data_2C10
# 
_entry.id   2C10 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2C10         
PDBE  EBI-25544    
WWPDB D_1290025544 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1PU4 unspecified 'CRYSTAL STRUCTURE OF HUMAN VASCULAR ADHESION PROTEIN-1'                                
PDB 1US1 unspecified 'CRYSTAL STRUCTURE OF HUMAN VASCULAR ADHESION PROTEIN-1'                                
PDB 2C11 unspecified 'CRYSTAL STRUCTURE OF THE 2-HYDRAZINOPYRIDINE OF SEMICARBAZIDE-SENSITIVE AMINE OXIDASE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2C10 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-09 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jakobsson, E.'  1 ? 
'Kleywegt, G.J.' 2 ? 
# 
_citation.id                        primary 
_citation.title                     'Structure of human semicarbazide-sensitive amine oxidase/vascular adhesion protein-1.' 
_citation.journal_abbrev            'Acta Crystallogr. D Biol. Crystallogr.' 
_citation.journal_volume            61 
_citation.page_first                1550 
_citation.page_last                 1562 
_citation.year                      2005 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16239734 
_citation.pdbx_database_id_DOI      10.1107/S0907444905028805 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jakobsson, E.'  1 ? 
primary 'Nilsson, J.'    2 ? 
primary 'Ogg, D.'        3 ? 
primary 'Kleywegt, G.J.' 4 ? 
# 
_cell.entry_id           2C10 
_cell.length_a           130.236 
_cell.length_b           130.236 
_cell.length_c           221.529 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2C10 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'MEMBRANE COPPER AMINE OXIDASE' 81682.602 4   1.4.3.6 ? 'EXTRA-CELLULAR DOMAIN, RESIDUES 29-763' ? 
2  branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   3   
?       ? ?                                        ? 
3  branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ? ?                                        ? 
4  branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   4   ?       
? ?                                        ? 
5  branched    man 
;alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
894.823   2   ?       ? ?                                        ? 
6  branched    man 
;alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682   1   ?       ? ?                                        ? 
7  non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   8   ?       ? ?                                        ? 
8  non-polymer syn 'CALCIUM ION' 40.078    8   ?       ? ?                                        ? 
9  non-polymer syn 'COPPER (II) ION' 63.546    4   ?       ? ?                                        ? 
10 non-polymer syn 'CHLORIDE ION' 35.453    8   ?       ? ?                                        ? 
11 water       nat water 18.015    563 ?       ? ?                                        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SEMICARBAZIDE-SENSITIVE AMINE OXIDASE, VASCULAR ADHESION PROTEIN 1, VAP-1, HPAO' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAA
ALAHLDRGSPPPAREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNREL
PQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQG
RYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSWSLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPR
IFDVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDA
FCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLN(TPQ)DYVWDTVFHPSGAIEIRFYATGYISSAFLFGAT
GKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATP
RYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFI
NNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQ
AAACAPDLPAFSHGGFSHN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAA
ALAHLDRGSPPPAREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNREL
PQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQG
RYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSWSLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPR
IFDVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDA
FCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGKYG
NQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLY
LASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNET
IAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAAC
APDLPAFSHGGFSHN
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLY n 
1 3   ASP n 
1 4   GLY n 
1 5   GLY n 
1 6   GLU n 
1 7   PRO n 
1 8   SER n 
1 9   GLN n 
1 10  LEU n 
1 11  PRO n 
1 12  HIS n 
1 13  CYS n 
1 14  PRO n 
1 15  SER n 
1 16  VAL n 
1 17  SER n 
1 18  PRO n 
1 19  SER n 
1 20  ALA n 
1 21  GLN n 
1 22  PRO n 
1 23  TRP n 
1 24  THR n 
1 25  HIS n 
1 26  PRO n 
1 27  GLY n 
1 28  GLN n 
1 29  SER n 
1 30  GLN n 
1 31  LEU n 
1 32  PHE n 
1 33  ALA n 
1 34  ASP n 
1 35  LEU n 
1 36  SER n 
1 37  ARG n 
1 38  GLU n 
1 39  GLU n 
1 40  LEU n 
1 41  THR n 
1 42  ALA n 
1 43  VAL n 
1 44  MET n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  THR n 
1 49  GLN n 
1 50  ARG n 
1 51  LEU n 
1 52  GLY n 
1 53  PRO n 
1 54  GLY n 
1 55  LEU n 
1 56  VAL n 
1 57  ASP n 
1 58  ALA n 
1 59  ALA n 
1 60  GLN n 
1 61  ALA n 
1 62  ARG n 
1 63  PRO n 
1 64  SER n 
1 65  ASP n 
1 66  ASN n 
1 67  CYS n 
1 68  VAL n 
1 69  PHE n 
1 70  SER n 
1 71  VAL n 
1 72  GLU n 
1 73  LEU n 
1 74  GLN n 
1 75  LEU n 
1 76  PRO n 
1 77  PRO n 
1 78  LYS n 
1 79  ALA n 
1 80  ALA n 
1 81  ALA n 
1 82  LEU n 
1 83  ALA n 
1 84  HIS n 
1 85  LEU n 
1 86  ASP n 
1 87  ARG n 
1 88  GLY n 
1 89  SER n 
1 90  PRO n 
1 91  PRO n 
1 92  PRO n 
1 93  ALA n 
1 94  ARG n 
1 95  GLU n 
1 96  ALA n 
1 97  LEU n 
1 98  ALA n 
1 99  ILE n 
1 100 VAL n 
1 101 PHE n 
1 102 PHE n 
1 103 GLY n 
1 104 ARG n 
1 105 GLN n 
1 106 PRO n 
1 107 GLN n 
1 108 PRO n 
1 109 ASN n 
1 110 VAL n 
1 111 SER n 
1 112 GLU n 
1 113 LEU n 
1 114 VAL n 
1 115 VAL n 
1 116 GLY n 
1 117 PRO n 
1 118 LEU n 
1 119 PRO n 
1 120 HIS n 
1 121 PRO n 
1 122 SER n 
1 123 TYR n 
1 124 MET n 
1 125 ARG n 
1 126 ASP n 
1 127 VAL n 
1 128 THR n 
1 129 VAL n 
1 130 GLU n 
1 131 ARG n 
1 132 HIS n 
1 133 GLY n 
1 134 GLY n 
1 135 PRO n 
1 136 LEU n 
1 137 PRO n 
1 138 TYR n 
1 139 HIS n 
1 140 ARG n 
1 141 ARG n 
1 142 PRO n 
1 143 VAL n 
1 144 LEU n 
1 145 PHE n 
1 146 GLN n 
1 147 GLU n 
1 148 TYR n 
1 149 LEU n 
1 150 ASP n 
1 151 ILE n 
1 152 ASP n 
1 153 GLN n 
1 154 MET n 
1 155 ILE n 
1 156 PHE n 
1 157 ASN n 
1 158 ARG n 
1 159 GLU n 
1 160 LEU n 
1 161 PRO n 
1 162 GLN n 
1 163 ALA n 
1 164 SER n 
1 165 GLY n 
1 166 LEU n 
1 167 LEU n 
1 168 HIS n 
1 169 HIS n 
1 170 CYS n 
1 171 CYS n 
1 172 PHE n 
1 173 TYR n 
1 174 LYS n 
1 175 HIS n 
1 176 ARG n 
1 177 GLY n 
1 178 ARG n 
1 179 ASN n 
1 180 LEU n 
1 181 VAL n 
1 182 THR n 
1 183 MET n 
1 184 THR n 
1 185 THR n 
1 186 ALA n 
1 187 PRO n 
1 188 ARG n 
1 189 GLY n 
1 190 LEU n 
1 191 GLN n 
1 192 SER n 
1 193 GLY n 
1 194 ASP n 
1 195 ARG n 
1 196 ALA n 
1 197 THR n 
1 198 TRP n 
1 199 PHE n 
1 200 GLY n 
1 201 LEU n 
1 202 TYR n 
1 203 TYR n 
1 204 ASN n 
1 205 ILE n 
1 206 SER n 
1 207 GLY n 
1 208 ALA n 
1 209 GLY n 
1 210 PHE n 
1 211 PHE n 
1 212 LEU n 
1 213 HIS n 
1 214 HIS n 
1 215 VAL n 
1 216 GLY n 
1 217 LEU n 
1 218 GLU n 
1 219 LEU n 
1 220 LEU n 
1 221 VAL n 
1 222 ASN n 
1 223 HIS n 
1 224 LYS n 
1 225 ALA n 
1 226 LEU n 
1 227 ASP n 
1 228 PRO n 
1 229 ALA n 
1 230 ARG n 
1 231 TRP n 
1 232 THR n 
1 233 ILE n 
1 234 GLN n 
1 235 LYS n 
1 236 VAL n 
1 237 PHE n 
1 238 TYR n 
1 239 GLN n 
1 240 GLY n 
1 241 ARG n 
1 242 TYR n 
1 243 TYR n 
1 244 ASP n 
1 245 SER n 
1 246 LEU n 
1 247 ALA n 
1 248 GLN n 
1 249 LEU n 
1 250 GLU n 
1 251 ALA n 
1 252 GLN n 
1 253 PHE n 
1 254 GLU n 
1 255 ALA n 
1 256 GLY n 
1 257 LEU n 
1 258 VAL n 
1 259 ASN n 
1 260 VAL n 
1 261 VAL n 
1 262 LEU n 
1 263 ILE n 
1 264 PRO n 
1 265 ASP n 
1 266 ASN n 
1 267 GLY n 
1 268 THR n 
1 269 GLY n 
1 270 GLY n 
1 271 SER n 
1 272 TRP n 
1 273 SER n 
1 274 LEU n 
1 275 LYS n 
1 276 SER n 
1 277 PRO n 
1 278 VAL n 
1 279 PRO n 
1 280 PRO n 
1 281 GLY n 
1 282 PRO n 
1 283 ALA n 
1 284 PRO n 
1 285 PRO n 
1 286 LEU n 
1 287 GLN n 
1 288 PHE n 
1 289 TYR n 
1 290 PRO n 
1 291 GLN n 
1 292 GLY n 
1 293 PRO n 
1 294 ARG n 
1 295 PHE n 
1 296 SER n 
1 297 VAL n 
1 298 GLN n 
1 299 GLY n 
1 300 SER n 
1 301 ARG n 
1 302 VAL n 
1 303 ALA n 
1 304 SER n 
1 305 SER n 
1 306 LEU n 
1 307 TRP n 
1 308 THR n 
1 309 PHE n 
1 310 SER n 
1 311 PHE n 
1 312 GLY n 
1 313 LEU n 
1 314 GLY n 
1 315 ALA n 
1 316 PHE n 
1 317 SER n 
1 318 GLY n 
1 319 PRO n 
1 320 ARG n 
1 321 ILE n 
1 322 PHE n 
1 323 ASP n 
1 324 VAL n 
1 325 ARG n 
1 326 PHE n 
1 327 GLN n 
1 328 GLY n 
1 329 GLU n 
1 330 ARG n 
1 331 LEU n 
1 332 VAL n 
1 333 TYR n 
1 334 GLU n 
1 335 ILE n 
1 336 SER n 
1 337 LEU n 
1 338 GLN n 
1 339 GLU n 
1 340 ALA n 
1 341 LEU n 
1 342 ALA n 
1 343 ILE n 
1 344 TYR n 
1 345 GLY n 
1 346 GLY n 
1 347 ASN n 
1 348 SER n 
1 349 PRO n 
1 350 ALA n 
1 351 ALA n 
1 352 MET n 
1 353 THR n 
1 354 THR n 
1 355 ARG n 
1 356 TYR n 
1 357 VAL n 
1 358 ASP n 
1 359 GLY n 
1 360 GLY n 
1 361 PHE n 
1 362 GLY n 
1 363 MET n 
1 364 GLY n 
1 365 LYS n 
1 366 TYR n 
1 367 THR n 
1 368 THR n 
1 369 PRO n 
1 370 LEU n 
1 371 THR n 
1 372 ARG n 
1 373 GLY n 
1 374 VAL n 
1 375 ASP n 
1 376 CYS n 
1 377 PRO n 
1 378 TYR n 
1 379 LEU n 
1 380 ALA n 
1 381 THR n 
1 382 TYR n 
1 383 VAL n 
1 384 ASP n 
1 385 TRP n 
1 386 HIS n 
1 387 PHE n 
1 388 LEU n 
1 389 LEU n 
1 390 GLU n 
1 391 SER n 
1 392 GLN n 
1 393 ALA n 
1 394 PRO n 
1 395 LYS n 
1 396 THR n 
1 397 ILE n 
1 398 ARG n 
1 399 ASP n 
1 400 ALA n 
1 401 PHE n 
1 402 CYS n 
1 403 VAL n 
1 404 PHE n 
1 405 GLU n 
1 406 GLN n 
1 407 ASN n 
1 408 GLN n 
1 409 GLY n 
1 410 LEU n 
1 411 PRO n 
1 412 LEU n 
1 413 ARG n 
1 414 ARG n 
1 415 HIS n 
1 416 HIS n 
1 417 SER n 
1 418 ASP n 
1 419 LEU n 
1 420 TYR n 
1 421 SER n 
1 422 HIS n 
1 423 TYR n 
1 424 PHE n 
1 425 GLY n 
1 426 GLY n 
1 427 LEU n 
1 428 ALA n 
1 429 GLU n 
1 430 THR n 
1 431 VAL n 
1 432 LEU n 
1 433 VAL n 
1 434 VAL n 
1 435 ARG n 
1 436 SER n 
1 437 MET n 
1 438 SER n 
1 439 THR n 
1 440 LEU n 
1 441 LEU n 
1 442 ASN n 
1 443 TPQ n 
1 444 ASP n 
1 445 TYR n 
1 446 VAL n 
1 447 TRP n 
1 448 ASP n 
1 449 THR n 
1 450 VAL n 
1 451 PHE n 
1 452 HIS n 
1 453 PRO n 
1 454 SER n 
1 455 GLY n 
1 456 ALA n 
1 457 ILE n 
1 458 GLU n 
1 459 ILE n 
1 460 ARG n 
1 461 PHE n 
1 462 TYR n 
1 463 ALA n 
1 464 THR n 
1 465 GLY n 
1 466 TYR n 
1 467 ILE n 
1 468 SER n 
1 469 SER n 
1 470 ALA n 
1 471 PHE n 
1 472 LEU n 
1 473 PHE n 
1 474 GLY n 
1 475 ALA n 
1 476 THR n 
1 477 GLY n 
1 478 LYS n 
1 479 TYR n 
1 480 GLY n 
1 481 ASN n 
1 482 GLN n 
1 483 VAL n 
1 484 SER n 
1 485 GLU n 
1 486 HIS n 
1 487 THR n 
1 488 LEU n 
1 489 GLY n 
1 490 THR n 
1 491 VAL n 
1 492 HIS n 
1 493 THR n 
1 494 HIS n 
1 495 SER n 
1 496 ALA n 
1 497 HIS n 
1 498 PHE n 
1 499 LYS n 
1 500 VAL n 
1 501 ASP n 
1 502 LEU n 
1 503 ASP n 
1 504 VAL n 
1 505 ALA n 
1 506 GLY n 
1 507 LEU n 
1 508 GLU n 
1 509 ASN n 
1 510 TRP n 
1 511 VAL n 
1 512 TRP n 
1 513 ALA n 
1 514 GLU n 
1 515 ASP n 
1 516 MET n 
1 517 VAL n 
1 518 PHE n 
1 519 VAL n 
1 520 PRO n 
1 521 MET n 
1 522 ALA n 
1 523 VAL n 
1 524 PRO n 
1 525 TRP n 
1 526 SER n 
1 527 PRO n 
1 528 GLU n 
1 529 HIS n 
1 530 GLN n 
1 531 LEU n 
1 532 GLN n 
1 533 ARG n 
1 534 LEU n 
1 535 GLN n 
1 536 VAL n 
1 537 THR n 
1 538 ARG n 
1 539 LYS n 
1 540 LEU n 
1 541 LEU n 
1 542 GLU n 
1 543 MET n 
1 544 GLU n 
1 545 GLU n 
1 546 GLN n 
1 547 ALA n 
1 548 ALA n 
1 549 PHE n 
1 550 LEU n 
1 551 VAL n 
1 552 GLY n 
1 553 SER n 
1 554 ALA n 
1 555 THR n 
1 556 PRO n 
1 557 ARG n 
1 558 TYR n 
1 559 LEU n 
1 560 TYR n 
1 561 LEU n 
1 562 ALA n 
1 563 SER n 
1 564 ASN n 
1 565 HIS n 
1 566 SER n 
1 567 ASN n 
1 568 LYS n 
1 569 TRP n 
1 570 GLY n 
1 571 HIS n 
1 572 PRO n 
1 573 ARG n 
1 574 GLY n 
1 575 TYR n 
1 576 ARG n 
1 577 ILE n 
1 578 GLN n 
1 579 MET n 
1 580 LEU n 
1 581 SER n 
1 582 PHE n 
1 583 ALA n 
1 584 GLY n 
1 585 GLU n 
1 586 PRO n 
1 587 LEU n 
1 588 PRO n 
1 589 GLN n 
1 590 ASN n 
1 591 SER n 
1 592 SER n 
1 593 MET n 
1 594 ALA n 
1 595 ARG n 
1 596 GLY n 
1 597 PHE n 
1 598 SER n 
1 599 TRP n 
1 600 GLU n 
1 601 ARG n 
1 602 TYR n 
1 603 GLN n 
1 604 LEU n 
1 605 ALA n 
1 606 VAL n 
1 607 THR n 
1 608 GLN n 
1 609 ARG n 
1 610 LYS n 
1 611 GLU n 
1 612 GLU n 
1 613 GLU n 
1 614 PRO n 
1 615 SER n 
1 616 SER n 
1 617 SER n 
1 618 SER n 
1 619 VAL n 
1 620 PHE n 
1 621 ASN n 
1 622 GLN n 
1 623 ASN n 
1 624 ASP n 
1 625 PRO n 
1 626 TRP n 
1 627 ALA n 
1 628 PRO n 
1 629 THR n 
1 630 VAL n 
1 631 ASP n 
1 632 PHE n 
1 633 SER n 
1 634 ASP n 
1 635 PHE n 
1 636 ILE n 
1 637 ASN n 
1 638 ASN n 
1 639 GLU n 
1 640 THR n 
1 641 ILE n 
1 642 ALA n 
1 643 GLY n 
1 644 LYS n 
1 645 ASP n 
1 646 LEU n 
1 647 VAL n 
1 648 ALA n 
1 649 TRP n 
1 650 VAL n 
1 651 THR n 
1 652 ALA n 
1 653 GLY n 
1 654 PHE n 
1 655 LEU n 
1 656 HIS n 
1 657 ILE n 
1 658 PRO n 
1 659 HIS n 
1 660 ALA n 
1 661 GLU n 
1 662 ASP n 
1 663 ILE n 
1 664 PRO n 
1 665 ASN n 
1 666 THR n 
1 667 VAL n 
1 668 THR n 
1 669 VAL n 
1 670 GLY n 
1 671 ASN n 
1 672 GLY n 
1 673 VAL n 
1 674 GLY n 
1 675 PHE n 
1 676 PHE n 
1 677 LEU n 
1 678 ARG n 
1 679 PRO n 
1 680 TYR n 
1 681 ASN n 
1 682 PHE n 
1 683 PHE n 
1 684 ASP n 
1 685 GLU n 
1 686 ASP n 
1 687 PRO n 
1 688 SER n 
1 689 PHE n 
1 690 TYR n 
1 691 SER n 
1 692 ALA n 
1 693 ASP n 
1 694 SER n 
1 695 ILE n 
1 696 TYR n 
1 697 PHE n 
1 698 ARG n 
1 699 GLY n 
1 700 ASP n 
1 701 GLN n 
1 702 ASP n 
1 703 ALA n 
1 704 GLY n 
1 705 ALA n 
1 706 CYS n 
1 707 GLU n 
1 708 VAL n 
1 709 ASN n 
1 710 PRO n 
1 711 LEU n 
1 712 ALA n 
1 713 CYS n 
1 714 LEU n 
1 715 PRO n 
1 716 GLN n 
1 717 ALA n 
1 718 ALA n 
1 719 ALA n 
1 720 CYS n 
1 721 ALA n 
1 722 PRO n 
1 723 ASP n 
1 724 LEU n 
1 725 PRO n 
1 726 ALA n 
1 727 PHE n 
1 728 SER n 
1 729 HIS n 
1 730 GLY n 
1 731 GLY n 
1 732 PHE n 
1 733 SER n 
1 734 HIS n 
1 735 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AOC3_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q16853 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2C10 A 1 ? 735 ? Q16853 29 ? 763 ? 29 763 
2 1 2C10 B 1 ? 735 ? Q16853 29 ? 763 ? 29 763 
3 1 2C10 C 1 ? 735 ? Q16853 29 ? 763 ? 29 763 
4 1 2C10 D 1 ? 735 ? Q16853 29 ? 763 ? 29 763 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                         ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                                    ? 'C6 H12 O6'      180.156 
CA  non-polymer                   . 'CALCIUM ION'                                           ? 'Ca 2'           40.078  
CL  non-polymer                   . 'CHLORIDE ION'                                          ? 'Cl -1'          35.453  
CU  non-polymer                   . 'COPPER (II) ION'                                       ? 'Cu 2'           63.546  
CYS 'L-peptide linking'           y CYSTEINE                                                ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                    ? 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                                   ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                                  ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                                   ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                                              ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                                           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                               ? 'C4 H9 N O3'     119.119 
TPQ 'L-peptide linking'           n '5-(2-CARBOXY-2-AMINOETHYL)-2-HYDROXY-1,4-BENZOQUINONE' 
'5-(2-CARBOXY-2-AMINOETHYL)-4-HYDROXY-1,2-BENZOQUINONE; 2,4,5-TRIHYDROXYPHENYLALANINE QUINONE; TOPA QUINONE' 'C9 H9 N O5'     
211.171 
TRP 'L-peptide linking'           y TRYPTOPHAN                                              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2C10 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.8 
_exptl_crystal.density_percent_sol   55 
_exptl_crystal.description           ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            288 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'THE PROTEIN WAS CRYSTALLISED IN 0.1 M KBR, 0.1 M ACETATE PH 5, 38% PEG1000 AT 288 K.' 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100.0 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2004-05-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.934 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             0.934 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2C10 
_reflns.observed_criterion_sigma_I   3.200 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             51.600 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   126698 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.10000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.8000 
_reflns.B_iso_Wilson_estimate        48.00 
_reflns.pdbx_redundancy              5.200 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.44000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.200 
_reflns_shell.pdbx_redundancy        3.80 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2C10 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     124418 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    98.2 
_refine.ls_R_factor_obs                          0.204 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  6243 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.939 
_refine.correlation_coeff_Fo_to_Fc_free          0.908 
_refine.B_iso_mean                               37.62 
_refine.aniso_B[1][1]                            1.83000 
_refine.aniso_B[2][2]                            1.83000 
_refine.aniso_B[3][3]                            -3.66000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. THE LAST REFINEMENT ROUND WAS DONE AGAINST ALL DATA, RFREE VALUES ARE THE LAST RECORDED
;
_refine.pdbx_starting_model                      'PDB ENTRY 1KSI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.449 
_refine.pdbx_overall_ESU_R_Free                  0.287 
_refine.overall_SU_ML                            0.165 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             14.748 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        22300 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         607 
_refine_hist.number_atoms_solvent             563 
_refine_hist.number_atoms_total               23470 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 23660 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.340  1.973  ? 32334 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.420  5.000  ? 2818  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       31.469 23.052 ? 1114  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.582 15.000 ? 3330  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.747 15.000 ? 160   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.085  0.200  ? 3487  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 18444 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.197  0.200  ? 10035 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.315  0.200  ? 15760 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.136  0.200  ? 1060  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.200  0.200  ? 43    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.249  0.200  ? 13    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.517  1.500  ? 14407 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.922  2.000  ? 22698 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.343  3.000  ? 10501 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.278  4.500  ? 9636  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.56 
_refine_ls_shell.number_reflns_R_work             8962 
_refine_ls_shell.R_factor_R_work                  0.3190 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.4020 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             427 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.499262 0.866448 0.002463  0.866444  -0.499267 0.002520  0.003413 0.000876 -0.999994 -23.67400  40.94700  15.58500 
2 given ? 0.000953 0.999999 0.000042  0.999999  -0.000953 0.000157  0.000157 0.000042 -1.000000 -65.23310  -65.01500 7.41670  
3 given ? 0.866852 0.498558 -0.002804 -0.498564 0.866850  -0.002252 0.001308 0.003350 0.999993  -112.55770 16.91520  7.82480  
# 
_struct.entry_id                  2C10 
_struct.title                     'The structure of a truncated, soluble version of semicarbazide- sensitive amine oxidase' 
_struct.pdbx_descriptor           'MEMBRANE COPPER AMINE OXIDASE (E.C.1.4.3.6)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2C10 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;SEMICARBAZIDE-SENSITIVE AMINE OXIDASE, VASCULAR ADHESION, PROTEIN-1, SSAO, VAP-1, CELL ADHESION, GLYCOPROTEIN, METAL- BINDING, OXIDOREDUCTASE, SIGNAL- ANCHOR, TPQ, TRANSMEMBRANE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 1  ? 
D  N N 1  ? 
E  N N 2  ? 
F  N N 3  ? 
G  N N 4  ? 
H  N N 2  ? 
I  N N 5  ? 
J  N N 4  ? 
K  N N 2  ? 
L  N N 3  ? 
M  N N 4  ? 
N  N N 6  ? 
O  N N 5  ? 
P  N N 4  ? 
Q  N N 7  ? 
R  N N 8  ? 
S  N N 9  ? 
T  N N 8  ? 
U  N N 10 ? 
V  N N 10 ? 
W  N N 7  ? 
X  N N 7  ? 
Y  N N 7  ? 
Z  N N 8  ? 
AA N N 9  ? 
BA N N 8  ? 
CA N N 10 ? 
DA N N 10 ? 
EA N N 7  ? 
FA N N 8  ? 
GA N N 9  ? 
HA N N 8  ? 
IA N N 10 ? 
JA N N 10 ? 
KA N N 7  ? 
LA N N 7  ? 
MA N N 7  ? 
NA N N 8  ? 
OA N N 9  ? 
PA N N 8  ? 
QA N N 10 ? 
RA N N 10 ? 
SA N N 11 ? 
TA N N 11 ? 
UA N N 11 ? 
VA N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 36  ? LEU A 51  ? SER A 64  LEU A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 57  ? ALA A 61  ? ASP A 85  ALA A 89  5 ? 5  
HELX_P HELX_P3  3  PRO A 77  ? GLY A 88  ? PRO A 105 GLY A 116 1 ? 12 
HELX_P HELX_P4  4  VAL A 127 ? GLY A 133 ? VAL A 155 GLY A 161 1 ? 7  
HELX_P HELX_P5  5  HIS A 139 ? ARG A 141 ? HIS A 167 ARG A 169 5 ? 3  
HELX_P HELX_P6  6  LEU A 144 ? ARG A 158 ? LEU A 172 ARG A 186 1 ? 15 
HELX_P HELX_P7  7  GLU A 159 ? GLN A 162 ? GLU A 187 GLN A 190 5 ? 4  
HELX_P HELX_P8  8  ALA A 163 ? PHE A 172 ? ALA A 191 PHE A 200 1 ? 10 
HELX_P HELX_P9  9  GLY A 209 ? LEU A 212 ? GLY A 237 LEU A 240 5 ? 4  
HELX_P HELX_P10 10 ASP A 227 ? TRP A 231 ? ASP A 255 TRP A 259 5 ? 5  
HELX_P HELX_P11 11 SER A 245 ? ALA A 255 ? SER A 273 ALA A 283 1 ? 11 
HELX_P HELX_P12 12 SER A 348 ? THR A 353 ? SER A 376 THR A 381 1 ? 6  
HELX_P HELX_P13 13 GLY A 359 ? PHE A 361 ? GLY A 387 PHE A 389 5 ? 3  
HELX_P HELX_P14 14 GLU A 544 ? ALA A 548 ? GLU A 572 ALA A 576 5 ? 5  
HELX_P HELX_P15 15 MET A 593 ? GLU A 600 ? MET A 621 GLU A 628 5 ? 8  
HELX_P HELX_P16 16 ASP A 631 ? ILE A 636 ? ASP A 659 ILE A 664 5 ? 6  
HELX_P HELX_P17 17 HIS A 659 ? ILE A 663 ? HIS A 687 ILE A 691 5 ? 5  
HELX_P HELX_P18 18 ASP A 686 ? SER A 691 ? ASP A 714 SER A 719 5 ? 6  
HELX_P HELX_P19 19 CYS A 713 ? ALA A 718 ? CYS A 741 ALA A 746 1 ? 6  
HELX_P HELX_P20 20 SER B 36  ? LEU B 51  ? SER B 64  LEU B 79  1 ? 16 
HELX_P HELX_P21 21 ASP B 57  ? ALA B 61  ? ASP B 85  ALA B 89  5 ? 5  
HELX_P HELX_P22 22 PRO B 77  ? GLY B 88  ? PRO B 105 GLY B 116 1 ? 12 
HELX_P HELX_P23 23 VAL B 127 ? GLY B 133 ? VAL B 155 GLY B 161 1 ? 7  
HELX_P HELX_P24 24 HIS B 139 ? ARG B 141 ? HIS B 167 ARG B 169 5 ? 3  
HELX_P HELX_P25 25 LEU B 144 ? GLU B 159 ? LEU B 172 GLU B 187 1 ? 16 
HELX_P HELX_P26 26 LEU B 160 ? GLN B 162 ? LEU B 188 GLN B 190 5 ? 3  
HELX_P HELX_P27 27 ALA B 163 ? PHE B 172 ? ALA B 191 PHE B 200 1 ? 10 
HELX_P HELX_P28 28 GLY B 209 ? LEU B 212 ? GLY B 237 LEU B 240 5 ? 4  
HELX_P HELX_P29 29 ASP B 227 ? TRP B 231 ? ASP B 255 TRP B 259 5 ? 5  
HELX_P HELX_P30 30 SER B 245 ? ALA B 255 ? SER B 273 ALA B 283 1 ? 11 
HELX_P HELX_P31 31 SER B 348 ? THR B 353 ? SER B 376 THR B 381 1 ? 6  
HELX_P HELX_P32 32 GLY B 359 ? PHE B 361 ? GLY B 387 PHE B 389 5 ? 3  
HELX_P HELX_P33 33 GLU B 544 ? GLN B 546 ? GLU B 572 GLN B 574 5 ? 3  
HELX_P HELX_P34 34 MET B 593 ? GLU B 600 ? MET B 621 GLU B 628 5 ? 8  
HELX_P HELX_P35 35 ASP B 631 ? ILE B 636 ? ASP B 659 ILE B 664 5 ? 6  
HELX_P HELX_P36 36 HIS B 659 ? ILE B 663 ? HIS B 687 ILE B 691 5 ? 5  
HELX_P HELX_P37 37 ASP B 686 ? SER B 691 ? ASP B 714 SER B 719 5 ? 6  
HELX_P HELX_P38 38 SER C 36  ? LEU C 51  ? SER C 64  LEU C 79  1 ? 16 
HELX_P HELX_P39 39 ASP C 57  ? ALA C 61  ? ASP C 85  ALA C 89  5 ? 5  
HELX_P HELX_P40 40 PRO C 77  ? ARG C 87  ? PRO C 105 ARG C 115 1 ? 11 
HELX_P HELX_P41 41 VAL C 127 ? GLY C 133 ? VAL C 155 GLY C 161 1 ? 7  
HELX_P HELX_P42 42 HIS C 139 ? ARG C 141 ? HIS C 167 ARG C 169 5 ? 3  
HELX_P HELX_P43 43 LEU C 144 ? ARG C 158 ? LEU C 172 ARG C 186 1 ? 15 
HELX_P HELX_P44 44 GLU C 159 ? GLN C 162 ? GLU C 187 GLN C 190 5 ? 4  
HELX_P HELX_P45 45 ALA C 163 ? CYS C 171 ? ALA C 191 CYS C 199 1 ? 9  
HELX_P HELX_P46 46 GLY C 209 ? LEU C 212 ? GLY C 237 LEU C 240 5 ? 4  
HELX_P HELX_P47 47 ASP C 227 ? TRP C 231 ? ASP C 255 TRP C 259 5 ? 5  
HELX_P HELX_P48 48 SER C 245 ? ALA C 255 ? SER C 273 ALA C 283 1 ? 11 
HELX_P HELX_P49 49 SER C 348 ? THR C 353 ? SER C 376 THR C 381 1 ? 6  
HELX_P HELX_P50 50 GLY C 359 ? PHE C 361 ? GLY C 387 PHE C 389 5 ? 3  
HELX_P HELX_P51 51 GLU C 544 ? ALA C 548 ? GLU C 572 ALA C 576 5 ? 5  
HELX_P HELX_P52 52 MET C 593 ? GLU C 600 ? MET C 621 GLU C 628 5 ? 8  
HELX_P HELX_P53 53 ASP C 631 ? ILE C 636 ? ASP C 659 ILE C 664 5 ? 6  
HELX_P HELX_P54 54 HIS C 659 ? ILE C 663 ? HIS C 687 ILE C 691 5 ? 5  
HELX_P HELX_P55 55 ASP C 686 ? SER C 691 ? ASP C 714 SER C 719 5 ? 6  
HELX_P HELX_P56 56 CYS C 713 ? ALA C 718 ? CYS C 741 ALA C 746 1 ? 6  
HELX_P HELX_P57 57 SER D 36  ? LEU D 51  ? SER D 64  LEU D 79  1 ? 16 
HELX_P HELX_P58 58 ASP D 57  ? ALA D 61  ? ASP D 85  ALA D 89  5 ? 5  
HELX_P HELX_P59 59 PRO D 77  ? GLY D 88  ? PRO D 105 GLY D 116 1 ? 12 
HELX_P HELX_P60 60 VAL D 127 ? GLY D 133 ? VAL D 155 GLY D 161 1 ? 7  
HELX_P HELX_P61 61 HIS D 139 ? ARG D 141 ? HIS D 167 ARG D 169 5 ? 3  
HELX_P HELX_P62 62 LEU D 144 ? ARG D 158 ? LEU D 172 ARG D 186 1 ? 15 
HELX_P HELX_P63 63 GLU D 159 ? GLN D 162 ? GLU D 187 GLN D 190 5 ? 4  
HELX_P HELX_P64 64 ALA D 163 ? CYS D 171 ? ALA D 191 CYS D 199 1 ? 9  
HELX_P HELX_P65 65 GLY D 209 ? LEU D 212 ? GLY D 237 LEU D 240 5 ? 4  
HELX_P HELX_P66 66 ASP D 227 ? TRP D 231 ? ASP D 255 TRP D 259 5 ? 5  
HELX_P HELX_P67 67 SER D 245 ? GLY D 256 ? SER D 273 GLY D 284 1 ? 12 
HELX_P HELX_P68 68 SER D 348 ? THR D 353 ? SER D 376 THR D 381 1 ? 6  
HELX_P HELX_P69 69 GLY D 359 ? PHE D 361 ? GLY D 387 PHE D 389 5 ? 3  
HELX_P HELX_P70 70 GLU D 544 ? GLN D 546 ? GLU D 572 GLN D 574 5 ? 3  
HELX_P HELX_P71 71 MET D 593 ? GLU D 600 ? MET D 621 GLU D 628 5 ? 8  
HELX_P HELX_P72 72 ASP D 631 ? ILE D 636 ? ASP D 659 ILE D 664 5 ? 6  
HELX_P HELX_P73 73 HIS D 659 ? ILE D 663 ? HIS D 687 ILE D 691 5 ? 5  
HELX_P HELX_P74 74 ASP D 686 ? SER D 691 ? ASP D 714 SER D 719 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A  CYS 13  SG  ? ? ? 1_555 A  CYS 720 SG ? ? A CYS 41   A CYS 748  1_555 ? ? ? ? ? ? ? 2.050 ? ? 
disulf2  disulf ?    ? A  CYS 170 SG  ? ? ? 1_555 A  CYS 171 SG ? ? A CYS 198  A CYS 199  1_555 ? ? ? ? ? ? ? 2.061 ? ? 
disulf3  disulf ?    ? A  CYS 376 SG  ? ? ? 1_555 A  CYS 402 SG ? ? A CYS 404  A CYS 430  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf4  disulf ?    ? A  CYS 706 SG  ? ? ? 1_555 A  CYS 713 SG ? ? A CYS 734  A CYS 741  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf5  disulf ?    ? B  CYS 13  SG  ? ? ? 1_555 B  CYS 720 SG ? ? B CYS 41   B CYS 748  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf6  disulf ?    ? B  CYS 170 SG  ? ? ? 1_555 B  CYS 171 SG ? ? B CYS 198  B CYS 199  1_555 ? ? ? ? ? ? ? 2.065 ? ? 
disulf7  disulf ?    ? B  CYS 376 SG  ? ? ? 1_555 B  CYS 402 SG ? ? B CYS 404  B CYS 430  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf8  disulf ?    ? B  CYS 706 SG  ? ? ? 1_555 B  CYS 713 SG ? ? B CYS 734  B CYS 741  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf9  disulf ?    ? C  CYS 13  SG  ? ? ? 1_555 C  CYS 720 SG ? ? C CYS 41   C CYS 748  1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf10 disulf ?    ? C  CYS 170 SG  ? ? ? 1_555 C  CYS 171 SG ? ? C CYS 198  C CYS 199  1_555 ? ? ? ? ? ? ? 2.064 ? ? 
disulf11 disulf ?    ? C  CYS 376 SG  ? ? ? 1_555 C  CYS 402 SG ? ? C CYS 404  C CYS 430  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf12 disulf ?    ? C  CYS 706 SG  ? ? ? 1_555 C  CYS 713 SG ? ? C CYS 734  C CYS 741  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf13 disulf ?    ? D  CYS 13  SG  ? ? ? 1_555 D  CYS 720 SG ? ? D CYS 41   D CYS 748  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf14 disulf ?    ? D  CYS 170 SG  ? ? ? 1_555 D  CYS 171 SG ? ? D CYS 198  D CYS 199  1_555 ? ? ? ? ? ? ? 2.055 ? ? 
disulf15 disulf ?    ? D  CYS 376 SG  ? ? ? 1_555 D  CYS 402 SG ? ? D CYS 404  D CYS 430  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf16 disulf ?    ? D  CYS 706 SG  ? ? ? 1_555 D  CYS 713 SG ? ? D CYS 734  D CYS 741  1_555 ? ? ? ? ? ? ? 2.047 ? ? 
covale1  covale one  ? A  ASN 109 ND2 ? ? ? 1_555 E  NAG .   C1 ? ? A ASN 137  E NAG 1    1_555 ? ? ? ? ? ? ? 1.452 ? 
N-Glycosylation 
covale2  covale one  ? A  ASN 204 ND2 ? ? ? 1_555 G  NAG .   C1 ? ? A ASN 232  G NAG 1    1_555 ? ? ? ? ? ? ? 1.448 ? 
N-Glycosylation 
covale3  covale one  ? A  ASN 266 ND2 ? ? ? 1_555 Q  NAG .   C1 ? ? A ASN 294  A NAG 1768 1_555 ? ? ? ? ? ? ? 1.457 ? 
N-Glycosylation 
covale4  covale both ? A  ASN 442 C   ? ? ? 1_555 A  TPQ 443 N  ? ? A ASN 470  A TPQ 471  1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale5  covale both ? A  TPQ 443 C   ? ? ? 1_555 A  ASP 444 N  ? ? A TPQ 471  A ASP 472  1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale6  covale one  ? A  ASN 564 ND2 ? ? ? 1_555 F  NAG .   C1 ? ? A ASN 592  F NAG 1    1_555 ? ? ? ? ? ? ? 1.426 ? 
N-Glycosylation 
covale7  covale one  ? B  ASN 109 ND2 ? ? ? 1_555 H  NAG .   C1 ? ? B ASN 137  H NAG 1    1_555 ? ? ? ? ? ? ? 1.455 ? 
N-Glycosylation 
covale8  covale one  ? B  ASN 204 ND2 ? ? ? 1_555 J  NAG .   C1 ? ? B ASN 232  J NAG 1    1_555 ? ? ? ? ? ? ? 1.453 ? 
N-Glycosylation 
covale9  covale one  ? B  ASN 266 ND2 ? ? ? 1_555 W  NAG .   C1 ? ? B ASN 294  B NAG 1768 1_555 ? ? ? ? ? ? ? 1.451 ? 
N-Glycosylation 
covale10 covale both ? B  ASN 442 C   ? ? ? 1_555 B  TPQ 443 N  ? ? B ASN 470  B TPQ 471  1_555 ? ? ? ? ? ? ? 1.324 ? ? 
covale11 covale both ? B  TPQ 443 C   ? ? ? 1_555 B  ASP 444 N  ? ? B TPQ 471  B ASP 472  1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale12 covale one  ? B  ASN 564 ND2 ? ? ? 1_555 I  NAG .   C1 ? ? B ASN 592  I NAG 1    1_555 ? ? ? ? ? ? ? 1.417 ? 
N-Glycosylation 
covale13 covale one  ? B  ASN 638 ND2 ? ? ? 1_555 X  NAG .   C1 ? ? B ASN 666  B NAG 1770 1_555 ? ? ? ? ? ? ? 1.455 ? 
N-Glycosylation 
covale14 covale one  ? C  ASN 109 ND2 ? ? ? 1_555 K  NAG .   C1 ? ? C ASN 137  K NAG 1    1_555 ? ? ? ? ? ? ? 1.450 ? 
N-Glycosylation 
covale15 covale one  ? C  ASN 204 ND2 ? ? ? 1_555 M  NAG .   C1 ? ? C ASN 232  M NAG 1    1_555 ? ? ? ? ? ? ? 1.445 ? 
N-Glycosylation 
covale16 covale one  ? C  ASN 266 ND2 ? ? ? 1_555 EA NAG .   C1 ? ? C ASN 294  C NAG 1768 1_555 ? ? ? ? ? ? ? 1.451 ? 
N-Glycosylation 
covale17 covale both ? C  ASN 442 C   ? ? ? 1_555 C  TPQ 443 N  ? ? C ASN 470  C TPQ 471  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale18 covale both ? C  TPQ 443 C   ? ? ? 1_555 C  ASP 444 N  ? ? C TPQ 471  C ASP 472  1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale19 covale one  ? C  ASN 564 ND2 ? ? ? 1_555 L  NAG .   C1 ? ? C ASN 592  L NAG 1    1_555 ? ? ? ? ? ? ? 1.424 ? 
N-Glycosylation 
covale20 covale one  ? D  ASN 109 ND2 ? ? ? 1_555 N  NAG .   C1 ? ? D ASN 137  N NAG 1    1_555 ? ? ? ? ? ? ? 1.453 ? 
N-Glycosylation 
covale21 covale one  ? D  ASN 204 ND2 ? ? ? 1_555 P  NAG .   C1 ? ? D ASN 232  P NAG 1    1_555 ? ? ? ? ? ? ? 1.441 ? 
N-Glycosylation 
covale22 covale one  ? D  ASN 266 ND2 ? ? ? 1_555 KA NAG .   C1 ? ? D ASN 294  D NAG 1768 1_555 ? ? ? ? ? ? ? 1.448 ? 
N-Glycosylation 
covale23 covale both ? D  ASN 442 C   ? ? ? 1_555 D  TPQ 443 N  ? ? D ASN 470  D TPQ 471  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale24 covale both ? D  TPQ 443 C   ? ? ? 1_555 D  ASP 444 N  ? ? D TPQ 471  D ASP 472  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale25 covale one  ? D  ASN 564 ND2 ? ? ? 1_555 O  NAG .   C1 ? ? D ASN 592  O NAG 1    1_555 ? ? ? ? ? ? ? 1.420 ? 
