 116.818 1.00 0.00 ? 72  ARG A HA   5  
ATOM 8345  H HB2  . ARG A 1 72  ? -253.034 -35.874 116.888 1.00 0.00 ? 72  ARG A HB2  5  
ATOM 8346  H HB3  . ARG A 1 72  ? -253.215 -35.388 115.210 1.00 0.00 ? 72  ARG A HB3  5  
ATOM 8347  H HG2  . ARG A 1 72  ? -253.773 -33.565 116.704 1.00 0.00 ? 72  ARG A HG2  5  
ATOM 8348  H HG3  . ARG A 1 72  ? -255.192 -34.083 115.794 1.00 0.00 ? 72  ARG A HG3  5  
ATOM 8349  H HD2  . ARG A 1 72  ? -255.857 -35.457 117.775 1.00 0.00 ? 72  ARG A HD2  5  
ATOM 8350  H HD3  . ARG A 1 72  ? -254.531 -34.709 118.666 1.00 0.00 ? 72  ARG A HD3  5  
ATOM 8351  H HE   . ARG A 1 72  ? -256.606 -33.026 117.434 1.00 0.00 ? 72  ARG A HE   5  
ATOM 8352  H HH11 . ARG A 1 72  ? -255.007 -34.245 120.314 1.00 0.00 ? 72  ARG A HH11 5  
ATOM 8353  H HH12 . ARG A 1 72  ? -255.685 -33.020 121.348 1.00 0.00 ? 72  ARG A HH12 5  
ATOM 8354  H HH21 . ARG A 1 72  ? -257.486 -31.433 118.791 1.00 0.00 ? 72  ARG A HH21 5  
ATOM 8355  H HH22 . ARG A 1 72  ? -257.078 -31.412 120.483 1.00 0.00 ? 72  ARG A HH22 5  
ATOM 8356  N N    . LYS A 1 73  ? -257.072 -36.777 115.595 1.00 0.00 ? 73  LYS A N    5  
ATOM 8357  C CA   . LYS A 1 73  ? -258.328 -36.367 114.986 1.00 0.00 ? 73  LYS A CA   5  
ATOM 8358  C C    . LYS A 1 73  ? -258.549 -34.881 115.205 1.00 0.00 ? 73  LYS A C    5  
ATOM 8359  O O    . LYS A 1 73  ? -258.752 -34.437 116.336 1.00 0.00 ? 73  LYS A O    5  
ATOM 8360  C CB   . LYS A 1 73  ? -259.506 -37.180 115.547 1.00 0.00 ? 73  LYS A CB   5  
ATOM 8361  C CG   . LYS A 1 73  ? -260.818 -36.991 114.783 1.00 0.00 ? 73  LYS A CG   5  
ATOM 8362  C CD   . LYS A 1 73  ? -261.554 -35.726 115.209 1.00 0.00 ? 73  LYS A CD   5  
ATOM 8363  C CE   . LYS A 1 73  ? -262.754 -35.442 114.320 1.00 0.00 ? 73  LYS A CE   5  
ATOM 8364  N NZ   . LYS A 1 73  ? -263.531 -34.261 114.789 1.00 0.00 ? 73  LYS A NZ   5  
ATOM 8365  H H    . LYS A 1 73  ? -257.090 -37.366 116.379 1.00 0.00 ? 73  LYS A H    5  
ATOM 8366  H HA   . LYS A 1 73  ? -258.251 -36.550 113.925 1.00 0.00 ? 73  LYS A HA   5  
ATOM 8367  H HB2  . LYS A 1 73  ? -259.248 -38.228 115.517 1.00 0.00 ? 73  LYS A HB2  5  
ATOM 8368  H HB3  . LYS A 1 73  ? -259.669 -36.890 116.575 1.00 0.00 ? 73  LYS A HB3  5  
ATOM 8369  H HG2  . LYS A 1 73  ? -260.599 -36.930 113.727 1.00 0.00 ? 73  LYS A HG2  5  
ATOM 8370  H HG3  . LYS A 1 73  ? -261.453 -37.846 114.969 1.00 0.00 ? 73  LYS A HG3  5  
ATOM 8371  H HD2  . LYS A 1 73  ? -261.897 -35.850 116.225 1.00 0.00 ? 73  LYS A HD2  5  
ATOM 8372  H HD3  . LYS A 1 73  ? -260.872 -34.888 115.158 1.00 0.00 ? 73  LYS A HD3  5  
ATOM 8373  H HE2  . LYS A 1 73  ? -262.404 -35.252 113.315 1.00 0.00 ? 73  LYS A HE2  5  
ATOM 8374  H HE3  . LYS A 1 73  ? -263.397 -36.309 114.320 1.00 0.00 ? 73  LYS A HE3  5  
ATOM 8375  H HZ1  . LYS A 1 73  ? -262.920 -33.419 114.840 1.00 0.00 ? 73  LYS A HZ1  5  
ATOM 8376  H HZ2  . LYS A 1 73  ? -264.319 -34.064 114.132 1.00 0.00 ? 73  LYS A HZ2  5  
ATOM 8377  H HZ3  . LYS A 1 73  ? -263.927 -34.447 115.738 1.00 0.00 ? 73  LYS A HZ3  5  
ATOM 8378  N N    . GLN A 1 74  ? -258.484 -34.132 114.110 1.00 0.00 ? 74  GLN A N    5  
ATOM 8379  C CA   . GLN A 1 74  ? -258.734 -32.696 114.115 1.00 0.00 ? 74  GLN A CA   5  
ATOM 8380  C C    . GLN A 1 74  ? -257.646 -31.947 114.887 1.00 0.00 ? 74  GLN A C    5  
ATOM 8381  O O    . GLN A 1 74  ? -257.601 -31.974 116.120 1.00 0.00 ? 74  GLN A O    5  
ATOM 8382  C CB   . GLN A 1 74  ? -260.118 -32.396 114.704 1.00 0.00 ? 74  GLN A CB   5  
ATOM 8383  C CG   . GLN A 1 74  ? -260.531 -30.936 114.612 1.00 0.00 ? 74  GLN A CG   5  
ATOM 8384  C CD   . GLN A 1 74  ? -261.919 -30.702 115.173 1.00 0.00 ? 74  GLN A CD   5  
ATOM 8385  O OE1  . GLN A 1 74  ? -262.776 -31.588 115.131 1.00 0.00 ? 74  GLN A OE1  5  
ATOM 8386  N NE2  . GLN A 1 74  ? -262.154 -29.510 115.699 1.00 0.00 ? 74  GLN A NE2  5  
ATOM 8387  H H    . GLN A 1 74  ? -258.242 -34.567 113.259 1.00 0.00 ? 74  GLN A H    5  
ATOM 8388  H HA   . GLN A 1 74  ? -258.715 -32.361 113.088 1.00 0.00 ? 74  GLN A HA   5  
ATOM 8389  H HB2  . GLN A 1 74  ? -260.854 -32.988 114.181 1.00 0.00 ? 74  GLN A HB2  5  
ATOM 8390  H HB3  . GLN A 1 74  ? -260.117 -32.682 115.745 1.00 0.00 ? 74  GLN A HB3  5  
ATOM 8391  H HG2  . GLN A 1 74  ? -259.827 -30.339 115.171 1.00 0.00 ? 74  GLN A HG2  5  
ATOM 8392  H HG3  . GLN A 1 74  ? -260.520 -30.635 113.576 1.00 0.00 ? 74  GLN A HG3  5  
ATOM 8393  H HE21 . GLN A 1 74  ? -261.426 -28.851 115.699 1.00 0.00 ? 74  GLN A HE21 5  
ATOM 8394  H HE22 . GLN A 1 74  ? -263.045 -29.335 116.066 1.00 0.00 ? 74  GLN A HE22 5  
ATOM 8395  N N    . PRO A 1 75  ? -256.738 -31.287 114.161 1.00 0.00 ? 75  PRO A N    5  
ATOM 8396  C CA   . PRO A 1 75  ? -255.693 -30.466 114.762 1.00 0.00 ? 75  PRO A CA   5  
ATOM 8397  C C    . PRO A 1 75  ? -256.220 -29.094 115.168 1.00 0.00 ? 75  PRO A C    5  
ATOM 8398  O O    . PRO A 1 75  ? -257.395 -28.783 114.964 1.00 0.00 ? 75  PRO A O    5  
ATOM 8399  C CB   . PRO A 1 75  ? -254.666 -30.340 113.640 1.00 0.00 ? 75  PRO A CB   5  
ATOM 8400  C CG   . PRO A 1 75  ? -255.468 -30.411 112.386 1.00 0.00 ? 75  PRO A CG   5  
ATOM 8401  C CD   . PRO A 1 75  ? -256.662 -31.285 112.688 1.00 0.00 ? 75  PRO A CD   5  
ATOM 8402  H HA   . PRO A 1 75  ? -255.245 -30.951 115.617 1.00 0.00 ? 75  PRO A HA   5  
ATOM 8403  H HB2  . PRO A 1 75  ? -254.150 -29.394 113.725 1.00 0.00 ? 75  PRO A HB2  5  
ATOM 8404  H HB3  . PRO A 1 75  ? -253.958 -31.152 113.701 1.00 0.00 ? 75  PRO A HB3  5  
ATOM 8405  H HG2  . PRO A 1 75  ? -255.792 -29.421 112.103 1.00 0.00 ? 75  PRO A HG2  5  
ATOM 8406  H HG3  . PRO A 1 75  ? -254.875 -30.851 111.598 1.00 0.00 ? 75  PRO A HG3  5  
ATOM 8407  H HD2  . PRO A 1 75  ? -257.557 -30.859 112.261 1.00 0.00 ? 75  PRO A HD2  5  
ATOM 8408  H HD3  . PRO A 1 75  ? -256.502 -32.284 112.311 1.00 0.00 ? 75  PRO A HD3  5  
ATOM 8409  N N    . PHE A 1 76  ? -255.354 -28.279 115.743 1.00 0.00 ? 76  PHE A N    5  
ATOM 8410  C CA   . PHE A 1 76  ? -255.734 -26.940 116.155 1.00 0.00 ? 76  PHE A CA   5  
ATOM 8411  C C    . PHE A 1 76  ? -255.096 -25.903 115.238 1.00 0.00 ? 76  PHE A C    5  
ATOM 8412  O O    . PHE A 1 76  ? -253.876 -25.867 115.073 1.00 0.00 ? 76  PHE A O    5  
ATOM 8413  C CB   . PHE A 1 76  ? -255.347 -26.693 117.623 1.00 0.00 ? 76  PHE A CB   5  
ATOM 8414  C CG   . PHE A 1 76  ? -253.887 -26.907 117.926 1.00 0.00 ? 76  PHE A CG   5  
ATOM 8415  C CD1  . PHE A 1 76  ? -253.392 -28.181 118.161 1.00 0.00 ? 76  PHE A CD1  5  
ATOM 8416  C CD2  . PHE A 1 76  ? -253.011 -25.835 117.977 1.00 0.00 ? 76  PHE A CD2  5  
ATOM 8417  C CE1  . PHE A 1 76  ? -252.053 -28.378 118.438 1.00 0.00 ? 76  PHE A CE1  5  
ATOM 8418  C CE2  . PHE A 1 76  ? -251.673 -26.028 118.254 1.00 0.00 ? 76  PHE A CE2  5  
ATOM 8419  C CZ   . PHE A 1 76  ? -251.192 -27.301 118.483 1.00 0.00 ? 76  PHE A CZ   5  
ATOM 8420  H H    . PHE A 1 76  ? -254.434 -28.577 115.884 1.00 0.00 ? 76  PHE A H    5  
ATOM 8421  H HA   . PHE A 1 76  ? -256.807 -26.863 116.060 1.00 0.00 ? 76  PHE A HA   5  
ATOM 8422  H HB2  . PHE A 1 76  ? -255.589 -25.672 117.881 1.00 0.00 ? 76  PHE A HB2  5  
ATOM 8423  H HB3  . PHE A 1 76  ? -255.919 -27.359 118.253 1.00 0.00 ? 76  PHE A HB3  5  
ATOM 8424  H HD1  . PHE A 1 76  ? -254.065 -29.027 118.124 1.00 0.00 ? 76  PHE A HD1  5  
ATOM 8425  H HD2  . PHE A 1 76  ? -253.383 -24.836 117.798 1.00 0.00 ? 76  PHE A HD2  5  
ATOM 8426  H HE1  . PHE A 1 76  ? -251.680 -29.374 118.619 1.00 0.00 ? 76  PHE A HE1  5  
ATOM 8427  H HE2  . PHE A 1 76  ? -251.002 -25.183 118.287 1.00 0.00 ? 76  PHE A HE2  5  
ATOM 8428  H HZ   . PHE A 1 76  ? -250.147 -27.455 118.700 1.00 0.00 ? 76  PHE A HZ   5  
ATOM 8429  N N    . GLN A 1 77  ? -255.929 -25.088 114.612 1.00 0.00 ? 77  GLN A N    5  
ATOM 8430  C CA   . GLN A 1 77  ? -255.437 -24.017 113.763 1.00 0.00 ? 77  GLN A CA   5  
ATOM 8431  C C    . GLN A 1 77  ? -255.200 -22.788 114.626 1.00 0.00 ? 77  GLN A C    5  
ATOM 8432  O O    . GLN A 1 77  ? -256.139 -22.247 115.220 1.00 0.00 ? 77  GLN A O    5  
ATOM 8433  C CB   . GLN A 1 77  ? -256.445 -23.699 112.650 1.00 0.00 ? 77  GLN A CB   5  
ATOM 8434  C CG   . GLN A 1 77  ? -257.064 -24.934 112.010 1.00 0.00 ? 77  GLN A CG   5  
ATOM 8435  C CD   . GLN A 1 77  ? -256.055 -25.829 111.311 1.00 0.00 ? 77  GLN A CD   5  
ATOM 8436  O OE1  . GLN A 1 77  ? -255.461 -26.714 111.927 1.00 0.00 ? 77  GLN A OE1  5  
ATOM 8437  N NE2  . GLN A 1 77  ? -255.859 -25.618 110.019 1.00 0.00 ? 77  GLN A NE2  5  
ATOM 8438  H H    . GLN A 1 77  ? -256.895 -25.208 114.725 1.00 0.00 ? 77  GLN A H    5  
ATOM 8439  H HA   . GLN A 1 77  ? -254.502 -24.333 113.327 1.00 0.00 ? 77  GLN A HA   5  
ATOM 8440  H HB2  . GLN A 1 77  ? -257.240 -23.096 113.062 1.00 0.00 ? 77  GLN A HB2  5  
ATOM 8441  H HB3  . GLN A 1 77  ? -255.943 -23.136 111.878 1.00 0.00 ? 77  GLN A HB3  5  
ATOM 8442  H HG2  . GLN A 1 77  ? -257.551 -25.511 112.781 1.00 0.00 ? 77  GLN A HG2  5  
ATOM 8443  H HG3  . GLN A 1 77  ? -257.801 -24.615 111.287 1.00 0.00 ? 77  GLN A HG3  5  
ATOM 8444  H HE21 . GLN A 1 77  ? -256.363 -24.892 109.576 1.00 0.00 ? 77  GLN A HE21 5  
ATOM 8445  H HE22 . GLN A 1 77  ? -255.240 -26.211 109.543 1.00 0.00 ? 77  GLN A HE22 5  
ATOM 8446  N N    . ARG A 1 78  ? -253.955 -22.350 114.716 1.00 0.00 ? 78  ARG A N    5  
ATOM 8447  C CA   . ARG A 1 78  ? -253.619 -21.266 115.623 1.00 0.00 ? 78  ARG A CA   5  
ATOM 8448  C C    . ARG A 1 78  ? -253.315 -19.978 114.874 1.00 0.00 ? 78  ARG A C    5  
ATOM 8449  O O    . ARG A 1 78  ? -252.813 -19.996 113.747 1.00 0.00 ? 78  ARG A O    5  
ATOM 8450  C CB   . ARG A 1 78  ? -252.443 -21.645 116.525 1.00 0.00 ? 78  ARG A CB   5  
ATOM 8451  C CG   . ARG A 1 78  ? -251.167 -21.982 115.780 1.00 0.00 ? 78  ARG A CG   5  
ATOM 8452  C CD   . ARG A 1 78  ? -250.030 -22.275 116.743 1.00 0.00 ? 78  ARG A CD   5  
ATOM 8453  N NE   . ARG A 1 78  ? -248.868 -22.821 116.055 1.00 0.00 ? 78  ARG A NE   5  
ATOM 8454  C CZ   . ARG A 1 78  ? -248.323 -23.995 116.344 1.00 0.00 ? 78  ARG A CZ   5  
ATOM 8455  N NH1  . ARG A 1 78  ? -248.743 -24.690 117.393 1.00 0.00 ? 78  ARG A NH1  5  
ATOM 8456  N NH2  . ARG A 1 78  ? -247.334 -24.464 115.597 1.00 0.00 ? 78  ARG A NH2  5  
ATOM 8457  H H    . ARG A 1 78  ? -253.259 -22.752 114.157 1.00 0.00 ? 78  ARG A H    5  
ATOM 8458  H HA   . ARG A 1 78  ? -254.485 -21.096 116.247 1.00 0.00 ? 78  ARG A HA   5  
ATOM 8459  H HB2  . ARG A 1 78  ? -252.234 -20.817 117.187 1.00 0.00 ? 78  ARG A HB2  5  
ATOM 8460  H HB3  . ARG A 1 78  ? -252.725 -22.503 117.118 1.00 0.00 ? 78  ARG A HB3  5  
ATOM 8461  H HG2  . ARG A 1 78  ? -251.340 -22.854 115.166 1.00 0.00 ? 78  ARG A HG2  5  
ATOM 8462  H HG3  . ARG A 1 78  ? -250.895 -21.146 115.156 1.00 0.00 ? 78  ARG A HG3  5  
ATOM 8463  H HD2  . ARG A 1 78  ? -249.746 -21.356 117.233 1.00 0.00 ? 78  ARG A HD2  5  
ATOM 8464  H HD3  . ARG A 1 78  ? -250.370 -22.986 117.479 1.00 0.00 ? 78  ARG A HD3  5  
ATOM 8465  H HE   . ARG A 1 78  ? -248.488 -22.294 115.301 1.00 0.00 ? 78  ARG A HE   5  
ATOM 8466  H HH11 . ARG A 1 78  ? -249.475 -24.328 117.979 1.00 0.00 ? 78  ARG A HH11 5  
ATOM 8467  H HH12 . ARG A 1 78  ? -248.337 -25.594 117.595 1.00 0.00 ? 78  ARG A HH12 5  
ATOM 8468  H HH21 . ARG A 1 78  ? -246.998 -23.926 114.808 1.00 0.00 ? 78  ARG A HH21 5  
ATOM 8469  H HH22 . ARG A 1 78  ? -246.931 -25.359 115.798 1.00 0.00 ? 78  ARG A HH22 5  
ATOM 8470  N N    . ALA A 1 79  ? -253.623 -18.867 115.521 1.00 0.00 ? 79  ALA A N    5  
ATOM 8471  C CA   . ALA A 1 79  ? -253.432 -17.556 114.943 1.00 0.00 ? 79  ALA A CA   5  
ATOM 8472  C C    . ALA A 1 79  ? -252.049 -17.007 115.307 1.00 0.00 ? 79  ALA A C    5  
ATOM 8473  O O    . ALA A 1 79  ? -251.544 -17.244 116.404 1.00 0.00 ? 79  ALA A O    5  
ATOM 8474  C CB   . ALA A 1 79  ? -254.521 -16.610 115.421 1.00 0.00 ? 79  ALA A CB   5  
ATOM 8475  H H    . ALA A 1 79  ? -253.986 -18.935 116.436 1.00 0.00 ? 79  ALA A H    5  
ATOM 8476  H HA   . ALA A 1 79  ? -253.519 -17.658 113.857 1.00 0.00 ? 79  ALA A HA   5  
ATOM 8477  H HB1  . ALA A 1 79  ? -254.451 -16.495 116.494 1.00 0.00 ? 79  ALA A HB1  5  
ATOM 8478  H HB2  . ALA A 1 79  ? -255.488 -17.017 115.165 1.00 0.00 ? 79  ALA A HB2  5  
ATOM 8479  H HB3  . ALA A 1 79  ? -254.398 -15.648 114.945 1.00 0.00 ? 79  ALA A HB3  5  
ATOM 8480  N N    . ILE A 1 80  ? -251.447 -16.303 114.371 1.00 0.00 ? 80  ILE A N    5  
ATOM 8481  C CA   . ILE A 1 80  ? -250.131 -15.702 114.545 1.00 0.00 ? 80  ILE A CA   5  
ATOM 8482  C C    . ILE A 1 80  ? -250.214 -14.320 115.174 1.00 0.00 ? 80  ILE A C    5  
ATOM 8483  O O    . ILE A 1 80  ? -250.913 -13.433 114.680 1.00 0.00 ? 80  ILE A O    5  
ATOM 8484  C CB   . ILE A 1 80  ? -249.379 -15.608 113.201 1.00 0.00 ? 80  ILE A CB   5  
ATOM 8485  C CG1  . ILE A 1 80  ? -248.835 -16.981 112.813 1.00 0.00 ? 80  ILE A CG1  5  
ATOM 8486  C CG2  . ILE A 1 80  ? -248.254 -14.589 113.269 1.00 0.00 ? 80  ILE A CG2  5  
ATOM 8487  C CD1  . ILE A 1 80  ? -247.833 -17.514 113.810 1.00 0.00 ? 80  ILE A CD1  5  
ATOM 8488  H H    . ILE A 1 80  ? -251.912 -16.167 113.519 1.00 0.00 ? 80  ILE A H    5  
ATOM 8489  H HA   . ILE A 1 80  ? -249.554 -16.335 115.183 1.00 0.00 ? 80  ILE A HA   5  
ATOM 8490  H HB   . ILE A 1 80  ? -250.079 -15.283 112.445 1.00 0.00 ? 80  ILE A HB   5  
ATOM 8491  H HG12 . ILE A 1 80  ? -249.652 -17.684 112.755 1.00 0.00 ? 80  ILE A HG12 5  
ATOM 8492  H HG13 . ILE A 1 80  ? -248.348 -16.914 111.853 1.00 0.00 ? 80  ILE A HG13 5  
ATOM 8493  H HG21 . ILE A 1 80  ? -248.657 -13.626 113.550 1.00 0.00 ? 80  ILE A HG21 5  
ATOM 8494  H HG22 . ILE A 1 80  ? -247.528 -14.904 114.005 1.00 0.00 ? 80  ILE A HG22 5  
ATOM 8495  H HG23 . ILE A 1 80  ? -247.776 -14.510 112.304 1.00 0.00 ? 80  ILE A HG23 5  
ATOM 8496  H HD11 . ILE A 1 80  ? -248.304 -17.587 114.778 1.00 0.00 ? 80  ILE A HD11 5  
ATOM 8497  H HD12 . ILE A 1 80  ? -247.494 -18.490 113.494 1.00 0.00 ? 80  ILE A HD12 5  
ATOM 8498  H HD13 . ILE A 1 80  ? -246.993 -16.835 113.868 1.00 0.00 ? 80  ILE A HD13 5  
ATOM 8499  N N    . GLY A 1 81  ? -249.503 -14.158 116.278 1.00 0.00 ? 81  GLY A N    5  
ATOM 8500  C CA   . GLY A 1 81  ? -249.315 -12.850 116.857 1.00 0.00 ? 81  GLY A CA   5  
ATOM 8501  C C    . GLY A 1 81  ? -247.899 -12.370 116.627 1.00 0.00 ? 81  GLY A C    5  
ATOM 8502  O O    . GLY A 1 81  ? -247.015 -13.184 116.378 1.00 0.00 ? 81  GLY A O    5  
ATOM 8503  H H    . GLY A 1 81  ? -249.094 -14.941 116.702 1.00 0.00 ? 81  GLY A H    5  
ATOM 8504  H HA2  . GLY A 1 81  ? -250.009 -12.154 116.407 1.00 0.00 ? 81  GLY A HA2  5  
ATOM 8505  H HA3  . GLY A 1 81  ? -249.502 -12.902 117.919 1.00 0.00 ? 81  GLY A HA3  5  
ATOM 8506  N N    . PRO A 1 82  ? -247.648 -11.056 116.696 1.00 0.00 ? 82  PRO A N    5  
ATOM 8507  C CA   . PRO A 1 82  ? -246.323 -10.484 116.470 1.00 0.00 ? 82  PRO A CA   5  
ATOM 8508  C C    . PRO A 1 82  ? -245.253 -11.068 117.386 1.00 0.00 ? 82  PRO A C    5  
ATOM 8509  O O    . PRO A 1 82  ? -244.088 -11.180 117.001 1.00 0.00 ? 82  PRO A O    5  
ATOM 8510  C CB   . PRO A 1 82  ? -246.527 -8.995  116.750 1.00 0.00 ? 82  PRO A CB   5  
ATOM 8511  C CG   . PRO A 1 82  ? -247.966 -8.777  116.486 1.00 0.00 ? 82  PRO A CG   5  
ATOM 8512  C CD   . PRO A 1 82  ? -248.629 -10.018 116.995 1.00 0.00 ? 82  PRO A CD   5  
ATOM 8513  H HA   . PRO A 1 82  ? -246.027 -10.614 115.460 1.00 0.00 ? 82  PRO A HA   5  
ATOM 8514  H HB2  . PRO A 1 82  ? -246.274 -8.779  117.778 1.00 0.00 ? 82  PRO A HB2  5  
ATOM 8515  H HB3  . PRO A 1 82  ? -245.908 -8.412  116.087 1.00 0.00 ? 82  PRO A HB3  5  
ATOM 8516  H HG2  . PRO A 1 82  ? -248.315 -7.910  117.026 1.00 0.00 ? 82  PRO A HG2  5  
ATOM 8517  H HG3  . PRO A 1 82  ? -248.140 -8.662  115.426 1.00 0.00 ? 82  PRO A HG3  5  
ATOM 8518  H HD2  . PRO A 1 82  ? -248.768 -9.947  118.046 1.00 0.00 ? 82  PRO A HD2  5  
ATOM 8519  H HD3  . PRO A 1 82  ? -249.562 -10.197 116.485 1.00 0.00 ? 82  PRO A HD3  5  
ATOM 8520  N N    . GLU A 1 83  ? -245.665 -11.435 118.590 1.00 0.00 ? 83  GLU A N    5  
ATOM 8521  C CA   . GLU A 1 83  ? -244.779 -12.051 119.561 1.00 0.00 ? 83  GLU A CA   5  
ATOM 8522  C C    . GLU A 1 83  ? -244.298 -13.416 119.078 1.00 0.00 ? 83  GLU A C    5  
ATOM 8523  O O    . GLU A 1 83  ? -243.111 -13.741 119.156 1.00 0.00 ? 83  GLU A O    5  
ATOM 8524  C CB   . GLU A 1 83  ? -245.515 -12.200 120.875 1.00 0.00 ? 83  GLU A CB   5  
ATOM 8525  C CG   . GLU A 1 83  ? -246.027 -10.880 121.403 1.00 0.00 ? 83  GLU A CG   5  
ATOM 8526  C CD   . GLU A 1 83  ? -244.944 -9.828  121.519 1.00 0.00 ? 83  GLU A CD   5  
ATOM 8527  O OE1  . GLU A 1 83  ? -244.121 -9.918  122.453 1.00 0.00 ? 83  GLU A OE1  5  
ATOM 8528  O OE2  . GLU A 1 83  ? -244.928 -8.899  120.691 1.00 0.00 ? 83  GLU A OE2  5  
ATOM 8529  H H    . GLU A 1 83  ? -246.595 -11.277 118.841 1.00 0.00 ? 83  GLU A H    5  
ATOM 8530  H HA   . GLU A 1 83  ? -243.937 -11.399 119.712 1.00 0.00 ? 83  GLU A HA   5  
ATOM 8531  H HB2  . GLU A 1 83  ? -246.356 -12.862 120.732 1.00 0.00 ? 83  GLU A HB2  5  
ATOM 8532  H HB3  . GLU A 1 83  ? -244.848 -12.624 121.603 1.00 0.00 ? 83  GLU A HB3  5  
ATOM 8533  H HG2  . GLU A 1 83  ? -246.795 -10.513 120.740 1.00 0.00 ? 83  GLU A HG2  5  
ATOM 8534  H HG3  . GLU A 1 83  ? -246.443 -11.047 122.371 1.00 0.00 ? 83  GLU A HG3  5  
ATOM 8535  N N    . GLU A 1 84  ? -245.240 -14.210 118.587 1.00 0.00 ? 84  GLU A N    5  
ATOM 8536  C CA   . GLU A 1 84  ? -244.947 -15.531 118.049 1.00 0.00 ? 84  GLU A CA   5  
ATOM 8537  C C    . GLU A 1 84  ? -244.311 -15.409 116.668 1.00 0.00 ? 84  GLU A C    5  
ATOM 8538  O O    . GLU A 1 84  ? -245.000 -15.214 115.665 1.00 0.00 ? 84  GLU A O    5  
ATOM 8539  C CB   . GLU A 1 84  ? -246.234 -16.357 117.980 1.00 0.00 ? 84  GLU A CB   5  
ATOM 8540  C CG   . GLU A 1 84  ? -246.913 -16.518 119.330 1.00 0.00 ? 84  GLU A CG   5  
ATOM 8541  C CD   . GLU A 1 84  ? -248.295 -17.132 119.229 1.00 0.00 ? 84  GLU A CD   5  
ATOM 8542  O OE1  . GLU A 1 84  ? -248.399 -18.338 118.925 1.00 0.00 ? 84  GLU A OE1  5  
ATOM 8543  O OE2  . GLU A 1 84  ? -249.284 -16.404 119.459 1.00 0.00 ? 84  GLU A OE2  5  
ATOM 8544  H H    . GLU A 1 84  ? -246.163 -13.895 118.581 1.00 0.00 ? 84  GLU A H    5  
ATOM 8545  H HA   . GLU A 1 84  ? -244.249 -16.015 118.717 1.00 0.00 ? 84  GLU A HA   5  
ATOM 8546  H HB2  . GLU A 1 84  ? -246.926 -15.870 117.309 1.00 0.00 ? 84  GLU A HB2  5  
ATOM 8547  H HB3  . GLU A 1 84  ? -246.001 -17.340 117.598 1.00 0.00 ? 84  GLU A HB3  5  
ATOM 8548  H HG2  . GLU A 1 84  ? -246.302 -17.149 119.953 1.00 0.00 ? 84  GLU A HG2  5  
ATOM 8549  H HG3  . GLU A 1 84  ? -247.003 -15.544 119.790 1.00 0.00 ? 84  GLU A HG3  5  
ATOM 8550  N N    . GLU A 1 85  ? -242.992 -15.509 116.627 1.00 0.00 ? 85  GLU A N    5  
ATOM 8551  C CA   . GLU A 1 85  ? -242.255 -15.316 115.391 1.00 0.00 ? 85  GLU A CA   5  
ATOM 8552  C C    . GLU A 1 85  ? -242.301 -16.559 114.513 1.00 0.00 ? 85  GLU A C    5  
ATOM 8553  O O    . GLU A 1 85  ? -242.105 -17.684 114.981 1.00 0.00 ? 85  GLU A O    5  
ATOM 8554  C CB   . GLU A 1 85  ? -240.805 -14.944 115.688 1.00 0.00 ? 85  GLU A CB   5  
ATOM 8555  C CG   . GLU A 1 85  ? -240.663 -13.692 116.526 1.00 0.00 ? 85  GLU A CG   5  
ATOM 8556  C CD   . GLU A 1 85  ? -239.216 -13.382 116.853 1.00 0.00 ? 85  GLU A CD   5  
ATOM 8557  O OE1  . GLU A 1 85  ? -238.516 -12.800 115.994 1.00 0.00 ? 85  GLU A OE1  5  
ATOM 8558  O OE2  . GLU A 1 85  ? -238.769 -13.716 117.966 1.00 0.00 ? 85  GLU A OE2  5  
ATOM 8559  H H    . GLU A 1 85  ? -242.502 -15.720 117.450 1.00 0.00 ? 85  GLU A H    5  
ATOM 8560  H HA   . GLU A 1 85  ? -242.717 -14.499 114.859 1.00 0.00 ? 85  GLU A HA   5  
ATOM 8561  H HB2  . GLU A 1 85  ? -240.334 -15.762 116.216 1.00 0.00 ? 85  GLU A HB2  5  
ATOM 8562  H HB3  . GLU A 1 85  ? -240.287 -14.789 114.753 1.00 0.00 ? 85  GLU A HB3  5  
ATOM 8563  H HG2  . GLU A 1 85  ? -241.085 -12.859 115.980 1.00 0.00 ? 85  GLU A HG2  5  
ATOM 8564  H HG3  . GLU A 1 85  ? -241.207 -13.828 117.449 1.00 0.00 ? 85  GLU A HG3  5  
ATOM 8565  N N    . ILE A 1 86  ? -242.540 -16.342 113.229 1.00 0.00 ? 86  ILE A N    5  
ATOM 8566  C CA   . ILE A 1 86  ? -242.588 -17.427 112.258 1.00 0.00 ? 86  ILE A CA   5  
ATOM 8567  C C    . ILE A 1 86  ? -241.242 -18.130 112.159 1.00 0.00 ? 86  ILE A C    5  
ATOM 8568  O O    . ILE A 1 86  ? -241.173 -19.322 111.880 1.00 0.00 ? 86  ILE A O    5  
ATOM 8569  C CB   . ILE A 1 86  ? -242.996 -16.911 110.871 1.00 0.00 ? 86  ILE A CB   5  
ATOM 8570  C CG1  . ILE A 1 86  ? -241.979 -15.884 110.366 1.00 0.00 ? 86  ILE A CG1  5  
ATOM 8571  C CG2  . ILE A 1 86  ? -244.389 -16.311 110.939 1.00 0.00 ? 86  ILE A CG2  5  
ATOM 8572  C CD1  . ILE A 1 86  ? -242.310 -15.324 109.006 1.00 0.00 ? 86  ILE A CD1  5  
ATOM 8573  H H    . ILE A 1 86  ? -242.701 -15.427 112.925 1.00 0.00 ? 86  ILE A H    5  
ATOM 8574  H HA   . ILE A 1 86  ? -243.333 -18.139 112.588 1.00 0.00 ? 86  ILE A HA   5  
ATOM 8575  H HB   . ILE A 1 86  ? -243.023 -17.749 110.189 1.00 0.00 ? 86  ILE A HB   5  
ATOM 8576  H HG12 . ILE A 1 86  ? -241.934 -15.060 111.062 1.00 0.00 ? 86  ILE A HG12 5  
ATOM 8577  H HG13 . ILE A 1 86  ? -241.008 -16.350 110.305 1.00 0.00 ? 86  ILE A HG13 5  
ATOM 8578  H HG21 . ILE A 1 86  ? -244.390 -15.494 111.646 1.00 0.00 ? 86  ILE A HG21 5  
ATOM 8579  H HG22 . ILE A 1 86  ? -244.671 -15.945 109.964 1.00 0.00 ? 86  ILE A HG22 5  
ATOM 8580  H HG23 . ILE A 1 86  ? -245.089 -17.065 111.260 1.00 0.00 ? 86  ILE A HG23 5  
ATOM 8581  H HD11 . ILE A 1 86  ? -242.378 -16.131 108.291 1.00 0.00 ? 86  ILE A HD11 5  
ATOM 8582  H HD12 . ILE A 1 86  ? -243.255 -14.803 109.054 1.00 0.00 ? 86  ILE A HD12 5  
ATOM 8583  H HD13 . ILE A 1 86  ? -241.535 -14.636 108.702 1.00 0.00 ? 86  ILE A HD13 5  
ATOM 8584  N N    . MET A 1 87  ? -240.171 -17.388 112.411 1.00 0.00 ? 87  MET A N    5  
ATOM 8585  C CA   . MET A 1 87  ? -238.835 -17.956 112.386 1.00 0.00 ? 87  MET A CA   5  
ATOM 8586  C C    . MET A 1 87  ? -238.628 -18.906 113.554 1.00 0.00 ? 87  MET A C    5  
ATOM 8587  O O    . MET A 1 87  ? -237.755 -19.763 113.512 1.00 0.00 ? 87  MET A O    5  
ATOM 8588  C CB   . MET A 1 87  ? -237.767 -16.862 112.365 1.00 0.00 ? 87  MET A CB   5  
ATOM 8589  C CG   . MET A 1 87  ? -237.531 -16.306 110.973 1.00 0.00 ? 87  MET A CG   5  
ATOM 8590  S SD   . MET A 1 87  ? -236.987 -17.587 109.823 1.00 0.00 ? 87  MET A SD   5  
ATOM 8591  C CE   . MET A 1 87  ? -237.084 -16.717 108.263 1.00 0.00 ? 87  MET A CE   5  
ATOM 8592  H H    . MET A 1 87  ? -240.285 -16.436 112.611 1.00 0.00 ? 87  MET A H    5  
ATOM 8593  H HA   . MET A 1 87  ? -238.752 -18.530 111.475 1.00 0.00 ? 87  MET A HA   5  
ATOM 8594  H HB2  . MET A 1 87  ? -238.080 -16.051 113.008 1.00 0.00 ? 87  MET A HB2  5  
ATOM 8595  H HB3  . MET A 1 87  ? -236.837 -17.269 112.732 1.00 0.00 ? 87  MET A HB3  5  
ATOM 8596  H HG2  . MET A 1 87  ? -238.452 -15.876 110.606 1.00 0.00 ? 87  MET A HG2  5  
ATOM 8597  H HG3  . MET A 1 87  ? -236.771 -15.540 111.024 1.00 0.00 ? 87  MET A HG3  5  
ATOM 8598  H HE1  . MET A 1 87  ? -236.457 -15.841 108.299 1.00 0.00 ? 87  MET A HE1  5  
ATOM 8599  H HE2  . MET A 1 87  ? -236.751 -17.368 107.466 1.00 0.00 ? 87  MET A HE2  5  
ATOM 8600  H HE3  . MET A 1 87  ? -238.109 -16.422 108.080 1.00 0.00 ? 87  MET A HE3  5  
ATOM 8601  N N    . GLN A 1 88  ? -239.453 -18.774 114.586 1.00 0.00 ? 88  GLN A N    5  
ATOM 8602  C CA   . GLN A 1 88  ? -239.394 -19.702 115.704 1.00 0.00 ? 88  GLN A CA   5  
ATOM 8603  C C    . GLN A 1 88  ? -240.079 -20.985 115.282 1.00 0.00 ? 88  GLN A C    5  
ATOM 8604  O O    . GLN A 1 88  ? -239.627 -22.094 115.576 1.00 0.00 ? 88  GLN A O    5  
ATOM 8605  C CB   . GLN A 1 88  ? -240.081 -19.123 116.938 1.00 0.00 ? 88  GLN A CB   5  
ATOM 8606  C CG   . GLN A 1 88  ? -239.516 -17.784 117.365 1.00 0.00 ? 88  GLN A CG   5  
ATOM 8607  C CD   . GLN A 1 88  ? -240.319 -17.134 118.475 1.00 0.00 ? 88  GLN A CD   5  
ATOM 8608  O OE1  . GLN A 1 88  ? -241.524 -17.346 118.594 1.00 0.00 ? 88  GLN A OE1  5  
ATOM 8609  N NE2  . GLN A 1 88  ? -239.665 -16.316 119.282 1.00 0.00 ? 88  GLN A NE2  5  
ATOM 8610  H H    . GLN A 1 88  ? -240.146 -18.070 114.572 1.00 0.00 ? 88  GLN A H    5  
ATOM 8611  H HA   . GLN A 1 88  ? -238.358 -19.901 115.926 1.00 0.00 ? 88  GLN A HA   5  
ATOM 8612  H HB2  . GLN A 1 88  ? -241.132 -18.996 116.727 1.00 0.00 ? 88  GLN A HB2  5  
ATOM 8613  H HB3  . GLN A 1 88  ? -239.967 -19.816 117.759 1.00 0.00 ? 88  GLN A HB3  5  
ATOM 8614  H HG2  . GLN A 1 88  ? -238.503 -17.930 117.709 1.00 0.00 ? 88  GLN A HG2  5  
ATOM 8615  H HG3  . GLN A 1 88  ? -239.512 -17.132 116.507 1.00 0.00 ? 88  GLN A HG3  5  
ATOM 8616  H HE21 . GLN A 1 88  ? -238.708 -16.172 119.123 1.00 0.00 ? 88  GLN A HE21 5  
ATOM 8617  H HE22 . GLN A 1 88  ? -240.165 -15.884 120.005 1.00 0.00 ? 88  GLN A HE22 5  
ATOM 8618  N N    . ILE A 1 89  ? -241.172 -20.797 114.555 1.00 0.00 ? 89  ILE A N    5  
ATOM 8619  C CA   . ILE A 1 89  ? -241.950 -21.889 113.996 1.00 0.00 ? 89  ILE A CA   5  
ATOM 8620  C C    . ILE A 1 89  ? -241.101 -22.723 113.036 1.00 0.00 ? 89  ILE A C    5  
ATOM 8621  O O    . ILE A 1 89  ? -241.006 -23.943 113.162 1.00 0.00 ? 89  ILE A O    5  
ATOM 8622  C CB   . ILE A 1 89  ? -243.154 -21.333 113.227 1.00 0.00 ? 89  ILE A CB   5  
ATOM 8623  C CG1  . ILE A 1 89  ? -243.873 -20.290 114.080 1.00 0.00 ? 89  ILE A CG1  5  
ATOM 8624  C CG2  . ILE A 1 89  ? -244.104 -22.454 112.829 1.00 0.00 ? 89  ILE A CG2  5  
ATOM 8625  C CD1  . ILE A 1 89  ? -244.315 -20.781 115.443 1.00 0.00 ? 89  ILE A CD1  5  
ATOM 8626  H H    . ILE A 1 89  ? -241.476 -19.874 114.400 1.00 0.00 ? 89  ILE A H    5  
ATOM 8627  H HA   . ILE A 1 89  ? -242.319 -22.498 114.799 1.00 0.00 ? 89  ILE A HA   5  
ATOM 8628  H HB   . ILE A 1 89  ? -242.791 -20.861 112.323 1.00 0.00 ? 89  ILE A HB   5  
ATOM 8629  H HG12 . ILE A 1 89  ? -243.217 -19.448 114.233 1.00 0.00 ? 89  ILE A HG12 5  
ATOM 8630  H HG13 . ILE A 1 89  ? -244.737 -19.964 113.555 1.00 0.00 ? 89  ILE A HG13 5  
ATOM 8631  H HG21 . ILE A 1 89  ? -244.434 -22.977 113.715 1.00 0.00 ? 89  ILE A HG21 5  
ATOM 8632  H HG22 . ILE A 1 89  ? -244.961 -22.039 112.318 1.00 0.00 ? 89  ILE A HG22 5  
ATOM 8633  H HG23 . ILE A 1 89  ? -243.593 -23.144 112.174 1.00 0.00 ? 89  ILE A HG23 5  
ATOM 8634  H HD11 . ILE A 1 89  ? -244.931 -21.660 115.328 1.00 0.00 ? 89  ILE A HD11 5  
ATOM 8635  H HD12 . ILE A 1 89  ? -243.448 -21.025 116.039 1.00 0.00 ? 89  ILE A HD12 5  
ATOM 8636  H HD13 . ILE A 1 89  ? -244.884 -20.005 115.937 1.00 0.00 ? 89  ILE A HD13 5  
ATOM 8637  N N    . LEU A 1 90  ? -240.460 -22.029 112.102 1.00 0.00 ? 90  LEU A N    5  
ATOM 8638  C CA   . LEU A 1 90  ? -239.666 -22.660 111.057 1.00 0.00 ? 90  LEU A CA   5  
ATOM 8639  C C    . LEU A 1 90  ? -238.421 -23.338 111.624 1.00 0.00 ? 90  LEU A C    5  
ATOM 8640  O O    . LEU A 1 90  ? -238.062 -24.436 111.203 1.00 0.00 ? 90  LEU A O    5  
ATOM 8641  C CB   . LEU A 1 90  ? -239.268 -21.608 110.020 1.00 0.00 ? 90  LEU A CB   5  
ATOM 8642  C CG   . LEU A 1 90  ? -240.442 -20.954 109.287 1.00 0.00 ? 90  LEU A CG   5  
ATOM 8643  C CD1  . LEU A 1 90  ? -240.040 -19.604 108.725 1.00 0.00 ? 90  LEU A CD1  5  
ATOM 8644  C CD2  . LEU A 1 90  ? -240.947 -21.853 108.171 1.00 0.00 ? 90  LEU A CD2  5  
ATOM 8645  H H    . LEU A 1 90  ? -240.538 -21.049 112.108 1.00 0.00 ? 90  LEU A H    5  
ATOM 8646  H HA   . LEU A 1 90  ? -240.281 -23.406 110.578 1.00 0.00 ? 90  LEU A HA   5  
ATOM 8647  H HB2  . LEU A 1 90  ? -238.706 -20.834 110.523 1.00 0.00 ? 90  LEU A HB2  5  
ATOM 8648  H HB3  . LEU A 1 90  ? -238.629 -22.075 109.287 1.00 0.00 ? 90  LEU A HB3  5  
ATOM 8649  H HG   . LEU A 1 90  ? -241.252 -20.797 109.984 1.00 0.00 ? 90  LEU A HG   5  
ATOM 8650  H HD11 . LEU A 1 90  ? -239.211 -19.729 108.044 1.00 0.00 ? 90  LEU A HD11 5  
ATOM 8651  H HD12 . LEU A 1 90  ? -240.877 -19.171 108.202 1.00 0.00 ? 90  LEU A HD12 5  
ATOM 8652  H HD13 . LEU A 1 90  ? -239.747 -18.954 109.536 1.00 0.00 ? 90  LEU A HD13 5  
ATOM 8653  H HD21 . LEU A 1 90  ? -240.140 -22.061 107.482 1.00 0.00 ? 90  LEU A HD21 5  
ATOM 8654  H HD22 . LEU A 1 90  ? -241.309 -22.780 108.591 1.00 0.00 ? 90  LEU A HD22 5  
ATOM 8655  H HD23 . LEU A 1 90  ? -241.750 -21.358 107.643 1.00 0.00 ? 90  LEU A HD23 5  
ATOM 8656  N N    . SER A 1 91  ? -237.769 -22.689 112.581 1.00 0.00 ? 91  SER A N    5  
ATOM 8657  C CA   . SER A 1 91  ? -236.549 -23.231 113.172 1.00 0.00 ? 91  SER A CA   5  
ATOM 8658  C C    . SER A 1 91  ? -236.830 -24.498 113.975 1.00 0.00 ? 91  SER A C    5  
ATOM 8659  O O    . SER A 1 91  ? -235.932 -25.317 114.178 1.00 0.00 ? 91  SER A O    5  
ATOM 8660  C CB   . SER A 1 91  ? -235.865 -22.188 114.054 1.00 0.00 ? 91  SER A CB   5  
ATOM 8661  O OG   . SER A 1 91  ? -235.489 -21.051 113.294 1.00 0.00 ? 91  SER A OG   5  
ATOM 8662  H H    . SER A 1 91  ? -238.108 -21.822 112.890 1.00 0.00 ? 91  SER A H    5  
ATOM 8663  H HA   . SER A 1 91  ? -235.885 -23.483 112.361 1.00 0.00 ? 91  SER A HA   5  
ATOM 8664  H HB2  . SER A 1 91  ? -236.544 -21.879 114.834 1.00 0.00 ? 91  SER A HB2  5  
ATOM 8665  H HB3  . SER A 1 91  ? -234.978 -22.619 114.496 1.00 0.00 ? 91  SER A HB3  5  
ATOM 8666  H HG   . SER A 1 91  ? -236.185 -20.382 113.361 1.00 0.00 ? 91  SER A HG   5  
ATOM 8667  N N    . SER A 1 92  ? -238.069 -24.656 114.429 1.00 0.00 ? 92  SER A N    5  
ATOM 8668  C CA   . SER A 1 92  ? -238.470 -25.862 115.142 1.00 0.00 ? 92  SER A CA   5  
ATOM 8669  C C    . SER A 1 92  ? -238.297 -27.080 114.243 1.00 0.00 ? 92  SER A C    5  
ATOM 8670  O O    . SER A 1 92  ? -237.710 -28.083 114.656 1.00 0.00 ? 92  SER A O    5  
ATOM 8671  C CB   . SER A 1 92  ? -239.917 -25.744 115.615 1.00 0.00 ? 92  SER A CB   5  
ATOM 8672  O OG   . SER A 1 92  ? -240.064 -24.662 116.518 1.00 0.00 ? 92  SER A OG   5  
ATOM 8673  H H    . SER A 1 92  ? -238.731 -23.950 114.273 1.00 0.00 ? 92  SER A H    5  
ATOM 8674  H HA   . SER A 1 92  ? -237.825 -25.971 116.001 1.00 0.00 ? 92  SER A HA   5  
ATOM 8675  H HB2  . SER A 1 92  ? -240.559 -25.577 114.763 1.00 0.00 ? 92  SER A HB2  5  
ATOM 8676  H HB3  . SER A 1 92  ? -240.209 -26.658 116.114 1.00 0.00 ? 92  SER A HB3  5  
ATOM 8677  H HG   . SER A 1 92  ? -239.959 -23.826 116.044 1.00 0.00 ? 92  SER A HG   5  
ATOM 8678  N N    . TRP A 1 93  ? -238.802 -26.957 113.010 1.00 0.00 ? 93  TRP A N    5  
ATOM 8679  C CA   . TRP A 1 93  ? -238.629 -27.962 111.955 1.00 0.00 ? 93  TRP A CA   5  
ATOM 8680  C C    . TRP A 1 93  ? -239.412 -29.247 112.245 1.00 0.00 ? 93  TRP A C    5  
ATOM 8681  O O    . TRP A 1 93  ? -240.252 -29.661 111.446 1.00 0.00 ? 93  TRP A O    5  
ATOM 8682  C CB   . TRP A 1 93  ? -237.143 -28.276 111.747 1.00 0.00 ? 93  TRP A CB   5  
ATOM 8683  C CG   . TRP A 1 93  ? -236.846 -28.920 110.426 1.00 0.00 ? 93  TRP A CG   5  
ATOM 8684  C CD1  . TRP A 1 93  ? -236.834 -30.253 110.143 1.00 0.00 ? 93  TRP A CD1  5  
ATOM 8685  C CD2  . TRP A 1 93  ? -236.523 -28.247 109.203 1.00 0.00 ? 93  TRP A CD2  5  
ATOM 8686  N NE1  . TRP A 1 93  ? -236.520 -30.451 108.821 1.00 0.00 ? 93  TRP A NE1  5  
ATOM 8687  C CE2  . TRP A 1 93  ? -236.325 -29.235 108.223 1.00 0.00 ? 93  TRP A CE2  5  
ATOM 8688  C CE3  . TRP A 1 93  ? -236.386 -26.903 108.843 1.00 0.00 ? 93  TRP A CE3  5  
ATOM 8689  C CZ2  . TRP A 1 93  ? -235.994 -28.923 106.907 1.00 0.00 ? 93  TRP A CZ2  5  
ATOM 8690  C CZ3  . TRP A 1 93  ? -236.052 -26.595 107.537 1.00 0.00 ? 93  TRP A CZ3  5  
ATOM 8691  C CH2  . TRP A 1 93  ? -235.862 -27.603 106.582 1.00 0.00 ? 93  TRP A CH2  5  
ATOM 8692  H H    . TRP A 1 93  ? -239.313 -26.148 112.795 1.00 0.00 ? 93  TRP A H    5  
ATOM 8693  H HA   . TRP A 1 93  ? -239.016 -27.534 111.042 1.00 0.00 ? 93  TRP A HA   5  
ATOM 8694  H HB2  . TRP A 1 93  ? -236.577 -27.360 111.805 1.00 0.00 ? 93  TRP A HB2  5  
ATOM 8695  H HB3  . TRP A 1 93  ? -236.812 -28.948 112.528 1.00 0.00 ? 93  TRP A HB3  5  
ATOM 8696  H HD1  . TRP A 1 93  ? -237.039 -31.031 110.865 1.00 0.00 ? 93  TRP A HD1  5  
ATOM 8697  H HE1  . TRP A 1 93  ? -236.446 -31.327 108.374 1.00 0.00 ? 93  TRP A HE1  5  
ATOM 8698  H HE3  . TRP A 1 93  ? -236.527 -26.116 109.566 1.00 0.00 ? 93  TRP A HE3  5  
ATOM 8699  H HZ2  . TRP A 1 93  ? -235.842 -29.689 106.158 1.00 0.00 ? 93  TRP A HZ2  5  
ATOM 8700  H HZ3  . TRP A 1 93  ? -235.939 -25.564 107.242 1.00 0.00 ? 93  TRP A HZ3  5  
ATOM 8701  H HH2  . TRP A 1 93  ? -235.602 -27.316 105.573 1.00 0.00 ? 93  TRP A HH2  5  
ATOM 8702  N N    . PHE A 1 94  ? -239.123 -29.871 113.380 1.00 0.00 ? 94  PHE A N    5  
ATOM 8703  C CA   . PHE A 1 94  ? -239.770 -31.117 113.769 1.00 0.00 ? 94  PHE A CA   5  
ATOM 8704  C C    . PHE A 1 94  ? -241.269 -30.919 113.958 1.00 0.00 ? 94  PHE A C    5  
ATOM 8705  O O    . PHE A 1 94  ? -241.704 -30.014 114.673 1.00 0.00 ? 94  PHE A O    5  
ATOM 8706  C CB   . PHE A 1 94  ? -239.139 -31.673 115.051 1.00 0.00 ? 94  PHE A CB   5  
ATOM 8707  C CG   . PHE A 1 94  ? -237.697 -32.069 114.884 1.00 0.00 ? 94  PHE A CG   5  
ATOM 8708  C CD1  . PHE A 1 94  ? -237.360 -33.340 114.444 1.00 0.00 ? 94  PHE A CD1  5  
ATOM 8709  C CD2  . PHE A 1 94  ? -236.681 -31.169 115.161 1.00 0.00 ? 94  PHE A CD2  5  
ATOM 8710  C CE1  . PHE A 1 94  ? -236.038 -33.705 114.283 1.00 0.00 ? 94  PHE A CE1  5  
ATOM 8711  C CE2  . PHE A 1 94  ? -235.357 -31.527 115.001 1.00 0.00 ? 94  PHE A CE2  5  
ATOM 8712  C CZ   . PHE A 1 94  ? -235.034 -32.797 114.563 1.00 0.00 ? 94  PHE A CZ   5  
ATOM 8713  H H    . PHE A 1 94  ? -238.453 -29.473 113.978 1.00 0.00 ? 94  PHE A H    5  
ATOM 8714  H HA   . PHE A 1 94  ? -239.613 -31.828 112.971 1.00 0.00 ? 94  PHE A HA   5  
ATOM 8715  H HB2  . PHE A 1 94  ? -239.190 -30.923 115.825 1.00 0.00 ? 94  PHE A HB2  5  
ATOM 8716  H HB3  . PHE A 1 94  ? -239.689 -32.548 115.366 1.00 0.00 ? 94  PHE A HB3  5  
ATOM 8717  H HD1  . PHE A 1 94  ? -238.143 -34.050 114.224 1.00 0.00 ? 94  PHE A HD1  5  
ATOM 8718  H HD2  . PHE A 1 94  ? -236.933 -30.176 115.506 1.00 0.00 ? 94  PHE A HD2  5  
ATOM 8719  H HE1  . PHE A 1 94  ? -235.788 -34.699 113.940 1.00 0.00 ? 94  PHE A HE1  5  
ATOM 8720  H HE2  . PHE A 1 94  ? -234.573 -30.816 115.219 1.00 0.00 ? 94  PHE A HE2  5  
ATOM 8721  H HZ   . PHE A 1 94  ? -233.997 -33.078 114.438 1.00 0.00 ? 94  PHE A HZ   5  
ATOM 8722  N N    . PRO A 1 95  ? -242.071 -31.772 113.309 1.00 0.00 ? 95  PRO A N    5  
ATOM 8723  C CA   . PRO A 1 95  ? -243.529 -31.656 113.318 1.00 0.00 ? 95  PRO A CA   5  
ATOM 8724  C C    . PRO A 1 95  ? -244.151 -31.930 114.687 1.00 0.00 ? 95  PRO A C    5  
ATOM 8725  O O    . PRO A 1 95  ? -243.760 -32.865 115.394 1.00 0.00 ? 95  PRO A O    5  
ATOM 8726  C CB   . PRO A 1 95  ? -243.977 -32.715 112.308 1.00 0.00 ? 95  PRO A CB   5  
ATOM 8727  C CG   . PRO A 1 95  ? -242.864 -33.700 112.256 1.00 0.00 ? 95  PRO A CG   5  
ATOM 8728  C CD   . PRO A 1 95  ? -241.608 -32.919 112.506 1.00 0.00 ? 95  PRO A CD   5  
ATOM 8729  H HA   . PRO A 1 95  ? -243.846 -30.682 112.976 1.00 0.00 ? 95  PRO A HA   5  
ATOM 8730  H HB2  . PRO A 1 95  ? -244.895 -33.172 112.647 1.00 0.00 ? 95  PRO A HB2  5  