N-Glycosylation 
covale26 covale one  ? D  ASN 638 ND2 ? ? ? 1_555 LA NAG .   C1 ? ? D ASN 666  D NAG 1770 1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale27 covale both ? E  NAG .   O4  ? ? ? 1_555 E  NAG .   C1 ? ? E NAG 1    E NAG 2    1_555 ? ? ? ? ? ? ? 1.436 ? ? 
covale28 covale both ? E  NAG .   O4  ? ? ? 1_555 E  BMA .   C1 ? ? E NAG 2    E BMA 3    1_555 ? ? ? ? ? ? ? 1.441 ? ? 
covale29 covale both ? F  NAG .   O4  ? ? ? 1_555 F  NAG .   C1 ? ? F NAG 1    F NAG 2    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale30 covale one  ? F  NAG .   O6  ? ? ? 1_555 F  FUC .   C1 ? ? F NAG 1    F FUC 3    1_555 ? ? ? ? ? ? ? 1.436 ? ? 
covale31 covale both ? G  NAG .   O4  ? ? ? 1_555 G  NAG .   C1 ? ? G NAG 1    G NAG 2    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale32 covale both ? H  NAG .   O4  ? ? ? 1_555 H  NAG .   C1 ? ? H NAG 1    H NAG 2    1_555 ? ? ? ? ? ? ? 1.450 ? ? 
covale33 covale both ? H  NAG .   O4  ? ? ? 1_555 H  BMA .   C1 ? ? H NAG 2    H BMA 3    1_555 ? ? ? ? ? ? ? 1.467 ? ? 
covale34 covale both ? I  NAG .   O4  ? ? ? 1_555 I  NAG .   C1 ? ? I NAG 1    I NAG 2    1_555 ? ? ? ? ? ? ? 1.438 ? ? 
covale35 covale one  ? I  NAG .   O6  ? ? ? 1_555 I  FUC .   C1 ? ? I NAG 1    I FUC 5    1_555 ? ? ? ? ? ? ? 1.434 ? ? 
covale36 covale both ? I  NAG .   O4  ? ? ? 1_555 I  BMA .   C1 ? ? I NAG 2    I BMA 3    1_555 ? ? ? ? ? ? ? 1.452 ? ? 
covale37 covale one  ? I  BMA .   O3  ? ? ? 1_555 I  MAN .   C1 ? ? I BMA 3    I MAN 4    1_555 ? ? ? ? ? ? ? 1.442 ? ? 
covale38 covale both ? J  NAG .   O4  ? ? ? 1_555 J  NAG .   C1 ? ? J NAG 1    J NAG 2    1_555 ? ? ? ? ? ? ? 1.456 ? ? 
covale39 covale both ? K  NAG .   O4  ? ? ? 1_555 K  NAG .   C1 ? ? K NAG 1    K NAG 2    1_555 ? ? ? ? ? ? ? 1.437 ? ? 
covale40 covale both ? K  NAG .   O4  ? ? ? 1_555 K  BMA .   C1 ? ? K NAG 2    K BMA 3    1_555 ? ? ? ? ? ? ? 1.442 ? ? 
covale41 covale both ? L  NAG .   O4  ? ? ? 1_555 L  NAG .   C1 ? ? L NAG 1    L NAG 2    1_555 ? ? ? ? ? ? ? 1.445 ? ? 
covale42 covale one  ? L  NAG .   O6  ? ? ? 1_555 L  FUC .   C1 ? ? L NAG 1    L FUC 3    1_555 ? ? ? ? ? ? ? 1.424 ? ? 
covale43 covale both ? M  NAG .   O4  ? ? ? 1_555 M  NAG .   C1 ? ? M NAG 1    M NAG 2    1_555 ? ? ? ? ? ? ? 1.451 ? ? 
covale44 covale both ? N  NAG .   O4  ? ? ? 1_555 N  NAG .   C1 ? ? N NAG 1    N NAG 2    1_555 ? ? ? ? ? ? ? 1.454 ? ? 
covale45 covale both ? N  NAG .   O4  ? ? ? 1_555 N  BMA .   C1 ? ? N NAG 2    N BMA 3    1_555 ? ? ? ? ? ? ? 1.461 ? ? 
covale46 covale one  ? N  BMA .   O6  ? ? ? 1_555 N  MAN .   C1 ? ? N BMA 3    N MAN 4    1_555 ? ? ? ? ? ? ? 1.451 ? ? 
covale47 covale both ? O  NAG .   O4  ? ? ? 1_555 O  NAG .   C1 ? ? O NAG 1    O NAG 2    1_555 ? ? ? ? ? ? ? 1.452 ? ? 
covale48 covale one  ? O  NAG .   O6  ? ? ? 1_555 O  FUC .   C1 ? ? O NAG 1    O FUC 5    1_555 ? ? ? ? ? ? ? 1.434 ? ? 
covale49 covale both ? O  NAG .   O4  ? ? ? 1_555 O  BMA .   C1 ? ? O NAG 2    O BMA 3    1_555 ? ? ? ? ? ? ? 1.459 ? ? 
covale50 covale one  ? O  BMA .   O3  ? ? ? 1_555 O  MAN .   C1 ? ? O BMA 3    O MAN 4    1_555 ? ? ? ? ? ? ? 1.466 ? ? 
covale51 covale both ? P  NAG .   O4  ? ? ? 1_555 P  NAG .   C1 ? ? P NAG 1    P NAG 2    1_555 ? ? ? ? ? ? ? 1.457 ? ? 
metalc1  metalc ?    ? A  HIS 492 NE2 ? ? ? 1_555 S  CU  .   CU ? ? A HIS 520  A CU  1772 1_555 ? ? ? ? ? ? ? 2.193 ? ? 
metalc2  metalc ?    ? A  HIS 494 NE2 ? ? ? 1_555 S  CU  .   CU ? ? A HIS 522  A CU  1772 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
metalc3  metalc ?    ? A  ASP 501 OD1 ? ? ? 1_555 R  CA  .   CA ? ? A ASP 529  A CA  1771 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc4  metalc ?    ? A  LEU 502 O   ? ? ? 1_555 R  CA  .   CA ? ? A LEU 530  A CA  1771 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc5  metalc ?    ? A  ASP 503 OD1 ? ? ? 1_555 R  CA  .   CA ? ? A ASP 531  A CA  1771 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc6  metalc ?    ? A  GLU 544 OE1 ? ? ? 1_555 T  CA  .   CA ? ? A GLU 572  A CA  1773 1_555 ? ? ? ? ? ? ? 2.593 ? ? 
metalc7  metalc ?    ? A  GLU 544 OE2 ? ? ? 1_555 T  CA  .   CA ? ? A GLU 572  A CA  1773 1_555 ? ? ? ? ? ? ? 2.511 ? ? 
metalc8  metalc ?    ? A  PHE 635 O   ? ? ? 1_555 T  CA  .   CA ? ? A PHE 663  A CA  1773 1_555 ? ? ? ? ? ? ? 2.346 ? ? 
metalc9  metalc ?    ? A  ASN 637 OD1 ? ? ? 1_555 T  CA  .   CA ? ? A ASN 665  A CA  1773 1_555 ? ? ? ? ? ? ? 2.412 ? ? 
metalc10 metalc ?    ? A  GLU 639 OE1 ? ? ? 1_555 T  CA  .   CA ? ? A GLU 667  A CA  1773 1_555 ? ? ? ? ? ? ? 2.640 ? ? 
metalc11 metalc ?    ? A  ASP 645 OD1 ? ? ? 1_555 R  CA  .   CA ? ? A ASP 673  A CA  1771 1_555 ? ? ? ? ? ? ? 2.470 ? ? 
metalc12 metalc ?    ? A  LEU 646 O   ? ? ? 1_555 R  CA  .   CA ? ? A LEU 674  A CA  1771 1_555 ? ? ? ? ? ? ? 2.386 ? ? 
metalc13 metalc ?    ? A  HIS 656 ND1 ? ? ? 1_555 S  CU  .   CU ? ? A HIS 684  A CU  1772 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
metalc14 metalc ?    ? R  CA  .   CA  ? ? ? 1_555 SA HOH .   O  ? ? A CA  1771 A HOH 2105 1_555 ? ? ? ? ? ? ? 2.465 ? ? 
metalc15 metalc ?    ? S  CU  .   CU  ? ? ? 1_555 SA HOH .   O  ? ? A CU  1772 A HOH 2089 1_555 ? ? ? ? ? ? ? 2.387 ? ? 
metalc16 metalc ?    ? T  CA  .   CA  ? ? ? 1_555 SA HOH .   O  ? ? A CA  1773 A HOH 2125 1_555 ? ? ? ? ? ? ? 2.532 ? ? 
metalc17 metalc ?    ? B  HIS 492 NE2 ? ? ? 1_555 AA CU  .   CU ? ? B HIS 520  B CU  1776 1_555 ? ? ? ? ? ? ? 2.174 ? ? 
metalc18 metalc ?    ? B  HIS 494 NE2 ? ? ? 1_555 AA CU  .   CU ? ? B HIS 522  B CU  1776 1_555 ? ? ? ? ? ? ? 2.105 ? ? 
metalc19 metalc ?    ? B  ASP 501 OD1 ? ? ? 1_555 Z  CA  .   CA ? ? B ASP 529  B CA  1775 1_555 ? ? ? ? ? ? ? 2.365 ? ? 
metalc20 metalc ?    ? B  LEU 502 O   ? ? ? 1_555 Z  CA  .   CA ? ? B LEU 530  B CA  1775 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc21 metalc ?    ? B  ASP 503 OD1 ? ? ? 1_555 Z  CA  .   CA ? ? B ASP 531  B CA  1775 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc22 metalc ?    ? B  GLU 544 OE2 ? ? ? 1_555 BA CA  .   CA ? ? B GLU 572  B CA  1777 1_555 ? ? ? ? ? ? ? 2.597 ? ? 
metalc23 metalc ?    ? B  GLU 544 OE1 ? ? ? 1_555 BA CA  .   CA ? ? B GLU 572  B CA  1777 1_555 ? ? ? ? ? ? ? 2.674 ? ? 
metalc24 metalc ?    ? B  PHE 635 O   ? ? ? 1_555 BA CA  .   CA ? ? B PHE 663  B CA  1777 1_555 ? ? ? ? ? ? ? 2.262 ? ? 
metalc25 metalc ?    ? B  ASN 637 OD1 ? ? ? 1_555 BA CA  .   CA ? ? B ASN 665  B CA  1777 1_555 ? ? ? ? ? ? ? 2.345 ? ? 
metalc26 metalc ?    ? B  GLU 639 OE1 ? ? ? 1_555 BA CA  .   CA ? ? B GLU 667  B CA  1777 1_555 ? ? ? ? ? ? ? 2.346 ? ? 
metalc27 metalc ?    ? B  ASP 645 OD1 ? ? ? 1_555 Z  CA  .   CA ? ? B ASP 673  B CA  1775 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc28 metalc ?    ? B  LEU 646 N   ? ? ? 1_555 Z  CA  .   CA ? ? B LEU 674  B CA  1775 1_555 ? ? ? ? ? ? ? 3.268 ? ? 
metalc29 metalc ?    ? B  LEU 646 O   ? ? ? 1_555 Z  CA  .   CA ? ? B LEU 674  B CA  1775 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc30 metalc ?    ? B  HIS 656 ND1 ? ? ? 1_555 AA CU  .   CU ? ? B HIS 684  B CU  1776 1_555 ? ? ? ? ? ? ? 2.018 ? ? 
metalc31 metalc ?    ? Z  CA  .   CA  ? ? ? 1_555 TA HOH .   O  ? ? B CA  1775 B HOH 2095 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc32 metalc ?    ? AA CU  .   CU  ? ? ? 1_555 TA HOH .   O  ? ? B CU  1776 B HOH 2079 1_555 ? ? ? ? ? ? ? 2.669 ? ? 
metalc33 metalc ?    ? BA CA  .   CA  ? ? ? 1_555 TA HOH .   O  ? ? B CA  1777 B HOH 2117 1_555 ? ? ? ? ? ? ? 2.387 ? ? 
metalc34 metalc ?    ? BA CA  .   CA  ? ? ? 1_555 TA HOH .   O  ? ? B CA  1777 B HOH 2120 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc35 metalc ?    ? C  HIS 492 NE2 ? ? ? 1_555 GA CU  .   CU ? ? C HIS 520  C CU  1772 1_555 ? ? ? ? ? ? ? 2.120 ? ? 
metalc36 metalc ?    ? C  HIS 494 NE2 ? ? ? 1_555 GA CU  .   CU ? ? C HIS 522  C CU  1772 1_555 ? ? ? ? ? ? ? 2.090 ? ? 
metalc37 metalc ?    ? C  ASP 501 OD1 ? ? ? 1_555 FA CA  .   CA ? ? C ASP 529  C CA  1771 1_555 ? ? ? ? ? ? ? 2.235 ? ? 
metalc38 metalc ?    ? C  LEU 502 O   ? ? ? 1_555 FA CA  .   CA ? ? C LEU 530  C CA  1771 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc39 metalc ?    ? C  ASP 503 OD1 ? ? ? 1_555 FA CA  .   CA ? ? C ASP 531  C CA  1771 1_555 ? ? ? ? ? ? ? 2.277 ? ? 
metalc40 metalc ?    ? C  GLU 544 OE2 ? ? ? 1_555 HA CA  .   CA ? ? C GLU 572  C CA  1773 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc41 metalc ?    ? C  GLU 544 OE1 ? ? ? 1_555 HA CA  .   CA ? ? C GLU 572  C CA  1773 1_555 ? ? ? ? ? ? ? 2.557 ? ? 
metalc42 metalc ?    ? C  PHE 635 O   ? ? ? 1_555 HA CA  .   CA ? ? C PHE 663  C CA  1773 1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc43 metalc ?    ? C  ASN 637 OD1 ? ? ? 1_555 HA CA  .   CA ? ? C ASN 665  C CA  1773 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc44 metalc ?    ? C  GLU 639 OE1 ? ? ? 1_555 HA CA  .   CA ? ? C GLU 667  C CA  1773 1_555 ? ? ? ? ? ? ? 2.560 ? ? 
metalc45 metalc ?    ? C  ASP 645 OD1 ? ? ? 1_555 FA CA  .   CA ? ? C ASP 673  C CA  1771 1_555 ? ? ? ? ? ? ? 2.439 ? ? 
metalc46 metalc ?    ? C  LEU 646 O   ? ? ? 1_555 FA CA  .   CA ? ? C LEU 674  C CA  1771 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc47 metalc ?    ? C  HIS 656 ND1 ? ? ? 1_555 GA CU  .   CU ? ? C HIS 684  C CU  1772 1_555 ? ? ? ? ? ? ? 2.124 ? ? 
metalc48 metalc ?    ? FA CA  .   CA  ? ? ? 1_555 UA HOH .   O  ? ? C CA  1771 C HOH 2121 1_555 ? ? ? ? ? ? ? 2.354 ? ? 
metalc49 metalc ?    ? GA CU  .   CU  ? ? ? 1_555 UA HOH .   O  ? ? C CU  1772 C HOH 2078 1_555 ? ? ? ? ? ? ? 2.678 ? ? 
metalc50 metalc ?    ? D  HIS 492 NE2 ? ? ? 1_555 OA CU  .   CU ? ? D HIS 520  D CU  1777 1_555 ? ? ? ? ? ? ? 2.216 ? ? 
metalc51 metalc ?    ? D  HIS 494 NE2 ? ? ? 1_555 OA CU  .   CU ? ? D HIS 522  D CU  1777 1_555 ? ? ? ? ? ? ? 2.054 ? ? 
metalc52 metalc ?    ? D  ASP 501 OD1 ? ? ? 1_555 NA CA  .   CA ? ? D ASP 529  D CA  1776 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc53 metalc ?    ? D  LEU 502 O   ? ? ? 1_555 NA CA  .   CA ? ? D LEU 530  D CA  1776 1_555 ? ? ? ? ? ? ? 2.296 ? ? 
metalc54 metalc ?    ? D  ASP 503 OD1 ? ? ? 1_555 NA CA  .   CA ? ? D ASP 531  D CA  1776 1_555 ? ? ? ? ? ? ? 2.238 ? ? 
metalc55 metalc ?    ? D  GLU 544 OE2 ? ? ? 1_555 PA CA  .   CA ? ? D GLU 572  D CA  1778 1_555 ? ? ? ? ? ? ? 2.504 ? ? 
metalc56 metalc ?    ? D  GLU 544 OE1 ? ? ? 1_555 PA CA  .   CA ? ? D GLU 572  D CA  1778 1_555 ? ? ? ? ? ? ? 2.752 ? ? 
metalc57 metalc ?    ? D  PHE 635 O   ? ? ? 1_555 PA CA  .   CA ? ? D PHE 663  D CA  1778 1_555 ? ? ? ? ? ? ? 2.164 ? ? 
metalc58 metalc ?    ? D  ASN 637 OD1 ? ? ? 1_555 PA CA  .   CA ? ? D ASN 665  D CA  1778 1_555 ? ? ? ? ? ? ? 2.714 ? ? 
metalc59 metalc ?    ? D  GLU 639 OE1 ? ? ? 1_555 PA CA  .   CA ? ? D GLU 667  D CA  1778 1_555 ? ? ? ? ? ? ? 2.422 ? ? 
metalc60 metalc ?    ? D  ASP 645 OD1 ? ? ? 1_555 NA CA  .   CA ? ? D ASP 673  D CA  1776 1_555 ? ? ? ? ? ? ? 2.151 ? ? 
metalc61 metalc ?    ? D  LEU 646 O   ? ? ? 1_555 NA CA  .   CA ? ? D LEU 674  D CA  1776 1_555 ? ? ? ? ? ? ? 2.351 ? ? 
metalc62 metalc ?    ? D  LEU 646 N   ? ? ? 1_555 NA CA  .   CA ? ? D LEU 674  D CA  1776 1_555 ? ? ? ? ? ? ? 3.328 ? ? 
metalc63 metalc ?    ? D  HIS 656 ND1 ? ? ? 1_555 OA CU  .   CU ? ? D HIS 684  D CU  1777 1_555 ? ? ? ? ? ? ? 2.101 ? ? 
metalc64 metalc ?    ? NA CA  .   CA  ? ? ? 1_555 VA HOH .   O  ? ? D CA  1776 D HOH 2092 1_555 ? ? ? ? ? ? ? 2.398 ? ? 
metalc65 metalc ?    ? OA CU  .   CU  ? ? ? 1_555 VA HOH .   O  ? ? D CU  1777 D HOH 2068 1_555 ? ? ? ? ? ? ? 2.404 ? ? 
metalc66 metalc ?    ? PA CA  .   CA  ? ? ? 1_555 VA HOH .   O  ? ? D CA  1778 D HOH 2113 1_555 ? ? ? ? ? ? ? 2.488 ? ? 
metalc67 metalc ?    ? PA CA  .   CA  ? ? ? 1_555 VA HOH .   O  ? ? D CA  1778 D HOH 2114 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLY 116 A . ? GLY 144 A PRO 117 A ? PRO 145 A 1 -7.59 
2  LEU 118 A . ? LEU 146 A PRO 119 A ? PRO 147 A 1 18.90 
3  ALA 186 A . ? ALA 214 A PRO 187 A ? PRO 215 A 1 -2.12 
4  ILE 663 A . ? ILE 691 A PRO 664 A ? PRO 692 A 1 -0.75 
5  GLY 116 B . ? GLY 144 B PRO 117 B ? PRO 145 B 1 -9.38 
6  LEU 118 B . ? LEU 146 B PRO 119 B ? PRO 147 B 1 11.37 
7  ALA 186 B . ? ALA 214 B PRO 187 B ? PRO 215 B 1 -1.90 
8  ILE 663 B . ? ILE 691 B PRO 664 B ? PRO 692 B 1 6.08  
9  GLY 116 C . ? GLY 144 C PRO 117 C ? PRO 145 C 1 -4.47 
10 LEU 118 C . ? LEU 146 C PRO 119 C ? PRO 147 C 1 16.69 
11 ALA 186 C . ? ALA 214 C PRO 187 C ? PRO 215 C 1 4.32  
12 ILE 663 C . ? ILE 691 C PRO 664 C ? PRO 692 C 1 5.64  
13 GLY 116 D . ? GLY 144 D PRO 117 D ? PRO 145 D 1 -8.20 
14 LEU 118 D . ? LEU 146 D PRO 119 D ? PRO 147 D 1 7.87  
15 ALA 186 D . ? ALA 214 D PRO 187 D ? PRO 215 D 1 0.05  
16 ILE 663 D . ? ILE 691 D PRO 664 D ? PRO 692 D 1 5.32  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7  ? 
AB ? 3  ? 
AC ? 5  ? 
AD ? 2  ? 
AE ? 3  ? 
BA ? 7  ? 
BB ? 3  ? 
BC ? 5  ? 
BD ? 3  ? 
CA ? 7  ? 
CB ? 3  ? 
CC ? 5  ? 
CD ? 2  ? 
CE ? 3  ? 
DA ? 18 ? 
DB ? 5  ? 
DC ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? anti-parallel 
AA 3  4  ? anti-parallel 
AA 4  5  ? anti-parallel 
AA 5  6  ? anti-parallel 
AA 6  7  ? anti-parallel 
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AC 1  2  ? anti-parallel 
AC 2  3  ? anti-parallel 
AC 3  4  ? anti-parallel 
AC 4  5  ? anti-parallel 
AD 1  2  ? anti-parallel 
AE 1  2  ? anti-parallel 
AE 2  3  ? anti-parallel 
BA 1  2  ? anti-parallel 
BA 2  3  ? anti-parallel 
BA 3  4  ? anti-parallel 
BA 4  5  ? anti-parallel 
BA 5  6  ? anti-parallel 
BA 6  7  ? anti-parallel 
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BC 1  2  ? anti-parallel 
BC 2  3  ? anti-parallel 
BC 3  4  ? anti-parallel 
BC 4  5  ? anti-parallel 
BD 1  2  ? anti-parallel 
BD 2  3  ? anti-parallel 
CA 1  2  ? anti-parallel 
CA 2  3  ? anti-parallel 
CA 3  4  ? anti-parallel 
CA 4  5  ? anti-parallel 
CA 5  6  ? anti-parallel 
CA 6  7  ? anti-parallel 
CB 1  2  ? anti-parallel 
CB 2  3  ? anti-parallel 
CC 1  2  ? anti-parallel 
CC 2  3  ? anti-parallel 
CC 3  4  ? anti-parallel 
CC 4  5  ? anti-parallel 
CD 1  2  ? anti-parallel 
CE 1  2  ? anti-parallel 
CE 2  3  ? anti-parallel 
DA 1  2  ? anti-parallel 
DA 2  3  ? anti-parallel 
DA 3  4  ? anti-parallel 
DA 5  6  ? anti-parallel 
DA 6  7  ? anti-parallel 
DA 7  8  ? anti-parallel 
DA 8  9  ? parallel      
DA 9  10 ? parallel      
DA 10 11 ? anti-parallel 
DA 12 13 ? anti-parallel 
DA 14 15 ? anti-parallel 
DA 15 16 ? anti-parallel 
DA 17 18 ? anti-parallel 
DB 1  2  ? anti-parallel 
DB 2  3  ? anti-parallel 
DB 3  4  ? anti-parallel 
DB 4  5  ? anti-parallel 
DC 1  2  ? anti-parallel 
DC 2  3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  TYR A 123 ? ASP A 126 ? TYR A 151 ASP A 154 
AA 2  ASN A 109 ? GLY A 116 ? ASN A 137 GLY A 144 
AA 3  GLU A 95  ? PHE A 102 ? GLU A 123 PHE A 130 
AA 4  ASN A 66  ? GLN A 74  ? ASN A 94  GLN A 102 
AA 5  THR A 381 ? LEU A 389 ? THR A 409 LEU A 417 
AA 6  LYS A 395 ? SER A 417 ? LYS A 423 SER A 445 
AA 7  TYR A 423 ? LEU A 440 ? TYR A 451 LEU A 468 
AB 1  TYR A 123 ? ASP A 126 ? TYR A 151 ASP A 154 
AB 2  ASN A 109 ? GLY A 116 ? ASN A 137 GLY A 144 
AB 3  LEU A 136 ? PRO A 137 ? LEU A 164 PRO A 165 
AC 1  LEU A 180 ? MET A 183 ? LEU A 208 MET A 211 
AC 2  ALA A 196 ? TYR A 203 ? ALA A 224 TYR A 231 
AC 3  HIS A 214 ? ASN A 222 ? HIS A 242 ASN A 250 
AC 4  THR A 232 ? TYR A 238 ? THR A 260 TYR A 266 
AC 5  ARG A 241 ? TYR A 243 ? ARG A 269 TYR A 271 
AD 1  LEU A 286 ? PHE A 288 ? LEU A 314 PHE A 316 
AD 2  LEU B 286 ? PHE B 288 ? LEU B 314 PHE B 316 
AE 1  SER A 469 ? PHE A 471 ? SER A 497 PHE A 499 
AE 2  THR A 487 ? THR A 490 ? THR A 515 THR A 518 
AE 3  GLY A 480 ? SER A 484 ? GLY A 508 SER A 512 
BA 1  TYR B 123 ? ASP B 126 ? TYR B 151 ASP B 154 
BA 2  ASN B 109 ? LEU B 118 ? ASN B 137 LEU B 146 
BA 3  ARG B 94  ? PHE B 102 ? ARG B 122 PHE B 130 
BA 4  ASN B 66  ? GLN B 74  ? ASN B 94  GLN B 102 
BA 5  THR B 381 ? LEU B 389 ? THR B 409 LEU B 417 
BA 6  LYS B 395 ? SER B 417 ? LYS B 423 SER B 445 
BA 7  TYR B 423 ? LEU B 440 ? TYR B 451 LEU B 468 
BB 1  TYR B 123 ? ASP B 126 ? TYR B 151 ASP B 154 
BB 2  ASN B 109 ? LEU B 118 ? ASN B 137 LEU B 146 
BB 3  LEU B 136 ? PRO B 137 ? LEU B 164 PRO B 165 
BC 1  LEU B 180 ? MET B 183 ? LEU B 208 MET B 211 
BC 2  ALA B 196 ? TYR B 203 ? ALA B 224 TYR B 231 
BC 3  HIS B 214 ? ASN B 222 ? HIS B 242 ASN B 250 
BC 4  THR B 232 ? TYR B 238 ? THR B 260 TYR B 266 
BC 5  ARG B 241 ? TYR B 243 ? ARG B 269 TYR B 271 
BD 1  SER B 469 ? PHE B 471 ? SER B 497 PHE B 499 
BD 2  THR B 487 ? THR B 490 ? THR B 515 THR B 518 
BD 3  GLY B 480 ? SER B 484 ? GLY B 508 SER B 512 
CA 1  TYR C 123 ? ASP C 126 ? TYR C 151 ASP C 154 
CA 2  ASN C 109 ? GLY C 116 ? ASN C 137 GLY C 144 
CA 3  GLU C 95  ? PHE C 102 ? GLU C 123 PHE C 130 
CA 4  ASN C 66  ? GLN C 74  ? ASN C 94  GLN C 102 
CA 5  THR C 381 ? LEU C 389 ? THR C 409 LEU C 417 
CA 6  LYS C 395 ? SER C 417 ? LYS C 423 SER C 445 
CA 7  TYR C 423 ? LEU C 440 ? TYR C 451 LEU C 468 
CB 1  TYR C 123 ? ASP C 126 ? TYR C 151 ASP C 154 
CB 2  ASN C 109 ? GLY C 116 ? ASN C 137 GLY C 144 
CB 3  LEU C 136 ? PRO C 137 ? LEU C 164 PRO C 165 
CC 1  LEU C 180 ? MET C 183 ? LEU C 208 MET C 211 
CC 2  ALA C 196 ? TYR C 203 ? ALA C 224 TYR C 231 
CC 3  HIS C 214 ? ASN C 222 ? HIS C 242 ASN C 250 
CC 4  THR C 232 ? TYR C 238 ? THR C 260 TYR C 266 
CC 5  ARG C 241 ? TYR C 243 ? ARG C 269 TYR C 271 
CD 1  LEU C 286 ? PHE C 288 ? LEU C 314 PHE C 316 
CD 2  LEU D 286 ? PHE D 288 ? LEU D 314 PHE D 316 
CE 1  SER C 469 ? PHE C 471 ? SER C 497 PHE C 499 
CE 2  THR C 487 ? THR C 490 ? THR C 515 THR C 518 
CE 3  GLY C 480 ? SER C 484 ? GLY C 508 SER C 512 
DA 1  TYR D 123 ? ASP D 126 ? TYR D 151 ASP D 154 
DA 2  ASN D 109 ? GLY D 116 ? ASN D 137 GLY D 144 
DA 3  LEU D 136 ? PRO D 137 ? LEU D 164 PRO D 165 
DA 4  ASN D 109 ? GLY D 116 ? ASN D 137 GLY D 144 
DA 5  PHE D 295 ? GLN D 298 ? PHE D 323 GLN D 326 
DA 6  ARG D 301 ? SER D 304 ? ARG D 329 SER D 332 
DA 7  TRP D 307 ? GLY D 314 ? TRP D 335 GLY D 342 
DA 8  GLY D 318 ? PHE D 326 ? GLY D 346 PHE D 354 
DA 9  GLU D 329 ? TYR D 344 ? GLU D 357 TYR D 372 
DA 10 ARG D 355 ? VAL D 357 ? ARG D 383 VAL D 385 
DA 11 GLU D 329 ? TYR D 344 ? GLU D 357 TYR D 372 
DA 12 SER D 526 ? LEU D 541 ? SER D 554 LEU D 569 
DA 13 GLU D 508 ? VAL D 523 ? GLU D 536 VAL D 551 
DA 14 ALA D 548 ? LEU D 550 ? ALA D 576 LEU D 578 
DA 15 TYR D 602 ? GLN D 608 ? TYR D 630 GLN D 636 
DA 16 LYS D 644 ? HIS D 656 ? LYS D 672 HIS D 684 
DA 17 ILE D 695 ? ARG D 698 ? ILE D 723 ARG D 726 
DA 18 TYR D 423 ? LEU D 440 ? TYR D 451 LEU D 468 
DB 1  LEU D 180 ? MET D 183 ? LEU D 208 MET D 211 
DB 2  ALA D 196 ? TYR D 203 ? ALA D 224 TYR D 231 
DB 3  HIS D 214 ? ASN D 222 ? HIS D 242 ASN D 250 
DB 4  THR D 232 ? TYR D 238 ? THR D 260 TYR D 266 
DB 5  ARG D 241 ? TYR D 243 ? ARG D 269 TYR D 271 
DC 1  SER D 469 ? PHE D 471 ? SER D 497 PHE D 499 
DC 2  THR D 487 ? THR D 490 ? THR D 515 THR D 518 
DC 3  GLY D 480 ? SER D 484 ? GLY D 508 SER D 512 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N ARG A 125 ? N ARG A 153 O VAL A 114 ? O VAL A 142 
AA 2  3  N VAL A 115 ? N VAL A 143 O ALA A 96  ? O ALA A 124 
AA 3  4  N PHE A 101 ? N PHE A 129 O CYS A 67  ? O CYS A 95  
AA 4  5  N VAL A 71  ? N VAL A 99  O LEU A 388 ? O LEU A 416 
AA 5  6  N PHE A 387 ? N PHE A 415 O LYS A 395 ? O LYS A 423 
AA 6  7  N SER A 417 ? N SER A 445 O TYR A 423 ? O TYR A 451 
AB 1  2  N ARG A 125 ? N ARG A 153 O VAL A 114 ? O VAL A 142 
AB 2  3  N VAL A 110 ? N VAL A 138 O LEU A 136 ? O LEU A 164 
AC 1  2  N MET A 183 ? N MET A 211 O GLY A 200 ? O GLY A 228 
AC 2  3  O LEU A 201 ? O LEU A 229 N VAL A 215 ? N VAL A 243 
AC 3  4  N ASN A 222 ? N ASN A 250 O THR A 232 ? O THR A 260 
AC 4  5  N TYR A 238 ? N TYR A 266 O ARG A 241 ? O ARG A 269 
AD 1  2  N PHE A 288 ? N PHE A 316 O LEU B 286 ? O LEU B 314 
AE 1  2  N ALA A 470 ? N ALA A 498 O LEU A 488 ? O LEU A 516 
AE 2  3  N GLY A 489 ? N GLY A 517 O ASN A 481 ? O ASN A 509 
BA 1  2  N ARG B 125 ? N ARG B 153 O VAL B 114 ? O VAL B 142 
BA 2  3  N LEU B 118 ? N LEU B 146 O ARG B 94  ? O ARG B 122 
BA 3  4  N PHE B 101 ? N PHE B 129 O CYS B 67  ? O CYS B 95  
BA 4  5  N VAL B 71  ? N VAL B 99  O LEU B 388 ? O LEU B 416 
BA 5  6  N PHE B 387 ? N PHE B 415 O LYS B 395 ? O LYS B 423 
BA 6  7  N SER B 417 ? N SER B 445 O TYR B 423 ? O TYR B 451 
BB 1  2  N ARG B 125 ? N ARG B 153 O VAL B 114 ? O VAL B 142 
BB 2  3  N VAL B 110 ? N VAL B 138 O LEU B 136 ? O LEU B 164 
BC 1  2  N MET B 183 ? N MET B 211 O GLY B 200 ? O GLY B 228 
BC 2  3  O LEU B 201 ? O LEU B 229 N VAL B 215 ? N VAL B 243 
BC 3  4  N ASN B 222 ? N ASN B 250 O THR B 232 ? O THR B 260 
BC 4  5  N TYR B 238 ? N TYR B 266 O ARG B 241 ? O ARG B 269 
BD 1  2  N ALA B 470 ? N ALA B 498 O LEU B 488 ? O LEU B 516 
BD 2  3  N GLY B 489 ? N GLY B 517 O ASN B 481 ? O ASN B 509 
CA 1  2  N ARG C 125 ? N ARG C 153 O VAL C 114 ? O VAL C 142 
CA 2  3  N VAL C 115 ? N VAL C 143 O ALA C 96  ? O ALA C 124 
CA 3  4  N PHE C 101 ? N PHE C 129 O CYS C 67  ? O CYS C 95  
CA 4  5  N VAL C 71  ? N VAL C 99  O LEU C 388 ? O LEU C 416 
CA 5  6  N PHE C 387 ? N PHE C 415 O LYS C 395 ? O LYS C 423 
CA 6  7  N SER C 417 ? N SER C 445 O TYR C 423 ? O TYR C 451 
CB 1  2  N ARG C 125 ? N ARG C 153 O VAL C 114 ? O VAL C 142 
CB 2  3  N VAL C 110 ? N VAL C 138 O LEU C 136 ? O LEU C 164 
CC 1  2  N MET C 183 ? N MET C 211 O GLY C 200 ? O GLY C 228 
CC 2  3  O LEU C 201 ? O LEU C 229 N VAL C 215 ? N VAL C 243 
CC 3  4  N ASN C 222 ? N ASN C 250 O THR C 232 ? O THR C 260 
CC 4  5  N TYR C 238 ? N TYR C 266 O ARG C 241 ? O ARG C 269 
CD 1  2  N PHE C 288 ? N PHE C 316 O LEU D 286 ? O LEU D 314 
CE 1  2  N ALA C 470 ? N ALA C 498 O LEU C 488 ? O LEU C 516 
CE 2  3  N GLY C 489 ? N GLY C 517 O ASN C 481 ? O ASN C 509 
DA 1  2  N ARG D 125 ? N ARG D 153 O VAL D 114 ? O VAL D 142 
DA 2  3  N VAL D 110 ? N VAL D 138 O LEU D 136 ? O LEU D 164 
DA 3  4  N LEU D 136 ? N LEU D 164 O VAL D 110 ? O VAL D 138 
DA 5  6  N GLN D 298 ? N GLN D 326 O ARG D 301 ? O ARG D 329 
DA 6  7  N SER D 304 ? N SER D 332 O TRP D 307 ? O TRP D 335 
DA 7  8  N GLY D 314 ? N GLY D 342 O GLY D 318 ? O GLY D 346 
DA 8  9  N PHE D 326 ? N PHE D 354 O GLU D 329 ? O GLU D 357 
DA 9  10 N ALA D 342 ? N ALA D 370 O TYR D 356 ? O TYR D 384 
DA 10 11 N TYR D 356 ? N TYR D 384 O ALA D 342 ? O ALA D 370 
DA 12 13 N LEU D 541 ? N LEU D 569 O VAL D 511 ? O VAL D 539 
DA 14 15 O PHE D 549 ? O PHE D 577 N GLN D 603 ? N GLN D 631 
DA 15 16 N THR D 607 ? N THR D 635 O VAL D 647 ? O VAL D 675 
DA 17 18 N PHE D 697 ? N PHE D 725 O PHE D 424 ? O PHE D 452 
DB 1  2  N MET D 183 ? N MET D 211 O GLY D 200 ? O GLY D 228 
DB 2  3  O LEU D 201 ? O LEU D 229 N VAL D 215 ? N VAL D 243 
DB 3  4  N ASN D 222 ? N ASN D 250 O THR D 232 ? O THR D 260 
DB 4  5  N TYR D 238 ? N TYR D 266 O ARG D 241 ? O ARG D 269 
DC 1  2  N ALA D 470 ? N ALA D 498 O LEU D 488 ? O LEU D 516 
DC 2  3  N GLY D 489 ? N GLY D 517 O ASN D 481 ? O ASN D 509 
# 
_database_PDB_matrix.entry_id          2C10 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2C10 
_atom_sites.fract_transf_matrix[1][1]   0.007678 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007678 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004514 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
CU 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . CYS A  1  13  ? 3.103   20.001  9.270   1.00 86.52  ? 41   CYS A N   1 
ATOM   2     C  CA  . CYS A  1  13  ? 4.535   20.205  8.912   1.00 86.62  ? 41   CYS A CA  1 
ATOM   3     C  C   . CYS A  1  13  ? 5.397   19.116  9.545   1.00 86.39  ? 41   CYS A C   1 
ATOM   4     O  O   . CYS A  1  13  ? 6.623   19.137  9.444   1.00 86.15  ? 41   CYS A O   1 
ATOM   5     C  CB  . CYS A  1  13  ? 5.018   21.595  9.356   1.00 86.74  ? 41   CYS A CB  1 
ATOM   6     S  SG  . CYS A  1  13  ? 3.843   22.987  9.127   1.00 87.58  ? 41   CYS A SG  1 
ATOM   7     N  N   . GLN A  1  30  ? 32.277  12.691  23.665  1.00 45.19  ? 58   GLN A N   1 
ATOM   8     C  CA  . GLN A  1  30  ? 32.084  14.147  23.628  1.00 45.36  ? 58   GLN A CA  1 
ATOM   9     C  C   . GLN A  1  30  ? 33.145  14.929  24.427  1.00 44.43  ? 58   GLN A C   1 
ATOM   10    O  O   . GLN A  1  30  ? 32.872  15.451  25.509  1.00 44.73  ? 58   GLN A O   1 
ATOM   11    C  CB  . GLN A  1  30  ? 30.656  14.534  24.065  1.00 45.46  ? 58   GLN A CB  1 
ATOM   12    C  CG  . GLN A  1  30  ? 29.564  14.249  23.003  1.00 46.78  ? 58   GLN A CG  1 
ATOM   13    C  CD  . GLN A  1  30  ? 28.388  15.258  23.000  1.00 46.62  ? 58   GLN A CD  1 
ATOM   14    O  OE1 . GLN A  1  30  ? 28.270  16.127  23.879  1.00 47.19  ? 58   GLN A OE1 1 
ATOM   15    N  NE2 . GLN A  1  30  ? 27.514  15.134  21.992  1.00 47.13  ? 58   GLN A NE2 1 
ATOM   16    N  N   . LEU A  1  31  ? 34.341  15.020  23.846  1.00 43.49  ? 59   LEU A N   1 
ATOM   17    C  CA  . LEU A  1  31  ? 35.536  15.664  24.424  1.00 42.19  ? 59   LEU A CA  1 
ATOM   18    C  C   . LEU A  1  31  ? 35.383  17.113  24.912  1.00 41.39  ? 59   LEU A C   1 
ATOM   19    O  O   . LEU A  1  31  ? 36.099  17.556  25.813  1.00 41.01  ? 59   LEU A O   1 
ATOM   20    C  CB  . LEU A  1  31  ? 36.668  15.631  23.379  1.00 42.19  ? 59   LEU A CB  1 
ATOM   21    C  CG  . LEU A  1  31  ? 37.771  14.572  23.445  1.00 42.56  ? 59   LEU A CG  1 
ATOM   22    C  CD1 . LEU A  1  31  ? 37.274  13.185  23.894  1.00 43.79  ? 59   LEU A CD1 1 
ATOM   23    C  CD2 . LEU A  1  31  ? 38.473  14.478  22.110  1.00 42.04  ? 59   LEU A CD2 1 
ATOM   24    N  N   . PHE A  1  32  ? 34.465  17.848  24.301  1.00 40.44  ? 60   PHE A N   1 
ATOM   25    C  CA  . PHE A  1  32  ? 34.446  19.292  24.433  1.00 39.62  ? 60   PHE A CA  1 
ATOM   26    C  C   . PHE A  1  32  ? 33.201  19.801  25.136  1.00 39.46  ? 60   PHE A C   1 
ATOM   27    O  O   . PHE A  1  32  ? 33.040  21.011  25.330  1.00 39.29  ? 60   PHE A O   1 
ATOM   28    C  CB  . PHE A  1  32  ? 34.555  19.930  23.050  1.00 39.41  ? 60   PHE A CB  1 
ATOM   29    C  CG  . PHE A  1  32  ? 35.811  19.582  22.321  1.00 38.41  ? 60   PHE A CG  1 
ATOM   30    C  CD1 . PHE A  1  32  ? 35.776  18.725  21.234  1.00 38.24  ? 60   PHE A CD1 1 
ATOM   31    C  CD2 . PHE A  1  32  ? 37.031  20.120  22.717  1.00 37.97  ? 60   PHE A CD2 1 
ATOM   32    C  CE1 . PHE A  1  32  ? 36.944  18.401  20.542  1.00 38.35  ? 60   PHE A CE1 1 
ATOM   33    C  CE2 . PHE A  1  32  ? 38.197  19.812  22.042  1.00 37.93  ? 60   PHE A CE2 1 
ATOM   34    C  CZ  . PHE A  1  32  ? 38.158  18.950  20.947  1.00 38.29  ? 60   PHE A CZ  1 
ATOM   35    N  N   . ALA A  1  33  ? 32.321  18.878  25.508  1.00 39.19  ? 61   ALA A N   1 
ATOM   36    C  CA  . ALA A  1  33  ? 31.113  19.229  26.224  1.00 39.32  ? 61   ALA A CA  1 
ATOM   37    C  C   . ALA A  1  33  ? 31.461  19.819  27.587  1.00 39.40  ? 61   ALA A C   1 
ATOM   38    O  O   . ALA A  1  33  ? 32.293  19.268  28.303  1.00 39.10  ? 61   ALA A O   1 
ATOM   39    C  CB  . ALA A  1  33  ? 30.228  18.004  26.380  1.00 39.41  ? 61   ALA A CB  1 
ATOM   40    N  N   . ASP A  1  34  ? 30.845  20.953  27.936  1.00 39.89  ? 62   ASP A N   1 
ATOM   41    C  CA  . ASP A  1  34  ? 30.926  21.474  29.309  1.00 39.88  ? 62   ASP A CA  1 
ATOM   42    C  C   . ASP A  1  34  ? 30.527  20.365  30.291  1.00 39.76  ? 62   ASP A C   1 
ATOM   43    O  O   . ASP A  1  34  ? 29.781  19.454  29.931  1.00 39.55  ? 62   ASP A O   1 
ATOM   44    C  CB  . ASP A  1  34  ? 30.018  22.681  29.481  1.00 39.72  ? 62   ASP A CB  1 
ATOM   45    C  CG  . ASP A  1  34  ? 30.409  23.850  28.581  1.00 41.09  ? 62   ASP A CG  1 
ATOM   46    O  OD1 . ASP A  1  34  ? 29.479  24.594  28.168  1.00 42.95  ? 62   ASP A OD1 1 
ATOM   47    O  OD2 . ASP A  1  34  ? 31.625  24.027  28.286  1.00 38.83  ? 62   ASP A OD2 1 
ATOM   48    N  N   . LEU A  1  35  ? 31.037  20.427  31.516  1.00 39.93  ? 63   LEU A N   1 
ATOM   49    C  CA  . LEU A  1  35  ? 30.688  19.429  32.525  1.00 40.11  ? 63   LEU A CA  1 
ATOM   50    C  C   . LEU A  1  35  ? 29.199  19.461  32.833  1.00 40.25  ? 63   LEU A C   1 
ATOM   51    O  O   . LEU A  1  35  ? 28.606  20.538  32.958  1.00 40.32  ? 63   LEU A O   1 
ATOM   52    C  CB  . LEU A  1  35  ? 31.472  19.653  33.810  1.00 40.08  ? 63   LEU A CB  1 
ATOM   53    C  CG  . LEU A  1  35  ? 32.992  19.749  33.735  1.00 40.37  ? 63   LEU A CG  1 
ATOM   54    C  CD1 . LEU A  1  35  ? 33.517  20.071  35.112  1.00 40.38  ? 63   LEU A CD1 1 
ATOM   55    C  CD2 . LEU A  1  35  ? 33.619  18.464  33.206  1.00 40.57  ? 63   LEU A CD2 1 
ATOM   56    N  N   . SER A  1  36  ? 28.609  18.275  32.948  1.00 40.37  ? 64   SER A N   1 
ATOM   57    C  CA  . SER A  1  36  ? 27.191  18.113  33.269  1.00 40.55  ? 64   SER A CA  1 
ATOM   58    C  C   . SER A  1  36  ? 26.928  18.256  34.775  1.00 40.93  ? 64   SER A C   1 
ATOM   59    O  O   . SER A  1  36  ? 27.865  18.304  35.566  1.00 40.94  ? 64   SER A O   1 
ATOM   60    C  CB  . SER A  1  36  ? 26.728  16.740  32.806  1.00 40.16  ? 64   SER A CB  1 
ATOM   61    O  OG  . SER A  1  36  ? 27.381  15.741  33.562  1.00 39.66  ? 64   SER A OG  1 
ATOM   62    N  N   . ARG A  1  37  ? 25.651  18.311  35.159  1.00 41.43  ? 65   ARG A N   1 
ATOM   63    C  CA  . ARG A  1  37  ? 25.237  18.353  36.569  1.00 41.89  ? 65   ARG A CA  1 
ATOM   64    C  C   . ARG A  1  37  ? 25.947  17.290  37.410  1.00 41.47  ? 65   ARG A C   1 
ATOM   65    O  O   . ARG A  1  37  ? 26.623  17.611  38.395  1.00 41.18  ? 65   ARG A O   1 
ATOM   66    C  CB  . ARG A  1  37  ? 23.714  18.185  36.694  1.00 42.25  ? 65   ARG A CB  1 
ATOM   67    C  CG  . ARG A  1  37  ? 22.923  19.419  36.285  1.00 44.70  ? 65   ARG A CG  1 
ATOM   68    C  CD  . ARG A  1  37  ? 21.504  19.425  36.865  1.00 47.84  ? 65   ARG A CD  1 
ATOM   69    N  NE  . ARG A  1  37  ? 21.070  20.796  37.160  1.00 48.85  ? 65   ARG A NE  1 
ATOM   70    C  CZ  . ARG A  1  37  ? 20.872  21.287  38.385  1.00 49.72  ? 65   ARG A CZ  1 
ATOM   71    N  NH1 . ARG A  1  37  ? 21.044  20.517  39.458  1.00 50.03  ? 65   ARG A NH1 1 
ATOM   72    N  NH2 . ARG A  1  37  ? 20.486  22.553  38.541  1.00 49.77  ? 65   ARG A NH2 1 
ATOM   73    N  N   . GLU A  1  38  ? 25.798  16.034  36.991  1.00 40.94  ? 66   GLU A N   1 
ATOM   74    C  CA  . GLU A  1  38  ? 26.399  14.889  37.662  1.00 40.81  ? 66   GLU A CA  1 
ATOM   75    C  C   . GLU A  1  38  ? 27.915  15.029  37.821  1.00 39.94  ? 66   GLU A C   1 
ATOM   76    O  O   . GLU A  1  38  ? 28.467  14.696  38.871  1.00 40.14  ? 66   GLU A O   1 
ATOM   77    C  CB  . GLU A  1  38  ? 26.072  13.603  36.899  1.00 40.78  ? 66   GLU A CB  1 
ATOM   78    C  CG  . GLU A  1  38  ? 25.962  12.368  37.783  1.00 41.64  ? 66   GLU A CG  1 
ATOM   79    C  CD  . GLU A  1  38  ? 25.840  11.068  36.988  1.00 41.70  ? 66   GLU A CD  1 
ATOM   80    O  OE1 . GLU A  1  38  ? 26.038  11.083  35.753  1.00 41.76  ? 66   GLU A OE1 1 
ATOM   81    O  OE2 . GLU A  1  38  ? 25.550  10.021  37.609  1.00 43.09  ? 66   GLU A OE2 1 
ATOM   82    N  N   . GLU A  1  39  ? 28.578  15.526  36.784  1.00 39.10  ? 67   GLU A N   1 
ATOM   83    C  CA  . GLU A  1  39  ? 30.031  15.710  36.825  1.00 38.29  ? 67   GLU A CA  1 
ATOM   84    C  C   . GLU A  1  39  ? 30.449  16.824  37.794  1.00 38.08  ? 67   GLU A C   1 
ATOM   85    O  O   . GLU A  1  39  ? 31.397  16.657  38.571  1.00 38.52  ? 67   GLU A O   1 
ATOM   86    C  CB  . GLU A  1  39  ? 30.597  15.946  35.424  1.00 38.03  ? 67   GLU A CB  1 
ATOM   87    C  CG  . GLU A  1  39  ? 30.491  14.732  34.504  1.00 37.18  ? 67   GLU A CG  1 
ATOM   88    C  CD  . GLU A  1  39  ? 30.915  15.030  33.068  1.00 37.94  ? 67   GLU A CD  1 
ATOM   89    O  OE1 . GLU A  1  39  ? 31.540  14.149  32.432  1.00 36.73  ? 67   GLU A OE1 1 
ATOM   90    O  OE2 . GLU A  1  39  ? 30.630  16.148  32.573  1.00 37.40  ? 67   GLU A OE2 1 
ATOM   91    N  N   . LEU A  1  40  ? 29.728  17.941  37.772  1.00 37.21  ? 68   LEU A N   1 
ATOM   92    C  CA  . LEU A  1  40  ? 29.986  19.031  38.698  1.00 36.68  ? 68   LEU A CA  1 
ATOM   93    C  C   . LEU A  1  40  ? 29.812  18.578  40.148  1.00 36.83  ? 68   LEU A C   1 
ATOM   94    O  O   . LEU A  1  40  ? 30.677  18.829  40.986  1.00 36.91  ? 68   LEU A O   1 
ATOM   95    C  CB  . LEU A  1  40  ? 29.082  20.225  38.383  1.00 36.45  ? 68   LEU A CB  1 
ATOM   96    C  CG  . LEU A  1  40  ? 29.344  20.935  37.047  1.00 35.42  ? 68   LEU A CG  1 
ATOM   97    C  CD1 . LEU A  1  40  ? 28.130  21.728  36.605  1.00 34.12  ? 68   LEU A CD1 1 
ATOM   98    C  CD2 . LEU A  1  40  ? 30.566  21.821  37.124  1.00 34.93  ? 68   LEU A CD2 1 
ATOM   99    N  N   . THR A  1  41  ? 28.701  17.898  40.429  1.00 36.96  ? 69   THR A N   1 
ATOM   100   C  CA  . THR A  1  41  ? 28.442  17.303  41.736  1.00 36.90  ? 69   THR A CA  1 
ATOM   101   C  C   . THR A  1  41  ? 29.607  16.416  42.179  1.00 37.06  ? 69   THR A C   1 
ATOM   102   O  O   . THR A  1  41  ? 30.104  16.557  43.297  1.00 36.97  ? 69   THR A O   1 
ATOM   103   C  CB  . THR A  1  41  ? 27.136  16.468  41.728  1.00 36.90  ? 69   THR A CB  1 
ATOM   104   O  OG1 . THR A  1  41  ? 26.035  17.294  41.327  1.00 37.55  ? 69   THR A OG1 1 
ATOM   105   C  CG2 . THR A  1  41  ? 26.846  15.882  43.109  1.00 36.10  ? 69   THR A CG2 1 
ATOM   106   N  N   . ALA A  1  42  ? 30.038  15.515  41.297  1.00 37.19  ? 70   ALA A N   1 
ATOM   107   C  CA  . ALA A  1  42  ? 31.122  14.575  41.596  1.00 37.52  ? 70   ALA A CA  1 
ATOM   108   C  C   . ALA A  1  42  ? 32.457  15.242  41.953  1.00 37.71  ? 70   ALA A C   1 
ATOM   109   O  O   . ALA A  1  42  ? 33.151  14.779  42.856  1.00 37.79  ? 70   ALA A O   1 
ATOM   110   C  CB  . ALA A  1  42  ? 31.315  13.602  40.440  1.00 37.62  ? 70   ALA A CB  1 
ATOM   111   N  N   . VAL A  1  43  ? 32.816  16.308  41.235  1.00 37.99  ? 71   VAL A N   1 
ATOM   112   C  CA  . VAL A  1  43  ? 34.045  17.059  41.507  1.00 38.17  ? 71   VAL A CA  1 
ATOM   113   C  C   . VAL A  1  43  ? 33.885  17.812  42.814  1.00 38.66  ? 71   VAL A C   1 
ATOM   114   O  O   . VAL A  1  43  ? 34.804  17.852  43.637  1.00 38.35  ? 71   VAL A O   1 
ATOM   115   C  CB  . VAL A  1  43  ? 34.381  18.049  40.364  1.00 38.03  ? 71   VAL A CB  1 
ATOM   116   C  CG1 . VAL A  1  43  ? 35.526  18.988  40.751  1.00 36.92  ? 71   VAL A CG1 1 
ATOM   117   C  CG2 . VAL A  1  43  ? 34.737  17.288  39.108  1.00 38.40  ? 71   VAL A CG2 1 
ATOM   118   N  N   . MET A  1  44  ? 32.705  18.398  42.995  1.00 39.57  ? 72   MET A N   1 
ATOM   119   C  CA  . MET A  1  44  ? 32.383  19.118  44.220  1.00 40.58  ? 72   MET A CA  1 
ATOM   120   C  C   . MET A  1  44  ? 32.426  18.171  45.406  1.00 40.93  ? 72   MET A C   1 
ATOM   121   O  O   . MET A  1  44  ? 33.038  18.487  46.417  1.00 41.48  ? 72   MET A O   1 
ATOM   122   C  CB  . MET A  1  44  ? 31.027  19.831  44.121  1.00 40.60  ? 72   MET A CB  1 
ATOM   123   C  CG  . MET A  1  44  ? 30.725  20.751  45.297  1.00 41.61  ? 72   MET A CG  1 
ATOM   124   S  SD  . MET A  1  44  ? 32.058  21.916  45.666  1.00 43.37  ? 72   MET A SD  1 
ATOM   125   C  CE  . MET A  1  44  ? 31.554  23.351  44.766  1.00 42.43  ? 72   MET A CE  1 
ATOM   126   N  N   . ARG A  1  45  ? 31.801  17.003  45.264  1.00 41.49  ? 73   ARG A N   1 
ATOM   127   C  CA  . ARG A  1  45  ? 31.850  15.956  46.288  1.00 42.01  ? 73   ARG A CA  1 
ATOM   128   C  C   . ARG A  1  45  ? 33.290  15.557  46.600  1.00 41.33  ? 73   ARG A C   1 
ATOM   129   O  O   . ARG A  1  45  ? 33.658  15.450  47.774  1.00 41.45  ? 73   ARG A O   1 
ATOM   130   C  CB  . ARG A  1  45  ? 31.032  14.735  45.865  1.00 41.73  ? 73   ARG A CB  1 
ATOM   131   C  CG  . ARG A  1  45  ? 30.959  13.632  46.918  1.00 43.17  ? 73   ARG A CG  1 
ATOM   132   C  CD  . ARG A  1  45  ? 30.257  12.356  46.392  1.00 44.07  ? 73   ARG A CD  1 
ATOM   133   N  NE  . ARG A  1  45  ? 28.812  12.547  46.197  1.00 48.57  ? 73   ARG A NE  1 
ATOM   134   C  CZ  . ARG A  1  45  ? 28.193  12.602  45.012  1.00 49.75  ? 73   ARG A CZ  1 
ATOM   135   N  NH1 . ARG A  1  45  ? 28.880  12.465  43.865  1.00 49.19  ? 73   ARG A NH1 1 
ATOM   136   N  NH2 . ARG A  1  45  ? 26.870  12.791  44.976  1.00 49.11  ? 73   ARG A NH2 1 
ATOM   137   N  N   . PHE A  1  46  ? 34.095  15.361  45.554  1.00 40.88  ? 74   PHE A N   1 
ATOM   138   C  CA  . PHE A  1  46  ? 35.501  14.988  45.713  1.00 40.63  ? 74   PHE A CA  1 
ATOM   139   C  C   . PHE A  1  46  ? 36.316  16.064  46.412  1.00 40.81  ? 74   PHE A C   1 
ATOM   140   O  O   . PHE A  1  46  ? 37.143  15.753  47.262  1.00 40.98  ? 74   PHE A O   1 
ATOM   141   C  CB  . PHE A  1  46  ? 36.144  14.642  44.373  1.00 40.46  ? 74   PHE A CB  1 
ATOM   142   C  CG  . PHE A  1  46  ? 37.514  14.010  44.495  1.00 40.12  ? 74   PHE A CG  1 
ATOM   143   C  CD1 . PHE A  1  46  ? 37.654  12.678  44.894  1.00 40.76  ? 74   PHE A CD1 1 
ATOM   144   C  CD2 . PHE A  1  46  ? 38.658  14.738  44.201  1.00 39.05  ? 74   PHE A CD2 1 
ATOM   145   C  CE1 . PHE A  1  46  ? 38.926  12.083  45.000  1.00 40.82  ? 74   PHE A CE1 1 
ATOM   146   C  CE2 . PHE A  1  46  ? 39.927  14.158  44.304  1.00 39.94  ? 74   PHE A CE2 1 
ATOM   147   C  CZ  . PHE A  1  46  ? 40.064  12.827  44.701  1.00 40.04  ? 74   PHE A CZ  1 
ATOM   148   N  N   . LEU A  1  47  ? 36.085  17.324  46.060  1.00 41.08  ? 75   LEU A N   1 
ATOM   149   C  CA  . LEU A  1  47  ? 36.763  18.438  46.723  1.00 41.33  ? 75   LEU A CA  1 
ATOM   150   C  C   . LEU A  1  47  ? 36.453  18.564  48.221  1.00 42.08  ? 75   LEU A C   1 
ATOM   151   O  O   . LEU A  1  47  ? 37.363  18.804  49.015  1.00 42.24  ? 75   LEU A O   1 
ATOM   152   C  CB  . LEU A  1  47  ? 36.471  19.758  46.016  1.00 40.76  ? 75   LEU A CB  1 
ATOM   153   C  CG  . LEU A  1  47  ? 37.079  19.949  44.627  1.00 40.15  ? 75   LEU A CG  1 
ATOM   154   C  CD1 . LEU A  1  47  ? 36.416  21.156  43.954  1.00 39.69  ? 75   LEU A CD1 1 
ATOM   155   C  CD2 . LEU A  1  47  ? 38.597  20.091  44.677  1.00 37.21  ? 75   LEU A CD2 1 
ATOM   156   N  N   . THR A  1  48  ? 35.188  18.402  48.612  1.00 42.72  ? 76   THR A N   1 
ATOM   157   C  CA  . THR A  1  48  ? 34.837  18.491  50.032  1.00 43.71  ? 76   THR A CA  1 
ATOM   158   C  C   . THR A  1  48  ? 35.489  17.373  50.849  1.00 43.97  ? 76   THR A C   1 
ATOM   159   O  O   . THR A  1  48  ? 35.872  17.592  51.996  1.00 43.83  ? 76   THR A O   1 
ATOM   160   C  CB  . THR A  1  48  ? 33.308  18.562  50.291  1.00 43.79  ? 76   THR A CB  1 
ATOM   161   O  OG1 . THR A  1  48  ? 32.630  17.624  49.453  1.00 44.68  ? 76   THR A OG1 1 
ATOM   162   C  CG2 . THR A  1  48  ? 32.772  19.968  50.002  1.00 44.35  ? 76   THR A CG2 1 
ATOM   163   N  N   . GLN A  1  49  ? 35.626  16.190  50.244  1.00 44.55  ? 77   GLN A N   1 
ATOM   164   C  CA  . GLN A  1  49  ? 36.350  15.073  50.854  1.00 45.13  ? 77   GLN A CA  1 
ATOM   165   C  C   . GLN A  1  49  ? 37.841  15.327  50.986  1.00 45.29  ? 77   GLN A C   1 
ATOM   166   O  O   . GLN A  1  49  ? 38.435  14.974  51.987  1.00 45.33  ? 77   GLN A O   1 
ATOM   167   C  CB  . GLN A  1  49  ? 36.175  13.807  50.033  1.00 45.37  ? 77   GLN A CB  1 
ATOM   168   C  CG  . GLN A  1  49  ? 34.887  13.057  50.276  1.00 47.06  ? 77   GLN A CG  1 
ATOM   169   C  CD  . GLN A  1  49  ? 34.629  11.990  49.217  1.00 49.45  ? 77   GLN A CD  1 
ATOM   170   O  OE1 . GLN A  1  49  ? 35.393  11.843  48.249  1.00 50.13  ? 77   GLN A OE1 1 
ATOM   171   N  NE2 . GLN A  1  49  ? 33.542  11.241  49.392  1.00 50.43  ? 77   GLN A NE2 1 
ATOM   172   N  N   . ARG A  1  50  ? 38.454  15.925  49.972  1.00 45.81  ? 78   ARG A N   1 
ATOM   173   C  CA  . ARG A  1  50  ? 39.914  16.024  49.936  1.00 46.35  ? 78   ARG A CA  1 
ATOM   174   C  C   . ARG A  1  50  ? 40.491  17.329  50.499  1.00 46.46  ? 78   ARG A C   1 
ATOM   175   O  O   . ARG A  1  50  ? 41.606  17.334  51.018  1.00 46.57  ? 78   ARG A O   1 
ATOM   176   C  CB  . ARG A  1  50  ? 40.453  15.737  48.524  1.00 46.37  ? 78   ARG A CB  1 
ATOM   177   C  CG  . ARG A  1  50  ? 40.092  14.340  47.981  1.00 47.68  ? 78   ARG A CG  1 
ATOM   178   C  CD  . ARG A  1  50  ? 41.008  13.206  48.495  1.00 50.10  ? 78   ARG A CD  1 
ATOM   179   N  NE  . ARG A  1  50  ? 42.101  12.936  47.560  1.00 51.94  ? 78   ARG A NE  1 
ATOM   180   C  CZ  . ARG A  1  50  ? 43.230  13.642  47.485  1.00 53.11  ? 78   ARG A CZ  1 
ATOM   181   N  NH1 . ARG A  1  50  ? 43.441  14.670  48.306  1.00 53.54  ? 78   ARG A NH1 1 
ATOM   182   N  NH2 . ARG A  1  50  ? 44.154  13.325  46.581  1.00 52.85  ? 78   ARG A NH2 1 
ATOM   183   N  N   . LEU A  1  51  ? 39.737  18.423  50.413  1.00 46.62  ? 79   LEU A N   1 
ATOM   184   C  CA  . LEU A  1  51  ? 40.229  19.724  50.885  1.00 46.83  ? 79   LEU A CA  1 
ATOM   185   C  C   . LEU A  1  51  ? 40.121  19.905  52.394  1.00 47.13  ? 79   LEU A C   1 
ATOM   186   O  O   . LEU A  1  51  ? 40.554  20.922  52.933  1.00 47.42  ? 79   LEU A O   1 
ATOM   187   C  CB  . LEU A  1  51  ? 39.524  20.879  50.170  1.00 46.56  ? 79   LEU A CB  1 
ATOM   188   C  CG  . LEU A  1  51  ? 39.911  21.097  48.718  1.00 46.33  ? 79   LEU A CG  1 
ATOM   189   C  CD1 . LEU A  1  51  ? 39.055  22.204  48.143  1.00 46.55  ? 79   LEU A CD1 1 
ATOM   190   C  CD2 . LEU A  1  51  ? 41.383  21.433  48.612  1.00 45.97  ? 79   LEU A CD2 1 
ATOM   191   N  N   . GLY A  1  52  ? 39.538  18.920  53.067  1.00 47.63  ? 80   GLY A N   1 
ATOM   192   C  CA  . GLY A  1  52  ? 39.432  18.930  54.525  1.00 47.84  ? 80   GLY A CA  1 
ATOM   193   C  C   . GLY A  1  52  ? 38.242  19.734  55.001  1.00 47.95  ? 80   GLY A C   1 
ATOM   194   O  O   . GLY A  1  52  ? 37.511  20.310  54.182  1.00 47.89  ? 80   GLY A O   1 
ATOM   195   N  N   . PRO A  1  53  ? 38.059  19.806  56.334  1.00 47.98  ? 81   PRO A N   1 
ATOM   196   C  CA  . PRO A  1  53  ? 36.845  20.372  56.933  1.00 47.75  ? 81   PRO A CA  1 
ATOM   197   C  C   . PRO A  1  53  ? 36.790  21.900  56.914  1.00 47.33  ? 81   PRO A C   1 
ATOM   198   O  O   . PRO A  1  53  ? 35.739  22.468  57.210  1.00 47.63  ? 81   PRO A O   1 
ATOM   199   C  CB  . PRO A  1  53  ? 36.880  19.858  58.387  1.00 47.76  ? 81   PRO A CB  1 
ATOM   200   C  CG  . PRO A  1  53  ? 38.143  19.021  58.522  1.00 47.93  ? 81   PRO A CG  1 
ATOM   201   C  CD  . PRO A  1  53  ? 39.023  19.368  57.361  1.00 48.18  ? 81   PRO A CD  1 
ATOM   202   N  N   . GLY A  1  54  ? 37.897  22.556  56.569  1.00 46.70  ? 82   GLY A N   1 
ATOM   203   C  CA  . GLY A  1  54  ? 37.945  24.023  56.557  1.00 46.14  ? 82   GLY A CA  1 
ATOM   204   C  C   . GLY A  1  54  ? 37.171  24.692  55.424  1.00 45.65  ? 82   GLY A C   1 
ATOM   205   O  O   . GLY A  1  54  ? 37.206  25.924  55.278  1.00 45.84  ? 82   GLY A O   1 
ATOM   206   N  N   . LEU A  1  55  ? 36.455  23.886  54.641  1.00 44.69  ? 83   LEU A N   1 
ATOM   207   C  CA  . LEU A  1  55  ? 35.819  24.348  53.411  1.00 43.95  ? 83   LEU A CA  1 
ATOM   208   C  C   . LEU A  1  55  ? 34.398  24.869  53.649  1.00 43.45  ? 83   LEU A C   1 
ATOM   209   O  O   . LEU A  1  55  ? 33.565  24.181  54.244  1.00 43.66  ? 83   LEU A O   1 
ATOM   210   C  CB  . LEU A  1  55  ? 35.832  23.228  52.368  1.00 43.79  ? 83   LEU A CB  1 
ATOM   211   C  CG  . LEU A  1  55  ? 35.635  23.574  50.896  1.00 43.41  ? 83   LEU A CG  1 
ATOM   212   C  CD1 . LEU A  1  55  ? 36.657  24.597  50.429  1.00 43.17  ? 83   LEU A CD1 1 
ATOM   213   C  CD2 . LEU A  1  55  ? 35.730  22.304  50.066  1.00 43.84  ? 83   LEU A CD2 1 
ATOM   214   N  N   . VAL A  1  56  ? 34.137  26.088  53.183  1.00 42.46  ? 84   VAL A N   1 
ATOM   215   C  CA  . VAL A  1  56  ? 32.869  26.779  53.435  1.00 41.72  ? 84   VAL A CA  1 
ATOM   216   C  C   . VAL A  1  56  ? 32.209  27.095  52.103  1.00 41.32  ? 84   VAL A C   1 
ATOM   217   O  O   . VAL A  1  56  ? 32.893  27.335  51.109  1.00 41.31  ? 84   VAL A O   1 
ATOM   218   C  CB  . VAL A  1  56  ? 33.089  28.108  54.249  1.00 41.67  ? 84   VAL A CB  1 
ATOM   219   C  CG1 . VAL A  1  56  ? 31.803  28.947  54.359  1.00 41.24  ? 84   VAL A CG1 1 
ATOM   220   C  CG2 . VAL A  1  56  ? 33.653  27.815  55.632  1.00 41.26  ? 84   VAL A CG2 1 
ATOM   221   N  N   . ASP A  1  57  ? 30.880  27.085  52.082  1.00 40.76  ? 85   ASP A N   1 
ATOM   222   C  CA  . ASP A  1  57  ? 30.120  27.555  50.925  1.00 40.30  ? 85   ASP A CA  1 
ATOM   223   C  C   . ASP A  1  57  ? 30.591  28.952  50.495  1.00 39.67  ? 85   ASP A C   1 
ATOM   224   O  O   . ASP A  1  57  ? 30.560  29.896  51.298  1.00 39.49  ? 85   ASP A O   1 
ATOM   225   C  CB  . ASP A  1  57  ? 28.632  27.596  51.273  1.00 40.67  ? 85   ASP A CB  1 
ATOM   226   C  CG  . ASP A  1  57  ? 27.734  27.688  50.051  1.00 41.80  ? 85   ASP A CG  1 
ATOM   227   O  OD1 . ASP A  1  57  ? 28.173  28.116  48.961  1.00 41.88  ? 85   ASP A OD1 1 
ATOM   228   O  OD2 . ASP A  1  57  ? 26.557  27.317  50.196  1.00 45.09  ? 85   ASP A OD2 1 
ATOM   229   N  N   . ALA A  1  58  ? 31.018  29.071  49.233  1.00 38.72  ? 86   ALA A N   1 
ATOM   230   C  CA  . ALA A  1  58  ? 31.478  30.338  48.677  1.00 37.79  ? 86   ALA A CA  1 
ATOM   231   C  C   . ALA A  1  58  ? 30.367  31.394  48.616  1.00 37.42  ? 86   ALA A C   1 
ATOM   232   O  O   . ALA A  1  58  ? 30.639  32.593  48.591  1.00 37.16  ? 86   ALA A O   1 
ATOM   233   C  CB  . ALA A  1  58  ? 32.068  30.119  47.326  1.00 38.04  ? 86   ALA A CB  1 
ATOM   234   N  N   . ALA A  1  59  ? 29.118  30.941  48.617  1.00 37.03  ? 87   ALA A N   1 
ATOM   235   C  CA  . ALA A  1  59  ? 27.958  31.831  48.659  1.00 36.91  ? 87   ALA A CA  1 
ATOM   236   C  C   . ALA A  1  59  ? 27.936  32.751  49.888  1.00 37.00  ? 87   ALA A C   1 
ATOM   237   O  O   . ALA A  1  59  ? 27.367  33.844  49.840  1.00 36.85  ? 87   ALA A O   1 
ATOM   238   C  CB  . ALA A  1  59  ? 26.659  31.027  48.573  1.00 36.69  ? 87   ALA A CB  1 
ATOM   239   N  N   . GLN A  1  60  ? 28.535  32.314  50.991  1.00 36.75  ? 88   GLN A N   1 
ATOM   240   C  CA  . GLN A  1  60  ? 28.550  33.147  52.185  1.00 37.08  ? 88   GLN A CA  1 
ATOM   241   C  C   . GLN A  1  60  ? 29.941  33.266  52.783  1.00 36.57  ? 88   GLN A C   1 
ATOM   242   O  O   . GLN A  1  60  ? 30.091  33.613  53.953  1.00 36.80  ? 88   GLN A O   1 
ATOM   243   C  CB  . GLN A  1  60  ? 27.564  32.619  53.222  1.00 37.37  ? 88   GLN A CB  1 
ATOM   244   C  CG  . GLN A  1  60  ? 26.172  32.322  52.664  1.00 39.89  ? 88   GLN A CG  1 
ATOM   245   C  CD  . GLN A  1  60  ? 25.472  31.211  53.424  1.00 43.92  ? 88   GLN A CD  1 
ATOM   246   O  OE1 . GLN A  1  60  ? 26.085  30.188  53.792  1.00 45.46  ? 88   GLN A OE1 1 
ATOM   247   N  NE2 . GLN A  1  60  ? 24.178  31.402  53.674  1.00 44.89  ? 88   GLN A NE2 1 
ATOM   248   N  N   . ALA A  1  61  ? 30.954  33.009  51.963  1.00 36.04  ? 89   ALA A N   1 
ATOM   249   C  CA  . ALA A  1  61  ? 32.333  32.982  52.438  1.00 35.69  ? 89   ALA A CA  1 
ATOM   250   C  C   . ALA A  1  61  ? 32.832  34.356  52.829  1.00 35.35  ? 89   ALA A C   1 
ATOM   251   O  O   . ALA A  1  61  ? 32.663  35.335  52.093  1.00 35.12  ? 89   ALA A O   1 
ATOM   252   C  CB  . ALA A  1  61  ? 33.261  32.348  51.402  1.00 35.44  ? 89   ALA A CB  1 
ATOM   253   N  N   . ARG A  1  62  ? 33.437  34.411  54.008  1.00 34.97  ? 90   ARG A N   1 
ATOM   254   C  CA  . ARG A  1  62  ? 34.109  35.603  54.485  1.00 34.86  ? 90   ARG A CA  1 
ATOM   255   C  C   . ARG A  1  62  ? 35.446  35.637  53.756  1.00 34.44  ? 90   ARG A C   1 
ATOM   256   O  O   . ARG A  1  62  ? 35.883  34.604  53.237  1.00 34.51  ? 90   ARG A O   1 
ATOM   257   C  CB  . ARG A  1  62  ? 34.269  35.532  56.009  1.00 35.02  ? 90   ARG A CB  1 
ATOM   258   C  CG  . ARG A  1  62  ? 32.959  35.132  56.676  1.00 36.37  ? 90   ARG A CG  1 
ATOM   259   C  CD  . ARG A  1  62  ? 32.917  35.392  58.155  1.00 40.08  ? 90   ARG A CD  1 
ATOM   260   N  NE  . ARG A  1  62  ? 33.545  34.321  58.916  1.00 41.82  ? 90   ARG A NE  1 
ATOM   261   C  CZ  . ARG A  1  62  ? 33.603  34.274  60.248  1.00 43.47  ? 90   ARG A CZ  1 
ATOM   262   N  NH1 . ARG A  1  62  ? 33.056  35.230  61.004  1.00 41.63  ? 90   ARG A NH1 1 
ATOM   263   N  NH2 . ARG A  1  62  ? 34.213  33.246  60.826  1.00 44.46  ? 90   ARG A NH2 1 
ATOM   264   N  N   . PRO A  1  63  ? 36.080  36.820  53.651  1.00 34.00  ? 91   PRO A N   1 
ATOM   265   C  CA  . PRO A  1  63  ? 37.363  36.856  52.951  1.00 33.78  ? 91   PRO A CA  1 
ATOM   266   C  C   . PRO A  1  63  ? 38.410  35.867  53.480  1.00 33.45  ? 91   PRO A C   1 
ATOM   267   O  O   . PRO A  1  63  ? 39.243  35.405  52.700  1.00 33.87  ? 91   PRO A O   1 
ATOM   268   C  CB  . PRO A  1  63  ? 37.817  38.300  53.147  1.00 33.86  ? 91   PRO A CB  1 
ATOM   269   C  CG  . PRO A  1  63  ? 36.527  39.058  53.210  1.00 33.88  ? 91   PRO A CG  1 
ATOM   270   C  CD  . PRO A  1  63  ? 35.672  38.168  54.082  1.00 33.81  ? 91   PRO A CD  1 
ATOM   271   N  N   . SER A  1  64  ? 38.355  35.527  54.767  1.00 32.54  ? 92   SER A N   1 
ATOM   272   C  CA  . SER A  1  64  ? 39.357  34.649  55.367  1.00 32.18  ? 92   SER A CA  1 
ATOM   273   C  C   . SER A  1  64  ? 38.979  33.146  55.375  1.00 32.01  ? 92   SER A C   1 
ATOM   274   O  O   . SER A  1  64  ? 39.681  32.315  55.976  1.00 31.61  ? 92   SER A O   1 
ATOM   275   C  CB  . SER A  1  64  ? 39.726  35.137  56.775  1.00 32.22  ? 92   SER A CB  1 
ATOM   276   O  OG  . SER A  1  64  ? 38.589  35.189  57.615  1.00 32.14  ? 92   SER A OG  1 
ATOM   277   N  N   . ASP A  1  65  ? 37.880  32.803  54.701  1.00 31.34  ? 93   ASP A N   1 
ATOM   278   C  CA  . ASP A  1  65  ? 37.465  31.410  54.565  1.00 30.76  ? 93   ASP A CA  1 
ATOM   279   C  C   . ASP A  1  65  ? 38.196  30.665  53.445  1.00 30.55  ? 93   ASP A C   1 
ATOM   280   O  O   . ASP A  1  65  ? 38.763  31.275  52.533  1.00 30.79  ? 93   ASP A O   1 
ATOM   281   C  CB  . ASP A  1  65  ? 35.966  31.330  54.305  1.00 30.45  ? 93   ASP A CB  1 
ATOM   282   C  CG  . ASP A  1  65  ? 35.141  31.561  55.552  1.00 30.18  ? 93   ASP A CG  1 
ATOM   283   O  OD1 . ASP A  1  65  ? 35.515  31.068  56.639  1.00 28.98  ? 93   ASP A OD1 1 
ATOM   284   O  OD2 . ASP A  1  65  ? 34.093  32.230  55.430  1.00 29.73  ? 93   ASP A OD2 1 
ATOM   285   N  N   . ASN A  1  66  ? 38.188  29.342  53.532  1.00 30.06  ? 94   ASN A N   1 
ATOM   286   C  CA  . ASN A  1  66  ? 38.465  28.512  52.373  1.00 29.85  ? 94   ASN A CA  1 
ATOM   287   C  C   . ASN A  1  66  ? 37.159  28.178  51.698  1.00 29.56  ? 94   ASN A C   1 
ATOM   288   O  O   . ASN A  1  66  ? 36.204  27.744  52.350  1.00 29.56  ? 94   ASN A O   1 
ATOM   289   C  CB  . ASN A  1  66  ? 39.180  27.217  52.757  1.00 29.93  ? 94   ASN A CB  1 
ATOM   290   C  CG  . ASN A  1  66  ? 40.558  27.460  53.284  1.00 29.71  ? 94   ASN A CG  1 
ATOM   291   O  OD1 . ASN A  1  66  ? 41.164  28.499  53.016  1.00 29.78  ? 94   ASN A OD1 1 
ATOM   292   N  ND2 . ASN A  1  66  ? 41.074  26.501  54.039  1.00 29.76  ? 94   ASN A ND2 1 
ATOM   293   N  N   . CYS A  1  67  ? 37.118  28.394  50.390  1.00 29.30  ? 95   CYS A N   1 
ATOM   294   C  CA  . CYS A  1  67  ? 35.925  28.110  49.618  1.00 29.24  ? 95   CYS A CA  1 
ATOM   295   C  C   . CYS A  1  67  ? 36.297  27.870  48.174  1.00 28.71  ? 95   CYS A C   1 
ATOM   296   O  O   . CYS A  1  67  ? 37.358  28.301  47.720  1.00 28.47  ? 95   CYS A O   1 
ATOM   297   C  CB  . CYS A  1  67  ? 34.920  29.264  49.716  1.00 29.18  ? 95   CYS A CB  1 
ATOM   298   S  SG  . CYS A  1  67  ? 35.442  30.701  48.827  1.00 30.34  ? 95   CYS A SG  1 
ATOM   299   N  N   . VAL A  1  68  ? 35.401  27.181  47.475  1.00 28.41  ? 96   VAL A N   1 
ATOM   300   C  CA  . VAL A  1  68  ? 35.557  26.868  46.078  1.00 28.37  ? 96   VAL A CA  1 
ATOM   301   C  C   . VAL A  1  68  ? 34.857  27.962  45.298  1.00 28.75  ? 96   VAL A C   1 
ATOM   302   O  O   . VAL A  1  68  ? 33.643  28.108  45.382  1.00 29.38  ? 96   VAL A O   1 
ATOM   303   C  CB  . VAL A  1  68  ? 34.921  25.513  45.734  1.00 28.03  ? 96   VAL A CB  1 
ATOM   304   C  CG1 . VAL A  1  68  ? 34.986  25.279  44.239  1.00 27.41  ? 96   VAL A CG1 1 
ATOM   305   C  CG2 . VAL A  1  68  ? 35.609  24.378  46.498  1.00 27.37  ? 96   VAL A CG2 1 
ATOM   306   N  N   . PHE A  1  69  ? 35.634  28.737  44.557  1.00 28.94  ? 97   PHE A N   1 
ATOM   307   C  CA  . PHE A  1  69  ? 35.110  29.820  43.746  1.00 29.04  ? 97   PHE A CA  1 
ATOM   308   C  C   . PHE A  1  69  ? 34.358  29.279  42.536  1.00 29.39  ? 97   PHE A C   1 
ATOM   309   O  O   . PHE A  1  69  ? 33.342  29.843  42.138  1.00 29.91  ? 97   PHE A O   1 
ATOM   310   C  CB  . PHE A  1  69  ? 36.261  30.727  43.294  1.00 28.71  ? 97   PHE A CB  1 
ATOM   311   C  CG  . PHE A  1  69  ? 35.841  31.876  42.398  1.00 27.56  ? 97   PHE A CG  1 
ATOM   312   C  CD1 . PHE A  1  69  ? 34.955  32.847  42.849  1.00 26.53  ? 97   PHE A CD1 1 
ATOM   313   C  CD2 . PHE A  1  69  ? 36.376  32.001  41.118  1.00 26.35  ? 97   PHE A CD2 1 
ATOM   314   C  CE1 . PHE A  1  69  ? 34.583  33.901  42.030  1.00 27.22  ? 97   PHE A CE1 1 
ATOM   315   C  CE2 . PHE A  1  69  ? 36.021  33.052  40.294  1.00 26.04  ? 97   PHE A CE2 1 
ATOM   316   C  CZ  . PHE A  1  69  ? 35.119  34.006  40.743  1.00 27.25  ? 97   PHE A CZ  1 
ATOM   317   N  N   . SER A  1  70  ? 34.861  28.198  41.947  1.00 29.49  ? 98   SER A N   1 
ATOM   318   C  CA  . SER A  1  70  ? 34.280  27.662  40.718  1.00 29.59  ? 98   SER A CA  1 
ATOM   319   C  C   . SER A  1  70  ? 34.828  26.294  40.329  1.00 29.59  ? 98   SER A C   1 
ATOM   320   O  O   . SER A  1  70  ? 35.958  25.927  40.684  1.00 29.39  ? 98   SER A O   1 
ATOM   321   C  CB  . SER A  1  70  ? 34.525  28.622  39.561  1.00 29.38  ? 98   SER A CB  1 
ATOM   322   O  OG  . SER A  1  70  ? 35.883  28.570  39.175  1.00 30.58  ? 98   SER A OG  1 
ATOM   323   N  N   . VAL A  1  71  ? 34.013  25.558  39.580  1.00 29.57  ? 99   VAL A N   1 
ATOM   324   C  CA  . VAL A  1  71  ? 34.421  24.304  38.971  1.00 29.42  ? 99   VAL A CA  1 
ATOM   325   C  C   . VAL A  1  71  ? 33.879  24.273  37.553  1.00 29.79  ? 99   VAL A C   1 
ATOM   326   O  O   . VAL A  1  71  ? 32.684  24.491  37.343  1.00 29.71  ? 99   VAL A O   1 
ATOM   327   C  CB  . VAL A  1  71  ? 33.863  23.080  39.735  1.00 29.39  ? 99   VAL A CB  1 
ATOM   328   C  CG1 . VAL A  1  71  ? 34.219  21.792  39.009  1.00 28.72  ? 99   VAL A CG1 1 
ATOM   329   C  CG2 . VAL A  1  71  ? 34.365  23.043  41.177  1.00 28.17  ? 99   VAL A CG2 1 
ATOM   330   N  N   . GLU A  1  72  ? 34.759  24.008  36.587  1.00 30.14  ? 100  GLU A N   1 
ATOM   331   C  CA  . GLU A  1  72  ? 34.367  23.817  35.175  1.00 30.46  ? 100  GLU A CA  1 
ATOM   332   C  C   . GLU A  1  72  ? 35.363  22.959  34.414  1.00 30.56  ? 100  GLU A C   1 
ATOM   333   O  O   . GLU A  1  72  ? 36.418  22.590  34.948  1.00 30.84  ? 100  GLU A O   1 
ATOM   334   C  CB  . GLU A  1  72  ? 34.163  25.145  34.435  1.00 30.35  ? 100  GLU A CB  1 
ATOM   335   C  CG  . GLU A  1  72  ? 35.364  26.081  34.440  1.00 30.18  ? 100  GLU A CG  1 
ATOM   336   C  CD  . GLU A  1  72  ? 35.259  27.158  33.379  1.00 30.75  ? 100  GLU A CD  1 
ATOM   337   O  OE1 . GLU A  1  72  ? 34.367  27.052  32.486  1.00 29.01  ? 100  GLU A OE1 1 
ATOM   338   O  OE2 . GLU A  1  72  ? 36.072  28.107  33.445  1.00 29.02  ? 100  GLU A OE2 1 
ATOM   339   N  N   . LEU A  1  73  ? 35.016  22.653  33.167  1.00 30.34  ? 101  LEU A N   1 
ATOM   340   C  CA  . LEU A  1  73  ? 35.816  21.772  32.323  1.00 30.57  ? 101  LEU A CA  1 
ATOM   341   C  C   . LEU A  1  73  ? 37.248  22.273  32.120  1.00 30.73  ? 101  LEU A C   1 
ATOM   342   O  O   . LEU A  1  73  ? 37.484  23.471  31.892  1.00 30.29  ? 101  LEU A O   1 
ATOM   343   C  CB  . LEU A  1  73  ? 35.118  21.568  30.970  1.00 30.36  ? 101  LEU A CB  1 
ATOM   344   C  CG  . LEU A  1  73  ? 35.771  20.691  29.895  1.00 30.66  ? 101  LEU A CG  1 
ATOM   345   C  CD1 . LEU A  1  73  ? 35.732  19.202  30.218  1.00 27.70  ? 101  LEU A CD1 1 
ATOM   346   C  CD2 . LEU A  1  73  ? 35.119  20.971  28.545  1.00 30.71  ? 101  LEU A CD2 1 
ATOM   347   N  N   . GLN A  1  74  ? 38.191  21.338  32.245  1.00 31.30  ? 102  GLN A N   1 
ATOM   348   C  CA  . GLN A  1  74  ? 39.582  21.539  31.832  1.00 31.42  ? 102  GLN A CA  1 
ATOM   349   C  C   . GLN A  1  74  ? 39.690  21.006  30.417  1.00 31.45  ? 102  GLN A C   1 
ATOM   350   O  O   . GLN A  1  74  ? 39.567  19.801  30.190  1.00 31.66  ? 102  GLN A O   1 
ATOM   351   C  CB  . GLN A  1  74  ? 40.555  20.801  32.766  1.00 31.30  ? 102  GLN A CB  1 
ATOM   352   C  CG  . GLN A  1  74  ? 42.031  20.732  32.293  1.00 31.46  ? 102  GLN A CG  1 
ATOM   353   C  CD  . GLN A  1  74  ? 42.657  22.104  31.993  1.00 32.78  ? 102  GLN A CD  1 
ATOM   354   O  OE1 . GLN A  1  74  ? 42.574  23.043  32.793  1.00 32.36  ? 102  GLN A OE1 1 
ATOM   355   N  NE2 . GLN A  1  74  ? 43.286  22.216  30.828  1.00 32.70  ? 102  GLN A NE2 1 
ATOM   356   N  N   . LEU A  1  75  ? 39.885  21.909  29.463  1.00 31.45  ? 103  LEU A N   1 
ATOM   357   C  CA  . LEU A  1  75  ? 39.998  21.518  28.065  1.00 31.46  ? 103  LEU A CA  1 
ATOM   358   C  C   . LEU A  1  75  ? 41.102  20.467  27.866  1.00 31.44  ? 103  LEU A C   1 
ATOM   359   O  O   . LEU A  1  75  ? 42.166  20.549  28.505  1.00 31.26  ? 103  LEU A O   1 
ATOM   360   C  CB  . LEU A  1  75  ? 40.179  22.743  27.168  1.00 31.28  ? 103  LEU A CB  1 
ATOM   361   C  CG  . LEU A  1  75  ? 38.929  23.645  27.165  1.00 31.72  ? 103  LEU A CG  1 
ATOM   362   C  CD1 . LEU A  1  75  ? 39.206  25.018  26.526  1.00 29.87  ? 103  LEU A CD1 1 
ATOM   363   C  CD2 . LEU A  1  75  ? 37.731  22.951  26.506  1.00 31.13  ? 103  LEU A CD2 1 
ATOM   364   N  N   . PRO A  1  76  ? 40.827  19.452  27.016  1.00 31.29  ? 104  PRO A N   1 