ATOM 8731  H HB3  . PRO A 1 95  ? -244.135 -32.251 111.345 1.00 0.00 ? 95  PRO A HB3  5  
ATOM 8732  H HG2  . PRO A 1 95  ? -243.000 -34.449 113.024 1.00 0.00 ? 95  PRO A HG2  5  
ATOM 8733  H HG3  . PRO A 1 95  ? -242.830 -34.163 111.281 1.00 0.00 ? 95  PRO A HG3  5  
ATOM 8734  H HD2  . PRO A 1 95  ? -240.897 -33.517 113.060 1.00 0.00 ? 95  PRO A HD2  5  
ATOM 8735  H HD3  . PRO A 1 95  ? -241.176 -32.587 111.573 1.00 0.00 ? 95  PRO A HD3  5  
ATOM 8736  N N    . GLU A 1 96  ? -245.128 -31.103 115.045 1.00 0.00 ? 96  GLU A N    5  
ATOM 8737  C CA   . GLU A 1 96  ? -245.881 -31.272 116.286 1.00 0.00 ? 96  GLU A CA   5  
ATOM 8738  C C    . GLU A 1 96  ? -246.650 -32.588 116.259 1.00 0.00 ? 96  GLU A C    5  
ATOM 8739  O O    . GLU A 1 96  ? -246.799 -33.262 117.276 1.00 0.00 ? 96  GLU A O    5  
ATOM 8740  C CB   . GLU A 1 96  ? -246.859 -30.107 116.452 1.00 0.00 ? 96  GLU A CB   5  
ATOM 8741  C CG   . GLU A 1 96  ? -246.203 -28.742 116.331 1.00 0.00 ? 96  GLU A CG   5  
ATOM 8742  C CD   . GLU A 1 96  ? -247.211 -27.618 116.272 1.00 0.00 ? 96  GLU A CD   5  
ATOM 8743  O OE1  . GLU A 1 96  ? -247.672 -27.285 115.159 1.00 0.00 ? 96  GLU A OE1  5  
ATOM 8744  O OE2  . GLU A 1 96  ? -247.545 -27.058 117.336 1.00 0.00 ? 96  GLU A OE2  5  
ATOM 8745  H H    . GLU A 1 96  ? -245.342 -30.346 114.464 1.00 0.00 ? 96  GLU A H    5  
ATOM 8746  H HA   . GLU A 1 96  ? -245.187 -31.280 117.112 1.00 0.00 ? 96  GLU A HA   5  
ATOM 8747  H HB2  . GLU A 1 96  ? -247.624 -30.184 115.694 1.00 0.00 ? 96  GLU A HB2  5  
ATOM 8748  H HB3  . GLU A 1 96  ? -247.321 -30.175 117.427 1.00 0.00 ? 96  GLU A HB3  5  
ATOM 8749  H HG2  . GLU A 1 96  ? -245.562 -28.585 117.187 1.00 0.00 ? 96  GLU A HG2  5  
ATOM 8750  H HG3  . GLU A 1 96  ? -245.609 -28.722 115.429 1.00 0.00 ? 96  GLU A HG3  5  
ATOM 8751  N N    . GLU A 1 97  ? -247.127 -32.933 115.073 1.00 0.00 ? 97  GLU A N    5  
ATOM 8752  C CA   . GLU A 1 97  ? -247.858 -34.169 114.851 1.00 0.00 ? 97  GLU A CA   5  
ATOM 8753  C C    . GLU A 1 97  ? -247.612 -34.596 113.411 1.00 0.00 ? 97  GLU A C    5  
ATOM 8754  O O    . GLU A 1 97  ? -247.043 -35.654 113.142 1.00 0.00 ? 97  GLU A O    5  
ATOM 8755  C CB   . GLU A 1 97  ? -249.357 -33.949 115.110 1.00 0.00 ? 97  GLU A CB   5  
ATOM 8756  C CG   . GLU A 1 97  ? -250.160 -35.220 115.386 1.00 0.00 ? 97  GLU A CG   5  
ATOM 8757  C CD   . GLU A 1 97  ? -250.257 -36.151 114.192 1.00 0.00 ? 97  GLU A CD   5  
ATOM 8758  O OE1  . GLU A 1 97  ? -250.682 -35.697 113.112 1.00 0.00 ? 97  GLU A OE1  5  
ATOM 8759  O OE2  . GLU A 1 97  ? -249.925 -37.349 114.339 1.00 0.00 ? 97  GLU A OE2  5  
ATOM 8760  H H    . GLU A 1 97  ? -246.969 -32.339 114.314 1.00 0.00 ? 97  GLU A H    5  
ATOM 8761  H HA   . GLU A 1 97  ? -247.473 -34.923 115.522 1.00 0.00 ? 97  GLU A HA   5  
ATOM 8762  H HB2  . GLU A 1 97  ? -249.467 -33.297 115.962 1.00 0.00 ? 97  GLU A HB2  5  
ATOM 8763  H HB3  . GLU A 1 97  ? -249.787 -33.464 114.244 1.00 0.00 ? 97  GLU A HB3  5  
ATOM 8764  H HG2  . GLU A 1 97  ? -249.690 -35.756 116.198 1.00 0.00 ? 97  GLU A HG2  5  
ATOM 8765  H HG3  . GLU A 1 97  ? -251.159 -34.934 115.682 1.00 0.00 ? 97  GLU A HG3  5  
ATOM 8766  N N    . GLY A 1 98  ? -248.020 -33.733 112.494 1.00 0.00 ? 98  GLY A N    5  
ATOM 8767  C CA   . GLY A 1 98  ? -247.742 -33.937 111.094 1.00 0.00 ? 98  GLY A CA   5  
ATOM 8768  C C    . GLY A 1 98  ? -246.940 -32.787 110.525 1.00 0.00 ? 98  GLY A C    5  
ATOM 8769  O O    . GLY A 1 98  ? -246.822 -31.739 111.160 1.00 0.00 ? 98  GLY A O    5  
ATOM 8770  H H    . GLY A 1 98  ? -248.528 -32.946 112.776 1.00 0.00 ? 98  GLY A H    5  
ATOM 8771  H HA2  . GLY A 1 98  ? -247.183 -34.854 110.975 1.00 0.00 ? 98  GLY A HA2  5  
ATOM 8772  H HA3  . GLY A 1 98  ? -248.673 -34.020 110.555 1.00 0.00 ? 98  GLY A HA3  5  
ATOM 8773  N N    . TYR A 1 99  ? -246.407 -32.972 109.328 1.00 0.00 ? 99  TYR A N    5  
ATOM 8774  C CA   . TYR A 1 99  ? -245.552 -31.970 108.695 1.00 0.00 ? 99  TYR A CA   5  
ATOM 8775  C C    . TYR A 1 99  ? -246.371 -30.952 107.903 1.00 0.00 ? 99  TYR A C    5  
ATOM 8776  O O    . TYR A 1 99  ? -245.863 -30.297 106.993 1.00 0.00 ? 99  TYR A O    5  
ATOM 8777  C CB   . TYR A 1 99  ? -244.531 -32.662 107.786 1.00 0.00 ? 99  TYR A CB   5  
ATOM 8778  C CG   . TYR A 1 99  ? -245.111 -33.813 106.987 1.00 0.00 ? 99  TYR A CG   5  
ATOM 8779  C CD1  . TYR A 1 99  ? -245.793 -33.595 105.796 1.00 0.00 ? 99  TYR A CD1  5  
ATOM 8780  C CD2  . TYR A 1 99  ? -244.978 -35.121 107.436 1.00 0.00 ? 99  TYR A CD2  5  
ATOM 8781  C CE1  . TYR A 1 99  ? -246.327 -34.649 105.078 1.00 0.00 ? 99  TYR A CE1  5  
ATOM 8782  C CE2  . TYR A 1 99  ? -245.507 -36.177 106.722 1.00 0.00 ? 99  TYR A CE2  5  
ATOM 8783  C CZ   . TYR A 1 99  ? -246.181 -35.936 105.546 1.00 0.00 ? 99  TYR A CZ   5  
ATOM 8784  O OH   . TYR A 1 99  ? -246.710 -36.987 104.837 1.00 0.00 ? 99  TYR A OH   5  
ATOM 8785  H H    . TYR A 1 99  ? -246.598 -33.806 108.849 1.00 0.00 ? 99  TYR A H    5  
ATOM 8786  H HA   . TYR A 1 99  ? -245.024 -31.451 109.479 1.00 0.00 ? 99  TYR A HA   5  
ATOM 8787  H HB2  . TYR A 1 99  ? -244.133 -31.940 107.087 1.00 0.00 ? 99  TYR A HB2  5  
ATOM 8788  H HB3  . TYR A 1 99  ? -243.726 -33.049 108.394 1.00 0.00 ? 99  TYR A HB3  5  
ATOM 8789  H HD1  . TYR A 1 99  ? -245.906 -32.584 105.432 1.00 0.00 ? 99  TYR A HD1  5  
ATOM 8790  H HD2  . TYR A 1 99  ? -244.450 -35.308 108.358 1.00 0.00 ? 99  TYR A HD2  5  
ATOM 8791  H HE1  . TYR A 1 99  ? -246.855 -34.461 104.153 1.00 0.00 ? 99  TYR A HE1  5  
ATOM 8792  H HE2  . TYR A 1 99  ? -245.394 -37.188 107.091 1.00 0.00 ? 99  TYR A HE2  5  
ATOM 8793  H HH   . TYR A 1 99  ? -246.504 -36.875 103.896 1.00 0.00 ? 99  TYR A HH   5  
ATOM 8794  N N    . MET A 1 100 ? -247.633 -30.807 108.268 1.00 0.00 ? 100 MET A N    5  
ATOM 8795  C CA   . MET A 1 100 ? -248.526 -29.885 107.583 1.00 0.00 ? 100 MET A CA   5  
ATOM 8796  C C    . MET A 1 100 ? -248.641 -28.577 108.361 1.00 0.00 ? 100 MET A C    5  
ATOM 8797  O O    . MET A 1 100 ? -249.317 -28.512 109.388 1.00 0.00 ? 100 MET A O    5  
ATOM 8798  C CB   . MET A 1 100 ? -249.923 -30.497 107.409 1.00 0.00 ? 100 MET A CB   5  
ATOM 8799  C CG   . MET A 1 100 ? -249.935 -31.866 106.741 1.00 0.00 ? 100 MET A CG   5  
ATOM 8800  S SD   . MET A 1 100 ? -249.433 -33.197 107.855 1.00 0.00 ? 100 MET A SD   5  
ATOM 8801  C CE   . MET A 1 100 ? -250.721 -33.106 109.099 1.00 0.00 ? 100 MET A CE   5  
ATOM 8802  H H    . MET A 1 100 ? -247.974 -31.329 109.023 1.00 0.00 ? 100 MET A H    5  
ATOM 8803  H HA   . MET A 1 100 ? -248.108 -29.680 106.609 1.00 0.00 ? 100 MET A HA   5  
ATOM 8804  H HB2  . MET A 1 100 ? -250.380 -30.599 108.383 1.00 0.00 ? 100 MET A HB2  5  
ATOM 8805  H HB3  . MET A 1 100 ? -250.522 -29.826 106.812 1.00 0.00 ? 100 MET A HB3  5  
ATOM 8806  H HG2  . MET A 1 100 ? -250.934 -32.070 106.388 1.00 0.00 ? 100 MET A HG2  5  
ATOM 8807  H HG3  . MET A 1 100 ? -249.255 -31.846 105.901 1.00 0.00 ? 100 MET A HG3  5  
ATOM 8808  H HE1  . MET A 1 100 ? -250.738 -32.115 109.531 1.00 0.00 ? 100 MET A HE1  5  
ATOM 8809  H HE2  . MET A 1 100 ? -251.678 -33.313 108.642 1.00 0.00 ? 100 MET A HE2  5  
ATOM 8810  H HE3  . MET A 1 100 ? -250.526 -33.834 109.873 1.00 0.00 ? 100 MET A HE3  5  
ATOM 8811  N N    . GLY A 1 101 ? -247.962 -27.547 107.879 1.00 0.00 ? 101 GLY A N    5  
ATOM 8812  C CA   . GLY A 1 101 ? -248.036 -26.246 108.512 1.00 0.00 ? 101 GLY A CA   5  
ATOM 8813  C C    . GLY A 1 101 ? -247.627 -25.135 107.570 1.00 0.00 ? 101 GLY A C    5  
ATOM 8814  O O    . GLY A 1 101 ? -246.520 -25.144 107.038 1.00 0.00 ? 101 GLY A O    5  
ATOM 8815  H H    . GLY A 1 101 ? -247.393 -27.671 107.088 1.00 0.00 ? 101 GLY A H    5  
ATOM 8816  H HA2  . GLY A 1 101 ? -249.049 -26.071 108.837 1.00 0.00 ? 101 GLY A HA2  5  
ATOM 8817  H HA3  . GLY A 1 101 ? -247.382 -26.233 109.371 1.00 0.00 ? 101 GLY A HA3  5  
ATOM 8818  N N    . ARG A 1 102 ? -248.539 -24.202 107.326 1.00 0.00 ? 102 ARG A N    5  
ATOM 8819  C CA   . ARG A 1 102 ? -248.250 -23.052 106.476 1.00 0.00 ? 102 ARG A CA   5  
ATOM 8820  C C    . ARG A 1 102 ? -249.119 -21.863 106.859 1.00 0.00 ? 102 ARG A C    5  
ATOM 8821  O O    . ARG A 1 102 ? -250.104 -22.012 107.580 1.00 0.00 ? 102 ARG A O    5  
ATOM 8822  C CB   . ARG A 1 102 ? -248.402 -23.377 104.977 1.00 0.00 ? 102 ARG A CB   5  
ATOM 8823  C CG   . ARG A 1 102 ? -249.649 -24.170 104.587 1.00 0.00 ? 102 ARG A CG   5  
ATOM 8824  C CD   . ARG A 1 102 ? -249.484 -25.661 104.873 1.00 0.00 ? 102 ARG A CD   5  
ATOM 8825  N NE   . ARG A 1 102 ? -248.121 -26.125 104.590 1.00 0.00 ? 102 ARG A NE   5  
ATOM 8826  C CZ   . ARG A 1 102 ? -247.824 -27.271 103.974 1.00 0.00 ? 102 ARG A CZ   5  
ATOM 8827  N NH1  . ARG A 1 102 ? -248.791 -28.059 103.526 1.00 0.00 ? 102 ARG A NH1  5  
ATOM 8828  N NH2  . ARG A 1 102 ? -246.559 -27.626 103.798 1.00 0.00 ? 102 ARG A NH2  5  
ATOM 8829  H H    . ARG A 1 102 ? -249.429 -24.281 107.733 1.00 0.00 ? 102 ARG A H    5  
ATOM 8830  H HA   . ARG A 1 102 ? -247.221 -22.780 106.659 1.00 0.00 ? 102 ARG A HA   5  
ATOM 8831  H HB2  . ARG A 1 102 ? -248.422 -22.448 104.429 1.00 0.00 ? 102 ARG A HB2  5  
ATOM 8832  H HB3  . ARG A 1 102 ? -247.535 -23.940 104.664 1.00 0.00 ? 102 ARG A HB3  5  
ATOM 8833  H HG2  . ARG A 1 102 ? -250.489 -23.800 105.152 1.00 0.00 ? 102 ARG A HG2  5  
ATOM 8834  H HG3  . ARG A 1 102 ? -249.833 -24.034 103.530 1.00 0.00 ? 102 ARG A HG3  5  
ATOM 8835  H HD2  . ARG A 1 102 ? -249.705 -25.841 105.916 1.00 0.00 ? 102 ARG A HD2  5  
ATOM 8836  H HD3  . ARG A 1 102 ? -250.180 -26.212 104.258 1.00 0.00 ? 102 ARG A HD3  5  
ATOM 8837  H HE   . ARG A 1 102 ? -247.381 -25.551 104.894 1.00 0.00 ? 102 ARG A HE   5  
ATOM 8838  H HH11 . ARG A 1 102 ? -249.748 -27.802 103.644 1.00 0.00 ? 102 ARG A HH11 5  
ATOM 8839  H HH12 . ARG A 1 102 ? -248.558 -28.911 103.042 1.00 0.00 ? 102 ARG A HH12 5  
ATOM 8840  H HH21 . ARG A 1 102 ? -245.810 -27.037 104.123 1.00 0.00 ? 102 ARG A HH21 5  
ATOM 8841  H HH22 . ARG A 1 102 ? -246.342 -28.496 103.333 1.00 0.00 ? 102 ARG A HH22 5  
ATOM 8842  N N    . ILE A 1 103 ? -248.750 -20.689 106.359 1.00 0.00 ? 103 ILE A N    5  
ATOM 8843  C CA   . ILE A 1 103 ? -249.342 -19.435 106.812 1.00 0.00 ? 103 ILE A CA   5  
ATOM 8844  C C    . ILE A 1 103 ? -250.550 -19.013 105.979 1.00 0.00 ? 103 ILE A C    5  
ATOM 8845  O O    . ILE A 1 103 ? -250.539 -19.094 104.749 1.00 0.00 ? 103 ILE A O    5  
ATOM 8846  C CB   . ILE A 1 103 ? -248.307 -18.291 106.770 1.00 0.00 ? 103 ILE A CB   5  
ATOM 8847  C CG1  . ILE A 1 103 ? -247.073 -18.659 107.601 1.00 0.00 ? 103 ILE A CG1  5  
ATOM 8848  C CG2  . ILE A 1 103 ? -248.924 -16.988 107.265 1.00 0.00 ? 103 ILE A CG2  5  
ATOM 8849  C CD1  . ILE A 1 103 ? -246.028 -17.567 107.658 1.00 0.00 ? 103 ILE A CD1  5  
ATOM 8850  H H    . ILE A 1 103 ? -248.058 -20.663 105.668 1.00 0.00 ? 103 ILE A H    5  
ATOM 8851  H HA   . ILE A 1 103 ? -249.654 -19.567 107.837 1.00 0.00 ? 103 ILE A HA   5  
ATOM 8852  H HB   . ILE A 1 103 ? -248.016 -18.145 105.739 1.00 0.00 ? 103 ILE A HB   5  
ATOM 8853  H HG12 . ILE A 1 103 ? -247.379 -18.874 108.613 1.00 0.00 ? 103 ILE A HG12 5  
ATOM 8854  H HG13 . ILE A 1 103 ? -246.610 -19.539 107.177 1.00 0.00 ? 103 ILE A HG13 5  
ATOM 8855  H HG21 . ILE A 1 103 ? -249.276 -17.119 108.278 1.00 0.00 ? 103 ILE A HG21 5  
ATOM 8856  H HG22 . ILE A 1 103 ? -248.180 -16.204 107.243 1.00 0.00 ? 103 ILE A HG22 5  
ATOM 8857  H HG23 . ILE A 1 103 ? -249.753 -16.715 106.629 1.00 0.00 ? 103 ILE A HG23 5  
ATOM 8858  H HD11 . ILE A 1 103 ? -245.697 -17.332 106.659 1.00 0.00 ? 103 ILE A HD11 5  
ATOM 8859  H HD12 . ILE A 1 103 ? -246.457 -16.684 108.112 1.00 0.00 ? 103 ILE A HD12 5  
ATOM 8860  H HD13 . ILE A 1 103 ? -245.187 -17.902 108.249 1.00 0.00 ? 103 ILE A HD13 5  
ATOM 8861  N N    . VAL A 1 104 ? -251.577 -18.543 106.670 1.00 0.00 ? 104 VAL A N    5  
ATOM 8862  C CA   . VAL A 1 104 ? -252.703 -17.889 106.057 1.00 0.00 ? 104 VAL A CA   5  
ATOM 8863  C C    . VAL A 1 104 ? -252.808 -16.494 106.627 1.00 0.00 ? 104 VAL A C    5  
ATOM 8864  O O    . VAL A 1 104 ? -252.999 -16.318 107.828 1.00 0.00 ? 104 VAL A O    5  
ATOM 8865  C CB   . VAL A 1 104 ? -254.027 -18.636 106.303 1.00 0.00 ? 104 VAL A CB   5  
ATOM 8866  C CG1  . VAL A 1 104 ? -254.178 -19.811 105.350 1.00 0.00 ? 104 VAL A CG1  5  
ATOM 8867  C CG2  . VAL A 1 104 ? -254.133 -19.093 107.737 1.00 0.00 ? 104 VAL A CG2  5  
ATOM 8868  H H    . VAL A 1 104 ? -251.572 -18.623 107.644 1.00 0.00 ? 104 VAL A H    5  
ATOM 8869  H HA   . VAL A 1 104 ? -252.524 -17.828 104.992 1.00 0.00 ? 104 VAL A HA   5  
ATOM 8870  H HB   . VAL A 1 104 ? -254.834 -17.950 106.136 1.00 0.00 ? 104 VAL A HB   5  
ATOM 8871  H HG11 . VAL A 1 104 ? -253.358 -20.497 105.494 1.00 0.00 ? 104 VAL A HG11 5  
ATOM 8872  H HG12 . VAL A 1 104 ? -255.110 -20.318 105.545 1.00 0.00 ? 104 VAL A HG12 5  
ATOM 8873  H HG13 . VAL A 1 104 ? -254.170 -19.451 104.331 1.00 0.00 ? 104 VAL A HG13 5  
ATOM 8874  H HG21 . VAL A 1 104 ? -253.227 -19.605 108.017 1.00 0.00 ? 104 VAL A HG21 5  
ATOM 8875  H HG22 . VAL A 1 104 ? -254.279 -18.226 108.372 1.00 0.00 ? 104 VAL A HG22 5  
ATOM 8876  H HG23 . VAL A 1 104 ? -254.975 -19.759 107.839 1.00 0.00 ? 104 VAL A HG23 5  
ATOM 8877  N N    . LEU A 1 105 ? -252.622 -15.505 105.786 1.00 0.00 ? 105 LEU A N    5  
ATOM 8878  C CA   . LEU A 1 105 ? -252.824 -14.145 106.208 1.00 0.00 ? 105 LEU A CA   5  
ATOM 8879  C C    . LEU A 1 105 ? -254.309 -13.938 106.443 1.00 0.00 ? 105 LEU A C    5  
ATOM 8880  O O    . LEU A 1 105 ? -255.109 -13.931 105.511 1.00 0.00 ? 105 LEU A O    5  
ATOM 8881  C CB   . LEU A 1 105 ? -252.340 -13.167 105.159 1.00 0.00 ? 105 LEU A CB   5  
ATOM 8882  C CG   . LEU A 1 105 ? -252.221 -11.740 105.656 1.00 0.00 ? 105 LEU A CG   5  
ATOM 8883  C CD1  . LEU A 1 105 ? -251.242 -11.690 106.811 1.00 0.00 ? 105 LEU A CD1  5  
ATOM 8884  C CD2  . LEU A 1 105 ? -251.793 -10.811 104.533 1.00 0.00 ? 105 LEU A CD2  5  
ATOM 8885  H H    . LEU A 1 105 ? -252.357 -15.693 104.868 1.00 0.00 ? 105 LEU A H    5  
ATOM 8886  H HA   . LEU A 1 105 ? -252.273 -13.980 107.140 1.00 0.00 ? 105 LEU A HA   5  
ATOM 8887  H HB2  . LEU A 1 105 ? -251.373 -13.494 104.797 1.00 0.00 ? 105 LEU A HB2  5  
ATOM 8888  H HB3  . LEU A 1 105 ? -253.042 -13.186 104.346 1.00 0.00 ? 105 LEU A HB3  5  
ATOM 8889  H HG   . LEU A 1 105 ? -253.186 -11.411 106.020 1.00 0.00 ? 105 LEU A HG   5  
ATOM 8890  H HD11 . LEU A 1 105 ? -251.559 -12.383 107.580 1.00 0.00 ? 105 LEU A HD11 5  
ATOM 8891  H HD12 . LEU A 1 105 ? -250.259 -11.970 106.462 1.00 0.00 ? 105 LEU A HD12 5  
ATOM 8892  H HD13 . LEU A 1 105 ? -251.212 -10.689 107.214 1.00 0.00 ? 105 LEU A HD13 5  
ATOM 8893  H HD21 . LEU A 1 105 ? -252.508 -10.868 103.726 1.00 0.00 ? 105 LEU A HD21 5  
ATOM 8894  H HD22 . LEU A 1 105 ? -251.744 -9.798  104.903 1.00 0.00 ? 105 LEU A HD22 5  
ATOM 8895  H HD23 . LEU A 1 105 ? -250.819 -11.109 104.172 1.00 0.00 ? 105 LEU A HD23 5  
ATOM 8896  N N    . LYS A 1 106 ? -254.661 -13.811 107.687 1.00 0.00 ? 106 LYS A N    5  
ATOM 8897  C CA   . LYS A 1 106 ? -256.036 -13.660 108.087 1.00 0.00 ? 106 LYS A CA   5  
ATOM 8898  C C    . LYS A 1 106 ? -256.306 -12.207 108.446 1.00 0.00 ? 106 LYS A C    5  
ATOM 8899  O O    . LYS A 1 106 ? -255.427 -11.353 108.322 1.00 0.00 ? 106 LYS A O    5  
ATOM 8900  C CB   . LYS A 1 106 ? -256.352 -14.572 109.271 1.00 0.00 ? 106 LYS A CB   5  
ATOM 8901  C CG   . LYS A 1 106 ? -256.352 -16.047 108.912 1.00 0.00 ? 106 LYS A CG   5  
ATOM 8902  C CD   . LYS A 1 106 ? -257.483 -16.398 107.961 1.00 0.00 ? 106 LYS A CD   5  
ATOM 8903  C CE   . LYS A 1 106 ? -257.504 -17.885 107.654 1.00 0.00 ? 106 LYS A CE   5  
ATOM 8904  N NZ   . LYS A 1 106 ? -258.640 -18.261 106.777 1.00 0.00 ? 106 LYS A NZ   5  
ATOM 8905  H H    . LYS A 1 106 ? -253.958 -13.779 108.367 1.00 0.00 ? 106 LYS A H    5  
ATOM 8906  H HA   . LYS A 1 106 ? -256.653 -13.952 107.251 1.00 0.00 ? 106 LYS A HA   5  
ATOM 8907  H HB2  . LYS A 1 106 ? -255.616 -14.408 110.044 1.00 0.00 ? 106 LYS A HB2  5  
ATOM 8908  H HB3  . LYS A 1 106 ? -257.329 -14.319 109.656 1.00 0.00 ? 106 LYS A HB3  5  
ATOM 8909  H HG2  . LYS A 1 106 ? -255.412 -16.289 108.438 1.00 0.00 ? 106 LYS A HG2  5  
ATOM 8910  H HG3  . LYS A 1 106 ? -256.459 -16.628 109.817 1.00 0.00 ? 106 LYS A HG3  5  
ATOM 8911  H HD2  . LYS A 1 106 ? -258.422 -16.120 108.414 1.00 0.00 ? 106 LYS A HD2  5  
ATOM 8912  H HD3  . LYS A 1 106 ? -257.347 -15.852 107.039 1.00 0.00 ? 106 LYS A HD3  5  
ATOM 8913  H HE2  . LYS A 1 106 ? -256.581 -18.149 107.162 1.00 0.00 ? 106 LYS A HE2  5  
ATOM 8914  H HE3  . LYS A 1 106 ? -257.581 -18.430 108.585 1.00 0.00 ? 106 LYS A HE3  5  
ATOM 8915  H HZ1  . LYS A 1 106 ? -258.607 -17.708 105.893 1.00 0.00 ? 106 LYS A HZ1  5  
ATOM 8916  H HZ2  . LYS A 1 106 ? -258.584 -19.278 106.542 1.00 0.00 ? 106 LYS A HZ2  5  
ATOM 8917  H HZ3  . LYS A 1 106 ? -259.546 -18.077 107.260 1.00 0.00 ? 106 LYS A HZ3  5  
ATOM 8918  N N    . THR A 1 107 ? -257.503 -11.932 108.915 1.00 0.00 ? 107 THR A N    5  
ATOM 8919  C CA   . THR A 1 107 ? -257.901 -10.600 109.259 1.00 0.00 ? 107 THR A CA   5  
ATOM 8920  C C    . THR A 1 107 ? -258.624 -10.672 110.589 1.00 0.00 ? 107 THR A C    5  
ATOM 8921  O O    . THR A 1 107 ? -259.260 -11.679 110.899 1.00 0.00 ? 107 THR A O    5  
ATOM 8922  C CB   . THR A 1 107 ? -258.856 -9.996  108.206 1.00 0.00 ? 107 THR A CB   5  
ATOM 8923  O OG1  . THR A 1 107 ? -260.121 -10.662 108.254 1.00 0.00 ? 107 THR A OG1  5  
ATOM 8924  C CG2  . THR A 1 107 ? -258.290 -10.119 106.802 1.00 0.00 ? 107 THR A CG2  5  
ATOM 8925  H H    . THR A 1 107 ? -258.135 -12.650 109.080 1.00 0.00 ? 107 THR A H    5  
ATOM 8926  H HA   . THR A 1 107 ? -257.014 -9.972  109.340 1.00 0.00 ? 107 THR A HA   5  
ATOM 8927  H HB   . THR A 1 107 ? -259.002 -8.950  108.430 1.00 0.00 ? 107 THR A HB   5  
ATOM 8928  H HG1  . THR A 1 107 ? -259.995 -11.610 108.115 1.00 0.00 ? 107 THR A HG1  5  
ATOM 8929  H HG21 . THR A 1 107 ? -258.112 -11.160 106.576 1.00 0.00 ? 107 THR A HG21 5  
ATOM 8930  H HG22 . THR A 1 107 ? -258.993 -9.711  106.090 1.00 0.00 ? 107 THR A HG22 5  
ATOM 8931  H HG23 . THR A 1 107 ? -257.360 -9.575  106.741 1.00 0.00 ? 107 THR A HG23 5  
ATOM 8932  N N    . GLN A 1 108 ? -258.518 -9.630  111.368 1.00 0.00 ? 108 GLN A N    5  
ATOM 8933  C CA   . GLN A 1 108 ? -259.303 -9.501  112.597 1.00 0.00 ? 108 GLN A CA   5  
ATOM 8934  C C    . GLN A 1 108 ? -260.742 -9.119  112.260 1.00 0.00 ? 108 GLN A C    5  
ATOM 8935  O O    . GLN A 1 108 ? -261.437 -8.462  113.041 1.00 0.00 ? 108 GLN A O    5  
ATOM 8936  C CB   . GLN A 1 108 ? -258.672 -8.460  113.523 1.00 0.00 ? 108 GLN A CB   5  
ATOM 8937  C CG   . GLN A 1 108 ? -257.923 -9.060  114.701 1.00 0.00 ? 108 GLN A CG   5  
ATOM 8938  C CD   . GLN A 1 108 ? -258.846 -9.752  115.690 1.00 0.00 ? 108 GLN A CD   5  
ATOM 8939  O OE1  . GLN A 1 108 ? -258.472 -10.732 116.330 1.00 0.00 ? 108 GLN A OE1  5  
ATOM 8940  N NE2  . GLN A 1 108 ? -260.057 -9.235  115.834 1.00 0.00 ? 108 GLN A NE2  5  
ATOM 8941  H H    . GLN A 1 108 ? -257.884 -8.937  111.125 1.00 0.00 ? 108 GLN A H    5  
ATOM 8942  H HA   . GLN A 1 108 ? -259.303 -10.462 113.093 1.00 0.00 ? 108 GLN A HA   5  
ATOM 8943  H HB2  . GLN A 1 108 ? -257.976 -7.865  112.950 1.00 0.00 ? 108 GLN A HB2  5  
ATOM 8944  H HB3  . GLN A 1 108 ? -259.447 -7.815  113.906 1.00 0.00 ? 108 GLN A HB3  5  
ATOM 8945  H HG2  . GLN A 1 108 ? -257.211 -9.782  114.332 1.00 0.00 ? 108 GLN A HG2  5  
ATOM 8946  H HG3  . GLN A 1 108 ? -257.399 -8.268  115.216 1.00 0.00 ? 108 GLN A HG3  5  
ATOM 8947  H HE21 . GLN A 1 108 ? -260.290 -8.446  115.300 1.00 0.00 ? 108 GLN A HE21 5  
ATOM 8948  H HE22 . GLN A 1 108 ? -260.669 -9.659  116.471 1.00 0.00 ? 108 GLN A HE22 5  
ATOM 8949  N N    . GLN A 1 109 ? -261.183 -9.582  111.105 1.00 0.00 ? 109 GLN A N    5  
ATOM 8950  C CA   . GLN A 1 109 ? -262.490 -9.277  110.577 1.00 0.00 ? 109 GLN A CA   5  
ATOM 8951  C C    . GLN A 1 109 ? -263.307 -10.559 110.474 1.00 0.00 ? 109 GLN A C    5  
ATOM 8952  O O    . GLN A 1 109 ? -262.757 -11.644 110.265 1.00 0.00 ? 109 GLN A O    5  
ATOM 8953  C CB   . GLN A 1 109 ? -262.336 -8.589  109.212 1.00 0.00 ? 109 GLN A CB   5  
ATOM 8954  C CG   . GLN A 1 109 ? -263.386 -8.975  108.186 1.00 0.00 ? 109 GLN A CG   5  
ATOM 8955  C CD   . GLN A 1 109 ? -263.116 -8.391  106.812 1.00 0.00 ? 109 GLN A CD   5  
ATOM 8956  O OE1  . GLN A 1 109 ? -263.483 -8.979  105.795 1.00 0.00 ? 109 GLN A OE1  5  
ATOM 8957  N NE2  . GLN A 1 109 ? -262.477 -7.232  106.768 1.00 0.00 ? 109 GLN A NE2  5  
ATOM 8958  H H    . GLN A 1 109 ? -260.602 -10.188 110.592 1.00 0.00 ? 109 GLN A H    5  
ATOM 8959  H HA   . GLN A 1 109 ? -262.980 -8.601  111.261 1.00 0.00 ? 109 GLN A HA   5  
ATOM 8960  H HB2  . GLN A 1 109 ? -262.402 -7.524  109.362 1.00 0.00 ? 109 GLN A HB2  5  
ATOM 8961  H HB3  . GLN A 1 109 ? -261.363 -8.829  108.809 1.00 0.00 ? 109 GLN A HB3  5  
ATOM 8962  H HG2  . GLN A 1 109 ? -263.401 -10.051 108.106 1.00 0.00 ? 109 GLN A HG2  5  
ATOM 8963  H HG3  . GLN A 1 109 ? -264.349 -8.627  108.529 1.00 0.00 ? 109 GLN A HG3  5  
ATOM 8964  H HE21 . GLN A 1 109 ? -262.215 -6.812  107.613 1.00 0.00 ? 109 GLN A HE21 5  
ATOM 8965  H HE22 . GLN A 1 109 ? -262.283 -6.844  105.884 1.00 0.00 ? 109 GLN A HE22 5  
ATOM 8966  N N    . GLU A 1 110 ? -264.611 -10.430 110.639 1.00 0.00 ? 110 GLU A N    5  
ATOM 8967  C CA   . GLU A 1 110 ? -265.501 -11.581 110.643 1.00 0.00 ? 110 GLU A CA   5  
ATOM 8968  C C    . GLU A 1 110 ? -265.739 -12.106 109.228 1.00 0.00 ? 110 GLU A C    5  
ATOM 8969  O O    . GLU A 1 110 ? -265.524 -11.392 108.243 1.00 0.00 ? 110 GLU A O    5  
ATOM 8970  C CB   . GLU A 1 110 ? -266.826 -11.199 111.294 1.00 0.00 ? 110 GLU A CB   5  
ATOM 8971  C CG   . GLU A 1 110 ? -267.531 -10.037 110.613 1.00 0.00 ? 110 GLU A CG   5  
ATOM 8972  C CD   . GLU A 1 110 ? -268.805 -9.638  111.319 1.00 0.00 ? 110 GLU A CD   5  
ATOM 8973  O OE1  . GLU A 1 110 ? -269.863 -10.226 111.020 1.00 0.00 ? 110 GLU A OE1  5  
ATOM 8974  O OE2  . GLU A 1 110 ? -268.752 -8.739  112.182 1.00 0.00 ? 110 GLU A OE2  5  
ATOM 8975  H H    . GLU A 1 110 ? -264.993 -9.530  110.745 1.00 0.00 ? 110 GLU A H    5  
ATOM 8976  H HA   . GLU A 1 110 ? -265.033 -12.355 111.228 1.00 0.00 ? 110 GLU A HA   5  
ATOM 8977  H HB2  . GLU A 1 110 ? -267.478 -12.052 111.268 1.00 0.00 ? 110 GLU A HB2  5  
ATOM 8978  H HB3  . GLU A 1 110 ? -266.642 -10.926 112.323 1.00 0.00 ? 110 GLU A HB3  5  
ATOM 8979  H HG2  . GLU A 1 110 ? -266.864 -9.189  110.601 1.00 0.00 ? 110 GLU A HG2  5  
ATOM 8980  H HG3  . GLU A 1 110 ? -267.769 -10.321 109.598 1.00 0.00 ? 110 GLU A HG3  5  
ATOM 8981  N N    . GLY A 1 1   ? -229.680 -11.682 101.914 1.00 0.00 ? 1   GLY A N    6  
ATOM 8982  C CA   . GLY A 1 1   ? -228.571 -11.472 100.959 1.00 0.00 ? 1   GLY A CA   6  
ATOM 8983  C C    . GLY A 1 1   ? -227.249 -11.699 101.635 1.00 0.00 ? 1   GLY A C    6  
ATOM 8984  O O    . GLY A 1 1   ? -227.061 -11.247 102.763 1.00 0.00 ? 1   GLY A O    6  
ATOM 8985  H H1   . GLY A 1 1   ? -229.560 -11.063 102.741 1.00 0.00 ? 1   GLY A H1   6  
ATOM 8986  H H2   . GLY A 1 1   ? -230.595 -11.468 101.461 1.00 0.00 ? 1   GLY A H2   6  
ATOM 8987  H H3   . GLY A 1 1   ? -229.687 -12.676 102.239 1.00 0.00 ? 1   GLY A H3   6  
ATOM 8988  H HA2  . GLY A 1 1   ? -228.670 -12.165 100.137 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8989  H HA3  . GLY A 1 1   ? -228.609 -10.460 100.582 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8990  N N    . GLU A 1 2   ? -226.342 -12.397 100.959 1.00 0.00 ? 2   GLU A N    6  
ATOM 8991  C CA   . GLU A 1 2   ? -225.077 -12.787 101.566 1.00 0.00 ? 2   GLU A CA   6  
ATOM 8992  C C    . GLU A 1 2   ? -225.363 -13.636 102.797 1.00 0.00 ? 2   GLU A C    6  
ATOM 8993  O O    . GLU A 1 2   ? -224.895 -13.338 103.896 1.00 0.00 ? 2   GLU A O    6  
ATOM 8994  C CB   . GLU A 1 2   ? -224.244 -11.553 101.939 1.00 0.00 ? 2   GLU A CB   6  
ATOM 8995  C CG   . GLU A 1 2   ? -223.844 -10.702 100.745 1.00 0.00 ? 2   GLU A CG   6  
ATOM 8996  C CD   . GLU A 1 2   ? -223.069 -11.491 99.716  1.00 0.00 ? 2   GLU A CD   6  
ATOM 8997  O OE1  . GLU A 1 2   ? -221.870 -11.759 99.946  1.00 0.00 ? 2   GLU A OE1  6  
ATOM 8998  O OE2  . GLU A 1 2   ? -223.655 -11.850 98.673  1.00 0.00 ? 2   GLU A OE2  6  
ATOM 8999  H H    . GLU A 1 2   ? -226.530 -12.661 100.027 1.00 0.00 ? 2   GLU A H    6  
ATOM 9000  H HA   . GLU A 1 2   ? -224.532 -13.383 100.848 1.00 0.00 ? 2   GLU A HA   6  
ATOM 9001  H HB2  . GLU A 1 2   ? -224.817 -10.937 102.615 1.00 0.00 ? 2   GLU A HB2  6  
ATOM 9002  H HB3  . GLU A 1 2   ? -223.343 -11.879 102.438 1.00 0.00 ? 2   GLU A HB3  6  
ATOM 9003  H HG2  . GLU A 1 2   ? -224.736 -10.310 100.281 1.00 0.00 ? 2   GLU A HG2  6  
ATOM 9004  H HG3  . GLU A 1 2   ? -223.228 -9.883  101.090 1.00 0.00 ? 2   GLU A HG3  6  
ATOM 9005  N N    . GLU A 1 3   ? -226.148 -14.692 102.586 1.00 0.00 ? 3   GLU A N    6  
ATOM 9006  C CA   . GLU A 1 3   ? -226.645 -15.536 103.668 1.00 0.00 ? 3   GLU A CA   6  
ATOM 9007  C C    . GLU A 1 3   ? -225.504 -16.135 104.484 1.00 0.00 ? 3   GLU A C    6  
ATOM 9008  O O    . GLU A 1 3   ? -224.943 -17.173 104.126 1.00 0.00 ? 3   GLU A O    6  
ATOM 9009  C CB   . GLU A 1 3   ? -227.524 -16.658 103.110 1.00 0.00 ? 3   GLU A CB   6  
ATOM 9010  C CG   . GLU A 1 3   ? -228.738 -16.165 102.342 1.00 0.00 ? 3   GLU A CG   6  
ATOM 9011  C CD   . GLU A 1 3   ? -229.690 -15.361 103.203 1.00 0.00 ? 3   GLU A CD   6  
ATOM 9012  O OE1  . GLU A 1 3   ? -230.111 -15.872 104.259 1.00 0.00 ? 3   GLU A OE1  6  
ATOM 9013  O OE2  . GLU A 1 3   ? -230.030 -14.218 102.815 1.00 0.00 ? 3   GLU A OE2  6  
ATOM 9014  H H    . GLU A 1 3   ? -226.396 -14.916 101.660 1.00 0.00 ? 3   GLU A H    6  
ATOM 9015  H HA   . GLU A 1 3   ? -227.244 -14.916 104.317 1.00 0.00 ? 3   GLU A HA   6  
ATOM 9016  H HB2  . GLU A 1 3   ? -226.930 -17.268 102.447 1.00 0.00 ? 3   GLU A HB2  6  
ATOM 9017  H HB3  . GLU A 1 3   ? -227.869 -17.269 103.932 1.00 0.00 ? 3   GLU A HB3  6  
ATOM 9018  H HG2  . GLU A 1 3   ? -228.403 -15.541 101.528 1.00 0.00 ? 3   GLU A HG2  6  
ATOM 9019  H HG3  . GLU A 1 3   ? -229.267 -17.018 101.946 1.00 0.00 ? 3   GLU A HG3  6  
ATOM 9020  N N    . ARG A 1 4   ? -225.156 -15.451 105.563 1.00 0.00 ? 4   ARG A N    6  
ATOM 9021  C CA   . ARG A 1 4   ? -224.112 -15.903 106.468 1.00 0.00 ? 4   ARG A CA   6  
ATOM 9022  C C    . ARG A 1 4   ? -224.496 -15.553 107.899 1.00 0.00 ? 4   ARG A C    6  
ATOM 9023  O O    . ARG A 1 4   ? -224.870 -16.424 108.686 1.00 0.00 ? 4   ARG A O    6  
ATOM 9024  C CB   . ARG A 1 4   ? -222.764 -15.257 106.115 1.00 0.00 ? 4   ARG A CB   6  
ATOM 9025  C CG   . ARG A 1 4   ? -222.245 -15.622 104.732 1.00 0.00 ? 4   ARG A CG   6  
ATOM 9026  C CD   . ARG A 1 4   ? -220.963 -14.876 104.393 1.00 0.00 ? 4   ARG A CD   6  
ATOM 9027  N NE   . ARG A 1 4   ? -221.138 -13.427 104.463 1.00 0.00 ? 4   ARG A NE   6  
ATOM 9028  C CZ   . ARG A 1 4   ? -221.239 -12.631 103.401 1.00 0.00 ? 4   ARG A CZ   6  
ATOM 9029  N NH1  . ARG A 1 4   ? -221.242 -13.147 102.175 1.00 0.00 ? 4   ARG A NH1  6  
ATOM 9030  N NH2  . ARG A 1 4   ? -221.359 -11.319 103.574 1.00 0.00 ? 4   ARG A NH2  6  
ATOM 9031  H H    . ARG A 1 4   ? -225.612 -14.603 105.749 1.00 0.00 ? 4   ARG A H    6  
ATOM 9032  H HA   . ARG A 1 4   ? -224.028 -16.975 106.378 1.00 0.00 ? 4   ARG A HA   6  
ATOM 9033  H HB2  . ARG A 1 4   ? -222.872 -14.182 106.161 1.00 0.00 ? 4   ARG A HB2  6  
ATOM 9034  H HB3  . ARG A 1 4   ? -222.030 -15.565 106.844 1.00 0.00 ? 4   ARG A HB3  6  
ATOM 9035  H HG2  . ARG A 1 4   ? -222.049 -16.684 104.700 1.00 0.00 ? 4   ARG A HG2  6  
ATOM 9036  H HG3  . ARG A 1 4   ? -222.999 -15.373 103.998 1.00 0.00 ? 4   ARG A HG3  6  
ATOM 9037  H HD2  . ARG A 1 4   ? -220.195 -15.170 105.092 1.00 0.00 ? 4   ARG A HD2  6  
ATOM 9038  H HD3  . ARG A 1 4   ? -220.660 -15.145 103.392 1.00 0.00 ? 4   ARG A HD3  6  
ATOM 9039  H HE   . ARG A 1 4   ? -221.170 -13.020 105.361 1.00 0.00 ? 4   ARG A HE   6  
ATOM 9040  H HH11 . ARG A 1 4   ? -221.168 -14.145 102.042 1.00 0.00 ? 4   ARG A HH11 6  
ATOM 9041  H HH12 . ARG A 1 4   ? -221.328 -12.545 101.367 1.00 0.00 ? 4   ARG A HH12 6  
ATOM 9042  H HH21 . ARG A 1 4   ? -221.372 -10.936 104.503 1.00 0.00 ? 4   ARG A HH21 6  
ATOM 9043  H HH22 . ARG A 1 4   ? -221.441 -10.711 102.783 1.00 0.00 ? 4   ARG A HH22 6  
ATOM 9044  N N    . LYS A 1 5   ? -224.424 -14.268 108.222 1.00 0.00 ? 5   LYS A N    6  
ATOM 9045  C CA   . LYS A 1 5   ? -224.773 -13.792 109.553 1.00 0.00 ? 5   LYS A CA   6  
ATOM 9046  C C    . LYS A 1 5   ? -225.337 -12.371 109.474 1.00 0.00 ? 5   LYS A C    6  
ATOM 9047  O O    . LYS A 1 5   ? -225.625 -11.741 110.493 1.00 0.00 ? 5   LYS A O    6  
ATOM 9048  C CB   . LYS A 1 5   ? -223.532 -13.841 110.460 1.00 0.00 ? 5   LYS A CB   6  
ATOM 9049  C CG   . LYS A 1 5   ? -223.808 -13.546 111.925 1.00 0.00 ? 5   LYS A CG   6  
ATOM 9050  C CD   . LYS A 1 5   ? -222.568 -13.746 112.784 1.00 0.00 ? 5   LYS A CD   6  
ATOM 9051  C CE   . LYS A 1 5   ? -221.426 -12.826 112.375 1.00 0.00 ? 5   LYS A CE   6  
ATOM 9052  N NZ   . LYS A 1 5   ? -221.751 -11.389 112.595 1.00 0.00 ? 5   LYS A NZ   6  
ATOM 9053  H H    . LYS A 1 5   ? -224.115 -13.624 107.550 1.00 0.00 ? 5   LYS A H    6  
ATOM 9054  H HA   . LYS A 1 5   ? -225.531 -14.446 109.954 1.00 0.00 ? 5   LYS A HA   6  
ATOM 9055  H HB2  . LYS A 1 5   ? -223.096 -14.826 110.395 1.00 0.00 ? 5   LYS A HB2  6  
ATOM 9056  H HB3  . LYS A 1 5   ? -222.812 -13.118 110.103 1.00 0.00 ? 5   LYS A HB3  6  
ATOM 9057  H HG2  . LYS A 1 5   ? -224.137 -12.522 112.020 1.00 0.00 ? 5   LYS A HG2  6  
ATOM 9058  H HG3  . LYS A 1 5   ? -224.586 -14.209 112.273 1.00 0.00 ? 5   LYS A HG3  6  
ATOM 9059  H HD2  . LYS A 1 5   ? -222.822 -13.546 113.813 1.00 0.00 ? 5   LYS A HD2  6  
ATOM 9060  H HD3  . LYS A 1 5   ? -222.242 -14.773 112.690 1.00 0.00 ? 5   LYS A HD3  6  
ATOM 9061  H HE2  . LYS A 1 5   ? -220.551 -13.078 112.957 1.00 0.00 ? 5   LYS A HE2  6  
ATOM 9062  H HE3  . LYS A 1 5   ? -221.216 -12.981 111.327 1.00 0.00 ? 5   LYS A HE3  6  
ATOM 9063  H HZ1  . LYS A 1 5   ? -222.585 -11.115 112.037 1.00 0.00 ? 5   LYS A HZ1  6  
ATOM 9064  H HZ2  . LYS A 1 5   ? -221.944 -11.213 113.604 1.00 0.00 ? 5   LYS A HZ2  6  
ATOM 9065  H HZ3  . LYS A 1 5   ? -220.947 -10.793 112.297 1.00 0.00 ? 5   LYS A HZ3  6  
ATOM 9066  N N    . CYS A 1 6   ? -225.536 -11.886 108.254 1.00 0.00 ? 6   CYS A N    6  
ATOM 9067  C CA   . CYS A 1 6   ? -225.975 -10.515 108.050 1.00 0.00 ? 6   CYS A CA   6  
ATOM 9068  C C    . CYS A 1 6   ? -227.152 -10.457 107.080 1.00 0.00 ? 6   CYS A C    6  
ATOM 9069  O O    . CYS A 1 6   ? -227.032 -10.866 105.929 1.00 0.00 ? 6   CYS A O    6  
ATOM 9070  C CB   . CYS A 1 6   ? -224.816 -9.667  107.526 1.00 0.00 ? 6   CYS A CB   6  
ATOM 9071  S SG   . CYS A 1 6   ? -225.132 -7.885  107.543 1.00 0.00 ? 6   CYS A SG   6  
ATOM 9072  H H    . CYS A 1 6   ? -225.417 -12.466 107.477 1.00 0.00 ? 6   CYS A H    6  
ATOM 9073  H HA   . CYS A 1 6   ? -226.293 -10.125 109.005 1.00 0.00 ? 6   CYS A HA   6  
ATOM 9074  H HB2  . CYS A 1 6   ? -223.943 -9.852  108.135 1.00 0.00 ? 6   CYS A HB2  6  
ATOM 9075  H HB3  . CYS A 1 6   ? -224.600 -9.958  106.506 1.00 0.00 ? 6   CYS A HB3  6  
ATOM 9076  H HG   . CYS A 1 6   ? -224.225 -7.330  108.343 1.00 0.00 ? 6   CYS A HG   6  
ATOM 9077  N N    . LEU A 1 7   ? -228.280 -9.941  107.573 1.00 0.00 ? 7   LEU A N    6  
ATOM 9078  C CA   . LEU A 1 7   ? -229.487 -9.743  106.779 1.00 0.00 ? 7   LEU A CA   6  
ATOM 9079  C C    . LEU A 1 7   ? -229.908 -10.986 105.991 1.00 0.00 ? 7   LEU A C    6  
ATOM 9080  O O    . LEU A 1 7   ? -229.888 -10.994 104.756 1.00 0.00 ? 7   LEU A O    6  
ATOM 9081  C CB   . LEU A 1 7   ? -229.297 -8.553  105.845 1.00 0.00 ? 7   LEU A CB   6  
ATOM 9082  C CG   . LEU A 1 7   ? -229.323 -7.179  106.521 1.00 0.00 ? 7   LEU A CG   6  
ATOM 9083  C CD1  . LEU A 1 7   ? -229.079 -6.077  105.501 1.00 0.00 ? 7   LEU A CD1  6  
ATOM 9084  C CD2  . LEU A 1 7   ? -230.649 -6.962  107.233 1.00 0.00 ? 7   LEU A CD2  6  
ATOM 9085  H H    . LEU A 1 7   ? -228.290 -9.659  108.505 1.00 0.00 ? 7   LEU A H    6  
ATOM 9086  H HA   . LEU A 1 7   ? -230.282 -9.503  107.469 1.00 0.00 ? 7   LEU A HA   6  
ATOM 9087  H HB2  . LEU A 1 7   ? -228.341 -8.668  105.361 1.00 0.00 ? 7   LEU A HB2  6  
ATOM 9088  H HB3  . LEU A 1 7   ? -230.072 -8.578  105.096 1.00 0.00 ? 7   LEU A HB3  6  
ATOM 9089  H HG   . LEU A 1 7   ? -228.533 -7.135  107.260 1.00 0.00 ? 7   LEU A HG   6  
ATOM 9090  H HD11 . LEU A 1 7   ? -229.843 -6.116  104.738 1.00 0.00 ? 7   LEU A HD11 6  
ATOM 9091  H HD12 . LEU A 1 7   ? -229.112 -5.116  105.992 1.00 0.00 ? 7   LEU A HD12 6  
ATOM 9092  H HD13 . LEU A 1 7   ? -228.109 -6.215  105.045 1.00 0.00 ? 7   LEU A HD13 6  
ATOM 9093  H HD21 . LEU A 1 7   ? -230.802 -7.746  107.960 1.00 0.00 ? 7   LEU A HD21 6  
ATOM 9094  H HD22 . LEU A 1 7   ? -230.637 -6.005  107.734 1.00 0.00 ? 7   LEU A HD22 6  
ATOM 9095  H HD23 . LEU A 1 7   ? -231.451 -6.980  106.511 1.00 0.00 ? 7   LEU A HD23 6  
ATOM 9096  N N    . GLN A 1 8   ? -230.287 -12.034 106.716 1.00 0.00 ? 8   GLN A N    6  
ATOM 9097  C CA   . GLN A 1 8   ? -230.833 -13.243 106.103 1.00 0.00 ? 8   GLN A CA   6  
ATOM 9098  C C    . GLN A 1 8   ? -232.166 -12.924 105.435 1.00 0.00 ? 8   GLN A C    6  
ATOM 9099  O O    . GLN A 1 8   ? -233.146 -12.615 106.111 1.00 0.00 ? 8   GLN A O    6  
ATOM 9100  C CB   . GLN A 1 8   ? -231.046 -14.350 107.145 1.00 0.00 ? 8   GLN A CB   6  
ATOM 9101  C CG   . GLN A 1 8   ? -229.771 -14.964 107.717 1.00 0.00 ? 8   GLN A CG   6  
ATOM 9102  C CD   . GLN A 1 8   ? -228.956 -13.987 108.541 1.00 0.00 ? 8   GLN A CD   6  
ATOM 9103  O OE1  . GLN A 1 8   ? -228.035 -13.351 108.037 1.00 0.00 ? 8   GLN A OE1  6  
ATOM 9104  N NE2  . GLN A 1 8   ? -229.308 -13.845 109.810 1.00 0.00 ? 8   GLN A NE2  6  
ATOM 9105  H H    . GLN A 1 8   ? -230.183 -12.002 107.688 1.00 0.00 ? 8   GLN A H    6  
ATOM 9106  H HA   . GLN A 1 8   ? -230.135 -13.587 105.354 1.00 0.00 ? 8   GLN A HA   6  
ATOM 9107  H HB2  . GLN A 1 8   ? -231.613 -13.939 107.968 1.00 0.00 ? 8   GLN A HB2  6  
ATOM 9108  H HB3  . GLN A 1 8   ? -231.622 -15.144 106.691 1.00 0.00 ? 8   GLN A HB3  6  
ATOM 9109  H HG2  . GLN A 1 8   ? -230.040 -15.799 108.345 1.00 0.00 ? 8   GLN A HG2  6  
ATOM 9110  H HG3  . GLN A 1 8   ? -229.161 -15.317 106.898 1.00 0.00 ? 8   GLN A HG3  6  
ATOM 9111  H HE21 . GLN A 1 8   ? -230.068 -14.375 110.143 1.00 0.00 ? 8   GLN A HE21 6  
ATOM 9112  H HE22 . GLN A 1 8   ? -228.803 -13.208 110.363 1.00 0.00 ? 8   GLN A HE22 6  
ATOM 9113  N N    . THR A 1 9   ? -232.205 -12.996 104.116 1.00 0.00 ? 9   THR A N    6  
ATOM 9114  C CA   . THR A 1 9   ? -233.420 -12.675 103.384 1.00 0.00 ? 9   THR A CA   6  
ATOM 9115  C C    . THR A 1 9   ? -234.083 -13.948 102.870 1.00 0.00 ? 9   THR A C    6  
ATOM 9116  O O    . THR A 1 9   ? -233.732 -14.464 101.811 1.00 0.00 ? 9   THR A O    6  
ATOM 9117  C CB   . THR A 1 9   ? -233.139 -11.711 102.211 1.00 0.00 ? 9   THR A CB   6  
ATOM 9118  O OG1  . THR A 1 9   ? -232.178 -12.277 101.311 1.00 0.00 ? 9   THR A OG1  6  
ATOM 9119  C CG2  . THR A 1 9   ? -232.626 -10.369 102.720 1.00 0.00 ? 9   THR A CG2  6  
ATOM 9120  H H    . THR A 1 9   ? -231.403 -13.289 103.624 1.00 0.00 ? 9   THR A H    6  
ATOM 9121  H HA   . THR A 1 9   ? -234.105 -12.179 104.071 1.00 0.00 ? 9   THR A HA   6  
ATOM 9122  H HB   . THR A 1 9   ? -234.064 -11.542 101.680 1.00 0.00 ? 9   THR A HB   6  
ATOM 9123  H HG1  . THR A 1 9   ? -232.495 -13.140 101.003 1.00 0.00 ? 9   THR A HG1  6  
ATOM 9124  H HG21 . THR A 1 9   ? -231.719 -10.523 103.285 1.00 0.00 ? 9   THR A HG21 6  
ATOM 9125  H HG22 . THR A 1 9   ? -232.425 -9.716  101.883 1.00 0.00 ? 9   THR A HG22 6  
ATOM 9126  H HG23 . THR A 1 9   ? -233.373 -9.918  103.357 1.00 0.00 ? 9   THR A HG23 6  
ATOM 9127  N N    . HIS A 1 10  ? -235.013 -14.478 103.651 1.00 0.00 ? 10  HIS A N    6  
ATOM 9128  C CA   . HIS A 1 10  ? -235.703 -15.709 103.284 1.00 0.00 ? 10  HIS A CA   6  
ATOM 9129  C C    . HIS A 1 10  ? -237.154 -15.413 102.952 1.00 0.00 ? 10  HIS A C    6  
ATOM 9130  O O    . HIS A 1 10  ? -237.789 -14.596 103.602 1.00 0.00 ? 10  HIS A O    6  
ATOM 9131  C CB   . HIS A 1 10  ? -235.618 -16.744 104.416 1.00 0.00 ? 10  HIS A CB   6  
ATOM 9132  C CG   . HIS A 1 10  ? -234.217 -17.187 104.731 1.00 0.00 ? 10  HIS A CG   6  
ATOM 9133  N ND1  . HIS A 1 10  ? -233.826 -18.505 104.777 1.00 0.00 ? 10  HIS A ND1  6  
ATOM 9134  C CD2  . HIS A 1 10  ? -233.107 -16.466 105.003 1.00 0.00 ? 10  HIS A CD2  6  
ATOM 9135  C CE1  . HIS A 1 10  ? -232.539 -18.571 105.064 1.00 0.00 ? 10  HIS A CE1  6  
ATOM 9136  N NE2  . HIS A 1 10  ? -232.074 -17.343 105.203 1.00 0.00 ? 10  HIS A NE2  6  
ATOM 9137  H H    . HIS A 1 10  ? -235.246 -14.028 104.490 1.00 0.00 ? 10  HIS A H    6  
ATOM 9138  H HA   . HIS A 1 10  ? -235.223 -16.107 102.405 1.00 0.00 ? 10  HIS A HA   6  
ATOM 9139  H HB2  . HIS A 1 10  ? -236.042 -16.319 105.310 1.00 0.00 ? 10  HIS A HB2  6  
ATOM 9140  H HB3  . HIS A 1 10  ? -236.188 -17.618 104.134 1.00 0.00 ? 10  HIS A HB3  6  
ATOM 9141  H HD1  . HIS A 1 10  ? -234.411 -19.285 104.643 1.00 0.00 ? 10  HIS A HD1  6  
ATOM 9142  H HD2  . HIS A 1 10  ? -233.047 -15.387 105.049 1.00 0.00 ? 10  HIS A HD2  6  
ATOM 9143  H HE1  . HIS A 1 10  ? -231.961 -19.478 105.165 1.00 0.00 ? 10  HIS A HE1  6  
ATOM 9144  H HE2  . HIS A 1 10  ? -231.120 -17.094 105.115 1.00 0.00 ? 10  HIS A HE2  6  
ATOM 9145  N N    . ARG A 1 11  ? -237.665 -16.049 101.922 1.00 0.00 ? 11  ARG A N    6  
ATOM 9146  C CA   . ARG A 1 11  ? -239.016 -15.831 101.496 1.00 0.00 ? 11  ARG A CA   6  
ATOM 9147  C C    . ARG A 1 11  ? -239.968 -16.777 102.218 1.00 0.00 ? 11  ARG A C    6  
ATOM 9148  O O    . ARG A 1 11  ? -239.595 -17.898 102.573 1.00 0.00 ? 11  ARG A O    6  
ATOM 9149  C CB   . ARG A 1 11  ? -239.094 -16.015 100.000 1.00 0.00 ? 11  ARG A CB   6  
ATOM 9150  C CG   . ARG A 1 11  ? -239.986 -14.992 99.369  1.00 0.00 ? 11  ARG A CG   6  
ATOM 9151  C CD   . ARG A 1 11  ? -239.655 -14.811 97.908  1.00 0.00 ? 11  ARG A CD   6  
ATOM 9152  N NE   . ARG A 1 11  ? -240.723 -14.141 97.161  1.00 0.00 ? 11  ARG A NE   6  
ATOM 9153  C CZ   . ARG A 1 11  ? -240.717 -13.986 95.837  1.00 0.00 ? 11  ARG A CZ   6  
ATOM 9154  N NH1  . ARG A 1 11  ? -239.655 -14.350 95.128  1.00 0.00 ? 11  ARG A NH1  6  
ATOM 9155  N NH2  . ARG A 1 11  ? -241.761 -13.435 95.226  1.00 0.00 ? 11  ARG A NH2  6  
ATOM 9156  H H    . ARG A 1 11  ? -237.123 -16.675 101.427 1.00 0.00 ? 11  ARG A H    6  
ATOM 9157  H HA   . ARG A 1 11  ? -239.280 -14.813 101.726 1.00 0.00 ? 11  ARG A HA   6  
ATOM 9158  H HB2  . ARG A 1 11  ? -238.103 -15.921 99.578  1.00 0.00 ? 11  ARG A HB2  6  
ATOM 9159  H HB3  . ARG A 1 11  ? -239.487 -16.996 99.780  1.00 0.00 ? 11  ARG A HB3  6  
ATOM 9160  H HG2  . ARG A 1 11  ? -241.009 -15.306 99.479  1.00 0.00 ? 11  ARG A HG2  6  
ATOM 9161  H HG3  . ARG A 1 11  ? -239.842 -14.057 99.892  1.00 0.00 ? 11  ARG A HG3  6  
ATOM 9162  H HD2  . ARG A 1 11  ? -238.757 -14.217 97.843  1.00 0.00 ? 11  ARG A HD2  6  
ATOM 9163  H HD3  . ARG A 1 11  ? -239.474 -15.781 97.475  1.00 0.00 ? 11  ARG A HD3  6  
ATOM 9164  H HE   . ARG A 1 11  ? -241.503 -13.823 97.672  1.00 0.00 ? 11  ARG A HE   6  
ATOM 9165  H HH11 . ARG A 1 11  ? -238.850 -14.746 95.585  1.00 0.00 ? 11  ARG A HH11 6  
ATOM 9166  H HH12 . ARG A 1 11  ? -239.657 -14.247 94.122  1.00 0.00 ? 11  ARG A HH12 6  
ATOM 9167  H HH21 . ARG A 1 11  ? -242.565 -13.138 95.756  1.00 0.00 ? 11  ARG A HH21 6  
ATOM 9168  H HH22 . ARG A 1 11  ? -241.758 -13.321 94.230  1.00 0.00 ? 11  ARG A HH22 6  
ATOM 9169  N N    . VAL A 1 12  ? -241.185 -16.314 102.441 1.00 0.00 ? 12  VAL A N    6  
ATOM 9170  C CA   . VAL A 1 12  ? -242.186 -17.089 103.153 1.00 0.00 ? 12  VAL A CA   6  
ATOM 9171  C C    . VAL A 1 12  ? -243.527 -16.997 102.423 1.00 0.00 ? 12  VAL A C    6  
ATOM 9172  O O    . VAL A 1 12  ? -244.033 -15.903 102.159 1.00 0.00 ? 12  VAL A O    6  
ATOM 9173  C CB   . VAL A 1 12  ? -242.319 -16.608 104.616 1.00 0.00 ? 12  VAL A CB   6  
ATOM 9174  C CG1  . VAL A 1 12  ? -242.487 -15.099 104.675 1.00 0.00 ? 12  VAL A CG1  6  
ATOM 9175  C CG2  . VAL A 1 12  ? -243.470 -17.310 105.316 1.00 0.00 ? 12  VAL A CG2  6  
ATOM 9176  H H    . VAL A 1 12  ? -241.429 -15.420 102.107 1.00 0.00 ? 12  VAL A H    6  
ATOM 9177  H HA   . VAL A 1 12  ? -241.864 -18.123 103.164 1.00 0.00 ? 12  VAL A HA   6  
ATOM 9178  H HB   . VAL A 1 12  ? -241.405 -16.862 105.138 1.00 0.00 ? 12  VAL A HB   6  
ATOM 9179  H HG11 . VAL A 1 12  ? -243.369 -14.811 104.118 1.00 0.00 ? 12  VAL A HG11 6  
ATOM 9180  H HG12 . VAL A 1 12  ? -242.592 -14.786 105.704 1.00 0.00 ? 12  VAL A HG12 6  
ATOM 9181  H HG13 . VAL A 1 12  ? -241.618 -14.626 104.240 1.00 0.00 ? 12  VAL A HG13 6  
ATOM 9182  H HG21 . VAL A 1 12  ? -244.384 -17.132 104.770 1.00 0.00 ? 12  VAL A HG21 6  
ATOM 9183  H HG22 . VAL A 1 12  ? -243.275 -18.372 105.354 1.00 0.00 ? 12  VAL A HG22 6  
ATOM 9184  H HG23 . VAL A 1 12  ? -243.567 -16.924 106.320 1.00 0.00 ? 12  VAL A HG23 6  
ATOM 9185  N N    . THR A 1 13  ? -244.068 -18.146 102.052 1.00 0.00 ? 13  THR A N    6  
ATOM 9186  C CA   . THR A 1 13  ? -245.267 -18.195 101.231 1.00 0.00 ? 13  THR A CA   6  
ATOM 9187  C C    . THR A 1 13  ? -246.499 -17.824 102.062 1.00 0.00 ? 13  THR A C    6  
ATOM 9188  O O    . THR A 1 13  ? -246.739 -18.408 103.119 1.00 0.00 ? 13  THR A O    6  
ATOM 9189  C CB   . THR A 1 13  ? -245.478 -19.612 100.662 1.00 0.00 ? 13  THR A CB   6  
ATOM 9190  O OG1  . THR A 1 13  ? -244.276 -20.073 100.036 1.00 0.00 ? 13  THR A OG1  6  
ATOM 9191  C CG2  . THR A 1 13  ? -246.622 -19.629 99.654  1.00 0.00 ? 13  THR A CG2  6  
ATOM 9192  H H    . THR A 1 13  ? -243.638 -18.987 102.327 1.00 0.00 ? 13  THR A H    6  
ATOM 9193  H HA   . THR A 1 13  ? -245.135 -17.498 100.393 1.00 0.00 ? 13  THR A HA   6  
ATOM 9194  H HB   . THR A 1 13  ? -245.728 -20.275 101.477 1.00 0.00 ? 13  THR A HB   6  
ATOM 9195  H HG1  . THR A 1 13  ? -243.590 -20.198 100.710 1.00 0.00 ? 13  THR A HG1  6  
ATOM 9196  H HG21 . THR A 1 13  ? -246.398 -18.944 98.848  1.00 0.00 ? 13  THR A HG21 6  
ATOM 9197  H HG22 . THR A 1 13  ? -246.738 -20.626 99.258  1.00 0.00 ? 13  THR A HG22 6  
ATOM 9198  H HG23 . THR A 1 13  ? -247.537 -19.325 100.139 1.00 0.00 ? 13  THR A HG23 6  
ATOM 9199  N N    . VAL A 1 14  ? -247.273 -16.866 101.589 1.00 0.00 ? 14  VAL A N    6  
ATOM 9200  C CA   . VAL A 1 14  ? -248.461 -16.424 102.301 1.00 0.00 ? 14  VAL A CA   6  
ATOM 9201  C C    . VAL A 1 14  ? -249.728 -16.904 101.595 1.00 0.00 ? 14  VAL A C    6  
ATOM 9202  O O    . VAL A 1 14  ? -249.927 -16.639 100.414 1.00 0.00 ? 14  VAL A O    6  
ATOM 9203  C CB   . VAL A 1 14  ? -248.464 -14.887 102.431 1.00 0.00 ? 14  VAL A CB   6  
ATOM 9204  C CG1  . VAL A 1 14  ? -249.748 -14.369 103.056 1.00 0.00 ? 14  VAL A CG1  6  
ATOM 9205  C CG2  . VAL A 1 14  ? -247.264 -14.437 103.238 1.00 0.00 ? 14  VAL A CG2  6  
ATOM 9206  H H    . VAL A 1 14  ? -247.037 -16.431 100.738 1.00 0.00 ? 14  VAL A H    6  
ATOM 9207  H HA   . VAL A 1 14  ? -248.430 -16.848 103.294 1.00 0.00 ? 14  VAL A HA   6  
ATOM 9208  H HB   . VAL A 1 14  ? -248.378 -14.463 101.440 1.00 0.00 ? 14  VAL A HB   6  
ATOM 9209  H HG11 . VAL A 1 14  ? -249.900 -14.838 104.017 1.00 0.00 ? 14  VAL A HG11 6  
ATOM 9210  H HG12 . VAL A 1 14  ? -249.675 -13.297 103.182 1.00 0.00 ? 14  VAL A HG12 6  
ATOM 9211  H HG13 . VAL A 1 14  ? -250.581 -14.595 102.405 1.00 0.00 ? 14  VAL A HG13 6  
ATOM 9212  H HG21 . VAL A 1 14  ? -247.301 -14.890 104.219 1.00 0.00 ? 14  VAL A HG21 6  
ATOM 9213  H HG22 . VAL A 1 14  ? -246.358 -14.739 102.736 1.00 0.00 ? 14  VAL A HG22 6  
ATOM 9214  H HG23 . VAL A 1 14  ? -247.281 -13.363 103.337 1.00 0.00 ? 14  VAL A HG23 6  
ATOM 9215  N N    . HIS A 1 15  ? -250.571 -17.631 102.327 1.00 0.00 ? 15  HIS A N    6  
ATOM 9216  C CA   . HIS A 1 15  ? -251.814 -18.176 101.775 1.00 0.00 ? 15  HIS A CA   6  
ATOM 9217  C C    . HIS A 1 15  ? -253.002 -17.259 102.038 1.00 0.00 ? 15  HIS A C    6  
ATOM 9218  O O    . HIS A 1 15  ? -254.095 -17.499 101.539 1.00 0.00 ? 15  HIS A O    6  
ATOM 9219  C CB   . HIS A 1 15  ? -252.115 -19.553 102.378 1.00 0.00 ? 15  HIS A CB   6  
ATOM 9220  C CG   . HIS A 1 15  ? -251.440 -20.695 101.684 1.00 0.00 ? 15  HIS A CG   6  
ATOM 9221  N ND1  . HIS A 1 15  ? -252.132 -21.753 101.137 1.00 0.00 ? 15  HIS A ND1  6  
ATOM 9222  C CD2  . HIS A 1 15  ? -250.128 -20.954 101.465 1.00 0.00 ? 15  HIS A CD2  6  
ATOM 9223  C CE1  . HIS A 1 15  ? -251.279 -22.613 100.614 1.00 0.00 ? 15  HIS A CE1  6  
ATOM 9224  N NE2  . HIS A 1 15  ? -250.055 -22.153 100.800 1.00 0.00 ? 15  HIS A NE2  6  
ATOM 9225  H H    . HIS A 1 15  ? -250.348 -17.816 103.267 1.00 0.00 ? 15  HIS A H    6  
ATOM 9226  H HA   . HIS A 1 15  ? -251.685 -18.282 100.710 1.00 0.00 ? 15  HIS A HA   6  
ATOM 9227  H HB2  . HIS A 1 15  ? -251.788 -19.559 103.408 1.00 0.00 ? 15  HIS A HB2  6  
ATOM 9228  H HB3  . HIS A 1 15  ? -253.180 -19.727 102.348 1.00 0.00 ? 15  HIS A HB3  6  
ATOM 9229  H HD1  . HIS A 1 15  ? -253.118 -21.861 101.140 1.00 0.00 ? 15  HIS A HD1  6  
ATOM 9230  H HD2  . HIS A 1 15  ? -249.295 -20.332 101.759 1.00 0.00 ? 15  HIS A HD2  6  
ATOM 9231  H HE1  . HIS A 1 15  ? -251.537 -23.536 100.113 1.00 0.00 ? 15  HIS A HE1  6  
ATOM 9232  H HE2  . HIS A 1 15  ? -249.227 -22.685 100.674 1.00 0.00 ? 15  HIS A HE2  6  
ATOM 9233  N N    . GLY A 1 16  ? -252.797 -16.218 102.831 1.00 0.00 ? 16  GLY A N    6  
ATOM 9234  C CA   . GLY A 1 16  ? -253.907 -15.332 103.163 1.00 0.00 ? 16  GLY A CA   6  
ATOM 9235  C C    . GLY A 1 16  ? -253.686 -13.909 102.689 1.00 0.00 ? 16  GLY A C    6  
ATOM 9236  O O    . GLY A 1 16  ? -254.177 -12.964 103.302 1.00 0.00 ? 16  GLY A O    6  
ATOM 9237  H H    . GLY A 1 16  ? -251.900 -16.053 103.194 1.00 0.00 ? 16  GLY A H    6  
ATOM 9238  H HA2  . GLY A 1 16  ? -254.805 -15.715 102.708 1.00 0.00 ? 16  GLY A HA2  6  
ATOM 9239  H HA3  . GLY A 1 16  ? -254.035 -15.326 104.237 1.00 0.00 ? 16  GLY A HA3  6  
ATOM 9240  N N    . VAL A 1 17  ? -252.961 -13.763 101.591 1.00 0.00 ? 17  VAL A N    6  
ATOM 9241  C CA   . VAL A 1 17  ? -252.552 -12.458 101.095 1.00 0.00 ? 17  VAL A CA   6  
ATOM 9242  C C    . VAL A 1 17  ? -253.747 -11.536 100.826 1.00 0.00 ? 17  VAL A C    6  
ATOM 9243  O O    . VAL A 1 17  ? -254.875 -11.994 100.638 1.00 0.00 ? 17  VAL A O    6  
ATOM 9244  C CB   . VAL A 1 17  ? -251.714 -12.600 99.811  1.00 0.00 ? 17  VAL A CB   6  
ATOM 9245  C CG1  . VAL A 1 17  ? -250.633 -13.644 99.992  1.00 0.00 ? 17  VAL A CG1  6  
ATOM 9246  C CG2  . VAL A 1 17  ? -252.583 -12.931 98.606  1.00 0.00 ? 17  VAL A CG2  6  
ATOM 9247  H H    . VAL A 1 17  ? -252.691 -14.554 101.096 1.00 0.00 ? 17  VAL A H    6  
ATOM 9248  H HA   . VAL A 1 17  ? -251.929 -12.001 101.850 1.00 0.00 ? 17  VAL A HA   6  
ATOM 9249  H HB   . VAL A 1 17  ? -251.227 -11.662 99.635  1.00 0.00 ? 17  VAL A HB   6  
ATOM 9250  H HG11 . VAL A 1 17  ? -251.087 -14.592 100.243 1.00 0.00 ? 17  VAL A HG11 6  
ATOM 9251  H HG12 . VAL A 1 17  ? -250.071 -13.744 99.074  1.00 0.00 ? 17  VAL A HG12 6  
ATOM 9252  H HG13 . VAL A 1 17  ? -249.967 -13.339 100.787 1.00 0.00 ? 17  VAL A HG13 6  
ATOM 9253  H HG21 . VAL A 1 17  ? -253.102 -13.860 98.781  1.00 0.00 ? 17  VAL A HG21 6  
ATOM 9254  H HG22 . VAL A 1 17  ? -253.303 -12.141 98.456  1.00 0.00 ? 17  VAL A HG22 6  
ATOM 9255  H HG23 . VAL A 1 17  ? -251.962 -13.023 97.727  1.00 0.00 ? 17  VAL A HG23 6  
ATOM 9256  N N    . PRO A 1 18  ? -253.498 -10.214 100.822 1.00 0.00 ? 18  PRO A N    6  
ATOM 9257  C CA   . PRO A 1 18  ? -254.528 -9.195  100.557 1.00 0.00 ? 18  PRO A CA   6  
ATOM 9258  C C    . PRO A 1 18  ? -254.890 -9.143  99.092  1.00 0.00 ? 18  PRO A C    6  
ATOM 9259  O O    . PRO A 1 18  ? -255.960 -8.682  98.690  1.00 0.00 ? 18  PRO A O    6  
ATOM 9260  C CB   . PRO A 1 18  ? -253.837 -7.903  100.981 1.00 0.00 ? 18  PRO A CB   6  
ATOM 9261  C CG   . PRO A 1 18  ? -252.405 -8.169  100.686 1.00 0.00 ? 18  PRO A CG   6  
ATOM 9262  C CD   . PRO A 1 18  ? -252.181 -9.600  101.075 1.00 0.00 ? 18  PRO A CD   6  
ATOM 9263  H HA   . PRO A 1 18  ? -255.399 -9.363  101.133 1.00 0.00 ? 18  PRO A HA   6  
ATOM 9264  H HB2  . PRO A 1 18  ? -254.220 -7.074  100.401 1.00 0.00 ? 18  PRO A HB2  6  
ATOM 9265  H HB3  . PRO A 1 18  ? -253.998 -7.725  102.033 1.00 0.00 ? 18  PRO A HB3  6  
ATOM 9266  H HG2  . PRO A 1 18  ? -252.214 -8.032  99.631  1.00 0.00 ? 18  PRO A HG2  6  
ATOM 9267  H HG3  . PRO A 1 18  ? -251.780 -7.524  101.262 1.00 0.00 ? 18  PRO A HG3  6  
ATOM 9268  H HD2  . PRO A 1 18  ? -251.418 -10.045 100.453 1.00 0.00 ? 18  PRO A HD2  6  
ATOM 9269  H HD3  . PRO A 1 18  ? -251.913 -9.680  102.118 1.00 0.00 ? 18  PRO A HD3  6  
ATOM 9270  N N    . GLY A 1 19  ? -253.949 -9.616  98.329  1.00 0.00 ? 19  GLY A N    6  
ATOM 9271  C CA   . GLY A 1 19  ? -254.089 -9.734  96.891  1.00 0.00 ? 19  GLY A CA   6  
ATOM 9272  C C    . GLY A 1 19  ? -255.172 -10.709 96.477  1.00 0.00 ? 19  GLY A C    6  
ATOM 9273  O O    . GLY A 1 19  ? -255.761 -11.394 97.315  1.00 0.00 ? 19  GLY A O    6  
ATOM 9274  H H    . GLY A 1 19  ? -253.120 -9.885  98.774  1.00 0.00 ? 19  GLY A H    6  
ATOM 9275  H HA2  . GLY A 1 19  ? -254.324 -8.769  96.474  1.00 0.00 ? 19  GLY A HA2  6  
ATOM 9276  H HA3  . GLY A 1 19  ? -253.149 -10.067 96.480  1.00 0.00 ? 19  GLY A HA3  6  
ATOM 9277  N N    . PRO A 1 20  ? -255.457 -10.783 95.177  1.00 0.00 ? 20  PRO A N    6  
ATOM 9278  C CA   . PRO A 1 20  ? -256.444 -11.708 94.626  1.00 0.00 ? 20  PRO A CA   6  
ATOM 9279  C C    . PRO A 1 20  ? -255.901 -13.124 94.593  1.00 0.00 ? 20  PRO A C    6  
ATOM 9280  O O    . PRO A 1 20  ? -256.648 -14.105 94.629  1.00 0.00 ? 20  PRO A O    6  
ATOM 9281  C CB   . PRO A 1 20  ? -256.632 -11.187 93.207  1.00 0.00 ? 20  PRO A CB   6  
ATOM 9282  C CG   . PRO A 1 20  ? -255.302 -10.625 92.868  1.00 0.00 ? 20  PRO A CG   6  
ATOM 9283  C CD   . PRO A 1 20  ? -254.824 -9.972  94.127  1.00 0.00 ? 20  PRO A CD   6  
ATOM 9284  H HA   . PRO A 1 20  ? -257.374 -11.674 95.164  1.00 0.00 ? 20  PRO A HA   6  
ATOM 9285  H HB2  . PRO A 1 20  ? -256.898 -11.998 92.551  1.00 0.00 ? 20  PRO A HB2  6  
ATOM 9286  H HB3  . PRO A 1 20  ? -257.399 -10.428 93.191  1.00 0.00 ? 20  PRO A HB3  6  
ATOM 9287  H HG2  . PRO A 1 20  ? -254.629 -11.417 92.575  1.00 0.00 ? 20  PRO A HG2  6  
ATOM 9288  H HG3  . PRO A 1 20  ? -255.393 -9.904  92.086  1.00 0.00 ? 20  PRO A HG3  6  
ATOM 9289  H HD2  . PRO A 1 20  ? -253.756 -10.031 94.196  1.00 0.00 ? 20  PRO A HD2  6  
ATOM 9290  H HD3  . PRO A 1 20  ? -255.156 -8.948  94.177  1.00 0.00 ? 20  PRO A HD3  6  
ATOM 9291  N N    . GLU A 1 21  ? -254.578 -13.198 94.514  1.00 0.00 ? 21  GLU A N    6  
ATOM 9292  C CA   . GLU A 1 21  ? -253.864 -14.465 94.471  1.00 0.00 ? 21  GLU A CA   6  
ATOM 9293  C C    . GLU A 1 21  ? -254.200 -15.324 95.677  1.00 0.00 ? 21  GLU A C    6  
ATOM 9294  O O    . GLU A 1 21  ? -254.568 -14.828 96.742  1.00 0.00 ? 21  GLU A O    6  
ATOM 9295  C CB   . GLU A 1 21  ? -252.353 -14.230 94.419  1.00 0.00 ? 21  GLU A CB   6  
ATOM 9296  C CG   . GLU A 1 21  ? -251.926 -13.182 93.408  1.00 0.00 ? 21  GLU A CG   6  
ATOM 9297  C CD   . GLU A 1 21  ? -250.421 -13.047 93.314  1.00 0.00 ? 21  GLU A CD   6  
ATOM 9298  O OE1  . GLU A 1 21  ? -249.840 -12.255 94.081  1.00 0.00 ? 21  GLU A OE1  6  
ATOM 9299  O OE2  . GLU A 1 21  ? -249.813 -13.725 92.460  1.00 0.00 ? 21  GLU A OE2  6  
ATOM 9300  H H    . GLU A 1 21  ? -254.067 -12.353 94.475  1.00 0.00 ? 21  GLU A H    6  
ATOM 9301  H HA   . GLU A 1 21  ? -254.171 -14.999 93.582  1.00 0.00 ? 21  GLU A HA   6  
ATOM 9302  H HB2  . GLU A 1 21  ? -252.010 -13.929 95.397  1.00 0.00 ? 21  GLU A HB2  6  
ATOM 9303  H HB3  . GLU A 1 21  ? -251.876 -15.158 94.156  1.00 0.00 ? 21  GLU A HB3  6  
ATOM 9304  H HG2  . GLU A 1 21  ? -252.309 -13.461 92.438  1.00 0.00 ? 21  GLU A HG2  6  
ATOM 9305  H HG3  . GLU A 1 21  ? -252.342 -12.230 93.700  1.00 0.00 ? 21  GLU A HG3  6  
ATOM 9306  N N    . PRO A 1 22  ? -254.055 -16.636 95.514  1.00 0.00 ? 22  PRO A N    6  
ATOM 9307  C CA   . PRO A 1 22  ? -254.373 -17.605 96.548  1.00 0.00 ? 22  PRO A CA   6  
ATOM 9308  C C    . PRO A 1 22  ? -253.238 -17.694 97.529  1.00 0.00 ? 22  PRO A C    6  
ATOM 9309  O O    . PRO A 1 22  ? -253.414 -17.852 98.737  1.00 0.00 ? 22  PRO A O    6  
ATOM 9310  C CB   . PRO A 1 22  ? -254.502 -18.923 95.782  1.00 0.00 ? 22  PRO A CB   6  
ATOM 9311  C CG   . PRO A 1 22  ? -254.234 -18.593 94.350  1.00 0.00 ? 22  PRO A CG   6  
ATOM 9312  C CD   . PRO A 1 22  ? -253.538 -17.286 94.309  1.00 0.00 ? 22  PRO A CD   6  
ATOM 9313  H HA   . PRO A 1 22  ? -255.292 -17.375 97.055  1.00 0.00 ? 22  PRO A HA   6  
ATOM 9314  H HB2  . PRO A 1 22  ? -253.781 -19.632 96.160  1.00 0.00 ? 22  PRO A HB2  6  
ATOM 9315  H HB3  . PRO A 1 22  ? -255.498 -19.321 95.911  1.00 0.00 ? 22  PRO A HB3  6  
ATOM 9316  H HG2  . PRO A 1 22  ? -253.623 -19.353 93.904  1.00 0.00 ? 22  PRO A HG2  6  
ATOM 9317  H HG3  . PRO A 1 22  ? -255.150 -18.502 93.837  1.00 0.00 ? 22  PRO A HG3  6  
ATOM 9318  H HD2  . PRO A 1 22  ? -252.469 -17.416 94.349  1.00 0.00 ? 22  PRO A HD2  6  
ATOM 9319  H HD3  . PRO A 1 22  ? -253.819 -16.736 93.424  1.00 0.00 ? 22  PRO A HD3  6  
ATOM 9320  N N    . PHE A 1 23  ? -252.066 -17.578 96.964  1.00 0.00 ? 23  PHE A N    6  
ATOM 9321  C CA   . PHE A 1 23  ? -250.834 -17.607 97.727  1.00 0.00 ? 23  PHE A CA   6  
ATOM 9322  C C    . PHE A 1 23  ? -249.723 -16.882 96.980  1.00 0.00 ? 23  PHE A C    6  
ATOM 9323  O O    . PHE A 1 23  ? -249.565 -17.047 95.768  1.00 0.00 ? 23  PHE A O    6  
ATOM 9324  C CB   . PHE A 1 23  ? -250.420 -19.056 98.046  1.00 0.00 ? 23  PHE A CB   6  
ATOM 9325  C CG   . PHE A 1 23  ? -250.015 -19.877 96.848  1.00 0.00 ? 23  PHE A CG   6  
ATOM 9326  C CD1  . PHE A 1 23  ? -250.969 -20.421 96.002  1.00 0.00 ? 23  PHE A CD1  6  
ATOM 9327  C CD2  . PHE A 1 23  ? -248.677 -20.111 96.577  1.00 0.00 ? 23  PHE A CD2  6  
ATOM 9328  C CE1  . PHE A 1 23  ? -250.593 -21.180 94.908  1.00 0.00 ? 23  PHE A CE1  6  
ATOM 9329  C CE2  . PHE A 1 23  ? -248.295 -20.868 95.486  1.00 0.00 ? 23  PHE A CE2  6  
ATOM 9330  C CZ   . PHE A 1 23  ? -249.256 -21.402 94.650  1.00 0.00 ? 23  PHE A CZ   6  
ATOM 9331  H H    . PHE A 1 23  ? -252.039 -17.460 95.982  1.00 0.00 ? 23  PHE A H    6  
ATOM 9332  H HA   . PHE A 1 23  ? -251.015 -17.087 98.658  1.00 0.00 ? 23  PHE A HA   6  
ATOM 9333  H HB2  . PHE A 1 23  ? -249.584 -19.038 98.725  1.00 0.00 ? 23  PHE A HB2  6  
ATOM 9334  H HB3  . PHE A 1 23  ? -251.249 -19.558 98.524  1.00 0.00 ? 23  PHE A HB3  6  
ATOM 9335  H HD1  . PHE A 1 23  ? -252.016 -20.247 96.199  1.00 0.00 ? 23  PHE A HD1  6  
ATOM 9336  H HD2  . PHE A 1 23  ? -247.924 -19.694 97.229  1.00 0.00 ? 23  PHE A HD2  6  
ATOM 9337  H HE1  . PHE A 1 23  ? -251.346 -21.599 94.257  1.00 0.00 ? 23  PHE A HE1  6  
ATOM 9338  H HE2  . PHE A 1 23  ? -247.248 -21.039 95.285  1.00 0.00 ? 23  PHE A HE2  6  
ATOM 9339  H HZ   . PHE A 1 23  ? -248.961 -21.995 93.794  1.00 0.00 ? 23  PHE A HZ   6  
ATOM 9340  N N    . THR A 1 24  ? -248.987 -16.058 97.704  1.00 0.00 ? 24  THR A N    6  
ATOM 9341  C CA   . THR A 1 24  ? -247.802 -15.418 97.168  1.00 0.00 ? 24  THR A CA   6  
ATOM 9342  C C    . THR A 1 24  ? -246.772 -15.252 98.284  1.00 0.00 ? 24  THR A C    6  
ATOM 9343  O O    . THR A 1 24  ? -247.122 -15.079 99.452  1.00 0.00 ? 24  THR A O    6  
ATOM 9344  C CB   . THR A 1 24  ? -248.110 -14.066 96.474  1.00 0.00 ? 24  THR A CB   6  
ATOM 9345  O OG1  . THR A 1 24  ? -246.918 -13.518 95.898  1.00 0.00 ? 24  THR A OG1  6  
ATOM 9346  C CG2  . THR A 1 24  ? -248.706 -13.057 97.434  1.00 0.00 ? 24  THR A CG2  6  
ATOM 9347  H H    . THR A 1 24  ? -249.242 -15.881 98.636  1.00 0.00 ? 24  THR A H    6  
ATOM 9348  H HA   . THR A 1 24  ? -247.387 -16.087 96.425  1.00 0.00 ? 24  THR A HA   6  
ATOM 9349  H HB   . THR A 1 24  ? -248.824 -14.246 95.683  1.00 0.00 ? 24  THR A HB   6  
ATOM 9350  H HG1  . THR A 1 24  ? -247.155 -12.769 95.327  1.00 0.00 ? 24  THR A HG1  6  
ATOM 9351  H HG21 . THR A 1 24  ? -249.626 -13.450 97.841  1.00 0.00 ? 24  THR A HG21 6  
ATOM 9352  H HG22 . THR A 1 24  ? -248.009 -12.868 98.237  1.00 0.00 ? 24  THR A HG22 6  
ATOM 9353  H HG23 . THR A 1 24  ? -248.910 -12.136 96.908  1.00 0.00 ? 24  THR A HG23 6  
ATOM 9354  N N    . VAL A 1 25  ? -245.512 -15.350 97.912  1.00 0.00 ? 25  VAL A N    6  
ATOM 9355  C CA   . VAL A 1 25  ? -244.409 -15.452 98.861  1.00 0.00 ? 25  VAL A CA   6  
ATOM 9356  C C    . VAL A 1 25  ? -243.621 -14.135 98.917  1.00 0.00 ? 25  VAL A C    6  
ATOM 9357  O O    . VAL A 1 25  ? -243.282 -13.578 97.874  1.00 0.00 ? 25  VAL A O    6  
ATOM 9358  C CB   . VAL A 1 25  ? -243.476 -16.592 98.398  1.00 0.00 ? 25  VAL A CB   6  
ATOM 9359  C CG1  . VAL A 1 25  ? -242.518 -17.031 99.478  1.00 0.00 ? 25  VAL A CG1  6  
ATOM 9360  C CG2  . VAL A 1 25  ? -244.275 -17.774 97.867  1.00 0.00 ? 25  VAL A CG2  6  
ATOM 9361  H H    . VAL A 1 25  ? -245.304 -15.351 96.947  1.00 0.00 ? 25  VAL A H    6  
ATOM 9362  H HA   . VAL A 1 25  ? -244.798 -15.692 99.841  1.00 0.00 ? 25  VAL A HA   6  
ATOM 9363  H HB   . VAL A 1 25  ? -242.897 -16.218 97.599  1.00 0.00 ? 25  VAL A HB   6  
ATOM 9364  H HG11 . VAL A 1 25  ? -243.074 -17.373 100.338 1.00 0.00 ? 25  VAL A HG11 6  
ATOM 9365  H HG12 . VAL A 1 25  ? -241.900 -17.835 99.107  1.00 0.00 ? 25  VAL A HG12 6  
ATOM 9366  H HG13 . VAL A 1 25  ? -241.891 -16.198 99.763  1.00 0.00 ? 25  VAL A HG13 6  
ATOM 9367  H HG21 . VAL A 1 25  ? -244.893 -17.450 97.045  1.00 0.00 ? 25  VAL A HG21 6  
ATOM 9368  H HG22 . VAL A 1 25  ? -243.596 -18.543 97.528  1.00 0.00 ? 25  VAL A HG22 6  
ATOM 9369  H HG23 . VAL A 1 25  ? -244.899 -18.169 98.656  1.00 0.00 ? 25  VAL A HG23 6  
ATOM 9370  N N    . PHE A 1 26  ? -243.329 -13.631 100.118 1.00 0.00 ? 26  PHE A N    6  
ATOM 9371  C CA   . PHE A 1 26  ? -242.560 -12.383 100.247 1.00 0.00 ? 26  PHE A CA   6  
ATOM 9372  C C    . PHE A 1 26  ? -241.246 -12.620 100.963 1.00 0.00 ? 26  PHE A C    6  
ATOM 9373  O O    . PHE A 1 26  ? -241.162 -13.446 101.873 1.00 0.00 ? 26  PHE A O    6  
ATOM 9374  C CB   . PHE A 1 26  ? -243.351 -11.294 100.975 1.00 0.00 ? 26  PHE A CB   6  
ATOM 9375  C CG   . PHE A 1 26  ? -244.669 -10.989 100.318 1.00 0.00 ? 26  PHE A CG   6  
ATOM 9376  C CD1  . PHE A 1 26  ? -245.805 -11.726 100.620 1.00 0.00 ? 26  PHE A CD1  6  
ATOM 9377  C CD2  . PHE A 1 26  ? -244.764 -9.974  99.386  1.00 0.00 ? 26  PHE A CD2  6  
ATOM 9378  C CE1  . PHE A 1 26  ? -247.009 -11.448 100.005 1.00 0.00 ? 26  PHE A CE1  6  
ATOM 9379  C CE2  . PHE A 1 26  ? -245.964 -9.693  98.766  1.00 0.00 ? 26  PHE A CE2  6  
ATOM 9380  C CZ   . PHE A 1 26  ? -247.088 -10.431 99.076  1.00 0.00 ? 26  PHE A CZ   6  
ATOM 9381  H H    . PHE A 1 26  ? -243.630 -14.103 100.927 1.00 0.00 ? 26  PHE A H    6  
ATOM 9382  H HA   . PHE A 1 26  ? -242.340 -12.038 99.252  1.00 0.00 ? 26  PHE A HA   6  
ATOM 9383  H HB2  . PHE A 1 26  ? -243.530 -11.592 101.990 1.00 0.00 ? 26  PHE A HB2  6  
ATOM 9384  H HB3  . PHE A 1 26  ? -242.766 -10.387 100.989 1.00 0.00 ? 26  PHE A HB3  6  
ATOM 9385  H HD1  . PHE A 1 26  ? -245.741 -12.523 101.350 1.00 0.00 ? 26  PHE A HD1  6  
ATOM 9386  H HD2  . PHE A 1 26  ? -243.886 -9.394  99.145  1.00 0.00 ? 26  PHE A HD2  6  
ATOM 9387  H HE1  . PHE A 1 26  ? -247.887 -12.027 100.249 1.00 0.00 ? 26  PHE A HE1  6  
ATOM 9388  H HE2  . PHE A 1 26  ? -246.024 -8.895  98.042  1.00 0.00 ? 26  PHE A HE2  6  
ATOM 9389  H HZ   . PHE A 1 26  ? -248.029 -10.213 98.592  1.00 0.00 ? 26  PHE A HZ   6  
ATOM 9390  N N    . THR A 1 27  ? -240.219 -11.904 100.533 1.00 0.00 ? 27  THR A N    6  
ATOM 9391  C CA   . THR A 1 27  ? -238.883 -12.087 101.067 1.00 0.00 ? 27  THR A CA   6  
ATOM 9392  C C    . THR A 1 27  ? -238.668 -11.216 102.293 1.00 0.00 ? 27  THR A C    6  
ATOM 9393  O O    . THR A 1 27  ? -239.099 -10.071 102.332 1.00 0.00 ? 27  THR A O    6  
ATOM 9394  C CB   . THR A 1 27  ? -237.813 -11.757 100.013 1.00 0.00 ? 27  THR A CB   6  
ATOM 9395  O OG1  . THR A 1 27  ? -238.388 -11.823 98.697  1.00 0.00 ? 27  THR A OG1  6  
ATOM 9396  C CG2  . THR A 1 27  ? -236.661 -12.744 100.107 1.00 0.00 ? 27  THR A CG2  6  
ATOM 9397  H H    . THR A 1 27  ? -240.366 -11.223 99.841  1.00 0.00 ? 27  THR A H    6  
ATOM 9398  H HA   . THR A 1 27  ? -238.775 -13.124 101.350 1.00 0.00 ? 27  THR A HA   6  
ATOM 9399  H HB   . THR A 1 27  ? -237.438 -10.759 100.193 1.00 0.00 ? 27  THR A HB   6  
ATOM 9400  H HG1  . THR A 1 27  ? -239.109 -11.177 98.630  1.00 0.00 ? 27  THR A HG1  6  
ATOM 9401  H HG21 . THR A 1 27  ? -237.039 -13.745 99.951  1.00 0.00 ? 27  THR A HG21 6  
ATOM 9402  H HG22 . THR A 1 27  ? -235.926 -12.513 99.347  1.00 0.00 ? 27  THR A HG22 6  
ATOM 9403  H HG23 . THR A 1 27  ? -236.204 -12.680 101.085 1.00 0.00 ? 27  THR A HG23 6  
ATOM 9404  N N    . ILE A 1 28  ? -237.998 -11.770 103.285 1.00 0.00 ? 28  ILE A N    6  
ATOM 9405  C CA   . ILE A 1 28  ? -237.778 -11.082 104.545 1.00 0.00 ? 28  ILE A CA   6  
ATOM 9406  C C    . ILE A 1 28  ? -236.319 -10.653 104.660 1.00 0.00 ? 28  ILE A C    6  
ATOM 9407  O O    . ILE A 1 28  ? -235.574 -10.761 103.692 1.00 0.00 ? 28  ILE A O    6  
ATOM 9408  C CB   . ILE A 1 28  ? -238.146 -11.997 105.721 1.00 0.00 ? 28  ILE A CB   6  
ATOM 9409  C CG1  . ILE A 1 28  ? -237.038 -13.021 105.969 1.00 0.00 ? 28  ILE A CG1  6  
ATOM 9410  C CG2  . ILE A 1 28  ? -239.464 -12.707 105.422 1.00 0.00 ? 28  ILE A CG2  6  
ATOM 9411  C CD1  . ILE A 1 28  ? -237.307 -13.921 107.140 1.00 0.00 ? 28  ILE A CD1  6  
ATOM 9412  H H    . ILE A 1 28  ? -237.655 -12.684 103.176 1.00 0.00 ? 28  ILE A H    6  
ATOM 9413  H HA   . ILE A 1 28  ? -238.409 -10.215 104.577 1.00 0.00 ? 28  ILE A HA   6  
ATOM 9414  H HB   . ILE A 1 28  ? -238.280 -11.388 106.606 1.00 0.00 ? 28  ILE A HB   6  
ATOM 9415  H HG12 . ILE A 1 28  ? -236.929 -13.643 105.092 1.00 0.00 ? 28  ILE A HG12 6  
ATOM 9416  H HG13 . ILE A 1 28  ? -236.110 -12.500 106.155 1.00 0.00 ? 28  ILE A HG13 6  
ATOM 9417  H HG21 . ILE A 1 28  ? -240.238 -11.973 105.209 1.00 0.00 ? 28  ILE A HG21 6  
ATOM 9418  H HG22 . ILE A 1 28  ? -239.344 -13.362 104.572 1.00 0.00 ? 28  ILE A HG22 6  
ATOM 9419  H HG23 . ILE A 1 28  ? -239.757 -13.283 106.288 1.00 0.00 ? 28  ILE A HG23 6  
ATOM 9420  H HD11 . ILE A 1 28  ? -237.459 -13.318 108.022 1.00 0.00 ? 28  ILE A HD11 6  
ATOM 9421  H HD12 . ILE A 1 28  ? -238.194 -14.504 106.947 1.00 0.00 ? 28  ILE A HD12 6  
ATOM 9422  H HD13 . ILE A 1 28  ? -236.464 -14.578 107.290 1.00 0.00 ? 28  ILE A HD13 6  
ATOM 9423  N N    . ASN A 1 29  ? -235.919 -10.151 105.822 1.00 0.00 ? 29  ASN A N    6  
ATOM 9424  C CA   . ASN A 1 29  ? -234.521 -9.801  106.060 1.00 0.00 ? 29  ASN A CA   6  
ATOM 9425  C C    . ASN A 1 29  ? -234.224 -9.790  107.556 1.00 0.00 ? 29  ASN A C    6  
ATOM 9426  O O    . ASN A 1 29  ? -235.053 -9.358  108.355 1.00 0.00 ? 29  ASN A O    6  
ATOM 9427  C CB   . ASN A 1 29  ? -234.158 -8.443  105.441 1.00 0.00 ? 29  ASN A CB   6  
ATOM 9428  C CG   . ASN A 1 29  ? -234.955 -7.290  106.017 1.00 0.00 ? 29  ASN A CG   6  
ATOM 9429  O OD1  . ASN A 1 29  ? -234.551 -6.666  107.000 1.00 0.00 ? 29  ASN A OD1  6  
ATOM 9430  N ND2  . ASN A 1 29  ? -236.079 -6.989  105.392 1.00 0.00 ? 29  ASN A ND2  6  
ATOM 9431  H H    . ASN A 1 29  ? -236.568 -10.033 106.546 1.00 0.00 ? 29  ASN A H    6  
ATOM 9432  H HA   . ASN A 1 29  ? -233.920 -10.562 105.594 1.00 0.00 ? 29  ASN A HA   6  
ATOM 9433  H HB2  . ASN A 1 29  ? -233.111 -8.247  105.616 1.00 0.00 ? 29  ASN A HB2  6  
ATOM 9434  H HB3  . ASN A 1 29  ? -234.338 -8.485  104.376 1.00 0.00 ? 29  ASN A HB3  6  
ATOM 9435  H HD21 . ASN A 1 29  ? -236.328 -7.518  104.599 1.00 0.00 ? 29  ASN A HD21 6  
ATOM 9436  H HD22 . ASN A 1 29  ? -236.618 -6.260  105.744 1.00 0.00 ? 29  ASN A HD22 6  
ATOM 9437  N N    . GLY A 1 30  ? -233.051 -10.291 107.924 1.00 0.00 ? 30  GLY A N    6  
ATOM 9438  C CA   . GLY A 1 30  ? -232.633 -10.280 109.315 1.00 0.00 ? 30  GLY A CA   6  
ATOM 9439  C C    . GLY A 1 30  ? -233.446 -11.223 110.184 1.00 0.00 ? 30  GLY A C    6  
ATOM 9440  O O    . GLY A 1 30  ? -233.500 -12.429 109.927 1.00 0.00 ? 30  GLY A O    6  
ATOM 9441  H H    . GLY A 1 30  ? -232.470 -10.692 107.245 1.00 0.00 ? 30  GLY A H    6  
ATOM 9442  H HA2  . GLY A 1 30  ? -231.593 -10.569 109.369 1.00 0.00 ? 30  GLY A HA2  6  
ATOM 9443  H HA3  . GLY A 1 30  ? -232.734 -9.275  109.701 1.00 0.00 ? 30  GLY A HA3  6  
ATOM 9444  N N    . GLY A 1 31  ? -234.078 -10.669 111.209 1.00 0.00 ? 31  GLY A N    6  
ATOM 9445  C CA   . GLY A 1 31  ? -234.887 -11.465 112.111 1.00 0.00 ? 31  GLY A CA   6  
ATOM 9446  C C    . GLY A 1 31  ? -236.306 -10.942 112.200 1.00 0.00 ? 31  GLY A C    6  
ATOM 9447  O O    . GLY A 1 31  ? -236.740 -10.452 113.247 1.00 0.00 ? 31  GLY A O    6  
ATOM 9448  H H    . GLY A 1 31  ? -234.001 -9.704  111.352 1.00 0.00 ? 31  GLY A H    6  
ATOM 9449  H HA2  . GLY A 1 31  ? -234.909 -12.485 111.757 1.00 0.00 ? 31  GLY A HA2  6  
ATOM 9450  H HA3  . GLY A 1 31  ? -234.442 -11.442 113.095 1.00 0.00 ? 31  GLY A HA3  6  
ATOM 9451  N N    . THR A 1 32  ? -237.023 -11.038 111.092 1.00 0.00 ? 32  THR A N    6  
ATOM 9452  C CA   . THR A 1 32  ? -238.380 -10.531 110.999 1.00 0.00 ? 32  THR A CA   6  
ATOM 9453  C C    . THR A 1 32  ? -239.345 -11.274 111.916 1.00 0.00 ? 32  THR A C    6  
ATOM 9454  O O    . THR A 1 32  ? -239.395 -12.504 111.915 1.00 0.00 ? 32  THR A O    6  
ATOM 9455  C CB   . THR A 1 32  ? -238.900 -10.641 109.574 1.00 0.00 ? 32  THR A CB   6  
ATOM 9456  O OG1  . THR A 1 32  ? -238.461 -11.879 109.011 1.00 0.00 ? 32  THR A OG1  6  
ATOM 9457  C CG2  . THR A 1 32  ? -238.415 -9.480  108.720 1.00 0.00 ? 32  THR A CG2  6  
ATOM 9458  H H    . THR A 1 32  ? -236.628 -11.470 110.306 1.00 0.00 ? 32  THR A H    6  
ATOM 9459  H HA   . THR A 1 32  ? -238.366 -9.490  111.253 1.00 0.00 ? 32  THR A HA   6  
ATOM 9460  H HB   . THR A 1 32  ? -239.989 -10.622 109.609 1.00 0.00 ? 32  THR A HB   6  
ATOM 9461  H HG1  . THR A 1 32  ? -238.825 -12.611 109.524 1.00 0.00 ? 32  THR A HG1  6  
ATOM 9462  H HG21 . THR A 1 32  ? -237.336 -9.461  108.717 1.00 0.00 ? 32  THR A HG21 6  
ATOM 9463  H HG22 . THR A 1 32  ? -238.775 -9.605  107.710 1.00 0.00 ? 32  THR A HG22 6  
ATOM 9464  H HG23 . THR A 1 32  ? -238.794 -8.554  109.124 1.00 0.00 ? 32  THR A HG23 6  
ATOM 9465  N N    . LYS A 1 33  ? -240.109 -10.522 112.693 1.00 0.00 ? 33  LYS A N    6  
ATOM 9466  C CA   . LYS A 1 33  ? -241.225 -11.089 113.435 1.00 0.00 ? 33  LYS A CA   6  
ATOM 9467  C C    . LYS A 1 33  ? -242.393 -11.279 112.496 1.00 0.00 ? 33  LYS A C    6  
ATOM 9468  O O    . LYS A 1 33  ? -242.288 -10.988 111.309 1.00 0.00 ? 33  LYS A O    6  
ATOM 9469  C CB   . LYS A 1 33  ? -241.668 -10.175 114.567 1.00 0.00 ? 33  LYS A CB   6  
ATOM 9470  C CG   . LYS A 1 33  ? -240.659 -10.044 115.676 1.00 0.00 ? 33  LYS A CG   6  
ATOM 9471  C CD   . LYS A 1 33  ? -239.648 -8.942  115.407 1.00 0.00 ? 33  LYS A CD   6  
ATOM 9472  C CE   . LYS A 1 33  ? -238.394 -9.136  116.244 1.00 0.00 ? 33  LYS A CE   6  
ATOM 9473  N NZ   . LYS A 1 33  ? -237.663 -10.379 115.871 1.00 0.00 ? 33  LYS A NZ   6  
ATOM 9474  H H    . LYS A 1 33  ? -239.918 -9.568  112.773 1.00 0.00 ? 33  LYS A H    6  
ATOM 9475  H HA   . LYS A 1 33  ? -240.922 -12.043 113.837 1.00 0.00 ? 33  LYS A HA   6  
ATOM 9476  H HB2  . LYS A 1 33  ? -241.856 -9.191  114.163 1.00 0.00 ? 33  LYS A HB2  6  
ATOM 9477  H HB3  . LYS A 1 33  ? -242.585 -10.563 114.985 1.00 0.00 ? 33  LYS A HB3  6  
ATOM 9478  H HG2  . LYS A 1 33  ? -241.188 -9.827  116.582 1.00 0.00 ? 33  LYS A HG2  6  
ATOM 9479  H HG3  . LYS A 1 33  ? -240.133 -10.983 115.784 1.00 0.00 ? 33  LYS A HG3  6  
ATOM 9480  H HD2  . LYS A 1 33  ? -239.381 -8.956  114.360 1.00 0.00 ? 33  LYS A HD2  6  
ATOM 9481  H HD3  . LYS A 1 33  ? -240.093 -7.991  115.656 1.00 0.00 ? 33  LYS A HD3  6  
ATOM 9482  H HE2  . LYS A 1 33  ? -237.743 -8.288  116.099 1.00 0.00 ? 33  LYS A HE2  6  
ATOM 9483  H HE3  . LYS A 1 33  ? -238.680 -9.195  117.286 1.00 0.00 ? 33  LYS A HE3  6  
ATOM 9484  H HZ1  . LYS A 1 33  ? -238.301 -11.209 115.930 1.00 0.00 ? 33  LYS A HZ1  6  
ATOM 9485  H HZ2  . LYS A 1 33  ? -237.295 -10.306 114.900 1.00 0.00 ? 33  LYS A HZ2  6  
ATOM 9486  H HZ3  . LYS A 1 33  ? -236.861 -10.532 116.518 1.00 0.00 ? 33  LYS A HZ3  6  
ATOM 9487  N N    . ALA A 1 34  ? -243.516 -11.727 113.029 1.00 0.00 ? 34  ALA A N    6  
ATOM 9488  C CA   . ALA A 1 34  ? -244.733 -11.808 112.242 1.00 0.00 ? 34  ALA A CA   6  
ATOM 9489  C C    . ALA A 1 34  ? -245.221 -10.405 111.883 1.00 0.00 ? 34  ALA A C    6  
ATOM 9490  O O    . ALA A 1 34  ? -245.950 -10.216 110.919 1.00 0.00 ? 34  ALA A O    6  
ATOM 9491  C CB   . ALA A 1 34  ? -245.803 -12.567 113.001 1.00 0.00 ? 34  ALA A CB   6  
ATOM 9492  H H    . ALA A 1 34  ? -243.528 -12.016 113.975 1.00 0.00 ? 34  ALA A H    6  
ATOM 9493  H HA   . ALA A 1 34  ? -244.507 -12.350 111.326 1.00 0.00 ? 34  ALA A HA   6  
ATOM 9494  H HB1  . ALA A 1 34  ? -246.054 -12.027 113.903 1.00 0.00 ? 34  ALA A HB1  6  
ATOM 9495  H HB2  . ALA A 1 34  ? -246.683 -12.665 112.383 1.00 0.00 ? 34  ALA A HB2  6  
ATOM 9496  H HB3  . ALA A 1 34  ? -245.433 -13.547 113.258 1.00 0.00 ? 34  ALA A HB3  6  
ATOM 9497  N N    . LYS A 1 35  ? -244.791 -9.424  112.667 1.00 0.00 ? 35  LYS A N    6  
ATOM 9498  C CA   . LYS A 1 35  ? -245.202 -8.034  112.460 1.00 0.00 ? 35  LYS A CA   6  
ATOM 9499  C C    . LYS A 1 35  ? -244.373 -7.412  111.352 1.00 0.00 ? 35  LYS A C    6  
ATOM 9500  O O    . LYS A 1 35  ? -244.904 -6.819  110.414 1.00 0.00 ? 35  LYS A O    6  
ATOM 9501  C CB   . LYS A 1 35  ? -245.077 -7.218  113.758 1.00 0.00 ? 35  LYS A CB   6  