ATOM   365   C  CA  . PRO A  1  76  ? 41.744  18.320  26.851  1.00 31.23  ? 104  PRO A CA  1 
ATOM   366   C  C   . PRO A  1  76  ? 42.941  18.699  25.993  1.00 31.14  ? 104  PRO A C   1 
ATOM   367   O  O   . PRO A  1  76  ? 42.791  19.514  25.078  1.00 31.46  ? 104  PRO A O   1 
ATOM   368   C  CB  . PRO A  1  76  ? 40.882  17.270  26.139  1.00 31.38  ? 104  PRO A CB  1 
ATOM   369   C  CG  . PRO A  1  76  ? 39.854  18.048  25.393  1.00 30.68  ? 104  PRO A CG  1 
ATOM   370   C  CD  . PRO A  1  76  ? 39.627  19.323  26.165  1.00 31.06  ? 104  PRO A CD  1 
ATOM   371   N  N   . PRO A  1  77  ? 44.128  18.142  26.298  1.00 30.96  ? 105  PRO A N   1 
ATOM   372   C  CA  . PRO A  1  77  ? 45.310  18.404  25.463  1.00 30.96  ? 105  PRO A CA  1 
ATOM   373   C  C   . PRO A  1  77  ? 45.038  18.132  23.981  1.00 31.05  ? 105  PRO A C   1 
ATOM   374   O  O   . PRO A  1  77  ? 44.438  17.110  23.626  1.00 31.15  ? 105  PRO A O   1 
ATOM   375   C  CB  . PRO A  1  77  ? 46.375  17.436  26.012  1.00 30.87  ? 105  PRO A CB  1 
ATOM   376   C  CG  . PRO A  1  77  ? 45.691  16.599  27.069  1.00 30.80  ? 105  PRO A CG  1 
ATOM   377   C  CD  . PRO A  1  77  ? 44.429  17.280  27.456  1.00 30.99  ? 105  PRO A CD  1 
ATOM   378   N  N   . LYS A  1  78  ? 45.468  19.047  23.122  1.00 31.16  ? 106  LYS A N   1 
ATOM   379   C  CA  . LYS A  1  78  ? 45.152  18.951  21.706  1.00 31.36  ? 106  LYS A CA  1 
ATOM   380   C  C   . LYS A  1  78  ? 45.667  17.646  21.087  1.00 31.79  ? 106  LYS A C   1 
ATOM   381   O  O   . LYS A  1  78  ? 44.913  16.944  20.405  1.00 31.94  ? 106  LYS A O   1 
ATOM   382   C  CB  . LYS A  1  78  ? 45.684  20.166  20.944  1.00 31.17  ? 106  LYS A CB  1 
ATOM   383   C  CG  . LYS A  1  78  ? 45.425  20.126  19.440  1.00 30.49  ? 106  LYS A CG  1 
ATOM   384   C  CD  . LYS A  1  78  ? 45.608  21.500  18.825  1.00 30.02  ? 106  LYS A CD  1 
ATOM   385   C  CE  . LYS A  1  78  ? 45.222  21.505  17.372  1.00 28.86  ? 106  LYS A CE  1 
ATOM   386   N  NZ  . LYS A  1  78  ? 45.705  22.742  16.721  1.00 28.87  ? 106  LYS A NZ  1 
ATOM   387   N  N   . ALA A  1  79  ? 46.931  17.309  21.324  1.00 32.06  ? 107  ALA A N   1 
ATOM   388   C  CA  . ALA A  1  79  ? 47.496  16.115  20.671  1.00 33.00  ? 107  ALA A CA  1 
ATOM   389   C  C   . ALA A  1  79  ? 46.614  14.899  20.915  1.00 32.99  ? 107  ALA A C   1 
ATOM   390   O  O   . ALA A  1  79  ? 46.276  14.196  19.971  1.00 33.21  ? 107  ALA A O   1 
ATOM   391   C  CB  . ALA A  1  79  ? 48.970  15.836  21.098  1.00 32.68  ? 107  ALA A CB  1 
ATOM   392   N  N   . ALA A  1  80  ? 46.217  14.685  22.170  1.00 33.16  ? 108  ALA A N   1 
ATOM   393   C  CA  . ALA A  1  80  ? 45.440  13.501  22.532  1.00 33.54  ? 108  ALA A CA  1 
ATOM   394   C  C   . ALA A  1  80  ? 44.046  13.575  21.939  1.00 33.73  ? 108  ALA A C   1 
ATOM   395   O  O   . ALA A  1  80  ? 43.532  12.570  21.448  1.00 33.91  ? 108  ALA A O   1 
ATOM   396   C  CB  . ALA A  1  80  ? 45.376  13.321  24.052  1.00 33.47  ? 108  ALA A CB  1 
ATOM   397   N  N   . ALA A  1  81  ? 43.450  14.770  21.978  1.00 33.69  ? 109  ALA A N   1 
ATOM   398   C  CA  . ALA A  1  81  ? 42.121  14.998  21.420  1.00 33.99  ? 109  ALA A CA  1 
ATOM   399   C  C   . ALA A  1  81  ? 42.057  14.614  19.932  1.00 34.42  ? 109  ALA A C   1 
ATOM   400   O  O   . ALA A  1  81  ? 41.121  13.926  19.505  1.00 34.26  ? 109  ALA A O   1 
ATOM   401   C  CB  . ALA A  1  81  ? 41.694  16.450  21.630  1.00 33.59  ? 109  ALA A CB  1 
ATOM   402   N  N   . LEU A  1  82  ? 43.063  15.052  19.164  1.00 34.69  ? 110  LEU A N   1 
ATOM   403   C  CA  . LEU A  1  82  ? 43.165  14.730  17.744  1.00 34.92  ? 110  LEU A CA  1 
ATOM   404   C  C   . LEU A  1  82  ? 43.444  13.243  17.536  1.00 35.46  ? 110  LEU A C   1 
ATOM   405   O  O   . LEU A  1  82  ? 42.906  12.628  16.616  1.00 35.84  ? 110  LEU A O   1 
ATOM   406   C  CB  . LEU A  1  82  ? 44.238  15.588  17.060  1.00 34.75  ? 110  LEU A CB  1 
ATOM   407   C  CG  . LEU A  1  82  ? 44.013  17.110  16.916  1.00 34.67  ? 110  LEU A CG  1 
ATOM   408   C  CD1 . LEU A  1  82  ? 45.126  17.759  16.110  1.00 32.92  ? 110  LEU A CD1 1 
ATOM   409   C  CD2 . LEU A  1  82  ? 42.652  17.458  16.306  1.00 33.53  ? 110  LEU A CD2 1 
ATOM   410   N  N   . ALA A  1  83  ? 44.275  12.664  18.399  1.00 35.91  ? 111  ALA A N   1 
ATOM   411   C  CA  . ALA A  1  83  ? 44.575  11.232  18.340  1.00 36.53  ? 111  ALA A CA  1 
ATOM   412   C  C   . ALA A  1  83  ? 43.293  10.393  18.449  1.00 36.74  ? 111  ALA A C   1 
ATOM   413   O  O   . ALA A  1  83  ? 43.089  9.446   17.682  1.00 36.73  ? 111  ALA A O   1 
ATOM   414   C  CB  . ALA A  1  83  ? 45.587  10.844  19.429  1.00 36.50  ? 111  ALA A CB  1 
ATOM   415   N  N   . HIS A  1  84  ? 42.427  10.769  19.384  1.00 37.04  ? 112  HIS A N   1 
ATOM   416   C  CA  . HIS A  1  84  ? 41.135  10.122  19.556  1.00 37.65  ? 112  HIS A CA  1 
ATOM   417   C  C   . HIS A  1  84  ? 40.213  10.358  18.370  1.00 37.80  ? 112  HIS A C   1 
ATOM   418   O  O   . HIS A  1  84  ? 39.576  9.428   17.890  1.00 37.81  ? 112  HIS A O   1 
ATOM   419   C  CB  . HIS A  1  84  ? 40.460  10.590  20.850  1.00 37.65  ? 112  HIS A CB  1 
ATOM   420   C  CG  . HIS A  1  84  ? 39.033  10.149  20.978  1.00 39.11  ? 112  HIS A CG  1 
ATOM   421   N  ND1 . HIS A  1  84  ? 38.675  8.836   21.203  1.00 40.12  ? 112  HIS A ND1 1 
ATOM   422   C  CD2 . HIS A  1  84  ? 37.872  10.848  20.913  1.00 40.10  ? 112  HIS A CD2 1 
ATOM   423   C  CE1 . HIS A  1  84  ? 37.357  8.745   21.274  1.00 40.05  ? 112  HIS A CE1 1 
ATOM   424   N  NE2 . HIS A  1  84  ? 36.847  9.952   21.104  1.00 40.63  ? 112  HIS A NE2 1 
ATOM   425   N  N   . LEU A  1  85  ? 40.142  11.599  17.901  1.00 38.44  ? 113  LEU A N   1 
ATOM   426   C  CA  . LEU A  1  85  ? 39.216  11.948  16.828  1.00 39.42  ? 113  LEU A CA  1 
ATOM   427   C  C   . LEU A  1  85  ? 39.646  11.454  15.437  1.00 40.05  ? 113  LEU A C   1 
ATOM   428   O  O   . LEU A  1  85  ? 38.799  11.192  14.583  1.00 40.21  ? 113  LEU A O   1 
ATOM   429   C  CB  . LEU A  1  85  ? 38.957  13.455  16.802  1.00 39.36  ? 113  LEU A CB  1 
ATOM   430   C  CG  . LEU A  1  85  ? 38.180  14.028  17.997  1.00 40.03  ? 113  LEU A CG  1 
ATOM   431   C  CD1 . LEU A  1  85  ? 38.287  15.543  18.057  1.00 38.06  ? 113  LEU A CD1 1 
ATOM   432   C  CD2 . LEU A  1  85  ? 36.720  13.580  17.970  1.00 40.83  ? 113  LEU A CD2 1 
ATOM   433   N  N   . ASP A  1  86  ? 40.948  11.324  15.204  1.00 40.49  ? 114  ASP A N   1 
ATOM   434   C  CA  . ASP A  1  86  ? 41.413  11.018  13.860  1.00 41.36  ? 114  ASP A CA  1 
ATOM   435   C  C   . ASP A  1  86  ? 42.028  9.632   13.723  1.00 42.36  ? 114  ASP A C   1 
ATOM   436   O  O   . ASP A  1  86  ? 41.890  9.004   12.676  1.00 42.68  ? 114  ASP A O   1 
ATOM   437   C  CB  . ASP A  1  86  ? 42.390  12.085  13.365  1.00 40.98  ? 114  ASP A CB  1 
ATOM   438   C  CG  . ASP A  1  86  ? 41.763  13.478  13.305  1.00 40.43  ? 114  ASP A CG  1 
ATOM   439   O  OD1 . ASP A  1  86  ? 40.522  13.595  13.153  1.00 38.54  ? 114  ASP A OD1 1 
ATOM   440   O  OD2 . ASP A  1  86  ? 42.529  14.460  13.409  1.00 38.93  ? 114  ASP A OD2 1 
ATOM   441   N  N   . ARG A  1  87  ? 42.705  9.161   14.769  1.00 42.98  ? 115  ARG A N   1 
ATOM   442   C  CA  . ARG A  1  87  ? 43.402  7.881   14.714  1.00 43.54  ? 115  ARG A CA  1 
ATOM   443   C  C   . ARG A  1  87  ? 42.678  6.802   15.524  1.00 43.60  ? 115  ARG A C   1 
ATOM   444   O  O   . ARG A  1  87  ? 43.115  5.654   15.544  1.00 43.83  ? 115  ARG A O   1 
ATOM   445   C  CB  . ARG A  1  87  ? 44.852  8.029   15.209  1.00 43.90  ? 115  ARG A CB  1 
ATOM   446   C  CG  . ARG A  1  87  ? 45.918  8.314   14.136  1.00 45.32  ? 115  ARG A CG  1 
ATOM   447   C  CD  . ARG A  1  87  ? 46.188  9.807   13.913  1.00 47.65  ? 115  ARG A CD  1 
ATOM   448   N  NE  . ARG A  1  87  ? 46.730  10.481  15.102  1.00 50.18  ? 115  ARG A NE  1 
ATOM   449   C  CZ  . ARG A  1  87  ? 46.889  11.806  15.224  1.00 51.40  ? 115  ARG A CZ  1 
ATOM   450   N  NH1 . ARG A  1  87  ? 46.557  12.632  14.231  1.00 51.03  ? 115  ARG A NH1 1 
ATOM   451   N  NH2 . ARG A  1  87  ? 47.378  12.314  16.353  1.00 52.16  ? 115  ARG A NH2 1 
ATOM   452   N  N   . GLY A  1  88  ? 41.588  7.172   16.197  1.00 43.50  ? 116  GLY A N   1 
ATOM   453   C  CA  . GLY A  1  88  ? 40.815  6.224   17.010  1.00 43.12  ? 116  GLY A CA  1 
ATOM   454   C  C   . GLY A  1  88  ? 41.383  5.877   18.384  1.00 42.99  ? 116  GLY A C   1 
ATOM   455   O  O   . GLY A  1  88  ? 40.934  4.918   19.016  1.00 42.84  ? 116  GLY A O   1 
ATOM   456   N  N   . SER A  1  89  ? 42.356  6.659   18.855  1.00 42.74  ? 117  SER A N   1 
ATOM   457   C  CA  . SER A  1  89  ? 43.010  6.431   20.157  1.00 42.50  ? 117  SER A CA  1 
ATOM   458   C  C   . SER A  1  89  ? 42.057  6.592   21.347  1.00 42.30  ? 117  SER A C   1 
ATOM   459   O  O   . SER A  1  89  ? 40.980  7.166   21.194  1.00 42.42  ? 117  SER A O   1 
ATOM   460   C  CB  . SER A  1  89  ? 44.209  7.368   20.322  1.00 42.50  ? 117  SER A CB  1 
ATOM   461   O  OG  . SER A  1  89  ? 45.184  7.112   19.328  1.00 42.50  ? 117  SER A OG  1 
ATOM   462   N  N   . PRO A  1  90  ? 42.447  6.082   22.537  1.00 42.07  ? 118  PRO A N   1 
ATOM   463   C  CA  . PRO A  1  90  ? 41.571  6.238   23.694  1.00 42.05  ? 118  PRO A CA  1 
ATOM   464   C  C   . PRO A  1  90  ? 41.361  7.715   24.034  1.00 41.98  ? 118  PRO A C   1 
ATOM   465   O  O   . PRO A  1  90  ? 42.331  8.487   24.044  1.00 42.06  ? 118  PRO A O   1 
ATOM   466   C  CB  . PRO A  1  90  ? 42.349  5.550   24.824  1.00 42.18  ? 118  PRO A CB  1 
ATOM   467   C  CG  . PRO A  1  90  ? 43.312  4.645   24.138  1.00 41.99  ? 118  PRO A CG  1 
ATOM   468   C  CD  . PRO A  1  90  ? 43.684  5.362   22.889  1.00 41.93  ? 118  PRO A CD  1 
ATOM   469   N  N   . PRO A  1  91  ? 40.102  8.107   24.320  1.00 41.72  ? 119  PRO A N   1 
ATOM   470   C  CA  . PRO A  1  91  ? 39.783  9.490   24.698  1.00 41.10  ? 119  PRO A CA  1 
ATOM   471   C  C   . PRO A  1  91  ? 40.699  9.956   25.827  1.00 40.40  ? 119  PRO A C   1 
ATOM   472   O  O   . PRO A  1  91  ? 41.029  9.159   26.704  1.00 40.27  ? 119  PRO A O   1 
ATOM   473   C  CB  . PRO A  1  91  ? 38.331  9.396   25.204  1.00 41.13  ? 119  PRO A CB  1 
ATOM   474   C  CG  . PRO A  1  91  ? 38.067  7.899   25.404  1.00 41.35  ? 119  PRO A CG  1 
ATOM   475   C  CD  . PRO A  1  91  ? 38.904  7.244   24.351  1.00 41.77  ? 119  PRO A CD  1 
ATOM   476   N  N   . PRO A  1  92  ? 41.121  11.234  25.803  1.00 40.08  ? 120  PRO A N   1 
ATOM   477   C  CA  . PRO A  1  92  ? 41.951  11.751  26.901  1.00 39.47  ? 120  PRO A CA  1 
ATOM   478   C  C   . PRO A  1  92  ? 41.110  11.862  28.159  1.00 38.82  ? 120  PRO A C   1 
ATOM   479   O  O   . PRO A  1  92  ? 39.877  11.956  28.078  1.00 38.46  ? 120  PRO A O   1 
ATOM   480   C  CB  . PRO A  1  92  ? 42.349  13.150  26.423  1.00 39.74  ? 120  PRO A CB  1 
ATOM   481   C  CG  . PRO A  1  92  ? 41.246  13.544  25.458  1.00 40.08  ? 120  PRO A CG  1 
ATOM   482   C  CD  . PRO A  1  92  ? 40.833  12.264  24.785  1.00 39.91  ? 120  PRO A CD  1 
ATOM   483   N  N   . ALA A  1  93  ? 41.771  11.856  29.310  1.00 38.09  ? 121  ALA A N   1 
ATOM   484   C  CA  . ALA A  1  93  ? 41.067  11.901  30.580  1.00 37.10  ? 121  ALA A CA  1 
ATOM   485   C  C   . ALA A  1  93  ? 40.175  13.149  30.714  1.00 36.44  ? 121  ALA A C   1 
ATOM   486   O  O   . ALA A  1  93  ? 40.618  14.283  30.535  1.00 35.86  ? 121  ALA A O   1 
ATOM   487   C  CB  . ALA A  1  93  ? 42.051  11.777  31.738  1.00 37.30  ? 121  ALA A CB  1 
ATOM   488   N  N   . ARG A  1  94  ? 38.900  12.894  30.984  1.00 35.73  ? 122  ARG A N   1 
ATOM   489   C  CA  . ARG A  1  94  ? 37.925  13.913  31.287  1.00 35.20  ? 122  ARG A CA  1 
ATOM   490   C  C   . ARG A  1  94  ? 38.274  14.570  32.619  1.00 34.63  ? 122  ARG A C   1 
ATOM   491   O  O   . ARG A  1  94  ? 38.243  13.915  33.662  1.00 33.99  ? 122  ARG A O   1 
ATOM   492   C  CB  . ARG A  1  94  ? 36.544  13.258  31.387  1.00 35.78  ? 122  ARG A CB  1 
ATOM   493   C  CG  . ARG A  1  94  ? 35.565  13.647  30.297  1.00 35.68  ? 122  ARG A CG  1 
ATOM   494   C  CD  . ARG A  1  94  ? 34.742  14.869  30.705  1.00 35.13  ? 122  ARG A CD  1 
ATOM   495   N  NE  . ARG A  1  94  ? 34.171  15.507  29.528  1.00 35.58  ? 122  ARG A NE  1 
ATOM   496   C  CZ  . ARG A  1  94  ? 33.083  16.268  29.511  1.00 34.63  ? 122  ARG A CZ  1 
ATOM   497   N  NH1 . ARG A  1  94  ? 32.394  16.515  30.606  1.00 32.76  ? 122  ARG A NH1 1 
ATOM   498   N  NH2 . ARG A  1  94  ? 32.684  16.774  28.365  1.00 36.32  ? 122  ARG A NH2 1 
ATOM   499   N  N   . GLU A  1  95  ? 38.593  15.863  32.577  1.00 34.00  ? 123  GLU A N   1 
ATOM   500   C  CA  . GLU A  1  95  ? 39.067  16.586  33.763  1.00 33.12  ? 123  GLU A CA  1 
ATOM   501   C  C   . GLU A  1  95  ? 38.332  17.893  33.997  1.00 32.89  ? 123  GLU A C   1 
ATOM   502   O  O   . GLU A  1  95  ? 37.812  18.502  33.056  1.00 32.92  ? 123  GLU A O   1 
ATOM   503   C  CB  . GLU A  1  95  ? 40.567  16.871  33.663  1.00 32.89  ? 123  GLU A CB  1 
ATOM   504   C  CG  . GLU A  1  95  ? 41.453  15.637  33.742  1.00 32.59  ? 123  GLU A CG  1 
ATOM   505   C  CD  . GLU A  1  95  ? 42.932  15.974  33.631  1.00 32.78  ? 123  GLU A CD  1 
ATOM   506   O  OE1 . GLU A  1  95  ? 43.279  16.967  32.951  1.00 32.09  ? 123  GLU A OE1 1 
ATOM   507   O  OE2 . GLU A  1  95  ? 43.751  15.244  34.224  1.00 32.96  ? 123  GLU A OE2 1 
ATOM   508   N  N   . ALA A  1  96  ? 38.306  18.319  35.262  1.00 32.25  ? 124  ALA A N   1 
ATOM   509   C  CA  . ALA A  1  96  ? 37.787  19.627  35.649  1.00 31.74  ? 124  ALA A CA  1 
ATOM   510   C  C   . ALA A  1  96  ? 38.893  20.491  36.246  1.00 31.44  ? 124  ALA A C   1 
ATOM   511   O  O   . ALA A  1  96  ? 39.838  19.975  36.837  1.00 31.40  ? 124  ALA A O   1 
ATOM   512   C  CB  . ALA A  1  96  ? 36.658  19.470  36.649  1.00 31.75  ? 124  ALA A CB  1 
ATOM   513   N  N   . LEU A  1  97  ? 38.773  21.802  36.070  1.00 31.18  ? 125  LEU A N   1 
ATOM   514   C  CA  . LEU A  1  97  ? 39.578  22.761  36.808  1.00 30.96  ? 125  LEU A CA  1 
ATOM   515   C  C   . LEU A  1  97  ? 38.724  23.471  37.857  1.00 30.89  ? 125  LEU A C   1 
ATOM   516   O  O   . LEU A  1  97  ? 37.715  24.103  37.529  1.00 30.73  ? 125  LEU A O   1 
ATOM   517   C  CB  . LEU A  1  97  ? 40.186  23.810  35.880  1.00 31.01  ? 125  LEU A CB  1 
ATOM   518   C  CG  . LEU A  1  97  ? 41.139  24.766  36.605  1.00 31.05  ? 125  LEU A CG  1 
ATOM   519   C  CD1 . LEU A  1  97  ? 42.570  24.254  36.504  1.00 31.06  ? 125  LEU A CD1 1 
ATOM   520   C  CD2 . LEU A  1  97  ? 41.031  26.170  36.058  1.00 31.40  ? 125  LEU A CD2 1 
ATOM   521   N  N   . ALA A  1  98  ? 39.148  23.370  39.113  1.00 30.58  ? 126  ALA A N   1 
ATOM   522   C  CA  . ALA A  1  98  ? 38.487  24.063  40.215  1.00 30.34  ? 126  ALA A CA  1 
ATOM   523   C  C   . ALA A  1  98  ? 39.387  25.169  40.738  1.00 30.24  ? 126  ALA A C   1 
ATOM   524   O  O   . ALA A  1  98  ? 40.594  24.949  40.949  1.00 30.14  ? 126  ALA A O   1 
ATOM   525   C  CB  . ALA A  1  98  ? 38.152  23.101  41.319  1.00 30.26  ? 126  ALA A CB  1 
ATOM   526   N  N   . ILE A  1  99  ? 38.809  26.362  40.896  1.00 29.66  ? 127  ILE A N   1 
ATOM   527   C  CA  . ILE A  1  99  ? 39.508  27.485  41.494  1.00 29.13  ? 127  ILE A CA  1 
ATOM   528   C  C   . ILE A  1  99  ? 39.095  27.536  42.959  1.00 29.37  ? 127  ILE A C   1 
ATOM   529   O  O   . ILE A  1  99  ? 37.903  27.616  43.276  1.00 29.30  ? 127  ILE A O   1 
ATOM   530   C  CB  . ILE A  1  99  ? 39.183  28.816  40.788  1.00 28.98  ? 127  ILE A CB  1 
ATOM   531   C  CG1 . ILE A  1  99  ? 39.839  28.857  39.404  1.00 28.89  ? 127  ILE A CG1 1 
ATOM   532   C  CG2 . ILE A  1  99  ? 39.645  30.002  41.635  1.00 28.59  ? 127  ILE A CG2 1 
ATOM   533   C  CD1 . ILE A  1  99  ? 39.183  29.797  38.399  1.00 25.82  ? 127  ILE A CD1 1 
ATOM   534   N  N   . VAL A  1  100 ? 40.089  27.473  43.843  1.00 29.34  ? 128  VAL A N   1 
ATOM   535   C  CA  . VAL A  1  100 ? 39.863  27.542  45.282  1.00 29.58  ? 128  VAL A CA  1 
ATOM   536   C  C   . VAL A  1  100 ? 40.488  28.797  45.899  1.00 29.80  ? 128  VAL A C   1 
ATOM   537   O  O   . VAL A  1  100 ? 41.585  29.207  45.524  1.00 29.84  ? 128  VAL A O   1 
ATOM   538   C  CB  . VAL A  1  100 ? 40.393  26.276  45.991  1.00 29.62  ? 128  VAL A CB  1 
ATOM   539   C  CG1 . VAL A  1  100 ? 39.961  26.255  47.466  1.00 29.00  ? 128  VAL A CG1 1 
ATOM   540   C  CG2 . VAL A  1  100 ? 39.887  25.024  45.272  1.00 29.59  ? 128  VAL A CG2 1 
ATOM   541   N  N   . PHE A  1  101 ? 39.760  29.408  46.833  1.00 30.25  ? 129  PHE A N   1 
ATOM   542   C  CA  . PHE A  1  101 ? 40.223  30.581  47.578  1.00 30.43  ? 129  PHE A CA  1 
ATOM   543   C  C   . PHE A  1  101 ? 40.680  30.120  48.940  1.00 30.74  ? 129  PHE A C   1 
ATOM   544   O  O   . PHE A  1  101 ? 39.853  29.797  49.800  1.00 30.81  ? 129  PHE A O   1 
ATOM   545   C  CB  . PHE A  1  101 ? 39.083  31.587  47.761  1.00 29.99  ? 129  PHE A CB  1 
ATOM   546   C  CG  . PHE A  1  101 ? 38.737  32.342  46.522  1.00 29.26  ? 129  PHE A CG  1 
ATOM   547   C  CD1 . PHE A  1  101 ? 37.829  33.399  46.582  1.00 28.53  ? 129  PHE A CD1 1 
ATOM   548   C  CD2 . PHE A  1  101 ? 39.322  32.022  45.306  1.00 27.50  ? 129  PHE A CD2 1 
ATOM   549   C  CE1 . PHE A  1  101 ? 37.497  34.102  45.460  1.00 27.41  ? 129  PHE A CE1 1 
ATOM   550   C  CE2 . PHE A  1  101 ? 38.997  32.730  44.167  1.00 28.80  ? 129  PHE A CE2 1 
ATOM   551   C  CZ  . PHE A  1  101 ? 38.078  33.771  44.243  1.00 28.55  ? 129  PHE A CZ  1 
ATOM   552   N  N   . PHE A  1  102 ? 41.993  30.082  49.142  1.00 31.23  ? 130  PHE A N   1 
ATOM   553   C  CA  . PHE A  1  102 ? 42.530  29.621  50.419  1.00 31.66  ? 130  PHE A CA  1 
ATOM   554   C  C   . PHE A  1  102 ? 42.812  30.808  51.331  1.00 32.11  ? 130  PHE A C   1 
ATOM   555   O  O   . PHE A  1  102 ? 43.960  31.266  51.440  1.00 32.62  ? 130  PHE A O   1 
ATOM   556   C  CB  . PHE A  1  102 ? 43.785  28.776  50.216  1.00 31.26  ? 130  PHE A CB  1 
ATOM   557   C  CG  . PHE A  1  102 ? 43.517  27.392  49.686  1.00 30.74  ? 130  PHE A CG  1 
ATOM   558   C  CD1 . PHE A  1  102 ? 43.831  27.066  48.368  1.00 29.84  ? 130  PHE A CD1 1 
ATOM   559   C  CD2 . PHE A  1  102 ? 42.979  26.402  50.513  1.00 29.82  ? 130  PHE A CD2 1 
ATOM   560   C  CE1 . PHE A  1  102 ? 43.610  25.770  47.878  1.00 30.05  ? 130  PHE A CE1 1 
ATOM   561   C  CE2 . PHE A  1  102 ? 42.749  25.104  50.033  1.00 28.64  ? 130  PHE A CE2 1 
ATOM   562   C  CZ  . PHE A  1  102 ? 43.062  24.788  48.718  1.00 29.93  ? 130  PHE A CZ  1 
ATOM   563   N  N   . GLY A  1  103 ? 41.758  31.309  51.974  1.00 32.18  ? 131  GLY A N   1 
ATOM   564   C  CA  . GLY A  1  103 ? 41.869  32.456  52.872  1.00 32.71  ? 131  GLY A CA  1 
ATOM   565   C  C   . GLY A  1  103 ? 42.193  32.130  54.318  1.00 33.16  ? 131  GLY A C   1 
ATOM   566   O  O   . GLY A  1  103 ? 42.559  33.012  55.078  1.00 33.50  ? 131  GLY A O   1 
ATOM   567   N  N   . ARG A  1  104 ? 42.072  30.859  54.692  1.00 33.85  ? 132  ARG A N   1 
ATOM   568   C  CA  . ARG A  1  104 ? 42.155  30.420  56.087  1.00 34.45  ? 132  ARG A CA  1 
ATOM   569   C  C   . ARG A  1  104 ? 43.570  29.929  56.397  1.00 34.51  ? 132  ARG A C   1 
ATOM   570   O  O   . ARG A  1  104 ? 43.778  28.766  56.761  1.00 34.68  ? 132  ARG A O   1 
ATOM   571   C  CB  . ARG A  1  104 ? 41.076  29.340  56.336  1.00 34.54  ? 132  ARG A CB  1 
ATOM   572   C  CG  . ARG A  1  104 ? 40.930  28.779  57.769  1.00 36.36  ? 132  ARG A CG  1 
ATOM   573   C  CD  . ARG A  1  104 ? 40.425  29.816  58.786  1.00 39.57  ? 132  ARG A CD  1 
ATOM   574   N  NE  . ARG A  1  104 ? 39.129  30.408  58.439  1.00 41.44  ? 132  ARG A NE  1 
ATOM   575   C  CZ  . ARG A  1  104 ? 38.691  31.582  58.900  1.00 42.44  ? 132  ARG A CZ  1 
ATOM   576   N  NH1 . ARG A  1  104 ? 39.446  32.302  59.728  1.00 42.75  ? 132  ARG A NH1 1 
ATOM   577   N  NH2 . ARG A  1  104 ? 37.499  32.046  58.532  1.00 41.73  ? 132  ARG A NH2 1 
ATOM   578   N  N   . GLN A  1  105 ? 44.546  30.820  56.238  1.00 34.65  ? 133  GLN A N   1 
ATOM   579   C  CA  . GLN A  1  105 ? 45.960  30.459  56.428  1.00 35.05  ? 133  GLN A CA  1 
ATOM   580   C  C   . GLN A  1  105 ? 46.878  31.682  56.539  1.00 35.67  ? 133  GLN A C   1 
ATOM   581   O  O   . GLN A  1  105 ? 46.513  32.766  56.094  1.00 35.83  ? 133  GLN A O   1 
ATOM   582   C  CB  . GLN A  1  105 ? 46.441  29.519  55.309  1.00 34.71  ? 133  GLN A CB  1 
ATOM   583   C  CG  . GLN A  1  105 ? 46.442  30.143  53.924  1.00 34.22  ? 133  GLN A CG  1 
ATOM   584   C  CD  . GLN A  1  105 ? 46.527  29.117  52.820  1.00 33.54  ? 133  GLN A CD  1 
ATOM   585   O  OE1 . GLN A  1  105 ? 45.908  28.053  52.891  1.00 32.19  ? 133  GLN A OE1 1 
ATOM   586   N  NE2 . GLN A  1  105 ? 47.290  29.436  51.778  1.00 33.53  ? 133  GLN A NE2 1 
ATOM   587   N  N   . PRO A  1  106 ? 48.058  31.520  57.171  1.00 36.45  ? 134  PRO A N   1 
ATOM   588   C  CA  . PRO A  1  106 ? 49.079  32.576  57.268  1.00 37.04  ? 134  PRO A CA  1 
ATOM   589   C  C   . PRO A  1  106 ? 49.432  33.298  55.953  1.00 37.69  ? 134  PRO A C   1 
ATOM   590   O  O   . PRO A  1  106 ? 49.552  34.528  55.968  1.00 38.24  ? 134  PRO A O   1 
ATOM   591   C  CB  . PRO A  1  106 ? 50.307  31.838  57.831  1.00 37.34  ? 134  PRO A CB  1 
ATOM   592   C  CG  . PRO A  1  106 ? 49.948  30.364  57.838  1.00 36.93  ? 134  PRO A CG  1 
ATOM   593   C  CD  . PRO A  1  106 ? 48.467  30.307  57.902  1.00 36.43  ? 134  PRO A CD  1 
ATOM   594   N  N   . GLN A  1  107 ? 49.612  32.565  54.846  1.00 37.93  ? 135  GLN A N   1 
ATOM   595   C  CA  . GLN A  1  107 ? 49.809  33.187  53.510  1.00 38.05  ? 135  GLN A CA  1 
ATOM   596   C  C   . GLN A  1  107 ? 48.628  32.852  52.593  1.00 37.38  ? 135  GLN A C   1 
ATOM   597   O  O   . GLN A  1  107 ? 48.670  31.856  51.871  1.00 37.19  ? 135  GLN A O   1 
ATOM   598   C  CB  . GLN A  1  107 ? 51.107  32.719  52.815  1.00 38.36  ? 135  GLN A CB  1 
ATOM   599   C  CG  . GLN A  1  107 ? 52.264  32.282  53.723  1.00 41.21  ? 135  GLN A CG  1 
ATOM   600   C  CD  . GLN A  1  107 ? 53.023  33.452  54.348  1.00 44.78  ? 135  GLN A CD  1 
ATOM   601   O  OE1 . GLN A  1  107 ? 53.168  34.523  53.738  1.00 46.62  ? 135  GLN A OE1 1 
ATOM   602   N  NE2 . GLN A  1  107 ? 53.520  33.246  55.569  1.00 45.37  ? 135  GLN A NE2 1 
ATOM   603   N  N   . PRO A  1  108 ? 47.564  33.671  52.627  1.00 36.91  ? 136  PRO A N   1 
ATOM   604   C  CA  . PRO A  1  108 ? 46.408  33.441  51.752  1.00 36.46  ? 136  PRO A CA  1 
ATOM   605   C  C   . PRO A  1  108 ? 46.802  33.395  50.283  1.00 35.89  ? 136  PRO A C   1 
ATOM   606   O  O   . PRO A  1  108 ? 47.620  34.197  49.840  1.00 36.05  ? 136  PRO A O   1 
ATOM   607   C  CB  . PRO A  1  108 ? 45.521  34.667  52.006  1.00 36.46  ? 136  PRO A CB  1 
ATOM   608   C  CG  . PRO A  1  108 ? 45.904  35.138  53.363  1.00 36.84  ? 136  PRO A CG  1 
ATOM   609   C  CD  . PRO A  1  108 ? 47.372  34.845  53.499  1.00 36.93  ? 136  PRO A CD  1 
ATOM   610   N  N   . ASN A  1  109 ? 46.236  32.443  49.547  1.00 35.20  ? 137  ASN A N   1 
ATOM   611   C  CA  . ASN A  1  109 ? 46.431  32.350  48.101  1.00 34.53  ? 137  ASN A CA  1 
ATOM   612   C  C   . ASN A  1  109 ? 45.181  31.818  47.393  1.00 33.85  ? 137  ASN A C   1 
ATOM   613   O  O   . ASN A  1  109 ? 44.262  31.283  48.026  1.00 33.77  ? 137  ASN A O   1 
ATOM   614   C  CB  . ASN A  1  109 ? 47.694  31.522  47.745  1.00 34.74  ? 137  ASN A CB  1 
ATOM   615   C  CG  . ASN A  1  109 ? 47.470  30.003  47.792  1.00 35.64  ? 137  ASN A CG  1 
ATOM   616   O  OD1 . ASN A  1  109 ? 46.507  29.482  47.228  1.00 35.57  ? 137  ASN A OD1 1 
ATOM   617   N  ND2 . ASN A  1  109 ? 48.393  29.287  48.444  1.00 39.59  ? 137  ASN A ND2 1 
ATOM   618   N  N   . VAL A  1  110 ? 45.153  31.971  46.077  1.00 32.92  ? 138  VAL A N   1 
ATOM   619   C  CA  . VAL A  1  110 ? 44.174  31.273  45.258  1.00 31.94  ? 138  VAL A CA  1 
ATOM   620   C  C   . VAL A  1  110 ? 44.897  30.216  44.429  1.00 31.68  ? 138  VAL A C   1 
ATOM   621   O  O   . VAL A  1  110 ? 45.995  30.456  43.912  1.00 31.04  ? 138  VAL A O   1 
ATOM   622   C  CB  . VAL A  1  110 ? 43.286  32.250  44.401  1.00 31.94  ? 138  VAL A CB  1 
ATOM   623   C  CG1 . VAL A  1  110 ? 43.976  33.588  44.177  1.00 31.37  ? 138  VAL A CG1 1 
ATOM   624   C  CG2 . VAL A  1  110 ? 42.841  31.606  43.091  1.00 31.19  ? 138  VAL A CG2 1 
ATOM   625   N  N   . SER A  1  111 ? 44.280  29.040  44.334  1.00 31.57  ? 139  SER A N   1 
ATOM   626   C  CA  . SER A  1  111 ? 44.866  27.914  43.620  1.00 31.59  ? 139  SER A CA  1 
ATOM   627   C  C   . SER A  1  111 ? 43.950  27.369  42.540  1.00 31.49  ? 139  SER A C   1 
ATOM   628   O  O   . SER A  1  111 ? 42.744  27.237  42.740  1.00 31.39  ? 139  SER A O   1 
ATOM   629   C  CB  . SER A  1  111 ? 45.240  26.779  44.590  1.00 31.60  ? 139  SER A CB  1 
ATOM   630   O  OG  . SER A  1  111 ? 46.234  27.187  45.512  1.00 31.51  ? 139  SER A OG  1 
ATOM   631   N  N   . GLU A  1  112 ? 44.549  27.051  41.399  1.00 31.56  ? 140  GLU A N   1 
ATOM   632   C  CA  . GLU A  1  112 ? 43.890  26.303  40.354  1.00 31.91  ? 140  GLU A CA  1 
ATOM   633   C  C   . GLU A  1  112 ? 44.237  24.855  40.569  1.00 31.87  ? 140  GLU A C   1 
ATOM   634   O  O   . GLU A  1  112 ? 45.404  24.533  40.729  1.00 32.22  ? 140  GLU A O   1 
ATOM   635   C  CB  . GLU A  1  112 ? 44.414  26.726  39.001  1.00 31.74  ? 140  GLU A CB  1 
ATOM   636   C  CG  . GLU A  1  112 ? 43.963  28.086  38.562  1.00 33.46  ? 140  GLU A CG  1 
ATOM   637   C  CD  . GLU A  1  112 ? 44.890  28.663  37.516  1.00 35.17  ? 140  GLU A CD  1 
ATOM   638   O  OE1 . GLU A  1  112 ? 46.043  28.979  37.885  1.00 35.08  ? 140  GLU A OE1 1 
ATOM   639   O  OE2 . GLU A  1  112 ? 44.478  28.781  36.336  1.00 36.37  ? 140  GLU A OE2 1 
ATOM   640   N  N   . LEU A  1  113 ? 43.225  23.990  40.567  1.00 32.20  ? 141  LEU A N   1 
ATOM   641   C  CA  . LEU A  1  113 ? 43.397  22.559  40.845  1.00 32.23  ? 141  LEU A CA  1 
ATOM   642   C  C   . LEU A  1  113 ? 42.741  21.716  39.756  1.00 32.82  ? 141  LEU A C   1 
ATOM   643   O  O   . LEU A  1  113 ? 41.559  21.901  39.435  1.00 32.81  ? 141  LEU A O   1 
ATOM   644   C  CB  . LEU A  1  113 ? 42.802  22.182  42.214  1.00 31.92  ? 141  LEU A CB  1 
ATOM   645   C  CG  . LEU A  1  113 ? 43.175  22.945  43.501  1.00 31.22  ? 141  LEU A CG  1 
ATOM   646   C  CD1 . LEU A  1  113 ? 42.362  22.452  44.702  1.00 29.08  ? 141  LEU A CD1 1 
ATOM   647   C  CD2 . LEU A  1  113 ? 44.667  22.875  43.809  1.00 30.39  ? 141  LEU A CD2 1 
ATOM   648   N  N   . VAL A  1  114 ? 43.517  20.800  39.182  1.00 33.35  ? 142  VAL A N   1 
ATOM   649   C  CA  . VAL A  1  114 ? 42.992  19.860  38.210  1.00 33.94  ? 142  VAL A CA  1 
ATOM   650   C  C   . VAL A  1  114 ? 42.461  18.651  38.974  1.00 34.68  ? 142  VAL A C   1 
ATOM   651   O  O   . VAL A  1  114 ? 43.162  18.093  39.826  1.00 34.76  ? 142  VAL A O   1 
ATOM   652   C  CB  . VAL A  1  114 ? 44.064  19.461  37.160  1.00 34.07  ? 142  VAL A CB  1 
ATOM   653   C  CG1 . VAL A  1  114 ? 43.628  18.236  36.350  1.00 34.03  ? 142  VAL A CG1 1 
ATOM   654   C  CG2 . VAL A  1  114 ? 44.354  20.629  36.214  1.00 33.28  ? 142  VAL A CG2 1 
ATOM   655   N  N   . VAL A  1  115 ? 41.213  18.282  38.696  1.00 35.36  ? 143  VAL A N   1 
ATOM   656   C  CA  . VAL A  1  115 ? 40.586  17.139  39.339  1.00 36.47  ? 143  VAL A CA  1 
ATOM   657   C  C   . VAL A  1  115 ? 40.181  16.171  38.244  1.00 37.59  ? 143  VAL A C   1 
ATOM   658   O  O   . VAL A  1  115 ? 39.620  16.592  37.229  1.00 37.93  ? 143  VAL A O   1 
ATOM   659   C  CB  . VAL A  1  115 ? 39.340  17.546  40.192  1.00 36.75  ? 143  VAL A CB  1 
ATOM   660   C  CG1 . VAL A  1  115 ? 38.590  16.312  40.722  1.00 36.42  ? 143  VAL A CG1 1 
ATOM   661   C  CG2 . VAL A  1  115 ? 39.733  18.471  41.357  1.00 36.07  ? 143  VAL A CG2 1 
ATOM   662   N  N   . GLY A  1  116 ? 40.485  14.885  38.437  1.00 38.54  ? 144  GLY A N   1 
ATOM   663   C  CA  . GLY A  1  116 ? 40.089  13.850  37.486  1.00 39.70  ? 144  GLY A CA  1 
ATOM   664   C  C   . GLY A  1  116 ? 40.282  12.431  37.993  1.00 40.76  ? 144  GLY A C   1 
ATOM   665   O  O   . GLY A  1  116 ? 40.756  12.230  39.118  1.00 40.60  ? 144  GLY A O   1 
ATOM   666   N  N   . PRO A  1  117 ? 39.887  11.428  37.178  1.00 41.52  ? 145  PRO A N   1 
ATOM   667   C  CA  . PRO A  1  117 ? 39.151  11.578  35.923  1.00 42.04  ? 145  PRO A CA  1 
ATOM   668   C  C   . PRO A  1  117 ? 37.639  11.513  36.155  1.00 42.77  ? 145  PRO A C   1 
ATOM   669   O  O   . PRO A  1  117 ? 37.197  11.081  37.221  1.00 43.19  ? 145  PRO A O   1 
ATOM   670   C  CB  . PRO A  1  117 ? 39.594  10.349  35.116  1.00 42.15  ? 145  PRO A CB  1 
ATOM   671   C  CG  . PRO A  1  117 ? 40.244  9.393   36.121  1.00 41.30  ? 145  PRO A CG  1 
ATOM   672   C  CD  . PRO A  1  117 ? 40.168  10.010  37.469  1.00 41.33  ? 145  PRO A CD  1 
ATOM   673   N  N   . LEU A  1  118 ? 36.850  11.932  35.172  1.00 43.23  ? 146  LEU A N   1 
ATOM   674   C  CA  . LEU A  1  118 ? 35.400  11.773  35.254  1.00 43.63  ? 146  LEU A CA  1 
ATOM   675   C  C   . LEU A  1  118 ? 34.991  10.518  34.482  1.00 44.15  ? 146  LEU A C   1 
ATOM   676   O  O   . LEU A  1  118 ? 35.587  10.216  33.447  1.00 44.09  ? 146  LEU A O   1 
ATOM   677   C  CB  . LEU A  1  118 ? 34.685  13.039  34.762  1.00 43.66  ? 146  LEU A CB  1 
ATOM   678   C  CG  . LEU A  1  118 ? 34.874  14.213  35.731  1.00 42.80  ? 146  LEU A CG  1 
ATOM   679   C  CD1 . LEU A  1  118 ? 34.964  15.506  34.989  1.00 42.82  ? 146  LEU A CD1 1 
ATOM   680   C  CD2 . LEU A  1  118 ? 33.774  14.273  36.764  1.00 43.10  ? 146  LEU A CD2 1 
ATOM   681   N  N   . PRO A  1  119 ? 33.957  9.796   34.961  1.00 44.76  ? 147  PRO A N   1 
ATOM   682   C  CA  . PRO A  1  119 ? 32.935  10.249  35.901  1.00 45.36  ? 147  PRO A CA  1 
ATOM   683   C  C   . PRO A  1  119 ? 33.273  10.157  37.404  1.00 45.87  ? 147  PRO A C   1 
ATOM   684   O  O   . PRO A  1  119 ? 32.735  10.956  38.178  1.00 46.11  ? 147  PRO A O   1 
ATOM   685   C  CB  . PRO A  1  119 ? 31.727  9.361   35.555  1.00 45.40  ? 147  PRO A CB  1 
ATOM   686   C  CG  . PRO A  1  119 ? 32.290  8.163   34.817  1.00 44.67  ? 147  PRO A CG  1 
ATOM   687   C  CD  . PRO A  1  119 ? 33.764  8.376   34.612  1.00 44.83  ? 147  PRO A CD  1 
ATOM   688   N  N   . HIS A  1  120 ? 34.139  9.217   37.808  1.00 46.21  ? 148  HIS A N   1 
ATOM   689   C  CA  . HIS A  1  120 ? 34.495  9.024   39.235  1.00 46.54  ? 148  HIS A CA  1 
ATOM   690   C  C   . HIS A  1  120 ? 35.911  9.529   39.585  1.00 45.73  ? 148  HIS A C   1 
ATOM   691   O  O   . HIS A  1  120 ? 36.896  8.815   39.371  1.00 45.62  ? 148  HIS A O   1 
ATOM   692   C  CB  . HIS A  1  120 ? 34.342  7.551   39.653  1.00 47.22  ? 148  HIS A CB  1 
ATOM   693   C  CG  . HIS A  1  120 ? 33.135  6.875   39.073  1.00 50.03  ? 148  HIS A CG  1 
ATOM   694   N  ND1 . HIS A  1  120 ? 33.225  5.868   38.130  1.00 51.91  ? 148  HIS A ND1 1 
ATOM   695   C  CD2 . HIS A  1  120 ? 31.811  7.072   39.288  1.00 51.84  ? 148  HIS A CD2 1 
ATOM   696   C  CE1 . HIS A  1  120 ? 32.010  5.470   37.796  1.00 52.59  ? 148  HIS A CE1 1 
ATOM   697   N  NE2 . HIS A  1  120 ? 31.134  6.185   38.483  1.00 53.12  ? 148  HIS A NE2 1 
ATOM   698   N  N   . PRO A  1  121 ? 36.009  10.761  40.136  1.00 45.04  ? 149  PRO A N   1 
ATOM   699   C  CA  . PRO A  1  121 ? 37.285  11.455  40.368  1.00 44.54  ? 149  PRO A CA  1 
ATOM   700   C  C   . PRO A  1  121 ? 38.227  10.735  41.331  1.00 44.07  ? 149  PRO A C   1 
ATOM   701   O  O   . PRO A  1  121 ? 37.777  10.102  42.281  1.00 43.70  ? 149  PRO A O   1 
ATOM   702   C  CB  . PRO A  1  121 ? 36.851  12.808  40.951  1.00 44.51  ? 149  PRO A CB  1 
ATOM   703   C  CG  . PRO A  1  121 ? 35.423  12.964  40.536  1.00 44.55  ? 149  PRO A CG  1 
ATOM   704   C  CD  . PRO A  1  121 ? 34.866  11.584  40.571  1.00 44.88  ? 149  PRO A CD  1 
ATOM   705   N  N   . SER A  1  122 ? 39.527  10.867  41.085  1.00 43.67  ? 150  SER A N   1 
ATOM   706   C  CA  . SER A  1  122 ? 40.540  10.097  41.799  1.00 43.18  ? 150  SER A CA  1 
ATOM   707   C  C   . SER A  1  122 ? 41.798  10.896  42.181  1.00 42.87  ? 150  SER A C   1 
ATOM   708   O  O   . SER A  1  122 ? 42.515  10.519  43.106  1.00 42.59  ? 150  SER A O   1 
ATOM   709   C  CB  . SER A  1  122 ? 40.899  8.846   40.977  1.00 43.19  ? 150  SER A CB  1 
ATOM   710   O  OG  . SER A  1  122 ? 42.285  8.566   40.999  1.00 42.86  ? 150  SER A OG  1 
ATOM   711   N  N   . TYR A  1  123 ? 42.079  11.981  41.467  1.00 42.62  ? 151  TYR A N   1 
ATOM   712   C  CA  . TYR A  1  123 ? 43.252  12.801  41.789  1.00 42.56  ? 151  TYR A CA  1 
ATOM   713   C  C   . TYR A  1  123 ? 42.938  14.285  41.902  1.00 42.80  ? 151  TYR A C   1 
ATOM   714   O  O   . TYR A  1  123 ? 41.889  14.761  41.453  1.00 42.71  ? 151  TYR A O   1 
ATOM   715   C  CB  . TYR A  1  123 ? 44.427  12.559  40.816  1.00 42.36  ? 151  TYR A CB  1 
ATOM   716   C  CG  . TYR A  1  123 ? 44.098  12.689  39.335  1.00 41.99  ? 151  TYR A CG  1 
ATOM   717   C  CD1 . TYR A  1  123 ? 44.126  13.927  38.691  1.00 41.27  ? 151  TYR A CD1 1 
ATOM   718   C  CD2 . TYR A  1  123 ? 43.782  11.562  38.576  1.00 42.22  ? 151  TYR A CD2 1 
ATOM   719   C  CE1 . TYR A  1  123 ? 43.824  14.041  37.326  1.00 41.46  ? 151  TYR A CE1 1 
ATOM   720   C  CE2 . TYR A  1  123 ? 43.479  11.667  37.209  1.00 42.30  ? 151  TYR A CE2 1 
ATOM   721   C  CZ  . TYR A  1  123 ? 43.500  12.906  36.600  1.00 41.61  ? 151  TYR A CZ  1 
ATOM   722   O  OH  . TYR A  1  123 ? 43.198  12.991  35.271  1.00 41.16  ? 151  TYR A OH  1 
ATOM   723   N  N   . MET A  1  124 ? 43.862  14.999  42.533  1.00 43.13  ? 152  MET A N   1 
ATOM   724   C  CA  . MET A  1  124 ? 43.799  16.439  42.665  1.00 43.51  ? 152  MET A CA  1 
ATOM   725   C  C   . MET A  1  124 ? 45.220  16.943  42.542  1.00 43.51  ? 152  MET A C   1 
ATOM   726   O  O   . MET A  1  124 ? 46.066  16.650  43.382  1.00 43.52  ? 152  MET A O   1 
ATOM   727   C  CB  . MET A  1  124 ? 43.206  16.829  44.012  1.00 43.33  ? 152  MET A CB  1 
ATOM   728   C  CG  . MET A  1  124 ? 42.998  18.328  44.186  1.00 44.27  ? 152  MET A CG  1 
ATOM   729   S  SD  . MET A  1  124 ? 42.357  18.760  45.823  1.00 44.27  ? 152  MET A SD  1 
ATOM   730   C  CE  . MET A  1  124 ? 43.534  17.922  46.898  1.00 43.12  ? 152  MET A CE  1 
ATOM   731   N  N   . ARG A  1  125 ? 45.475  17.693  41.478  1.00 43.76  ? 153  ARG A N   1 
ATOM   732   C  CA  . ARG A  1  125 ? 46.807  18.174  41.160  1.00 43.86  ? 153  ARG A CA  1 
ATOM   733   C  C   . ARG A  1  125 ? 46.791  19.707  41.227  1.00 43.39  ? 153  ARG A C   1 
ATOM   734   O  O   . ARG A  1  125 ? 45.960  20.345  40.585  1.00 43.50  ? 153  ARG A O   1 
ATOM   735   C  CB  . ARG A  1  125 ? 47.174  17.661  39.760  1.00 44.25  ? 153  ARG A CB  1 
ATOM   736   C  CG  . ARG A  1  125 ? 48.631  17.833  39.294  1.00 46.16  ? 153  ARG A CG  1 
ATOM   737   C  CD  . ARG A  1  125 ? 48.702  18.111  37.758  1.00 48.75  ? 153  ARG A CD  1 
ATOM   738   N  NE  . ARG A  1  125 ? 47.927  17.150  36.957  1.00 50.60  ? 153  ARG A NE  1 
ATOM   739   C  CZ  . ARG A  1  125 ? 47.454  17.370  35.726  1.00 50.94  ? 153  ARG A CZ  1 
ATOM   740   N  NH1 . ARG A  1  125 ? 47.654  18.530  35.110  1.00 50.79  ? 153  ARG A NH1 1 
ATOM   741   N  NH2 . ARG A  1  125 ? 46.767  16.419  35.105  1.00 50.87  ? 153  ARG A NH2 1 
ATOM   742   N  N   . ASP A  1  126 ? 47.678  20.295  42.029  1.00 42.98  ? 154  ASP A N   1 
ATOM   743   C  CA  . ASP A  1  126 ? 47.829  21.757  42.069  1.00 42.61  ? 154  ASP A CA  1 
ATOM   744   C  C   . ASP A  1  126 ? 48.698  22.262  40.916  1.00 42.51  ? 154  ASP A C   1 
ATOM   745   O  O   . ASP A  1  126 ? 49.913  22.033  40.892  1.00 42.50  ? 154  ASP A O   1 
ATOM   746   C  CB  . ASP A  1  126 ? 48.420  22.223  43.403  1.00 42.37  ? 154  ASP A CB  1 
ATOM   747   C  CG  . ASP A  1  126 ? 48.510  23.749  43.512  1.00 42.65  ? 154  ASP A CG  1 
ATOM   748   O  OD1 . ASP A  1  126 ? 47.962  24.476  42.651  1.00 42.24  ? 154  ASP A OD1 1 
ATOM   749   O  OD2 . ASP A  1  126 ? 49.132  24.227  44.477  1.00 43.03  ? 154  ASP A OD2 1 
ATOM   750   N  N   . VAL A  1  127 ? 48.075  22.969  39.974  1.00 42.26  ? 155  VAL A N   1 
ATOM   751   C  CA  . VAL A  1  127 ? 48.777  23.443  38.774  1.00 42.02  ? 155  VAL A CA  1 
ATOM   752   C  C   . VAL A  1  127 ? 49.157  24.919  38.811  1.00 41.87  ? 155  VAL A C   1 
ATOM   753   O  O   . VAL A  1  127 ? 49.648  25.444  37.815  1.00 41.98  ? 155  VAL A O   1 
ATOM   754   C  CB  . VAL A  1  127 ? 47.963  23.181  37.480  1.00 41.83  ? 155  VAL A CB  1 
ATOM   755   C  CG1 . VAL A  1  127 ? 47.744  21.701  37.275  1.00 41.44  ? 155  VAL A CG1 1 
ATOM   756   C  CG2 . VAL A  1  127 ? 46.636  23.919  37.522  1.00 42.50  ? 155  VAL A CG2 1 
ATOM   757   N  N   . THR A  1  128 ? 48.927  25.585  39.942  1.00 41.86  ? 156  THR A N   1 
ATOM   758   C  CA  . THR A  1  128 ? 49.173  27.026  40.041  1.00 41.95  ? 156  THR A CA  1 
ATOM   759   C  C   . THR A  1  128 ? 50.623  27.395  39.739  1.00 42.08  ? 156  THR A C   1 
ATOM   760   O  O   . THR A  1  128 ? 50.876  28.180  38.823  1.00 42.40  ? 156  THR A O   1 
ATOM   761   C  CB  . THR A  1  128 ? 48.747  27.608  41.409  1.00 41.96  ? 156  THR A CB  1 
ATOM   762   O  OG1 . THR A  1  128 ? 47.344  27.407  41.593  1.00 41.98  ? 156  THR A OG1 1 
ATOM   763   C  CG2 . THR A  1  128 ? 49.034  29.107  41.477  1.00 41.89  ? 156  THR A CG2 1 
ATOM   764   N  N   . VAL A  1  129 ? 51.552  26.821  40.504  1.00 42.18  ? 157  VAL A N   1 
ATOM   765   C  CA  . VAL A  1  129 ? 52.984  27.094  40.380  1.00 42.41  ? 157  VAL A CA  1 
ATOM   766   C  C   . VAL A  1  129 ? 53.462  26.754  38.975  1.00 42.68  ? 157  VAL A C   1 
ATOM   767   O  O   . VAL A  1  129 ? 54.154  27.541  38.333  1.00 42.90  ? 157  VAL A O   1 
ATOM   768   C  CB  . VAL A  1  129 ? 53.815  26.250  41.382  1.00 42.72  ? 157  VAL A CB  1 
ATOM   769   C  CG1 . VAL A  1  129 ? 55.253  26.756  41.452  1.00 42.73  ? 157  VAL A CG1 1 
ATOM   770   C  CG2 . VAL A  1  129 ? 53.177  26.233  42.762  1.00 41.93  ? 157  VAL A CG2 1 
ATOM   771   N  N   . GLU A  1  130 ? 53.084  25.562  38.526  1.00 42.75  ? 158  GLU A N   1 
ATOM   772   C  CA  . GLU A  1  130 ? 53.302  25.074  37.170  1.00 42.96  ? 158  GLU A CA  1 
ATOM   773   C  C   . GLU A  1  130 ? 52.890  26.071  36.078  1.00 42.33  ? 158  GLU A C   1 
ATOM   774   O  O   . GLU A  1  130 ? 53.653  26.308  35.147  1.00 42.46  ? 158  GLU A O   1 
ATOM   775   C  CB  . GLU A  1  130 ? 52.521  23.774  37.017  1.00 42.79  ? 158  GLU A CB  1 
ATOM   776   C  CG  . GLU A  1  130 ? 52.774  22.964  35.771  1.00 44.24  ? 158  GLU A CG  1 
ATOM   777   C  CD  . GLU A  1  130 ? 51.923  21.690  35.766  1.00 44.90  ? 158  GLU A CD  1 
ATOM   778   O  OE1 . GLU A  1  130 ? 52.000  20.912  36.761  1.00 46.14  ? 158  GLU A OE1 1 
ATOM   779   O  OE2 . GLU A  1  130 ? 51.165  21.483  34.780  1.00 45.95  ? 158  GLU A OE2 1 
ATOM   780   N  N   . ARG A  1  131 ? 51.692  26.646  36.185  1.00 41.86  ? 159  ARG A N   1 
ATOM   781   C  CA  . ARG A  1  131 ? 51.195  27.602  35.174  1.00 41.16  ? 159  ARG A CA  1 
ATOM   782   C  C   . ARG A  1  131 ? 51.750  29.006  35.329  1.00 40.79  ? 159  ARG A C   1 
ATOM   783   O  O   . ARG A  1  131 ? 51.887  29.708  34.340  1.00 40.65  ? 159  ARG A O   1 
ATOM   784   C  CB  . ARG A  1  131 ? 49.664  27.681  35.178  1.00 40.93  ? 159  ARG A CB  1 
ATOM   785   C  CG  . ARG A  1  131 ? 48.986  26.488  34.553  1.00 40.62  ? 159  ARG A CG  1 
ATOM   786   C  CD  . ARG A  1  131 ? 47.515  26.424  34.911  1.00 38.74  ? 159  ARG A CD  1 
ATOM   787   N  NE  . ARG A  1  131 ? 46.879  25.263  34.291  1.00 37.56  ? 159  ARG A NE  1 
ATOM   788   C  CZ  . ARG A  1  131 ? 45.567  25.111  34.128  1.00 36.69  ? 159  ARG A CZ  1 
ATOM   789   N  NH1 . ARG A  1  131 ? 44.725  26.055  34.529  1.00 35.81  ? 159  ARG A NH1 1 
ATOM   790   N  NH2 . ARG A  1  131 ? 45.096  24.012  33.551  1.00 36.55  ? 159  ARG A NH2 1 
ATOM   791   N  N   . HIS A  1  132 ? 52.068  29.409  36.559  1.00 40.63  ? 160  HIS A N   1 
ATOM   792   C  CA  . HIS A  1  132 ? 52.358  30.824  36.854  1.00 40.95  ? 160  HIS A CA  1 
ATOM   793   C  C   . HIS A  1  132 ? 53.741  31.129  37.505  1.00 41.21  ? 160  HIS A C   1 
ATOM   794   O  O   . HIS A  1  132 ? 54.087  32.299  37.759  1.00 41.06  ? 160  HIS A O   1 
ATOM   795   C  CB  . HIS A  1  132 ? 51.215  31.434  37.689  1.00 40.66  ? 160  HIS A CB  1 
ATOM   796   C  CG  . HIS A  1  132 ? 49.849  31.242  37.094  1.00 40.03  ? 160  HIS A CG  1 
ATOM   797   N  ND1 . HIS A  1  132 ? 49.559  31.523  35.774  1.00 39.39  ? 160  HIS A ND1 1 
ATOM   798   C  CD2 . HIS A  1  132 ? 48.689  30.818  37.650  1.00 37.72  ? 160  HIS A CD2 1 
ATOM   799   C  CE1 . HIS A  1  132 ? 48.283  31.269  35.541  1.00 37.79  ? 160  HIS A CE1 1 
ATOM   800   N  NE2 . HIS A  1  132 ? 47.732  30.850  36.665  1.00 37.25  ? 160  HIS A NE2 1 
ATOM   801   N  N   . GLY A  1  133 ? 54.517  30.085  37.786  1.00 41.16  ? 161  GLY A N   1 
ATOM   802   C  CA  . GLY A  1  133 ? 55.869  30.260  38.317  1.00 41.25  ? 161  GLY A CA  1 
ATOM   803   C  C   . GLY A  1  133 ? 55.887  30.574  39.799  1.00 41.44  ? 161  GLY A C   1 
ATOM   804   O  O   . GLY A  1  133 ? 56.951  30.564  40.441  1.00 41.78  ? 161  GLY A O   1 
ATOM   805   N  N   . GLY A  1  134 ? 54.707  30.844  40.351  1.00 41.10  ? 162  GLY A N   1 
ATOM   806   C  CA  . GLY A  1  134 ? 54.569  31.174  41.765  1.00 40.37  ? 162  GLY A CA  1 
ATOM   807   C  C   . GLY A  1  134 ? 53.123  31.119  42.214  1.00 39.86  ? 162  GLY A C   1 
ATOM   808   O  O   . GLY A  1  134 ? 52.228  30.873  41.396  1.00 40.14  ? 162  GLY A O   1 
ATOM   809   N  N   . PRO A  1  135 ? 52.878  31.354  43.517  1.00 39.17  ? 163  PRO A N   1 
ATOM   810   C  CA  . PRO A  1  135 ? 51.505  31.348  44.006  1.00 38.59  ? 163  PRO A CA  1 
ATOM   811   C  C   . PRO A  1  135 ? 50.761  32.529  43.411  1.00 37.92  ? 163  PRO A C   1 
ATOM   812   O  O   . PRO A  1  135 ? 51.393  33.541  43.109  1.00 37.91  ? 163  PRO A O   1 
ATOM   813   C  CB  . PRO A  1  135 ? 51.672  31.550  45.514  1.00 38.83  ? 163  PRO A CB  1 
ATOM   814   C  CG  . PRO A  1  135 ? 53.003  32.254  45.657  1.00 39.10  ? 163  PRO A CG  1 
ATOM   815   C  CD  . PRO A  1  135 ? 53.851  31.659  44.584  1.00 39.04  ? 163  PRO A CD  1 
ATOM   816   N  N   . LEU A  1  136 ? 49.447  32.395  43.222  1.00 36.98  ? 164  LEU A N   1 
ATOM   817   C  CA  . LEU A  1  136 ? 48.602  33.542  42.886  1.00 35.99  ? 164  LEU A CA  1 
ATOM   818   C  C   . LEU A  1  136 ? 48.280  34.356  44.141  1.00 35.58  ? 164  LEU A C   1 
ATOM   819   O  O   . LEU A  1  136 ? 47.680  33.827  45.087  1.00 35.80  ? 164  LEU A O   1 
ATOM   820   C  CB  . LEU A  1  136 ? 47.317  33.091  42.205  1.00 35.85  ? 164  LEU A CB  1 
ATOM   821   C  CG  . LEU A  1  136 ? 47.471  32.563  40.779  1.00 35.61  ? 164  LEU A CG  1 
ATOM   822   C  CD1 . LEU A  1  136 ? 46.137  32.098  40.274  1.00 35.75  ? 164  LEU A CD1 1 
ATOM   823   C  CD2 . LEU A  1  136 ? 48.052  33.607  39.843  1.00 34.19  ? 164  LEU A CD2 1 
ATOM   824   N  N   . PRO A  1  137 ? 48.710  35.634  44.175  1.00 34.99  ? 165  PRO A N   1 
ATOM   825   C  CA  . PRO A  1  137 ? 48.399  36.488  45.318  1.00 34.70  ? 165  PRO A CA  1 
ATOM   826   C  C   . PRO A  1  137 ? 46.892  36.662  45.524  1.00 34.60  ? 165  PRO A C   1 
ATOM   827   O  O   . PRO A  1  137 ? 46.123  36.710  44.561  1.00 35.07  ? 165  PRO A O   1 
ATOM   828   C  CB  . PRO A  1  137 ? 49.061  37.826  44.958  1.00 34.52  ? 165  PRO A CB  1 
ATOM   829   C  CG  . PRO A  1  137 ? 50.117  37.482  43.974  1.00 34.51  ? 165  PRO A CG  1 
ATOM   830   C  CD  . PRO A  1  137 ? 49.535  36.344  43.179  1.00 35.05  ? 165  PRO A CD  1 
ATOM   831   N  N   . TYR A  1  138 ? 46.489  36.752  46.783  1.00 34.05  ? 166  TYR A N   1 
ATOM   832   C  CA  . TYR A  1  138 ? 45.085  36.767  47.155  1.00 33.58  ? 166  TYR A CA  1 
ATOM   833   C  C   . TYR A  1  138 ? 44.257  37.971  46.637  1.00 33.83  ? 166  TYR A C   1 
ATOM   834   O  O   . TYR A  1  138 ? 43.042  37.845  46.406  1.00 33.79  ? 166  TYR A O   1 
ATOM   835   C  CB  . TYR A  1  138 ? 44.978  36.644  48.681  1.00 32.83  ? 166  TYR A CB  1 
ATOM   836   C  CG  . TYR A  1  138 ? 43.724  35.961  49.135  1.00 31.64  ? 166  TYR A CG  1 
ATOM   837   C  CD1 . TYR A  1  138 ? 43.435  34.654  48.739  1.00 29.67  ? 166  TYR A CD1 1 
ATOM   838   C  CD2 . TYR A  1  138 ? 42.821  36.620  49.966  1.00 31.75  ? 166  TYR A CD2 1 
ATOM   839   C  CE1 . TYR A  1  138 ? 42.281  34.023  49.154  1.00 29.57  ? 166  TYR A CE1 1 
ATOM   840   C  CE2 . TYR A  1  138 ? 41.668  36.000  50.390  1.00 30.90  ? 166  TYR A CE2 1 
ATOM   841   C  CZ  . TYR A  1  138 ? 41.398  34.703  49.978  1.00 31.07  ? 166  TYR A CZ  1 
ATOM   842   O  OH  . TYR A  1  138 ? 40.235  34.105  50.398  1.00 31.11  ? 166  TYR A OH  1 
ATOM   843   N  N   . HIS A  1  139 ? 44.902  39.125  46.457  1.00 33.54  ? 167  HIS A N   1 
ATOM   844   C  CA  . HIS A  1  139 ? 44.201  40.332  46.017  1.00 33.88  ? 167  HIS A CA  1 
ATOM   845   C  C   . HIS A  1  139 ? 43.770  40.213  44.547  1.00 33.83  ? 167  HIS A C   1 
ATOM   846   O  O   . HIS A  1  139 ? 43.115  41.102  44.003  1.00 33.51  ? 167  HIS A O   1 
ATOM   847   C  CB  . HIS A  1  139 ? 45.095  41.548  46.192  1.00 34.02  ? 167  HIS A CB  1 
ATOM   848   C  CG  . HIS A  1  139 ? 46.326  41.488  45.354  1.00 35.28  ? 167  HIS A CG  1 
ATOM   849   N  ND1 . HIS A  1  139 ? 47.499  40.916  45.799  1.00 36.82  ? 167  HIS A ND1 1 
ATOM   850   C  CD2 . HIS A  1  139 ? 46.557  41.880  44.080  1.00 36.10  ? 167  HIS A CD2 1 
ATOM   851   C  CE1 . HIS A  1  139 ? 48.410  40.985  44.844  1.00 36.46  ? 167  HIS A CE1 1 
ATOM   852   N  NE2 . HIS A  1  139 ? 47.860  41.557  43.787  1.00 37.10  ? 167  HIS A NE2 1 
ATOM   853   N  N   . ARG A  1  140 ? 44.160  39.115  43.908  1.00 33.53  ? 168  ARG A N   1 
ATOM   854   C  CA  . ARG A  1  140 ? 43.747  38.869  42.549  1.00 33.52  ? 168  ARG A CA  1 
ATOM   855   C  C   . ARG A  1  140 ? 42.387  38.206  42.491  1.00 33.44  ? 168  ARG A C   1 
ATOM   856   O  O   . ARG A  1  140 ? 41.708  38.299  41.465  1.00 33.53  ? 168  ARG A O   1 
ATOM   857   C  CB  . ARG A  1  140 ? 44.790  38.049  41.791  1.00 33.50  ? 168  ARG A CB  1 
ATOM   858   C  CG  . ARG A  1  140 ? 46.032  38.866  41.473  1.00 34.11  ? 168  ARG A CG  1 
ATOM   859   C  CD  . ARG A  1  140 ? 46.940  38.193  40.489  1.00 34.36  ? 168  ARG A CD  1 
ATOM   860   N  NE  . ARG A  1  140 ? 48.295  38.732  40.576  1.00 34.48  ? 168  ARG A NE  1 
ATOM   861   C  CZ  . ARG A  1  140 ? 49.348  38.221  39.943  1.00 34.00  ? 168  ARG A CZ  1 
ATOM   862   N  NH1 . ARG A  1  140 ? 49.220  37.147  39.174  1.00 33.08  ? 168  ARG A NH1 1 
ATOM   863   N  NH2 . ARG A  1  140 ? 50.535  38.781  40.091  1.00 34.66  ? 168  ARG A NH2 1 
ATOM   864   N  N   . ARG A  1  141 ? 41.976  37.537  43.568  1.00 32.85  ? 169  ARG A N   1 
ATOM   865   C  CA  . ARG A  1  141 ? 40.697  36.842  43.511  1.00 32.57  ? 169  ARG A CA  1 
ATOM   866   C  C   . ARG A  1  141 ? 39.555  37.814  43.183  1.00 32.44  ? 169  ARG A C   1 
ATOM   867   O  O   . ARG A  1  141 ? 39.501  38.904  43.752  1.00 32.73  ? 169  ARG A O   1 
ATOM   868   C  CB  . ARG A  1  141 ? 40.413  35.951  44.743  1.00 32.32  ? 169  ARG A CB  1 
ATOM   869   C  CG  . ARG A  1  141 ? 40.556  36.521  46.159  1.00 32.55  ? 169  ARG A CG  1 
ATOM   870   C  CD  . ARG A  1  141 ? 39.319  37.254  46.547  1.00 32.58  ? 169  ARG A CD  1 
ATOM   871   N  NE  . ARG A  1  141 ? 39.028  37.384  47.980  1.00 29.91  ? 169  ARG A NE  1 
ATOM   872   C  CZ  . ARG A  1  141 ? 39.590  38.259  48.808  1.00 30.71  ? 169  ARG A CZ  1 
ATOM   873   N  NH1 . ARG A  1  141 ? 40.591  39.046  48.421  1.00 31.37  ? 169  ARG A NH1 1 
ATOM   874   N  NH2 . ARG A  1  141 ? 39.169  38.321  50.059  1.00 32.08  ? 169  ARG A NH2 1 
ATOM   875   N  N   . PRO A  1  142 ? 38.683  37.445  42.218  1.00 31.91  ? 170  PRO A N   1 
ATOM   876   C  CA  . PRO A  1  142 ? 37.464  38.197  41.931  1.00 31.87  ? 170  PRO A CA  1 
ATOM   877   C  C   . PRO A  1  142 ? 36.641  38.446  43.192  1.00 31.86  ? 170  PRO A C   1 
ATOM   878   O  O   . PRO A  1  142 ? 36.680  37.623  44.119  1.00 32.28  ? 170  PRO A O   1 
ATOM   879   C  CB  . PRO A  1  142 ? 36.710  37.269  40.976  1.00 31.53  ? 170  PRO A CB  1 
ATOM   880   C  CG  . PRO A  1  142 ? 37.748  36.558  40.284  1.00 31.47  ? 170  PRO A CG  1 
ATOM   881   C  CD  . PRO A  1  142 ? 38.818  36.295  41.311  1.00 31.71  ? 170  PRO A CD  1 
ATOM   882   N  N   . VAL A  1  143 ? 35.932  39.578  43.235  1.00 31.52  ? 171  VAL A N   1 
ATOM   883   C  CA  . VAL A  1  143 ? 35.088  39.941  44.385  1.00 31.28  ? 171  VAL A CA  1 
ATOM   884   C  C   . VAL A  1  143 ? 33.904  38.989  44.465  1.00 31.45  ? 171  VAL A C   1 
ATOM   885   O  O   . VAL A  1  143 ? 33.187  38.818  43.473  1.00 31.71  ? 171  VAL A O   1 
ATOM   886   C  CB  . VAL A  1  143 ? 34.577  41.420  44.301  1.00 31.37  ? 171  VAL A CB  1 
ATOM   887   C  CG1 . VAL A  1  143 ? 33.671  41.762  45.468  1.00 30.09  ? 171  VAL A CG1 1 
ATOM   888   C  CG2 . VAL A  1  143 ? 35.743  42.386  44.293  1.00 30.85  ? 171  VAL A CG2 1 
ATOM   889   N  N   . LEU A  1  144 ? 33.715  38.360  45.628  1.00 31.44  ? 172  LEU A N   1 
ATOM   890   C  CA  . LEU A  1  144 ? 32.601  37.425  45.835  1.00 31.82  ? 172  LEU A CA  1 
ATOM   891   C  C   . LEU A  1  144 ? 31.261  38.155  45.976  1.00 32.57  ? 172  LEU A C   1 
ATOM   892   O  O   . LEU A  1  144 ? 31.230  39.343  46.340  1.00 32.43  ? 172  LEU A O   1 
ATOM   893   C  CB  . LEU A  1  144 ? 32.826  36.562  47.081  1.00 31.43  ? 172  LEU A CB  1 
ATOM   894   C  CG  . LEU A  1  144 ? 33.965  35.538  47.134  1.00 30.97  ? 172  LEU A CG  1 
ATOM   895   C  CD1 . LEU A  1  144 ? 34.013  34.872  48.524  1.00 28.46  ? 172  LEU A CD1 1 
ATOM   896   C  CD2 . LEU A  1  144 ? 33.863  34.497  46.021  1.00 28.76  ? 172  LEU A CD2 1 
ATOM   897   N  N   . PHE A  1  145 ? 30.159  37.447  45.700  1.00 32.97  ? 173  PHE A N   1 
ATOM   898   C  CA  . PHE A  1  145 ? 28.835  38.008  45.933  1.00 33.86  ? 173  PHE A CA  1 
ATOM   899   C  C   . PHE A  1  145 ? 28.736  38.430  47.391  1.00 33.54  ? 173  PHE A C   1 
ATOM   900   O  O   . PHE A  1  145 ? 28.266  39.535  47.685  1.00 33.17  ? 173  PHE A O   1 
ATOM   901   C  CB  . PHE A  1  145 ? 27.712  37.026  45.574  1.00 34.74  ? 173  PHE A CB  1 
ATOM   902   C  CG  . PHE A  1  145 ? 27.518  36.825  44.077  1.00 37.96  ? 173  PHE A CG  1 
ATOM   903   C  CD1 . PHE A  1  145 ? 27.584  35.532  43.512  1.00 40.65  ? 173  PHE A CD1 1 
ATOM   904   C  CD2 . PHE A  1  145 ? 27.272  37.915  43.225  1.00 40.17  ? 173  PHE A CD2 1 
ATOM   905   C  CE1 . PHE A  1  145 ? 27.395  35.326  42.132  1.00 40.66  ? 173  PHE A CE1 1 
ATOM   906   C  CE2 . PHE A  1  145 ? 27.081  37.724  41.833  1.00 41.02  ? 173  PHE A CE2 1 
ATOM   907   C  CZ  . PHE A  1  145 ? 27.141  36.432  41.288  1.00 39.90  ? 173  PHE A CZ  1 
ATOM   908   N  N   . GLN A  1  146 ? 29.216  37.564  48.288  1.00 33.27  ? 174  GLN A N   1 
ATOM   909   C  CA  . GLN A  1  146 ? 29.241  37.853  49.725  1.00 33.39  ? 174  GLN A CA  1 
ATOM   910   C  C   . GLN A  1  146 ? 30.069  39.099  50.046  1.00 33.55  ? 174  GLN A C   1 
ATOM   911   O  O   . GLN A  1  146 ? 29.676  39.909  50.885  1.00 33.95  ? 174  GLN A O   1 
ATOM   912   C  CB  . GLN A  1  146 ? 29.760  36.655  50.524  1.00 33.19  ? 174  GLN A CB  1 
ATOM   913   C  CG  . GLN A  1  146 ? 29.727  36.841  52.042  1.00 33.54  ? 174  GLN A CG  1 
ATOM   914   C  CD  . GLN A  1  146 ? 28.326  37.105  52.586  1.00 34.13  ? 174  GLN A CD  1 
ATOM   915   O  OE1 . GLN A  1  146 ? 27.388  36.351  52.314  1.00 33.76  ? 174  GLN A OE1 1 
ATOM   916   N  NE2 . GLN A  1  146 ? 28.185  38.179  53.366  1.00 33.11  ? 174  GLN A NE2 1 
ATOM   917   N  N   . GLU A  1  147 ? 31.204  39.256  49.369  1.00 33.34  ? 175  GLU A N   1 
ATOM   918   C  CA  . GLU A  1  147 ? 32.018  40.447  49.520  1.00 33.38  ? 175  GLU A CA  1 
ATOM   919   C  C   . GLU A  1  147 ? 31.252  41.707  49.100  1.00 33.08  ? 175  GLU A C   1 
ATOM   920   O  O   . GLU A  1  147 ? 31.352  42.717  49.790  1.00 33.50  ? 175  GLU A O   1 
ATOM   921   C  CB  . GLU A  1  147 ? 33.342  40.311  48.764  1.00 33.09  ? 175  GLU A CB  1 
ATOM   922   C  CG  . GLU A  1  147 ? 34.428  41.273  49.213  1.00 33.31  ? 175  GLU A CG  1 
ATOM   923   C  CD  . GLU A  1  147 ? 35.681  41.160  48.364  1.00 35.02  ? 175  GLU A CD  1 
ATOM   924   O  OE1 . GLU A  1  147 ? 35.804  40.151  47.635  1.00 40.54  ? 175  GLU A OE1 1 
ATOM   925   O  OE2 . GLU A  1  147 ? 36.551  42.061  48.412  1.00 35.43  ? 175  GLU A OE2 1 
ATOM   926   N  N   . TYR A  1  148 ? 30.484  41.636  48.005  1.00 32.50  ? 176  TYR A N   1 
ATOM   927   C  CA  . TYR A  1  148 ? 29.597  42.733  47.582  1.00 32.17  ? 176  TYR A CA  1 
ATOM   928   C  C   . TYR A  1  148 ? 28.498  43.020  48.605  1.00 32.34  ? 176  TYR A C   1 
ATOM   929   O  O   . TYR A  1  148 ? 28.099  44.182  48.778  1.00 32.20  ? 176  TYR A O   1 
ATOM   930   C  CB  . TYR A  1  148 ? 28.944  42.477  46.202  1.00 32.13  ? 176  TYR A CB  1 
ATOM   931   C  CG  . TYR A  1  148 ? 29.867  42.555  44.992  1.00 31.74  ? 176  TYR A CG  1 
ATOM   932   C  CD1 . TYR A  1  148 ? 30.073  41.443  44.173  1.00 32.09  ? 176  TYR A CD1 1 
ATOM   933   C  CD2 . TYR A  1  148 ? 30.538  43.738  44.662  1.00 31.85  ? 176  TYR A CD2 1 
ATOM   934   C  CE1 . TYR A  1  148 ? 30.924  41.508  43.047  1.00 30.85  ? 176  TYR A CE1 1 
ATOM   935   C  CE2 . TYR A  1  148 ? 31.394  43.806  43.550  1.00 30.96  ? 176  TYR A CE2 1 
ATOM   936   C  CZ  . TYR A  1  148 ? 31.571  42.691  42.753  1.00 31.39  ? 176  TYR A CZ  1 
ATOM   937   O  OH  . TYR A  1  148 ? 32.408  42.758  41.666  1.00 32.47  ? 176  TYR A OH  1 
ATOM   938   N  N   . LEU A  1  149 ? 28.003  41.970  49.268  1.00 32.46  ? 177  LEU A N   1 
ATOM   939   C  CA  . LEU A  1  149 ? 26.972  42.119  50.311  1.00 32.61  ? 177  LEU A CA  1 
ATOM   940   C  C   . LEU A  1  149 ? 27.501  42.875  51.511  1.00 32.09  ? 177  LEU A C   1 
ATOM   941   O  O   . LEU A  1  149 ? 26.829  43.775  52.018  1.00 32.14  ? 177  LEU A O   1 
ATOM   942   C  CB  . LEU A  1  149 ? 26.437  40.765  50.796  1.00 33.11  ? 177  LEU A CB  1 
ATOM   943   C  CG  . LEU A  1  149 ? 25.250  40.080  50.108  1.00 35.62  ? 177  LEU A CG  1 
ATOM   944   C  CD1 . LEU A  1  149 ? 24.570  39.108  51.098  1.00 35.94  ? 177  LEU A CD1 1 
ATOM   945   C  CD2 . LEU A  1  149 ? 24.229  41.096  49.519  1.00 36.35  ? 177  LEU A CD2 1 
ATOM   946   N  N   . ASP A  1  150 ? 28.689  42.481  51.971  1.00 31.53  ? 178  ASP A N   1 
ATOM   947   C  CA  . ASP A  1  150 ? 29.373  43.140  53.082  1.00 31.29  ? 178  ASP A CA  1 
ATOM   948   C  C   . ASP A  1  150 ? 29.684  44.592  52.747  1.00 30.81  ? 178  ASP A C   1 
ATOM   949   O  O   . ASP A  1  150 ? 29.545  45.454  53.604  1.00 30.75  ? 178  ASP A O   1 
ATOM   950   C  CB  . ASP A  1  150 ? 30.665  42.389  53.467  1.00 31.58  ? 178  ASP A CB  1 
ATOM   951   C  CG  . ASP A  1  150 ? 30.400  40.966  53.984  1.00 33.20  ? 178  ASP A CG  1 
ATOM   952   O  OD1 . ASP A  1  150 ? 29.344  40.728  54.601  1.00 36.55  ? 178  ASP A OD1 1 
ATOM   953   O  OD2 . ASP A  1  150 ? 31.250  40.075  53.782  1.00 35.20  ? 178  ASP A OD2 1 
ATOM   954   N  N   . ILE A  1  151 ? 30.088  44.868  51.504  1.00 30.66  ? 179  ILE A N   1 
ATOM   955   C  CA  . ILE A  1  151 ? 30.347  46.249  51.087  1.00 30.61  ? 179  ILE A CA  1 
ATOM   956   C  C   . ILE A  1  151 ? 29.070  47.088  51.199  1.00 30.80  ? 179  ILE A C   1 
ATOM   957   O  O   . ILE A  1  151 ? 29.097  48.204  51.695  1.00 31.05  ? 179  ILE A O   1 
ATOM   958   C  CB  . ILE A  1  151 ? 30.956  46.373  49.658  1.00 30.96  ? 179  ILE A CB  1 
ATOM   959   C  CG1 . ILE A  1  151 ? 32.345  45.720  49.588  1.00 30.55  ? 179  ILE A CG1 1 
ATOM   960   C  CG2 . ILE A  1  151 ? 31.076  47.865  49.274  1.00 30.79  ? 179  ILE A CG2 1 
ATOM   961   C  CD1 . ILE A  1  151 ? 32.874  45.477  48.192  1.00 29.29  ? 179  ILE A CD1 1 
ATOM   962   N  N   . ASP A  1  152 ? 27.949  46.535  50.760  1.00 30.76  ? 180  ASP A N   1 
ATOM   963   C  CA  . ASP A  1  152 ? 26.679  47.220  50.887  1.00 30.90  ? 180  ASP A CA  1 
ATOM   964   C  C   . ASP A  1  152 ? 26.248  47.413  52.340  1.00 31.19  ? 180  ASP A C   1 
ATOM   965   O  O   . ASP A  1  152 ? 25.703  48.459  52.698  1.00 30.36  ? 180  ASP A O   1 
ATOM   966   C  CB  . ASP A  1  152 ? 25.612  46.489  50.098  1.00 30.64  ? 180  ASP A CB  1 
ATOM   967   C  CG  . ASP A  1  152 ? 25.661  46.822  48.625  1.00 31.74  ? 180  ASP A CG  1 
ATOM   968   O  OD1 . ASP A  1  152 ? 26.581  47.561  48.199  1.00 32.01  ? 180  ASP A OD1 1 
ATOM   969   O  OD2 . ASP A  1  152 ? 24.769  46.351  47.889  1.00 33.76  ? 180  ASP A OD2 1 
ATOM   970   N  N   . GLN A  1  153 ? 26.488  46.399  53.164  1.00 31.49  ? 181  GLN A N   1 
ATOM   971   C  CA  . GLN A  1  153 ? 26.190  46.497  54.576  1.00 32.36  ? 181  GLN A CA  1 
ATOM   972   C  C   . GLN A  1  153 ? 26.951  47.656  55.184  1.00 32.24  ? 181  GLN A C   1 
ATOM   973   O  O   . GLN A  1  153 ? 26.379  48.450  55.928  1.00 32.04  ? 181  GLN A O   1 
ATOM   974   C  CB  . GLN A  1  153 ? 26.583  45.227  55.297  1.00 32.58  ? 181  GLN A CB  1 
ATOM   975   C  CG  . GLN A  1  153 ? 25.450  44.293  55.554  1.00 35.90  ? 181  GLN A CG  1 