ATOM 9502  C CG   . LYS A 1 35  ? -243.697 -7.251  114.401 1.00 0.00 ? 35  LYS A CG   6  
ATOM 9503  C CD   . LYS A 1 35  ? -243.651 -6.425  115.680 1.00 0.00 ? 35  LYS A CD   6  
ATOM 9504  C CE   . LYS A 1 35  ? -244.443 -7.077  116.806 1.00 0.00 ? 35  LYS A CE   6  
ATOM 9505  N NZ   . LYS A 1 35  ? -244.443 -6.256  118.047 1.00 0.00 ? 35  LYS A NZ   6  
ATOM 9506  H H    . LYS A 1 35  ? -244.137 -9.633  113.361 1.00 0.00 ? 35  LYS A H    6  
ATOM 9507  H HA   . LYS A 1 35  ? -246.239 -8.039  112.143 1.00 0.00 ? 35  LYS A HA   6  
ATOM 9508  H HB2  . LYS A 1 35  ? -245.317 -6.188  113.541 1.00 0.00 ? 35  LYS A HB2  6  
ATOM 9509  H HB3  . LYS A 1 35  ? -245.792 -7.598  114.475 1.00 0.00 ? 35  LYS A HB3  6  
ATOM 9510  H HG2  . LYS A 1 35  ? -243.448 -8.276  114.636 1.00 0.00 ? 35  LYS A HG2  6  
ATOM 9511  H HG3  . LYS A 1 35  ? -242.975 -6.856  113.700 1.00 0.00 ? 35  LYS A HG3  6  
ATOM 9512  H HD2  . LYS A 1 35  ? -242.623 -6.318  115.990 1.00 0.00 ? 35  LYS A HD2  6  
ATOM 9513  H HD3  . LYS A 1 35  ? -244.070 -5.451  115.475 1.00 0.00 ? 35  LYS A HD3  6  
ATOM 9514  H HE2  . LYS A 1 35  ? -245.461 -7.215  116.480 1.00 0.00 ? 35  LYS A HE2  6  
ATOM 9515  H HE3  . LYS A 1 35  ? -244.004 -8.040  117.025 1.00 0.00 ? 35  LYS A HE3  6  
ATOM 9516  H HZ1  . LYS A 1 35  ? -243.465 -6.025  118.330 1.00 0.00 ? 35  LYS A HZ1  6  
ATOM 9517  H HZ2  . LYS A 1 35  ? -244.967 -5.367  117.891 1.00 0.00 ? 35  LYS A HZ2  6  
ATOM 9518  H HZ3  . LYS A 1 35  ? -244.903 -6.782  118.827 1.00 0.00 ? 35  LYS A HZ3  6  
ATOM 9519  N N    . GLN A 1 36  ? -243.063 -7.579  111.461 1.00 0.00 ? 36  GLN A N    6  
ATOM 9520  C CA   . GLN A 1 36  ? -242.146 -7.133  110.438 1.00 0.00 ? 36  GLN A CA   6  
ATOM 9521  C C    . GLN A 1 36  ? -242.388 -7.924  109.169 1.00 0.00 ? 36  GLN A C    6  
ATOM 9522  O O    . GLN A 1 36  ? -242.020 -7.503  108.070 1.00 0.00 ? 36  GLN A O    6  
ATOM 9523  C CB   . GLN A 1 36  ? -240.705 -7.296  110.913 1.00 0.00 ? 36  GLN A CB   6  
ATOM 9524  C CG   . GLN A 1 36  ? -240.421 -6.589  112.230 1.00 0.00 ? 36  GLN A CG   6  
ATOM 9525  C CD   . GLN A 1 36  ? -240.876 -5.145  112.224 1.00 0.00 ? 36  GLN A CD   6  
ATOM 9526  O OE1  . GLN A 1 36  ? -242.019 -4.844  112.561 1.00 0.00 ? 36  GLN A OE1  6  
ATOM 9527  N NE2  . GLN A 1 36  ? -239.983 -4.240  111.860 1.00 0.00 ? 36  GLN A NE2  6  
ATOM 9528  H H    . GLN A 1 36  ? -242.701 -8.008  112.261 1.00 0.00 ? 36  GLN A H    6  
ATOM 9529  H HA   . GLN A 1 36  ? -242.342 -6.087  110.246 1.00 0.00 ? 36  GLN A HA   6  
ATOM 9530  H HB2  . GLN A 1 36  ? -240.493 -8.348  111.037 1.00 0.00 ? 36  GLN A HB2  6  
ATOM 9531  H HB3  . GLN A 1 36  ? -240.049 -6.893  110.165 1.00 0.00 ? 36  GLN A HB3  6  
ATOM 9532  H HG2  . GLN A 1 36  ? -240.938 -7.109  113.019 1.00 0.00 ? 36  GLN A HG2  6  
ATOM 9533  H HG3  . GLN A 1 36  ? -239.358 -6.614  112.417 1.00 0.00 ? 36  GLN A HG3  6  
ATOM 9534  H HE21 . GLN A 1 36  ? -239.076 -4.547  111.613 1.00 0.00 ? 36  GLN A HE21 6  
ATOM 9535  H HE22 . GLN A 1 36  ? -240.260 -3.299  111.857 1.00 0.00 ? 36  GLN A HE22 6  
ATOM 9536  N N    . LEU A 1 37  ? -242.983 -9.095  109.331 1.00 0.00 ? 37  LEU A N    6  
ATOM 9537  C CA   . LEU A 1 37  ? -243.308 -9.924  108.202 1.00 0.00 ? 37  LEU A CA   6  
ATOM 9538  C C    . LEU A 1 37  ? -244.598 -9.545  107.547 1.00 0.00 ? 37  LEU A C    6  
ATOM 9539  O O    . LEU A 1 37  ? -244.657 -9.492  106.332 1.00 0.00 ? 37  LEU A O    6  
ATOM 9540  C CB   . LEU A 1 37  ? -243.356 -11.381 108.567 1.00 0.00 ? 37  LEU A CB   6  
ATOM 9541  C CG   . LEU A 1 37  ? -242.524 -12.181 107.617 1.00 0.00 ? 37  LEU A CG   6  
ATOM 9542  C CD1  . LEU A 1 37  ? -243.103 -12.075 106.222 1.00 0.00 ? 37  LEU A CD1  6  
ATOM 9543  C CD2  . LEU A 1 37  ? -241.153 -11.585 107.623 1.00 0.00 ? 37  LEU A CD2  6  
ATOM 9544  H H    . LEU A 1 37  ? -243.173 -9.418  110.230 1.00 0.00 ? 37  LEU A H    6  
ATOM 9545  H HA   . LEU A 1 37  ? -242.522 -9.784  107.477 1.00 0.00 ? 37  LEU A HA   6  
ATOM 9546  H HB2  . LEU A 1 37  ? -242.980 -11.508 109.573 1.00 0.00 ? 37  LEU A HB2  6  
ATOM 9547  H HB3  . LEU A 1 37  ? -244.375 -11.729 108.516 1.00 0.00 ? 37  LEU A HB3  6  
ATOM 9548  H HG   . LEU A 1 37  ? -242.473 -13.212 107.924 1.00 0.00 ? 37  LEU A HG   6  
ATOM 9549  H HD11 . LEU A 1 37  ? -243.283 -11.020 106.000 1.00 0.00 ? 37  LEU A HD11 6  
ATOM 9550  H HD12 . LEU A 1 37  ? -242.406 -12.476 105.499 1.00 0.00 ? 37  LEU A HD12 6  
ATOM 9551  H HD13 . LEU A 1 37  ? -244.035 -12.610 106.171 1.00 0.00 ? 37  LEU A HD13 6  
ATOM 9552  H HD21 . LEU A 1 37  ? -240.920 -11.232 108.616 1.00 0.00 ? 37  LEU A HD21 6  
ATOM 9553  H HD22 . LEU A 1 37  ? -240.434 -12.326 107.315 1.00 0.00 ? 37  LEU A HD22 6  
ATOM 9554  H HD23 . LEU A 1 37  ? -241.132 -10.746 106.933 1.00 0.00 ? 37  LEU A HD23 6  
ATOM 9555  N N    . LEU A 1 38  ? -245.633 -9.325  108.325 1.00 0.00 ? 38  LEU A N    6  
ATOM 9556  C CA   . LEU A 1 38  ? -246.880 -8.870  107.760 1.00 0.00 ? 38  LEU A CA   6  
ATOM 9557  C C    . LEU A 1 38  ? -246.571 -7.664  106.875 1.00 0.00 ? 38  LEU A C    6  
ATOM 9558  O O    . LEU A 1 38  ? -247.096 -7.540  105.785 1.00 0.00 ? 38  LEU A O    6  
ATOM 9559  C CB   . LEU A 1 38  ? -247.871 -8.545  108.888 1.00 0.00 ? 38  LEU A CB   6  
ATOM 9560  C CG   . LEU A 1 38  ? -249.339 -8.397  108.472 1.00 0.00 ? 38  LEU A CG   6  
ATOM 9561  C CD1  . LEU A 1 38  ? -249.833 -6.993  108.776 1.00 0.00 ? 38  LEU A CD1  6  
ATOM 9562  C CD2  . LEU A 1 38  ? -249.527 -8.732  106.994 1.00 0.00 ? 38  LEU A CD2  6  
ATOM 9563  H H    . LEU A 1 38  ? -245.564 -9.480  109.292 1.00 0.00 ? 38  LEU A H    6  
ATOM 9564  H HA   . LEU A 1 38  ? -247.280 -9.668  107.137 1.00 0.00 ? 38  LEU A HA   6  
ATOM 9565  H HB2  . LEU A 1 38  ? -247.812 -9.342  109.617 1.00 0.00 ? 38  LEU A HB2  6  
ATOM 9566  H HB3  . LEU A 1 38  ? -247.557 -7.629  109.369 1.00 0.00 ? 38  LEU A HB3  6  
ATOM 9567  H HG   . LEU A 1 38  ? -249.936 -9.089  109.049 1.00 0.00 ? 38  LEU A HG   6  
ATOM 9568  H HD11 . LEU A 1 38  ? -249.189 -6.273  108.296 1.00 0.00 ? 38  LEU A HD11 6  
ATOM 9569  H HD12 . LEU A 1 38  ? -250.840 -6.876  108.405 1.00 0.00 ? 38  LEU A HD12 6  
ATOM 9570  H HD13 . LEU A 1 38  ? -249.821 -6.830  109.844 1.00 0.00 ? 38  LEU A HD13 6  
ATOM 9571  H HD21 . LEU A 1 38  ? -249.082 -9.700  106.781 1.00 0.00 ? 38  LEU A HD21 6  
ATOM 9572  H HD22 . LEU A 1 38  ? -250.580 -8.757  106.758 1.00 0.00 ? 38  LEU A HD22 6  
ATOM 9573  H HD23 . LEU A 1 38  ? -249.038 -7.980  106.390 1.00 0.00 ? 38  LEU A HD23 6  
ATOM 9574  N N    . GLN A 1 39  ? -245.617 -6.864  107.323 1.00 0.00 ? 39  GLN A N    6  
ATOM 9575  C CA   . GLN A 1 39  ? -245.035 -5.802  106.562 1.00 0.00 ? 39  GLN A CA   6  
ATOM 9576  C C    . GLN A 1 39  ? -244.511 -6.290  105.239 1.00 0.00 ? 39  GLN A C    6  
ATOM 9577  O O    . GLN A 1 39  ? -244.832 -5.751  104.202 1.00 0.00 ? 39  GLN A O    6  
ATOM 9578  C CB   . GLN A 1 39  ? -243.829 -5.346  107.329 1.00 0.00 ? 39  GLN A CB   6  
ATOM 9579  C CG   . GLN A 1 39  ? -243.275 -4.071  106.796 1.00 0.00 ? 39  GLN A CG   6  
ATOM 9580  C CD   . GLN A 1 39  ? -241.984 -3.645  107.473 1.00 0.00 ? 39  GLN A CD   6  
ATOM 9581  O OE1  . GLN A 1 39  ? -241.695 -2.457  107.589 1.00 0.00 ? 39  GLN A OE1  6  
ATOM 9582  N NE2  . GLN A 1 39  ? -241.200 -4.615  107.923 1.00 0.00 ? 39  GLN A NE2  6  
ATOM 9583  H H    . GLN A 1 39  ? -245.293 -6.977  108.223 1.00 0.00 ? 39  GLN A H    6  
ATOM 9584  H HA   . GLN A 1 39  ? -245.745 -4.988  106.424 1.00 0.00 ? 39  GLN A HA   6  
ATOM 9585  H HB2  . GLN A 1 39  ? -244.066 -5.265  108.364 1.00 0.00 ? 39  GLN A HB2  6  
ATOM 9586  H HB3  . GLN A 1 39  ? -243.064 -6.101  107.222 1.00 0.00 ? 39  GLN A HB3  6  
ATOM 9587  H HG2  . GLN A 1 39  ? -243.086 -4.241  105.747 1.00 0.00 ? 39  GLN A HG2  6  
ATOM 9588  H HG3  . GLN A 1 39  ? -244.017 -3.301  106.916 1.00 0.00 ? 39  GLN A HG3  6  
ATOM 9589  H HE21 . GLN A 1 39  ? -241.489 -5.545  107.796 1.00 0.00 ? 39  GLN A HE21 6  
ATOM 9590  H HE22 . GLN A 1 39  ? -240.362 -4.363  108.362 1.00 0.00 ? 39  GLN A HE22 6  
ATOM 9591  N N    . GLN A 1 40  ? -243.651 -7.281  105.308 1.00 0.00 ? 40  GLN A N    6  
ATOM 9592  C CA   . GLN A 1 40  ? -243.058 -7.867  104.128 1.00 0.00 ? 40  GLN A CA   6  
ATOM 9593  C C    . GLN A 1 40  ? -244.117 -8.359  103.158 1.00 0.00 ? 40  GLN A C    6  
ATOM 9594  O O    . GLN A 1 40  ? -243.924 -8.358  101.945 1.00 0.00 ? 40  GLN A O    6  
ATOM 9595  C CB   . GLN A 1 40  ? -242.125 -9.002  104.529 1.00 0.00 ? 40  GLN A CB   6  
ATOM 9596  C CG   . GLN A 1 40  ? -240.726 -8.510  104.829 1.00 0.00 ? 40  GLN A CG   6  
ATOM 9597  C CD   . GLN A 1 40  ? -240.214 -7.647  103.695 1.00 0.00 ? 40  GLN A CD   6  
ATOM 9598  O OE1  . GLN A 1 40  ? -239.354 -6.786  103.877 1.00 0.00 ? 40  GLN A OE1  6  
ATOM 9599  N NE2  . GLN A 1 40  ? -240.797 -7.849  102.523 1.00 0.00 ? 40  GLN A NE2  6  
ATOM 9600  H H    . GLN A 1 40  ? -243.408 -7.638  106.191 1.00 0.00 ? 40  GLN A H    6  
ATOM 9601  H HA   . GLN A 1 40  ? -242.473 -7.103  103.640 1.00 0.00 ? 40  GLN A HA   6  
ATOM 9602  H HB2  . GLN A 1 40  ? -242.517 -9.487  105.411 1.00 0.00 ? 40  GLN A HB2  6  
ATOM 9603  H HB3  . GLN A 1 40  ? -242.070 -9.718  103.722 1.00 0.00 ? 40  GLN A HB3  6  
ATOM 9604  H HG2  . GLN A 1 40  ? -240.747 -7.924  105.738 1.00 0.00 ? 40  GLN A HG2  6  
ATOM 9605  H HG3  . GLN A 1 40  ? -240.073 -9.355  104.955 1.00 0.00 ? 40  GLN A HG3  6  
ATOM 9606  H HE21 . GLN A 1 40  ? -241.504 -8.531  102.479 1.00 0.00 ? 40  GLN A HE21 6  
ATOM 9607  H HE22 . GLN A 1 40  ? -240.525 -7.315  101.768 1.00 0.00 ? 40  GLN A HE22 6  
ATOM 9608  N N    . ILE A 1 41  ? -245.229 -8.756  103.725 1.00 0.00 ? 41  ILE A N    6  
ATOM 9609  C CA   . ILE A 1 41  ? -246.375 -9.245  102.988 1.00 0.00 ? 41  ILE A CA   6  
ATOM 9610  C C    . ILE A 1 41  ? -247.156 -8.066  102.394 1.00 0.00 ? 41  ILE A C    6  
ATOM 9611  O O    . ILE A 1 41  ? -247.781 -8.163  101.336 1.00 0.00 ? 41  ILE A O    6  
ATOM 9612  C CB   . ILE A 1 41  ? -247.263 -10.066 103.952 1.00 0.00 ? 41  ILE A CB   6  
ATOM 9613  C CG1  . ILE A 1 41  ? -246.416 -11.128 104.689 1.00 0.00 ? 41  ILE A CG1  6  
ATOM 9614  C CG2  . ILE A 1 41  ? -248.432 -10.714 103.238 1.00 0.00 ? 41  ILE A CG2  6  
ATOM 9615  C CD1  . ILE A 1 41  ? -245.335 -11.799 103.844 1.00 0.00 ? 41  ILE A CD1  6  
ATOM 9616  H H    . ILE A 1 41  ? -245.282 -8.731  104.709 1.00 0.00 ? 41  ILE A H    6  
ATOM 9617  H HA   . ILE A 1 41  ? -246.032 -9.891  102.195 1.00 0.00 ? 41  ILE A HA   6  
ATOM 9618  H HB   . ILE A 1 41  ? -247.669 -9.379  104.688 1.00 0.00 ? 41  ILE A HB   6  
ATOM 9619  H HG12 . ILE A 1 41  ? -245.926 -10.661 105.530 1.00 0.00 ? 41  ILE A HG12 6  
ATOM 9620  H HG13 . ILE A 1 41  ? -247.076 -11.904 105.055 1.00 0.00 ? 41  ILE A HG13 6  
ATOM 9621  H HG21 . ILE A 1 41  ? -248.996 -9.958  102.714 1.00 0.00 ? 41  ILE A HG21 6  
ATOM 9622  H HG22 . ILE A 1 41  ? -248.065 -11.448 102.537 1.00 0.00 ? 41  ILE A HG22 6  
ATOM 9623  H HG23 . ILE A 1 41  ? -249.064 -11.195 103.971 1.00 0.00 ? 41  ILE A HG23 6  
ATOM 9624  H HD11 . ILE A 1 41  ? -244.806 -11.049 103.274 1.00 0.00 ? 41  ILE A HD11 6  
ATOM 9625  H HD12 . ILE A 1 41  ? -244.627 -12.312 104.487 1.00 0.00 ? 41  ILE A HD12 6  
ATOM 9626  H HD13 . ILE A 1 41  ? -245.788 -12.506 103.168 1.00 0.00 ? 41  ILE A HD13 6  
ATOM 9627  N N    . LEU A 1 42  ? -247.069 -6.950  103.092 1.00 0.00 ? 42  LEU A N    6  
ATOM 9628  C CA   . LEU A 1 42  ? -247.784 -5.725  102.769 1.00 0.00 ? 42  LEU A CA   6  
ATOM 9629  C C    . LEU A 1 42  ? -247.061 -4.885  101.727 1.00 0.00 ? 42  LEU A C    6  
ATOM 9630  O O    . LEU A 1 42  ? -247.667 -4.380  100.785 1.00 0.00 ? 42  LEU A O    6  
ATOM 9631  C CB   . LEU A 1 42  ? -247.896 -4.919  104.045 1.00 0.00 ? 42  LEU A CB   6  
ATOM 9632  C CG   . LEU A 1 42  ? -248.858 -5.513  105.058 1.00 0.00 ? 42  LEU A CG   6  
ATOM 9633  C CD1  . LEU A 1 42  ? -248.543 -4.984  106.419 1.00 0.00 ? 42  LEU A CD1  6  
ATOM 9634  C CD2  . LEU A 1 42  ? -250.297 -5.205  104.694 1.00 0.00 ? 42  LEU A CD2  6  
ATOM 9635  H H    . LEU A 1 42  ? -246.490 -6.947  103.882 1.00 0.00 ? 42  LEU A H    6  
ATOM 9636  H HA   . LEU A 1 42  ? -248.771 -5.974  102.439 1.00 0.00 ? 42  LEU A HA   6  
ATOM 9637  H HB2  . LEU A 1 42  ? -246.910 -4.857  104.485 1.00 0.00 ? 42  LEU A HB2  6  
ATOM 9638  H HB3  . LEU A 1 42  ? -248.212 -3.926  103.816 1.00 0.00 ? 42  LEU A HB3  6  
ATOM 9639  H HG   . LEU A 1 42  ? -248.738 -6.587  105.080 1.00 0.00 ? 42  LEU A HG   6  
ATOM 9640  H HD11 . LEU A 1 42  ? -248.582 -3.909  106.397 1.00 0.00 ? 42  LEU A HD11 6  
ATOM 9641  H HD12 . LEU A 1 42  ? -249.262 -5.364  107.125 1.00 0.00 ? 42  LEU A HD12 6  
ATOM 9642  H HD13 . LEU A 1 42  ? -247.553 -5.308  106.695 1.00 0.00 ? 42  LEU A HD13 6  
ATOM 9643  H HD21 . LEU A 1 42  ? -250.508 -5.589  103.709 1.00 0.00 ? 42  LEU A HD21 6  
ATOM 9644  H HD22 . LEU A 1 42  ? -250.953 -5.673  105.413 1.00 0.00 ? 42  LEU A HD22 6  
ATOM 9645  H HD23 . LEU A 1 42  ? -250.449 -4.138  104.710 1.00 0.00 ? 42  LEU A HD23 6  
ATOM 9646  N N    . THR A 1 43  ? -245.758 -4.766  101.921 1.00 0.00 ? 43  THR A N    6  
ATOM 9647  C CA   . THR A 1 43  ? -244.932 -3.767  101.285 1.00 0.00 ? 43  THR A CA   6  
ATOM 9648  C C    . THR A 1 43  ? -245.174 -3.653  99.793  1.00 0.00 ? 43  THR A C    6  
ATOM 9649  O O    . THR A 1 43  ? -244.759 -4.485  98.983  1.00 0.00 ? 43  THR A O    6  
ATOM 9650  C CB   . THR A 1 43  ? -243.427 -3.992  101.575 1.00 0.00 ? 43  THR A CB   6  
ATOM 9651  O OG1  . THR A 1 43  ? -242.638 -3.023  100.876 1.00 0.00 ? 43  THR A OG1  6  
ATOM 9652  C CG2  . THR A 1 43  ? -242.981 -5.394  101.188 1.00 0.00 ? 43  THR A CG2  6  
ATOM 9653  H H    . THR A 1 43  ? -245.330 -5.385  102.538 1.00 0.00 ? 43  THR A H    6  
ATOM 9654  H HA   . THR A 1 43  ? -245.205 -2.820  101.736 1.00 0.00 ? 43  THR A HA   6  
ATOM 9655  H HB   . THR A 1 43  ? -243.265 -3.865  102.637 1.00 0.00 ? 43  THR A HB   6  
ATOM 9656  H HG1  . THR A 1 43  ? -242.240 -3.431  100.099 1.00 0.00 ? 43  THR A HG1  6  
ATOM 9657  H HG21 . THR A 1 43  ? -243.186 -5.562  100.140 1.00 0.00 ? 43  THR A HG21 6  
ATOM 9658  H HG22 . THR A 1 43  ? -241.922 -5.499  101.370 1.00 0.00 ? 43  THR A HG22 6  
ATOM 9659  H HG23 . THR A 1 43  ? -243.520 -6.120  101.781 1.00 0.00 ? 43  THR A HG23 6  
ATOM 9660  N N    . ASN A 1 44  ? -245.902 -2.614  99.466  1.00 0.00 ? 44  ASN A N    6  
ATOM 9661  C CA   . ASN A 1 44  ? -246.086 -2.187  98.087  1.00 0.00 ? 44  ASN A CA   6  
ATOM 9662  C C    . ASN A 1 44  ? -244.891 -1.358  97.660  1.00 0.00 ? 44  ASN A C    6  
ATOM 9663  O O    . ASN A 1 44  ? -244.724 -1.045  96.486  1.00 0.00 ? 44  ASN A O    6  
ATOM 9664  C CB   . ASN A 1 44  ? -247.359 -1.354  97.939  1.00 0.00 ? 44  ASN A CB   6  
ATOM 9665  C CG   . ASN A 1 44  ? -248.618 -2.190  97.790  1.00 0.00 ? 44  ASN A CG   6  
ATOM 9666  O OD1  . ASN A 1 44  ? -249.570 -1.769  97.133  1.00 0.00 ? 44  ASN A OD1  6  
ATOM 9667  N ND2  . ASN A 1 44  ? -248.649 -3.361  98.405  1.00 0.00 ? 44  ASN A ND2  6  
ATOM 9668  H H    . ASN A 1 44  ? -246.338 -2.123  100.189 1.00 0.00 ? 44  ASN A H    6  
ATOM 9669  H HA   . ASN A 1 44  ? -246.155 -3.066  97.465  1.00 0.00 ? 44  ASN A HA   6  
ATOM 9670  H HB2  . ASN A 1 44  ? -247.464 -0.733  98.814  1.00 0.00 ? 44  ASN A HB2  6  
ATOM 9671  H HB3  . ASN A 1 44  ? -247.262 -0.721  97.070  1.00 0.00 ? 44  ASN A HB3  6  
ATOM 9672  H HD21 . ASN A 1 44  ? -247.864 -3.635  98.930  1.00 0.00 ? 44  ASN A HD21 6  
ATOM 9673  H HD22 . ASN A 1 44  ? -249.453 -3.912  98.309  1.00 0.00 ? 44  ASN A HD22 6  
ATOM 9674  N N    . GLU A 1 45  ? -244.093 -0.974  98.653  1.00 0.00 ? 45  GLU A N    6  
ATOM 9675  C CA   . GLU A 1 45  ? -242.851 -0.245  98.446  1.00 0.00 ? 45  GLU A CA   6  
ATOM 9676  C C    . GLU A 1 45  ? -243.090 1.167   97.922  1.00 0.00 ? 45  GLU A C    6  
ATOM 9677  O O    . GLU A 1 45  ? -242.185 1.805   97.395  1.00 0.00 ? 45  GLU A O    6  
ATOM 9678  C CB   . GLU A 1 45  ? -241.926 -1.030  97.529  1.00 0.00 ? 45  GLU A CB   6  
ATOM 9679  C CG   . GLU A 1 45  ? -241.092 -2.063  98.266  1.00 0.00 ? 45  GLU A CG   6  
ATOM 9680  C CD   . GLU A 1 45  ? -240.061 -2.736  97.386  1.00 0.00 ? 45  GLU A CD   6  
ATOM 9681  O OE1  . GLU A 1 45  ? -238.928 -2.222  97.293  1.00 0.00 ? 45  GLU A OE1  6  
ATOM 9682  O OE2  . GLU A 1 45  ? -240.377 -3.791  96.797  1.00 0.00 ? 45  GLU A OE2  6  
ATOM 9683  H H    . GLU A 1 45  ? -244.353 -1.200  99.565  1.00 0.00 ? 45  GLU A H    6  
ATOM 9684  H HA   . GLU A 1 45  ? -242.373 -0.161  99.411  1.00 0.00 ? 45  GLU A HA   6  
ATOM 9685  H HB2  . GLU A 1 45  ? -242.534 -1.546  96.797  1.00 0.00 ? 45  GLU A HB2  6  
ATOM 9686  H HB3  . GLU A 1 45  ? -241.266 -0.346  97.027  1.00 0.00 ? 45  GLU A HB3  6  
ATOM 9687  H HG2  . GLU A 1 45  ? -240.578 -1.573  99.081  1.00 0.00 ? 45  GLU A HG2  6  
ATOM 9688  H HG3  . GLU A 1 45  ? -241.753 -2.820  98.663  1.00 0.00 ? 45  GLU A HG3  6  
ATOM 9689  N N    . GLN A 1 46  ? -244.315 1.655   98.087  1.00 0.00 ? 46  GLN A N    6  
ATOM 9690  C CA   . GLN A 1 46  ? -244.619 3.058   97.866  1.00 0.00 ? 46  GLN A CA   6  
ATOM 9691  C C    . GLN A 1 46  ? -243.930 3.883   98.920  1.00 0.00 ? 46  GLN A C    6  
ATOM 9692  O O    . GLN A 1 46  ? -242.776 4.292   98.798  1.00 0.00 ? 46  GLN A O    6  
ATOM 9693  C CB   . GLN A 1 46  ? -246.125 3.284   97.954  1.00 0.00 ? 46  GLN A CB   6  
ATOM 9694  C CG   . GLN A 1 46  ? -246.935 2.490   96.951  1.00 0.00 ? 46  GLN A CG   6  
ATOM 9695  C CD   . GLN A 1 46  ? -248.424 2.733   97.098  1.00 0.00 ? 46  GLN A CD   6  
ATOM 9696  O OE1  . GLN A 1 46  ? -248.980 3.637   96.478  1.00 0.00 ? 46  GLN A OE1  6  
ATOM 9697  N NE2  . GLN A 1 46  ? -249.077 1.930   97.921  1.00 0.00 ? 46  GLN A NE2  6  
ATOM 9698  H H    . GLN A 1 46  ? -245.036 1.053   98.348  1.00 0.00 ? 46  GLN A H    6  
ATOM 9699  H HA   . GLN A 1 46  ? -244.270 3.351   96.914  1.00 0.00 ? 46  GLN A HA   6  
ATOM 9700  H HB2  . GLN A 1 46  ? -246.458 3.006   98.943  1.00 0.00 ? 46  GLN A HB2  6  
ATOM 9701  H HB3  . GLN A 1 46  ? -246.325 4.325   97.803  1.00 0.00 ? 46  GLN A HB3  6  
ATOM 9702  H HG2  . GLN A 1 46  ? -246.632 2.772   95.955  1.00 0.00 ? 46  GLN A HG2  6  
ATOM 9703  H HG3  . GLN A 1 46  ? -246.738 1.441   97.107  1.00 0.00 ? 46  GLN A HG3  6  
ATOM 9704  H HE21 . GLN A 1 46  ? -248.575 1.233   98.382  1.00 0.00 ? 46  GLN A HE21 6  
ATOM 9705  H HE22 . GLN A 1 46  ? -250.043 2.076   98.043  1.00 0.00 ? 46  GLN A HE22 6  
ATOM 9706  N N    . ASP A 1 47  ? -244.673 4.092   99.962  1.00 0.00 ? 47  ASP A N    6  
ATOM 9707  C CA   . ASP A 1 47  ? -244.138 4.511   101.242 1.00 0.00 ? 47  ASP A CA   6  
ATOM 9708  C C    . ASP A 1 47  ? -243.729 3.256   101.993 1.00 0.00 ? 47  ASP A C    6  
ATOM 9709  O O    . ASP A 1 47  ? -243.480 3.276   103.197 1.00 0.00 ? 47  ASP A O    6  
ATOM 9710  C CB   . ASP A 1 47  ? -245.195 5.275   102.038 1.00 0.00 ? 47  ASP A CB   6  
ATOM 9711  C CG   . ASP A 1 47  ? -245.618 6.568   101.373 1.00 0.00 ? 47  ASP A CG   6  
ATOM 9712  O OD1  . ASP A 1 47  ? -244.992 7.613   101.643 1.00 0.00 ? 47  ASP A OD1  6  
ATOM 9713  O OD2  . ASP A 1 47  ? -246.585 6.543   100.582 1.00 0.00 ? 47  ASP A OD2  6  
ATOM 9714  H H    . ASP A 1 47  ? -245.635 3.976   99.860  1.00 0.00 ? 47  ASP A H    6  
ATOM 9715  H HA   . ASP A 1 47  ? -243.274 5.133   101.072 1.00 0.00 ? 47  ASP A HA   6  
ATOM 9716  H HB2  . ASP A 1 47  ? -246.068 4.653   102.153 1.00 0.00 ? 47  ASP A HB2  6  
ATOM 9717  H HB3  . ASP A 1 47  ? -244.799 5.506   103.008 1.00 0.00 ? 47  ASP A HB3  6  
ATOM 9718  N N    . ILE A 1 48  ? -243.685 2.161   101.230 1.00 0.00 ? 48  ILE A N    6  
ATOM 9719  C CA   . ILE A 1 48  ? -243.457 0.814   101.732 1.00 0.00 ? 48  ILE A CA   6  
ATOM 9720  C C    . ILE A 1 48  ? -244.677 0.279   102.438 1.00 0.00 ? 48  ILE A C    6  
ATOM 9721  O O    . ILE A 1 48  ? -245.203 -0.775  102.091 1.00 0.00 ? 48  ILE A O    6  
ATOM 9722  C CB   . ILE A 1 48  ? -242.224 0.713   102.645 1.00 0.00 ? 48  ILE A CB   6  
ATOM 9723  C CG1  . ILE A 1 48  ? -240.947 0.963   101.838 1.00 0.00 ? 48  ILE A CG1  6  
ATOM 9724  C CG2  . ILE A 1 48  ? -242.181 -0.653  103.317 1.00 0.00 ? 48  ILE A CG2  6  
ATOM 9725  C CD1  . ILE A 1 48  ? -239.684 0.881   102.662 1.00 0.00 ? 48  ILE A CD1  6  
ATOM 9726  H H    . ILE A 1 48  ? -243.808 2.277   100.269 1.00 0.00 ? 48  ILE A H    6  
ATOM 9727  H HA   . ILE A 1 48  ? -243.291 0.199   100.892 1.00 0.00 ? 48  ILE A HA   6  
ATOM 9728  H HB   . ILE A 1 48  ? -242.313 1.467   103.408 1.00 0.00 ? 48  ILE A HB   6  
ATOM 9729  H HG12 . ILE A 1 48  ? -240.878 0.228   101.050 1.00 0.00 ? 48  ILE A HG12 6  
ATOM 9730  H HG13 . ILE A 1 48  ? -240.996 1.950   101.398 1.00 0.00 ? 48  ILE A HG13 6  
ATOM 9731  H HG21 . ILE A 1 48  ? -243.091 -0.805  103.881 1.00 0.00 ? 48  ILE A HG21 6  
ATOM 9732  H HG22 . ILE A 1 48  ? -242.097 -1.418  102.559 1.00 0.00 ? 48  ILE A HG22 6  
ATOM 9733  H HG23 . ILE A 1 48  ? -241.329 -0.704  103.980 1.00 0.00 ? 48  ILE A HG23 6  
ATOM 9734  H HD11 . ILE A 1 48  ? -239.613 -0.097  103.113 1.00 0.00 ? 48  ILE A HD11 6  
ATOM 9735  H HD12 . ILE A 1 48  ? -238.826 1.047   102.026 1.00 0.00 ? 48  ILE A HD12 6  
ATOM 9736  H HD13 . ILE A 1 48  ? -239.711 1.633   103.436 1.00 0.00 ? 48  ILE A HD13 6  
ATOM 9737  N N    . LYS A 1 49  ? -245.122 1.051   103.379 1.00 0.00 ? 49  LYS A N    6  
ATOM 9738  C CA   . LYS A 1 49  ? -246.226 0.703   104.252 1.00 0.00 ? 49  LYS A CA   6  
ATOM 9739  C C    . LYS A 1 49  ? -247.586 1.035   103.628 1.00 0.00 ? 49  LYS A C    6  
ATOM 9740  O O    . LYS A 1 49  ? -247.927 2.201   103.420 1.00 0.00 ? 49  LYS A O    6  
ATOM 9741  C CB   . LYS A 1 49  ? -246.056 1.425   105.591 1.00 0.00 ? 49  LYS A CB   6  
ATOM 9742  C CG   . LYS A 1 49  ? -245.851 2.930   105.460 1.00 0.00 ? 49  LYS A CG   6  
ATOM 9743  C CD   . LYS A 1 49  ? -245.569 3.583   106.805 1.00 0.00 ? 49  LYS A CD   6  
ATOM 9744  C CE   . LYS A 1 49  ? -244.269 3.079   107.417 1.00 0.00 ? 49  LYS A CE   6  
ATOM 9745  N NZ   . LYS A 1 49  ? -243.955 3.761   108.700 1.00 0.00 ? 49  LYS A NZ   6  
ATOM 9746  H H    . LYS A 1 49  ? -244.674 1.906   103.493 1.00 0.00 ? 49  LYS A H    6  
ATOM 9747  H HA   . LYS A 1 49  ? -246.180 -0.361  104.428 1.00 0.00 ? 49  LYS A HA   6  
ATOM 9748  H HB2  . LYS A 1 49  ? -246.936 1.256   106.185 1.00 0.00 ? 49  LYS A HB2  6  
ATOM 9749  H HB3  . LYS A 1 49  ? -245.200 1.010   106.102 1.00 0.00 ? 49  LYS A HB3  6  
ATOM 9750  H HG2  . LYS A 1 49  ? -245.016 3.113   104.802 1.00 0.00 ? 49  LYS A HG2  6  
ATOM 9751  H HG3  . LYS A 1 49  ? -246.744 3.367   105.041 1.00 0.00 ? 49  LYS A HG3  6  
ATOM 9752  H HD2  . LYS A 1 49  ? -245.500 4.650   106.667 1.00 0.00 ? 49  LYS A HD2  6  
ATOM 9753  H HD3  . LYS A 1 49  ? -246.384 3.356   107.476 1.00 0.00 ? 49  LYS A HD3  6  
ATOM 9754  H HE2  . LYS A 1 49  ? -244.360 2.017   107.597 1.00 0.00 ? 49  LYS A HE2  6  
ATOM 9755  H HE3  . LYS A 1 49  ? -243.466 3.254   106.715 1.00 0.00 ? 49  LYS A HE3  6  
ATOM 9756  H HZ1  . LYS A 1 49  ? -244.759 3.682   109.358 1.00 0.00 ? 49  LYS A HZ1  6  
ATOM 9757  H HZ2  . LYS A 1 49  ? -243.115 3.326   109.144 1.00 0.00 ? 49  LYS A HZ2  6  
ATOM 9758  H HZ3  . LYS A 1 49  ? -243.757 4.772   108.533 1.00 0.00 ? 49  LYS A HZ3  6  
ATOM 9759  N N    . PRO A 1 50  ? -248.338 -0.010  103.256 1.00 0.00 ? 50  PRO A N    6  
ATOM 9760  C CA   . PRO A 1 50  ? -249.760 0.082   102.879 1.00 0.00 ? 50  PRO A CA   6  
ATOM 9761  C C    . PRO A 1 50  ? -250.671 0.639   103.956 1.00 0.00 ? 50  PRO A C    6  
ATOM 9762  O O    . PRO A 1 50  ? -250.285 1.446   104.804 1.00 0.00 ? 50  PRO A O    6  
ATOM 9763  C CB   . PRO A 1 50  ? -250.119 -1.389  102.716 1.00 0.00 ? 50  PRO A CB   6  
ATOM 9764  C CG   . PRO A 1 50  ? -248.897 -1.982  102.202 1.00 0.00 ? 50  PRO A CG   6  
ATOM 9765  C CD   . PRO A 1 50  ? -247.847 -1.392  103.078 1.00 0.00 ? 50  PRO A CD   6  
ATOM 9766  H HA   . PRO A 1 50  ? -249.911 0.601   101.945 1.00 0.00 ? 50  PRO A HA   6  
ATOM 9767  H HB2  . PRO A 1 50  ? -250.383 -1.802  103.678 1.00 0.00 ? 50  PRO A HB2  6  
ATOM 9768  H HB3  . PRO A 1 50  ? -250.923 -1.501  102.048 1.00 0.00 ? 50  PRO A HB3  6  
ATOM 9769  H HG2  . PRO A 1 50  ? -248.938 -3.055  102.303 1.00 0.00 ? 50  PRO A HG2  6  
ATOM 9770  H HG3  . PRO A 1 50  ? -248.751 -1.689  101.178 1.00 0.00 ? 50  PRO A HG3  6  
ATOM 9771  H HD2  . PRO A 1 50  ? -247.817 -1.918  104.010 1.00 0.00 ? 50  PRO A HD2  6  
ATOM 9772  H HD3  . PRO A 1 50  ? -246.884 -1.407  102.592 1.00 0.00 ? 50  PRO A HD3  6  
ATOM 9773  N N    . VAL A 1 51  ? -251.901 0.163   103.901 1.00 0.00 ? 51  VAL A N    6  
ATOM 9774  C CA   . VAL A 1 51  ? -252.860 0.389   104.963 1.00 0.00 ? 51  VAL A CA   6  
ATOM 9775  C C    . VAL A 1 51  ? -252.795 -0.817  105.879 1.00 0.00 ? 51  VAL A C    6  
ATOM 9776  O O    . VAL A 1 51  ? -253.662 -1.693  105.861 1.00 0.00 ? 51  VAL A O    6  
ATOM 9777  C CB   . VAL A 1 51  ? -254.302 0.573   104.440 1.00 0.00 ? 51  VAL A CB   6  
ATOM 9778  C CG1  . VAL A 1 51  ? -255.230 1.026   105.559 1.00 0.00 ? 51  VAL A CG1  6  
ATOM 9779  C CG2  . VAL A 1 51  ? -254.336 1.561   103.284 1.00 0.00 ? 51  VAL A CG2  6  
ATOM 9780  H H    . VAL A 1 51  ? -252.152 -0.397  103.128 1.00 0.00 ? 51  VAL A H    6  
ATOM 9781  H HA   . VAL A 1 51  ? -252.565 1.272   105.511 1.00 0.00 ? 51  VAL A HA   6  
ATOM 9782  H HB   . VAL A 1 51  ? -254.654 -0.386  104.080 1.00 0.00 ? 51  VAL A HB   6  
ATOM 9783  H HG11 . VAL A 1 51  ? -255.232 0.286   106.347 1.00 0.00 ? 51  VAL A HG11 6  
ATOM 9784  H HG12 . VAL A 1 51  ? -254.885 1.970   105.954 1.00 0.00 ? 51  VAL A HG12 6  
ATOM 9785  H HG13 . VAL A 1 51  ? -256.232 1.142   105.173 1.00 0.00 ? 51  VAL A HG13 6  
ATOM 9786  H HG21 . VAL A 1 51  ? -253.696 1.208   102.488 1.00 0.00 ? 51  VAL A HG21 6  
ATOM 9787  H HG22 . VAL A 1 51  ? -255.347 1.653   102.917 1.00 0.00 ? 51  VAL A HG22 6  
ATOM 9788  H HG23 . VAL A 1 51  ? -253.987 2.525   103.624 1.00 0.00 ? 51  VAL A HG23 6  
ATOM 9789  N N    . THR A 1 52  ? -251.707 -0.889  106.619 1.00 0.00 ? 52  THR A N    6  
ATOM 9790  C CA   . THR A 1 52  ? -251.369 -2.063  107.383 1.00 0.00 ? 52  THR A CA   6  
ATOM 9791  C C    . THR A 1 52  ? -252.284 -2.192  108.604 1.00 0.00 ? 52  THR A C    6  
ATOM 9792  O O    . THR A 1 52  ? -252.089 -1.530  109.624 1.00 0.00 ? 52  THR A O    6  
ATOM 9793  C CB   . THR A 1 52  ? -249.881 -1.992  107.770 1.00 0.00 ? 52  THR A CB   6  
ATOM 9794  O OG1  . THR A 1 52  ? -249.659 -0.911  108.686 1.00 0.00 ? 52  THR A OG1  6  
ATOM 9795  C CG2  . THR A 1 52  ? -249.032 -1.764  106.517 1.00 0.00 ? 52  THR A CG2  6  
ATOM 9796  H H    . THR A 1 52  ? -251.104 -0.117  106.653 1.00 0.00 ? 52  THR A H    6  
ATOM 9797  H HA   . THR A 1 52  ? -251.512 -2.925  106.747 1.00 0.00 ? 52  THR A HA   6  
ATOM 9798  H HB   . THR A 1 52  ? -249.587 -2.921  108.228 1.00 0.00 ? 52  THR A HB   6  
ATOM 9799  H HG1  . THR A 1 52  ? -250.420 -0.834  109.278 1.00 0.00 ? 52  THR A HG1  6  
ATOM 9800  H HG21 . THR A 1 52  ? -249.447 -2.334  105.686 1.00 0.00 ? 52  THR A HG21 6  
ATOM 9801  H HG22 . THR A 1 52  ? -249.045 -0.715  106.258 1.00 0.00 ? 52  THR A HG22 6  
ATOM 9802  H HG23 . THR A 1 52  ? -248.012 -2.081  106.699 1.00 0.00 ? 52  THR A HG23 6  
ATOM 9803  N N    . THR A 1 53  ? -253.298 -3.038  108.470 1.00 0.00 ? 53  THR A N    6  
ATOM 9804  C CA   . THR A 1 53  ? -254.394 -3.085  109.425 1.00 0.00 ? 53  THR A CA   6  
ATOM 9805  C C    . THR A 1 53  ? -254.449 -4.416  110.194 1.00 0.00 ? 53  THR A C    6  
ATOM 9806  O O    . THR A 1 53  ? -253.413 -5.008  110.487 1.00 0.00 ? 53  THR A O    6  
ATOM 9807  C CB   . THR A 1 53  ? -255.730 -2.790  108.679 1.00 0.00 ? 53  THR A CB   6  
ATOM 9808  O OG1  . THR A 1 53  ? -256.834 -2.713  109.587 1.00 0.00 ? 53  THR A OG1  6  
ATOM 9809  C CG2  . THR A 1 53  ? -256.016 -3.836  107.609 1.00 0.00 ? 53  THR A CG2  6  
ATOM 9810  H H    . THR A 1 53  ? -253.320 -3.635  107.696 1.00 0.00 ? 53  THR A H    6  
ATOM 9811  H HA   . THR A 1 53  ? -254.234 -2.306  110.139 1.00 0.00 ? 53  THR A HA   6  
ATOM 9812  H HB   . THR A 1 53  ? -255.629 -1.832  108.187 1.00 0.00 ? 53  THR A HB   6  
ATOM 9813  H HG1  . THR A 1 53  ? -256.592 -2.168  110.350 1.00 0.00 ? 53  THR A HG1  6  
ATOM 9814  H HG21 . THR A 1 53  ? -255.212 -3.841  106.886 1.00 0.00 ? 53  THR A HG21 6  
ATOM 9815  H HG22 . THR A 1 53  ? -256.093 -4.811  108.068 1.00 0.00 ? 53  THR A HG22 6  
ATOM 9816  H HG23 . THR A 1 53  ? -256.945 -3.597  107.111 1.00 0.00 ? 53  THR A HG23 6  
ATOM 9817  N N    . ASP A 1 54  ? -255.673 -4.848  110.509 1.00 0.00 ? 54  ASP A N    6  
ATOM 9818  C CA   . ASP A 1 54  ? -255.989 -5.989  111.392 1.00 0.00 ? 54  ASP A CA   6  
ATOM 9819  C C    . ASP A 1 54  ? -255.343 -7.316  110.996 1.00 0.00 ? 54  ASP A C    6  
ATOM 9820  O O    . ASP A 1 54  ? -255.604 -8.345  111.614 1.00 0.00 ? 54  ASP A O    6  
ATOM 9821  C CB   . ASP A 1 54  ? -257.491 -6.202  111.361 1.00 0.00 ? 54  ASP A CB   6  
ATOM 9822  C CG   . ASP A 1 54  ? -258.272 -5.142  112.112 1.00 0.00 ? 54  ASP A CG   6  
ATOM 9823  O OD1  . ASP A 1 54  ? -258.590 -4.095  111.512 1.00 0.00 ? 54  ASP A OD1  6  
ATOM 9824  O OD2  . ASP A 1 54  ? -258.588 -5.356  113.299 1.00 0.00 ? 54  ASP A OD2  6  
ATOM 9825  H H    . ASP A 1 54  ? -256.433 -4.357  110.117 1.00 0.00 ? 54  ASP A H    6  
ATOM 9826  H HA   . ASP A 1 54  ? -255.698 -5.737  112.399 1.00 0.00 ? 54  ASP A HA   6  
ATOM 9827  H HB2  . ASP A 1 54  ? -257.812 -6.192  110.330 1.00 0.00 ? 54  ASP A HB2  6  
ATOM 9828  H HB3  . ASP A 1 54  ? -257.708 -7.164  111.787 1.00 0.00 ? 54  ASP A HB3  6  
ATOM 9829  N N    . TYR A 1 55  ? -254.534 -7.303  109.979 1.00 0.00 ? 55  TYR A N    6  
ATOM 9830  C CA   . TYR A 1 55  ? -253.947 -8.530  109.458 1.00 0.00 ? 55  TYR A CA   6  
ATOM 9831  C C    . TYR A 1 55  ? -252.992 -9.190  110.450 1.00 0.00 ? 55  TYR A C    6  
ATOM 9832  O O    . TYR A 1 55  ? -252.300 -8.519  111.218 1.00 0.00 ? 55  TYR A O    6  
ATOM 9833  C CB   . TYR A 1 55  ? -253.195 -8.240  108.175 1.00 0.00 ? 55  TYR A CB   6  
ATOM 9834  C CG   . TYR A 1 55  ? -254.073 -7.864  107.019 1.00 0.00 ? 55  TYR A CG   6  
ATOM 9835  C CD1  . TYR A 1 55  ? -255.116 -8.680  106.635 1.00 0.00 ? 55  TYR A CD1  6  
ATOM 9836  C CD2  . TYR A 1 55  ? -253.846 -6.697  106.307 1.00 0.00 ? 55  TYR A CD2  6  
ATOM 9837  C CE1  . TYR A 1 55  ? -255.919 -8.350  105.570 1.00 0.00 ? 55  TYR A CE1  6  
ATOM 9838  C CE2  . TYR A 1 55  ? -254.644 -6.354  105.238 1.00 0.00 ? 55  TYR A CE2  6  
ATOM 9839  C CZ   . TYR A 1 55  ? -255.681 -7.182  104.872 1.00 0.00 ? 55  TYR A CZ   6  
ATOM 9840  O OH   . TYR A 1 55  ? -256.476 -6.842  103.804 1.00 0.00 ? 55  TYR A OH   6  
ATOM 9841  H H    . TYR A 1 55  ? -254.313 -6.439  109.573 1.00 0.00 ? 55  TYR A H    6  
ATOM 9842  H HA   . TYR A 1 55  ? -254.752 -9.214  109.241 1.00 0.00 ? 55  TYR A HA   6  
ATOM 9843  H HB2  . TYR A 1 55  ? -252.535 -7.423  108.352 1.00 0.00 ? 55  TYR A HB2  6  
ATOM 9844  H HB3  . TYR A 1 55  ? -252.624 -9.106  107.895 1.00 0.00 ? 55  TYR A HB3  6  
ATOM 9845  H HD1  . TYR A 1 55  ? -255.299 -9.590  107.185 1.00 0.00 ? 55  TYR A HD1  6  
ATOM 9846  H HD2  . TYR A 1 55  ? -253.029 -6.052  106.599 1.00 0.00 ? 55  TYR A HD2  6  
ATOM 9847  H HE1  . TYR A 1 55  ? -256.729 -9.005  105.294 1.00 0.00 ? 55  TYR A HE1  6  
ATOM 9848  H HE2  . TYR A 1 55  ? -254.453 -5.441  104.696 1.00 0.00 ? 55  TYR A HE2  6  
ATOM 9849  H HH   . TYR A 1 55  ? -257.402 -6.892  104.070 1.00 0.00 ? 55  TYR A HH   6  
ATOM 9850  N N    . PHE A 1 56  ? -252.987 -10.513 110.423 1.00 0.00 ? 56  PHE A N    6  
ATOM 9851  C CA   . PHE A 1 56  ? -252.038 -11.324 111.175 1.00 0.00 ? 56  PHE A CA   6  
ATOM 9852  C C    . PHE A 1 56  ? -251.873 -12.650 110.445 1.00 0.00 ? 56  PHE A C    6  
ATOM 9853  O O    . PHE A 1 56  ? -252.465 -12.844 109.400 1.00 0.00 ? 56  PHE A O    6  
ATOM 9854  C CB   . PHE A 1 56  ? -252.493 -11.546 112.628 1.00 0.00 ? 56  PHE A CB   6  
ATOM 9855  C CG   . PHE A 1 56  ? -253.833 -12.214 112.766 1.00 0.00 ? 56  PHE A CG   6  
ATOM 9856  C CD1  . PHE A 1 56  ? -254.991 -11.464 112.661 1.00 0.00 ? 56  PHE A CD1  6  
ATOM 9857  C CD2  . PHE A 1 56  ? -253.940 -13.584 112.991 1.00 0.00 ? 56  PHE A CD2  6  
ATOM 9858  C CE1  . PHE A 1 56  ? -256.230 -12.055 112.779 1.00 0.00 ? 56  PHE A CE1  6  
ATOM 9859  C CE2  . PHE A 1 56  ? -255.187 -14.181 113.106 1.00 0.00 ? 56  PHE A CE2  6  
ATOM 9860  C CZ   . PHE A 1 56  ? -256.333 -13.409 112.998 1.00 0.00 ? 56  PHE A CZ   6  
ATOM 9861  H H    . PHE A 1 56  ? -253.647 -10.972 109.858 1.00 0.00 ? 56  PHE A H    6  
ATOM 9862  H HA   . PHE A 1 56  ? -251.089 -10.806 111.171 1.00 0.00 ? 56  PHE A HA   6  
ATOM 9863  H HB2  . PHE A 1 56  ? -251.766 -12.164 113.133 1.00 0.00 ? 56  PHE A HB2  6  
ATOM 9864  H HB3  . PHE A 1 56  ? -252.549 -10.589 113.127 1.00 0.00 ? 56  PHE A HB3  6  
ATOM 9865  H HD1  . PHE A 1 56  ? -254.917 -10.402 112.488 1.00 0.00 ? 56  PHE A HD1  6  
ATOM 9866  H HD2  . PHE A 1 56  ? -253.035 -14.189 113.082 1.00 0.00 ? 56  PHE A HD2  6  
ATOM 9867  H HE1  . PHE A 1 56  ? -257.122 -11.453 112.692 1.00 0.00 ? 56  PHE A HE1  6  
ATOM 9868  H HE2  . PHE A 1 56  ? -255.264 -15.247 113.278 1.00 0.00 ? 56  PHE A HE2  6  
ATOM 9869  H HZ   . PHE A 1 56  ? -257.310 -13.865 113.082 1.00 0.00 ? 56  PHE A HZ   6  
ATOM 9870  N N    . LEU A 1 57  ? -251.077 -13.549 110.977 1.00 0.00 ? 57  LEU A N    6  
ATOM 9871  C CA   . LEU A 1 57  ? -250.787 -14.810 110.300 1.00 0.00 ? 57  LEU A CA   6  
ATOM 9872  C C    . LEU A 1 57  ? -251.450 -15.925 111.070 1.00 0.00 ? 57  LEU A C    6  
ATOM 9873  O O    . LEU A 1 57  ? -251.969 -15.679 112.141 1.00 0.00 ? 57  LEU A O    6  
ATOM 9874  C CB   . LEU A 1 57  ? -249.273 -15.069 110.212 1.00 0.00 ? 57  LEU A CB   6  
ATOM 9875  C CG   . LEU A 1 57  ? -248.443 -14.021 109.460 1.00 0.00 ? 57  LEU A CG   6  
ATOM 9876  C CD1  . LEU A 1 57  ? -248.564 -12.671 110.129 1.00 0.00 ? 57  LEU A CD1  6  
ATOM 9877  C CD2  . LEU A 1 57  ? -246.987 -14.442 109.389 1.00 0.00 ? 57  LEU A CD2  6  
ATOM 9878  H H    . LEU A 1 57  ? -250.673 -13.376 111.855 1.00 0.00 ? 57  LEU A H    6  
ATOM 9879  H HA   . LEU A 1 57  ? -251.203 -14.766 109.304 1.00 0.00 ? 57  LEU A HA   6  
ATOM 9880  H HB2  . LEU A 1 57  ? -248.887 -15.140 111.217 1.00 0.00 ? 57  LEU A HB2  6  
ATOM 9881  H HB3  . LEU A 1 57  ? -249.128 -16.023 109.727 1.00 0.00 ? 57  LEU A HB3  6  
ATOM 9882  H HG   . LEU A 1 57  ? -248.815 -13.930 108.449 1.00 0.00 ? 57  LEU A HG   6  
ATOM 9883  H HD11 . LEU A 1 57  ? -248.463 -12.798 111.206 1.00 0.00 ? 57  LEU A HD11 6  
ATOM 9884  H HD12 . LEU A 1 57  ? -247.800 -12.006 109.760 1.00 0.00 ? 57  LEU A HD12 6  
ATOM 9885  H HD13 . LEU A 1 57  ? -249.548 -12.266 109.909 1.00 0.00 ? 57  LEU A HD13 6  
ATOM 9886  H HD21 . LEU A 1 57  ? -246.910 -15.389 108.877 1.00 0.00 ? 57  LEU A HD21 6  
ATOM 9887  H HD22 . LEU A 1 57  ? -246.420 -13.694 108.853 1.00 0.00 ? 57  LEU A HD22 6  
ATOM 9888  H HD23 . LEU A 1 57  ? -246.596 -14.539 110.392 1.00 0.00 ? 57  LEU A HD23 6  
ATOM 9889  N N    . MET A 1 58  ? -251.496 -17.122 110.508 1.00 0.00 ? 58  MET A N    6  
ATOM 9890  C CA   . MET A 1 58  ? -251.937 -18.306 111.244 1.00 0.00 ? 58  MET A CA   6  
ATOM 9891  C C    . MET A 1 58  ? -251.348 -19.555 110.610 1.00 0.00 ? 58  MET A C    6  
ATOM 9892  O O    . MET A 1 58  ? -251.000 -19.543 109.430 1.00 0.00 ? 58  MET A O    6  
ATOM 9893  C CB   . MET A 1 58  ? -253.461 -18.456 111.269 1.00 0.00 ? 58  MET A CB   6  
ATOM 9894  C CG   . MET A 1 58  ? -254.229 -17.319 111.927 1.00 0.00 ? 58  MET A CG   6  
ATOM 9895  S SD   . MET A 1 58  ? -255.929 -17.771 112.300 1.00 0.00 ? 58  MET A SD   6  
ATOM 9896  C CE   . MET A 1 58  ? -256.171 -19.007 111.036 1.00 0.00 ? 58  MET A CE   6  
ATOM 9897  H H    . MET A 1 58  ? -251.231 -17.218 109.567 1.00 0.00 ? 58  MET A H    6  
ATOM 9898  H HA   . MET A 1 58  ? -251.570 -18.223 112.257 1.00 0.00 ? 58  MET A HA   6  
ATOM 9899  H HB2  . MET A 1 58  ? -253.811 -18.541 110.252 1.00 0.00 ? 58  MET A HB2  6  
ATOM 9900  H HB3  . MET A 1 58  ? -253.704 -19.368 111.792 1.00 0.00 ? 58  MET A HB3  6  
ATOM 9901  H HG2  . MET A 1 58  ? -253.735 -17.051 112.849 1.00 0.00 ? 58  MET A HG2  6  
ATOM 9902  H HG3  . MET A 1 58  ? -254.235 -16.470 111.260 1.00 0.00 ? 58  MET A HG3  6  
ATOM 9903  H HE1  . MET A 1 58  ? -255.973 -18.573 110.055 1.00 0.00 ? 58  MET A HE1  6  
ATOM 9904  H HE2  . MET A 1 58  ? -255.481 -19.819 111.214 1.00 0.00 ? 58  MET A HE2  6  
ATOM 9905  H HE3  . MET A 1 58  ? -257.184 -19.375 111.073 1.00 0.00 ? 58  MET A HE3  6  
ATOM 9906  N N    . GLU A 1 59  ? -251.233 -20.621 111.388 1.00 0.00 ? 59  GLU A N    6  
ATOM 9907  C CA   . GLU A 1 59  ? -250.780 -21.898 110.860 1.00 0.00 ? 59  GLU A CA   6  
ATOM 9908  C C    . GLU A 1 59  ? -251.953 -22.742 110.387 1.00 0.00 ? 59  GLU A C    6  
ATOM 9909  O O    . GLU A 1 59  ? -252.861 -23.053 111.158 1.00 0.00 ? 59  GLU A O    6  
ATOM 9910  C CB   . GLU A 1 59  ? -249.994 -22.680 111.901 1.00 0.00 ? 59  GLU A CB   6  
ATOM 9911  C CG   . GLU A 1 59  ? -248.528 -22.317 111.962 1.00 0.00 ? 59  GLU A CG   6  
ATOM 9912  C CD   . GLU A 1 59  ? -247.751 -23.325 112.768 1.00 0.00 ? 59  GLU A CD   6  
ATOM 9913  O OE1  . GLU A 1 59  ? -247.737 -24.514 112.378 1.00 0.00 ? 59  GLU A OE1  6  
ATOM 9914  O OE2  . GLU A 1 59  ? -247.183 -22.947 113.808 1.00 0.00 ? 59  GLU A OE2  6  
ATOM 9915  H H    . GLU A 1 59  ? -251.467 -20.551 112.342 1.00 0.00 ? 59  GLU A H    6  
ATOM 9916  H HA   . GLU A 1 59  ? -250.137 -21.699 110.016 1.00 0.00 ? 59  GLU A HA   6  
ATOM 9917  H HB2  . GLU A 1 59  ? -250.427 -22.498 112.872 1.00 0.00 ? 59  GLU A HB2  6  
ATOM 9918  H HB3  . GLU A 1 59  ? -250.069 -23.732 111.674 1.00 0.00 ? 59  GLU A HB3  6  
ATOM 9919  H HG2  . GLU A 1 59  ? -248.131 -22.289 110.960 1.00 0.00 ? 59  GLU A HG2  6  
ATOM 9920  H HG3  . GLU A 1 59  ? -248.423 -21.345 112.424 1.00 0.00 ? 59  GLU A HG3  6  
ATOM 9921  N N    . GLU A 1 60  ? -251.922 -23.106 109.120 1.00 0.00 ? 60  GLU A N    6  
ATOM 9922  C CA   . GLU A 1 60  ? -252.923 -23.983 108.551 1.00 0.00 ? 60  GLU A CA   6  
ATOM 9923  C C    . GLU A 1 60  ? -252.446 -25.424 108.537 1.00 0.00 ? 60  GLU A C    6  
ATOM 9924  O O    . GLU A 1 60  ? -251.563 -25.794 107.760 1.00 0.00 ? 60  GLU A O    6  
ATOM 9925  C CB   . GLU A 1 60  ? -253.275 -23.556 107.128 1.00 0.00 ? 60  GLU A CB   6  
ATOM 9926  C CG   . GLU A 1 60  ? -254.223 -22.380 107.062 1.00 0.00 ? 60  GLU A CG   6  
ATOM 9927  C CD   . GLU A 1 60  ? -255.630 -22.739 107.491 1.00 0.00 ? 60  GLU A CD   6  
ATOM 9928  O OE1  . GLU A 1 60  ? -256.357 -23.360 106.686 1.00 0.00 ? 60  GLU A OE1  6  
ATOM 9929  O OE2  . GLU A 1 60  ? -256.018 -22.407 108.630 1.00 0.00 ? 60  GLU A OE2  6  
ATOM 9930  H H    . GLU A 1 60  ? -251.204 -22.760 108.540 1.00 0.00 ? 60  GLU A H    6  
ATOM 9931  H HA   . GLU A 1 60  ? -253.811 -23.917 109.164 1.00 0.00 ? 60  GLU A HA   6  
ATOM 9932  H HB2  . GLU A 1 60  ? -252.367 -23.287 106.610 1.00 0.00 ? 60  GLU A HB2  6  
ATOM 9933  H HB3  . GLU A 1 60  ? -253.735 -24.391 106.620 1.00 0.00 ? 60  GLU A HB3  6  
ATOM 9934  H HG2  . GLU A 1 60  ? -253.854 -21.602 107.713 1.00 0.00 ? 60  GLU A HG2  6  
ATOM 9935  H HG3  . GLU A 1 60  ? -254.255 -22.013 106.045 1.00 0.00 ? 60  GLU A HG3  6  
ATOM 9936  N N    . LYS A 1 61  ? -253.007 -26.222 109.427 1.00 0.00 ? 61  LYS A N    6  
ATOM 9937  C CA   . LYS A 1 61  ? -252.857 -27.660 109.347 1.00 0.00 ? 61  LYS A CA   6  
ATOM 9938  C C    . LYS A 1 61  ? -253.956 -28.193 108.433 1.00 0.00 ? 61  LYS A C    6  
ATOM 9939  O O    . LYS A 1 61  ? -254.924 -27.481 108.153 1.00 0.00 ? 61  LYS A O    6  
ATOM 9940  C CB   . LYS A 1 61  ? -252.939 -28.307 110.740 1.00 0.00 ? 61  LYS A CB   6  
ATOM 9941  C CG   . LYS A 1 61  ? -251.709 -28.081 111.625 1.00 0.00 ? 61  LYS A CG   6  
ATOM 9942  C CD   . LYS A 1 61  ? -251.563 -26.630 112.075 1.00 0.00 ? 61  LYS A CD   6  
ATOM 9943  C CE   . LYS A 1 61  ? -250.478 -26.475 113.138 1.00 0.00 ? 61  LYS A CE   6  
ATOM 9944  N NZ   . LYS A 1 61  ? -249.114 -26.785 112.623 1.00 0.00 ? 61  LYS A NZ   6  
ATOM 9945  H H    . LYS A 1 61  ? -253.540 -25.834 110.158 1.00 0.00 ? 61  LYS A H    6  
ATOM 9946  H HA   . LYS A 1 61  ? -251.895 -27.873 108.906 1.00 0.00 ? 61  LYS A HA   6  
ATOM 9947  H HB2  . LYS A 1 61  ? -253.800 -27.908 111.255 1.00 0.00 ? 61  LYS A HB2  6  
ATOM 9948  H HB3  . LYS A 1 61  ? -253.073 -29.373 110.614 1.00 0.00 ? 61  LYS A HB3  6  
ATOM 9949  H HG2  . LYS A 1 61  ? -251.794 -28.706 112.499 1.00 0.00 ? 61  LYS A HG2  6  
ATOM 9950  H HG3  . LYS A 1 61  ? -250.828 -28.365 111.068 1.00 0.00 ? 61  LYS A HG3  6  
ATOM 9951  H HD2  . LYS A 1 61  ? -251.305 -26.023 111.220 1.00 0.00 ? 61  LYS A HD2  6  
ATOM 9952  H HD3  . LYS A 1 61  ? -252.505 -26.294 112.483 1.00 0.00 ? 61  LYS A HD3  6  
ATOM 9953  H HE2  . LYS A 1 61  ? -250.490 -25.456 113.495 1.00 0.00 ? 61  LYS A HE2  6  
ATOM 9954  H HE3  . LYS A 1 61  ? -250.702 -27.141 113.958 1.00 0.00 ? 61  LYS A HE3  6  
ATOM 9955  H HZ1  . LYS A 1 61  ? -249.170 -27.471 111.847 1.00 0.00 ? 61  LYS A HZ1  6  
ATOM 9956  H HZ2  . LYS A 1 61  ? -248.648 -25.912 112.281 1.00 0.00 ? 61  LYS A HZ2  6  
ATOM 9957  H HZ3  . LYS A 1 61  ? -248.529 -27.193 113.390 1.00 0.00 ? 61  LYS A HZ3  6  
ATOM 9958  N N    . TYR A 1 62  ? -253.821 -29.416 107.950 1.00 0.00 ? 62  TYR A N    6  
ATOM 9959  C CA   . TYR A 1 62  ? -254.782 -29.935 106.988 1.00 0.00 ? 62  TYR A CA   6  
ATOM 9960  C C    . TYR A 1 62  ? -255.513 -31.140 107.556 1.00 0.00 ? 62  TYR A C    6  
ATOM 9961  O O    . TYR A 1 62  ? -254.964 -31.875 108.376 1.00 0.00 ? 62  TYR A O    6  
ATOM 9962  C CB   . TYR A 1 62  ? -254.083 -30.305 105.678 1.00 0.00 ? 62  TYR A CB   6  
ATOM 9963  C CG   . TYR A 1 62  ? -254.994 -30.230 104.473 1.00 0.00 ? 62  TYR A CG   6  
ATOM 9964  C CD1  . TYR A 1 62  ? -255.298 -29.006 103.896 1.00 0.00 ? 62  TYR A CD1  6  
ATOM 9965  C CD2  . TYR A 1 62  ? -255.552 -31.374 103.915 1.00 0.00 ? 62  TYR A CD2  6  
ATOM 9966  C CE1  . TYR A 1 62  ? -256.128 -28.920 102.798 1.00 0.00 ? 62  TYR A CE1  6  
ATOM 9967  C CE2  . TYR A 1 62  ? -256.385 -31.297 102.815 1.00 0.00 ? 62  TYR A CE2  6  
ATOM 9968  C CZ   . TYR A 1 62  ? -256.670 -30.064 102.260 1.00 0.00 ? 62  TYR A CZ   6  
ATOM 9969  O OH   . TYR A 1 62  ? -257.496 -29.974 101.162 1.00 0.00 ? 62  TYR A OH   6  
ATOM 9970  H H    . TYR A 1 62  ? -253.085 -29.984 108.258 1.00 0.00 ? 62  TYR A H    6  
ATOM 9971  H HA   . TYR A 1 62  ? -255.502 -29.156 106.792 1.00 0.00 ? 62  TYR A HA   6  
ATOM 9972  H HB2  . TYR A 1 62  ? -253.257 -29.627 105.513 1.00 0.00 ? 62  TYR A HB2  6  
ATOM 9973  H HB3  . TYR A 1 62  ? -253.705 -31.314 105.750 1.00 0.00 ? 62  TYR A HB3  6  
ATOM 9974  H HD1  . TYR A 1 62  ? -254.872 -28.107 104.319 1.00 0.00 ? 62  TYR A HD1  6  
ATOM 9975  H HD2  . TYR A 1 62  ? -255.328 -32.335 104.355 1.00 0.00 ? 62  TYR A HD2  6  
ATOM 9976  H HE1  . TYR A 1 62  ? -256.349 -27.955 102.365 1.00 0.00 ? 62  TYR A HE1  6  
ATOM 9977  H HE2  . TYR A 1 62  ? -256.809 -32.196 102.394 1.00 0.00 ? 62  TYR A HE2  6  
ATOM 9978  H HH   . TYR A 1 62  ? -257.108 -29.352 100.527 1.00 0.00 ? 62  TYR A HH   6  
ATOM 9979  N N    . PHE A 1 63  ? -256.752 -31.338 107.123 1.00 0.00 ? 63  PHE A N    6  
ATOM 9980  C CA   . PHE A 1 63  ? -257.554 -32.450 107.602 1.00 0.00 ? 63  PHE A CA   6  
ATOM 9981  C C    . PHE A 1 63  ? -257.190 -33.730 106.859 1.00 0.00 ? 63  PHE A C    6  
ATOM 9982  O O    . PHE A 1 63  ? -257.750 -34.043 105.809 1.00 0.00 ? 63  PHE A O    6  
ATOM 9983  C CB   . PHE A 1 63  ? -259.049 -32.139 107.445 1.00 0.00 ? 63  PHE A CB   6  
ATOM 9984  C CG   . PHE A 1 63  ? -259.960 -33.178 108.045 1.00 0.00 ? 63  PHE A CG   6  
ATOM 9985  C CD1  . PHE A 1 63  ? -260.242 -33.172 109.402 1.00 0.00 ? 63  PHE A CD1  6  
ATOM 9986  C CD2  . PHE A 1 63  ? -260.531 -34.159 107.250 1.00 0.00 ? 63  PHE A CD2  6  
ATOM 9987  C CE1  . PHE A 1 63  ? -261.076 -34.125 109.955 1.00 0.00 ? 63  PHE A CE1  6  
ATOM 9988  C CE2  . PHE A 1 63  ? -261.365 -35.114 107.797 1.00 0.00 ? 63  PHE A CE2  6  
ATOM 9989  C CZ   . PHE A 1 63  ? -261.639 -35.097 109.151 1.00 0.00 ? 63  PHE A CZ   6  
ATOM 9990  H H    . PHE A 1 63  ? -257.132 -30.724 106.462 1.00 0.00 ? 63  PHE A H    6  
ATOM 9991  H HA   . PHE A 1 63  ? -257.335 -32.586 108.651 1.00 0.00 ? 63  PHE A HA   6  
ATOM 9992  H HB2  . PHE A 1 63  ? -259.261 -31.197 107.929 1.00 0.00 ? 63  PHE A HB2  6  
ATOM 9993  H HB3  . PHE A 1 63  ? -259.282 -32.057 106.395 1.00 0.00 ? 63  PHE A HB3  6  
ATOM 9994  H HD1  . PHE A 1 63  ? -259.804 -32.410 110.030 1.00 0.00 ? 63  PHE A HD1  6  
ATOM 9995  H HD2  . PHE A 1 63  ? -260.316 -34.174 106.191 1.00 0.00 ? 63  PHE A HD2  6  
ATOM 9996  H HE1  . PHE A 1 63  ? -261.290 -34.108 111.014 1.00 0.00 ? 63  PHE A HE1  6  
ATOM 9997  H HE2  . PHE A 1 63  ? -261.804 -35.873 107.166 1.00 0.00 ? 63  PHE A HE2  6  
ATOM 9998  H HZ   . PHE A 1 63  ? -262.290 -35.843 109.580 1.00 0.00 ? 63  PHE A HZ   6  
ATOM 9999  N N    . ILE A 1 64  ? -256.211 -34.442 107.393 1.00 0.00 ? 64  ILE A N    6  
ATOM 10000 C CA   . ILE A 1 64  ? -255.808 -35.723 106.839 1.00 0.00 ? 64  ILE A CA   6  
ATOM 10001 C C    . ILE A 1 64  ? -256.080 -36.807 107.882 1.00 0.00 ? 64  ILE A C    6  
ATOM 10002 O O    . ILE A 1 64  ? -255.584 -37.933 107.793 1.00 0.00 ? 64  ILE A O    6  
ATOM 10003 C CB   . ILE A 1 64  ? -254.310 -35.713 106.432 1.00 0.00 ? 64  ILE A CB   6  
ATOM 10004 C CG1  . ILE A 1 64  ? -253.990 -34.439 105.646 1.00 0.00 ? 64  ILE A CG1  6  
ATOM 10005 C CG2  . ILE A 1 64  ? -253.964 -36.936 105.591 1.00 0.00 ? 64  ILE A CG2  6  
ATOM 10006 C CD1  . ILE A 1 64  ? -252.546 -34.344 105.194 1.00 0.00 ? 64  ILE A CD1  6  
ATOM 10007 H H    . ILE A 1 64  ? -255.734 -34.089 108.179 1.00 0.00 ? 64  ILE A H    6  
ATOM 10008 H HA   . ILE A 1 64  ? -256.408 -35.915 105.963 1.00 0.00 ? 64  ILE A HA   6  
ATOM 10009 H HB   . ILE A 1 64  ? -253.711 -35.736 107.328 1.00 0.00 ? 64  ILE A HB   6  
ATOM 10010 H HG12 . ILE A 1 64  ? -254.615 -34.401 104.767 1.00 0.00 ? 64  ILE A HG12 6  
ATOM 10011 H HG13 . ILE A 1 64  ? -254.201 -33.582 106.269 1.00 0.00 ? 64  ILE A HG13 6  
ATOM 10012 H HG21 . ILE A 1 64  ? -254.223 -37.831 106.134 1.00 0.00 ? 64  ILE A HG21 6  
ATOM 10013 H HG22 . ILE A 1 64  ? -254.518 -36.903 104.663 1.00 0.00 ? 64  ILE A HG22 6  
ATOM 10014 H HG23 . ILE A 1 64  ? -252.906 -36.938 105.378 1.00 0.00 ? 64  ILE A HG23 6  
ATOM 10015 H HD11 . ILE A 1 64  ? -251.897 -34.363 106.058 1.00 0.00 ? 64  ILE A HD11 6  
ATOM 10016 H HD12 . ILE A 1 64  ? -252.317 -35.182 104.551 1.00 0.00 ? 64  ILE A HD12 6  
ATOM 10017 H HD13 . ILE A 1 64  ? -252.398 -33.421 104.652 1.00 0.00 ? 64  ILE A HD13 6  
ATOM 10018 N N    . SER A 1 65  ? -256.912 -36.442 108.853 1.00 0.00 ? 65  SER A N    6  
ATOM 10019 C CA   . SER A 1 65  ? -257.252 -37.299 109.982 1.00 0.00 ? 65  SER A CA   6  
ATOM 10020 C C    . SER A 1 65  ? -257.737 -38.673 109.527 1.00 0.00 ? 65  SER A C    6  
ATOM 10021 O O    . SER A 1 65  ? -258.850 -38.821 109.015 1.00 0.00 ? 65  SER A O    6  
ATOM 10022 C CB   . SER A 1 65  ? -258.334 -36.619 110.821 1.00 0.00 ? 65  SER A CB   6  
ATOM 10023 O OG   . SER A 1 65  ? -258.000 -35.261 111.076 1.00 0.00 ? 65  SER A OG   6  
ATOM 10024 H H    . SER A 1 65  ? -257.319 -35.553 108.810 1.00 0.00 ? 65  SER A H    6  
ATOM 10025 H HA   . SER A 1 65  ? -256.365 -37.424 110.587 1.00 0.00 ? 65  SER A HA   6  
ATOM 10026 H HB2  . SER A 1 65  ? -259.273 -36.652 110.289 1.00 0.00 ? 65  SER A HB2  6  
ATOM 10027 H HB3  . SER A 1 65  ? -258.433 -37.137 111.763 1.00 0.00 ? 65  SER A HB3  6  
ATOM 10028 H HG   . SER A 1 65  ? -257.287 -35.225 111.734 1.00 0.00 ? 65  SER A HG   6  
ATOM 10029 N N    . LYS A 1 66  ? -256.885 -39.671 109.700 1.00 0.00 ? 66  LYS A N    6  
ATOM 10030 C CA   . LYS A 1 66  ? -257.223 -41.043 109.355 1.00 0.00 ? 66  LYS A CA   6  
ATOM 10031 C C    . LYS A 1 66  ? -258.016 -41.673 110.490 1.00 0.00 ? 66  LYS A C    6  
ATOM 10032 O O    . LYS A 1 66  ? -259.032 -42.334 110.262 1.00 0.00 ? 66  LYS A O    6  
ATOM 10033 C CB   . LYS A 1 66  ? -255.949 -41.845 109.092 1.00 0.00 ? 66  LYS A CB   6  
ATOM 10034 C CG   . LYS A 1 66  ? -255.025 -41.192 108.077 1.00 0.00 ? 66  LYS A CG   6  
ATOM 10035 C CD   . LYS A 1 66  ? -253.747 -41.987 107.870 1.00 0.00 ? 66  LYS A CD   6  
ATOM 10036 C CE   . LYS A 1 66  ? -252.791 -41.255 106.937 1.00 0.00 ? 66  LYS A CE   6  
ATOM 10037 N NZ   . LYS A 1 66  ? -253.370 -41.051 105.581 1.00 0.00 ? 66  LYS A NZ   6  
ATOM 10038 H H    . LYS A 1 66  ? -255.996 -39.475 110.067 1.00 0.00 ? 66  LYS A H    6  
ATOM 10039 H HA   . LYS A 1 66  ? -257.831 -41.027 108.463 1.00 0.00 ? 66  LYS A HA   6  
ATOM 10040 H HB2  . LYS A 1 66  ? -255.409 -41.957 110.019 1.00 0.00 ? 66  LYS A HB2  6  
ATOM 10041 H HB3  . LYS A 1 66  ? -256.221 -42.824 108.723 1.00 0.00 ? 66  LYS A HB3  6  
ATOM 10042 H HG2  . LYS A 1 66  ? -255.544 -41.115 107.134 1.00 0.00 ? 66  LYS A HG2  6  
ATOM 10043 H HG3  . LYS A 1 66  ? -254.768 -40.204 108.430 1.00 0.00 ? 66  LYS A HG3  6  
ATOM 10044 H HD2  . LYS A 1 66  ? -253.263 -42.131 108.824 1.00 0.00 ? 66  LYS A HD2  6  
ATOM 10045 H HD3  . LYS A 1 66  ? -253.993 -42.946 107.440 1.00 0.00 ? 66  LYS A HD3  6  
ATOM 10046 H HE2  . LYS A 1 66  ? -252.559 -40.293 107.367 1.00 0.00 ? 66  LYS A HE2  6  
ATOM 10047 H HE3  . LYS A 1 66  ? -251.884 -41.834 106.846 1.00 0.00 ? 66  LYS A HE3  6  
ATOM 10048 H HZ1  . LYS A 1 66  ? -254.273 -40.526 105.647 1.00 0.00 ? 66  LYS A HZ1  6  
ATOM 10049 H HZ2  . LYS A 1 66  ? -252.709 -40.503 104.990 1.00 0.00 ? 66  LYS A HZ2  6  
ATOM 10050 H HZ3  . LYS A 1 66  ? -253.549 -41.967 105.121 1.00 0.00 ? 66  LYS A HZ3  6  
ATOM 10051 N N    . GLU A 1 67  ? -257.528 -41.448 111.709 1.00 0.00 ? 67  GLU A N    6  
ATOM 10052 C CA   . GLU A 1 67  ? -258.194 -41.880 112.936 1.00 0.00 ? 67  GLU A CA   6  
ATOM 10053 C C    . GLU A 1 67  ? -258.235 -43.397 113.083 1.00 0.00 ? 67  GLU A C    6  
ATOM 10054 O O    . GLU A 1 67  ? -257.611 -44.126 112.310 1.00 0.00 ? 67  GLU A O    6  
ATOM 10055 C CB   . GLU A 1 67  ? -259.597 -41.283 113.028 1.00 0.00 ? 67  GLU A CB   6  
ATOM 10056 C CG   . GLU A 1 67  ? -259.575 -39.798 113.337 1.00 0.00 ? 67  GLU A CG   6  
ATOM 10057 C CD   . GLU A 1 67  ? -258.723 -39.489 114.553 1.00 0.00 ? 67  GLU A CD   6  
ATOM 10058 O OE1  . GLU A 1 67  ? -259.258 -39.496 115.679 1.00 0.00 ? 67  GLU A OE1  6  
ATOM 10059 O OE2  . GLU A 1 67  ? -257.509 -39.261 114.392 1.00 0.00 ? 67  GLU A OE2  6  
ATOM 10060 H H    . GLU A 1 67  ? -256.681 -40.968 111.789 1.00 0.00 ? 67  GLU A H    6  
ATOM 10061 H HA   . GLU A 1 67  ? -257.613 -41.490 113.756 1.00 0.00 ? 67  GLU A HA   6  
ATOM 10062 H HB2  . GLU A 1 67  ? -260.102 -41.431 112.087 1.00 0.00 ? 67  GLU A HB2  6  
ATOM 10063 H HB3  . GLU A 1 67  ? -260.144 -41.786 113.810 1.00 0.00 ? 67  GLU A HB3  6  
ATOM 10064 H HG2  . GLU A 1 67  ? -259.171 -39.267 112.486 1.00 0.00 ? 67  GLU A HG2  6  
ATOM 10065 H HG3  . GLU A 1 67  ? -260.586 -39.466 113.527 1.00 0.00 ? 67  GLU A HG3  6  
ATOM 10066 N N    . LYS A 1 68  ? -258.949 -43.849 114.120 1.00 0.00 ? 68  LYS A N    6  
ATOM 10067 C CA   . LYS A 1 68  ? -259.023 -45.262 114.511 1.00 0.00 ? 68  LYS A CA   6  
ATOM 10068 C C    . LYS A 1 68  ? -257.742 -45.700 115.213 1.00 0.00 ? 68  LYS A C    6  
ATOM 10069 O O    . LYS A 1 68  ? -257.793 -46.343 116.263 1.00 0.00 ? 68  LYS A O    6  
ATOM 10070 C CB   . LYS A 1 68  ? -259.337 -46.189 113.325 1.00 0.00 ? 68  LYS A CB   6  
ATOM 10071 C CG   . LYS A 1 68  ? -260.766 -46.077 112.808 1.00 0.00 ? 68  LYS A CG   6  
ATOM 10072 C CD   . LYS A 1 68  ? -261.790 -46.363 113.901 1.00 0.00 ? 68  LYS A CD   6  
ATOM 10073 C CE   . LYS A 1 68  ? -261.626 -47.760 114.494 1.00 0.00 ? 68  LYS A CE   6  
ATOM 10074 N NZ   . LYS A 1 68  ? -261.986 -48.836 113.532 1.00 0.00 ? 68  LYS A NZ   6  
ATOM 10075 H H    . LYS A 1 68  ? -259.442 -43.195 114.663 1.00 0.00 ? 68  LYS A H    6  
ATOM 10076 H HA   . LYS A 1 68  ? -259.828 -45.342 115.225 1.00 0.00 ? 68  LYS A HA   6  
ATOM 10077 H HB2  . LYS A 1 68  ? -258.665 -45.953 112.513 1.00 0.00 ? 68  LYS A HB2  6  
ATOM 10078 H HB3  . LYS A 1 68  ? -259.168 -47.212 113.630 1.00 0.00 ? 68  LYS A HB3  6  
ATOM 10079 H HG2  . LYS A 1 68  ? -260.925 -45.076 112.435 1.00 0.00 ? 68  LYS A HG2  6  
ATOM 10080 H HG3  . LYS A 1 68  ? -260.904 -46.788 112.005 1.00 0.00 ? 68  LYS A HG3  6  
ATOM 10081 H HD2  . LYS A 1 68  ? -261.665 -45.637 114.691 1.00 0.00 ? 68  LYS A HD2  6  
ATOM 10082 H HD3  . LYS A 1 68  ? -262.781 -46.274 113.484 1.00 0.00 ? 68  LYS A HD3  6  
ATOM 10083 H HE2  . LYS A 1 68  ? -260.596 -47.889 114.793 1.00 0.00 ? 68  LYS A HE2  6  
ATOM 10084 H HE3  . LYS A 1 68  ? -262.261 -47.841 115.364 1.00 0.00 ? 68  LYS A HE3  6  
ATOM 10085 H HZ1  . LYS A 1 68  ? -261.467 -48.712 112.635 1.00 0.00 ? 68  LYS A HZ1  6  
ATOM 10086 H HZ2  . LYS A 1 68  ? -261.747 -49.771 113.932 1.00 0.00 ? 68  LYS A HZ2  6  
ATOM 10087 H HZ3  . LYS A 1 68  ? -263.009 -48.816 113.331 1.00 0.00 ? 68  LYS A HZ3  6  
ATOM 10088 N N    . ASN A 1 69  ? -256.602 -45.339 114.642 1.00 0.00 ? 69  ASN A N    6  
ATOM 10089 C CA   . ASN A 1 69  ? -255.309 -45.630 115.250 1.00 0.00 ? 69  ASN A CA   6  
ATOM 10090 C C    . ASN A 1 69  ? -254.233 -44.699 114.727 1.00 0.00 ? 69  ASN A C    6  
ATOM 10091 O O    . ASN A 1 69  ? -253.898 -44.707 113.543 1.00 0.00 ? 69  ASN A O    6  
ATOM 10092 C CB   . ASN A 1 69  ? -254.899 -47.087 115.015 1.00 0.00 ? 69  ASN A CB   6  
ATOM 10093 C CG   . ASN A 1 69  ? -253.578 -47.427 115.688 1.00 0.00 ? 69  ASN A CG   6  
ATOM 10094 O OD1  . ASN A 1 69  ? -253.253 -46.895 116.750 1.00 0.00 ? 69  ASN A OD1  6  
ATOM 10095 N ND2  . ASN A 1 69  ? -252.804 -48.307 115.074 1.00 0.00 ? 69  ASN A ND2  6  
ATOM 10096 H H    . ASN A 1 69  ? -256.632 -44.856 113.787 1.00 0.00 ? 69  ASN A H    6  
ATOM 10097 H HA   . ASN A 1 69  ? -255.394 -45.457 116.315 1.00 0.00 ? 69  ASN A HA   6  
ATOM 10098 H HB2  . ASN A 1 69  ? -255.663 -47.737 115.413 1.00 0.00 ? 69  ASN A HB2  6  
ATOM 10099 H HB3  . ASN A 1 69  ? -254.795 -47.262 113.955 1.00 0.00 ? 69  ASN A HB3  6  
ATOM 10100 H HD21 . ASN A 1 69  ? -253.116 -48.690 114.221 1.00 0.00 ? 69  ASN A HD21 6  
ATOM 10101 H HD22 . ASN A 1 69  ? -251.945 -48.548 115.499 1.00 0.00 ? 69  ASN A HD22 6  
ATOM 10102 N N    . GLU A 1 70  ? -253.714 -43.912 115.653 1.00 0.00 ? 70  GLU A N    6  
ATOM 10103 C CA   . GLU A 1 70  ? -252.609 -43.005 115.437 1.00 0.00 ? 70  GLU A CA   6  
ATOM 10104 C C    . GLU A 1 70  ? -252.887 -41.955 114.355 1.00 0.00 ? 70  GLU A C    6  
ATOM 10105 O O    . GLU A 1 70  ? -252.644 -42.172 113.164 1.00 0.00 ? 70  GLU A O    6  
ATOM 10106 C CB   . GLU A 1 70  ? -251.329 -43.782 115.156 1.00 0.00 ? 70  GLU A CB   6  
ATOM 10107 C CG   . GLU A 1 70  ? -250.098 -42.904 115.120 1.00 0.00 ? 70  GLU A CG   6  
ATOM 10108 C CD   . GLU A 1 70  ? -248.839 -43.655 115.484 1.00 0.00 ? 70  GLU A CD   6  
ATOM 10109 O OE1  . GLU A 1 70  ? -248.324 -44.419 114.639 1.00 0.00 ? 70  GLU A OE1  6  
ATOM 10110 O OE2  . GLU A 1 70  ? -248.355 -43.489 116.622 1.00 0.00 ? 70  GLU A OE2  6  
ATOM 10111 H H    . GLU A 1 70  ? -254.090 -43.951 116.551 1.00 0.00 ? 70  GLU A H    6  
ATOM 10112 H HA   . GLU A 1 70  ? -252.480 -42.485 116.370 1.00 0.00 ? 70  GLU A HA   6  
ATOM 10113 H HB2  . GLU A 1 70  ? -251.195 -44.526 115.929 1.00 0.00 ? 70  GLU A HB2  6  
ATOM 10114 H HB3  . GLU A 1 70  ? -251.427 -44.277 114.204 1.00 0.00 ? 70  GLU A HB3  6  
ATOM 10115 H HG2  . GLU A 1 70  ? -249.987 -42.501 114.125 1.00 0.00 ? 70  GLU A HG2  6  
ATOM 10116 H HG3  . GLU A 1 70  ? -250.236 -42.098 115.824 1.00 0.00 ? 70  GLU A HG3  6  
ATOM 10117 N N    . CYS A 1 71  ? -253.425 -40.828 114.812 1.00 0.00 ? 71  CYS A N    6  
ATOM 10118 C CA   . CYS A 1 71  ? -253.653 -39.636 114.000 1.00 0.00 ? 71  CYS A CA   6  
ATOM 10119 C C    . CYS A 1 71  ? -254.408 -38.637 114.869 1.00 0.00 ? 71  CYS A C    6  
ATOM 10120 O O    . CYS A 1 71  ? -254.801 -38.978 115.987 1.00 0.00 ? 71  CYS A O    6  
ATOM 10121 C CB   . CYS A 1 71  ? -254.461 -39.961 112.738 1.00 0.00 ? 71  CYS A CB   6  
ATOM 10122 S SG   . CYS A 1 71  ? -254.484 -38.640 111.505 1.00 0.00 ? 71  CYS A SG   6  
ATOM 10123 H H    . CYS A 1 71  ? -253.708 -40.800 115.748 1.00 0.00 ? 71  CYS A H    6  
ATOM 10124 H HA   . CYS A 1 71  ? -252.695 -39.219 113.727 1.00 0.00 ? 71  CYS A HA   6  
ATOM 10125 H HB2  . CYS A 1 71  ? -254.044 -40.839 112.269 1.00 0.00 ? 71  CYS A HB2  6  
ATOM 10126 H HB3  . CYS A 1 71  ? -255.485 -40.166 113.019 1.00 0.00 ? 71  CYS A HB3  6  
ATOM 10127 H HG   . CYS A 1 71  ? -253.445 -37.836 111.737 1.00 0.00 ? 71  CYS A HG   6  
ATOM 10128 N N    . ARG A 1 72  ? -254.601 -37.412 114.407 1.00 0.00 ? 72  ARG A N    6  
ATOM 10129 C CA   . ARG A 1 72  ? -255.381 -36.467 115.174 1.00 0.00 ? 72  ARG A CA   6  
ATOM 10130 C C    . ARG A 1 72  ? -256.600 -35.986 114.398 1.00 0.00 ? 72  ARG A C    6  
ATOM 10131 O O    . ARG A 1 72  ? -256.485 -35.479 113.281 1.00 0.00 ? 72  ARG A O    6  
ATOM 10132 C CB   . ARG A 1 72  ? -254.532 -35.279 115.612 1.00 0.00 ? 72  ARG A CB   6  
ATOM 10133 C CG   . ARG A 1 72  ? -255.285 -34.346 116.532 1.00 0.00 ? 72  ARG A CG   6  
ATOM 10134 C CD   . ARG A 1 72  ? -255.793 -35.091 117.758 1.00 0.00 ? 72  ARG A CD   6  
ATOM 10135 N NE   . ARG A 1 72  ? -256.830 -34.347 118.467 1.00 0.00 ? 72  ARG A NE   6  
ATOM 10136 C CZ   . ARG A 1 72  ? -258.007 -34.869 118.835 1.00 0.00 ? 72  ARG A CZ   6  
ATOM 10137 N NH1  . ARG A 1 72  ? -258.287 -36.151 118.590 1.00 0.00 ? 72  ARG A NH1  6  
ATOM 10138 N NH2  . ARG A 1 72  ? -258.897 -34.108 119.453 1.00 0.00 ? 72  ARG A NH2  6  
ATOM 10139 H H    . ARG A 1 72  ? -254.207 -37.133 113.553 1.00 0.00 ? 72  ARG A H    6  
ATOM 10140 H HA   . ARG A 1 72  ? -255.727 -36.982 116.059 1.00 0.00 ? 72  ARG A HA   6  
ATOM 10141 H HB2  . ARG A 1 72  ? -253.655 -35.642 116.129 1.00 0.00 ? 72  ARG A HB2  6  
ATOM 10142 H HB3  . ARG A 1 72  ? -254.226 -34.724 114.739 1.00 0.00 ? 72  ARG A HB3  6  
ATOM 10143 H HG2  . ARG A 1 72  ? -254.623 -33.553 116.845 1.00 0.00 ? 72  ARG A HG2  6  
ATOM 10144 H HG3  . ARG A 1 72  ? -256.123 -33.934 115.995 1.00 0.00 ? 72  ARG A HG3  6  
ATOM 10145 H HD2  . ARG A 1 72  ? -256.200 -36.038 117.442 1.00 0.00 ? 72  ARG A HD2  6  
ATOM 10146 H HD3  . ARG A 1 72  ? -254.964 -35.262 118.428 1.00 0.00 ? 72  ARG A HD3  6  
ATOM 10147 H HE   . ARG A 1 72  ? -256.647 -33.402 118.674 1.00 0.00 ? 72  ARG A HE   6  
ATOM 10148 H HH11 . ARG A 1 72  ? -257.615 -36.741 118.129 1.00 0.00 ? 72  ARG A HH11 6  
ATOM 10149 H HH12 . ARG A 1 72  ? -259.177 -36.538 118.865 1.00 0.00 ? 72  ARG A HH12 6  
ATOM 10150 H HH21 . ARG A 1 72  ? -258.687 -33.140 119.650 1.00 0.00 ? 72  ARG A HH21 6  
ATOM 10151 H HH22 . ARG A 1 72  ? -259.797 -34.486 119.713 1.00 0.00 ? 72  ARG A HH22 6  
ATOM 10152 N N    . LYS A 1 73  ? -257.764 -36.164 115.006 1.00 0.00 ? 73  LYS A N    6  
ATOM 10153 C CA   . LYS A 1 73  ? -259.023 -35.706 114.442 1.00 0.00 ? 73  LYS A CA   6  
ATOM 10154 C C    . LYS A 1 73  ? -259.200 -34.209 114.672 1.00 0.00 ? 73  LYS A C    6  
ATOM 10155 O O    . LYS A 1 73  ? -258.892 -33.710 115.753 1.00 0.00 ? 73  LYS A O    6  
ATOM 10156 C CB   . LYS A 1 73  ? -260.175 -36.486 115.081 1.00 0.00 ? 73  LYS A CB   6  
ATOM 10157 C CG   . LYS A 1 73  ? -261.560 -36.029 114.661 1.00 0.00 ? 73  LYS A CG   6  
ATOM 10158 C CD   . LYS A 1 73  ? -262.631 -36.943 115.235 1.00 0.00 ? 73  LYS A CD   6  
ATOM 10159 C CE   . LYS A 1 73  ? -264.030 -36.399 114.994 1.00 0.00 ? 73  LYS A CE   6  
ATOM 10160 N NZ   . LYS A 1 73  ? -265.076 -37.388 115.362 1.00 0.00 ? 73  LYS A NZ   6  
ATOM 10161 H H    . LYS A 1 73  ? -257.780 -36.632 115.866 1.00 0.00 ? 73  LYS A H    6  
ATOM 10162 H HA   . LYS A 1 73  ? -259.009 -35.902 113.380 1.00 0.00 ? 73  LYS A HA   6  
ATOM 10163 H HB2  . LYS A 1 73  ? -260.072 -37.528 114.815 1.00 0.00 ? 73  LYS A HB2  6  
ATOM 10164 H HB3  . LYS A 1 73  ? -260.100 -36.394 116.155 1.00 0.00 ? 73  LYS A HB3  6  
ATOM 10165 H HG2  . LYS A 1 73  ? -261.722 -35.023 115.020 1.00 0.00 ? 73  LYS A HG2  6  
ATOM 10166 H HG3  . LYS A 1 73  ? -261.624 -36.044 113.582 1.00 0.00 ? 73  LYS A HG3  6  
ATOM 10167 H HD2  . LYS A 1 73  ? -262.549 -37.913 114.768 1.00 0.00 ? 73  LYS A HD2  6  
ATOM 10168 H HD3  . LYS A 1 73  ? -262.471 -37.039 116.299 1.00 0.00 ? 73  LYS A HD3  6  
ATOM 10169 H HE2  . LYS A 1 73  ? -264.165 -35.508 115.590 1.00 0.00 ? 73  LYS A HE2  6  
ATOM 10170 H HE3  . LYS A 1 73  ? -264.130 -36.152 113.948 1.00 0.00 ? 73  LYS A HE3  6  
ATOM 10171 H HZ1  . LYS A 1 73  ? -264.904 -37.754 116.325 1.00 0.00 ? 73  LYS A HZ1  6  
ATOM 10172 H HZ2  . LYS A 1 73  ? -266.018 -36.940 115.338 1.00 0.00 ? 73  LYS A HZ2  6  
ATOM 10173 H HZ3  . LYS A 1 73  ? -265.067 -38.186 114.691 1.00 0.00 ? 73  LYS A HZ3  6  
ATOM 10174 N N    . GLN A 1 74  ? -259.682 -33.514 113.641 1.00 0.00 ? 74  GLN A N    6  
ATOM 10175 C CA   . GLN A 1 74  ? -259.944 -32.074 113.699 1.00 0.00 ? 74  GLN A CA   6  
ATOM 10176 C C    . GLN A 1 74  ? -258.644 -31.280 113.819 1.00 0.00 ? 74  GLN A C    6  
ATOM 10177 O O    . GLN A 1 74  ? -258.014 -31.242 114.876 1.00 0.00 ? 74  GLN A O    6  
ATOM 10178 C CB   . GLN A 1 74  ? -260.885 -31.723 114.857 1.00 0.00 ? 74  GLN A CB   6  
ATOM 10179 C CG   . GLN A 1 74  ? -261.240 -30.245 114.924 1.00 0.00 ? 74  GLN A CG   6  
ATOM 10180 C CD   . GLN A 1 74  ? -262.134 -29.903 116.100 1.00 0.00 ? 74  GLN A CD   6  
ATOM 10181 O OE1  . GLN A 1 74  ? -262.940 -30.721 116.551 1.00 0.00 ? 74  GLN A OE1  6  
ATOM 10182 N NE2  . GLN A 1 74  ? -262.000 -28.690 116.605 1.00 0.00 ? 74  GLN A NE2  6  
ATOM 10183 H H    . GLN A 1 74  ? -259.853 -33.988 112.800 1.00 0.00 ? 74  GLN A H    6  
ATOM 10184 H HA   . GLN A 1 74  ? -260.423 -31.799 112.770 1.00 0.00 ? 74  GLN A HA   6  
ATOM 10185 H HB2  . GLN A 1 74  ? -261.799 -32.287 114.748 1.00 0.00 ? 74  GLN A HB2  6  
ATOM 10186 H HB3  . GLN A 1 74  ? -260.410 -31.998 115.788 1.00 0.00 ? 74  GLN A HB3  6  
ATOM 10187 H HG2  . GLN A 1 74  ? -260.328 -29.673 115.010 1.00 0.00 ? 74  GLN A HG2  6  
ATOM 10188 H HG3  . GLN A 1 74  ? -261.750 -29.972 114.012 1.00 0.00 ? 74  GLN A HG3  6  
ATOM 10189 H HE21 . GLN A 1 74  ? -261.338 -28.083 116.193 1.00 0.00 ? 74  GLN A HE21 6  
ATOM 10190 H HE22 . GLN A 1 74  ? -262.556 -28.440 117.373 1.00 0.00 ? 74  GLN A HE22 6  
ATOM 10191 N N    . PRO A 1 75  ? -258.223 -30.640 112.723 1.00 0.00 ? 75  PRO A N    6  
ATOM 10192 C CA   . PRO A 1 75  ? -257.010 -29.833 112.714 1.00 0.00 ? 75  PRO A CA   6  
ATOM 10193 C C    . PRO A 1 75  ? -257.177 -28.554 113.532 1.00 0.00 ? 75  PRO A C    6  
ATOM 10194 O O    . PRO A 1 75  ? -257.831 -27.606 113.097 1.00 0.00 ? 75  PRO A O    6  
ATOM 10195 C CB   . PRO A 1 75  ? -256.802 -29.508 111.232 1.00 0.00 ? 75  PRO A CB   6  
ATOM 10196 C CG   . PRO A 1 75  ? -258.152 -29.621 110.614 1.00 0.00 ? 75  PRO A CG   6  
ATOM 10197 C CD   . PRO A 1 75  ? -258.899 -30.653 111.415 1.00 0.00 ? 75  PRO A CD   6  
ATOM 10198 H HA   . PRO A 1 75  ? -256.164 -30.389 113.090 1.00 0.00 ? 75  PRO A HA   6  
ATOM 10199 H HB2  . PRO A 1 75  ? -256.407 -28.507 111.136 1.00 0.00 ? 75  PRO A HB2  6  
ATOM 10200 H HB3  . PRO A 1 75  ? -256.110 -30.216 110.801 1.00 0.00 ? 75  PRO A HB3  6  
ATOM 10201 H HG2  . PRO A 1 75  ? -258.661 -28.668 110.665 1.00 0.00 ? 75  PRO A HG2  6  
ATOM 10202 H HG3  . PRO A 1 75  ? -258.058 -29.942 109.587 1.00 0.00 ? 75  PRO A HG3  6  
ATOM 10203 H HD2  . PRO A 1 75  ? -259.939 -30.371 111.517 1.00 0.00 ? 75  PRO A HD2  6  
ATOM 10204 H HD3  . PRO A 1 75  ? -258.815 -31.623 110.949 1.00 0.00 ? 75  PRO A HD3  6  
ATOM 10205 N N    . PHE A 1 76  ? -256.630 -28.552 114.737 1.00 0.00 ? 76  PHE A N    6  
ATOM 10206 C CA   . PHE A 1 76  ? -256.656 -27.366 115.577 1.00 0.00 ? 76  PHE A CA   6  
ATOM 10207 C C    . PHE A 1 76  ? -255.629 -26.353 115.085 1.00 0.00 ? 76  PHE A C    6  
ATOM 10208 O O    . PHE A 1 76  ? -254.422 -26.594 115.124 1.00 0.00 ? 76  PHE A O    6  
ATOM 10209 C CB   . PHE A 1 76  ? -256.434 -27.723 117.056 1.00 0.00 ? 76  PHE A CB   6  
ATOM 10210 C CG   . PHE A 1 76  ? -255.393 -28.784 117.302 1.00 0.00 ? 76  PHE A CG   6  
ATOM 10211 C CD1  . PHE A 1 76  ? -255.746 -30.126 117.315 1.00 0.00 ? 76  PHE A CD1  6  
ATOM 10212 C CD2  . PHE A 1 76  ? -254.071 -28.444 117.532 1.00 0.00 ? 76  PHE A CD2  6  
ATOM 10213 C CE1  . PHE A 1 76  ? -254.800 -31.104 117.548 1.00 0.00 ? 76  PHE A CE1  6  
ATOM 10214 C CE2  . PHE A 1 76  ? -253.120 -29.420 117.763 1.00 0.00 ? 76  PHE A CE2  6  
ATOM 10215 C CZ   . PHE A 1 76  ? -253.485 -30.751 117.773 1.00 0.00 ? 76  PHE A CZ   6  
ATOM 10216 H H    . PHE A 1 76  ? -256.203 -29.368 115.072 1.00 0.00 ? 76  PHE A H    6  
ATOM 10217 H HA   . PHE A 1 76  ? -257.636 -26.925 115.473 1.00 0.00 ? 76  PHE A HA   6  
ATOM 10218 H HB2  . PHE A 1 76  ? -256.127 -26.836 117.586 1.00 0.00 ? 76  PHE A HB2  6  
ATOM 10219 H HB3  . PHE A 1 76  ? -257.368 -28.073 117.473 1.00 0.00 ? 76  PHE A HB3  6  
ATOM 10220 H HD1  . PHE A 1 76  ? -256.773 -30.404 117.139 1.00 0.00 ? 76  PHE A HD1  6  
ATOM 10221 H HD2  . PHE A 1 76  ? -253.784 -27.403 117.526 1.00 0.00 ? 76  PHE A HD2  6  
ATOM 10222 H HE1  . PHE A 1 76  ? -255.090 -32.145 117.557 1.00 0.00 ? 76  PHE A HE1  6  
ATOM 10223 H HE2  . PHE A 1 76  ? -252.093 -29.141 117.938 1.00 0.00 ? 76  PHE A HE2  6  
ATOM 10224 H HZ   . PHE A 1 76  ? -252.743 -31.514 117.955 1.00 0.00 ? 76  PHE A HZ   6  
ATOM 10225 N N    . GLN A 1 77  ? -256.125 -25.227 114.597 1.00 0.00 ? 77  GLN A N    6  
ATOM 10226 C CA   . GLN A 1 77  ? -255.280 -24.201 114.009 1.00 0.00 ? 77  GLN A CA   6  
ATOM 10227 C C    . GLN A 1 77  ? -254.854 -23.205 115.074 1.00 0.00 ? 77  GLN A C    6  
ATOM 10228 O O    . GLN A 1 77  ? -255.621 -22.905 115.991 1.00 0.00 ? 77  GLN A O    6  
ATOM 10229 C CB   . GLN A 1 77  ? -256.042 -23.470 112.899 1.00 0.00 ? 77  GLN A CB   6  
ATOM 10230 C CG   . GLN A 1 77  ? -256.817 -24.395 111.973 1.00 0.00 ? 77  GLN A CG   6  
ATOM 10231 C CD   . GLN A 1 77  ? -255.926 -25.266 111.105 1.00 0.00 ? 77  GLN A CD   6  
ATOM 10232 O OE1  . GLN A 1 77  ? -255.518 -26.358 111.499 1.00 0.00 ? 77  GLN A OE1  6  
ATOM 10233 N NE2  . GLN A 1 77  ? -255.630 -24.796 109.908 1.00 0.00 ? 77  GLN A NE2  6  
ATOM 10234 H H    . GLN A 1 77  ? -257.096 -25.076 114.643 1.00 0.00 ? 77  GLN A H    6  
ATOM 10235 H HA   . GLN A 1 77  ? -254.404 -24.677 113.590 1.00 0.00 ? 77  GLN A HA   6  
ATOM 10236 H HB2  . GLN A 1 77  ? -256.742 -22.784 113.353 1.00 0.00 ? 77  GLN A HB2  6  
ATOM 10237 H HB3  . GLN A 1 77  ? -255.337 -22.909 112.305 1.00 0.00 ? 77  GLN A HB3  6  
ATOM 10238 H HG2  . GLN A 1 77  ? -257.438 -25.041 112.574 1.00 0.00 ? 77  GLN A HG2  6  
ATOM 10239 H HG3  . GLN A 1 77  ? -257.445 -23.793 111.330 1.00 0.00 ? 77  GLN A HG3  6  
ATOM 10240 H HE21 . GLN A 1 77  ? -255.990 -23.910 109.649 1.00 0.00 ? 77  GLN A HE21 6  
ATOM 10241 H HE22 . GLN A 1 77  ? -255.088 -25.352 109.315 1.00 0.00 ? 77  GLN A HE22 6  
ATOM 10242 N N    . ARG A 1 78  ? -253.638 -22.696 114.965 1.00 0.00 ? 78  ARG A N    6  
ATOM 10243 C CA   . ARG A 1 78  ? -253.162 -21.689 115.898 1.00 0.00 ? 78  ARG A CA   6  
ATOM 10244 C C    . ARG A 1 78  ? -252.862 -20.385 115.168 1.00 0.00 ? 78  ARG A C    6  
ATOM 10245 O O    . ARG A 1 78  ? -252.297 -20.383 114.070 1.00 0.00 ? 78  ARG A O    6  
ATOM 10246 C CB   . ARG A 1 78  ? -251.937 -22.183 116.678 1.00 0.00 ? 78  ARG A CB   6  
ATOM 10247 C CG   . ARG A 1 78  ? -250.787 -22.668 115.816 1.00 0.00 ? 78  ARG A CG   6  
ATOM 10248 C CD   . ARG A 1 78  ? -249.678 -23.267 116.670 1.00 0.00 ? 78  ARG A CD   6  
ATOM 10249 N NE   . ARG A 1 78  ? -248.600 -23.812 115.852 1.00 0.00 ? 78  ARG A NE   6  
ATOM 10250 C CZ   . ARG A 1 78  ? -248.077 -25.025 116.001 1.00 0.00 ? 78  ARG A CZ   6  
ATOM 10251 N NH1  . ARG A 1 78  ? -248.439 -25.807 117.009 1.00 0.00 ? 78  ARG A NH1  6  
ATOM 10252 N NH2  . ARG A 1 78  ? -247.162 -25.451 115.146 1.00 0.00 ? 78  ARG A NH2  6  
ATOM 10253 H H    . ARG A 1 78  ? -253.053 -22.995 114.238 1.00 0.00 ? 78  ARG A H    6  
ATOM 10254 H HA   . ARG A 1 78  ? -253.962 -21.502 116.600 1.00 0.00 ? 78  ARG A HA   6  
ATOM 10255 H HB2  . ARG A 1 78  ? -251.574 -21.377 117.296 1.00 0.00 ? 78  ARG A HB2  6  
ATOM 10256 H HB3  . ARG A 1 78  ? -252.244 -22.998 117.318 1.00 0.00 ? 78  ARG A HB3  6  
ATOM 10257 H HG2  . ARG A 1 78  ? -251.152 -23.421 115.132 1.00 0.00 ? 78  ARG A HG2  6  
ATOM 10258 H HG3  . ARG A 1 78  ? -250.389 -21.833 115.257 1.00 0.00 ? 78  ARG A HG3  6  
ATOM 10259 H HD2  . ARG A 1 78  ? -249.277 -22.497 117.312 1.00 0.00 ? 78  ARG A HD2  6  
ATOM 10260 H HD3  . ARG A 1 78  ? -250.094 -24.060 117.276 1.00 0.00 ? 78  ARG A HD3  6  
ATOM 10261 H HE   . ARG A 1 78  ? -248.254 -23.241 115.117 1.00 0.00 ? 78  ARG A HE   6  
ATOM 10262 H HH11 . ARG A 1 78  ? -249.118 -25.488 117.683 1.00 0.00 ? 78  ARG A HH11 6  
ATOM 10263 H HH12 . ARG A 1 78  ? -248.034 -26.724 117.102 1.00 0.00 ? 78  ARG A HH12 6  
ATOM 10264 H HH21 . ARG A 1 78  ? -246.863 -24.853 114.388 1.00 0.00 ? 78  ARG A HH21 6  
ATOM 10265 H HH22 . ARG A 1 78  ? -246.773 -26.373 115.243 1.00 0.00 ? 78  ARG A HH22 6  
ATOM 10266 N N    . ALA A 1 79  ? -253.266 -19.285 115.781 1.00 0.00 ? 79  ALA A N    6  
ATOM 10267 C CA   . ALA A 1 79  ? -253.147 -17.969 115.175 1.00 0.00 ? 79  ALA A CA   6  
ATOM 10268 C C    . ALA A 1 79  ? -251.777 -17.350 115.471 1.00 0.00 ? 79  ALA A C    6  
ATOM 10269 O O    . ALA A 1 79  ? -251.222 -17.541 116.551 1.00 0.00 ? 79  ALA A O    6  
ATOM 10270 C CB   . ALA A 1 79  ? -254.252 -17.062 115.692 1.00 0.00 ? 79  ALA A CB   6  
ATOM 10271 H H    . ALA A 1 79  ? -253.649 -19.358 116.686 1.00 0.00 ? 79  ALA A H    6  
ATOM 10272 H HA   . ALA A 1 79  ? -253.277 -18.080 114.097 1.00 0.00 ? 79  ALA A HA   6  
ATOM 10273 H HB1  . ALA A 1 79  ? -254.156 -16.955 116.761 1.00 0.00 ? 79  ALA A HB1  6  