ATOM   976   C  CD  . GLN A  1  153 ? 25.912  43.096  56.352  1.00 40.69  ? 181  GLN A CD  1 
ATOM   977   O  OE1 . GLN A  1  153 ? 26.507  43.236  57.436  1.00 41.82  ? 181  GLN A OE1 1 
ATOM   978   N  NE2 . GLN A  1  153 ? 25.653  41.900  55.819  1.00 42.38  ? 181  GLN A NE2 1 
ATOM   979   N  N   . MET A  1  154 ? 28.240  47.739  54.862  1.00 32.15  ? 182  MET A N   1 
ATOM   980   C  CA  . MET A  1  154 ? 29.079  48.828  55.338  1.00 32.33  ? 182  MET A CA  1 
ATOM   981   C  C   . MET A  1  154 ? 28.517  50.156  54.859  1.00 31.77  ? 182  MET A C   1 
ATOM   982   O  O   . MET A  1  154 ? 28.326  51.063  55.664  1.00 32.07  ? 182  MET A O   1 
ATOM   983   C  CB  . MET A  1  154 ? 30.534  48.653  54.890  1.00 31.94  ? 182  MET A CB  1 
ATOM   984   C  CG  . MET A  1  154 ? 31.440  49.792  55.312  1.00 32.13  ? 182  MET A CG  1 
ATOM   985   S  SD  . MET A  1  154 ? 32.924  49.916  54.295  1.00 34.26  ? 182  MET A SD  1 
ATOM   986   C  CE  . MET A  1  154 ? 33.753  51.292  55.067  1.00 32.78  ? 182  MET A CE  1 
ATOM   987   N  N   . ILE A  1  155 ? 28.219  50.248  53.565  1.00 31.32  ? 183  ILE A N   1 
ATOM   988   C  CA  . ILE A  1  155 ? 27.755  51.490  52.974  1.00 31.27  ? 183  ILE A CA  1 
ATOM   989   C  C   . ILE A  1  155 ? 26.444  51.958  53.573  1.00 31.58  ? 183  ILE A C   1 
ATOM   990   O  O   . ILE A  1  155 ? 26.348  53.087  54.069  1.00 32.29  ? 183  ILE A O   1 
ATOM   991   C  CB  . ILE A  1  155 ? 27.631  51.401  51.434  1.00 31.24  ? 183  ILE A CB  1 
ATOM   992   C  CG1 . ILE A  1  155 ? 29.024  51.405  50.798  1.00 30.58  ? 183  ILE A CG1 1 
ATOM   993   C  CG2 . ILE A  1  155 ? 26.796  52.569  50.893  1.00 30.87  ? 183  ILE A CG2 1 
ATOM   994   C  CD1 . ILE A  1  155 ? 29.045  51.149  49.317  1.00 30.70  ? 183  ILE A CD1 1 
ATOM   995   N  N   . PHE A  1  156 ? 25.440  51.097  53.530  1.00 31.53  ? 184  PHE A N   1 
ATOM   996   C  CA  . PHE A  1  156 ? 24.097  51.472  53.945  1.00 31.77  ? 184  PHE A CA  1 
ATOM   997   C  C   . PHE A  1  156 ? 23.899  51.506  55.455  1.00 32.33  ? 184  PHE A C   1 
ATOM   998   O  O   . PHE A  1  156 ? 23.085  52.287  55.941  1.00 32.33  ? 184  PHE A O   1 
ATOM   999   C  CB  . PHE A  1  156 ? 23.065  50.568  53.276  1.00 31.52  ? 184  PHE A CB  1 
ATOM   1000  C  CG  . PHE A  1  156 ? 23.017  50.727  51.784  1.00 31.71  ? 184  PHE A CG  1 
ATOM   1001  C  CD1 . PHE A  1  156 ? 23.751  49.880  50.955  1.00 31.78  ? 184  PHE A CD1 1 
ATOM   1002  C  CD2 . PHE A  1  156 ? 22.259  51.739  51.208  1.00 31.64  ? 184  PHE A CD2 1 
ATOM   1003  C  CE1 . PHE A  1  156 ? 23.722  50.026  49.588  1.00 32.61  ? 184  PHE A CE1 1 
ATOM   1004  C  CE2 . PHE A  1  156 ? 22.211  51.892  49.832  1.00 31.81  ? 184  PHE A CE2 1 
ATOM   1005  C  CZ  . PHE A  1  156 ? 22.955  51.041  49.016  1.00 32.65  ? 184  PHE A CZ  1 
ATOM   1006  N  N   . ASN A  1  157 ? 24.646  50.685  56.193  1.00 32.93  ? 185  ASN A N   1 
ATOM   1007  C  CA  . ASN A  1  157 ? 24.492  50.627  57.644  1.00 33.97  ? 185  ASN A CA  1 
ATOM   1008  C  C   . ASN A  1  157 ? 25.440  51.508  58.419  1.00 34.44  ? 185  ASN A C   1 
ATOM   1009  O  O   . ASN A  1  157 ? 25.020  52.137  59.375  1.00 34.69  ? 185  ASN A O   1 
ATOM   1010  C  CB  . ASN A  1  157 ? 24.597  49.194  58.176  1.00 34.00  ? 185  ASN A CB  1 
ATOM   1011  C  CG  . ASN A  1  157 ? 23.438  48.316  57.729  1.00 34.92  ? 185  ASN A CG  1 
ATOM   1012  O  OD1 . ASN A  1  157 ? 23.501  47.082  57.845  1.00 36.79  ? 185  ASN A OD1 1 
ATOM   1013  N  ND2 . ASN A  1  157 ? 22.378  48.939  57.207  1.00 32.31  ? 185  ASN A ND2 1 
ATOM   1014  N  N   . ARG A  1  158 ? 26.715  51.537  58.031  1.00 34.90  ? 186  ARG A N   1 
ATOM   1015  C  CA  . ARG A  1  158 ? 27.723  52.286  58.785  1.00 35.33  ? 186  ARG A CA  1 
ATOM   1016  C  C   . ARG A  1  158 ? 28.073  53.611  58.118  1.00 34.91  ? 186  ARG A C   1 
ATOM   1017  O  O   . ARG A  1  158 ? 28.506  54.534  58.789  1.00 35.15  ? 186  ARG A O   1 
ATOM   1018  C  CB  . ARG A  1  158 ? 29.009  51.460  58.991  1.00 35.41  ? 186  ARG A CB  1 
ATOM   1019  C  CG  . ARG A  1  158 ? 28.831  50.098  59.689  1.00 36.72  ? 186  ARG A CG  1 
ATOM   1020  C  CD  . ARG A  1  158 ? 30.154  49.550  60.289  1.00 36.91  ? 186  ARG A CD  1 
ATOM   1021  N  NE  . ARG A  1  158 ? 31.109  48.996  59.313  1.00 39.25  ? 186  ARG A NE  1 
ATOM   1022  C  CZ  . ARG A  1  158 ? 32.278  49.559  58.985  1.00 42.31  ? 186  ARG A CZ  1 
ATOM   1023  N  NH1 . ARG A  1  158 ? 32.647  50.715  59.535  1.00 43.55  ? 186  ARG A NH1 1 
ATOM   1024  N  NH2 . ARG A  1  158 ? 33.092  48.973  58.105  1.00 41.95  ? 186  ARG A NH2 1 
ATOM   1025  N  N   . GLU A  1  159 ? 27.908  53.707  56.799  1.00 34.33  ? 187  GLU A N   1 
ATOM   1026  C  CA  . GLU A  1  159 ? 28.417  54.869  56.075  1.00 33.61  ? 187  GLU A CA  1 
ATOM   1027  C  C   . GLU A  1  159 ? 27.369  55.929  55.714  1.00 33.45  ? 187  GLU A C   1 
ATOM   1028  O  O   . GLU A  1  159 ? 27.416  57.040  56.247  1.00 33.40  ? 187  GLU A O   1 
ATOM   1029  C  CB  . GLU A  1  159 ? 29.267  54.446  54.872  1.00 33.44  ? 187  GLU A CB  1 
ATOM   1030  C  CG  . GLU A  1  159 ? 30.517  53.629  55.253  1.00 33.87  ? 187  GLU A CG  1 
ATOM   1031  C  CD  . GLU A  1  159 ? 31.500  54.407  56.118  1.00 35.46  ? 187  GLU A CD  1 
ATOM   1032  O  OE1 . GLU A  1  159 ? 31.354  55.643  56.218  1.00 36.98  ? 187  GLU A OE1 1 
ATOM   1033  O  OE2 . GLU A  1  159 ? 32.428  53.799  56.694  1.00 35.78  ? 187  GLU A OE2 1 
ATOM   1034  N  N   . LEU A  1  160 ? 26.412  55.591  54.851  1.00 33.14  ? 188  LEU A N   1 
ATOM   1035  C  CA  . LEU A  1  160 ? 25.419  56.578  54.405  1.00 32.94  ? 188  LEU A CA  1 
ATOM   1036  C  C   . LEU A  1  160 ? 24.616  57.281  55.508  1.00 33.13  ? 188  LEU A C   1 
ATOM   1037  O  O   . LEU A  1  160 ? 24.309  58.463  55.361  1.00 33.28  ? 188  LEU A O   1 
ATOM   1038  C  CB  . LEU A  1  160 ? 24.474  56.001  53.356  1.00 32.68  ? 188  LEU A CB  1 
ATOM   1039  C  CG  . LEU A  1  160 ? 25.089  55.703  51.991  1.00 32.61  ? 188  LEU A CG  1 
ATOM   1040  C  CD1 . LEU A  1  160 ? 24.000  55.289  51.005  1.00 31.87  ? 188  LEU A CD1 1 
ATOM   1041  C  CD2 . LEU A  1  160 ? 25.874  56.890  51.474  1.00 30.48  ? 188  LEU A CD2 1 
ATOM   1042  N  N   . PRO A  1  161 ? 24.278  56.578  56.614  1.00 33.09  ? 189  PRO A N   1 
ATOM   1043  C  CA  . PRO A  1  161 ? 23.502  57.284  57.649  1.00 33.33  ? 189  PRO A CA  1 
ATOM   1044  C  C   . PRO A  1  161 ? 24.188  58.536  58.210  1.00 33.30  ? 189  PRO A C   1 
ATOM   1045  O  O   . PRO A  1  161 ? 23.510  59.408  58.759  1.00 33.52  ? 189  PRO A O   1 
ATOM   1046  C  CB  . PRO A  1  161 ? 23.312  56.229  58.744  1.00 33.10  ? 189  PRO A CB  1 
ATOM   1047  C  CG  . PRO A  1  161 ? 24.291  55.163  58.438  1.00 33.45  ? 189  PRO A CG  1 
ATOM   1048  C  CD  . PRO A  1  161 ? 24.530  55.175  56.985  1.00 32.99  ? 189  PRO A CD  1 
ATOM   1049  N  N   . GLN A  1  162 ? 25.510  58.622  58.053  1.00 33.37  ? 190  GLN A N   1 
ATOM   1050  C  CA  . GLN A  1  162 ? 26.292  59.792  58.475  1.00 33.17  ? 190  GLN A CA  1 
ATOM   1051  C  C   . GLN A  1  162 ? 26.011  61.042  57.643  1.00 33.09  ? 190  GLN A C   1 
ATOM   1052  O  O   . GLN A  1  162 ? 26.336  62.148  58.058  1.00 33.53  ? 190  GLN A O   1 
ATOM   1053  C  CB  . GLN A  1  162 ? 27.774  59.482  58.409  1.00 32.96  ? 190  GLN A CB  1 
ATOM   1054  C  CG  . GLN A  1  162 ? 28.234  58.434  59.386  1.00 33.92  ? 190  GLN A CG  1 
ATOM   1055  C  CD  . GLN A  1  162 ? 29.740  58.335  59.407  1.00 35.49  ? 190  GLN A CD  1 
ATOM   1056  O  OE1 . GLN A  1  162 ? 30.435  59.334  59.617  1.00 36.61  ? 190  GLN A OE1 1 
ATOM   1057  N  NE2 . GLN A  1  162 ? 30.261  57.140  59.155  1.00 35.19  ? 190  GLN A NE2 1 
ATOM   1058  N  N   . ALA A  1  163 ? 25.416  60.862  56.470  1.00 32.79  ? 191  ALA A N   1 
ATOM   1059  C  CA  . ALA A  1  163 ? 25.033  61.979  55.616  1.00 32.54  ? 191  ALA A CA  1 
ATOM   1060  C  C   . ALA A  1  163 ? 23.519  61.993  55.442  1.00 32.25  ? 191  ALA A C   1 
ATOM   1061  O  O   . ALA A  1  163 ? 22.981  62.492  54.444  1.00 32.15  ? 191  ALA A O   1 
ATOM   1062  C  CB  . ALA A  1  163 ? 25.751  61.906  54.262  1.00 32.36  ? 191  ALA A CB  1 
ATOM   1063  N  N   . SER A  1  164 ? 22.843  61.450  56.445  1.00 32.20  ? 192  SER A N   1 
ATOM   1064  C  CA  . SER A  1  164 ? 21.389  61.327  56.452  1.00 32.32  ? 192  SER A CA  1 
ATOM   1065  C  C   . SER A  1  164 ? 20.625  62.593  56.063  1.00 31.91  ? 192  SER A C   1 
ATOM   1066  O  O   . SER A  1  164 ? 19.662  62.517  55.307  1.00 32.10  ? 192  SER A O   1 
ATOM   1067  C  CB  . SER A  1  164 ? 20.921  60.871  57.823  1.00 32.36  ? 192  SER A CB  1 
ATOM   1068  O  OG  . SER A  1  164 ? 19.629  60.332  57.706  1.00 34.10  ? 192  SER A OG  1 
ATOM   1069  N  N   . GLY A  1  165 ? 21.044  63.743  56.587  1.00 31.25  ? 193  GLY A N   1 
ATOM   1070  C  CA  . GLY A  1  165 ? 20.383  65.003  56.292  1.00 30.94  ? 193  GLY A CA  1 
ATOM   1071  C  C   . GLY A  1  165 ? 20.419  65.337  54.812  1.00 31.14  ? 193  GLY A C   1 
ATOM   1072  O  O   . GLY A  1  165 ? 19.397  65.688  54.221  1.00 31.17  ? 193  GLY A O   1 
ATOM   1073  N  N   . LEU A  1  166 ? 21.601  65.216  54.214  1.00 30.94  ? 194  LEU A N   1 
ATOM   1074  C  CA  . LEU A  1  166 ? 21.784  65.480  52.798  1.00 30.96  ? 194  LEU A CA  1 
ATOM   1075  C  C   . LEU A  1  166 ? 20.959  64.519  51.948  1.00 31.42  ? 194  LEU A C   1 
ATOM   1076  O  O   . LEU A  1  166 ? 20.226  64.934  51.042  1.00 31.55  ? 194  LEU A O   1 
ATOM   1077  C  CB  . LEU A  1  166 ? 23.257  65.349  52.417  1.00 30.72  ? 194  LEU A CB  1 
ATOM   1078  C  CG  . LEU A  1  166 ? 23.517  65.329  50.912  1.00 29.97  ? 194  LEU A CG  1 
ATOM   1079  C  CD1 . LEU A  1  166 ? 23.204  66.672  50.301  1.00 28.56  ? 194  LEU A CD1 1 
ATOM   1080  C  CD2 . LEU A  1  166 ? 24.940  64.892  50.617  1.00 29.02  ? 194  LEU A CD2 1 
ATOM   1081  N  N   . LEU A  1  167 ? 21.092  63.234  52.240  1.00 31.29  ? 195  LEU A N   1 
ATOM   1082  C  CA  . LEU A  1  167 ? 20.380  62.236  51.483  1.00 31.57  ? 195  LEU A CA  1 
ATOM   1083  C  C   . LEU A  1  167 ? 18.856  62.414  51.586  1.00 32.11  ? 195  LEU A C   1 
ATOM   1084  O  O   . LEU A  1  167 ? 18.140  62.253  50.588  1.00 32.06  ? 195  LEU A O   1 
ATOM   1085  C  CB  . LEU A  1  167 ? 20.843  60.837  51.881  1.00 31.27  ? 195  LEU A CB  1 
ATOM   1086  C  CG  . LEU A  1  167 ? 22.340  60.561  51.692  1.00 29.93  ? 195  LEU A CG  1 
ATOM   1087  C  CD1 . LEU A  1  167 ? 22.675  59.156  52.176  1.00 30.30  ? 195  LEU A CD1 1 
ATOM   1088  C  CD2 . LEU A  1  167 ? 22.766  60.753  50.261  1.00 28.07  ? 195  LEU A CD2 1 
ATOM   1089  N  N   . HIS A  1  168 ? 18.364  62.772  52.770  1.00 32.53  ? 196  HIS A N   1 
ATOM   1090  C  CA  . HIS A  1  168 ? 16.954  63.121  52.919  1.00 33.45  ? 196  HIS A CA  1 
ATOM   1091  C  C   . HIS A  1  168 ? 16.589  64.238  51.963  1.00 33.30  ? 196  HIS A C   1 
ATOM   1092  O  O   . HIS A  1  168 ? 15.568  64.181  51.309  1.00 33.19  ? 196  HIS A O   1 
ATOM   1093  C  CB  . HIS A  1  168 ? 16.625  63.546  54.350  1.00 33.80  ? 196  HIS A CB  1 
ATOM   1094  C  CG  . HIS A  1  168 ? 16.262  62.405  55.250  1.00 37.20  ? 196  HIS A CG  1 
ATOM   1095  N  ND1 . HIS A  1  168 ? 17.086  61.960  56.267  1.00 39.66  ? 196  HIS A ND1 1 
ATOM   1096  C  CD2 . HIS A  1  168 ? 15.161  61.613  55.288  1.00 39.28  ? 196  HIS A CD2 1 
ATOM   1097  C  CE1 . HIS A  1  168 ? 16.506  60.949  56.893  1.00 40.19  ? 196  HIS A CE1 1 
ATOM   1098  N  NE2 . HIS A  1  168 ? 15.340  60.715  56.315  1.00 40.46  ? 196  HIS A NE2 1 
ATOM   1099  N  N   . HIS A  1  169 ? 17.449  65.248  51.875  1.00 33.82  ? 197  HIS A N   1 
ATOM   1100  C  CA  . HIS A  1  169 ? 17.181  66.412  51.051  1.00 33.72  ? 197  HIS A CA  1 
ATOM   1101  C  C   . HIS A  1  169 ? 17.300  66.147  49.547  1.00 33.97  ? 197  HIS A C   1 
ATOM   1102  O  O   . HIS A  1  169 ? 16.495  66.657  48.787  1.00 34.37  ? 197  HIS A O   1 
ATOM   1103  C  CB  . HIS A  1  169 ? 18.073  67.581  51.469  1.00 33.63  ? 197  HIS A CB  1 
ATOM   1104  C  CG  . HIS A  1  169 ? 17.875  68.813  50.638  1.00 33.57  ? 197  HIS A CG  1 
ATOM   1105  N  ND1 . HIS A  1  169 ? 16.864  69.718  50.878  1.00 33.35  ? 197  HIS A ND1 1 
ATOM   1106  C  CD2 . HIS A  1  169 ? 18.545  69.276  49.556  1.00 32.79  ? 197  HIS A CD2 1 
ATOM   1107  C  CE1 . HIS A  1  169 ? 16.925  70.691  49.986  1.00 33.13  ? 197  HIS A CE1 1 
ATOM   1108  N  NE2 . HIS A  1  169 ? 17.934  70.444  49.171  1.00 33.75  ? 197  HIS A NE2 1 
ATOM   1109  N  N   . CYS A  1  170 ? 18.285  65.361  49.119  1.00 34.26  ? 198  CYS A N   1 
ATOM   1110  C  CA  . CYS A  1  170 ? 18.554  65.180  47.681  1.00 34.96  ? 198  CYS A CA  1 
ATOM   1111  C  C   . CYS A  1  170 ? 17.919  63.965  47.071  1.00 35.19  ? 198  CYS A C   1 
ATOM   1112  O  O   . CYS A  1  170 ? 17.674  63.930  45.880  1.00 35.13  ? 198  CYS A O   1 
ATOM   1113  C  CB  . CYS A  1  170 ? 20.056  65.032  47.402  1.00 34.85  ? 198  CYS A CB  1 
ATOM   1114  S  SG  . CYS A  1  170 ? 20.824  63.500  48.059  1.00 35.94  ? 198  CYS A SG  1 
ATOM   1115  N  N   . CYS A  1  171 ? 17.711  62.940  47.882  1.00 36.04  ? 199  CYS A N   1 
ATOM   1116  C  CA  . CYS A  1  171 ? 17.662  61.599  47.340  1.00 36.95  ? 199  CYS A CA  1 
ATOM   1117  C  C   . CYS A  1  171 ? 16.555  60.721  47.900  1.00 37.45  ? 199  CYS A C   1 
ATOM   1118  O  O   . CYS A  1  171 ? 16.640  59.501  47.784  1.00 37.62  ? 199  CYS A O   1 
ATOM   1119  C  CB  . CYS A  1  171 ? 19.046  60.958  47.523  1.00 36.71  ? 199  CYS A CB  1 
ATOM   1120  S  SG  . CYS A  1  171 ? 20.371  61.965  46.761  1.00 37.64  ? 199  CYS A SG  1 
ATOM   1121  N  N   . PHE A  1  172 ? 15.521  61.336  48.482  1.00 38.48  ? 200  PHE A N   1 
ATOM   1122  C  CA  . PHE A  1  172 ? 14.342  60.621  49.024  1.00 39.92  ? 200  PHE A CA  1 
ATOM   1123  C  C   . PHE A  1  172 ? 14.736  59.470  49.946  1.00 41.39  ? 200  PHE A C   1 
ATOM   1124  O  O   . PHE A  1  172 ? 14.076  58.437  49.988  1.00 41.29  ? 200  PHE A O   1 
ATOM   1125  C  CB  . PHE A  1  172 ? 13.421  60.119  47.896  1.00 39.27  ? 200  PHE A CB  1 
ATOM   1126  C  CG  . PHE A  1  172 ? 13.111  61.161  46.871  1.00 38.39  ? 200  PHE A CG  1 
ATOM   1127  C  CD1 . PHE A  1  172 ? 13.940  61.337  45.766  1.00 37.52  ? 200  PHE A CD1 1 
ATOM   1128  C  CD2 . PHE A  1  172 ? 12.011  61.993  47.022  1.00 36.95  ? 200  PHE A CD2 1 
ATOM   1129  C  CE1 . PHE A  1  172 ? 13.671  62.331  44.833  1.00 37.34  ? 200  PHE A CE1 1 
ATOM   1130  C  CE2 . PHE A  1  172 ? 11.729  62.985  46.082  1.00 36.16  ? 200  PHE A CE2 1 
ATOM   1131  C  CZ  . PHE A  1  172 ? 12.561  63.158  44.993  1.00 36.68  ? 200  PHE A CZ  1 
ATOM   1132  N  N   . TYR A  1  173 ? 15.836  59.672  50.665  1.00 43.61  ? 201  TYR A N   1 
ATOM   1133  C  CA  . TYR A  1  173 ? 16.393  58.703  51.587  1.00 46.02  ? 201  TYR A CA  1 
ATOM   1134  C  C   . TYR A  1  173 ? 15.503  58.610  52.803  1.00 48.50  ? 201  TYR A C   1 
ATOM   1135  O  O   . TYR A  1  173 ? 14.985  59.619  53.287  1.00 48.83  ? 201  TYR A O   1 
ATOM   1136  C  CB  . TYR A  1  173 ? 17.780  59.180  51.996  1.00 45.45  ? 201  TYR A CB  1 
ATOM   1137  C  CG  . TYR A  1  173 ? 18.560  58.324  52.967  1.00 44.77  ? 201  TYR A CG  1 
ATOM   1138  C  CD1 . TYR A  1  173 ? 19.272  57.202  52.527  1.00 44.97  ? 201  TYR A CD1 1 
ATOM   1139  C  CD2 . TYR A  1  173 ? 18.642  58.669  54.312  1.00 43.23  ? 201  TYR A CD2 1 
ATOM   1140  C  CE1 . TYR A  1  173 ? 20.014  56.423  53.417  1.00 44.26  ? 201  TYR A CE1 1 
ATOM   1141  C  CE2 . TYR A  1  173 ? 19.379  57.897  55.212  1.00 43.32  ? 201  TYR A CE2 1 
ATOM   1142  C  CZ  . TYR A  1  173 ? 20.061  56.778  54.759  1.00 44.33  ? 201  TYR A CZ  1 
ATOM   1143  O  OH  . TYR A  1  173 ? 20.799  56.016  55.642  1.00 44.80  ? 201  TYR A OH  1 
ATOM   1144  N  N   . LYS A  1  174 ? 15.304  57.395  53.284  1.00 51.59  ? 202  LYS A N   1 
ATOM   1145  C  CA  . LYS A  1  174 ? 14.652  57.200  54.570  1.00 54.91  ? 202  LYS A CA  1 
ATOM   1146  C  C   . LYS A  1  174 ? 15.517  56.316  55.462  1.00 56.73  ? 202  LYS A C   1 
ATOM   1147  O  O   . LYS A  1  174 ? 16.177  55.393  54.977  1.00 57.04  ? 202  LYS A O   1 
ATOM   1148  C  CB  . LYS A  1  174 ? 13.233  56.637  54.403  1.00 55.03  ? 202  LYS A CB  1 
ATOM   1149  C  CG  . LYS A  1  174 ? 12.100  57.695  54.491  1.00 56.80  ? 202  LYS A CG  1 
ATOM   1150  C  CD  . LYS A  1  174 ? 11.546  58.109  53.111  1.00 58.08  ? 202  LYS A CD  1 
ATOM   1151  C  CE  . LYS A  1  174 ? 11.800  59.592  52.788  1.00 58.56  ? 202  LYS A CE  1 
ATOM   1152  N  NZ  . LYS A  1  174 ? 11.502  59.939  51.349  1.00 57.83  ? 202  LYS A NZ  1 
ATOM   1153  N  N   . HIS A  1  175 ? 15.534  56.632  56.758  1.00 59.35  ? 203  HIS A N   1 
ATOM   1154  C  CA  . HIS A  1  175 ? 16.289  55.864  57.770  1.00 61.74  ? 203  HIS A CA  1 
ATOM   1155  C  C   . HIS A  1  175 ? 16.053  54.352  57.615  1.00 62.53  ? 203  HIS A C   1 
ATOM   1156  O  O   . HIS A  1  175 ? 14.896  53.912  57.453  1.00 62.94  ? 203  HIS A O   1 
ATOM   1157  C  CB  . HIS A  1  175 ? 15.931  56.343  59.192  1.00 62.19  ? 203  HIS A CB  1 
ATOM   1158  C  CG  . HIS A  1  175 ? 14.498  56.099  59.585  1.00 64.84  ? 203  HIS A CG  1 
ATOM   1159  N  ND1 . HIS A  1  175 ? 13.427  56.459  58.788  1.00 66.69  ? 203  HIS A ND1 1 
ATOM   1160  C  CD2 . HIS A  1  175 ? 13.963  55.547  60.704  1.00 67.03  ? 203  HIS A CD2 1 
ATOM   1161  C  CE1 . HIS A  1  175 ? 12.297  56.130  59.393  1.00 67.60  ? 203  HIS A CE1 1 
ATOM   1162  N  NE2 . HIS A  1  175 ? 12.593  55.576  60.558  1.00 67.75  ? 203  HIS A NE2 1 
ATOM   1163  N  N   . ARG A  1  176 ? 17.144  53.573  57.639  1.00 63.23  ? 204  ARG A N   1 
ATOM   1164  C  CA  . ARG A  1  176 ? 17.108  52.116  57.327  1.00 63.76  ? 204  ARG A CA  1 
ATOM   1165  C  C   . ARG A  1  176 ? 16.219  51.808  56.103  1.00 62.88  ? 204  ARG A C   1 
ATOM   1166  O  O   . ARG A  1  176 ? 15.348  50.925  56.134  1.00 63.18  ? 204  ARG A O   1 
ATOM   1167  C  CB  . ARG A  1  176 ? 16.676  51.260  58.544  1.00 64.38  ? 204  ARG A CB  1 
ATOM   1168  C  CG  . ARG A  1  176 ? 17.481  51.481  59.825  1.00 66.98  ? 204  ARG A CG  1 
ATOM   1169  C  CD  . ARG A  1  176 ? 18.649  50.496  59.988  1.00 71.06  ? 204  ARG A CD  1 
ATOM   1170  N  NE  . ARG A  1  176 ? 19.476  50.901  61.131  1.00 74.02  ? 204  ARG A NE  1 
ATOM   1171  C  CZ  . ARG A  1  176 ? 20.126  50.077  61.955  1.00 74.83  ? 204  ARG A CZ  1 
ATOM   1172  N  NH1 . ARG A  1  176 ? 20.071  48.756  61.788  1.00 75.21  ? 204  ARG A NH1 1 
ATOM   1173  N  NH2 . ARG A  1  176 ? 20.836  50.586  62.959  1.00 74.62  ? 204  ARG A NH2 1 
ATOM   1174  N  N   . GLY A  1  177 ? 16.430  52.570  55.038  1.00 61.75  ? 205  GLY A N   1 
ATOM   1175  C  CA  . GLY A  1  177 ? 15.748  52.324  53.778  1.00 59.92  ? 205  GLY A CA  1 
ATOM   1176  C  C   . GLY A  1  177 ? 16.819  52.090  52.741  1.00 58.52  ? 205  GLY A C   1 
ATOM   1177  O  O   . GLY A  1  177 ? 17.931  52.652  52.835  1.00 58.70  ? 205  GLY A O   1 
ATOM   1178  N  N   . ARG A  1  178 ? 16.500  51.250  51.761  1.00 56.48  ? 206  ARG A N   1 
ATOM   1179  C  CA  . ARG A  1  178 ? 17.395  51.064  50.631  1.00 54.26  ? 206  ARG A CA  1 
ATOM   1180  C  C   . ARG A  1  178 ? 16.692  51.358  49.307  1.00 52.39  ? 206  ARG A C   1 
ATOM   1181  O  O   . ARG A  1  178 ? 16.454  50.456  48.494  1.00 52.85  ? 206  ARG A O   1 
ATOM   1182  C  CB  . ARG A  1  178 ? 18.013  49.668  50.644  1.00 54.75  ? 206  ARG A CB  1 
ATOM   1183  C  CG  . ARG A  1  178 ? 19.163  49.486  51.624  1.00 54.39  ? 206  ARG A CG  1 
ATOM   1184  C  CD  . ARG A  1  178 ? 20.142  48.530  51.002  1.00 54.64  ? 206  ARG A CD  1 
ATOM   1185  N  NE  . ARG A  1  178 ? 20.921  47.791  51.985  1.00 55.55  ? 206  ARG A NE  1 
ATOM   1186  C  CZ  . ARG A  1  178 ? 21.730  46.778  51.676  1.00 55.65  ? 206  ARG A CZ  1 
ATOM   1187  N  NH1 . ARG A  1  178 ? 21.855  46.386  50.414  1.00 55.67  ? 206  ARG A NH1 1 
ATOM   1188  N  NH2 . ARG A  1  178 ? 22.412  46.152  52.626  1.00 55.71  ? 206  ARG A NH2 1 
ATOM   1189  N  N   . ASN A  1  179 ? 16.349  52.627  49.112  1.00 49.38  ? 207  ASN A N   1 
ATOM   1190  C  CA  . ASN A  1  179 ? 15.873  53.133  47.822  1.00 46.39  ? 207  ASN A CA  1 
ATOM   1191  C  C   . ASN A  1  179 ? 17.036  53.376  46.841  1.00 43.91  ? 207  ASN A C   1 
ATOM   1192  O  O   . ASN A  1  179 ? 16.798  53.643  45.667  1.00 43.24  ? 207  ASN A O   1 
ATOM   1193  C  CB  . ASN A  1  179 ? 15.121  54.449  48.031  1.00 46.51  ? 207  ASN A CB  1 
ATOM   1194  C  CG  . ASN A  1  179 ? 16.009  55.518  48.654  1.00 46.98  ? 207  ASN A CG  1 
ATOM   1195  O  OD1 . ASN A  1  179 ? 16.516  55.353  49.779  1.00 47.13  ? 207  ASN A OD1 1 
ATOM   1196  N  ND2 . ASN A  1  179 ? 16.239  56.599  47.913  1.00 46.30  ? 207  ASN A ND2 1 
ATOM   1197  N  N   . LEU A  1  180 ? 18.278  53.307  47.337  1.00 41.02  ? 208  LEU A N   1 
ATOM   1198  C  CA  . LEU A  1  180 ? 19.473  53.419  46.499  1.00 38.58  ? 208  LEU A CA  1 
ATOM   1199  C  C   . LEU A  1  180 ? 20.153  52.065  46.321  1.00 37.39  ? 208  LEU A C   1 
ATOM   1200  O  O   . LEU A  1  180 ? 20.014  51.189  47.170  1.00 37.49  ? 208  LEU A O   1 
ATOM   1201  C  CB  . LEU A  1  180 ? 20.467  54.423  47.084  1.00 38.37  ? 208  LEU A CB  1 
ATOM   1202  C  CG  . LEU A  1  180 ? 19.992  55.827  47.495  1.00 37.86  ? 208  LEU A CG  1 
ATOM   1203  C  CD1 . LEU A  1  180 ? 21.090  56.581  48.204  1.00 37.42  ? 208  LEU A CD1 1 
ATOM   1204  C  CD2 . LEU A  1  180 ? 19.519  56.632  46.326  1.00 37.24  ? 208  LEU A CD2 1 
ATOM   1205  N  N   . VAL A  1  181 ? 20.866  51.890  45.207  1.00 35.87  ? 209  VAL A N   1 
ATOM   1206  C  CA  . VAL A  1  181 ? 21.715  50.708  44.970  1.00 34.30  ? 209  VAL A CA  1 
ATOM   1207  C  C   . VAL A  1  181 ? 23.105  51.124  44.524  1.00 33.77  ? 209  VAL A C   1 
ATOM   1208  O  O   . VAL A  1  181 ? 23.306  52.255  44.091  1.00 33.61  ? 209  VAL A O   1 
ATOM   1209  C  CB  . VAL A  1  181 ? 21.143  49.762  43.897  1.00 34.34  ? 209  VAL A CB  1 
ATOM   1210  C  CG1 . VAL A  1  181 ? 20.029  48.876  44.477  1.00 34.03  ? 209  VAL A CG1 1 
ATOM   1211  C  CG2 . VAL A  1  181 ? 20.675  50.541  42.673  1.00 33.43  ? 209  VAL A CG2 1 
ATOM   1212  N  N   . THR A  1  182 ? 24.061  50.211  44.637  1.00 33.00  ? 210  THR A N   1 
ATOM   1213  C  CA  . THR A  1  182 ? 25.433  50.509  44.285  1.00 33.16  ? 210  THR A CA  1 
ATOM   1214  C  C   . THR A  1  182 ? 25.819  49.798  42.997  1.00 33.74  ? 210  THR A C   1 
ATOM   1215  O  O   . THR A  1  182 ? 25.207  48.804  42.623  1.00 33.76  ? 210  THR A O   1 
ATOM   1216  C  CB  . THR A  1  182 ? 26.435  50.083  45.385  1.00 32.93  ? 210  THR A CB  1 
ATOM   1217  O  OG1 . THR A  1  182 ? 26.420  48.658  45.521  1.00 32.19  ? 210  THR A OG1 1 
ATOM   1218  C  CG2 . THR A  1  182 ? 26.102  50.731  46.723  1.00 33.03  ? 210  THR A CG2 1 
ATOM   1219  N  N   . MET A  1  183 ? 26.841  50.302  42.323  1.00 33.94  ? 211  MET A N   1 
ATOM   1220  C  CA  . MET A  1  183 ? 27.387  49.579  41.201  1.00 35.33  ? 211  MET A CA  1 
ATOM   1221  C  C   . MET A  1  183 ? 28.917  49.638  41.207  1.00 34.62  ? 211  MET A C   1 
ATOM   1222  O  O   . MET A  1  183 ? 29.510  50.724  41.224  1.00 34.67  ? 211  MET A O   1 
ATOM   1223  C  CB  . MET A  1  183 ? 26.809  50.066  39.863  1.00 34.76  ? 211  MET A CB  1 
ATOM   1224  C  CG  . MET A  1  183 ? 27.305  49.218  38.709  1.00 36.52  ? 211  MET A CG  1 
ATOM   1225  S  SD  . MET A  1  183 ? 26.625  49.555  37.073  1.00 39.07  ? 211  MET A SD  1 
ATOM   1226  C  CE  . MET A  1  183 ? 27.392  51.136  36.673  1.00 37.23  ? 211  MET A CE  1 
ATOM   1227  N  N   . THR A  1  184 ? 29.538  48.459  41.180  1.00 33.85  ? 212  THR A N   1 
ATOM   1228  C  CA  . THR A  1  184 ? 30.987  48.346  41.207  1.00 32.90  ? 212  THR A CA  1 
ATOM   1229  C  C   . THR A  1  184 ? 31.649  48.891  39.938  1.00 32.71  ? 212  THR A C   1 
ATOM   1230  O  O   . THR A  1  184 ? 31.055  48.892  38.867  1.00 32.94  ? 212  THR A O   1 
ATOM   1231  C  CB  . THR A  1  184 ? 31.420  46.870  41.471  1.00 32.77  ? 212  THR A CB  1 
ATOM   1232  O  OG1 . THR A  1  184 ? 32.848  46.783  41.560  1.00 31.33  ? 212  THR A OG1 1 
ATOM   1233  C  CG2 . THR A  1  184 ? 30.927  45.945  40.372  1.00 32.75  ? 212  THR A CG2 1 
ATOM   1234  N  N   . THR A  1  185 ? 32.877  49.373  40.073  1.00 32.26  ? 213  THR A N   1 
ATOM   1235  C  CA  . THR A  1  185 ? 33.741  49.567  38.919  1.00 31.89  ? 213  THR A CA  1 
ATOM   1236  C  C   . THR A  1  185 ? 34.971  48.651  39.045  1.00 31.60  ? 213  THR A C   1 
ATOM   1237  O  O   . THR A  1  185 ? 35.050  47.835  39.975  1.00 31.78  ? 213  THR A O   1 
ATOM   1238  C  CB  . THR A  1  185 ? 34.155  51.039  38.752  1.00 31.83  ? 213  THR A CB  1 
ATOM   1239  O  OG1 . THR A  1  185 ? 34.826  51.483  39.926  1.00 33.01  ? 213  THR A OG1 1 
ATOM   1240  C  CG2 . THR A  1  185 ? 32.939  51.916  38.515  1.00 32.01  ? 213  THR A CG2 1 
ATOM   1241  N  N   . ALA A  1  186 ? 35.913  48.779  38.111  1.00 30.92  ? 214  ALA A N   1 
ATOM   1242  C  CA  . ALA A  1  186 ? 37.130  47.962  38.073  1.00 30.51  ? 214  ALA A CA  1 
ATOM   1243  C  C   . ALA A  1  186 ? 38.112  48.626  37.109  1.00 30.64  ? 214  ALA A C   1 
ATOM   1244  O  O   . ALA A  1  186 ? 37.668  49.307  36.180  1.00 31.61  ? 214  ALA A O   1 
ATOM   1245  C  CB  . ALA A  1  186 ? 36.809  46.564  37.626  1.00 30.12  ? 214  ALA A CB  1 
ATOM   1246  N  N   . PRO A  1  187 ? 39.441  48.471  37.318  1.00 30.45  ? 215  PRO A N   1 
ATOM   1247  C  CA  . PRO A  1  187 ? 40.139  47.773  38.386  1.00 30.52  ? 215  PRO A CA  1 
ATOM   1248  C  C   . PRO A  1  187 ? 39.941  48.497  39.706  1.00 30.67  ? 215  PRO A C   1 
ATOM   1249  O  O   . PRO A  1  187 ? 39.294  49.537  39.758  1.00 30.73  ? 215  PRO A O   1 
ATOM   1250  C  CB  . PRO A  1  187 ? 41.607  47.852  37.949  1.00 30.37  ? 215  PRO A CB  1 
ATOM   1251  C  CG  . PRO A  1  187 ? 41.682  49.067  37.129  1.00 29.80  ? 215  PRO A CG  1 
ATOM   1252  C  CD  . PRO A  1  187 ? 40.405  49.046  36.359  1.00 30.39  ? 215  PRO A CD  1 
ATOM   1253  N  N   . ARG A  1  188 ? 40.501  47.955  40.767  1.00 30.64  ? 216  ARG A N   1 
ATOM   1254  C  CA  . ARG A  1  188 ? 40.184  48.460  42.062  1.00 31.12  ? 216  ARG A CA  1 
ATOM   1255  C  C   . ARG A  1  188 ? 41.442  49.017  42.719  1.00 31.51  ? 216  ARG A C   1 
ATOM   1256  O  O   . ARG A  1  188 ? 42.027  48.392  43.612  1.00 32.06  ? 216  ARG A O   1 
ATOM   1257  C  CB  . ARG A  1  188 ? 39.549  47.337  42.876  1.00 31.09  ? 216  ARG A CB  1 
ATOM   1258  C  CG  . ARG A  1  188 ? 38.511  46.569  42.099  1.00 30.19  ? 216  ARG A CG  1 
ATOM   1259  C  CD  . ARG A  1  188 ? 38.119  45.265  42.795  1.00 29.11  ? 216  ARG A CD  1 
ATOM   1260  N  NE  . ARG A  1  188 ? 37.171  44.531  41.965  1.00 28.62  ? 216  ARG A NE  1 
ATOM   1261  C  CZ  . ARG A  1  188 ? 35.861  44.766  41.949  1.00 27.61  ? 216  ARG A CZ  1 
ATOM   1262  N  NH1 . ARG A  1  188 ? 35.351  45.691  42.752  1.00 24.62  ? 216  ARG A NH1 1 
ATOM   1263  N  NH2 . ARG A  1  188 ? 35.063  44.060  41.146  1.00 26.98  ? 216  ARG A NH2 1 
ATOM   1264  N  N   . GLY A  1  189 ? 41.859  50.194  42.270  1.00 31.66  ? 217  GLY A N   1 
ATOM   1265  C  CA  . GLY A  1  189 ? 43.076  50.811  42.782  1.00 32.40  ? 217  GLY A CA  1 
ATOM   1266  C  C   . GLY A  1  189 ? 43.978  51.377  41.707  1.00 33.24  ? 217  GLY A C   1 
ATOM   1267  O  O   . GLY A  1  189 ? 43.567  51.532  40.555  1.00 33.49  ? 217  GLY A O   1 
ATOM   1268  N  N   . LEU A  1  190 ? 45.218  51.677  42.081  1.00 33.93  ? 218  LEU A N   1 
ATOM   1269  C  CA  . LEU A  1  190 ? 46.167  52.327  41.174  1.00 34.38  ? 218  LEU A CA  1 
ATOM   1270  C  C   . LEU A  1  190 ? 47.478  51.555  41.019  1.00 34.86  ? 218  LEU A C   1 
ATOM   1271  O  O   . LEU A  1  190 ? 48.352  51.955  40.232  1.00 35.08  ? 218  LEU A O   1 
ATOM   1272  C  CB  . LEU A  1  190 ? 46.475  53.733  41.678  1.00 34.41  ? 218  LEU A CB  1 
ATOM   1273  C  CG  . LEU A  1  190 ? 45.254  54.543  42.099  1.00 34.23  ? 218  LEU A CG  1 
ATOM   1274  C  CD1 . LEU A  1  190 ? 45.572  55.405  43.331  1.00 34.57  ? 218  LEU A CD1 1 
ATOM   1275  C  CD2 . LEU A  1  190 ? 44.742  55.362  40.924  1.00 33.36  ? 218  LEU A CD2 1 
ATOM   1276  N  N   . GLN A  1  191 ? 47.621  50.463  41.771  1.00 34.98  ? 219  GLN A N   1 
ATOM   1277  C  CA  . GLN A  1  191 ? 48.832  49.640  41.712  1.00 35.63  ? 219  GLN A CA  1 
ATOM   1278  C  C   . GLN A  1  191 ? 48.610  48.200  42.199  1.00 35.62  ? 219  GLN A C   1 
ATOM   1279  O  O   . GLN A  1  191 ? 47.589  47.882  42.822  1.00 36.40  ? 219  GLN A O   1 
ATOM   1280  C  CB  . GLN A  1  191 ? 49.971  50.304  42.493  1.00 35.39  ? 219  GLN A CB  1 