ATOM 10274 H HB2  . ALA A 1 79  ? -255.212 -17.496 115.457 1.00 0.00 ? 79  ALA A HB2  6  
ATOM 10275 H HB3  . ALA A 1 79  ? -254.169 -16.093 115.223 1.00 0.00 ? 79  ALA A HB3  6  
ATOM 10276 N N    . ILE A 1 80  ? -251.240 -16.636 114.497 1.00 0.00 ? 80  ILE A N    6  
ATOM 10277 C CA   . ILE A 1 80  ? -249.964 -15.940 114.628 1.00 0.00 ? 80  ILE A CA   6  
ATOM 10278 C C    . ILE A 1 80  ? -250.161 -14.446 114.832 1.00 0.00 ? 80  ILE A C    6  
ATOM 10279 O O    . ILE A 1 80  ? -250.578 -13.723 113.922 1.00 0.00 ? 80  ILE A O    6  
ATOM 10280 C CB   . ILE A 1 80  ? -249.051 -16.179 113.402 1.00 0.00 ? 80  ILE A CB   6  
ATOM 10281 C CG1  . ILE A 1 80  ? -248.461 -17.579 113.464 1.00 0.00 ? 80  ILE A CG1  6  
ATOM 10282 C CG2  . ILE A 1 80  ? -247.932 -15.147 113.344 1.00 0.00 ? 80  ILE A CG2  6  
ATOM 10283 C CD1  . ILE A 1 80  ? -247.585 -17.768 114.675 1.00 0.00 ? 80  ILE A CD1  6  
ATOM 10284 H H    . ILE A 1 80  ? -251.728 -16.553 113.651 1.00 0.00 ? 80  ILE A H    6  
ATOM 10285 H HA   . ILE A 1 80  ? -249.457 -16.326 115.486 1.00 0.00 ? 80  ILE A HA   6  
ATOM 10286 H HB   . ILE A 1 80  ? -249.645 -16.085 112.508 1.00 0.00 ? 80  ILE A HB   6  
ATOM 10287 H HG12 . ILE A 1 80  ? -249.260 -18.304 113.509 1.00 0.00 ? 80  ILE A HG12 6  
ATOM 10288 H HG13 . ILE A 1 80  ? -247.860 -17.756 112.583 1.00 0.00 ? 80  ILE A HG13 6  
ATOM 10289 H HG21 . ILE A 1 80  ? -248.358 -14.156 113.298 1.00 0.00 ? 80  ILE A HG21 6  
ATOM 10290 H HG22 . ILE A 1 80  ? -247.318 -15.233 114.229 1.00 0.00 ? 80  ILE A HG22 6  
ATOM 10291 H HG23 . ILE A 1 80  ? -247.326 -15.322 112.467 1.00 0.00 ? 80  ILE A HG23 6  
ATOM 10292 H HD11 . ILE A 1 80  ? -246.781 -17.042 114.652 1.00 0.00 ? 80  ILE A HD11 6  
ATOM 10293 H HD12 . ILE A 1 80  ? -248.180 -17.616 115.564 1.00 0.00 ? 80  ILE A HD12 6  
ATOM 10294 H HD13 . ILE A 1 80  ? -247.176 -18.765 114.677 1.00 0.00 ? 80  ILE A HD13 6  
ATOM 10295 N N    . GLY A 1 81  ? -249.883 -14.000 116.045 1.00 0.00 ? 81  GLY A N    6  
ATOM 10296 C CA   . GLY A 1 81  ? -249.838 -12.584 116.314 1.00 0.00 ? 81  GLY A CA   6  
ATOM 10297 C C    . GLY A 1 81  ? -248.434 -12.052 116.118 1.00 0.00 ? 81  GLY A C    6  
ATOM 10298 O O    . GLY A 1 81  ? -247.490 -12.830 116.101 1.00 0.00 ? 81  GLY A O    6  
ATOM 10299 H H    . GLY A 1 81  ? -249.699 -14.642 116.764 1.00 0.00 ? 81  GLY A H    6  
ATOM 10300 H HA2  . GLY A 1 81  ? -250.512 -12.071 115.642 1.00 0.00 ? 81  GLY A HA2  6  
ATOM 10301 H HA3  . GLY A 1 81  ? -250.145 -12.406 117.333 1.00 0.00 ? 81  GLY A HA3  6  
ATOM 10302 N N    . PRO A 1 82  ? -248.260 -10.734 115.972 1.00 0.00 ? 82  PRO A N    6  
ATOM 10303 C CA   . PRO A 1 82  ? -246.952 -10.112 115.740 1.00 0.00 ? 82  PRO A CA   6  
ATOM 10304 C C    . PRO A 1 82  ? -245.925 -10.417 116.823 1.00 0.00 ? 82  PRO A C    6  
ATOM 10305 O O    . PRO A 1 82  ? -244.720 -10.440 116.558 1.00 0.00 ? 82  PRO A O    6  
ATOM 10306 C CB   . PRO A 1 82  ? -247.278 -8.616  115.709 1.00 0.00 ? 82  PRO A CB   6  
ATOM 10307 C CG   . PRO A 1 82  ? -248.704 -8.568  115.306 1.00 0.00 ? 82  PRO A CG   6  
ATOM 10308 C CD   . PRO A 1 82  ? -249.322 -9.732  116.013 1.00 0.00 ? 82  PRO A CD   6  
ATOM 10309 H HA   . PRO A 1 82  ? -246.555 -10.408 114.802 1.00 0.00 ? 82  PRO A HA   6  
ATOM 10310 H HB2  . PRO A 1 82  ? -247.130 -8.190  116.691 1.00 0.00 ? 82  PRO A HB2  6  
ATOM 10311 H HB3  . PRO A 1 82  ? -246.646 -8.120  114.993 1.00 0.00 ? 82  PRO A HB3  6  
ATOM 10312 H HG2  . PRO A 1 82  ? -249.152 -7.640  115.632 1.00 0.00 ? 82  PRO A HG2  6  
ATOM 10313 H HG3  . PRO A 1 82  ? -248.795 -8.684  114.236 1.00 0.00 ? 82  PRO A HG3  6  
ATOM 10314 H HD2  . PRO A 1 82  ? -249.529 -9.471  117.023 1.00 0.00 ? 82  PRO A HD2  6  
ATOM 10315 H HD3  . PRO A 1 82  ? -250.207 -10.076 115.504 1.00 0.00 ? 82  PRO A HD3  6  
ATOM 10316 N N    . GLU A 1 83  ? -246.410 -10.624 118.034 1.00 0.00 ? 83  GLU A N    6  
ATOM 10317 C CA   . GLU A 1 83  ? -245.563 -11.012 119.145 1.00 0.00 ? 83  GLU A CA   6  
ATOM 10318 C C    . GLU A 1 83  ? -244.936 -12.379 118.892 1.00 0.00 ? 83  GLU A C    6  
ATOM 10319 O O    . GLU A 1 83  ? -243.745 -12.585 119.114 1.00 0.00 ? 83  GLU A O    6  
ATOM 10320 C CB   . GLU A 1 83  ? -246.393 -11.030 120.411 1.00 0.00 ? 83  GLU A CB   6  
ATOM 10321 C CG   . GLU A 1 83  ? -247.004 -9.679  120.717 1.00 0.00 ? 83  GLU A CG   6  
ATOM 10322 C CD   . GLU A 1 83  ? -245.973 -8.567  120.774 1.00 0.00 ? 83  GLU A CD   6  
ATOM 10323 O OE1  . GLU A 1 83  ? -245.289 -8.442  121.809 1.00 0.00 ? 83  GLU A OE1  6  
ATOM 10324 O OE2  . GLU A 1 83  ? -245.851 -7.808  119.791 1.00 0.00 ? 83  GLU A OE2  6  
ATOM 10325 H H    . GLU A 1 83  ? -247.366 -10.500 118.192 1.00 0.00 ? 83  GLU A H    6  
ATOM 10326 H HA   . GLU A 1 83  ? -244.789 -10.273 119.255 1.00 0.00 ? 83  GLU A HA   6  
ATOM 10327 H HB2  . GLU A 1 83  ? -247.191 -11.751 120.300 1.00 0.00 ? 83  GLU A HB2  6  
ATOM 10328 H HB3  . GLU A 1 83  ? -245.768 -11.319 121.237 1.00 0.00 ? 83  GLU A HB3  6  
ATOM 10329 H HG2  . GLU A 1 83  ? -247.727 -9.439  119.951 1.00 0.00 ? 83  GLU A HG2  6  
ATOM 10330 H HG3  . GLU A 1 83  ? -247.493 -9.738  121.661 1.00 0.00 ? 83  GLU A HG3  6  
ATOM 10331 N N    . GLU A 1 84  ? -245.761 -13.299 118.417 1.00 0.00 ? 84  GLU A N    6  
ATOM 10332 C CA   . GLU A 1 84  ? -245.323 -14.643 118.065 1.00 0.00 ? 84  GLU A CA   6  
ATOM 10333 C C    . GLU A 1 84  ? -244.620 -14.628 116.709 1.00 0.00 ? 84  GLU A C    6  
ATOM 10334 O O    . GLU A 1 84  ? -245.149 -14.109 115.727 1.00 0.00 ? 84  GLU A O    6  
ATOM 10335 C CB   . GLU A 1 84  ? -246.534 -15.573 118.032 1.00 0.00 ? 84  GLU A CB   6  
ATOM 10336 C CG   . GLU A 1 84  ? -247.313 -15.572 119.336 1.00 0.00 ? 84  GLU A CG   6  
ATOM 10337 C CD   . GLU A 1 84  ? -248.654 -16.261 119.226 1.00 0.00 ? 84  GLU A CD   6  
ATOM 10338 O OE1  . GLU A 1 84  ? -248.701 -17.505 119.312 1.00 0.00 ? 84  GLU A OE1  6  
ATOM 10339 O OE2  . GLU A 1 84  ? -249.676 -15.554 119.067 1.00 0.00 ? 84  GLU A OE2  6  
ATOM 10340 H H    . GLU A 1 84  ? -246.702 -13.065 118.292 1.00 0.00 ? 84  GLU A H    6  
ATOM 10341 H HA   . GLU A 1 84  ? -244.632 -14.983 118.819 1.00 0.00 ? 84  GLU A HA   6  
ATOM 10342 H HB2  . GLU A 1 84  ? -247.195 -15.261 117.236 1.00 0.00 ? 84  GLU A HB2  6  
ATOM 10343 H HB3  . GLU A 1 84  ? -246.196 -16.581 117.837 1.00 0.00 ? 84  GLU A HB3  6  
ATOM 10344 H HG2  . GLU A 1 84  ? -246.729 -16.078 120.088 1.00 0.00 ? 84  GLU A HG2  6  
ATOM 10345 H HG3  . GLU A 1 84  ? -247.476 -14.548 119.639 1.00 0.00 ? 84  GLU A HG3  6  
ATOM 10346 N N    . GLU A 1 85  ? -243.426 -15.187 116.649 1.00 0.00 ? 85  GLU A N    6  
ATOM 10347 C CA   . GLU A 1 85  ? -242.620 -15.079 115.450 1.00 0.00 ? 85  GLU A CA   6  
ATOM 10348 C C    . GLU A 1 85  ? -242.599 -16.367 114.636 1.00 0.00 ? 85  GLU A C    6  
ATOM 10349 O O    . GLU A 1 85  ? -242.334 -17.463 115.145 1.00 0.00 ? 85  GLU A O    6  
ATOM 10350 C CB   . GLU A 1 85  ? -241.208 -14.661 115.824 1.00 0.00 ? 85  GLU A CB   6  
ATOM 10351 C CG   . GLU A 1 85  ? -241.186 -13.415 116.689 1.00 0.00 ? 85  GLU A CG   6  
ATOM 10352 C CD   . GLU A 1 85  ? -239.774 -12.974 117.021 1.00 0.00 ? 85  GLU A CD   6  
ATOM 10353 O OE1  . GLU A 1 85  ? -239.034 -12.595 116.095 1.00 0.00 ? 85  GLU A OE1  6  
ATOM 10354 O OE2  . GLU A 1 85  ? -239.398 -12.998 118.212 1.00 0.00 ? 85  GLU A OE2  6  
ATOM 10355 H H    . GLU A 1 85  ? -243.073 -15.664 117.427 1.00 0.00 ? 85  GLU A H    6  
ATOM 10356 H HA   . GLU A 1 85  ? -243.053 -14.301 114.841 1.00 0.00 ? 85  GLU A HA   6  
ATOM 10357 H HB2  . GLU A 1 85  ? -240.735 -15.466 116.368 1.00 0.00 ? 85  GLU A HB2  6  
ATOM 10358 H HB3  . GLU A 1 85  ? -240.648 -14.463 114.923 1.00 0.00 ? 85  GLU A HB3  6  
ATOM 10359 H HG2  . GLU A 1 85  ? -241.699 -12.618 116.160 1.00 0.00 ? 85  GLU A HG2  6  
ATOM 10360 H HG3  . GLU A 1 85  ? -241.711 -13.621 117.608 1.00 0.00 ? 85  GLU A HG3  6  
ATOM 10361 N N    . ILE A 1 86  ? -242.852 -16.215 113.345 1.00 0.00 ? 86  ILE A N    6  
ATOM 10362 C CA   . ILE A 1 86  ? -242.842 -17.332 112.414 1.00 0.00 ? 86  ILE A CA   6  
ATOM 10363 C C    . ILE A 1 86  ? -241.460 -17.951 112.310 1.00 0.00 ? 86  ILE A C    6  
ATOM 10364 O O    . ILE A 1 86  ? -241.316 -19.109 111.945 1.00 0.00 ? 86  ILE A O    6  
ATOM 10365 C CB   . ILE A 1 86  ? -243.307 -16.894 111.017 1.00 0.00 ? 86  ILE A CB   6  
ATOM 10366 C CG1  . ILE A 1 86  ? -242.441 -15.738 110.499 1.00 0.00 ? 86  ILE A CG1  6  
ATOM 10367 C CG2  . ILE A 1 86  ? -244.765 -16.490 111.079 1.00 0.00 ? 86  ILE A CG2  6  
ATOM 10368 C CD1  . ILE A 1 86  ? -242.813 -15.273 109.109 1.00 0.00 ? 86  ILE A CD1  6  
ATOM 10369 H H    . ILE A 1 86  ? -243.066 -15.321 113.007 1.00 0.00 ? 86  ILE A H    6  
ATOM 10370 H HA   . ILE A 1 86  ? -243.533 -18.077 112.780 1.00 0.00 ? 86  ILE A HA   6  
ATOM 10371 H HB   . ILE A 1 86  ? -243.218 -17.735 110.345 1.00 0.00 ? 86  ILE A HB   6  
ATOM 10372 H HG12 . ILE A 1 86  ? -242.542 -14.894 111.165 1.00 0.00 ? 86  ILE A HG12 6  
ATOM 10373 H HG13 . ILE A 1 86  ? -241.407 -16.052 110.479 1.00 0.00 ? 86  ILE A HG13 6  
ATOM 10374 H HG21 . ILE A 1 86  ? -245.353 -17.325 111.423 1.00 0.00 ? 86  ILE A HG21 6  
ATOM 10375 H HG22 . ILE A 1 86  ? -244.877 -15.664 111.767 1.00 0.00 ? 86  ILE A HG22 6  
ATOM 10376 H HG23 . ILE A 1 86  ? -245.101 -16.190 110.098 1.00 0.00 ? 86  ILE A HG23 6  
ATOM 10377 H HD11 . ILE A 1 86  ? -243.845 -14.956 109.103 1.00 0.00 ? 86  ILE A HD11 6  
ATOM 10378 H HD12 . ILE A 1 86  ? -242.180 -14.445 108.825 1.00 0.00 ? 86  ILE A HD12 6  
ATOM 10379 H HD13 . ILE A 1 86  ? -242.682 -16.086 108.410 1.00 0.00 ? 86  ILE A HD13 6  
ATOM 10380 N N    . MET A 1 87  ? -240.439 -17.177 112.643 1.00 0.00 ? 87  MET A N    6  
ATOM 10381 C CA   . MET A 1 87  ? -239.081 -17.690 112.654 1.00 0.00 ? 87  MET A CA   6  
ATOM 10382 C C    . MET A 1 87  ? -238.852 -18.593 113.852 1.00 0.00 ? 87  MET A C    6  
ATOM 10383 O O    . MET A 1 87  ? -237.925 -19.395 113.863 1.00 0.00 ? 87  MET A O    6  
ATOM 10384 C CB   . MET A 1 87  ? -238.055 -16.560 112.592 1.00 0.00 ? 87  MET A CB   6  
ATOM 10385 C CG   . MET A 1 87  ? -237.742 -16.168 111.161 1.00 0.00 ? 87  MET A CG   6  
ATOM 10386 S SD   . MET A 1 87  ? -237.173 -17.585 110.196 1.00 0.00 ? 87  MET A SD   6  
ATOM 10387 C CE   . MET A 1 87  ? -237.433 -17.000 108.526 1.00 0.00 ? 87  MET A CE   6  
ATOM 10388 H H    . MET A 1 87  ? -240.602 -16.241 112.882 1.00 0.00 ? 87  MET A H    6  
ATOM 10389 H HA   . MET A 1 87  ? -238.971 -18.294 111.764 1.00 0.00 ? 87  MET A HA   6  
ATOM 10390 H HB2  . MET A 1 87  ? -238.447 -15.697 113.111 1.00 0.00 ? 87  MET A HB2  6  
ATOM 10391 H HB3  . MET A 1 87  ? -237.143 -16.883 113.068 1.00 0.00 ? 87  MET A HB3  6  
ATOM 10392 H HG2  . MET A 1 87  ? -238.635 -15.767 110.703 1.00 0.00 ? 87  MET A HG2  6  
ATOM 10393 H HG3  . MET A 1 87  ? -236.967 -15.416 111.166 1.00 0.00 ? 87  MET A HG3  6  
ATOM 10394 H HE1  . MET A 1 87  ? -236.878 -16.087 108.373 1.00 0.00 ? 87  MET A HE1  6  
ATOM 10395 H HE2  . MET A 1 87  ? -237.095 -17.750 107.827 1.00 0.00 ? 87  MET A HE2  6  
ATOM 10396 H HE3  . MET A 1 87  ? -238.487 -16.812 108.370 1.00 0.00 ? 87  MET A HE3  6  
ATOM 10397 N N    . GLN A 1 88  ? -239.716 -18.479 114.853 1.00 0.00 ? 88  GLN A N    6  
ATOM 10398 C CA   . GLN A 1 88  ? -239.665 -19.396 115.985 1.00 0.00 ? 88  GLN A CA   6  
ATOM 10399 C C    . GLN A 1 88  ? -240.258 -20.715 115.530 1.00 0.00 ? 88  GLN A C    6  
ATOM 10400 O O    . GLN A 1 88  ? -239.825 -21.798 115.924 1.00 0.00 ? 88  GLN A O    6  
ATOM 10401 C CB   . GLN A 1 88  ? -240.461 -18.854 117.171 1.00 0.00 ? 88  GLN A CB   6  
ATOM 10402 C CG   . GLN A 1 88  ? -240.016 -17.479 117.627 1.00 0.00 ? 88  GLN A CG   6  
ATOM 10403 C CD   . GLN A 1 88  ? -240.979 -16.854 118.617 1.00 0.00 ? 88  GLN A CD   6  
ATOM 10404 O OE1  . GLN A 1 88  ? -242.180 -17.119 118.580 1.00 0.00 ? 88  GLN A OE1  6  
ATOM 10405 N NE2  . GLN A 1 88  ? -240.468 -16.013 119.501 1.00 0.00 ? 88  GLN A NE2  6  
ATOM 10406 H H    . GLN A 1 88  ? -240.431 -17.801 114.808 1.00 0.00 ? 88  GLN A H    6  
ATOM 10407 H HA   . GLN A 1 88  ? -238.634 -19.537 116.267 1.00 0.00 ? 88  GLN A HA   6  
ATOM 10408 H HB2  . GLN A 1 88  ? -241.503 -18.797 116.895 1.00 0.00 ? 88  GLN A HB2  6  
ATOM 10409 H HB3  . GLN A 1 88  ? -240.354 -19.536 118.001 1.00 0.00 ? 88  GLN A HB3  6  
ATOM 10410 H HG2  . GLN A 1 88  ? -239.045 -17.562 118.094 1.00 0.00 ? 88  GLN A HG2  6  
ATOM 10411 H HG3  . GLN A 1 88  ? -239.945 -16.839 116.761 1.00 0.00 ? 88  GLN A HG3  6  
ATOM 10412 H HE21 . GLN A 1 88  ? -239.500 -15.834 119.471 1.00 0.00 ? 88  GLN A HE21 6  
ATOM 10413 H HE22 . GLN A 1 88  ? -241.078 -15.596 120.154 1.00 0.00 ? 88  GLN A HE22 6  
ATOM 10414 N N    . ILE A 1 89  ? -241.257 -20.582 114.673 1.00 0.00 ? 89  ILE A N    6  
ATOM 10415 C CA   . ILE A 1 89  ? -241.933 -21.719 114.072 1.00 0.00 ? 89  ILE A CA   6  
ATOM 10416 C C    . ILE A 1 89  ? -241.014 -22.464 113.104 1.00 0.00 ? 89  ILE A C    6  
ATOM 10417 O O    . ILE A 1 89  ? -240.821 -23.674 113.207 1.00 0.00 ? 89  ILE A O    6  
ATOM 10418 C CB   . ILE A 1 89  ? -243.170 -21.241 113.308 1.00 0.00 ? 89  ILE A CB   6  
ATOM 10419 C CG1  . ILE A 1 89  ? -243.978 -20.297 114.195 1.00 0.00 ? 89  ILE A CG1  6  
ATOM 10420 C CG2  . ILE A 1 89  ? -244.015 -22.424 112.854 1.00 0.00 ? 89  ILE A CG2  6  
ATOM 10421 C CD1  . ILE A 1 89  ? -244.367 -20.878 115.536 1.00 0.00 ? 89  ILE A CD1  6  
ATOM 10422 H H    . ILE A 1 89  ? -241.570 -19.671 114.452 1.00 0.00 ? 89  ILE A H    6  
ATOM 10423 H HA   . ILE A 1 89  ? -242.264 -22.379 114.854 1.00 0.00 ? 89  ILE A HA   6  
ATOM 10424 H HB   . ILE A 1 89  ? -242.840 -20.705 112.425 1.00 0.00 ? 89  ILE A HB   6  
ATOM 10425 H HG12 . ILE A 1 89  ? -243.402 -19.404 114.380 1.00 0.00 ? 89  ILE A HG12 6  
ATOM 10426 H HG13 . ILE A 1 89  ? -244.870 -20.034 113.682 1.00 0.00 ? 89  ILE A HG13 6  
ATOM 10427 H HG21 . ILE A 1 89  ? -243.427 -23.061 112.209 1.00 0.00 ? 89  ILE A HG21 6  
ATOM 10428 H HG22 . ILE A 1 89  ? -244.339 -22.988 113.719 1.00 0.00 ? 89  ILE A HG22 6  
ATOM 10429 H HG23 . ILE A 1 89  ? -244.879 -22.063 112.317 1.00 0.00 ? 89  ILE A HG23 6  
ATOM 10430 H HD11 . ILE A 1 89  ? -244.957 -21.770 115.387 1.00 0.00 ? 89  ILE A HD11 6  
ATOM 10431 H HD12 . ILE A 1 89  ? -243.473 -21.126 116.090 1.00 0.00 ? 89  ILE A HD12 6  
ATOM 10432 H HD13 . ILE A 1 89  ? -244.943 -20.152 116.089 1.00 0.00 ? 89  ILE A HD13 6  
ATOM 10433 N N    . LEU A 1 90  ? -240.417 -21.710 112.192 1.00 0.00 ? 90  LEU A N    6  
ATOM 10434 C CA   . LEU A 1 90  ? -239.603 -22.274 111.120 1.00 0.00 ? 90  LEU A CA   6  
ATOM 10435 C C    . LEU A 1 90  ? -238.281 -22.844 111.633 1.00 0.00 ? 90  LEU A C    6  
ATOM 10436 O O    . LEU A 1 90  ? -237.726 -23.762 111.029 1.00 0.00 ? 90  LEU A O    6  
ATOM 10437 C CB   . LEU A 1 90  ? -239.347 -21.203 110.058 1.00 0.00 ? 90  LEU A CB   6  
ATOM 10438 C CG   . LEU A 1 90  ? -240.599 -20.718 109.319 1.00 0.00 ? 90  LEU A CG   6  
ATOM 10439 C CD1  . LEU A 1 90  ? -240.353 -19.368 108.674 1.00 0.00 ? 90  LEU A CD1  6  
ATOM 10440 C CD2  . LEU A 1 90  ? -241.026 -21.731 108.268 1.00 0.00 ? 90  LEU A CD2  6  
ATOM 10441 H H    . LEU A 1 90  ? -240.546 -20.736 112.225 1.00 0.00 ? 90  LEU A H    6  
ATOM 10442 H HA   . LEU A 1 90  ? -240.169 -23.076 110.671 1.00 0.00 ? 90  LEU A HA   6  
ATOM 10443 H HB2  . LEU A 1 90  ? -238.880 -20.354 110.534 1.00 0.00 ? 90  LEU A HB2  6  
ATOM 10444 H HB3  . LEU A 1 90  ? -238.662 -21.609 109.329 1.00 0.00 ? 90  LEU A HB3  6  
ATOM 10445 H HG   . LEU A 1 90  ? -241.408 -20.609 110.025 1.00 0.00 ? 90  LEU A HG   6  
ATOM 10446 H HD11 . LEU A 1 90  ? -239.531 -19.445 107.977 1.00 0.00 ? 90  LEU A HD11 6  
ATOM 10447 H HD12 . LEU A 1 90  ? -241.243 -19.053 108.152 1.00 0.00 ? 90  LEU A HD12 6  
ATOM 10448 H HD13 . LEU A 1 90  ? -240.111 -18.648 109.442 1.00 0.00 ? 90  LEU A HD13 6  
ATOM 10449 H HD21 . LEU A 1 90  ? -240.210 -21.901 107.581 1.00 0.00 ? 90  LEU A HD21 6  
ATOM 10450 H HD22 . LEU A 1 90  ? -241.289 -22.660 108.751 1.00 0.00 ? 90  LEU A HD22 6  
ATOM 10451 H HD23 . LEU A 1 90  ? -241.879 -21.350 107.727 1.00 0.00 ? 90  LEU A HD23 6  
ATOM 10452 N N    . SER A 1 91  ? -237.774 -22.311 112.738 1.00 0.00 ? 91  SER A N    6  
ATOM 10453 C CA   . SER A 1 91  ? -236.534 -22.820 113.313 1.00 0.00 ? 91  SER A CA   6  
ATOM 10454 C C    . SER A 1 91  ? -236.764 -24.170 113.986 1.00 0.00 ? 91  SER A C    6  
ATOM 10455 O O    . SER A 1 91  ? -235.828 -24.954 114.151 1.00 0.00 ? 91  SER A O    6  
ATOM 10456 C CB   . SER A 1 91  ? -235.944 -21.822 114.310 1.00 0.00 ? 91  SER A CB   6  
ATOM 10457 O OG   . SER A 1 91  ? -235.594 -20.607 113.667 1.00 0.00 ? 91  SER A OG   6  
ATOM 10458 H H    . SER A 1 91  ? -238.234 -21.564 113.169 1.00 0.00 ? 91  SER A H    6  
ATOM 10459 H HA   . SER A 1 91  ? -235.830 -22.955 112.501 1.00 0.00 ? 91  SER A HA   6  
ATOM 10460 H HB2  . SER A 1 91  ? -236.674 -21.612 115.078 1.00 0.00 ? 91  SER A HB2  6  
ATOM 10461 H HB3  . SER A 1 91  ? -235.060 -22.246 114.761 1.00 0.00 ? 91  SER A HB3  6  
ATOM 10462 H HG   . SER A 1 91  ? -236.336 -19.990 113.726 1.00 0.00 ? 91  SER A HG   6  
ATOM 10463 N N    . SER A 1 92  ? -238.012 -24.440 114.362 1.00 0.00 ? 92  SER A N    6  
ATOM 10464 C CA   . SER A 1 92  ? -238.367 -25.729 114.934 1.00 0.00 ? 92  SER A CA   6  
ATOM 10465 C C    . SER A 1 92  ? -238.190 -26.812 113.874 1.00 0.00 ? 92  SER A C    6  
ATOM 10466 O O    . SER A 1 92  ? -237.531 -27.824 114.117 1.00 0.00 ? 92  SER A O    6  
ATOM 10467 C CB   . SER A 1 92  ? -239.806 -25.708 115.455 1.00 0.00 ? 92  SER A CB   6  
ATOM 10468 O OG   . SER A 1 92  ? -239.995 -24.661 116.395 1.00 0.00 ? 92  SER A OG   6  
ATOM 10469 H H    . SER A 1 92  ? -238.709 -23.761 114.235 1.00 0.00 ? 92  SER A H    6  
ATOM 10470 H HA   . SER A 1 92  ? -237.692 -25.927 115.754 1.00 0.00 ? 92  SER A HA   6  
ATOM 10471 H HB2  . SER A 1 92  ? -240.484 -25.561 114.627 1.00 0.00 ? 92  SER A HB2  6  
ATOM 10472 H HB3  . SER A 1 92  ? -240.025 -26.650 115.936 1.00 0.00 ? 92  SER A HB3  6  
ATOM 10473 H HG   . SER A 1 92  ? -239.919 -23.810 115.948 1.00 0.00 ? 92  SER A HG   6  
ATOM 10474 N N    . TRP A 1 93  ? -238.796 -26.578 112.707 1.00 0.00 ? 93  TRP A N    6  
ATOM 10475 C CA   . TRP A 1 93  ? -238.566 -27.378 111.497 1.00 0.00 ? 93  TRP A CA   6  
ATOM 10476 C C    . TRP A 1 93  ? -239.243 -28.753 111.556 1.00 0.00 ? 93  TRP A C    6  
ATOM 10477 O O    . TRP A 1 93  ? -239.885 -29.174 110.590 1.00 0.00 ? 93  TRP A O    6  
ATOM 10478 C CB   . TRP A 1 93  ? -237.063 -27.531 111.238 1.00 0.00 ? 93  TRP A CB   6  
ATOM 10479 C CG   . TRP A 1 93  ? -236.742 -28.092 109.889 1.00 0.00 ? 93  TRP A CG   6  
ATOM 10480 C CD1  . TRP A 1 93  ? -236.362 -29.370 109.602 1.00 0.00 ? 93  TRP A CD1  6  
ATOM 10481 C CD2  . TRP A 1 93  ? -236.775 -27.390 108.642 1.00 0.00 ? 93  TRP A CD2  6  
ATOM 10482 N NE1  . TRP A 1 93  ? -236.157 -29.507 108.252 1.00 0.00 ? 93  TRP A NE1  6  
ATOM 10483 C CE2  . TRP A 1 93  ? -236.399 -28.306 107.641 1.00 0.00 ? 93  TRP A CE2  6  
ATOM 10484 C CE3  . TRP A 1 93  ? -237.082 -26.077 108.272 1.00 0.00 ? 93  TRP A CE3  6  
ATOM 10485 C CZ2  . TRP A 1 93  ? -236.328 -27.951 106.298 1.00 0.00 ? 93  TRP A CZ2  6  
ATOM 10486 C CZ3  . TRP A 1 93  ? -237.010 -25.727 106.938 1.00 0.00 ? 93  TRP A CZ3  6  
ATOM 10487 C CH2  . TRP A 1 93  ? -236.634 -26.661 105.965 1.00 0.00 ? 93  TRP A CH2  6  
ATOM 10488 H H    . TRP A 1 93  ? -239.436 -25.837 112.657 1.00 0.00 ? 93  TRP A H    6  
ATOM 10489 H HA   . TRP A 1 93  ? -238.995 -26.832 110.672 1.00 0.00 ? 93  TRP A HA   6  
ATOM 10490 H HB2  . TRP A 1 93  ? -236.590 -26.565 111.319 1.00 0.00 ? 93  TRP A HB2  6  
ATOM 10491 H HB3  . TRP A 1 93  ? -236.643 -28.195 111.980 1.00 0.00 ? 93  TRP A HB3  6  
ATOM 10492 H HD1  . TRP A 1 93  ? -236.246 -30.151 110.339 1.00 0.00 ? 93  TRP A HD1  6  
ATOM 10493 H HE1  . TRP A 1 93  ? -235.876 -30.333 107.800 1.00 0.00 ? 93  TRP A HE1  6  
ATOM 10494 H HE3  . TRP A 1 93  ? -237.373 -25.342 109.010 1.00 0.00 ? 93  TRP A HE3  6  
ATOM 10495 H HZ2  . TRP A 1 93  ? -236.041 -28.659 105.533 1.00 0.00 ? 93  TRP A HZ2  6  
ATOM 10496 H HZ3  . TRP A 1 93  ? -237.244 -24.716 106.633 1.00 0.00 ? 93  TRP A HZ3  6  
ATOM 10497 H HH2  . TRP A 1 93  ? -236.591 -26.343 104.931 1.00 0.00 ? 93  TRP A HH2  6  
ATOM 10498 N N    . PHE A 1 94  ? -239.090 -29.448 112.673 1.00 0.00 ? 94  PHE A N    6  
ATOM 10499 C CA   . PHE A 1 94  ? -239.665 -30.777 112.839 1.00 0.00 ? 94  PHE A CA   6  
ATOM 10500 C C    . PHE A 1 94  ? -241.192 -30.729 112.781 1.00 0.00 ? 94  PHE A C    6  
ATOM 10501 O O    . PHE A 1 94  ? -241.821 -29.872 113.405 1.00 0.00 ? 94  PHE A O    6  
ATOM 10502 C CB   . PHE A 1 94  ? -239.203 -31.392 114.163 1.00 0.00 ? 94  PHE A CB   6  
ATOM 10503 C CG   . PHE A 1 94  ? -237.731 -31.682 114.211 1.00 0.00 ? 94  PHE A CG   6  
ATOM 10504 C CD1  . PHE A 1 94  ? -237.221 -32.828 113.626 1.00 0.00 ? 94  PHE A CD1  6  
ATOM 10505 C CD2  . PHE A 1 94  ? -236.859 -30.810 114.840 1.00 0.00 ? 94  PHE A CD2  6  
ATOM 10506 C CE1  . PHE A 1 94  ? -235.867 -33.101 113.668 1.00 0.00 ? 94  PHE A CE1  6  
ATOM 10507 C CE2  . PHE A 1 94  ? -235.504 -31.078 114.887 1.00 0.00 ? 94  PHE A CE2  6  
ATOM 10508 C CZ   . PHE A 1 94  ? -235.007 -32.225 114.302 1.00 0.00 ? 94  PHE A CZ   6  
ATOM 10509 H H    . PHE A 1 94  ? -238.570 -29.054 113.408 1.00 0.00 ? 94  PHE A H    6  
ATOM 10510 H HA   . PHE A 1 94  ? -239.308 -31.391 112.027 1.00 0.00 ? 94  PHE A HA   6  
ATOM 10511 H HB2  . PHE A 1 94  ? -239.430 -30.709 114.967 1.00 0.00 ? 94  PHE A HB2  6  
ATOM 10512 H HB3  . PHE A 1 94  ? -239.731 -32.319 114.324 1.00 0.00 ? 94  PHE A HB3  6  
ATOM 10513 H HD1  . PHE A 1 94  ? -237.892 -33.514 113.130 1.00 0.00 ? 94  PHE A HD1  6  
ATOM 10514 H HD2  . PHE A 1 94  ? -237.246 -29.912 115.299 1.00 0.00 ? 94  PHE A HD2  6  
ATOM 10515 H HE1  . PHE A 1 94  ? -235.483 -34.001 113.208 1.00 0.00 ? 94  PHE A HE1  6  
ATOM 10516 H HE2  . PHE A 1 94  ? -234.834 -30.389 115.383 1.00 0.00 ? 94  PHE A HE2  6  
ATOM 10517 H HZ   . PHE A 1 94  ? -233.949 -32.438 114.339 1.00 0.00 ? 94  PHE A HZ   6  
ATOM 10518 N N    . PRO A 1 95  ? -241.800 -31.641 112.003 1.00 0.00 ? 95  PRO A N    6  
ATOM 10519 C CA   . PRO A 1 95  ? -243.256 -31.739 111.872 1.00 0.00 ? 95  PRO A CA   6  
ATOM 10520 C C    . PRO A 1 95  ? -243.924 -32.181 113.174 1.00 0.00 ? 95  PRO A C    6  
ATOM 10521 O O    . PRO A 1 95  ? -243.265 -32.708 114.075 1.00 0.00 ? 95  PRO A O    6  
ATOM 10522 C CB   . PRO A 1 95  ? -243.452 -32.799 110.784 1.00 0.00 ? 95  PRO A CB   6  
ATOM 10523 C CG   . PRO A 1 95  ? -242.195 -33.597 110.794 1.00 0.00 ? 95  PRO A CG   6  
ATOM 10524 C CD   . PRO A 1 95  ? -241.104 -32.637 111.168 1.00 0.00 ? 95  PRO A CD   6  
ATOM 10525 H HA   . PRO A 1 95  ? -243.687 -30.803 111.549 1.00 0.00 ? 95  PRO A HA   6  
ATOM 10526 H HB2  . PRO A 1 95  ? -244.310 -33.410 111.024 1.00 0.00 ? 95  PRO A HB2  6  
ATOM 10527 H HB3  . PRO A 1 95  ? -243.605 -32.316 109.830 1.00 0.00 ? 95  PRO A HB3  6  
ATOM 10528 H HG2  . PRO A 1 95  ? -242.267 -34.386 111.527 1.00 0.00 ? 95  PRO A HG2  6  
ATOM 10529 H HG3  . PRO A 1 95  ? -242.013 -34.008 109.812 1.00 0.00 ? 95  PRO A HG3  6  
ATOM 10530 H HD2  . PRO A 1 95  ? -240.333 -33.139 111.733 1.00 0.00 ? 95  PRO A HD2  6  
ATOM 10531 H HD3  . PRO A 1 95  ? -240.686 -32.176 110.286 1.00 0.00 ? 95  PRO A HD3  6  
ATOM 10532 N N    . GLU A 1 96  ? -245.232 -31.967 113.261 1.00 0.00 ? 96  GLU A N    6  
ATOM 10533 C CA   . GLU A 1 96  ? -245.990 -32.303 114.464 1.00 0.00 ? 96  GLU A CA   6  
ATOM 10534 C C    . GLU A 1 96  ? -246.893 -33.511 114.204 1.00 0.00 ? 96  GLU A C    6  
ATOM 10535 O O    . GLU A 1 96  ? -246.433 -34.653 114.221 1.00 0.00 ? 96  GLU A O    6  
ATOM 10536 C CB   . GLU A 1 96  ? -246.813 -31.091 114.916 1.00 0.00 ? 96  GLU A CB   6  
ATOM 10537 C CG   . GLU A 1 96  ? -245.983 -29.825 115.082 1.00 0.00 ? 96  GLU A CG   6  
ATOM 10538 C CD   . GLU A 1 96  ? -246.829 -28.589 115.308 1.00 0.00 ? 96  GLU A CD   6  
ATOM 10539 O OE1  . GLU A 1 96  ? -247.566 -28.187 114.380 1.00 0.00 ? 96  GLU A OE1  6  
ATOM 10540 O OE2  . GLU A 1 96  ? -246.754 -28.003 116.410 1.00 0.00 ? 96  GLU A OE2  6  
ATOM 10541 H H    . GLU A 1 96  ? -245.704 -31.579 112.494 1.00 0.00 ? 96  GLU A H    6  
ATOM 10542 H HA   . GLU A 1 96  ? -245.282 -32.558 115.239 1.00 0.00 ? 96  GLU A HA   6  
ATOM 10543 H HB2  . GLU A 1 96  ? -247.581 -30.899 114.182 1.00 0.00 ? 96  GLU A HB2  6  
ATOM 10544 H HB3  . GLU A 1 96  ? -247.279 -31.318 115.863 1.00 0.00 ? 96  GLU A HB3  6  
ATOM 10545 H HG2  . GLU A 1 96  ? -245.325 -29.949 115.929 1.00 0.00 ? 96  GLU A HG2  6  
ATOM 10546 H HG3  . GLU A 1 96  ? -245.392 -29.680 114.190 1.00 0.00 ? 96  GLU A HG3  6  
ATOM 10547 N N    . GLU A 1 97  ? -248.173 -33.254 113.945 1.00 0.00 ? 97  GLU A N    6  
ATOM 10548 C CA   . GLU A 1 97  ? -249.104 -34.311 113.565 1.00 0.00 ? 97  GLU A CA   6  
ATOM 10549 C C    . GLU A 1 97  ? -248.784 -34.742 112.140 1.00 0.00 ? 97  GLU A C    6  
ATOM 10550 O O    . GLU A 1 97  ? -248.716 -35.933 111.823 1.00 0.00 ? 97  GLU A O    6  
ATOM 10551 C CB   . GLU A 1 97  ? -250.546 -33.797 113.688 1.00 0.00 ? 97  GLU A CB   6  
ATOM 10552 C CG   . GLU A 1 97  ? -251.618 -34.882 113.707 1.00 0.00 ? 97  GLU A CG   6  
ATOM 10553 C CD   . GLU A 1 97  ? -252.014 -35.381 112.328 1.00 0.00 ? 97  GLU A CD   6  
ATOM 10554 O OE1  . GLU A 1 97  ? -251.961 -34.586 111.367 1.00 0.00 ? 97  GLU A OE1  6  
ATOM 10555 O OE2  . GLU A 1 97  ? -252.387 -36.574 112.206 1.00 0.00 ? 97  GLU A OE2  6  
ATOM 10556 H H    . GLU A 1 97  ? -248.499 -32.335 114.022 1.00 0.00 ? 97  GLU A H    6  
ATOM 10557 H HA   . GLU A 1 97  ? -248.958 -35.149 114.232 1.00 0.00 ? 97  GLU A HA   6  
ATOM 10558 H HB2  . GLU A 1 97  ? -250.630 -33.233 114.604 1.00 0.00 ? 97  GLU A HB2  6  
ATOM 10559 H HB3  . GLU A 1 97  ? -250.749 -33.138 112.856 1.00 0.00 ? 97  GLU A HB3  6  
ATOM 10560 H HG2  . GLU A 1 97  ? -251.248 -35.719 114.278 1.00 0.00 ? 97  GLU A HG2  6  
ATOM 10561 H HG3  . GLU A 1 97  ? -252.499 -34.484 114.194 1.00 0.00 ? 97  GLU A HG3  6  
ATOM 10562 N N    . GLY A 1 98  ? -248.547 -33.746 111.303 1.00 0.00 ? 98  GLY A N    6  
ATOM 10563 C CA   . GLY A 1 98  ? -248.109 -33.977 109.948 1.00 0.00 ? 98  GLY A CA   6  
ATOM 10564 C C    . GLY A 1 98  ? -247.143 -32.897 109.508 1.00 0.00 ? 98  GLY A C    6  
ATOM 10565 O O    . GLY A 1 98  ? -246.657 -32.130 110.340 1.00 0.00 ? 98  GLY A O    6  
ATOM 10566 H H    . GLY A 1 98  ? -248.673 -32.828 111.615 1.00 0.00 ? 98  GLY A H    6  
ATOM 10567 H HA2  . GLY A 1 98  ? -247.620 -34.941 109.894 1.00 0.00 ? 98  GLY A HA2  6  
ATOM 10568 H HA3  . GLY A 1 98  ? -248.966 -33.975 109.292 1.00 0.00 ? 98  GLY A HA3  6  
ATOM 10569 N N    . TYR A 1 99  ? -246.881 -32.812 108.213 1.00 0.00 ? 99  TYR A N    6  
ATOM 10570 C CA   . TYR A 1 99  ? -245.963 -31.803 107.687 1.00 0.00 ? 99  TYR A CA   6  
ATOM 10571 C C    . TYR A 1 99  ? -246.737 -30.553 107.270 1.00 0.00 ? 99  TYR A C    6  
ATOM 10572 O O    . TYR A 1 99  ? -246.175 -29.605 106.719 1.00 0.00 ? 99  TYR A O    6  
ATOM 10573 C CB   . TYR A 1 99  ? -245.176 -32.358 106.492 1.00 0.00 ? 99  TYR A CB   6  
ATOM 10574 C CG   . TYR A 1 99  ? -245.984 -32.476 105.216 1.00 0.00 ? 99  TYR A CG   6  
ATOM 10575 C CD1  . TYR A 1 99  ? -246.886 -33.517 105.022 1.00 0.00 ? 99  TYR A CD1  6  
ATOM 10576 C CD2  . TYR A 1 99  ? -245.839 -31.537 104.204 1.00 0.00 ? 99  TYR A CD2  6  
ATOM 10577 C CE1  . TYR A 1 99  ? -247.618 -33.615 103.854 1.00 0.00 ? 99  TYR A CE1  6  
ATOM 10578 C CE2  . TYR A 1 99  ? -246.569 -31.626 103.037 1.00 0.00 ? 99  TYR A CE2  6  
ATOM 10579 C CZ   . TYR A 1 99  ? -247.457 -32.666 102.866 1.00 0.00 ? 99  TYR A CZ   6  
ATOM 10580 O OH   . TYR A 1 99  ? -248.191 -32.753 101.705 1.00 0.00 ? 99  TYR A OH   6  
ATOM 10581 H H    . TYR A 1 99  ? -247.311 -33.437 107.593 1.00 0.00 ? 99  TYR A H    6  
ATOM 10582 H HA   . TYR A 1 99  ? -245.271 -31.539 108.472 1.00 0.00 ? 99  TYR A HA   6  
ATOM 10583 H HB2  . TYR A 1 99  ? -244.338 -31.709 106.289 1.00 0.00 ? 99  TYR A HB2  6  
ATOM 10584 H HB3  . TYR A 1 99  ? -244.808 -33.343 106.741 1.00 0.00 ? 99  TYR A HB3  6  
ATOM 10585 H HD1  . TYR A 1 99  ? -247.010 -34.257 105.797 1.00 0.00 ? 99  TYR A HD1  6  
ATOM 10586 H HD2  . TYR A 1 99  ? -245.142 -30.723 104.340 1.00 0.00 ? 99  TYR A HD2  6  
ATOM 10587 H HE1  . TYR A 1 99  ? -248.314 -34.431 103.720 1.00 0.00 ? 99  TYR A HE1  6  
ATOM 10588 H HE2  . TYR A 1 99  ? -246.439 -30.884 102.262 1.00 0.00 ? 99  TYR A HE2  6  
ATOM 10589 H HH   . TYR A 1 99  ? -247.604 -32.649 100.946 1.00 0.00 ? 99  TYR A HH   6  
ATOM 10590 N N    . MET A 1 100 ? -248.034 -30.565 107.544 1.00 0.00 ? 100 MET A N    6  
ATOM 10591 C CA   . MET A 1 100 ? -248.920 -29.486 107.131 1.00 0.00 ? 100 MET A CA   6  
ATOM 10592 C C    . MET A 1 100 ? -248.728 -28.255 108.007 1.00 0.00 ? 100 MET A C    6  
ATOM 10593 O O    . MET A 1 100 ? -249.224 -28.195 109.134 1.00 0.00 ? 100 MET A O    6  
ATOM 10594 C CB   . MET A 1 100 ? -250.388 -29.937 107.173 1.00 0.00 ? 100 MET A CB   6  
ATOM 10595 C CG   . MET A 1 100 ? -250.676 -31.178 106.338 1.00 0.00 ? 100 MET A CG   6  
ATOM 10596 S SD   . MET A 1 100 ? -250.118 -32.703 107.124 1.00 0.00 ? 100 MET A SD   6  
ATOM 10597 C CE   . MET A 1 100 ? -251.239 -32.803 108.520 1.00 0.00 ? 100 MET A CE   6  
ATOM 10598 H H    . MET A 1 100 ? -248.405 -31.323 108.040 1.00 0.00 ? 100 MET A H    6  
ATOM 10599 H HA   . MET A 1 100 ? -248.667 -29.227 106.115 1.00 0.00 ? 100 MET A HA   6  
ATOM 10600 H HB2  . MET A 1 100 ? -250.661 -30.148 108.199 1.00 0.00 ? 100 MET A HB2  6  
ATOM 10601 H HB3  . MET A 1 100 ? -251.008 -29.132 106.806 1.00 0.00 ? 100 MET A HB3  6  
ATOM 10602 H HG2  . MET A 1 100 ? -251.740 -31.246 106.176 1.00 0.00 ? 100 MET A HG2  6  
ATOM 10603 H HG3  . MET A 1 100 ? -250.175 -31.075 105.386 1.00 0.00 ? 100 MET A HG3  6  
ATOM 10604 H HE1  . MET A 1 100 ? -252.258 -32.826 108.163 1.00 0.00 ? 100 MET A HE1  6  
ATOM 10605 H HE2  . MET A 1 100 ? -251.033 -33.701 109.081 1.00 0.00 ? 100 MET A HE2  6  
ATOM 10606 H HE3  . MET A 1 100 ? -251.097 -31.942 109.155 1.00 0.00 ? 100 MET A HE3  6  
ATOM 10607 N N    . GLY A 1 101 ? -247.985 -27.292 107.492 1.00 0.00 ? 101 GLY A N    6  
ATOM 10608 C CA   . GLY A 1 101 ? -247.778 -26.049 108.197 1.00 0.00 ? 101 GLY A CA   6  
ATOM 10609 C C    . GLY A 1 101 ? -247.526 -24.900 107.246 1.00 0.00 ? 101 GLY A C    6  
ATOM 10610 O O    . GLY A 1 101 ? -246.391 -24.666 106.834 1.00 0.00 ? 101 GLY A O    6  
ATOM 10611 H H    . GLY A 1 101 ? -247.554 -27.434 106.624 1.00 0.00 ? 101 GLY A H    6  
ATOM 10612 H HA2  . GLY A 1 101 ? -248.656 -25.831 108.787 1.00 0.00 ? 101 GLY A HA2  6  
ATOM 10613 H HA3  . GLY A 1 101 ? -246.929 -26.155 108.854 1.00 0.00 ? 101 GLY A HA3  6  
ATOM 10614 N N    . ARG A 1 102 ? -248.587 -24.200 106.874 1.00 0.00 ? 102 ARG A N    6  
ATOM 10615 C CA   . ARG A 1 102 ? -248.465 -23.040 106.004 1.00 0.00 ? 102 ARG A CA   6  
ATOM 10616 C C    . ARG A 1 102 ? -249.265 -21.874 106.567 1.00 0.00 ? 102 ARG A C    6  
ATOM 10617 O O    . ARG A 1 102 ? -250.232 -22.071 107.298 1.00 0.00 ? 102 ARG A O    6  
ATOM 10618 C CB   . ARG A 1 102 ? -248.893 -23.358 104.558 1.00 0.00 ? 102 ARG A CB   6  
ATOM 10619 C CG   . ARG A 1 102 ? -250.285 -23.966 104.397 1.00 0.00 ? 102 ARG A CG   6  
ATOM 10620 C CD   . ARG A 1 102 ? -250.313 -25.450 104.748 1.00 0.00 ? 102 ARG A CD   6  
ATOM 10621 N NE   . ARG A 1 102 ? -249.245 -26.202 104.082 1.00 0.00 ? 102 ARG A NE   6  
ATOM 10622 C CZ   . ARG A 1 102 ? -249.430 -27.359 103.443 1.00 0.00 ? 102 ARG A CZ   6  
ATOM 10623 N NH1  . ARG A 1 102 ? -250.652 -27.843 103.265 1.00 0.00 ? 102 ARG A NH1  6  
ATOM 10624 N NH2  . ARG A 1 102 ? -248.393 -28.018 102.940 1.00 0.00 ? 102 ARG A NH2  6  
ATOM 10625 H H    . ARG A 1 102 ? -249.474 -24.458 107.207 1.00 0.00 ? 102 ARG A H    6  
ATOM 10626 H HA   . ARG A 1 102 ? -247.422 -22.759 105.999 1.00 0.00 ? 102 ARG A HA   6  
ATOM 10627 H HB2  . ARG A 1 102 ? -248.864 -22.445 103.985 1.00 0.00 ? 102 ARG A HB2  6  
ATOM 10628 H HB3  . ARG A 1 102 ? -248.177 -24.048 104.139 1.00 0.00 ? 102 ARG A HB3  6  
ATOM 10629 H HG2  . ARG A 1 102 ? -250.971 -23.444 105.045 1.00 0.00 ? 102 ARG A HG2  6  
ATOM 10630 H HG3  . ARG A 1 102 ? -250.600 -23.845 103.369 1.00 0.00 ? 102 ARG A HG3  6  
ATOM 10631 H HD2  . ARG A 1 102 ? -250.199 -25.555 105.815 1.00 0.00 ? 102 ARG A HD2  6  
ATOM 10632 H HD3  . ARG A 1 102 ? -251.269 -25.858 104.447 1.00 0.00 ? 102 ARG A HD3  6  
ATOM 10633 H HE   . ARG A 1 102 ? -248.336 -25.835 104.140 1.00 0.00 ? 102 ARG A HE   6  
ATOM 10634 H HH11 . ARG A 1 102 ? -251.452 -27.336 103.600 1.00 0.00 ? 102 ARG A HH11 6  
ATOM 10635 H HH12 . ARG A 1 102 ? -250.782 -28.720 102.787 1.00 0.00 ? 102 ARG A HH12 6  
ATOM 10636 H HH21 . ARG A 1 102 ? -247.457 -27.652 103.033 1.00 0.00 ? 102 ARG A HH21 6  
ATOM 10637 H HH22 . ARG A 1 102 ? -248.541 -28.887 102.450 1.00 0.00 ? 102 ARG A HH22 6  
ATOM 10638 N N    . ILE A 1 103 ? -248.854 -20.664 106.218 1.00 0.00 ? 103 ILE A N    6  
ATOM 10639 C CA   . ILE A 1 103 ? -249.397 -19.455 106.827 1.00 0.00 ? 103 ILE A CA   6  
ATOM 10640 C C    . ILE A 1 103 ? -250.603 -18.914 106.074 1.00 0.00 ? 103 ILE A C    6  
ATOM 10641 O O    . ILE A 1 103 ? -250.590 -18.826 104.847 1.00 0.00 ? 103 ILE A O    6  
ATOM 10642 C CB   . ILE A 1 103 ? -248.334 -18.339 106.875 1.00 0.00 ? 103 ILE A CB   6  
ATOM 10643 C CG1  . ILE A 1 103 ? -247.094 -18.812 107.637 1.00 0.00 ? 103 ILE A CG1  6  
ATOM 10644 C CG2  . ILE A 1 103 ? -248.907 -17.084 107.519 1.00 0.00 ? 103 ILE A CG2  6  
ATOM 10645 C CD1  . ILE A 1 103 ? -246.009 -17.762 107.744 1.00 0.00 ? 103 ILE A CD1  6  
ATOM 10646 H H    . ILE A 1 103 ? -248.160 -20.579 105.525 1.00 0.00 ? 103 ILE A H    6  
ATOM 10647 H HA   . ILE A 1 103 ? -249.688 -19.687 107.841 1.00 0.00 ? 103 ILE A HA   6  
ATOM 10648 H HB   . ILE A 1 103 ? -248.061 -18.092 105.858 1.00 0.00 ? 103 ILE A HB   6  
ATOM 10649 H HG12 . ILE A 1 103 ? -247.384 -19.092 108.639 1.00 0.00 ? 103 ILE A HG12 6  
ATOM 10650 H HG13 . ILE A 1 103 ? -246.679 -19.672 107.134 1.00 0.00 ? 103 ILE A HG13 6  
ATOM 10651 H HG21 . ILE A 1 103 ? -249.237 -17.315 108.519 1.00 0.00 ? 103 ILE A HG21 6  
ATOM 10652 H HG22 . ILE A 1 103 ? -248.144 -16.319 107.556 1.00 0.00 ? 103 ILE A HG22 6  
ATOM 10653 H HG23 . ILE A 1 103 ? -249.744 -16.729 106.936 1.00 0.00 ? 103 ILE A HG23 6  
ATOM 10654 H HD11 . ILE A 1 103 ? -246.401 -16.891 108.248 1.00 0.00 ? 103 ILE A HD11 6  
ATOM 10655 H HD12 . ILE A 1 103 ? -245.177 -18.159 108.304 1.00 0.00 ? 103 ILE A HD12 6  
ATOM 10656 H HD13 . ILE A 1 103 ? -245.679 -17.486 106.754 1.00 0.00 ? 103 ILE A HD13 6  
ATOM 10657 N N    . VAL A 1 104 ? -251.628 -18.531 106.821 1.00 0.00 ? 104 VAL A N    6  
ATOM 10658 C CA   . VAL A 1 104 ? -252.743 -17.792 106.284 1.00 0.00 ? 104 VAL A CA   6  
ATOM 10659 C C    . VAL A 1 104 ? -252.772 -16.422 106.913 1.00 0.00 ? 104 VAL A C    6  
ATOM 10660 O O    . VAL A 1 104 ? -252.966 -16.285 108.119 1.00 0.00 ? 104 VAL A O    6  
ATOM 10661 C CB   . VAL A 1 104 ? -254.104 -18.472 106.529 1.00 0.00 ? 104 VAL A CB   6  
ATOM 10662 C CG1  . VAL A 1 104 ? -254.374 -19.538 105.482 1.00 0.00 ? 104 VAL A CG1  6  
ATOM 10663 C CG2  . VAL A 1 104 ? -254.188 -19.040 107.929 1.00 0.00 ? 104 VAL A CG2  6  
ATOM 10664 H H    . VAL A 1 104 ? -251.628 -18.737 107.775 1.00 0.00 ? 104 VAL A H    6  
ATOM 10665 H HA   . VAL A 1 104 ? -252.595 -17.688 105.219 1.00 0.00 ? 104 VAL A HA   6  
ATOM 10666 H HB   . VAL A 1 104 ? -254.866 -17.721 106.453 1.00 0.00 ? 104 VAL A HB   6  
ATOM 10667 H HG11 . VAL A 1 104 ? -254.349 -19.090 104.501 1.00 0.00 ? 104 VAL A HG11 6  
ATOM 10668 H HG12 . VAL A 1 104 ? -253.619 -20.306 105.545 1.00 0.00 ? 104 VAL A HG12 6  
ATOM 10669 H HG13 . VAL A 1 104 ? -255.347 -19.973 105.653 1.00 0.00 ? 104 VAL A HG13 6  
ATOM 10670 H HG21 . VAL A 1 104 ? -253.301 -19.615 108.141 1.00 0.00 ? 104 VAL A HG21 6  
ATOM 10671 H HG22 . VAL A 1 104 ? -254.275 -18.222 108.632 1.00 0.00 ? 104 VAL A HG22 6  
ATOM 10672 H HG23 . VAL A 1 104 ? -255.063 -19.669 108.006 1.00 0.00 ? 104 VAL A HG23 6  
ATOM 10673 N N    . LEU A 1 105 ? -252.532 -15.413 106.112 1.00 0.00 ? 105 LEU A N    6  
ATOM 10674 C CA   . LEU A 1 105 ? -252.704 -14.063 106.570 1.00 0.00 ? 105 LEU A CA   6  
ATOM 10675 C C    . LEU A 1 105 ? -254.190 -13.835 106.788 1.00 0.00 ? 105 LEU A C    6  
ATOM 10676 O O    . LEU A 1 105 ? -254.973 -13.779 105.842 1.00 0.00 ? 105 LEU A O    6  
ATOM 10677 C CB   . LEU A 1 105 ? -252.184 -13.080 105.544 1.00 0.00 ? 105 LEU A CB   6  
ATOM 10678 C CG   . LEU A 1 105 ? -251.848 -11.714 106.102 1.00 0.00 ? 105 LEU A CG   6  
ATOM 10679 C CD1  . LEU A 1 105 ? -250.690 -11.849 107.069 1.00 0.00 ? 105 LEU A CD1  6  
ATOM 10680 C CD2  . LEU A 1 105 ? -251.523 -10.743 104.981 1.00 0.00 ? 105 LEU A CD2  6  
ATOM 10681 H H    . LEU A 1 105 ? -252.245 -15.579 105.197 1.00 0.00 ? 105 LEU A H    6  
ATOM 10682 H HA   . LEU A 1 105 ? -252.161 -13.932 107.512 1.00 0.00 ? 105 LEU A HA   6  
ATOM 10683 H HB2  . LEU A 1 105 ? -251.300 -13.495 105.084 1.00 0.00 ? 105 LEU A HB2  6  
ATOM 10684 H HB3  . LEU A 1 105 ? -252.944 -12.959 104.790 1.00 0.00 ? 105 LEU A HB3  6  
ATOM 10685 H HG   . LEU A 1 105 ? -252.699 -11.330 106.649 1.00 0.00 ? 105 LEU A HG   6  
ATOM 10686 H HD11 . LEU A 1 105 ? -250.931 -12.595 107.814 1.00 0.00 ? 105 LEU A HD11 6  
ATOM 10687 H HD12 . LEU A 1 105 ? -249.807 -12.157 106.528 1.00 0.00 ? 105 LEU A HD12 6  
ATOM 10688 H HD13 . LEU A 1 105 ? -250.509 -10.899 107.548 1.00 0.00 ? 105 LEU A HD13 6  
ATOM 10689 H HD21 . LEU A 1 105 ? -252.367 -10.671 104.312 1.00 0.00 ? 105 LEU A HD21 6  
ATOM 10690 H HD22 . LEU A 1 105 ? -251.309 -9.771  105.398 1.00 0.00 ? 105 LEU A HD22 6  
ATOM 10691 H HD23 . LEU A 1 105 ? -250.661 -11.098 104.436 1.00 0.00 ? 105 LEU A HD23 6  
ATOM 10692 N N    . LYS A 1 106 ? -254.571 -13.752 108.028 1.00 0.00 ? 106 LYS A N    6  
ATOM 10693 C CA   . LYS A 1 106 ? -255.954 -13.585 108.384 1.00 0.00 ? 106 LYS A CA   6  
ATOM 10694 C C    . LYS A 1 106 ? -256.228 -12.128 108.703 1.00 0.00 ? 106 LYS A C    6  
ATOM 10695 O O    . LYS A 1 106 ? -255.318 -11.300 108.712 1.00 0.00 ? 106 LYS A O    6  
ATOM 10696 C CB   . LYS A 1 106 ? -256.315 -14.458 109.585 1.00 0.00 ? 106 LYS A CB   6  
ATOM 10697 C CG   . LYS A 1 106 ? -256.400 -15.941 109.266 1.00 0.00 ? 106 LYS A CG   6  
ATOM 10698 C CD   . LYS A 1 106 ? -257.559 -16.252 108.329 1.00 0.00 ? 106 LYS A CD   6  
ATOM 10699 C CE   . LYS A 1 106 ? -257.778 -17.753 108.197 1.00 0.00 ? 106 LYS A CE   6  
ATOM 10700 N NZ   . LYS A 1 106 ? -258.977 -18.088 107.379 1.00 0.00 ? 106 LYS A NZ   6  
ATOM 10701 H H    . LYS A 1 106 ? -253.888 -13.768 108.728 1.00 0.00 ? 106 LYS A H    6  
ATOM 10702 H HA   . LYS A 1 106 ? -256.548 -13.893 107.538 1.00 0.00 ? 106 LYS A HA   6  
ATOM 10703 H HB2  . LYS A 1 106 ? -255.567 -14.318 110.351 1.00 0.00 ? 106 LYS A HB2  6  
ATOM 10704 H HB3  . LYS A 1 106 ? -257.273 -14.140 109.969 1.00 0.00 ? 106 LYS A HB3  6  
ATOM 10705 H HG2  . LYS A 1 106 ? -255.480 -16.251 108.795 1.00 0.00 ? 106 LYS A HG2  6  
ATOM 10706 H HG3  . LYS A 1 106 ? -256.538 -16.489 110.187 1.00 0.00 ? 106 LYS A HG3  6  
ATOM 10707 H HD2  . LYS A 1 106 ? -258.458 -15.799 108.717 1.00 0.00 ? 106 LYS A HD2  6  
ATOM 10708 H HD3  . LYS A 1 106 ? -257.337 -15.843 107.354 1.00 0.00 ? 106 LYS A HD3  6  
ATOM 10709 H HE2  . LYS A 1 106 ? -256.907 -18.189 107.731 1.00 0.00 ? 106 LYS A HE2  6  
ATOM 10710 H HE3  . LYS A 1 106 ? -257.901 -18.172 109.185 1.00 0.00 ? 106 LYS A HE3  6  
ATOM 10711 H HZ1  . LYS A 1 106 ? -259.815 -17.584 107.740 1.00 0.00 ? 106 LYS A HZ1  6  
ATOM 10712 H HZ2  . LYS A 1 106 ? -258.826 -17.814 106.383 1.00 0.00 ? 106 LYS A HZ2  6  
ATOM 10713 H HZ3  . LYS A 1 106 ? -259.159 -19.114 107.420 1.00 0.00 ? 106 LYS A HZ3  6  
ATOM 10714 N N    . THR A 1 107 ? -257.472 -11.829 108.996 1.00 0.00 ? 107 THR A N    6  
ATOM 10715 C CA   . THR A 1 107 ? -257.872 -10.515 109.380 1.00 0.00 ? 107 THR A CA   6  
ATOM 10716 C C    . THR A 1 107 ? -258.393 -10.608 110.798 1.00 0.00 ? 107 THR A C    6  
ATOM 10717 O O    . THR A 1 107 ? -259.066 -11.578 111.146 1.00 0.00 ? 107 THR A O    6  
ATOM 10718 C CB   . THR A 1 107 ? -258.994 -9.976  108.467 1.00 0.00 ? 107 THR A CB   6  
ATOM 10719 O OG1  . THR A 1 107 ? -260.086 -10.906 108.425 1.00 0.00 ? 107 THR A OG1  6  
ATOM 10720 C CG2  . THR A 1 107 ? -258.492 -9.734  107.056 1.00 0.00 ? 107 THR A CG2  6  
ATOM 10721 H H    . THR A 1 107 ? -258.138 -12.525 109.002 1.00 0.00 ? 107 THR A H    6  
ATOM 10722 H HA   . THR A 1 107 ? -257.005 -9.847  109.323 1.00 0.00 ? 107 THR A HA   6  
ATOM 10723 H HB   . THR A 1 107 ? -259.346 -9.038  108.873 1.00 0.00 ? 107 THR A HB   6  
ATOM 10724 H HG1  . THR A 1 107 ? -260.229 -11.281 109.303 1.00 0.00 ? 107 THR A HG1  6  
ATOM 10725 H HG21 . THR A 1 107 ? -257.688 -9.011  107.080 1.00 0.00 ? 107 THR A HG21 6  
ATOM 10726 H HG22 . THR A 1 107 ? -258.131 -10.661 106.642 1.00 0.00 ? 107 THR A HG22 6  
ATOM 10727 H HG23 . THR A 1 107 ? -259.299 -9.357  106.448 1.00 0.00 ? 107 THR A HG23 6  
ATOM 10728 N N    . GLN A 1 108 ? -258.074 -9.628  111.602 1.00 0.00 ? 108 GLN A N    6  
ATOM 10729 C CA   . GLN A 1 108 ? -258.564 -9.536  112.985 1.00 0.00 ? 108 GLN A CA   6  
ATOM 10730 C C    . GLN A 1 108 ? -260.057 -9.178  112.982 1.00 0.00 ? 108 GLN A C    6  
ATOM 10731 O O    . GLN A 1 108 ? -260.586 -8.588  113.916 1.00 0.00 ? 108 GLN A O    6  
ATOM 10732 C CB   . GLN A 1 108 ? -257.737 -8.482  113.742 1.00 0.00 ? 108 GLN A CB   6  
ATOM 10733 C CG   . GLN A 1 108 ? -257.583 -8.732  115.238 1.00 0.00 ? 108 GLN A CG   6  
ATOM 10734 C CD   . GLN A 1 108 ? -258.664 -8.078  116.077 1.00 0.00 ? 108 GLN A CD   6  
ATOM 10735 O OE1  . GLN A 1 108 ? -259.050 -8.600  117.123 1.00 0.00 ? 108 GLN A OE1  6  
ATOM 10736 N NE2  . GLN A 1 108 ? -259.146 -6.922  115.639 1.00 0.00 ? 108 GLN A NE2  6  
ATOM 10737 H H    . GLN A 1 108 ? -257.467 -8.951  111.266 1.00 0.00 ? 108 GLN A H    6  
ATOM 10738 H HA   . GLN A 1 108 ? -258.435 -10.501 113.452 1.00 0.00 ? 108 GLN A HA   6  
ATOM 10739 H HB2  . GLN A 1 108 ? -256.747 -8.448  113.311 1.00 0.00 ? 108 GLN A HB2  6  
ATOM 10740 H HB3  . GLN A 1 108 ? -258.205 -7.518  113.611 1.00 0.00 ? 108 GLN A HB3  6  
ATOM 10741 H HG2  . GLN A 1 108 ? -257.609 -9.796  115.415 1.00 0.00 ? 108 GLN A HG2  6  
ATOM 10742 H HG3  . GLN A 1 108 ? -256.623 -8.342  115.549 1.00 0.00 ? 108 GLN A HG3  6  
ATOM 10743 H HE21 . GLN A 1 108 ? -258.781 -6.547  114.802 1.00 0.00 ? 108 GLN A HE21 6  
ATOM 10744 H HE22 . GLN A 1 108 ? -259.850 -6.486  116.166 1.00 0.00 ? 108 GLN A HE22 6  
ATOM 10745 N N    . GLN A 1 109 ? -260.730 -9.587  111.926 1.00 0.00 ? 109 GLN A N    6  
ATOM 10746 C CA   . GLN A 1 109 ? -262.117 -9.281  111.712 1.00 0.00 ? 109 GLN A CA   6  
ATOM 10747 C C    . GLN A 1 109 ? -262.831 -10.502 111.159 1.00 0.00 ? 109 GLN A C    6  
ATOM 10748 O O    . GLN A 1 109 ? -262.257 -11.275 110.385 1.00 0.00 ? 109 GLN A O    6  
ATOM 10749 C CB   . GLN A 1 109 ? -262.224 -8.098  110.757 1.00 0.00 ? 109 GLN A CB   6  
ATOM 10750 C CG   . GLN A 1 109 ? -263.376 -8.184  109.773 1.00 0.00 ? 109 GLN A CG   6  
ATOM 10751 C CD   . GLN A 1 109 ? -263.421 -7.015  108.806 1.00 0.00 ? 109 GLN A CD   6  
ATOM 10752 O OE1  . GLN A 1 109 ? -263.872 -7.152  107.668 1.00 0.00 ? 109 GLN A OE1  6  
ATOM 10753 N NE2  . GLN A 1 109 ? -262.955 -5.858  109.245 1.00 0.00 ? 109 GLN A NE2  6  
ATOM 10754 H H    . GLN A 1 109 ? -260.273 -10.137 111.263 1.00 0.00 ? 109 GLN A H    6  
ATOM 10755 H HA   . GLN A 1 109 ? -262.555 -9.015  112.664 1.00 0.00 ? 109 GLN A HA   6  
ATOM 10756 H HB2  . GLN A 1 109 ? -262.354 -7.211  111.345 1.00 0.00 ? 109 GLN A HB2  6  
ATOM 10757 H HB3  . GLN A 1 109 ? -261.305 -8.018  110.197 1.00 0.00 ? 109 GLN A HB3  6  
ATOM 10758 H HG2  . GLN A 1 109 ? -263.265 -9.095  109.207 1.00 0.00 ? 109 GLN A HG2  6  
ATOM 10759 H HG3  . GLN A 1 109 ? -264.302 -8.214  110.326 1.00 0.00 ? 109 GLN A HG3  6  
ATOM 10760 H HE21 . GLN A 1 109 ? -262.607 -5.811  110.163 1.00 0.00 ? 109 GLN A HE21 6  
ATOM 10761 H HE22 . GLN A 1 109 ? -262.975 -5.087  108.631 1.00 0.00 ? 109 GLN A HE22 6  
ATOM 10762 N N    . GLU A 1 110 ? -264.067 -10.672 111.572 1.00 0.00 ? 110 GLU A N    6  
ATOM 10763 C CA   . GLU A 1 110 ? -264.871 -11.797 111.154 1.00 0.00 ? 110 GLU A CA   6  
ATOM 10764 C C    . GLU A 1 110 ? -266.208 -11.327 110.593 1.00 0.00 ? 110 GLU A C    6  
ATOM 10765 O O    . GLU A 1 110 ? -266.696 -10.250 110.952 1.00 0.00 ? 110 GLU A O    6  
ATOM 10766 C CB   . GLU A 1 110 ? -265.096 -12.719 112.343 1.00 0.00 ? 110 GLU A CB   6  
ATOM 10767 C CG   . GLU A 1 110 ? -265.438 -11.986 113.627 1.00 0.00 ? 110 GLU A CG   6  
ATOM 10768 C CD   . GLU A 1 110 ? -265.662 -12.926 114.789 1.00 0.00 ? 110 GLU A CD   6  
ATOM 10769 O OE1  . GLU A 1 110 ? -264.684 -13.261 115.485 1.00 0.00 ? 110 GLU A OE1  6  
ATOM 10770 O OE2  . GLU A 1 110 ? -266.821 -13.335 115.008 1.00 0.00 ? 110 GLU A OE2  6  
ATOM 10771 H H    . GLU A 1 110 ? -264.461 -10.014 112.186 1.00 0.00 ? 110 GLU A H    6  
ATOM 10772 H HA   . GLU A 1 110 ? -264.332 -12.331 110.388 1.00 0.00 ? 110 GLU A HA   6  
ATOM 10773 H HB2  . GLU A 1 110 ? -265.909 -13.375 112.109 1.00 0.00 ? 110 GLU A HB2  6  
ATOM 10774 H HB3  . GLU A 1 110 ? -264.202 -13.303 112.510 1.00 0.00 ? 110 GLU A HB3  6  
ATOM 10775 H HG2  . GLU A 1 110 ? -264.625 -11.320 113.873 1.00 0.00 ? 110 GLU A HG2  6  
ATOM 10776 H HG3  . GLU A 1 110 ? -266.338 -11.411 113.467 1.00 0.00 ? 110 GLU A HG3  6  
ATOM 10777 N N    . GLY A 1 1   ? -220.939 -13.025 99.745  1.00 0.00 ? 1   GLY A N    7  
ATOM 10778 C CA   . GLY A 1 1   ? -220.906 -14.185 98.814  1.00 0.00 ? 1   GLY A CA   7  
ATOM 10779 C C    . GLY A 1 1   ? -220.248 -15.385 99.453  1.00 0.00 ? 1   GLY A C    7  
ATOM 10780 O O    . GLY A 1 1   ? -219.242 -15.895 98.963  1.00 0.00 ? 1   GLY A O    7  
ATOM 10781 H H1   . GLY A 1 1   ? -221.375 -13.306 100.650 1.00 0.00 ? 1   GLY A H1   7  
ATOM 10782 H H2   . GLY A 1 1   ? -219.974 -12.693 99.938  1.00 0.00 ? 1   GLY A H2   7  
ATOM 10783 H H3   . GLY A 1 1   ? -221.491 -12.243 99.333  1.00 0.00 ? 1   GLY A H3   7  
ATOM 10784 H HA2  . GLY A 1 1   ? -221.916 -14.443 98.537  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10785 H HA3  . GLY A 1 1   ? -220.354 -13.910 97.927  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10786 N N    . GLU A 1 2   ? -220.830 -15.831 100.552 1.00 0.00 ? 2   GLU A N    7  
ATOM 10787 C CA   . GLU A 1 2   ? -220.253 -16.875 101.374 1.00 0.00 ? 2   GLU A CA   7  
ATOM 10788 C C    . GLU A 1 2   ? -221.352 -17.502 102.220 1.00 0.00 ? 2   GLU A C    7  
ATOM 10789 O O    . GLU A 1 2   ? -222.336 -16.828 102.545 1.00 0.00 ? 2   GLU A O    7  
ATOM 10790 C CB   . GLU A 1 2   ? -219.142 -16.297 102.271 1.00 0.00 ? 2   GLU A CB   7  
ATOM 10791 C CG   . GLU A 1 2   ? -219.607 -15.214 103.251 1.00 0.00 ? 2   GLU A CG   7  
ATOM 10792 C CD   . GLU A 1 2   ? -220.158 -13.971 102.570 1.00 0.00 ? 2   GLU A CD   7  
ATOM 10793 O OE1  . GLU A 1 2   ? -219.367 -13.118 102.128 1.00 0.00 ? 2   GLU A OE1  7  
ATOM 10794 O OE2  . GLU A 1 2   ? -221.400 -13.850 102.447 1.00 0.00 ? 2   GLU A OE2  7  
ATOM 10795 H H    . GLU A 1 2   ? -221.687 -15.441 100.831 1.00 0.00 ? 2   GLU A H    7  
ATOM 10796 H HA   . GLU A 1 2   ? -219.834 -17.626 100.722 1.00 0.00 ? 2   GLU A HA   7  
ATOM 10797 H HB2  . GLU A 1 2   ? -218.708 -17.102 102.844 1.00 0.00 ? 2   GLU A HB2  7  
ATOM 10798 H HB3  . GLU A 1 2   ? -218.378 -15.870 101.638 1.00 0.00 ? 2   GLU A HB3  7  
ATOM 10799 H HG2  . GLU A 1 2   ? -220.382 -15.629 103.878 1.00 0.00 ? 2   GLU A HG2  7  
ATOM 10800 H HG3  . GLU A 1 2   ? -218.768 -14.926 103.866 1.00 0.00 ? 2   GLU A HG3  7  
ATOM 10801 N N    . GLU A 1 3   ? -221.196 -18.786 102.552 1.00 0.00 ? 3   GLU A N    7  
ATOM 10802 C CA   . GLU A 1 3   ? -222.199 -19.504 103.341 1.00 0.00 ? 3   GLU A CA   7  
ATOM 10803 C C    . GLU A 1 3   ? -223.536 -19.463 102.587 1.00 0.00 ? 3   GLU A C    7  
ATOM 10804 O O    . GLU A 1 3   ? -223.551 -19.426 101.354 1.00 0.00 ? 3   GLU A O    7  
ATOM 10805 C CB   . GLU A 1 3   ? -222.313 -18.852 104.734 1.00 0.00 ? 3   GLU A CB   7  
ATOM 10806 C CG   . GLU A 1 3   ? -222.454 -19.837 105.889 1.00 0.00 ? 3   GLU A CG   7  
ATOM 10807 C CD   . GLU A 1 3   ? -223.809 -20.506 105.937 1.00 0.00 ? 3   GLU A CD   7  
ATOM 10808 O OE1  . GLU A 1 3   ? -224.778 -19.855 106.384 1.00 0.00 ? 3   GLU A OE1  7  
ATOM 10809 O OE2  . GLU A 1 3   ? -223.913 -21.672 105.513 1.00 0.00 ? 3   GLU A OE2  7  
ATOM 10810 H H    . GLU A 1 3   ? -220.396 -19.262 102.252 1.00 0.00 ? 3   GLU A H    7  
ATOM 10811 H HA   . GLU A 1 3   ? -221.878 -20.529 103.444 1.00 0.00 ? 3   GLU A HA   7  
ATOM 10812 H HB2  . GLU A 1 3   ? -221.428 -18.260 104.909 1.00 0.00 ? 3   GLU A HB2  7  
ATOM 10813 H HB3  . GLU A 1 3   ? -223.174 -18.201 104.740 1.00 0.00 ? 3   GLU A HB3  7  
ATOM 10814 H HG2  . GLU A 1 3   ? -221.701 -20.603 105.784 1.00 0.00 ? 3   GLU A HG2  7  
ATOM 10815 H HG3  . GLU A 1 3   ? -222.299 -19.306 106.816 1.00 0.00 ? 3   GLU A HG3  7  
ATOM 10816 N N    . ARG A 1 4   ? -224.650 -19.493 103.301 1.00 0.00 ? 4   ARG A N    7  
ATOM 10817 C CA   . ARG A 1 4   ? -225.941 -19.269 102.675 1.00 0.00 ? 4   ARG A CA   7  
ATOM 10818 C C    . ARG A 1 4   ? -226.082 -17.796 102.325 1.00 0.00 ? 4   ARG A C    7  
ATOM 10819 O O    . ARG A 1 4   ? -226.229 -17.436 101.155 1.00 0.00 ? 4   ARG A O    7  
ATOM 10820 C CB   . ARG A 1 4   ? -227.086 -19.699 103.593 1.00 0.00 ? 4   ARG A CB   7  
ATOM 10821 C CG   . ARG A 1 4   ? -227.235 -21.203 103.753 1.00 0.00 ? 4   ARG A CG   7  
ATOM 10822 C CD   . ARG A 1 4   ? -227.501 -21.874 102.416 1.00 0.00 ? 4   ARG A CD   7  
ATOM 10823 N NE   . ARG A 1 4   ? -228.059 -23.216 102.578 1.00 0.00 ? 4   ARG A NE   7  
ATOM 10824 C CZ   . ARG A 1 4   ? -227.788 -24.239 101.773 1.00 0.00 ? 4   ARG A CZ   7  
ATOM 10825 N NH1  . ARG A 1 4   ? -226.920 -24.095 100.776 1.00 0.00 ? 4   ARG A NH1  7  
ATOM 10826 N NH2  . ARG A 1 4   ? -228.381 -25.406 101.965 1.00 0.00 ? 4   ARG A NH2  7  
ATOM 10827 H H    . ARG A 1 4   ? -224.606 -19.674 104.264 1.00 0.00 ? 4   ARG A H    7  
ATOM 10828 H HA   . ARG A 1 4   ? -225.978 -19.851 101.763 1.00 0.00 ? 4   ARG A HA   7  
ATOM 10829 H HB2  . ARG A 1 4   ? -226.924 -19.273 104.571 1.00 0.00 ? 4   ARG A HB2  7  
ATOM 10830 H HB3  . ARG A 1 4   ? -228.011 -19.311 103.194 1.00 0.00 ? 4   ARG A HB3  7  
ATOM 10831 H HG2  . ARG A 1 4   ? -226.325 -21.606 104.173 1.00 0.00 ? 4   ARG A HG2  7  
ATOM 10832 H HG3  . ARG A 1 4   ? -228.061 -21.404 104.419 1.00 0.00 ? 4   ARG A HG3  7  
ATOM 10833 H HD2  . ARG A 1 4   ? -228.203 -21.271 101.859 1.00 0.00 ? 4   ARG A HD2  7  
ATOM 10834 H HD3  . ARG A 1 4   ? -226.573 -21.945 101.868 1.00 0.00 ? 4   ARG A HD3  7  
ATOM 10835 H HE   . ARG A 1 4   ? -228.691 -23.352 103.321 1.00 0.00 ? 4   ARG A HE   7  
ATOM 10836 H HH11 . ARG A 1 4   ? -226.464 -23.216 100.630 1.00 0.00 ? 4   ARG A HH11 7  
ATOM 10837 H HH12 . ARG A 1 4   ? -226.720 -24.866 100.166 1.00 0.00 ? 4   ARG A HH12 7  
ATOM 10838 H HH21 . ARG A 1 4   ? -229.046 -25.522 102.717 1.00 0.00 ? 4   ARG A HH21 7  
ATOM 10839 H HH22 . ARG A 1 4   ? -228.166 -26.188 101.367 1.00 0.00 ? 4   ARG A HH22 7  
ATOM 10840 N N    . LYS A 1 5   ? -226.039 -16.949 103.350 1.00 0.00 ? 5   LYS A N    7  
ATOM 10841 C CA   . LYS A 1 5   ? -226.115 -15.505 103.170 1.00 0.00 ? 5   LYS A CA   7  
ATOM 10842 C C    . LYS A 1 5   ? -225.847 -14.786 104.487 1.00 0.00 ? 5   LYS A C    7  
ATOM 10843 O O    . LYS A 1 5   ? -226.479 -15.081 105.505 1.00 0.00 ? 5   LYS A O    7  
ATOM 10844 C CB   . LYS A 1 5   ? -227.488 -15.095 102.613 1.00 0.00 ? 5   LYS A CB   7  
ATOM 10845 C CG   . LYS A 1 5   ? -228.664 -15.774 103.306 1.00 0.00 ? 5   LYS A CG   7  
ATOM 10846 C CD   . LYS A 1 5   ? -229.999 -15.197 102.855 1.00 0.00 ? 5   LYS A CD   7  
ATOM 10847 C CE   . LYS A 1 5   ? -230.192 -15.296 101.348 1.00 0.00 ? 5   LYS A CE   7  
ATOM 10848 N NZ   . LYS A 1 5   ? -230.315 -16.707 100.885 1.00 0.00 ? 5   LYS A NZ   7  
ATOM 10849 H H    . LYS A 1 5   ? -225.957 -17.308 104.262 1.00 0.00 ? 5   LYS A H    7  
ATOM 10850 H HA   . LYS A 1 5   ? -225.352 -15.223 102.461 1.00 0.00 ? 5   LYS A HA   7  
ATOM 10851 H HB2  . LYS A 1 5   ? -227.602 -14.027 102.723 1.00 0.00 ? 5   LYS A HB2  7  
ATOM 10852 H HB3  . LYS A 1 5   ? -227.525 -15.346 101.563 1.00 0.00 ? 5   LYS A HB3  7  
ATOM 10853 H HG2  . LYS A 1 5   ? -228.642 -16.829 103.079 1.00 0.00 ? 5   LYS A HG2  7  
ATOM 10854 H HG3  . LYS A 1 5   ? -228.564 -15.634 104.373 1.00 0.00 ? 5   LYS A HG3  7  
ATOM 10855 H HD2  . LYS A 1 5   ? -230.795 -15.741 103.341 1.00 0.00 ? 5   LYS A HD2  7  
ATOM 10856 H HD3  . LYS A 1 5   ? -230.044 -14.158 103.145 1.00 0.00 ? 5   LYS A HD3  7  
ATOM 10857 H HE2  . LYS A 1 5   ? -231.089 -14.761 101.079 1.00 0.00 ? 5   LYS A HE2  7  
ATOM 10858 H HE3  . LYS A 1 5   ? -229.342 -14.840 100.861 1.00 0.00 ? 5   LYS A HE3  7  
ATOM 10859 H HZ1  . LYS A 1 5   ? -229.497 -17.261 101.192 1.00 0.00 ? 5   LYS A HZ1  7  
ATOM 10860 H HZ2  . LYS A 1 5   ? -231.184 -17.137 101.270 1.00 0.00 ? 5   LYS A HZ2  7  
ATOM 10861 H HZ3  . LYS A 1 5   ? -230.367 -16.735 99.842  1.00 0.00 ? 5   LYS A HZ3  7  
ATOM 10862 N N    . CYS A 1 6   ? -224.900 -13.856 104.473 1.00 0.00 ? 6   CYS A N    7  
ATOM 10863 C CA   . CYS A 1 6   ? -224.621 -13.043 105.649 1.00 0.00 ? 6   CYS A CA   7  
ATOM 10864 C C    . CYS A 1 6   ? -225.757 -12.055 105.881 1.00 0.00 ? 6   CYS A C    7  
ATOM 10865 O O    . CYS A 1 6   ? -226.059 -11.687 107.016 1.00 0.00 ? 6   CYS A O    7  
ATOM 10866 C CB   . CYS A 1 6   ? -223.289 -12.314 105.494 1.00 0.00 ? 6   CYS A CB   7  
ATOM 10867 S SG   . CYS A 1 6   ? -221.870 -13.426 105.379 1.00 0.00 ? 6   CYS A SG   7  
ATOM 10868 H H    . CYS A 1 6   ? -224.369 -13.721 103.659 1.00 0.00 ? 6   CYS A H    7  
ATOM 10869 H HA   . CYS A 1 6   ? -224.561 -13.706 106.500 1.00 0.00 ? 6   CYS A HA   7  
ATOM 10870 H HB2  . CYS A 1 6   ? -223.314 -11.716 104.595 1.00 0.00 ? 6   CYS A HB2  7  
ATOM 10871 H HB3  . CYS A 1 6   ? -223.134 -11.669 106.348 1.00 0.00 ? 6   CYS A HB3  7  
ATOM 10872 H HG   . CYS A 1 6   ? -221.668 -13.697 104.090 1.00 0.00 ? 6   CYS A HG   7  
ATOM 10873 N N    . LEU A 1 7   ? -226.387 -11.635 104.794 1.00 0.00 ? 7   LEU A N    7  
ATOM 10874 C CA   . LEU A 1 7   ? -227.602 -10.847 104.877 1.00 0.00 ? 7   LEU A CA   7  
ATOM 10875 C C    . LEU A 1 7   ? -228.770 -11.794 105.116 1.00 0.00 ? 7   LEU A C    7  
ATOM 10876 O O    . LEU A 1 7   ? -229.149 -12.551 104.226 1.00 0.00 ? 7   LEU A O    7  
ATOM 10877 C CB   . LEU A 1 7   ? -227.810 -10.048 103.586 1.00 0.00 ? 7   LEU A CB   7  
ATOM 10878 C CG   . LEU A 1 7   ? -228.999 -9.083  103.596 1.00 0.00 ? 7   LEU A CG   7  
ATOM 10879 C CD1  . LEU A 1 7   ? -228.808 -8.008  104.653 1.00 0.00 ? 7   LEU A CD1  7  
ATOM 10880 C CD2  . LEU A 1 7   ? -229.181 -8.458  102.222 1.00 0.00 ? 7   LEU A CD2  7  
ATOM 10881 H H    . LEU A 1 7   ? -226.028 -11.869 103.914 1.00 0.00 ? 7   LEU A H    7  
ATOM 10882 H HA   . LEU A 1 7   ? -227.513 -10.170 105.713 1.00 0.00 ? 7   LEU A HA   7  
ATOM 10883 H HB2  . LEU A 1 7   ? -226.914 -9.478  103.392 1.00 0.00 ? 7   LEU A HB2  7  
ATOM 10884 H HB3  . LEU A 1 7   ? -227.954 -10.746 102.775 1.00 0.00 ? 7   LEU A HB3  7  
ATOM 10885 H HG   . LEU A 1 7   ? -229.897 -9.631  103.835 1.00 0.00 ? 7   LEU A HG   7  
ATOM 10886 H HD11 . LEU A 1 7   ? -227.905 -7.453  104.445 1.00 0.00 ? 7   LEU A HD11 7  
ATOM 10887 H HD12 . LEU A 1 7   ? -229.655 -7.335  104.637 1.00 0.00 ? 7   LEU A HD12 7  
ATOM 10888 H HD13 . LEU A 1 7   ? -228.733 -8.469  105.627 1.00 0.00 ? 7   LEU A HD13 7  
ATOM 10889 H HD21 . LEU A 1 7   ? -229.336 -9.237  101.491 1.00 0.00 ? 7   LEU A HD21 7  
ATOM 10890 H HD22 . LEU A 1 7   ? -230.039 -7.802  102.237 1.00 0.00 ? 7   LEU A HD22 7  
ATOM 10891 H HD23 . LEU A 1 7   ? -228.298 -7.891  101.964 1.00 0.00 ? 7   LEU A HD23 7  
ATOM 10892 N N    . GLN A 1 8   ? -229.307 -11.774 106.327 1.00 0.00 ? 8   GLN A N    7  
ATOM 10893 C CA   . GLN A 1 8   ? -230.323 -12.737 106.731 1.00 0.00 ? 8   GLN A CA   7  
ATOM 10894 C C    . GLN A 1 8   ? -231.686 -12.405 106.129 1.00 0.00 ? 8   GLN A C    7  
ATOM 10895 O O    . GLN A 1 8   ? -232.571 -11.878 106.805 1.00 0.00 ? 8   GLN A O    7  
ATOM 10896 C CB   . GLN A 1 8   ? -230.414 -12.792 108.255 1.00 0.00 ? 8   GLN A CB   7  
ATOM 10897 C CG   . GLN A 1 8   ? -231.303 -13.905 108.783 1.00 0.00 ? 8   GLN A CG   7  
ATOM 10898 C CD   . GLN A 1 8   ? -231.352 -13.932 110.297 1.00 0.00 ? 8   GLN A CD   7  
ATOM 10899 O OE1  . GLN A 1 8   ? -231.224 -12.898 110.951 1.00 0.00 ? 8   GLN A OE1  7  
ATOM 10900 N NE2  . GLN A 1 8   ? -231.540 -15.113 110.863 1.00 0.00 ? 8   GLN A NE2  7  
ATOM 10901 H H    . GLN A 1 8   ? -229.014 -11.095 106.966 1.00 0.00 ? 8   GLN A H    7  
ATOM 10902 H HA   . GLN A 1 8   ? -230.014 -13.705 106.368 1.00 0.00 ? 8   GLN A HA   7  
ATOM 10903 H HB2  . GLN A 1 8   ? -229.422 -12.936 108.657 1.00 0.00 ? 8   GLN A HB2  7  
ATOM 10904 H HB3  . GLN A 1 8   ? -230.804 -11.850 108.613 1.00 0.00 ? 8   GLN A HB3  7  
ATOM 10905 H HG2  . GLN A 1 8   ? -232.306 -13.755 108.409 1.00 0.00 ? 8   GLN A HG2  7  
ATOM 10906 H HG3  . GLN A 1 8   ? -230.925 -14.852 108.430 1.00 0.00 ? 8   GLN A HG3  7  
ATOM 10907 H HE21 . GLN A 1 8   ? -231.644 -15.902 110.279 1.00 0.00 ? 8   GLN A HE21 7  
ATOM 10908 H HE22 . GLN A 1 8   ? -231.561 -15.159 111.844 1.00 0.00 ? 8   GLN A HE22 7  
ATOM 10909 N N    . THR A 1 9   ? -231.833 -12.699 104.850 1.00 0.00 ? 9   THR A N    7  
ATOM 10910 C CA   . THR A 1 9   ? -233.088 -12.504 104.151 1.00 0.00 ? 9   THR A CA   7  
ATOM 10911 C C    . THR A 1 9   ? -233.689 -13.857 103.770 1.00 0.00 ? 9   THR A C    7  
ATOM 10912 O O    . THR A 1 9   ? -233.082 -14.637 103.037 1.00 0.00 ? 9   THR A O    7  
ATOM 10913 C CB   . THR A 1 9   ? -232.880 -11.657 102.877 1.00 0.00 ? 9   THR A CB   7  
ATOM 10914 O OG1  . THR A 1 9   ? -231.921 -12.285 102.015 1.00 0.00 ? 9   THR A OG1  7  
ATOM 10915 C CG2  . THR A 1 9   ? -232.400 -10.257 103.226 1.00 0.00 ? 9   THR A CG2  7  
ATOM 10916 H H    . THR A 1 9   ? -231.061 -13.039 104.350 1.00 0.00 ? 9   THR A H    7  
ATOM 10917 H HA   . THR A 1 9   ? -233.774 -11.975 104.809 1.00 0.00 ? 9   THR A HA   7  
ATOM 10918 H HB   . THR A 1 9   ? -233.825 -11.577 102.363 1.00 0.00 ? 9   THR A HB   7  
ATOM 10919 H HG1  . THR A 1 9   ? -232.371 -12.618 101.223 1.00 0.00 ? 9   THR A HG1  7  
ATOM 10920 H HG21 . THR A 1 9   ? -233.125 -9.777  103.866 1.00 0.00 ? 9   THR A HG21 7  
ATOM 10921 H HG22 . THR A 1 9   ? -231.452 -10.319 103.739 1.00 0.00 ? 9   THR A HG22 7  
ATOM 10922 H HG23 . THR A 1 9   ? -232.282 -9.680  102.321 1.00 0.00 ? 9   THR A HG23 7  
ATOM 10923 N N    . HIS A 1 10  ? -234.861 -14.156 104.302 1.00 0.00 ? 10  HIS A N    7  
ATOM 10924 C CA   . HIS A 1 10  ? -235.537 -15.413 103.997 1.00 0.00 ? 10  HIS A CA   7  
ATOM 10925 C C    . HIS A 1 10  ? -236.962 -15.147 103.551 1.00 0.00 ? 10  HIS A C    7  
ATOM 10926 O O    . HIS A 1 10  ? -237.649 -14.318 104.121 1.00 0.00 ? 10  HIS A O    7  
ATOM 10927 C CB   . HIS A 1 10  ? -235.542 -16.356 105.205 1.00 0.00 ? 10  HIS A CB   7  
ATOM 10928 C CG   . HIS A 1 10  ? -234.188 -16.880 105.596 1.00 0.00 ? 10  HIS A CG   7  
ATOM 10929 N ND1  . HIS A 1 10  ? -233.844 -18.211 105.509 1.00 0.00 ? 10  HIS A ND1  7  
ATOM 10930 C CD2  . HIS A 1 10  ? -233.094 -16.248 106.086 1.00 0.00 ? 10  HIS A CD2  7  
ATOM 10931 C CE1  . HIS A 1 10  ? -232.604 -18.375 105.926 1.00 0.00 ? 10  HIS A CE1  7  
ATOM 10932 N NE2  . HIS A 1 10  ? -232.127 -17.201 106.280 1.00 0.00 ? 10  HIS A NE2  7  
ATOM 10933 H H    . HIS A 1 10  ? -235.290 -13.514 104.905 1.00 0.00 ? 10  HIS A H    7  
ATOM 10934 H HA   . HIS A 1 10  ? -235.006 -15.881 103.187 1.00 0.00 ? 10  HIS A HA   7  
ATOM 10935 H HB2  . HIS A 1 10  ? -235.952 -15.833 106.048 1.00 0.00 ? 10  HIS A HB2  7  
ATOM 10936 H HB3  . HIS A 1 10  ? -236.172 -17.205 104.981 1.00 0.00 ? 10  HIS A HB3  7  
ATOM 10937 H HD1  . HIS A 1 10  ? -234.439 -18.944 105.199 1.00 0.00 ? 10  HIS A HD1  7  
ATOM 10938 H HD2  . HIS A 1 10  ? -233.001 -15.190 106.288 1.00 0.00 ? 10  HIS A HD2  7  
ATOM 10939 H HE1  . HIS A 1 10  ? -232.070 -19.315 105.966 1.00 0.00 ? 10  HIS A HE1  7  
ATOM 10940 H HE2  . HIS A 1 10  ? -231.202 -17.030 106.594 1.00 0.00 ? 10  HIS A HE2  7  
ATOM 10941 N N    . ARG A 1 11  ? -237.391 -15.836 102.524 1.00 0.00 ? 11  ARG A N    7  
ATOM 10942 C CA   . ARG A 1 11  ? -238.711 -15.650 101.992 1.00 0.00 ? 11  ARG A CA   7  
ATOM 10943 C C    . ARG A 1 11  ? -239.709 -16.604 102.632 1.00 0.00 ? 11  ARG A C    7  
ATOM 10944 O O    . ARG A 1 11  ? -239.386 -17.758 102.914 1.00 0.00 ? 11  ARG A O    7  
ATOM 10945 C CB   . ARG A 1 11  ? -238.667 -15.840 100.498 1.00 0.00 ? 11  ARG A CB   7  
ATOM 10946 C CG   . ARG A 1 11  ? -239.454 -14.773 99.808  1.00 0.00 ? 11  ARG A CG   7  
ATOM 10947 C CD   . ARG A 1 11  ? -239.042 -14.609 98.364  1.00 0.00 ? 11  ARG A CD   7  
ATOM 10948 N NE   . ARG A 1 11  ? -239.283 -15.815 97.565  1.00 0.00 ? 11  ARG A NE   7  
ATOM 10949 C CZ   . ARG A 1 11  ? -240.012 -15.837 96.447  1.00 0.00 ? 11  ARG A CZ   7  
ATOM 10950 N NH1  . ARG A 1 11  ? -240.630 -14.739 96.033  1.00 0.00 ? 11  ARG A NH1  7  
ATOM 10951 N NH2  . ARG A 1 11  ? -240.138 -16.963 95.753  1.00 0.00 ? 11  ARG A NH2  7  
ATOM 10952 H H    . ARG A 1 11  ? -236.807 -16.470 102.095 1.00 0.00 ? 11  ARG A H    7  
ATOM 10953 H HA   . ARG A 1 11  ? -239.010 -14.632 102.190 1.00 0.00 ? 11  ARG A HA   7  
ATOM 10954 H HB2  . ARG A 1 11  ? -237.641 -15.795 100.162 1.00 0.00 ? 11  ARG A HB2  7  
ATOM 10955 H HB3  . ARG A 1 11  ? -239.090 -16.799 100.244 1.00 0.00 ? 11  ARG A HB3  7  
ATOM 10956 H HG2  . ARG A 1 11  ? -240.497 -15.024 99.858  1.00 0.00 ? 11  ARG A HG2  7  
ATOM 10957 H HG3  . ARG A 1 11  ? -239.288 -13.844 100.336 1.00 0.00 ? 11  ARG A HG3  7  
ATOM 10958 H HD2  . ARG A 1 11  ? -239.597 -13.787 97.942  1.00 0.00 ? 11  ARG A HD2  7  
ATOM 10959 H HD3  . ARG A 1 11  ? -237.991 -14.381 98.344  1.00 0.00 ? 11  ARG A HD3  7  
ATOM 10960 H HE   . ARG A 1 11  ? -238.861 -16.657 97.875  1.00 0.00 ? 11  ARG A HE   7  
ATOM 10961 H HH11 . ARG A 1 11  ? -240.553 -13.889 96.557  1.00 0.00 ? 11  ARG A HH11 7  
ATOM 10962 H HH12 . ARG A 1 11  ? -241.183 -14.757 95.195  1.00 0.00 ? 11  ARG A HH12 7  
ATOM 10963 H HH21 . ARG A 1 11  ? -239.685 -17.808 96.069  1.00 0.00 ? 11  ARG A HH21 7  
ATOM 10964 H HH22 . ARG A 1 11  ? -240.684 -16.979 94.905  1.00 0.00 ? 11  ARG A HH22 7  
ATOM 10965 N N    . VAL A 1 12  ? -240.921 -16.118 102.848 1.00 0.00 ? 12  VAL A N    7  
ATOM 10966 C CA   . VAL A 1 12  ? -241.965 -16.902 103.493 1.00 0.00 ? 12  VAL A CA   7  
ATOM 10967 C C    . VAL A 1 12  ? -243.248 -16.873 102.655 1.00 0.00 ? 12  VAL A C    7  
ATOM 10968 O O    . VAL A 1 12  ? -243.775 -15.803 102.342 1.00 0.00 ? 12  VAL A O    7  
ATOM 10969 C CB   . VAL A 1 12  ? -242.225 -16.394 104.935 1.00 0.00 ? 12  VAL A CB   7  
ATOM 10970 C CG1  . VAL A 1 12  ? -242.355 -14.878 104.964 1.00 0.00 ? 12  VAL A CG1  7  
ATOM 10971 C CG2  . VAL A 1 12  ? -243.460 -17.053 105.534 1.00 0.00 ? 12  VAL A CG2  7  
ATOM 10972 H H    . VAL A 1 12  ? -241.131 -15.200 102.556 1.00 0.00 ? 12  VAL A H    7  
ATOM 10973 H HA   . VAL A 1 12  ? -241.616 -17.923 103.553 1.00 0.00 ? 12  VAL A HA   7  
ATOM 10974 H HB   . VAL A 1 12  ? -241.373 -16.664 105.544 1.00 0.00 ? 12  VAL A HB   7  
ATOM 10975 H HG11 . VAL A 1 12  ? -243.147 -14.570 104.298 1.00 0.00 ? 12  VAL A HG11 7  
ATOM 10976 H HG12 . VAL A 1 12  ? -242.579 -14.553 105.968 1.00 0.00 ? 12  VAL A HG12 7  
ATOM 10977 H HG13 . VAL A 1 12  ? -241.421 -14.434 104.639 1.00 0.00 ? 12  VAL A HG13 7  
ATOM 10978 H HG21 . VAL A 1 12  ? -243.320 -18.123 105.559 1.00 0.00 ? 12  VAL A HG21 7  
ATOM 10979 H HG22 . VAL A 1 12  ? -243.613 -16.686 106.539 1.00 0.00 ? 12  VAL A HG22 7  
ATOM 10980 H HG23 . VAL A 1 12  ? -244.324 -16.816 104.930 1.00 0.00 ? 12  VAL A HG23 7  
ATOM 10981 N N    . THR A 1 13  ? -243.719 -18.050 102.252 1.00 0.00 ? 13  THR A N    7  
ATOM 10982 C CA   . THR A 1 13  ? -244.868 -18.149 101.362 1.00 0.00 ? 13  THR A CA   7  
ATOM 10983 C C    . THR A 1 13  ? -246.157 -17.847 102.130 1.00 0.00 ? 13  THR A C    7  
ATOM 10984 O O    . THR A 1 13  ? -246.427 -18.465 103.161 1.00 0.00 ? 13  THR A O    7  
ATOM 10985 C CB   . THR A 1 13  ? -244.997 -19.567 100.774 1.00 0.00 ? 13  THR A CB   7  
ATOM 10986 O OG1  . THR A 1 13  ? -243.728 -20.008 100.271 1.00 0.00 ? 13  THR A OG1  7  
ATOM 10987 C CG2  . THR A 1 13  ? -246.043 -19.592 99.661  1.00 0.00 ? 13  THR A CG2  7  
ATOM 10988 H H    . THR A 1 13  ? -243.284 -18.871 102.560 1.00 0.00 ? 13  THR A H    7  
ATOM 10989 H HA   . THR A 1 13  ? -244.723 -17.437 100.532 1.00 0.00 ? 13  THR A HA   7  
ATOM 10990 H HB   . THR A 1 13  ? -245.315 -20.236 101.561 1.00 0.00 ? 13  THR A HB   7  
ATOM 10991 H HG1  . THR A 1 13  ? -243.753 -20.033 99.311  1.00 0.00 ? 13  THR A HG1  7  
ATOM 10992 H HG21 . THR A 1 13  ? -245.762 -18.888 98.891  1.00 0.00 ? 13  THR A HG21 7  
ATOM 10993 H HG22 . THR A 1 13  ? -246.104 -20.584 99.240  1.00 0.00 ? 13  THR A HG22 7  
ATOM 10994 H HG23 . THR A 1 13  ? -247.009 -19.311 100.064 1.00 0.00 ? 13  THR A HG23 7  
ATOM 10995 N N    . VAL A 1 14  ? -246.950 -16.917 101.636 1.00 0.00 ? 14  VAL A N    7  
ATOM 10996 C CA   . VAL A 1 14  ? -248.179 -16.531 102.311 1.00 0.00 ? 14  VAL A CA   7  
ATOM 10997 C C    . VAL A 1 14  ? -249.404 -16.817 101.435 1.00 0.00 ? 14  VAL A C    7  
ATOM 10998 O O    . VAL A 1 14  ? -249.420 -16.503 100.246 1.00 0.00 ? 14  VAL A O    7  
ATOM 10999 C CB   . VAL A 1 14  ? -248.098 -15.042 102.723 1.00 0.00 ? 14  VAL A CB   7  
ATOM 11000 C CG1  . VAL A 1 14  ? -249.448 -14.476 103.138 1.00 0.00 ? 14  VAL A CG1  7  
ATOM 11001 C CG2  . VAL A 1 14  ? -247.091 -14.884 103.849 1.00 0.00 ? 14  VAL A CG2  7  
ATOM 11002 H H    . VAL A 1 14  ? -246.702 -16.464 100.797 1.00 0.00 ? 14  VAL A H    7  
ATOM 11003 H HA   . VAL A 1 14  ? -248.255 -17.123 103.211 1.00 0.00 ? 14  VAL A HA   7  
ATOM 11004 H HB   . VAL A 1 14  ? -247.743 -14.477 101.877 1.00 0.00 ? 14  VAL A HB   7  
ATOM 11005 H HG11 . VAL A 1 14  ? -249.929 -15.149 103.829 1.00 0.00 ? 14  VAL A HG11 7  
ATOM 11006 H HG12 . VAL A 1 14  ? -249.295 -13.515 103.612 1.00 0.00 ? 14  VAL A HG12 7  
ATOM 11007 H HG13 . VAL A 1 14  ? -250.066 -14.342 102.258 1.00 0.00 ? 14  VAL A HG13 7  
ATOM 11008 H HG21 . VAL A 1 14  ? -247.401 -15.478 104.696 1.00 0.00 ? 14  VAL A HG21 7  
ATOM 11009 H HG22 . VAL A 1 14  ? -246.119 -15.215 103.513 1.00 0.00 ? 14  VAL A HG22 7  
ATOM 11010 H HG23 . VAL A 1 14  ? -247.036 -13.845 104.139 1.00 0.00 ? 14  VAL A HG23 7  
ATOM 11011 N N    . HIS A 1 15  ? -250.413 -17.456 102.027 1.00 0.00 ? 15  HIS A N    7  
ATOM 11012 C CA   . HIS A 1 15  ? -251.626 -17.852 101.305 1.00 0.00 ? 15  HIS A CA   7  
ATOM 11013 C C    . HIS A 1 15  ? -252.744 -16.829 101.467 1.00 0.00 ? 15  HIS A C    7  
ATOM 11014 O O    . HIS A 1 15  ? -253.687 -16.797 100.681 1.00 0.00 ? 15  HIS A O    7  
ATOM 11015 C CB   . HIS A 1 15  ? -252.109 -19.219 101.806 1.00 0.00 ? 15  HIS A CB   7  
ATOM 11016 C CG   . HIS A 1 15  ? -251.541 -20.371 101.041 1.00 0.00 ? 15  HIS A CG   7  
ATOM 11017 N ND1  . HIS A 1 15  ? -252.146 -20.912 99.925  1.00 0.00 ? 15  HIS A ND1  7  
ATOM 11018 C CD2  . HIS A 1 15  ? -250.406 -21.083 101.232 1.00 0.00 ? 15  HIS A CD2  7  
ATOM 11019 C CE1  . HIS A 1 15  ? -251.404 -21.903 99.465  1.00 0.00 ? 15  HIS A CE1  7  
ATOM 11020 N NE2  . HIS A 1 15  ? -250.345 -22.025 100.240 1.00 0.00 ? 15  HIS A NE2  7  
ATOM 11021 H H    . HIS A 1 15  ? -250.334 -17.685 102.981 1.00 0.00 ? 15  HIS A H    7  
ATOM 11022 H HA   . HIS A 1 15  ? -251.378 -17.932 100.259 1.00 0.00 ? 15  HIS A HA   7  
ATOM 11023 H HB2  . HIS A 1 15  ? -251.806 -19.331 102.835 1.00 0.00 ? 15  HIS A HB2  7  
ATOM 11024 H HB3  . HIS A 1 15  ? -253.187 -19.267 101.752 1.00 0.00 ? 15  HIS A HB3  7  
ATOM 11025 H HD1  . HIS A 1 15  ? -253.005 -20.616 99.533  1.00 0.00 ? 15  HIS A HD1  7  
ATOM 11026 H HD2  . HIS A 1 15  ? -249.683 -20.934 102.020 1.00 0.00 ? 15  HIS A HD2  7  
ATOM 11027 H HE1  . HIS A 1 15  ? -251.617 -22.500 98.593  1.00 0.00 ? 15  HIS A HE1  7  
ATOM 11028 H HE2  . HIS A 1 15  ? -249.642 -22.718 100.143 1.00 0.00 ? 15  HIS A HE2  7  
ATOM 11029 N N    . GLY A 1 16  ? -252.628 -15.987 102.475 1.00 0.00 ? 16  GLY A N    7  
ATOM 11030 C CA   . GLY A 1 16  ? -253.696 -15.046 102.774 1.00 0.00 ? 16  GLY A CA   7  
ATOM 11031 C C    . GLY A 1 16  ? -253.385 -13.643 102.300 1.00 0.00 ? 16  GLY A C    7  
ATOM 11032 O O    . GLY A 1 16  ? -253.891 -12.665 102.846 1.00 0.00 ? 16  GLY A O    7  
ATOM 11033 H H    . GLY A 1 16  ? -251.808 -15.994 103.011 1.00 0.00 ? 16  GLY A H    7  
ATOM 11034 H HA2  . GLY A 1 16  ? -254.603 -15.389 102.300 1.00 0.00 ? 16  GLY A HA2  7  
ATOM 11035 H HA3  . GLY A 1 16  ? -253.851 -15.024 103.843 1.00 0.00 ? 16  GLY A HA3  7  
ATOM 11036 N N    . VAL A 1 17  ? -252.558 -13.550 101.272 1.00 0.00 ? 17  VAL A N    7  
ATOM 11037 C CA   . VAL A 1 17  ? -252.051 -12.275 100.800 1.00 0.00 ? 17  VAL A CA   7  
ATOM 11038 C C    . VAL A 1 17  ? -253.164 -11.368 100.266 1.00 0.00 ? 17  VAL A C    7  
ATOM 11039 O O    . VAL A 1 17  ? -254.221 -11.839 99.844  1.00 0.00 ? 17  VAL A O    7  
ATOM 11040 C CB   . VAL A 1 17  ? -250.990 -12.481 99.698  1.00 0.00 ? 17  VAL A CB   7  
ATOM 11041 C CG1  . VAL A 1 17  ? -249.962 -13.502 100.125 1.00 0.00 ? 17  VAL A CG1  7  
ATOM 11042 C CG2  . VAL A 1 17  ? -251.630 -12.884 98.376  1.00 0.00 ? 17  VAL A CG2  7  
ATOM 11043 H H    . VAL A 1 17  ? -252.291 -14.362 100.806 1.00 0.00 ? 17  VAL A H    7  
ATOM 11044 H HA   . VAL A 1 17  ? -251.574 -11.783 101.633 1.00 0.00 ? 17  VAL A HA   7  
ATOM 11045 H HB   . VAL A 1 17  ? -250.477 -11.553 99.559  1.00 0.00 ? 17  VAL A HB   7  