ATOM   1281  C  CG  . GLN A  1  191 ? 49.759  50.355  44.001  1.00 36.02  ? 219  GLN A CG  1 
ATOM   1282  C  CD  . GLN A  1  191 ? 50.953  50.958  44.726  1.00 36.64  ? 219  GLN A CD  1 
ATOM   1283  O  OE1 . GLN A  1  191 ? 51.531  51.952  44.286  1.00 38.53  ? 219  GLN A OE1 1 
ATOM   1284  N  NE2 . GLN A  1  191 ? 51.327  50.357  45.844  1.00 38.42  ? 219  GLN A NE2 1 
ATOM   1285  N  N   . SER A  1  192 ? 49.571  47.329  41.914  1.00 35.33  ? 220  SER A N   1 
ATOM   1286  C  CA  . SER A  1  192 ? 49.447  45.926  42.275  1.00 35.14  ? 220  SER A CA  1 
ATOM   1287  C  C   . SER A  1  192 ? 49.261  45.770  43.790  1.00 35.01  ? 220  SER A C   1 
ATOM   1288  O  O   . SER A  1  192 ? 50.015  46.338  44.576  1.00 34.83  ? 220  SER A O   1 
ATOM   1289  C  CB  . SER A  1  192 ? 50.664  45.139  41.788  1.00 34.98  ? 220  SER A CB  1 
ATOM   1290  O  OG  . SER A  1  192 ? 50.369  43.755  41.727  1.00 35.07  ? 220  SER A OG  1 
ATOM   1291  N  N   . GLY A  1  193 ? 48.234  45.020  44.181  1.00 34.82  ? 221  GLY A N   1 
ATOM   1292  C  CA  . GLY A  1  193 ? 47.972  44.752  45.582  1.00 34.33  ? 221  GLY A CA  1 
ATOM   1293  C  C   . GLY A  1  193 ? 46.771  45.493  46.126  1.00 34.36  ? 221  GLY A C   1 
ATOM   1294  O  O   . GLY A  1  193 ? 46.240  45.124  47.167  1.00 34.52  ? 221  GLY A O   1 
ATOM   1295  N  N   . ASP A  1  194 ? 46.337  46.545  45.436  1.00 34.12  ? 222  ASP A N   1 
ATOM   1296  C  CA  . ASP A  1  194 ? 45.178  47.318  45.891  1.00 33.97  ? 222  ASP A CA  1 
ATOM   1297  C  C   . ASP A  1  194 ? 43.852  46.568  45.756  1.00 33.43  ? 222  ASP A C   1 
ATOM   1298  O  O   . ASP A  1  194 ? 43.744  45.616  45.000  1.00 33.31  ? 222  ASP A O   1 
ATOM   1299  C  CB  . ASP A  1  194 ? 45.104  48.655  45.158  1.00 34.19  ? 222  ASP A CB  1 
ATOM   1300  C  CG  . ASP A  1  194 ? 46.258  49.577  45.505  1.00 36.08  ? 222  ASP A CG  1 
ATOM   1301  O  OD1 . ASP A  1  194 ? 46.946  49.321  46.522  1.00 37.39  ? 222  ASP A OD1 1 
ATOM   1302  O  OD2 . ASP A  1  194 ? 46.486  50.560  44.754  1.00 38.41  ? 222  ASP A OD2 1 
ATOM   1303  N  N   . ARG A  1  195 ? 42.855  46.992  46.527  1.00 33.37  ? 223  ARG A N   1 
ATOM   1304  C  CA  . ARG A  1  195 ? 41.488  46.469  46.426  1.00 32.90  ? 223  ARG A CA  1 
ATOM   1305  C  C   . ARG A  1  195 ? 40.564  47.558  46.957  1.00 33.01  ? 223  ARG A C   1 
ATOM   1306  O  O   . ARG A  1  195 ? 39.925  47.419  48.004  1.00 32.96  ? 223  ARG A O   1 
ATOM   1307  C  CB  . ARG A  1  195 ? 41.345  45.167  47.203  1.00 32.27  ? 223  ARG A CB  1 
ATOM   1308  C  CG  . ARG A  1  195 ? 40.163  44.320  46.833  1.00 31.71  ? 223  ARG A CG  1 
ATOM   1309  C  CD  . ARG A  1  195 ? 40.303  42.994  47.538  1.00 31.18  ? 223  ARG A CD  1 
ATOM   1310  N  NE  . ARG A  1  195 ? 39.194  42.082  47.322  1.00 30.98  ? 223  ARG A NE  1 
ATOM   1311  C  CZ  . ARG A  1  195 ? 39.129  41.202  46.332  1.00 31.26  ? 223  ARG A CZ  1 
ATOM   1312  N  NH1 . ARG A  1  195 ? 40.106  41.146  45.440  1.00 30.81  ? 223  ARG A NH1 1 
ATOM   1313  N  NH2 . ARG A  1  195 ? 38.073  40.392  46.222  1.00 30.87  ? 223  ARG A NH2 1 
ATOM   1314  N  N   . ALA A  1  196 ? 40.540  48.665  46.220  1.00 33.12  ? 224  ALA A N   1 
ATOM   1315  C  CA  . ALA A  1  196 ? 39.742  49.832  46.549  1.00 33.08  ? 224  ALA A CA  1 
ATOM   1316  C  C   . ALA A  1  196 ? 38.877  50.105  45.339  1.00 32.86  ? 224  ALA A C   1 
ATOM   1317  O  O   . ALA A  1  196 ? 39.392  50.241  44.229  1.00 33.29  ? 224  ALA A O   1 
ATOM   1318  C  CB  . ALA A  1  196 ? 40.660  51.029  46.846  1.00 33.37  ? 224  ALA A CB  1 
ATOM   1319  N  N   . THR A  1  197 ? 37.566  50.166  45.534  1.00 32.28  ? 225  THR A N   1 
ATOM   1320  C  CA  . THR A  1  197 ? 36.639  50.242  44.404  1.00 31.59  ? 225  THR A CA  1 
ATOM   1321  C  C   . THR A  1  197 ? 35.786  51.488  44.493  1.00 31.41  ? 225  THR A C   1 
ATOM   1322  O  O   . THR A  1  197 ? 35.284  51.822  45.573  1.00 31.67  ? 225  THR A O   1 
ATOM   1323  C  CB  . THR A  1  197 ? 35.710  49.012  44.377  1.00 31.46  ? 225  THR A CB  1 
ATOM   1324  O  OG1 . THR A  1  197 ? 36.498  47.823  44.331  1.00 32.08  ? 225  THR A OG1 1 
ATOM   1325  C  CG2 . THR A  1  197 ? 34.789  49.031  43.174  1.00 31.49  ? 225  THR A CG2 1 
ATOM   1326  N  N   . TRP A  1  198 ? 35.626  52.184  43.370  1.00 31.03  ? 226  TRP A N   1 
ATOM   1327  C  CA  . TRP A  1  198 ? 34.648  53.260  43.304  1.00 31.08  ? 226  TRP A CA  1 
ATOM   1328  C  C   . TRP A  1  198 ? 33.260  52.667  43.018  1.00 31.31  ? 226  TRP A C   1 
ATOM   1329  O  O   . TRP A  1  198 ? 33.048  51.975  42.013  1.00 31.18  ? 226  TRP A O   1 
ATOM   1330  C  CB  . TRP A  1  198 ? 35.005  54.265  42.210  1.00 31.12  ? 226  TRP A CB  1 
ATOM   1331  C  CG  . TRP A  1  198 ? 36.112  55.233  42.514  1.00 30.50  ? 226  TRP A CG  1 
ATOM   1332  C  CD1 . TRP A  1  198 ? 37.373  55.183  42.034  1.00 30.60  ? 226  TRP A CD1 1 
ATOM   1333  C  CD2 . TRP A  1  198 ? 36.036  56.421  43.326  1.00 30.53  ? 226  TRP A CD2 1 
ATOM   1334  N  NE1 . TRP A  1  198 ? 38.105  56.253  42.498  1.00 32.13  ? 226  TRP A NE1 1 
ATOM   1335  C  CE2 . TRP A  1  198 ? 37.306  57.030  43.291  1.00 30.95  ? 226  TRP A CE2 1 
ATOM   1336  C  CE3 . TRP A  1  198 ? 35.018  57.025  44.080  1.00 29.89  ? 226  TRP A CE3 1 
ATOM   1337  C  CZ2 . TRP A  1  198 ? 37.592  58.214  43.981  1.00 30.85  ? 226  TRP A CZ2 1 
ATOM   1338  C  CZ3 . TRP A  1  198 ? 35.295  58.201  44.763  1.00 29.73  ? 226  TRP A CZ3 1 
ATOM   1339  C  CH2 . TRP A  1  198 ? 36.573  58.781  44.712  1.00 31.11  ? 226  TRP A CH2 1 
ATOM   1340  N  N   . PHE A  1  199 ? 32.322  52.917  43.918  1.00 31.60  ? 227  PHE A N   1 
ATOM   1341  C  CA  . PHE A  1  199 ? 30.936  52.546  43.688  1.00 31.59  ? 227  PHE A CA  1 
ATOM   1342  C  C   . PHE A  1  199 ? 30.151  53.824  43.478  1.00 31.72  ? 227  PHE A C   1 
ATOM   1343  O  O   . PHE A  1  199 ? 30.257  54.743  44.272  1.00 32.25  ? 227  PHE A O   1 
ATOM   1344  C  CB  . PHE A  1  199 ? 30.360  51.799  44.897  1.00 31.45  ? 227  PHE A CB  1 
ATOM   1345  C  CG  . PHE A  1  199 ? 30.914  50.409  45.098  1.00 30.85  ? 227  PHE A CG  1 
ATOM   1346  C  CD1 . PHE A  1  199 ? 32.032  50.196  45.901  1.00 30.73  ? 227  PHE A CD1 1 
ATOM   1347  C  CD2 . PHE A  1  199 ? 30.287  49.306  44.525  1.00 30.60  ? 227  PHE A CD2 1 
ATOM   1348  C  CE1 . PHE A  1  199 ? 32.534  48.898  46.116  1.00 30.79  ? 227  PHE A CE1 1 
ATOM   1349  C  CE2 . PHE A  1  199 ? 30.783  48.004  44.729  1.00 30.99  ? 227  PHE A CE2 1 
ATOM   1350  C  CZ  . PHE A  1  199 ? 31.915  47.804  45.519  1.00 30.50  ? 227  PHE A CZ  1 
ATOM   1351  N  N   . GLY A  1  200 ? 29.388  53.896  42.396  1.00 32.08  ? 228  GLY A N   1 
ATOM   1352  C  CA  . GLY A  1  200 ? 28.381  54.940  42.237  1.00 31.79  ? 228  GLY A CA  1 
ATOM   1353  C  C   . GLY A  1  200 ? 27.090  54.515  42.928  1.00 32.05  ? 228  GLY A C   1 
ATOM   1354  O  O   . GLY A  1  200 ? 26.870  53.325  43.205  1.00 31.64  ? 228  GLY A O   1 
ATOM   1355  N  N   . LEU A  1  201 ? 26.241  55.500  43.206  1.00 31.98  ? 229  LEU A N   1 
ATOM   1356  C  CA  . LEU A  1  201 ? 24.964  55.285  43.867  1.00 31.85  ? 229  LEU A CA  1 
ATOM   1357  C  C   . LEU A  1  201 ? 23.816  55.728  42.961  1.00 32.01  ? 229  LEU A C   1 
ATOM   1358  O  O   . LEU A  1  201 ? 23.899  56.771  42.303  1.00 31.82  ? 229  LEU A O   1 
ATOM   1359  C  CB  . LEU A  1  201 ? 24.937  56.011  45.211  1.00 31.81  ? 229  LEU A CB  1 
ATOM   1360  C  CG  . LEU A  1  201 ? 25.432  55.041  46.284  1.00 32.71  ? 229  LEU A CG  1 
ATOM   1361  C  CD1 . LEU A  1  201 ? 26.504  55.620  47.165  1.00 33.14  ? 229  LEU A CD1 1 
ATOM   1362  C  CD2 . LEU A  1  201 ? 24.269  54.511  47.108  1.00 34.14  ? 229  LEU A CD2 1 
ATOM   1363  N  N   . TYR A  1  202 ? 22.754  54.920  42.932  1.00 31.83  ? 230  TYR A N   1 
ATOM   1364  C  CA  . TYR A  1  202 ? 21.680  55.054  41.944  1.00 31.67  ? 230  TYR A CA  1 
ATOM   1365  C  C   . TYR A  1  202 ? 20.328  54.795  42.578  1.00 31.87  ? 230  TYR A C   1 
ATOM   1366  O  O   . TYR A  1  202 ? 20.228  54.057  43.563  1.00 31.86  ? 230  TYR A O   1 
ATOM   1367  C  CB  . TYR A  1  202 ? 21.856  54.040  40.817  1.00 31.08  ? 230  TYR A CB  1 
ATOM   1368  C  CG  . TYR A  1  202 ? 23.182  54.085  40.101  1.00 31.19  ? 230  TYR A CG  1 
ATOM   1369  C  CD1 . TYR A  1  202 ? 24.300  53.404  40.604  1.00 31.48  ? 230  TYR A CD1 1 
ATOM   1370  C  CD2 . TYR A  1  202 ? 23.319  54.783  38.898  1.00 30.96  ? 230  TYR A CD2 1 
ATOM   1371  C  CE1 . TYR A  1  202 ? 25.533  53.453  39.936  1.00 30.75  ? 230  TYR A CE1 1 
ATOM   1372  C  CE2 . TYR A  1  202 ? 24.542  54.825  38.221  1.00 29.65  ? 230  TYR A CE2 1 
ATOM   1373  C  CZ  . TYR A  1  202 ? 25.638  54.159  38.742  1.00 30.12  ? 230  TYR A CZ  1 
ATOM   1374  O  OH  . TYR A  1  202 ? 26.839  54.202  38.064  1.00 30.31  ? 230  TYR A OH  1 
ATOM   1375  N  N   . TYR A  1  203 ? 19.288  55.391  42.006  1.00 31.86  ? 231  TYR A N   1 
ATOM   1376  C  CA  . TYR A  1  203 ? 17.928  55.062  42.404  1.00 32.36  ? 231  TYR A CA  1 
ATOM   1377  C  C   . TYR A  1  203 ? 17.607  53.613  42.020  1.00 33.27  ? 231  TYR A C   1 
ATOM   1378  O  O   . TYR A  1  203 ? 17.835  53.195  40.882  1.00 33.44  ? 231  TYR A O   1 
ATOM   1379  C  CB  . TYR A  1  203 ? 16.934  56.025  41.762  1.00 31.40  ? 231  TYR A CB  1 
ATOM   1380  C  CG  . TYR A  1  203 ? 16.979  57.415  42.348  1.00 31.25  ? 231  TYR A CG  1 
ATOM   1381  C  CD1 . TYR A  1  203 ? 16.790  57.618  43.719  1.00 29.26  ? 231  TYR A CD1 1 
ATOM   1382  C  CD2 . TYR A  1  203 ? 17.197  58.536  41.534  1.00 29.96  ? 231  TYR A CD2 1 
ATOM   1383  C  CE1 . TYR A  1  203 ? 16.832  58.885  44.260  1.00 29.61  ? 231  TYR A CE1 1 
ATOM   1384  C  CE2 . TYR A  1  203 ? 17.230  59.821  42.075  1.00 28.79  ? 231  TYR A CE2 1 
ATOM   1385  C  CZ  . TYR A  1  203 ? 17.047  59.983  43.433  1.00 30.08  ? 231  TYR A CZ  1 
ATOM   1386  O  OH  . TYR A  1  203 ? 17.078  61.238  43.986  1.00 30.09  ? 231  TYR A OH  1 
ATOM   1387  N  N   . ASN A  1  204 ? 17.106  52.838  42.975  1.00 34.46  ? 232  ASN A N   1 
ATOM   1388  C  CA  . ASN A  1  204 ? 16.637  51.491  42.682  1.00 35.98  ? 232  ASN A CA  1 
ATOM   1389  C  C   . ASN A  1  204 ? 15.343  51.606  41.895  1.00 35.64  ? 232  ASN A C   1 
ATOM   1390  O  O   . ASN A  1  204 ? 14.274  51.626  42.471  1.00 35.71  ? 232  ASN A O   1 
ATOM   1391  C  CB  . ASN A  1  204 ? 16.434  50.695  43.973  1.00 36.65  ? 232  ASN A CB  1 
ATOM   1392  C  CG  . ASN A  1  204 ? 16.084  49.237  43.719  1.00 41.36  ? 232  ASN A CG  1 
ATOM   1393  O  OD1 . ASN A  1  204 ? 16.367  48.688  42.647  1.00 41.71  ? 232  ASN A OD1 1 
ATOM   1394  N  ND2 . ASN A  1  204 ? 15.475  48.595  44.732  1.00 49.90  ? 232  ASN A ND2 1 
ATOM   1395  N  N   . ILE A  1  205 ? 15.468  51.737  40.577  1.00 35.92  ? 233  ILE A N   1 
ATOM   1396  C  CA  . ILE A  1  205 ? 14.330  51.892  39.669  1.00 35.93  ? 233  ILE A CA  1 
ATOM   1397  C  C   . ILE A  1  205 ? 13.664  50.540  39.492  1.00 35.95  ? 233  ILE A C   1 
ATOM   1398  O  O   . ILE A  1  205 ? 14.333  49.551  39.184  1.00 36.33  ? 233  ILE A O   1 
ATOM   1399  C  CB  . ILE A  1  205 ? 14.781  52.436  38.271  1.00 35.99  ? 233  ILE A CB  1 
ATOM   1400  C  CG1 . ILE A  1  205 ? 15.327  53.866  38.380  1.00 35.95  ? 233  ILE A CG1 1 
ATOM   1401  C  CG2 . ILE A  1  205 ? 13.655  52.351  37.234  1.00 35.74  ? 233  ILE A CG2 1 
ATOM   1402  C  CD1 . ILE A  1  205 ? 14.418  54.850  39.111  1.00 36.84  ? 233  ILE A CD1 1 
ATOM   1403  N  N   . SER A  1  206 ? 12.354  50.500  39.679  1.00 35.61  ? 234  SER A N   1 
ATOM   1404  C  CA  . SER A  1  206 ? 11.605  49.254  39.550  1.00 35.88  ? 234  SER A CA  1 
ATOM   1405  C  C   . SER A  1  206 ? 11.266  48.855  38.096  1.00 35.13  ? 234  SER A C   1 
ATOM   1406  O  O   . SER A  1  206 ? 10.558  49.573  37.394  1.00 35.22  ? 234  SER A O   1 
ATOM   1407  C  CB  . SER A  1  206 ? 10.330  49.333  40.390  1.00 35.97  ? 234  SER A CB  1 
ATOM   1408  O  OG  . SER A  1  206 ? 9.606   48.127  40.271  1.00 38.27  ? 234  SER A OG  1 
ATOM   1409  N  N   . GLY A  1  207 ? 11.772  47.709  37.654  1.00 34.58  ? 235  GLY A N   1 
ATOM   1410  C  CA  . GLY A  1  207 ? 11.416  47.171  36.339  1.00 34.10  ? 235  GLY A CA  1 
ATOM   1411  C  C   . GLY A  1  207 ? 12.100  47.801  35.131  1.00 34.02  ? 235  GLY A C   1 
ATOM   1412  O  O   . GLY A  1  207 ? 11.777  47.463  33.994  1.00 33.86  ? 235  GLY A O   1 
ATOM   1413  N  N   . ALA A  1  208 ? 13.041  48.720  35.375  1.00 33.92  ? 236  ALA A N   1 
ATOM   1414  C  CA  . ALA A  1  208 ? 13.840  49.346  34.318  1.00 33.32  ? 236  ALA A CA  1 
ATOM   1415  C  C   . ALA A  1  208 ? 15.277  49.563  34.787  1.00 33.29  ? 236  ALA A C   1 
ATOM   1416  O  O   . ALA A  1  208 ? 15.610  49.276  35.934  1.00 33.25  ? 236  ALA A O   1 
ATOM   1417  C  CB  . ALA A  1  208 ? 13.223  50.650  33.889  1.00 33.28  ? 236  ALA A CB  1 
ATOM   1418  N  N   . GLY A  1  209 ? 16.126  50.063  33.897  1.00 33.07  ? 237  GLY A N   1 
ATOM   1419  C  CA  . GLY A  1  209 ? 17.543  50.244  34.199  1.00 33.16  ? 237  GLY A CA  1 
ATOM   1420  C  C   . GLY A  1  209 ? 17.801  51.305  35.238  1.00 32.94  ? 237  GLY A C   1 
ATOM   1421  O  O   . GLY A  1  209 ? 17.375  52.449  35.082  1.00 33.23  ? 237  GLY A O   1 
ATOM   1422  N  N   . PHE A  1  210 ? 18.496  50.926  36.305  1.00 32.59  ? 238  PHE A N   1 
ATOM   1423  C  CA  . PHE A  1  210 ? 18.861  51.883  37.350  1.00 31.99  ? 238  PHE A CA  1 
ATOM   1424  C  C   . PHE A  1  210 ? 20.075  52.696  36.919  1.00 31.65  ? 238  PHE A C   1 
ATOM   1425  O  O   . PHE A  1  210 ? 20.391  53.714  37.530  1.00 32.20  ? 238  PHE A O   1 
ATOM   1426  C  CB  . PHE A  1  210 ? 19.132  51.173  38.689  1.00 31.74  ? 238  PHE A CB  1 
ATOM   1427  C  CG  . PHE A  1  210 ? 20.438  50.412  38.733  1.00 31.30  ? 238  PHE A CG  1 
ATOM   1428  C  CD1 . PHE A  1  210 ? 21.664  51.088  38.803  1.00 31.34  ? 238  PHE A CD1 1 
ATOM   1429  C  CD2 . PHE A  1  210 ? 20.446  49.020  38.718  1.00 30.36  ? 238  PHE A CD2 1 
ATOM   1430  C  CE1 . PHE A  1  210 ? 22.879  50.392  38.847  1.00 30.74  ? 238  PHE A CE1 1 
ATOM   1431  C  CE2 . PHE A  1  210 ? 21.658  48.309  38.764  1.00 30.72  ? 238  PHE A CE2 1 
ATOM   1432  C  CZ  . PHE A  1  210 ? 22.876  48.998  38.835  1.00 30.89  ? 238  PHE A CZ  1 
ATOM   1433  N  N   . PHE A  1  211 ? 20.748  52.242  35.862  1.00 31.23  ? 239  PHE A N   1 
ATOM   1434  C  CA  . PHE A  1  211 ? 22.023  52.836  35.403  1.00 30.72  ? 239  PHE A CA  1 
ATOM   1435  C  C   . PHE A  1  211 ? 21.903  54.272  34.899  1.00 30.42  ? 239  PHE A C   1 
ATOM   1436  O  O   . PHE A  1  211 ? 22.881  54.998  34.873  1.00 30.14  ? 239  PHE A O   1 
ATOM   1437  C  CB  . PHE A  1  211 ? 22.666  51.973  34.308  1.00 30.30  ? 239  PHE A CB  1 
ATOM   1438  C  CG  . PHE A  1  211 ? 22.467  50.495  34.498  1.00 29.72  ? 239  PHE A CG  1 
ATOM   1439  C  CD1 . PHE A  1  211 ? 21.422  49.830  33.853  1.00 29.40  ? 239  PHE A CD1 1 
ATOM   1440  C  CD2 . PHE A  1  211 ? 23.317  49.765  35.323  1.00 29.88  ? 239  PHE A CD2 1 
ATOM   1441  C  CE1 . PHE A  1  211 ? 21.231  48.454  34.019  1.00 29.28  ? 239  PHE A CE1 1 
ATOM   1442  C  CE2 . PHE A  1  211 ? 23.136  48.378  35.498  1.00 30.58  ? 239  PHE A CE2 1 
ATOM   1443  C  CZ  . PHE A  1  211 ? 22.090  47.725  34.851  1.00 29.46  ? 239  PHE A CZ  1 
ATOM   1444  N  N   . LEU A  1  212 ? 20.709  54.677  34.488  1.00 30.53  ? 240  LEU A N   1 
ATOM   1445  C  CA  . LEU A  1  212 ? 20.520  56.020  33.955  1.00 30.95  ? 240  LEU A CA  1 
ATOM   1446  C  C   . LEU A  1  212 ? 20.158  56.993  35.056  1.00 31.14  ? 240  LEU A C   1 
ATOM   1447  O  O   . LEU A  1  212 ? 19.772  58.116  34.799  1.00 31.58  ? 240  LEU A O   1 
ATOM   1448  C  CB  . LEU A  1  212 ? 19.454  56.021  32.846  1.00 31.12  ? 240  LEU A CB  1 
ATOM   1449  C  CG  . LEU A  1  212 ? 19.692  55.041  31.688  1.00 30.58  ? 240  LEU A CG  1 
ATOM   1450  C  CD1 . LEU A  1  212 ? 18.671  55.232  30.604  1.00 30.92  ? 240  LEU A CD1 1 
ATOM   1451  C  CD2 . LEU A  1  212 ? 21.087  55.218  31.126  1.00 31.00  ? 240  LEU A CD2 1 
ATOM   1452  N  N   . HIS A  1  213 ? 20.310  56.563  36.298  1.00 31.75  ? 241  HIS A N   1 
ATOM   1453  C  CA  . HIS A  1  213 ? 19.797  57.327  37.420  1.00 32.07  ? 241  HIS A CA  1 
ATOM   1454  C  C   . HIS A  1  213 ? 20.833  57.486  38.515  1.00 32.45  ? 241  HIS A C   1 
ATOM   1455  O  O   . HIS A  1  213 ? 20.623  57.128  39.677  1.00 32.73  ? 241  HIS A O   1 
ATOM   1456  C  CB  . HIS A  1  213 ? 18.483  56.700  37.883  1.00 31.98  ? 241  HIS A CB  1 
ATOM   1457  C  CG  . HIS A  1  213 ? 17.457  56.696  36.801  1.00 32.98  ? 241  HIS A CG  1 
ATOM   1458  N  ND1 . HIS A  1  213 ? 16.716  57.815  36.484  1.00 34.82  ? 241  HIS A ND1 1 
ATOM   1459  C  CD2 . HIS A  1  213 ? 17.137  55.758  35.881  1.00 33.01  ? 241  HIS A CD2 1 
ATOM   1460  C  CE1 . HIS A  1  213 ? 15.951  57.551  35.440  1.00 33.56  ? 241  HIS A CE1 1 
ATOM   1461  N  NE2 . HIS A  1  213 ? 16.180  56.307  35.063  1.00 34.03  ? 241  HIS A NE2 1 
ATOM   1462  N  N   . HIS A  1  214 ? 21.968  58.034  38.110  1.00 32.76  ? 242  HIS A N   1 
ATOM   1463  C  CA  . HIS A  1  214 ? 23.045  58.329  39.020  1.00 33.03  ? 242  HIS A CA  1 
ATOM   1464  C  C   . HIS A  1  214 ? 22.645  59.494  39.910  1.00 33.30  ? 242  HIS A C   1 
ATOM   1465  O  O   . HIS A  1  214 ? 22.193  60.558  39.439  1.00 33.84  ? 242  HIS A O   1 
ATOM   1466  C  CB  . HIS A  1  214 ? 24.289  58.690  38.238  1.00 33.25  ? 242  HIS A CB  1 
ATOM   1467  C  CG  . HIS A  1  214 ? 25.562  58.385  38.952  1.00 33.13  ? 242  HIS A CG  1 
ATOM   1468  N  ND1 . HIS A  1  214 ? 26.172  59.283  39.796  1.00 34.81  ? 242  HIS A ND1 1 
ATOM   1469  C  CD2 . HIS A  1  214 ? 26.365  57.299  38.914  1.00 33.38  ? 242  HIS A CD2 1 
ATOM   1470  C  CE1 . HIS A  1  214 ? 27.288  58.755  40.265  1.00 34.78  ? 242  HIS A CE1 1 
ATOM   1471  N  NE2 . HIS A  1  214 ? 27.428  57.550  39.744  1.00 33.71  ? 242  HIS A NE2 1 
ATOM   1472  N  N   . VAL A  1  215 ? 22.827  59.269  41.201  1.00 32.73  ? 243  VAL A N   1 
ATOM   1473  C  CA  . VAL A  1  215 ? 22.432  60.178  42.246  1.00 32.13  ? 243  VAL A CA  1 
ATOM   1474  C  C   . VAL A  1  215 ? 23.548  61.185  42.515  1.00 31.76  ? 243  VAL A C   1 
ATOM   1475  O  O   . VAL A  1  215 ? 23.341  62.175  43.214  1.00 32.06  ? 243  VAL A O   1 
ATOM   1476  C  CB  . VAL A  1  215 ? 22.057  59.339  43.479  1.00 32.16  ? 243  VAL A CB  1 
ATOM   1477  C  CG1 . VAL A  1  215 ? 22.411  60.010  44.761  1.00 32.80  ? 243  VAL A CG1 1 
ATOM   1478  C  CG2 . VAL A  1  215 ? 20.582  58.965  43.419  1.00 33.12  ? 243  VAL A CG2 1 
ATOM   1479  N  N   . GLY A  1  216 ? 24.719  60.942  41.935  1.00 31.23  ? 244  GLY A N   1 
ATOM   1480  C  CA  . GLY A  1  216 ? 25.825  61.893  41.991  1.00 31.23  ? 244  GLY A CA  1 
ATOM   1481  C  C   . GLY A  1  216 ? 26.829  61.594  43.083  1.00 31.38  ? 244  GLY A C   1 
ATOM   1482  O  O   . GLY A  1  216 ? 27.851  62.272  43.204  1.00 31.97  ? 244  GLY A O   1 
ATOM   1483  N  N   . LEU A  1  217 ? 26.526  60.585  43.891  1.00 30.88  ? 245  LEU A N   1 
ATOM   1484  C  CA  . LEU A  1  217 ? 27.388  60.171  44.981  1.00 30.12  ? 245  LEU A CA  1 
ATOM   1485  C  C   . LEU A  1  217 ? 28.227  58.957  44.570  1.00 29.99  ? 245  LEU A C   1 
ATOM   1486  O  O   . LEU A  1  217 ? 27.708  57.977  44.035  1.00 29.78  ? 245  LEU A O   1 
ATOM   1487  C  CB  . LEU A  1  217 ? 26.535  59.850  46.211  1.00 29.91  ? 245  LEU A CB  1 
ATOM   1488  C  CG  . LEU A  1  217 ? 27.254  59.507  47.514  1.00 29.97  ? 245  LEU A CG  1 
ATOM   1489  C  CD1 . LEU A  1  217 ? 28.149  60.660  47.973  1.00 28.80  ? 245  LEU A CD1 1 
ATOM   1490  C  CD2 . LEU A  1  217 ? 26.242  59.126  48.595  1.00 29.75  ? 245  LEU A CD2 1 
ATOM   1491  N  N   . GLU A  1  218 ? 29.530  59.036  44.805  1.00 29.58  ? 246  GLU A N   1 
ATOM   1492  C  CA  . GLU A  1  218 ? 30.423  57.927  44.522  1.00 29.57  ? 246  GLU A CA  1 
ATOM   1493  C  C   . GLU A  1  218 ? 31.349  57.798  45.707  1.00 29.27  ? 246  GLU A C   1 
ATOM   1494  O  O   . GLU A  1  218 ? 31.794  58.813  46.274  1.00 29.50  ? 246  GLU A O   1 
ATOM   1495  C  CB  . GLU A  1  218 ? 31.221  58.175  43.241  1.00 29.23  ? 246  GLU A CB  1 
ATOM   1496  C  CG  . GLU A  1  218 ? 30.369  58.625  42.045  1.00 29.99  ? 246  GLU A CG  1 
ATOM   1497  C  CD  . GLU A  1  218 ? 31.103  58.540  40.723  1.00 31.70  ? 246  GLU A CD  1 
ATOM   1498  O  OE1 . GLU A  1  218 ? 32.353  58.646  40.700  1.00 35.13  ? 246  GLU A OE1 1 
ATOM   1499  O  OE2 . GLU A  1  218 ? 30.430  58.352  39.686  1.00 36.75  ? 246  GLU A OE2 1 
ATOM   1500  N  N   . LEU A  1  219 ? 31.623  56.560  46.100  1.00 28.83  ? 247  LEU A N   1 
ATOM   1501  C  CA  . LEU A  1  219 ? 32.423  56.296  47.292  1.00 28.80  ? 247  LEU A CA  1 
ATOM   1502  C  C   . LEU A  1  219 ? 33.566  55.366  46.944  1.00 28.98  ? 247  LEU A C   1 
ATOM   1503  O  O   . LEU A  1  219 ? 33.369  54.371  46.238  1.00 29.24  ? 247  LEU A O   1 
ATOM   1504  C  CB  . LEU A  1  219 ? 31.573  55.661  48.387  1.00 28.32  ? 247  LEU A CB  1 
ATOM   1505  C  CG  . LEU A  1  219 ? 30.277  56.338  48.807  1.00 28.66  ? 247  LEU A CG  1 
ATOM   1506  C  CD1 . LEU A  1  219 ? 29.458  55.377  49.642  1.00 28.43  ? 247  LEU A CD1 1 
ATOM   1507  C  CD2 . LEU A  1  219 ? 30.562  57.624  49.580  1.00 29.44  ? 247  LEU A CD2 1 
ATOM   1508  N  N   . LEU A  1  220 ? 34.761  55.693  47.423  1.00 29.14  ? 248  LEU A N   1 
ATOM   1509  C  CA  . LEU A  1  220 ? 35.906  54.827  47.193  1.00 29.68  ? 248  LEU A CA  1 
ATOM   1510  C  C   . LEU A  1  220 ? 36.057  53.947  48.412  1.00 30.06  ? 248  LEU A C   1 
ATOM   1511  O  O   . LEU A  1  220 ? 36.484  54.414  49.476  1.00 30.15  ? 248  LEU A O   1 
ATOM   1512  C  CB  . LEU A  1  220 ? 37.185  55.629  46.908  1.00 29.66  ? 248  LEU A CB  1 
ATOM   1513  C  CG  . LEU A  1  220 ? 38.504  54.871  46.668  1.00 29.47  ? 248  LEU A CG  1 
ATOM   1514  C  CD1 . LEU A  1  220 ? 38.408  53.856  45.518  1.00 28.23  ? 248  LEU A CD1 1 
ATOM   1515  C  CD2 . LEU A  1  220 ? 39.658  55.858  46.425  1.00 29.16  ? 248  LEU A CD2 1 
ATOM   1516  N  N   . VAL A  1  221 ? 35.671  52.683  48.248  1.00 30.21  ? 249  VAL A N   1 
ATOM   1517  C  CA  . VAL A  1  221 ? 35.660  51.721  49.341  1.00 30.35  ? 249  VAL A CA  1 
ATOM   1518  C  C   . VAL A  1  221 ? 36.928  50.898  49.306  1.00 30.83  ? 249  VAL A C   1 
ATOM   1519  O  O   . VAL A  1  221 ? 37.162  50.142  48.355  1.00 31.34  ? 249  VAL A O   1 
ATOM   1520  C  CB  . VAL A  1  221 ? 34.418  50.774  49.288  1.00 30.12  ? 249  VAL A CB  1 
ATOM   1521  C  CG1 . VAL A  1  221 ? 34.499  49.709  50.374  1.00 29.68  ? 249  VAL A CG1 1 
ATOM   1522  C  CG2 . VAL A  1  221 ? 33.145  51.558  49.443  1.00 29.30  ? 249  VAL A CG2 1 
ATOM   1523  N  N   . ASN A  1  222 ? 37.752  51.059  50.338  1.00 31.32  ? 250  ASN A N   1 
ATOM   1524  C  CA  . ASN A  1  222 ? 38.910  50.185  50.541  1.00 31.48  ? 250  ASN A CA  1 
ATOM   1525  C  C   . ASN A  1  222 ? 38.506  48.901  51.246  1.00 31.27  ? 250  ASN A C   1 
ATOM   1526  O  O   . ASN A  1  222 ? 38.256  48.908  52.442  1.00 31.38  ? 250  ASN A O   1 
ATOM   1527  C  CB  . ASN A  1  222 ? 40.004  50.879  51.350  1.00 31.44  ? 250  ASN A CB  1 
ATOM   1528  C  CG  . ASN A  1  222 ? 41.257  50.037  51.449  1.00 31.94  ? 250  ASN A CG  1 
ATOM   1529  O  OD1 . ASN A  1  222 ? 41.306  48.909  50.944  1.00 31.62  ? 250  ASN A OD1 1 
ATOM   1530  N  ND2 . ASN A  1  222 ? 42.276  50.573  52.097  1.00 31.77  ? 250  ASN A ND2 1 
ATOM   1531  N  N   . HIS A  1  223 ? 38.438  47.804  50.500  1.00 31.46  ? 251  HIS A N   1 
ATOM   1532  C  CA  . HIS A  1  223 ? 37.976  46.527  51.053  1.00 31.17  ? 251  HIS A CA  1 
ATOM   1533  C  C   . HIS A  1  223 ? 39.029  45.453  50.865  1.00 31.83  ? 251  HIS A C   1 
ATOM   1534  O  O   . HIS A  1  223 ? 38.715  44.276  50.624  1.00 32.46  ? 251  HIS A O   1 
ATOM   1535  C  CB  . HIS A  1  223 ? 36.607  46.108  50.479  1.00 30.45  ? 251  HIS A CB  1 
ATOM   1536  C  CG  . HIS A  1  223 ? 36.561  46.014  48.987  1.00 29.15  ? 251  HIS A CG  1 
ATOM   1537  N  ND1 . HIS A  1  223 ? 36.423  44.816  48.323  1.00 28.00  ? 251  HIS A ND1 1 
ATOM   1538  C  CD2 . HIS A  1  223 ? 36.602  46.970  48.029  1.00 28.51  ? 251  HIS A CD2 1 
ATOM   1539  C  CE1 . HIS A  1  223 ? 36.392  45.035  47.020  1.00 26.99  ? 251  HIS A CE1 1 
ATOM   1540  N  NE2 . HIS A  1  223 ? 36.501  46.334  46.814  1.00 26.80  ? 251  HIS A NE2 1 
ATOM   1541  N  N   . LYS A  1  224 ? 40.287  45.874  50.974  1.00 32.19  ? 252  LYS A N   1 
ATOM   1542  C  CA  . LYS A  1  224 ? 41.416  44.966  50.907  1.00 32.60  ? 252  LYS A CA  1 
ATOM   1543  C  C   . LYS A  1  224 ? 41.464  44.044  52.118  1.00 32.80  ? 252  LYS A C   1 
ATOM   1544  O  O   . LYS A  1  224 ? 41.705  42.849  51.972  1.00 33.47  ? 252  LYS A O   1 
ATOM   1545  C  CB  . LYS A  1  224 ? 42.726  45.742  50.788  1.00 32.55  ? 252  LYS A CB  1 
ATOM   1546  C  CG  . LYS A  1  224 ? 43.946  44.852  50.549  1.00 33.58  ? 252  LYS A CG  1 
ATOM   1547  C  CD  . LYS A  1  224 ? 45.230  45.680  50.522  1.00 35.51  ? 252  LYS A CD  1 
ATOM   1548  C  CE  . LYS A  1  224 ? 46.495  44.811  50.578  1.00 35.27  ? 252  LYS A CE  1 
ATOM   1549  N  NZ  . LYS A  1  224 ? 46.500  43.712  49.589  1.00 31.71  ? 252  LYS A NZ  1 
ATOM   1550  N  N   . ALA A  1  225 ? 41.239  44.591  53.310  1.00 32.92  ? 253  ALA A N   1 
ATOM   1551  C  CA  . ALA A  1  225 ? 41.421  43.822  54.540  1.00 33.03  ? 253  ALA A CA  1 
ATOM   1552  C  C   . ALA A  1  225 ? 40.554  42.554  54.566  1.00 33.24  ? 253  ALA A C   1 
ATOM   1553  O  O   . ALA A  1  225 ? 39.404  42.572  54.112  1.00 33.35  ? 253  ALA A O   1 
ATOM   1554  C  CB  . ALA A  1  225 ? 41.162  44.694  55.764  1.00 32.72  ? 253  ALA A CB  1 
ATOM   1555  N  N   . LEU A  1  226 ? 41.123  41.459  55.075  1.00 32.97  ? 254  LEU A N   1 
ATOM   1556  C  CA  . LEU A  1  226 ? 40.392  40.198  55.235  1.00 32.91  ? 254  LEU A CA  1 
ATOM   1557  C  C   . LEU A  1  226 ? 39.282  40.262  56.280  1.00 32.99  ? 254  LEU A C   1 
ATOM   1558  O  O   . LEU A  1  226 ? 38.346  39.471  56.239  1.00 33.21  ? 254  LEU A O   1 
ATOM   1559  C  CB  . LEU A  1  226 ? 41.354  39.063  55.585  1.00 32.93  ? 254  LEU A CB  1 
ATOM   1560  C  CG  . LEU A  1  226 ? 42.374  38.692  54.511  1.00 33.31  ? 254  LEU A CG  1 
ATOM   1561  C  CD1 . LEU A  1  226 ? 43.172  37.470  54.937  1.00 35.11  ? 254  LEU A CD1 1 
ATOM   1562  C  CD2 . LEU A  1  226 ? 41.689  38.455  53.178  1.00 33.06  ? 254  LEU A CD2 1 
ATOM   1563  N  N   . ASP A  1  227 ? 39.407  41.183  57.233  1.00 33.07  ? 255  ASP A N   1 
ATOM   1564  C  CA  . ASP A  1  227 ? 38.339  41.473  58.184  1.00 33.11  ? 255  ASP A CA  1 
ATOM   1565  C  C   . ASP A  1  227 ? 37.562  42.721  57.726  1.00 33.09  ? 255  ASP A C   1 
ATOM   1566  O  O   . ASP A  1  227 ? 38.108  43.830  57.719  1.00 33.02  ? 255  ASP A O   1 
ATOM   1567  C  CB  . ASP A  1  227 ? 38.908  41.659  59.599  1.00 32.85  ? 255  ASP A CB  1 
ATOM   1568  C  CG  . ASP A  1  227 ? 37.839  42.040  60.624  1.00 33.50  ? 255  ASP A CG  1 
ATOM   1569  O  OD1 . ASP A  1  227 ? 36.626  41.869  60.371  1.00 33.45  ? 255  ASP A OD1 1 
ATOM   1570  O  OD2 . ASP A  1  227 ? 38.217  42.509  61.711  1.00 35.66  ? 255  ASP A OD2 1 
ATOM   1571  N  N   . PRO A  1  228 ? 36.292  42.541  57.326  1.00 33.00  ? 256  PRO A N   1 
ATOM   1572  C  CA  . PRO A  1  228 ? 35.466  43.661  56.857  1.00 33.52  ? 256  PRO A CA  1 
ATOM   1573  C  C   . PRO A  1  228 ? 35.304  44.825  57.843  1.00 34.05  ? 256  PRO A C   1 
ATOM   1574  O  O   . PRO A  1  228 ? 35.112  45.966  57.421  1.00 34.70  ? 256  PRO A O   1 
ATOM   1575  C  CB  . PRO A  1  228 ? 34.116  43.000  56.560  1.00 33.55  ? 256  PRO A CB  1 
ATOM   1576  C  CG  . PRO A  1  228 ? 34.474  41.569  56.250  1.00 32.79  ? 256  PRO A CG  1 
ATOM   1577  C  CD  . PRO A  1  228 ? 35.575  41.259  57.231  1.00 32.77  ? 256  PRO A CD  1 
ATOM   1578  N  N   . ALA A  1  229 ? 35.396  44.563  59.135  1.00 34.10  ? 257  ALA A N   1 
ATOM   1579  C  CA  . ALA A  1  229 ? 35.326  45.645  60.117  1.00 34.45  ? 257  ALA A CA  1 
ATOM   1580  C  C   . ALA A  1  229 ? 36.432  46.703  59.921  1.00 34.56  ? 257  ALA A C   1 
ATOM   1581  O  O   . ALA A  1  229 ? 36.296  47.845  60.375  1.00 34.68  ? 257  ALA A O   1 
ATOM   1582  C  CB  . ALA A  1  229 ? 35.363  45.073  61.560  1.00 34.16  ? 257  ALA A CB  1 
ATOM   1583  N  N   . ARG A  1  230 ? 37.523  46.320  59.263  1.00 34.58  ? 258  ARG A N   1 
ATOM   1584  C  CA  . ARG A  1  230 ? 38.665  47.224  59.065  1.00 34.94  ? 258  ARG A CA  1 
ATOM   1585  C  C   . ARG A  1  230 ? 38.624  47.935  57.707  1.00 34.01  ? 258  ARG A C   1 