ATOM 11046 H HG11 . VAL A 1 17  ? -250.450 -14.445 100.321 1.00 0.00 ? 17  VAL A HG11 7  
ATOM 11047 H HG12 . VAL A 1 17  ? -249.232 -13.630 99.340  1.00 0.00 ? 17  VAL A HG12 7  
ATOM 11048 H HG13 . VAL A 1 17  ? -249.468 -13.161 101.024 1.00 0.00 ? 17  VAL A HG13 7  
ATOM 11049 H HG21 . VAL A 1 17  ? -252.337 -12.126 98.073  1.00 0.00 ? 17  VAL A HG21 7  
ATOM 11050 H HG22 . VAL A 1 17  ? -250.864 -12.982 97.621  1.00 0.00 ? 17  VAL A HG22 7  
ATOM 11051 H HG23 . VAL A 1 17  ? -252.141 -13.827 98.497  1.00 0.00 ? 17  VAL A HG23 7  
ATOM 11052 N N    . PRO A 1 18  ? -252.927 -10.047 100.287 1.00 0.00 ? 18  PRO A N    7  
ATOM 11053 C CA   . PRO A 1 18  ? -253.851 -9.055  99.719  1.00 0.00 ? 18  PRO A CA   7  
ATOM 11054 C C    . PRO A 1 18  ? -253.696 -8.965  98.217  1.00 0.00 ? 18  PRO A C    7  
ATOM 11055 O O    . PRO A 1 18  ? -254.549 -8.451  97.489  1.00 0.00 ? 18  PRO A O    7  
ATOM 11056 C CB   . PRO A 1 18  ? -253.381 -7.762  100.373 1.00 0.00 ? 18  PRO A CB   7  
ATOM 11057 C CG   . PRO A 1 18  ? -251.912 -7.963  100.492 1.00 0.00 ? 18  PRO A CG   7  
ATOM 11058 C CD   . PRO A 1 18  ? -251.741 -9.405  100.882 1.00 0.00 ? 18  PRO A CD   7  
ATOM 11059 H HA   . PRO A 1 18  ? -254.861 -9.263  99.967  1.00 0.00 ? 18  PRO A HA   7  
ATOM 11060 H HB2  . PRO A 1 18  ? -253.622 -6.919  99.738  1.00 0.00 ? 18  PRO A HB2  7  
ATOM 11061 H HB3  . PRO A 1 18  ? -253.847 -7.644  101.340 1.00 0.00 ? 18  PRO A HB3  7  
ATOM 11062 H HG2  . PRO A 1 18  ? -251.437 -7.774  99.541  1.00 0.00 ? 18  PRO A HG2  7  
ATOM 11063 H HG3  . PRO A 1 18  ? -251.508 -7.325  101.243 1.00 0.00 ? 18  PRO A HG3  7  
ATOM 11064 H HD2  . PRO A 1 18  ? -250.830 -9.806  100.462 1.00 0.00 ? 18  PRO A HD2  7  
ATOM 11065 H HD3  . PRO A 1 18  ? -251.746 -9.512  101.956 1.00 0.00 ? 18  PRO A HD3  7  
ATOM 11066 N N    . GLY A 1 19  ? -252.560 -9.458  97.809  1.00 0.00 ? 19  GLY A N    7  
ATOM 11067 C CA   . GLY A 1 19  ? -252.180 -9.532  96.409  1.00 0.00 ? 19  GLY A CA   7  
ATOM 11068 C C    . GLY A 1 19  ? -253.179 -10.271 95.541  1.00 0.00 ? 19  GLY A C    7  
ATOM 11069 O O    . GLY A 1 19  ? -254.070 -10.961 96.046  1.00 0.00 ? 19  GLY A O    7  
ATOM 11070 H H    . GLY A 1 19  ? -251.949 -9.765  98.504  1.00 0.00 ? 19  GLY A H    7  
ATOM 11071 H HA2  . GLY A 1 19  ? -252.064 -8.537  96.019  1.00 0.00 ? 19  GLY A HA2  7  
ATOM 11072 H HA3  . GLY A 1 19  ? -251.229 -10.040 96.342  1.00 0.00 ? 19  GLY A HA3  7  
ATOM 11073 N N    . PRO A 1 20  ? -253.044 -10.136 94.219  1.00 0.00 ? 20  PRO A N    7  
ATOM 11074 C CA   . PRO A 1 20  ? -253.904 -10.815 93.250  1.00 0.00 ? 20  PRO A CA   7  
ATOM 11075 C C    . PRO A 1 20  ? -253.666 -12.312 93.271  1.00 0.00 ? 20  PRO A C    7  
ATOM 11076 O O    . PRO A 1 20  ? -254.576 -13.115 93.048  1.00 0.00 ? 20  PRO A O    7  
ATOM 11077 C CB   . PRO A 1 20  ? -253.451 -10.229 91.913  1.00 0.00 ? 20  PRO A CB   7  
ATOM 11078 C CG   . PRO A 1 20  ? -252.041 -9.835  92.154  1.00 0.00 ? 20  PRO A CG   7  
ATOM 11079 C CD   . PRO A 1 20  ? -252.019 -9.318  93.554  1.00 0.00 ? 20  PRO A CD   7  
ATOM 11080 H HA   . PRO A 1 20  ? -254.943 -10.599 93.420  1.00 0.00 ? 20  PRO A HA   7  
ATOM 11081 H HB2  . PRO A 1 20  ? -253.525 -10.979 91.145  1.00 0.00 ? 20  PRO A HB2  7  
ATOM 11082 H HB3  . PRO A 1 20  ? -254.062 -9.375  91.662  1.00 0.00 ? 20  PRO A HB3  7  
ATOM 11083 H HG2  . PRO A 1 20  ? -251.395 -10.698 92.062  1.00 0.00 ? 20  PRO A HG2  7  
ATOM 11084 H HG3  . PRO A 1 20  ? -251.746 -9.072  91.470  1.00 0.00 ? 20  PRO A HG3  7  
ATOM 11085 H HD2  . PRO A 1 20  ? -251.058 -9.481  93.998  1.00 0.00 ? 20  PRO A HD2  7  
ATOM 11086 H HD3  . PRO A 1 20  ? -252.283 -8.273  93.579  1.00 0.00 ? 20  PRO A HD3  7  
ATOM 11087 N N    . GLU A 1 21  ? -252.423 -12.662 93.555  1.00 0.00 ? 21  GLU A N    7  
ATOM 11088 C CA   . GLU A 1 21  ? -251.990 -14.051 93.614  1.00 0.00 ? 21  GLU A CA   7  
ATOM 11089 C C    . GLU A 1 21  ? -252.654 -14.771 94.781  1.00 0.00 ? 21  GLU A C    7  
ATOM 11090 O O    . GLU A 1 21  ? -253.057 -14.154 95.766  1.00 0.00 ? 21  GLU A O    7  
ATOM 11091 C CB   . GLU A 1 21  ? -250.461 -14.110 93.732  1.00 0.00 ? 21  GLU A CB   7  
ATOM 11092 C CG   . GLU A 1 21  ? -249.753 -13.075 92.864  1.00 0.00 ? 21  GLU A CG   7  
ATOM 11093 C CD   . GLU A 1 21  ? -248.253 -13.284 92.770  1.00 0.00 ? 21  GLU A CD   7  
ATOM 11094 O OE1  . GLU A 1 21  ? -247.529 -12.917 93.717  1.00 0.00 ? 21  GLU A OE1  7  
ATOM 11095 O OE2  . GLU A 1 21  ? -247.786 -13.807 91.735  1.00 0.00 ? 21  GLU A OE2  7  
ATOM 11096 H H    . GLU A 1 21  ? -251.766 -11.945 93.729  1.00 0.00 ? 21  GLU A H    7  
ATOM 11097 H HA   . GLU A 1 21  ? -252.293 -14.550 92.700  1.00 0.00 ? 21  GLU A HA   7  
ATOM 11098 H HB2  . GLU A 1 21  ? -250.181 -13.953 94.765  1.00 0.00 ? 21  GLU A HB2  7  
ATOM 11099 H HB3  . GLU A 1 21  ? -250.131 -15.088 93.427  1.00 0.00 ? 21  GLU A HB3  7  
ATOM 11100 H HG2  . GLU A 1 21  ? -250.165 -13.123 91.868  1.00 0.00 ? 21  GLU A HG2  7  
ATOM 11101 H HG3  . GLU A 1 21  ? -249.939 -12.093 93.277  1.00 0.00 ? 21  GLU A HG3  7  
ATOM 11102 N N    . PRO A 1 22  ? -252.778 -16.088 94.663  1.00 0.00 ? 22  PRO A N    7  
ATOM 11103 C CA   . PRO A 1 22  ? -253.464 -16.921 95.644  1.00 0.00 ? 22  PRO A CA   7  
ATOM 11104 C C    . PRO A 1 22  ? -252.542 -17.253 96.789  1.00 0.00 ? 22  PRO A C    7  
ATOM 11105 O O    . PRO A 1 22  ? -252.943 -17.395 97.944  1.00 0.00 ? 22  PRO A O    7  
ATOM 11106 C CB   . PRO A 1 22  ? -253.799 -18.190 94.863  1.00 0.00 ? 22  PRO A CB   7  
ATOM 11107 C CG   . PRO A 1 22  ? -253.145 -18.048 93.524  1.00 0.00 ? 22  PRO A CG   7  
ATOM 11108 C CD   . PRO A 1 22  ? -252.227 -16.882 93.568  1.00 0.00 ? 22  PRO A CD   7  
ATOM 11109 H HA   . PRO A 1 22  ? -254.364 -16.460 96.006  1.00 0.00 ? 22  PRO A HA   7  
ATOM 11110 H HB2  . PRO A 1 22  ? -253.415 -19.048 95.396  1.00 0.00 ? 22  PRO A HB2  7  
ATOM 11111 H HB3  . PRO A 1 22  ? -254.873 -18.277 94.768  1.00 0.00 ? 22  PRO A HB3  7  
ATOM 11112 H HG2  . PRO A 1 22  ? -252.597 -18.936 93.288  1.00 0.00 ? 22  PRO A HG2  7  
ATOM 11113 H HG3  . PRO A 1 22  ? -253.883 -17.867 92.792  1.00 0.00 ? 22  PRO A HG3  7  
ATOM 11114 H HD2  . PRO A 1 22  ? -251.219 -17.196 93.770  1.00 0.00 ? 22  PRO A HD2  7  
ATOM 11115 H HD3  . PRO A 1 22  ? -252.273 -16.337 92.639  1.00 0.00 ? 22  PRO A HD3  7  
ATOM 11116 N N    . PHE A 1 23  ? -251.299 -17.393 96.413  1.00 0.00 ? 23  PHE A N    7  
ATOM 11117 C CA   . PHE A 1 23  ? -250.208 -17.609 97.345  1.00 0.00 ? 23  PHE A CA   7  
ATOM 11118 C C    . PHE A 1 23  ? -248.956 -16.969 96.781  1.00 0.00 ? 23  PHE A C    7  
ATOM 11119 O O    . PHE A 1 23  ? -248.619 -17.164 95.615  1.00 0.00 ? 23  PHE A O    7  
ATOM 11120 C CB   . PHE A 1 23  ? -249.985 -19.108 97.617  1.00 0.00 ? 23  PHE A CB   7  
ATOM 11121 C CG   . PHE A 1 23  ? -249.575 -19.916 96.414  1.00 0.00 ? 23  PHE A CG   7  
ATOM 11122 C CD1  . PHE A 1 23  ? -250.516 -20.348 95.494  1.00 0.00 ? 23  PHE A CD1  7  
ATOM 11123 C CD2  . PHE A 1 23  ? -248.242 -20.251 96.208  1.00 0.00 ? 23  PHE A CD2  7  
ATOM 11124 C CE1  . PHE A 1 23  ? -250.140 -21.094 94.394  1.00 0.00 ? 23  PHE A CE1  7  
ATOM 11125 C CE2  . PHE A 1 23  ? -247.861 -20.998 95.110  1.00 0.00 ? 23  PHE A CE2  7  
ATOM 11126 C CZ   . PHE A 1 23  ? -248.812 -21.419 94.202  1.00 0.00 ? 23  PHE A CZ   7  
ATOM 11127 H H    . PHE A 1 23  ? -251.109 -17.329 95.442  1.00 0.00 ? 23  PHE A H    7  
ATOM 11128 H HA   . PHE A 1 23  ? -250.460 -17.116 98.277  1.00 0.00 ? 23  PHE A HA   7  
ATOM 11129 H HB2  . PHE A 1 23  ? -249.209 -19.215 98.360  1.00 0.00 ? 23  PHE A HB2  7  
ATOM 11130 H HB3  . PHE A 1 23  ? -250.900 -19.534 98.005  1.00 0.00 ? 23  PHE A HB3  7  
ATOM 11131 H HD1  . PHE A 1 23  ? -251.557 -20.095 95.642  1.00 0.00 ? 23  PHE A HD1  7  
ATOM 11132 H HD2  . PHE A 1 23  ? -247.499 -19.922 96.917  1.00 0.00 ? 23  PHE A HD2  7  
ATOM 11133 H HE1  . PHE A 1 23  ? -250.883 -21.424 93.684  1.00 0.00 ? 23  PHE A HE1  7  
ATOM 11134 H HE2  . PHE A 1 23  ? -246.823 -21.249 94.962  1.00 0.00 ? 23  PHE A HE2  7  
ATOM 11135 H HZ   . PHE A 1 23  ? -248.517 -22.003 93.343  1.00 0.00 ? 23  PHE A HZ   7  
ATOM 11136 N N    . THR A 1 24  ? -248.293 -16.172 97.588  1.00 0.00 ? 24  THR A N    7  
ATOM 11137 C CA   . THR A 1 24  ? -247.085 -15.511 97.151  1.00 0.00 ? 24  THR A CA   7  
ATOM 11138 C C    . THR A 1 24  ? -246.137 -15.331 98.329  1.00 0.00 ? 24  THR A C    7  
ATOM 11139 O O    . THR A 1 24  ? -246.563 -15.230 99.477  1.00 0.00 ? 24  THR A O    7  
ATOM 11140 C CB   . THR A 1 24  ? -247.397 -14.165 96.457  1.00 0.00 ? 24  THR A CB   7  
ATOM 11141 O OG1  . THR A 1 24  ? -246.203 -13.566 95.949  1.00 0.00 ? 24  THR A OG1  7  
ATOM 11142 C CG2  . THR A 1 24  ? -248.090 -13.197 97.393  1.00 0.00 ? 24  THR A CG2  7  
ATOM 11143 H H    . THR A 1 24  ? -248.620 -16.025 98.504  1.00 0.00 ? 24  THR A H    7  
ATOM 11144 H HA   . THR A 1 24  ? -246.608 -16.157 96.428  1.00 0.00 ? 24  THR A HA   7  
ATOM 11145 H HB   . THR A 1 24  ? -248.060 -14.365 95.627  1.00 0.00 ? 24  THR A HB   7  
ATOM 11146 H HG1  . THR A 1 24  ? -246.362 -13.294 95.032  1.00 0.00 ? 24  THR A HG1  7  
ATOM 11147 H HG21 . THR A 1 24  ? -249.012 -13.634 97.745  1.00 0.00 ? 24  THR A HG21 7  
ATOM 11148 H HG22 . THR A 1 24  ? -247.447 -12.989 98.235  1.00 0.00 ? 24  THR A HG22 7  
ATOM 11149 H HG23 . THR A 1 24  ? -248.305 -12.278 96.867  1.00 0.00 ? 24  THR A HG23 7  
ATOM 11150 N N    . VAL A 1 25  ? -244.855 -15.319 98.030  1.00 0.00 ? 25  VAL A N    7  
ATOM 11151 C CA   . VAL A 1 25  ? -243.816 -15.402 99.043  1.00 0.00 ? 25  VAL A CA   7  
ATOM 11152 C C    . VAL A 1 25  ? -243.044 -14.084 99.116  1.00 0.00 ? 25  VAL A C    7  
ATOM 11153 O O    . VAL A 1 25  ? -242.550 -13.598 98.096  1.00 0.00 ? 25  VAL A O    7  
ATOM 11154 C CB   . VAL A 1 25  ? -242.846 -16.538 98.669  1.00 0.00 ? 25  VAL A CB   7  
ATOM 11155 C CG1  . VAL A 1 25  ? -241.953 -16.936 99.818  1.00 0.00 ? 25  VAL A CG1  7  
ATOM 11156 C CG2  . VAL A 1 25  ? -243.593 -17.737 98.110  1.00 0.00 ? 25  VAL A CG2  7  
ATOM 11157 H H    . VAL A 1 25  ? -244.589 -15.241 97.086  1.00 0.00 ? 25  VAL A H    7  
ATOM 11158 H HA   . VAL A 1 25  ? -244.264 -15.624 100.002 1.00 0.00 ? 25  VAL A HA   7  
ATOM 11159 H HB   . VAL A 1 25  ? -242.223 -16.170 97.904  1.00 0.00 ? 25  VAL A HB   7  
ATOM 11160 H HG11 . VAL A 1 25  ? -241.403 -16.070 100.159 1.00 0.00 ? 25  VAL A HG11 7  
ATOM 11161 H HG12 . VAL A 1 25  ? -242.553 -17.323 100.628 1.00 0.00 ? 25  VAL A HG12 7  
ATOM 11162 H HG13 . VAL A 1 25  ? -241.259 -17.696 99.489  1.00 0.00 ? 25  VAL A HG13 7  
ATOM 11163 H HG21 . VAL A 1 25  ? -244.299 -18.095 98.846  1.00 0.00 ? 25  VAL A HG21 7  
ATOM 11164 H HG22 . VAL A 1 25  ? -244.124 -17.446 97.216  1.00 0.00 ? 25  VAL A HG22 7  
ATOM 11165 H HG23 . VAL A 1 25  ? -242.891 -18.523 97.875  1.00 0.00 ? 25  VAL A HG23 7  
ATOM 11166 N N    . PHE A 1 26  ? -242.940 -13.499 100.303 1.00 0.00 ? 26  PHE A N    7  
ATOM 11167 C CA   . PHE A 1 26  ? -242.215 -12.233 100.455 1.00 0.00 ? 26  PHE A CA   7  
ATOM 11168 C C    . PHE A 1 26  ? -240.966 -12.426 101.283 1.00 0.00 ? 26  PHE A C    7  
ATOM 11169 O O    . PHE A 1 26  ? -240.943 -13.232 102.216 1.00 0.00 ? 26  PHE A O    7  
ATOM 11170 C CB   . PHE A 1 26  ? -243.083 -11.136 101.071 1.00 0.00 ? 26  PHE A CB   7  
ATOM 11171 C CG   . PHE A 1 26  ? -244.401 -10.954 100.378 1.00 0.00 ? 26  PHE A CG   7  
ATOM 11172 C CD1  . PHE A 1 26  ? -245.511 -11.694 100.753 1.00 0.00 ? 26  PHE A CD1  7  
ATOM 11173 C CD2  . PHE A 1 26  ? -244.525 -10.041 99.345  1.00 0.00 ? 26  PHE A CD2  7  
ATOM 11174 C CE1  . PHE A 1 26  ? -246.720 -11.522 100.110 1.00 0.00 ? 26  PHE A CE1  7  
ATOM 11175 C CE2  . PHE A 1 26  ? -245.731 -9.864  98.697  1.00 0.00 ? 26  PHE A CE2  7  
ATOM 11176 C CZ   . PHE A 1 26  ? -246.831 -10.605 99.080  1.00 0.00 ? 26  PHE A CZ   7  
ATOM 11177 H H    . PHE A 1 26  ? -243.338 -13.928 101.090 1.00 0.00 ? 26  PHE A H    7  
ATOM 11178 H HA   . PHE A 1 26  ? -241.914 -11.921 99.472  1.00 0.00 ? 26  PHE A HA   7  
ATOM 11179 H HB2  . PHE A 1 26  ? -243.265 -11.355 102.107 1.00 0.00 ? 26  PHE A HB2  7  
ATOM 11180 H HB3  . PHE A 1 26  ? -242.548 -10.199 101.006 1.00 0.00 ? 26  PHE A HB3  7  
ATOM 11181 H HD1  . PHE A 1 26  ? -245.428 -12.407 101.565 1.00 0.00 ? 26  PHE A HD1  7  
ATOM 11182 H HD2  . PHE A 1 26  ? -243.663 -9.462  99.047  1.00 0.00 ? 26  PHE A HD2  7  
ATOM 11183 H HE1  . PHE A 1 26  ? -247.580 -12.102 100.410 1.00 0.00 ? 26  PHE A HE1  7  
ATOM 11184 H HE2  . PHE A 1 26  ? -245.813 -9.149  97.893  1.00 0.00 ? 26  PHE A HE2  7  
ATOM 11185 H HZ   . PHE A 1 26  ? -247.776 -10.469 98.576  1.00 0.00 ? 26  PHE A HZ   7  
ATOM 11186 N N    . THR A 1 27  ? -239.924 -11.697 100.926 1.00 0.00 ? 27  THR A N    7  
ATOM 11187 C CA   . THR A 1 27  ? -238.630 -11.876 101.545 1.00 0.00 ? 27  THR A CA   7  
ATOM 11188 C C    . THR A 1 27  ? -238.495 -11.014 102.791 1.00 0.00 ? 27  THR A C    7  
ATOM 11189 O O    . THR A 1 27  ? -238.989 -9.889  102.843 1.00 0.00 ? 27  THR A O    7  
ATOM 11190 C CB   . THR A 1 27  ? -237.495 -11.539 100.564 1.00 0.00 ? 27  THR A CB   7  
ATOM 11191 O OG1  . THR A 1 27  ? -237.942 -11.743 99.215  1.00 0.00 ? 27  THR A OG1  7  
ATOM 11192 C CG2  . THR A 1 27  ? -236.290 -12.427 100.830 1.00 0.00 ? 27  THR A CG2  7  
ATOM 11193 H H    . THR A 1 27  ? -240.031 -11.012 100.224 1.00 0.00 ? 27  THR A H    7  
ATOM 11194 H HA   . THR A 1 27  ? -238.537 -12.916 101.826 1.00 0.00 ? 27  THR A HA   7  
ATOM 11195 H HB   . THR A 1 27  ? -237.208 -10.509 100.695 1.00 0.00 ? 27  THR A HB   7  
ATOM 11196 H HG1  . THR A 1 27  ? -237.489 -11.117 98.630  1.00 0.00 ? 27  THR A HG1  7  
ATOM 11197 H HG21 . THR A 1 27  ? -236.590 -13.463 100.755 1.00 0.00 ? 27  THR A HG21 7  
ATOM 11198 H HG22 . THR A 1 27  ? -235.522 -12.218 100.100 1.00 0.00 ? 27  THR A HG22 7  
ATOM 11199 H HG23 . THR A 1 27  ? -235.907 -12.233 101.824 1.00 0.00 ? 27  THR A HG23 7  
ATOM 11200 N N    . ILE A 1 28  ? -237.833 -11.561 103.794 1.00 0.00 ? 28  ILE A N    7  
ATOM 11201 C CA   . ILE A 1 28  ? -237.614 -10.861 105.043 1.00 0.00 ? 28  ILE A CA   7  
ATOM 11202 C C    . ILE A 1 28  ? -236.151 -10.459 105.163 1.00 0.00 ? 28  ILE A C    7  
ATOM 11203 O O    . ILE A 1 28  ? -235.380 -10.674 104.234 1.00 0.00 ? 28  ILE A O    7  
ATOM 11204 C CB   . ILE A 1 28  ? -238.025 -11.738 106.236 1.00 0.00 ? 28  ILE A CB   7  
ATOM 11205 C CG1  . ILE A 1 28  ? -236.984 -12.820 106.515 1.00 0.00 ? 28  ILE A CG1  7  
ATOM 11206 C CG2  . ILE A 1 28  ? -239.378 -12.373 105.943 1.00 0.00 ? 28  ILE A CG2  7  
ATOM 11207 C CD1  . ILE A 1 28  ? -237.303 -13.659 107.723 1.00 0.00 ? 28  ILE A CD1  7  
ATOM 11208 H H    . ILE A 1 28  ? -237.491 -12.476 103.694 1.00 0.00 ? 28  ILE A H    7  
ATOM 11209 H HA   . ILE A 1 28  ? -238.228 -9.980  105.050 1.00 0.00 ? 28  ILE A HA   7  
ATOM 11210 H HB   . ILE A 1 28  ? -238.126 -11.105 107.107 1.00 0.00 ? 28  ILE A HB   7  
ATOM 11211 H HG12 . ILE A 1 28  ? -236.926 -13.480 105.664 1.00 0.00 ? 28  ILE A HG12 7  
ATOM 11212 H HG13 . ILE A 1 28  ? -236.021 -12.355 106.677 1.00 0.00 ? 28  ILE A HG13 7  
ATOM 11213 H HG21 . ILE A 1 28  ? -240.053 -11.612 105.555 1.00 0.00 ? 28  ILE A HG21 7  
ATOM 11214 H HG22 . ILE A 1 28  ? -239.264 -13.158 105.211 1.00 0.00 ? 28  ILE A HG22 7  
ATOM 11215 H HG23 . ILE A 1 28  ? -239.787 -12.776 106.860 1.00 0.00 ? 28  ILE A HG23 7  
ATOM 11216 H HD11 . ILE A 1 28  ? -237.386 -13.018 108.587 1.00 0.00 ? 28  ILE A HD11 7  
ATOM 11217 H HD12 . ILE A 1 28  ? -238.239 -14.170 107.564 1.00 0.00 ? 28  ILE A HD12 7  
ATOM 11218 H HD13 . ILE A 1 28  ? -236.517 -14.380 107.882 1.00 0.00 ? 28  ILE A HD13 7  
ATOM 11219 N N    . ASN A 1 29  ? -235.774 -9.884  106.295 1.00 0.00 ? 29  ASN A N    7  
ATOM 11220 C CA   . ASN A 1 29  ? -234.398 -9.462  106.519 1.00 0.00 ? 29  ASN A CA   7  
ATOM 11221 C C    . ASN A 1 29  ? -234.160 -9.201  108.001 1.00 0.00 ? 29  ASN A C    7  
ATOM 11222 O O    . ASN A 1 29  ? -235.023 -8.652  108.686 1.00 0.00 ? 29  ASN A O    7  
ATOM 11223 C CB   . ASN A 1 29  ? -234.079 -8.201  105.711 1.00 0.00 ? 29  ASN A CB   7  
ATOM 11224 C CG   . ASN A 1 29  ? -232.645 -7.737  105.901 1.00 0.00 ? 29  ASN A CG   7  
ATOM 11225 O OD1  . ASN A 1 29  ? -231.747 -8.543  106.157 1.00 0.00 ? 29  ASN A OD1  7  
ATOM 11226 N ND2  . ASN A 1 29  ? -232.413 -6.440  105.767 1.00 0.00 ? 29  ASN A ND2  7  
ATOM 11227 H H    . ASN A 1 29  ? -236.431 -9.756  107.007 1.00 0.00 ? 29  ASN A H    7  
ATOM 11228 H HA   . ASN A 1 29  ? -233.750 -10.263 106.190 1.00 0.00 ? 29  ASN A HA   7  
ATOM 11229 H HB2  . ASN A 1 29  ? -234.237 -8.404  104.660 1.00 0.00 ? 29  ASN A HB2  7  
ATOM 11230 H HB3  . ASN A 1 29  ? -234.739 -7.404  106.022 1.00 0.00 ? 29  ASN A HB3  7  
ATOM 11231 H HD21 . ASN A 1 29  ? -233.174 -5.849  105.548 1.00 0.00 ? 29  ASN A HD21 7  
ATOM 11232 H HD22 . ASN A 1 29  ? -231.497 -6.117  105.895 1.00 0.00 ? 29  ASN A HD22 7  
ATOM 11233 N N    . GLY A 1 30  ? -232.995 -9.609  108.489 1.00 0.00 ? 30  GLY A N    7  
ATOM 11234 C CA   . GLY A 1 30  ? -232.617 -9.351  109.869 1.00 0.00 ? 30  GLY A CA   7  
ATOM 11235 C C    . GLY A 1 30  ? -233.469 -10.101 110.873 1.00 0.00 ? 30  GLY A C    7  
ATOM 11236 O O    . GLY A 1 30  ? -233.564 -9.703  112.036 1.00 0.00 ? 30  GLY A O    7  
ATOM 11237 H H    . GLY A 1 30  ? -232.376 -10.093 107.898 1.00 0.00 ? 30  GLY A H    7  
ATOM 11238 H HA2  . GLY A 1 30  ? -231.586 -9.640  110.005 1.00 0.00 ? 30  GLY A HA2  7  
ATOM 11239 H HA3  . GLY A 1 30  ? -232.707 -8.290  110.061 1.00 0.00 ? 30  GLY A HA3  7  
ATOM 11240 N N    . GLY A 1 31  ? -234.093 -11.180 110.428 1.00 0.00 ? 31  GLY A N    7  
ATOM 11241 C CA   . GLY A 1 31  ? -234.919 -11.975 111.312 1.00 0.00 ? 31  GLY A CA   7  
ATOM 11242 C C    . GLY A 1 31  ? -236.395 -11.696 111.128 1.00 0.00 ? 31  GLY A C    7  
ATOM 11243 O O    . GLY A 1 31  ? -237.149 -12.600 110.789 1.00 0.00 ? 31  GLY A O    7  
ATOM 11244 H H    . GLY A 1 31  ? -233.997 -11.435 109.488 1.00 0.00 ? 31  GLY A H    7  
ATOM 11245 H HA2  . GLY A 1 31  ? -234.733 -13.022 111.115 1.00 0.00 ? 31  GLY A HA2  7  
ATOM 11246 H HA3  . GLY A 1 31  ? -234.645 -11.760 112.336 1.00 0.00 ? 31  GLY A HA3  7  
ATOM 11247 N N    . THR A 1 32  ? -236.781 -10.427 111.319 1.00 0.00 ? 32  THR A N    7  
ATOM 11248 C CA   . THR A 1 32  ? -238.180 -9.966  111.243 1.00 0.00 ? 32  THR A CA   7  
ATOM 11249 C C    . THR A 1 32  ? -239.166 -10.811 112.044 1.00 0.00 ? 32  THR A C    7  
ATOM 11250 O O    . THR A 1 32  ? -239.418 -11.974 111.727 1.00 0.00 ? 32  THR A O    7  
ATOM 11251 C CB   . THR A 1 32  ? -238.712 -9.879  109.809 1.00 0.00 ? 32  THR A CB   7  
ATOM 11252 O OG1  . THR A 1 32  ? -238.277 -11.005 109.050 1.00 0.00 ? 32  THR A OG1  7  
ATOM 11253 C CG2  . THR A 1 32  ? -238.276 -8.599  109.117 1.00 0.00 ? 32  THR A CG2  7  
ATOM 11254 H H    . THR A 1 32  ? -236.089 -9.763  111.513 1.00 0.00 ? 32  THR A H    7  
ATOM 11255 H HA   . THR A 1 32  ? -238.202 -8.969  111.639 1.00 0.00 ? 32  THR A HA   7  
ATOM 11256 H HB   . THR A 1 32  ? -239.802 -9.887  109.863 1.00 0.00 ? 32  THR A HB   7  
ATOM 11257 H HG1  . THR A 1 32  ? -238.087 -11.740 109.651 1.00 0.00 ? 32  THR A HG1  7  
ATOM 11258 H HG21 . THR A 1 32  ? -238.630 -7.748  109.680 1.00 0.00 ? 32  THR A HG21 7  
ATOM 11259 H HG22 . THR A 1 32  ? -237.199 -8.569  109.058 1.00 0.00 ? 32  THR A HG22 7  
ATOM 11260 H HG23 . THR A 1 32  ? -238.696 -8.574  108.119 1.00 0.00 ? 32  THR A HG23 7  
ATOM 11261 N N    . LYS A 1 33  ? -239.764 -10.222 113.065 1.00 0.00 ? 33  LYS A N    7  
ATOM 11262 C CA   . LYS A 1 33  ? -240.889 -10.865 113.708 1.00 0.00 ? 33  LYS A CA   7  
ATOM 11263 C C    . LYS A 1 33  ? -242.103 -10.772 112.789 1.00 0.00 ? 33  LYS A C    7  
ATOM 11264 O O    . LYS A 1 33  ? -242.070 -10.082 111.767 1.00 0.00 ? 33  LYS A O    7  
ATOM 11265 C CB   . LYS A 1 33  ? -241.190 -10.246 115.070 1.00 0.00 ? 33  LYS A CB   7  
ATOM 11266 C CG   . LYS A 1 33  ? -241.567 -8.796  114.984 1.00 0.00 ? 33  LYS A CG   7  
ATOM 11267 C CD   . LYS A 1 33  ? -241.475 -8.106  116.338 1.00 0.00 ? 33  LYS A CD   7  
ATOM 11268 C CE   . LYS A 1 33  ? -240.080 -8.211  116.937 1.00 0.00 ? 33  LYS A CE   7  
ATOM 11269 N NZ   . LYS A 1 33  ? -240.016 -7.620  118.300 1.00 0.00 ? 33  LYS A NZ   7  
ATOM 11270 H H    . LYS A 1 33  ? -239.443 -9.354  113.385 1.00 0.00 ? 33  LYS A H    7  
ATOM 11271 H HA   . LYS A 1 33  ? -240.637 -11.899 113.844 1.00 0.00 ? 33  LYS A HA   7  
ATOM 11272 H HB2  . LYS A 1 33  ? -242.007 -10.784 115.527 1.00 0.00 ? 33  LYS A HB2  7  
ATOM 11273 H HB3  . LYS A 1 33  ? -240.313 -10.334 115.694 1.00 0.00 ? 33  LYS A HB3  7  
ATOM 11274 H HG2  . LYS A 1 33  ? -240.908 -8.324  114.286 1.00 0.00 ? 33  LYS A HG2  7  
ATOM 11275 H HG3  . LYS A 1 33  ? -242.584 -8.722  114.623 1.00 0.00 ? 33  LYS A HG3  7  
ATOM 11276 H HD2  . LYS A 1 33  ? -241.723 -7.061  116.217 1.00 0.00 ? 33  LYS A HD2  7  
ATOM 11277 H HD3  . LYS A 1 33  ? -242.182 -8.567  117.014 1.00 0.00 ? 33  LYS A HD3  7  
ATOM 11278 H HE2  . LYS A 1 33  ? -239.802 -9.253  116.992 1.00 0.00 ? 33  LYS A HE2  7  
ATOM 11279 H HE3  . LYS A 1 33  ? -239.386 -7.688  116.294 1.00 0.00 ? 33  LYS A HE3  7  
ATOM 11280 H HZ1  . LYS A 1 33  ? -240.790 -7.995  118.890 1.00 0.00 ? 33  LYS A HZ1  7  
ATOM 11281 H HZ2  . LYS A 1 33  ? -239.107 -7.854  118.750 1.00 0.00 ? 33  LYS A HZ2  7  
ATOM 11282 H HZ3  . LYS A 1 33  ? -240.106 -6.580  118.246 1.00 0.00 ? 33  LYS A HZ3  7  
ATOM 11283 N N    . ALA A 1 34  ? -243.176 -11.425 113.175 1.00 0.00 ? 34  ALA A N    7  
ATOM 11284 C CA   . ALA A 1 34  ? -244.317 -11.632 112.288 1.00 0.00 ? 34  ALA A CA   7  
ATOM 11285 C C    . ALA A 1 34  ? -245.044 -10.334 111.936 1.00 0.00 ? 34  ALA A C    7  
ATOM 11286 O O    . ALA A 1 34  ? -245.745 -10.266 110.934 1.00 0.00 ? 34  ALA A O    7  
ATOM 11287 C CB   . ALA A 1 34  ? -245.277 -12.613 112.924 1.00 0.00 ? 34  ALA A CB   7  
ATOM 11288 H H    . ALA A 1 34  ? -243.212 -11.770 114.090 1.00 0.00 ? 34  ALA A H    7  
ATOM 11289 H HA   . ALA A 1 34  ? -243.946 -12.077 111.374 1.00 0.00 ? 34  ALA A HA   7  
ATOM 11290 H HB1  . ALA A 1 34  ? -246.069 -12.844 112.228 1.00 0.00 ? 34  ALA A HB1  7  
ATOM 11291 H HB2  . ALA A 1 34  ? -245.699 -12.177 113.819 1.00 0.00 ? 34  ALA A HB2  7  
ATOM 11292 H HB3  . ALA A 1 34  ? -244.749 -13.519 113.182 1.00 0.00 ? 34  ALA A HB3  7  
ATOM 11293 N N    . LYS A 1 35  ? -244.878 -9.313  112.759 1.00 0.00 ? 35  LYS A N    7  
ATOM 11294 C CA   . LYS A 1 35  ? -245.611 -8.053  112.578 1.00 0.00 ? 35  LYS A CA   7  
ATOM 11295 C C    . LYS A 1 35  ? -244.932 -7.188  111.522 1.00 0.00 ? 35  LYS A C    7  
ATOM 11296 O O    . LYS A 1 35  ? -245.570 -6.723  110.569 1.00 0.00 ? 35  LYS A O    7  
ATOM 11297 C CB   . LYS A 1 35  ? -245.759 -7.309  113.913 1.00 0.00 ? 35  LYS A CB   7  
ATOM 11298 C CG   . LYS A 1 35  ? -244.446 -7.050  114.632 1.00 0.00 ? 35  LYS A CG   7  
ATOM 11299 C CD   . LYS A 1 35  ? -244.659 -6.569  116.062 1.00 0.00 ? 35  LYS A CD   7  
ATOM 11300 C CE   . LYS A 1 35  ? -245.419 -5.253  116.127 1.00 0.00 ? 35  LYS A CE   7  
ATOM 11301 N NZ   . LYS A 1 35  ? -245.608 -4.803  117.532 1.00 0.00 ? 35  LYS A NZ   7  
ATOM 11302 H H    . LYS A 1 35  ? -244.200 -9.384  113.457 1.00 0.00 ? 35  LYS A H    7  
ATOM 11303 H HA   . LYS A 1 35  ? -246.599 -8.308  112.212 1.00 0.00 ? 35  LYS A HA   7  
ATOM 11304 H HB2  . LYS A 1 35  ? -246.234 -6.357  113.729 1.00 0.00 ? 35  LYS A HB2  7  
ATOM 11305 H HB3  . LYS A 1 35  ? -246.391 -7.893  114.566 1.00 0.00 ? 35  LYS A HB3  7  
ATOM 11306 H HG2  . LYS A 1 35  ? -243.878 -7.968  114.656 1.00 0.00 ? 35  LYS A HG2  7  
ATOM 11307 H HG3  . LYS A 1 35  ? -243.894 -6.299  114.087 1.00 0.00 ? 35  LYS A HG3  7  
ATOM 11308 H HD2  . LYS A 1 35  ? -245.220 -7.319  116.599 1.00 0.00 ? 35  LYS A HD2  7  
ATOM 11309 H HD3  . LYS A 1 35  ? -243.695 -6.440  116.530 1.00 0.00 ? 35  LYS A HD3  7  
ATOM 11310 H HE2  . LYS A 1 35  ? -244.861 -4.502  115.588 1.00 0.00 ? 35  LYS A HE2  7  
ATOM 11311 H HE3  . LYS A 1 35  ? -246.387 -5.385  115.664 1.00 0.00 ? 35  LYS A HE3  7  
ATOM 11312 H HZ1  . LYS A 1 35  ? -246.106 -5.536  118.080 1.00 0.00 ? 35  LYS A HZ1  7  
ATOM 11313 H HZ2  . LYS A 1 35  ? -244.679 -4.624  117.977 1.00 0.00 ? 35  LYS A HZ2  7  
ATOM 11314 H HZ3  . LYS A 1 35  ? -246.167 -3.923  117.559 1.00 0.00 ? 35  LYS A HZ3  7  
ATOM 11315 N N    . GLN A 1 36  ? -243.626 -6.997  111.684 1.00 0.00 ? 36  GLN A N    7  
ATOM 11316 C CA   . GLN A 1 36  ? -242.817 -6.329  110.677 1.00 0.00 ? 36  GLN A CA   7  
ATOM 11317 C C    . GLN A 1 36  ? -242.878 -7.131  109.388 1.00 0.00 ? 36  GLN A C    7  
ATOM 11318 O O    . GLN A 1 36  ? -242.646 -6.623  108.294 1.00 0.00 ? 36  GLN A O    7  
ATOM 11319 C CB   . GLN A 1 36  ? -241.366 -6.201  111.154 1.00 0.00 ? 36  GLN A CB   7  
ATOM 11320 C CG   . GLN A 1 36  ? -240.470 -5.427  110.199 1.00 0.00 ? 36  GLN A CG   7  
ATOM 11321 C CD   . GLN A 1 36  ? -239.054 -5.287  110.719 1.00 0.00 ? 36  GLN A CD   7  
ATOM 11322 O OE1  . GLN A 1 36  ? -238.827 -5.243  111.926 1.00 0.00 ? 36  GLN A OE1  7  
ATOM 11323 N NE2  . GLN A 1 36  ? -238.092 -5.213  109.812 1.00 0.00 ? 36  GLN A NE2  7  
ATOM 11324 H H    . GLN A 1 36  ? -243.197 -7.303  112.507 1.00 0.00 ? 36  GLN A H    7  
ATOM 11325 H HA   . GLN A 1 36  ? -243.229 -5.346  110.504 1.00 0.00 ? 36  GLN A HA   7  
ATOM 11326 H HB2  . GLN A 1 36  ? -241.358 -5.697  112.108 1.00 0.00 ? 36  GLN A HB2  7  
ATOM 11327 H HB3  . GLN A 1 36  ? -240.953 -7.192  111.278 1.00 0.00 ? 36  GLN A HB3  7  
ATOM 11328 H HG2  . GLN A 1 36  ? -240.442 -5.947  109.253 1.00 0.00 ? 36  GLN A HG2  7  
ATOM 11329 H HG3  . GLN A 1 36  ? -240.888 -4.442  110.055 1.00 0.00 ? 36  GLN A HG3  7  
ATOM 11330 H HE21 . GLN A 1 36  ? -238.346 -5.251  108.854 1.00 0.00 ? 36  GLN A HE21 7  
ATOM 11331 H HE22 . GLN A 1 36  ? -237.165 -5.127  110.129 1.00 0.00 ? 36  GLN A HE22 7  
ATOM 11332 N N    . LEU A 1 37  ? -243.177 -8.406  109.528 1.00 0.00 ? 37  LEU A N    7  
ATOM 11333 C CA   . LEU A 1 37  ? -243.287 -9.254  108.384 1.00 0.00 ? 37  LEU A CA   7  
ATOM 11334 C C    . LEU A 1 37  ? -244.642 -9.191  107.725 1.00 0.00 ? 37  LEU A C    7  
ATOM 11335 O O    . LEU A 1 37  ? -244.751 -9.346  106.512 1.00 0.00 ? 37  LEU A O    7  
ATOM 11336 C CB   . LEU A 1 37  ? -242.929 -10.672 108.737 1.00 0.00 ? 37  LEU A CB   7  
ATOM 11337 C CG   . LEU A 1 37  ? -241.960 -11.227 107.745 1.00 0.00 ? 37  LEU A CG   7  
ATOM 11338 C CD1  . LEU A 1 37  ? -242.667 -11.405 106.429 1.00 0.00 ? 37  LEU A CD1  7  
ATOM 11339 C CD2  . LEU A 1 37  ? -240.837 -10.232 107.570 1.00 0.00 ? 37  LEU A CD2  7  
ATOM 11340 H H    . LEU A 1 37  ? -243.285 -8.788  110.422 1.00 0.00 ? 37  LEU A H    7  
ATOM 11341 H HA   . LEU A 1 37  ? -242.569 -8.896  107.668 1.00 0.00 ? 37  LEU A HA   7  
ATOM 11342 H HB2  . LEU A 1 37  ? -242.488 -10.691 109.725 1.00 0.00 ? 37  LEU A HB2  7  
ATOM 11343 H HB3  . LEU A 1 37  ? -243.822 -11.277 108.728 1.00 0.00 ? 37  LEU A HB3  7  
ATOM 11344 H HG   . LEU A 1 37  ? -241.563 -12.169 108.087 1.00 0.00 ? 37  LEU A HG   7  
ATOM 11345 H HD11 . LEU A 1 37  ? -243.186 -10.472 106.191 1.00 0.00 ? 37  LEU A HD11 7  
ATOM 11346 H HD12 . LEU A 1 37  ? -241.950 -11.622 105.655 1.00 0.00 ? 37  LEU A HD12 7  
ATOM 11347 H HD13 . LEU A 1 37  ? -243.385 -12.206 106.507 1.00 0.00 ? 37  LEU A HD13 7  
ATOM 11348 H HD21 . LEU A 1 37  ? -240.605 -9.780  108.522 1.00 0.00 ? 37  LEU A HD21 7  
ATOM 11349 H HD22 . LEU A 1 37  ? -239.965 -10.740 107.191 1.00 0.00 ? 37  LEU A HD22 7  
ATOM 11350 H HD23 . LEU A 1 37  ? -241.138 -9.468  106.866 1.00 0.00 ? 37  LEU A HD23 7  
ATOM 11351 N N    . LEU A 1 38  ? -245.673 -8.975  108.504 1.00 0.00 ? 38  LEU A N    7  
ATOM 11352 C CA   . LEU A 1 38  ? -246.974 -8.728  107.934 1.00 0.00 ? 38  LEU A CA   7  
ATOM 11353 C C    . LEU A 1 38  ? -246.825 -7.588  106.924 1.00 0.00 ? 38  LEU A C    7  
ATOM 11354 O O    . LEU A 1 38  ? -247.343 -7.653  105.815 1.00 0.00 ? 38  LEU A O    7  
ATOM 11355 C CB   . LEU A 1 38  ? -247.975 -8.412  109.057 1.00 0.00 ? 38  LEU A CB   7  
ATOM 11356 C CG   . LEU A 1 38  ? -249.447 -8.374  108.654 1.00 0.00 ? 38  LEU A CG   7  
ATOM 11357 C CD1  . LEU A 1 38  ? -249.999 -6.972  108.823 1.00 0.00 ? 38  LEU A CD1  7  
ATOM 11358 C CD2  . LEU A 1 38  ? -249.631 -8.860  107.221 1.00 0.00 ? 38  LEU A CD2  7  
ATOM 11359 H H    . LEU A 1 38  ? -245.564 -9.002  109.478 1.00 0.00 ? 38  LEU A H    7  
ATOM 11360 H HA   . LEU A 1 38  ? -247.289 -9.621  107.407 1.00 0.00 ? 38  LEU A HA   7  
ATOM 11361 H HB2  . LEU A 1 38  ? -247.861 -9.165  109.823 1.00 0.00 ? 38  LEU A HB2  7  
ATOM 11362 H HB3  . LEU A 1 38  ? -247.715 -7.455  109.487 1.00 0.00 ? 38  LEU A HB3  7  
ATOM 11363 H HG   . LEU A 1 38  ? -250.008 -9.030  109.305 1.00 0.00 ? 38  LEU A HG   7  
ATOM 11364 H HD11 . LEU A 1 38  ? -249.356 -6.270  108.312 1.00 0.00 ? 38  LEU A HD11 7  
ATOM 11365 H HD12 . LEU A 1 38  ? -250.989 -6.921  108.403 1.00 0.00 ? 38  LEU A HD12 7  
ATOM 11366 H HD13 . LEU A 1 38  ? -250.040 -6.725  109.873 1.00 0.00 ? 38  LEU A HD13 7  
ATOM 11367 H HD21 . LEU A 1 38  ? -249.129 -9.814  107.094 1.00 0.00 ? 38  LEU A HD21 7  
ATOM 11368 H HD22 . LEU A 1 38  ? -250.684 -8.970  107.007 1.00 0.00 ? 38  LEU A HD22 7  
ATOM 11369 H HD23 . LEU A 1 38  ? -249.198 -8.141  106.540 1.00 0.00 ? 38  LEU A HD23 7  
ATOM 11370 N N    . GLN A 1 39  ? -246.023 -6.603  107.296 1.00 0.00 ? 39  GLN A N    7  
ATOM 11371 C CA   . GLN A 1 39  ? -245.591 -5.552  106.430 1.00 0.00 ? 39  GLN A CA   7  
ATOM 11372 C C    . GLN A 1 39  ? -244.970 -6.081  105.169 1.00 0.00 ? 39  GLN A C    7  
ATOM 11373 O O    . GLN A 1 39  ? -245.354 -5.692  104.085 1.00 0.00 ? 39  GLN A O    7  
ATOM 11374 C CB   . GLN A 1 39  ? -244.494 -4.834  107.157 1.00 0.00 ? 39  GLN A CB   7  
ATOM 11375 C CG   . GLN A 1 39  ? -244.036 -3.618  106.429 1.00 0.00 ? 39  GLN A CG   7  
ATOM 11376 C CD   . GLN A 1 39  ? -242.989 -2.816  107.178 1.00 0.00 ? 39  GLN A CD   7  
ATOM 11377 O OE1  . GLN A 1 39  ? -243.314 -1.913  107.950 1.00 0.00 ? 39  GLN A OE1  7  
ATOM 11378 N NE2  . GLN A 1 39  ? -241.722 -3.136  106.955 1.00 0.00 ? 39  GLN A NE2  7  
ATOM 11379 H H    . GLN A 1 39  ? -245.729 -6.555  108.212 1.00 0.00 ? 39  GLN A H    7  
ATOM 11380 H HA   . GLN A 1 39  ? -246.410 -4.876  106.202 1.00 0.00 ? 39  GLN A HA   7  
ATOM 11381 H HB2  . GLN A 1 39  ? -244.812 -4.601  108.142 1.00 0.00 ? 39  GLN A HB2  7  
ATOM 11382 H HB3  . GLN A 1 39  ? -243.653 -5.505  107.226 1.00 0.00 ? 39  GLN A HB3  7  
ATOM 11383 H HG2  . GLN A 1 39  ? -243.615 -3.965  105.494 1.00 0.00 ? 39  GLN A HG2  7  
ATOM 11384 H HG3  . GLN A 1 39  ? -244.896 -2.999  106.237 1.00 0.00 ? 39  GLN A HG3  7  
ATOM 11385 H HE21 . GLN A 1 39  ? -241.531 -3.863  106.326 1.00 0.00 ? 39  GLN A HE21 7  
ATOM 11386 H HE22 . GLN A 1 39  ? -241.025 -2.628  107.427 1.00 0.00 ? 39  GLN A HE22 7  
ATOM 11387 N N    . GLN A 1 40  ? -243.971 -6.927  105.334 1.00 0.00 ? 40  GLN A N    7  
ATOM 11388 C CA   . GLN A 1 40  ? -243.254 -7.491  104.207 1.00 0.00 ? 40  GLN A CA   7  
ATOM 11389 C C    . GLN A 1 40  ? -244.200 -8.190  103.234 1.00 0.00 ? 40  GLN A C    7  
ATOM 11390 O O    . GLN A 1 40  ? -243.965 -8.212  102.029 1.00 0.00 ? 40  GLN A O    7  
ATOM 11391 C CB   . GLN A 1 40  ? -242.172 -8.445  104.705 1.00 0.00 ? 40  GLN A CB   7  
ATOM 11392 C CG   . GLN A 1 40  ? -240.851 -7.747  104.958 1.00 0.00 ? 40  GLN A CG   7  
ATOM 11393 C CD   . GLN A 1 40  ? -240.395 -6.977  103.742 1.00 0.00 ? 40  GLN A CD   7  
ATOM 11394 O OE1  . GLN A 1 40  ? -239.678 -5.982  103.848 1.00 0.00 ? 40  GLN A OE1  7  
ATOM 11395 N NE2  . GLN A 1 40  ? -240.849 -7.421  102.583 1.00 0.00 ? 40  GLN A NE2  7  
ATOM 11396 H H    . GLN A 1 40  ? -243.700 -7.173  106.247 1.00 0.00 ? 40  GLN A H    7  
ATOM 11397 H HA   . GLN A 1 40  ? -242.770 -6.677  103.688 1.00 0.00 ? 40  GLN A HA   7  
ATOM 11398 H HB2  . GLN A 1 40  ? -242.499 -8.892  105.635 1.00 0.00 ? 40  GLN A HB2  7  
ATOM 11399 H HB3  . GLN A 1 40  ? -242.014 -9.221  103.973 1.00 0.00 ? 40  GLN A HB3  7  
ATOM 11400 H HG2  . GLN A 1 40  ? -240.968 -7.062  105.785 1.00 0.00 ? 40  GLN A HG2  7  
ATOM 11401 H HG3  . GLN A 1 40  ? -240.105 -8.485  105.202 1.00 0.00 ? 40  GLN A HG3  7  
ATOM 11402 H HE21 . GLN A 1 40  ? -241.437 -8.207  102.590 1.00 0.00 ? 40  GLN A HE21 7  
ATOM 11403 H HE22 . GLN A 1 40  ? -240.595 -6.947  101.777 1.00 0.00 ? 40  GLN A HE22 7  
ATOM 11404 N N    . ILE A 1 41  ? -245.274 -8.731  103.775 1.00 0.00 ? 41  ILE A N    7  
ATOM 11405 C CA   . ILE A 1 41  ? -246.309 -9.387  102.993 1.00 0.00 ? 41  ILE A CA   7  
ATOM 11406 C C    . ILE A 1 41  ? -247.226 -8.362  102.337 1.00 0.00 ? 41  ILE A C    7  
ATOM 11407 O O    . ILE A 1 41  ? -247.688 -8.530  101.209 1.00 0.00 ? 41  ILE A O    7  
ATOM 11408 C CB   . ILE A 1 41  ? -247.091 -10.332 103.923 1.00 0.00 ? 41  ILE A CB   7  
ATOM 11409 C CG1  . ILE A 1 41  ? -246.383 -11.680 103.992 1.00 0.00 ? 41  ILE A CG1  7  
ATOM 11410 C CG2  . ILE A 1 41  ? -248.531 -10.514 103.478 1.00 0.00 ? 41  ILE A CG2  7  
ATOM 11411 C CD1  . ILE A 1 41  ? -244.876 -11.589 104.125 1.00 0.00 ? 41  ILE A CD1  7  
ATOM 11412 H H    . ILE A 1 41  ? -245.368 -8.715  104.753 1.00 0.00 ? 41  ILE A H    7  
ATOM 11413 H HA   . ILE A 1 41  ? -245.832 -9.978  102.226 1.00 0.00 ? 41  ILE A HA   7  
ATOM 11414 H HB   . ILE A 1 41  ? -247.102 -9.888  104.911 1.00 0.00 ? 41  ILE A HB   7  
ATOM 11415 H HG12 . ILE A 1 41  ? -246.756 -12.230 104.841 1.00 0.00 ? 41  ILE A HG12 7  
ATOM 11416 H HG13 . ILE A 1 41  ? -246.600 -12.228 103.092 1.00 0.00 ? 41  ILE A HG13 7  
ATOM 11417 H HG21 . ILE A 1 41  ? -249.007 -9.549  103.398 1.00 0.00 ? 41  ILE A HG21 7  
ATOM 11418 H HG22 . ILE A 1 41  ? -248.554 -11.013 102.520 1.00 0.00 ? 41  ILE A HG22 7  
ATOM 11419 H HG23 . ILE A 1 41  ? -249.052 -11.111 104.210 1.00 0.00 ? 41  ILE A HG23 7  
ATOM 11420 H HD11 . ILE A 1 41  ? -244.475 -10.979 103.318 1.00 0.00 ? 41  ILE A HD11 7  
ATOM 11421 H HD12 . ILE A 1 41  ? -244.636 -11.127 105.073 1.00 0.00 ? 41  ILE A HD12 7  
ATOM 11422 H HD13 . ILE A 1 41  ? -244.437 -12.576 104.079 1.00 0.00 ? 41  ILE A HD13 7  
ATOM 11423 N N    . LEU A 1 42  ? -247.467 -7.298  103.065 1.00 0.00 ? 42  LEU A N    7  
ATOM 11424 C CA   . LEU A 1 42  ? -248.195 -6.145  102.573 1.00 0.00 ? 42  LEU A CA   7  
ATOM 11425 C C    . LEU A 1 42  ? -247.396 -5.400  101.527 1.00 0.00 ? 42  LEU A C    7  
ATOM 11426 O O    . LEU A 1 42  ? -247.923 -4.567  100.791 1.00 0.00 ? 42  LEU A O    7  
ATOM 11427 C CB   . LEU A 1 42  ? -248.423 -5.227  103.728 1.00 0.00 ? 42  LEU A CB   7  
ATOM 11428 C CG   . LEU A 1 42  ? -249.473 -5.705  104.700 1.00 0.00 ? 42  LEU A CG   7  
ATOM 11429 C CD1  . LEU A 1 42  ? -249.074 -5.324  106.081 1.00 0.00 ? 42  LEU A CD1  7  
ATOM 11430 C CD2  . LEU A 1 42  ? -250.810 -5.102  104.370 1.00 0.00 ? 42  LEU A CD2  7  
ATOM 11431 H H    . LEU A 1 42  ? -247.145 -7.287  1