ATOM   1586  O  O   . ARG A  1  230 ? 39.598  48.575  57.325  1.00 34.05  ? 258  ARG A O   1 
ATOM   1587  C  CB  . ARG A  1  230 ? 39.987  46.462  59.195  1.00 35.70  ? 258  ARG A CB  1 
ATOM   1588  C  CG  . ARG A  1  230 ? 40.231  45.813  60.546  1.00 39.33  ? 258  ARG A CG  1 
ATOM   1589  C  CD  . ARG A  1  230 ? 41.107  46.698  61.414  1.00 46.46  ? 258  ARG A CD  1 
ATOM   1590  N  NE  . ARG A  1  230 ? 42.248  45.962  61.974  1.00 51.55  ? 258  ARG A NE  1 
ATOM   1591  C  CZ  . ARG A  1  230 ? 43.280  45.489  61.261  1.00 53.72  ? 258  ARG A CZ  1 
ATOM   1592  N  NH1 . ARG A  1  230 ? 43.331  45.649  59.932  1.00 53.05  ? 258  ARG A NH1 1 
ATOM   1593  N  NH2 . ARG A  1  230 ? 44.263  44.839  61.884  1.00 53.77  ? 258  ARG A NH2 1 
ATOM   1594  N  N   . TRP A  1  231 ? 37.508  47.806  56.986  1.00 32.90  ? 259  TRP A N   1 
ATOM   1595  C  CA  . TRP A  1  231 ? 37.323  48.471  55.698  1.00 32.09  ? 259  TRP A CA  1 
ATOM   1596  C  C   . TRP A  1  231 ? 37.024  49.939  55.916  1.00 32.00  ? 259  TRP A C   1 
ATOM   1597  O  O   . TRP A  1  231 ? 36.547  50.317  56.992  1.00 32.13  ? 259  TRP A O   1 
ATOM   1598  C  CB  . TRP A  1  231 ? 36.192  47.822  54.885  1.00 31.23  ? 259  TRP A CB  1 
ATOM   1599  C  CG  . TRP A  1  231 ? 36.505  46.434  54.405  1.00 30.07  ? 259  TRP A CG  1 
ATOM   1600  C  CD1 . TRP A  1  231 ? 37.713  45.787  54.478  1.00 29.42  ? 259  TRP A CD1 1 
ATOM   1601  C  CD2 . TRP A  1  231 ? 35.607  45.525  53.759  1.00 29.25  ? 259  TRP A CD2 1 
ATOM   1602  N  NE1 . TRP A  1  231 ? 37.612  44.530  53.934  1.00 28.70  ? 259  TRP A NE1 1 
ATOM   1603  C  CE2 . TRP A  1  231 ? 36.334  44.344  53.479  1.00 28.81  ? 259  TRP A CE2 1 
ATOM   1604  C  CE3 . TRP A  1  231 ? 34.259  45.592  53.386  1.00 29.19  ? 259  TRP A CE3 1 
ATOM   1605  C  CZ2 . TRP A  1  231 ? 35.757  43.244  52.841  1.00 29.21  ? 259  TRP A CZ2 1 
ATOM   1606  C  CZ3 . TRP A  1  231 ? 33.685  44.494  52.759  1.00 29.69  ? 259  TRP A CZ3 1 
ATOM   1607  C  CH2 . TRP A  1  231 ? 34.437  43.335  52.490  1.00 29.58  ? 259  TRP A CH2 1 
ATOM   1608  N  N   . THR A  1  232 ? 37.305  50.754  54.899  1.00 31.52  ? 260  THR A N   1 
ATOM   1609  C  CA  . THR A  1  232 ? 37.176  52.209  54.997  1.00 31.35  ? 260  THR A CA  1 
ATOM   1610  C  C   . THR A  1  232 ? 36.683  52.869  53.715  1.00 31.40  ? 260  THR A C   1 
ATOM   1611  O  O   . THR A  1  232 ? 36.760  52.294  52.621  1.00 31.44  ? 260  THR A O   1 
ATOM   1612  C  CB  . THR A  1  232 ? 38.530  52.882  55.323  1.00 31.36  ? 260  THR A CB  1 
ATOM   1613  O  OG1 . THR A  1  232 ? 39.538  52.363  54.451  1.00 31.39  ? 260  THR A OG1 1 
ATOM   1614  C  CG2 . THR A  1  232 ? 38.934  52.681  56.790  1.00 30.62  ? 260  THR A CG2 1 
ATOM   1615  N  N   . ILE A  1  233 ? 36.206  54.101  53.864  1.00 31.30  ? 261  ILE A N   1 
ATOM   1616  C  CA  . ILE A  1  233 ? 35.962  54.993  52.739  1.00 31.22  ? 261  ILE A CA  1 
ATOM   1617  C  C   . ILE A  1  233 ? 37.186  55.885  52.586  1.00 31.11  ? 261  ILE A C   1 
ATOM   1618  O  O   . ILE A  1  233 ? 37.464  56.677  53.475  1.00 31.20  ? 261  ILE A O   1 
ATOM   1619  C  CB  . ILE A  1  233 ? 34.747  55.907  53.008  1.00 31.00  ? 261  ILE A CB  1 
ATOM   1620  C  CG1 . ILE A  1  233 ? 33.501  55.083  53.346  1.00 31.35  ? 261  ILE A CG1 1 
ATOM   1621  C  CG2 . ILE A  1  233 ? 34.496  56.859  51.833  1.00 31.22  ? 261  ILE A CG2 1 
ATOM   1622  C  CD1 . ILE A  1  233 ? 33.039  54.141  52.254  1.00 33.11  ? 261  ILE A CD1 1 
ATOM   1623  N  N   . GLN A  1  234 ? 37.911  55.765  51.478  1.00 30.99  ? 262  GLN A N   1 
ATOM   1624  C  CA  . GLN A  1  234 ? 39.091  56.613  51.258  1.00 31.64  ? 262  GLN A CA  1 
ATOM   1625  C  C   . GLN A  1  234 ? 38.747  57.996  50.697  1.00 31.17  ? 262  GLN A C   1 
ATOM   1626  O  O   . GLN A  1  234 ? 39.488  58.948  50.916  1.00 31.33  ? 262  GLN A O   1 
ATOM   1627  C  CB  . GLN A  1  234 ? 40.131  55.934  50.348  1.00 31.66  ? 262  GLN A CB  1 
ATOM   1628  C  CG  . GLN A  1  234 ? 40.783  54.676  50.927  1.00 32.60  ? 262  GLN A CG  1 
ATOM   1629  C  CD  . GLN A  1  234 ? 41.751  53.961  49.948  1.00 33.35  ? 262  GLN A CD  1 
ATOM   1630  O  OE1 . GLN A  1  234 ? 42.648  53.237  50.381  1.00 36.33  ? 262  GLN A OE1 1 
ATOM   1631  N  NE2 . GLN A  1  234 ? 41.562  54.157  48.643  1.00 34.08  ? 262  GLN A NE2 1 
ATOM   1632  N  N   . LYS A  1  235 ? 37.632  58.103  49.974  1.00 30.77  ? 263  LYS A N   1 
ATOM   1633  C  CA  . LYS A  1  235 ? 37.245  59.348  49.321  1.00 29.90  ? 263  LYS A CA  1 
ATOM   1634  C  C   . LYS A  1  235 ? 35.767  59.377  48.973  1.00 29.60  ? 263  LYS A C   1 
ATOM   1635  O  O   . LYS A  1  235 ? 35.172  58.348  48.685  1.00 29.51  ? 263  LYS A O   1 
ATOM   1636  C  CB  . LYS A  1  235 ? 38.039  59.536  48.030  1.00 30.19  ? 263  LYS A CB  1 
ATOM   1637  C  CG  . LYS A  1  235 ? 38.365  60.984  47.705  1.00 29.85  ? 263  LYS A CG  1 
ATOM   1638  C  CD  . LYS A  1  235 ? 39.433  61.471  48.649  1.00 30.30  ? 263  LYS A CD  1 
ATOM   1639  C  CE  . LYS A  1  235 ? 39.914  62.825  48.273  1.00 30.58  ? 263  LYS A CE  1 
ATOM   1640  N  NZ  . LYS A  1  235 ? 40.853  63.263  49.317  1.00 32.29  ? 263  LYS A NZ  1 
ATOM   1641  N  N   . VAL A  1  236 ? 35.193  60.573  48.987  1.00 29.05  ? 264  VAL A N   1 
ATOM   1642  C  CA  . VAL A  1  236 ? 33.824  60.786  48.590  1.00 28.62  ? 264  VAL A CA  1 
ATOM   1643  C  C   . VAL A  1  236 ? 33.821  61.809  47.447  1.00 29.04  ? 264  VAL A C   1 
ATOM   1644  O  O   . VAL A  1  236 ? 34.676  62.692  47.392  1.00 29.06  ? 264  VAL A O   1 
ATOM   1645  C  CB  . VAL A  1  236 ? 32.977  61.286  49.783  1.00 28.63  ? 264  VAL A CB  1 
ATOM   1646  C  CG1 . VAL A  1  236 ? 31.534  61.502  49.370  1.00 27.59  ? 264  VAL A CG1 1 
ATOM   1647  C  CG2 . VAL A  1  236 ? 33.037  60.297  50.929  1.00 27.26  ? 264  VAL A CG2 1 
ATOM   1648  N  N   . PHE A  1  237 ? 32.881  61.659  46.522  1.00 28.94  ? 265  PHE A N   1 
ATOM   1649  C  CA  . PHE A  1  237 ? 32.704  62.595  45.429  1.00 29.00  ? 265  PHE A CA  1 
ATOM   1650  C  C   . PHE A  1  237 ? 31.207  62.788  45.340  1.00 29.17  ? 265  PHE A C   1 
ATOM   1651  O  O   . PHE A  1  237 ? 30.450  61.809  45.195  1.00 29.65  ? 265  PHE A O   1 
ATOM   1652  C  CB  . PHE A  1  237 ? 33.252  61.986  44.133  1.00 29.65  ? 265  PHE A CB  1 
ATOM   1653  C  CG  . PHE A  1  237 ? 33.311  62.945  42.968  1.00 29.54  ? 265  PHE A CG  1 
ATOM   1654  C  CD1 . PHE A  1  237 ? 34.429  63.763  42.775  1.00 30.45  ? 265  PHE A CD1 1 
ATOM   1655  C  CD2 . PHE A  1  237 ? 32.256  63.016  42.047  1.00 29.99  ? 265  PHE A CD2 1 
ATOM   1656  C  CE1 . PHE A  1  237 ? 34.491  64.661  41.688  1.00 30.71  ? 265  PHE A CE1 1 
ATOM   1657  C  CE2 . PHE A  1  237 ? 32.301  63.883  40.955  1.00 29.02  ? 265  PHE A CE2 1 
ATOM   1658  C  CZ  . PHE A  1  237 ? 33.426  64.709  40.771  1.00 30.71  ? 265  PHE A CZ  1 
ATOM   1659  N  N   . TYR A  1  238 ? 30.762  64.030  45.483  1.00 28.65  ? 266  TYR A N   1 
ATOM   1660  C  CA  . TYR A  1  238 ? 29.335  64.319  45.426  1.00 28.29  ? 266  TYR A CA  1 
ATOM   1661  C  C   . TYR A  1  238 ? 29.051  65.496  44.517  1.00 29.09  ? 266  TYR A C   1 
ATOM   1662  O  O   . TYR A  1  238 ? 29.627  66.589  44.684  1.00 29.22  ? 266  TYR A O   1 
ATOM   1663  C  CB  . TYR A  1  238 ? 28.743  64.568  46.810  1.00 27.39  ? 266  TYR A CB  1 
ATOM   1664  C  CG  . TYR A  1  238 ? 27.260  64.835  46.755  1.00 26.47  ? 266  TYR A CG  1 
ATOM   1665  C  CD1 . TYR A  1  238 ? 26.363  63.801  46.480  1.00 26.11  ? 266  TYR A CD1 1 
ATOM   1666  C  CD2 . TYR A  1  238 ? 26.747  66.116  46.951  1.00 25.10  ? 266  TYR A CD2 1 
ATOM   1667  C  CE1 . TYR A  1  238 ? 24.996  64.023  46.408  1.00 25.19  ? 266  TYR A CE1 1 
ATOM   1668  C  CE2 . TYR A  1  238 ? 25.366  66.355  46.889  1.00 25.50  ? 266  TYR A CE2 1 
ATOM   1669  C  CZ  . TYR A  1  238 ? 24.497  65.286  46.612  1.00 26.54  ? 266  TYR A CZ  1 
ATOM   1670  O  OH  . TYR A  1  238 ? 23.130  65.470  46.532  1.00 26.59  ? 266  TYR A OH  1 
ATOM   1671  N  N   . GLN A  1  239 ? 28.162  65.265  43.552  1.00 29.54  ? 267  GLN A N   1 
ATOM   1672  C  CA  . GLN A  1  239 ? 27.764  66.286  42.587  1.00 30.43  ? 267  GLN A CA  1 
ATOM   1673  C  C   . GLN A  1  239 ? 28.928  67.184  42.147  1.00 30.88  ? 267  GLN A C   1 
ATOM   1674  O  O   . GLN A  1  239 ? 28.821  68.413  42.178  1.00 31.17  ? 267  GLN A O   1 
ATOM   1675  C  CB  . GLN A  1  239 ? 26.598  67.118  43.129  1.00 30.16  ? 267  GLN A CB  1 
ATOM   1676  C  CG  . GLN A  1  239 ? 25.307  66.310  43.225  1.00 31.64  ? 267  GLN A CG  1 
ATOM   1677  C  CD  . GLN A  1  239 ? 24.058  67.166  43.350  1.00 32.72  ? 267  GLN A CD  1 
ATOM   1678  O  OE1 . GLN A  1  239 ? 24.104  68.398  43.265  1.00 33.01  ? 267  GLN A OE1 1 
ATOM   1679  N  NE2 . GLN A  1  239 ? 22.928  66.508  43.546  1.00 33.79  ? 267  GLN A NE2 1 
ATOM   1680  N  N   . GLY A  1  240 ? 30.040  66.564  41.762  1.00 31.12  ? 268  GLY A N   1 
ATOM   1681  C  CA  . GLY A  1  240 ? 31.134  67.287  41.105  1.00 31.86  ? 268  GLY A CA  1 
ATOM   1682  C  C   . GLY A  1  240 ? 32.279  67.776  41.975  1.00 32.19  ? 268  GLY A C   1 
ATOM   1683  O  O   . GLY A  1  240 ? 33.126  68.541  41.506  1.00 31.96  ? 268  GLY A O   1 
ATOM   1684  N  N   . ARG A  1  241 ? 32.309  67.346  43.235  1.00 32.53  ? 269  ARG A N   1 
ATOM   1685  C  CA  . ARG A  1  241 ? 33.302  67.834  44.193  1.00 33.56  ? 269  ARG A CA  1 
ATOM   1686  C  C   . ARG A  1  241 ? 33.756  66.712  45.112  1.00 33.08  ? 269  ARG A C   1 
ATOM   1687  O  O   . ARG A  1  241 ? 32.973  65.818  45.426  1.00 33.00  ? 269  ARG A O   1 
ATOM   1688  C  CB  . ARG A  1  241 ? 32.745  68.995  45.033  1.00 33.14  ? 269  ARG A CB  1 
ATOM   1689  C  CG  . ARG A  1  241 ? 32.591  70.343  44.306  1.00 34.75  ? 269  ARG A CG  1 
ATOM   1690  C  CD  . ARG A  1  241 ? 32.129  71.438  45.288  1.00 36.09  ? 269  ARG A CD  1 
ATOM   1691  N  NE  . ARG A  1  241 ? 31.650  72.654  44.613  1.00 41.58  ? 269  ARG A NE  1 
ATOM   1692  C  CZ  . ARG A  1  241 ? 32.263  73.843  44.636  1.00 43.55  ? 269  ARG A CZ  1 
ATOM   1693  N  NH1 . ARG A  1  241 ? 33.405  74.011  45.303  1.00 44.68  ? 269  ARG A NH1 1 
ATOM   1694  N  NH2 . ARG A  1  241 ? 31.731  74.875  43.986  1.00 44.08  ? 269  ARG A NH2 1 
ATOM   1695  N  N   . TYR A  1  242 ? 35.019  66.784  45.545  1.00 32.99  ? 270  TYR A N   1 
ATOM   1696  C  CA  . TYR A  1  242 ? 35.607  65.811  46.480  1.00 32.54  ? 270  TYR A CA  1 
ATOM   1697  C  C   . TYR A  1  242 ? 35.414  66.228  47.931  1.00 32.10  ? 270  TYR A C   1 
ATOM   1698  O  O   . TYR A  1  242 ? 35.441  67.413  48.263  1.00 31.87  ? 270  TYR A O   1 
ATOM   1699  C  CB  . TYR A  1  242 ? 37.112  65.602  46.207  1.00 32.58  ? 270  TYR A CB  1 
ATOM   1700  C  CG  . TYR A  1  242 ? 37.406  64.983  44.855  1.00 32.62  ? 270  TYR A CG  1 
ATOM   1701  C  CD1 . TYR A  1  242 ? 37.621  65.785  43.713  1.00 32.08  ? 270  TYR A CD1 1 
ATOM   1702  C  CD2 . TYR A  1  242 ? 37.460  63.601  44.709  1.00 32.06  ? 270  TYR A CD2 1 
ATOM   1703  C  CE1 . TYR A  1  242 ? 37.874  65.203  42.465  1.00 31.77  ? 270  TYR A CE1 1 
ATOM   1704  C  CE2 . TYR A  1  242 ? 37.715  63.014  43.468  1.00 31.99  ? 270  TYR A CE2 1 
ATOM   1705  C  CZ  . TYR A  1  242 ? 37.912  63.809  42.359  1.00 31.83  ? 270  TYR A CZ  1 
ATOM   1706  O  OH  . TYR A  1  242 ? 38.157  63.193  41.161  1.00 31.96  ? 270  TYR A OH  1 
ATOM   1707  N  N   . TYR A  1  243 ? 35.228  65.225  48.781  1.00 31.81  ? 271  TYR A N   1 
ATOM   1708  C  CA  . TYR A  1  243 ? 35.090  65.390  50.217  1.00 31.49  ? 271  TYR A CA  1 
ATOM   1709  C  C   . TYR A  1  243 ? 35.829  64.216  50.834  1.00 32.17  ? 271  TYR A C   1 
ATOM   1710  O  O   . TYR A  1  243 ? 35.880  63.133  50.234  1.00 32.99  ? 271  TYR A O   1 
ATOM   1711  C  CB  . TYR A  1  243 ? 33.612  65.340  50.611  1.00 30.67  ? 271  TYR A CB  1 
ATOM   1712  C  CG  . TYR A  1  243 ? 32.758  66.432  49.988  1.00 29.84  ? 271  TYR A CG  1 
ATOM   1713  C  CD1 . TYR A  1  243 ? 32.253  66.305  48.692  1.00 29.04  ? 271  TYR A CD1 1 
ATOM   1714  C  CD2 . TYR A  1  243 ? 32.449  67.587  50.696  1.00 29.14  ? 271  TYR A CD2 1 
ATOM   1715  C  CE1 . TYR A  1  243 ? 31.472  67.302  48.119  1.00 28.24  ? 271  TYR A CE1 1 
ATOM   1716  C  CE2 . TYR A  1  243 ? 31.658  68.590  50.132  1.00 29.51  ? 271  TYR A CE2 1 
ATOM   1717  C  CZ  . TYR A  1  243 ? 31.174  68.437  48.847  1.00 29.25  ? 271  TYR A CZ  1 
ATOM   1718  O  OH  . TYR A  1  243 ? 30.406  69.428  48.289  1.00 29.32  ? 271  TYR A OH  1 
ATOM   1719  N  N   . ASP A  1  244 ? 36.392  64.421  52.023  1.00 32.52  ? 272  ASP A N   1 
ATOM   1720  C  CA  . ASP A  1  244 ? 37.202  63.404  52.702  1.00 33.07  ? 272  ASP A CA  1 
ATOM   1721  C  C   . ASP A  1  244 ? 36.384  62.305  53.355  1.00 32.83  ? 272  ASP A C   1 
ATOM   1722  O  O   . ASP A  1  244 ? 36.859  61.174  53.538  1.00 32.90  ? 272  ASP A O   1 
ATOM   1723  C  CB  . ASP A  1  244 ? 38.107  64.062  53.737  1.00 33.35  ? 272  ASP A CB  1 
ATOM   1724  C  CG  . ASP A  1  244 ? 39.075  65.026  53.104  1.00 35.61  ? 272  ASP A CG  1 
ATOM   1725  O  OD1 . ASP A  1  244 ? 39.425  64.828  51.910  1.00 37.27  ? 272  ASP A OD1 1 
ATOM   1726  O  OD2 . ASP A  1  244 ? 39.476  65.991  53.784  1.00 39.33  ? 272  ASP A OD2 1 
ATOM   1727  N  N   . SER A  1  245 ? 35.150  62.640  53.701  1.00 32.21  ? 273  SER A N   1 
ATOM   1728  C  CA  . SER A  1  245 ? 34.284  61.693  54.354  1.00 31.86  ? 273  SER A CA  1 
ATOM   1729  C  C   . SER A  1  245 ? 32.826  62.086  54.168  1.00 31.69  ? 273  SER A C   1 
ATOM   1730  O  O   . SER A  1  245 ? 32.500  63.254  53.864  1.00 31.09  ? 273  SER A O   1 
ATOM   1731  C  CB  . SER A  1  245 ? 34.629  61.618  55.847  1.00 31.77  ? 273  SER A CB  1 
ATOM   1732  O  OG  . SER A  1  245 ? 34.589  62.911  56.418  1.00 31.79  ? 273  SER A OG  1 
ATOM   1733  N  N   . LEU A  1  246 ? 31.951  61.104  54.371  1.00 31.15  ? 274  LEU A N   1 
ATOM   1734  C  CA  . LEU A  1  246 ? 30.528  61.370  54.439  1.00 30.82  ? 274  LEU A CA  1 
ATOM   1735  C  C   . LEU A  1  246 ? 30.190  62.341  55.576  1.00 31.12  ? 274  LEU A C   1 
ATOM   1736  O  O   . LEU A  1  246 ? 29.211  63.082  55.484  1.00 31.75  ? 274  LEU A O   1 
ATOM   1737  C  CB  . LEU A  1  246 ? 29.759  60.064  54.573  1.00 30.57  ? 274  LEU A CB  1 
ATOM   1738  C  CG  . LEU A  1  246 ? 29.774  59.210  53.305  1.00 29.84  ? 274  LEU A CG  1 
ATOM   1739  C  CD1 . LEU A  1  246 ? 29.672  57.745  53.639  1.00 30.19  ? 274  LEU A CD1 1 
ATOM   1740  C  CD2 . LEU A  1  246 ? 28.677  59.637  52.325  1.00 29.03  ? 274  LEU A CD2 1 
ATOM   1741  N  N   . ALA A  1  247 ? 31.007  62.362  56.632  1.00 30.93  ? 275  ALA A N   1 
ATOM   1742  C  CA  . ALA A  1  247 ? 30.766  63.271  57.759  1.00 30.88  ? 275  ALA A CA  1 
ATOM   1743  C  C   . ALA A  1  247 ? 31.134  64.720  57.413  1.00 31.28  ? 275  ALA A C   1 
ATOM   1744  O  O   . ALA A  1  247 ? 30.389  65.648  57.763  1.00 31.35  ? 275  ALA A O   1 
ATOM   1745  C  CB  . ALA A  1  247 ? 31.481  62.800  59.031  1.00 30.19  ? 275  ALA A CB  1 
ATOM   1746  N  N   . GLN A  1  248 ? 32.257  64.920  56.716  1.00 31.28  ? 276  GLN A N   1 
ATOM   1747  C  CA  . GLN A  1  248 ? 32.639  66.273  56.302  1.00 31.82  ? 276  GLN A CA  1 
ATOM   1748  C  C   . GLN A  1  248 ? 31.591  66.804  55.315  1.00 31.64  ? 276  GLN A C   1 
ATOM   1749  O  O   . GLN A  1  248 ? 31.190  67.966  55.395  1.00 31.80  ? 276  GLN A O   1 
ATOM   1750  C  CB  . GLN A  1  248 ? 34.070  66.330  55.722  1.00 31.70  ? 276  GLN A CB  1 
ATOM   1751  C  CG  . GLN A  1  248 ? 34.363  67.584  54.857  1.00 32.59  ? 276  GLN A CG  1 
ATOM   1752  C  CD  . GLN A  1  248 ? 35.815  67.672  54.351  1.00 32.65  ? 276  GLN A CD  1 
ATOM   1753  O  OE1 . GLN A  1  248 ? 36.099  67.492  53.146  1.00 31.70  ? 276  GLN A OE1 1 
ATOM   1754  N  NE2 . GLN A  1  248 ? 36.738  67.952  55.273  1.00 31.69  ? 276  GLN A NE2 1 
ATOM   1755  N  N   . LEU A  1  249 ? 31.136  65.931  54.415  1.00 31.55  ? 277  LEU A N   1 
ATOM   1756  C  CA  . LEU A  1  249 ? 30.102  66.269  53.445  1.00 31.58  ? 277  LEU A CA  1 
ATOM   1757  C  C   . LEU A  1  249 ? 28.805  66.709  54.133  1.00 31.71  ? 277  LEU A C   1 
ATOM   1758  O  O   . LEU A  1  249 ? 28.219  67.742  53.781  1.00 31.41  ? 277  LEU A O   1 
ATOM   1759  C  CB  . LEU A  1  249 ? 29.847  65.081  52.508  1.00 31.62  ? 277  LEU A CB  1 
ATOM   1760  C  CG  . LEU A  1  249 ? 28.681  65.093  51.506  1.00 31.65  ? 277  LEU A CG  1 
ATOM   1761  C  CD1 . LEU A  1  249 ? 28.616  66.378  50.672  1.00 31.38  ? 277  LEU A CD1 1 
ATOM   1762  C  CD2 . LEU A  1  249 ? 28.772  63.883  50.590  1.00 31.62  ? 277  LEU A CD2 1 
ATOM   1763  N  N   . GLU A  1  250 ? 28.375  65.927  55.122  1.00 31.63  ? 278  GLU A N   1 
ATOM   1764  C  CA  . GLU A  1  250 ? 27.135  66.207  55.834  1.00 31.50  ? 278  GLU A CA  1 
ATOM   1765  C  C   . GLU A  1  250 ? 27.224  67.537  56.584  1.00 31.41  ? 278  GLU A C   1 
ATOM   1766  O  O   . GLU A  1  250 ? 26.287  68.350  56.557  1.00 31.36  ? 278  GLU A O   1 
ATOM   1767  C  CB  . GLU A  1  250 ? 26.795  65.053  56.783  1.00 31.59  ? 278  GLU A CB  1 
ATOM   1768  C  CG  . GLU A  1  250 ? 25.530  65.239  57.616  1.00 31.48  ? 278  GLU A CG  1 
ATOM   1769  C  CD  . GLU A  1  250 ? 24.298  65.557  56.775  1.00 32.17  ? 278  GLU A CD  1 
ATOM   1770  O  OE1 . GLU A  1  250 ? 24.092  64.918  55.726  1.00 29.93  ? 278  GLU A OE1 1 
ATOM   1771  O  OE2 . GLU A  1  250 ? 23.529  66.458  57.168  1.00 33.42  ? 278  GLU A OE2 1 
ATOM   1772  N  N   . ALA A  1  251 ? 28.360  67.754  57.247  1.00 31.39  ? 279  ALA A N   1 
ATOM   1773  C  CA  . ALA A  1  251 ? 28.589  68.976  58.026  1.00 30.75  ? 279  ALA A CA  1 
ATOM   1774  C  C   . ALA A  1  251 ? 28.588  70.167  57.086  1.00 30.48  ? 279  ALA A C   1 
ATOM   1775  O  O   . ALA A  1  251 ? 27.950  71.172  57.344  1.00 30.50  ? 279  ALA A O   1 
ATOM   1776  C  CB  . ALA A  1  251 ? 29.901  68.889  58.774  1.00 30.37  ? 279  ALA A CB  1 
ATOM   1777  N  N   . GLN A  1  252 ? 29.282  70.030  55.972  1.00 30.47  ? 280  GLN A N   1 
ATOM   1778  C  CA  . GLN A  1  252 ? 29.344  71.099  55.001  1.00 31.03  ? 280  GLN A CA  1 
ATOM   1779  C  C   . GLN A  1  252 ? 27.957  71.394  54.393  1.00 30.69  ? 280  GLN A C   1 
ATOM   1780  O  O   . GLN A  1  252 ? 27.659  72.551  54.063  1.00 30.62  ? 280  GLN A O   1 
ATOM   1781  C  CB  . GLN A  1  252 ? 30.359  70.743  53.929  1.00 31.17  ? 280  GLN A CB  1 
ATOM   1782  C  CG  . GLN A  1  252 ? 31.218  71.897  53.515  1.00 34.00  ? 280  GLN A CG  1 
ATOM   1783  C  CD  . GLN A  1  252 ? 32.671  71.492  53.414  1.00 37.17  ? 280  GLN A CD  1 
ATOM   1784  O  OE1 . GLN A  1  252 ? 33.400  71.504  54.416  1.00 39.13  ? 280  GLN A OE1 1 
ATOM   1785  N  NE2 . GLN A  1  252 ? 33.105  71.125  52.208  1.00 36.76  ? 280  GLN A NE2 1 
ATOM   1786  N  N   . PHE A  1  253 ? 27.116  70.356  54.263  1.00 29.92  ? 281  PHE A N   1 
ATOM   1787  C  CA  . PHE A  1  253 ? 25.734  70.532  53.817  1.00 29.04  ? 281  PHE A CA  1 
ATOM   1788  C  C   . PHE A  1  253 ? 24.884  71.295  54.849  1.00 29.16  ? 281  PHE A C   1 
ATOM   1789  O  O   . PHE A  1  253 ? 24.139  72.229  54.507  1.00 28.91  ? 281  PHE A O   1 
ATOM   1790  C  CB  . PHE A  1  253 ? 25.069  69.193  53.485  1.00 28.55  ? 281  PHE A CB  1 
ATOM   1791  C  CG  . PHE A  1  253 ? 23.569  69.287  53.340  1.00 27.12  ? 281  PHE A CG  1 
ATOM   1792  C  CD1 . PHE A  1  253 ? 22.997  69.843  52.197  1.00 26.31  ? 281  PHE A CD1 1 
ATOM   1793  C  CD2 . PHE A  1  253 ? 22.732  68.843  54.354  1.00 26.51  ? 281  PHE A CD2 1 
ATOM   1794  C  CE1 . PHE A  1  253 ? 21.616  69.954  52.068  1.00 26.30  ? 281  PHE A CE1 1 
ATOM   1795  C  CE2 . PHE A  1  253 ? 21.336  68.945  54.237  1.00 25.82  ? 281  PHE A CE2 1 
ATOM   1796  C  CZ  . PHE A  1  253 ? 20.781  69.496  53.090  1.00 26.51  ? 281  PHE A CZ  1 
ATOM   1797  N  N   . GLU A  1  254 ? 24.986  70.878  56.106  1.00 28.84  ? 282  GLU A N   1 
ATOM   1798  C  CA  . GLU A  1  254 ? 24.257  71.525  57.187  1.00 28.94  ? 282  GLU A CA  1 
ATOM   1799  C  C   . GLU A  1  254 ? 24.721  72.971  57.382  1.00 28.34  ? 282  GLU A C   1 
ATOM   1800  O  O   . GLU A  1  254 ? 23.920  73.824  57.754  1.00 27.98  ? 282  GLU A O   1 
ATOM   1801  C  CB  . GLU A  1  254 ? 24.360  70.699  58.477  1.00 28.85  ? 282  GLU A CB  1 
ATOM   1802  C  CG  . GLU A  1  254 ? 23.594  69.358  58.383  1.00 30.22  ? 282  GLU A CG  1 
ATOM   1803  C  CD  . GLU A  1  254 ? 23.707  68.474  59.622  1.00 30.47  ? 282  GLU A CD  1 
ATOM   1804  O  OE1 . GLU A  1  254 ? 23.914  68.998  60.737  1.00 33.30  ? 282  GLU A OE1 1 
ATOM   1805  O  OE2 . GLU A  1  254 ? 23.586  67.239  59.483  1.00 31.31  ? 282  GLU A OE2 1 
ATOM   1806  N  N   . ALA A  1  255 ? 26.001  73.236  57.086  1.00 28.00  ? 283  ALA A N   1 
ATOM   1807  C  CA  . ALA A  1  255 ? 26.610  74.581  57.180  1.00 27.41  ? 283  ALA A CA  1 
ATOM   1808  C  C   . ALA A  1  255 ? 26.188  75.519  56.045  1.00 27.24  ? 283  ALA A C   1 
ATOM   1809  O  O   . ALA A  1  255 ? 26.576  76.688  56.017  1.00 27.55  ? 283  ALA A O   1 
ATOM   1810  C  CB  . ALA A  1  255 ? 28.137  74.481  57.240  1.00 27.02  ? 283  ALA A CB  1 
ATOM   1811  N  N   . GLY A  1  256 ? 25.408  74.999  55.110  1.00 26.75  ? 284  GLY A N   1 
ATOM   1812  C  CA  . GLY A  1  256 ? 24.820  75.813  54.064  1.00 26.85  ? 284  GLY A CA  1 
ATOM   1813  C  C   . GLY A  1  256 ? 25.667  75.995  52.823  1.00 26.83  ? 284  GLY A C   1 
ATOM   1814  O  O   . GLY A  1  256 ? 25.304  76.760  51.944  1.00 26.09  ? 284  GLY A O   1 
ATOM   1815  N  N   . LEU A  1  257 ? 26.787  75.280  52.740  1.00 27.64  ? 285  LEU A N   1 
ATOM   1816  C  CA  . LEU A  1  257 ? 27.720  75.455  51.630  1.00 28.06  ? 285  LEU A CA  1 
ATOM   1817  C  C   . LEU A  1  257 ? 27.474  74.573  50.412  1.00 28.73  ? 285  LEU A C   1 
ATOM   1818  O  O   . LEU A  1  257 ? 27.945  74.911  49.331  1.00 29.49  ? 285  LEU A O   1 
ATOM   1819  C  CB  . LEU A  1  257 ? 29.175  75.306  52.092  1.00 28.10  ? 285  LEU A CB  1 
ATOM   1820  C  CG  . LEU A  1  257 ? 30.222  75.837  51.094  1.00 27.98  ? 285  LEU A CG  1 
ATOM   1821  C  CD1 . LEU A  1  257 ? 30.240  77.347  51.065  1.00 25.42  ? 285  LEU A CD1 1 
ATOM   1822  C  CD2 . LEU A  1  257 ? 31.608  75.269  51.364  1.00 27.88  ? 285  LEU A CD2 1 
ATOM   1823  N  N   . VAL A  1  258 ? 26.754  73.460  50.560  1.00 29.15  ? 286  VAL A N   1 
ATOM   1824  C  CA  . VAL A  1  258 ? 26.598  72.509  49.438  1.00 29.71  ? 286  VAL A CA  1 
ATOM   1825  C  C   . VAL A  1  258 ? 25.292  72.711  48.664  1.00 30.75  ? 286  VAL A C   1 
ATOM   1826  O  O   . VAL A  1  258 ? 24.214  72.383  49.179  1.00 30.67  ? 286  VAL A O   1 
ATOM   1827  C  CB  . VAL A  1  258 ? 26.688  71.031  49.901  1.00 29.40  ? 286  VAL A CB  1 
ATOM   1828  C  CG1 . VAL A  1  258 ? 26.748  70.120  48.726  1.00 28.57  ? 286  VAL A CG1 1 
ATOM   1829  C  CG2 . VAL A  1  258 ? 27.914  70.804  50.761  1.00 30.14  ? 286  VAL A CG2 1 
ATOM   1830  N  N   . ASN A  1  259 ? 25.393  73.236  47.433  1.00 31.69  ? 287  ASN A N   1 
ATOM   1831  C  CA  . ASN A  1  259 ? 24.237  73.418  46.546  1.00 32.93  ? 287  ASN A CA  1 
ATOM   1832  C  C   . ASN A  1  259 ? 23.855  72.094  45.915  1.00 33.34  ? 287  ASN A C   1 
ATOM   1833  O  O   . ASN A  1  259 ? 24.596  71.550  45.101  1.00 34.01  ? 287  ASN A O   1 
ATOM   1834  C  CB  . ASN A  1  259 ? 24.521  74.447  45.450  1.00 33.57  ? 287  ASN A CB  1 
ATOM   1835  C  CG  . ASN A  1  259 ? 25.146  75.741  45.995  1.00 35.45  ? 287  ASN A CG  1 
ATOM   1836  O  OD1 . ASN A  1  259 ? 26.180  76.202  45.490  1.00 36.90  ? 287  ASN A OD1 1 
ATOM   1837  N  ND2 . ASN A  1  259 ? 24.533  76.316  47.035  1.00 36.40  ? 287  ASN A ND2 1 
ATOM   1838  N  N   . VAL A  1  260 ? 22.699  71.575  46.308  1.00 33.52  ? 288  VAL A N   1 
ATOM   1839  C  CA  . VAL A  1  260 ? 22.275  70.236  45.933  1.00 33.61  ? 288  VAL A CA  1 
ATOM   1840  C  C   . VAL A  1  260 ? 21.321  70.325  44.754  1.00 34.31  ? 288  VAL A C   1 
ATOM   1841  O  O   . VAL A  1  260 ? 20.242  70.908  44.880  1.00 34.46  ? 288  VAL A O   1 
ATOM   1842  C  CB  . VAL A  1  260 ? 21.541  69.547  47.097  1.00 33.40  ? 288  VAL A CB  1 
ATOM   1843  C  CG1 . VAL A  1  260 ? 21.030  68.192  46.684  1.00 32.96  ? 288  VAL A CG1 1 
ATOM   1844  C  CG2 . VAL A  1  260 ? 22.453  69.420  48.294  1.00 33.06  ? 288  VAL A CG2 1 
ATOM   1845  N  N   . VAL A  1  261 ? 21.721  69.763  43.610  1.00 34.55  ? 289  VAL A N   1 
ATOM   1846  C  CA  . VAL A  1  261 ? 20.833  69.658  42.459  1.00 34.73  ? 289  VAL A CA  1 
ATOM   1847  C  C   . VAL A  1  261 ? 19.892  68.488  42.739  1.00 35.24  ? 289  VAL A C   1 
ATOM   1848  O  O   . VAL A  1  261 ? 20.336  67.422  43.177  1.00 35.42  ? 289  VAL A O   1 
ATOM   1849  C  CB  . VAL A  1  261 ? 21.623  69.506  41.127  1.00 34.97  ? 289  VAL A CB  1 
ATOM   1850  C  CG1 . VAL A  1  261 ? 20.729  68.998  39.963  1.00 34.30  ? 289  VAL A CG1 1 
ATOM   1851  C  CG2 . VAL A  1  261 ? 22.302  70.839  40.755  1.00 34.70  ? 289  VAL A CG2 1 
ATOM   1852  N  N   . LEU A  1  262 ? 18.594  68.703  42.531  1.00 35.55  ? 290  LEU A N   1 
ATOM   1853  C  CA  . LEU A  1  262 ? 17.595  67.696  42.873  1.00 36.06  ? 290  LEU A CA  1 
ATOM   1854  C  C   . LEU A  1  262 ? 17.305  66.763  41.701  1.00 36.28  ? 290  LEU A C   1 
ATOM   1855  O  O   . LEU A  1  262 ? 16.663  67.157  40.725  1.00 36.58  ? 290  LEU A O   1 
ATOM   1856  C  CB  . LEU A  1  262 ? 16.308  68.352  43.390  1.00 36.01  ? 290  LEU A CB  1 
ATOM   1857  C  CG  . LEU A  1  262 ? 16.428  69.278  44.612  1.00 36.80  ? 290  LEU A CG  1 
ATOM   1858  C  CD1 . LEU A  1  262 ? 15.134  70.072  44.839  1.00 36.06  ? 290  LEU A CD1 1 
ATOM   1859  C  CD2 . LEU A  1  262 ? 16.824  68.494  45.879  1.00 35.74  ? 290  LEU A CD2 1 
ATOM   1860  N  N   . ILE A  1  263 ? 17.787  65.526  41.806  1.00 36.37  ? 291  ILE A N   1 
ATOM   1861  C  CA  . ILE A  1  263 ? 17.523  64.514  40.804  1.00 36.33  ? 291  ILE A CA  1 
ATOM   1862  C  C   . ILE A  1  263 ? 16.257  63.752  41.181  1.00 36.95  ? 291  ILE A C   1 
ATOM   1863  O  O   . ILE A  1  263 ? 16.234  63.094  42.215  1.00 36.91  ? 291  ILE A O   1 
ATOM   1864  C  CB  . ILE A  1  263 ? 18.690  63.526  40.686  1.00 36.16  ? 291  ILE A CB  1 
ATOM   1865  C  CG1 . ILE A  1  263 ? 20.019  64.282  40.515  1.00 35.56  ? 291  ILE A CG1 1 
ATOM   1866  C  CG2 . ILE A  1  263 ? 18.429  62.552  39.539  1.00 35.11  ? 291  ILE A CG2 1 
ATOM   1867  C  CD1 . ILE A  1  263 ? 21.267  63.503  40.987  1.00 34.17  ? 291  ILE A CD1 1 
ATOM   1868  N  N   . PRO A  1  264 ? 15.203  63.839  40.344  1.00 37.49  ? 292  PRO A N   1 
ATOM   1869  C  CA  . PRO A  1  264 ? 13.948  63.109  40.571  1.00 37.96  ? 292  PRO A CA  1 
ATOM   1870  C  C   . PRO A  1  264 ? 14.135  61.595  40.465  1.00 38.25  ? 292  PRO A C   1 
ATOM   1871  O  O   . PRO A  1  264 ? 15.006  61.142  39.742  1.00 38.26  ? 292  PRO A O   1 
ATOM   1872  C  CB  . PRO A  1  264 ? 13.036  63.619  39.447  1.00 37.59  ? 292  PRO A CB  1 
ATOM   1873  C  CG  . PRO A  1  264 ? 13.952  64.074  38.392  1.00 37.43  ? 292  PRO A CG  1 
ATOM   1874  C  CD  . PRO A  1  264 ? 15.141  64.643  39.110  1.00 37.66  ? 292  PRO A CD  1 
ATOM   1875  N  N   . ASP A  1  265 ? 13.328  60.831  41.195  1.00 39.09  ? 293  ASP A N   1 
ATOM   1876  C  CA  . ASP A  1  265 ? 13.470  59.378  41.229  1.00 39.82  ? 293  ASP A CA  1 
ATOM   1877  C  C   . ASP A  1  265 ? 12.320  58.643  40.537  1.00 40.62  ? 293  ASP A C   1 
ATOM   1878  O  O   . ASP A  1  265 ? 12.225  57.416  40.584  1.00 40.81  ? 293  ASP A O   1 
ATOM   1879  C  CB  . ASP A  1  265 ? 13.686  58.880  42.667  1.00 39.72  ? 293  ASP A CB  1 
ATOM   1880  C  CG  . ASP A  1  265 ? 12.427  58.945  43.535  1.00 39.49  ? 293  ASP A CG  1 
ATOM   1881  O  OD1 . ASP A  1  265 ? 11.454  59.650  43.187  1.00 39.94  ? 293  ASP A OD1 1 
ATOM   1882  O  OD2 . ASP A  1  265 ? 12.430  58.282  44.597  1.00 38.48  ? 293  ASP A OD2 1 
ATOM   1883  N  N   . ASN A  1  266 ? 11.448  59.403  39.894  1.00 41.64  ? 294  ASN A N   1 
ATOM   1884  C  CA  . ASN A  1  266 ? 10.438  58.824  39.041  1.00 42.85  ? 294  ASN A CA  1 
ATOM   1885  C  C   . ASN A  1  266 ? 10.196  59.695  37.814  1.00 41.94  ? 294  ASN A C   1 
ATOM   1886  O  O   . ASN A  1  266 ? 10.490  60.892  37.826  1.00 41.35  ? 294  ASN A O   1 
ATOM   1887  C  CB  . ASN A  1  266 ? 9.136   58.574  39.816  1.00 44.15  ? 294  ASN A CB  1 
ATOM   1888  C  CG  . ASN A  1  266 ? 8.328   57.401  39.242  1.00 49.12  ? 294  ASN A CG  1 
ATOM   1889  O  OD1 . ASN A  1  266 ? 8.855   56.594  38.453  1.00 49.96  ? 294  ASN A OD1 1 
ATOM   1890  N  ND2 . ASN A  1  266 ? 7.042   57.297  39.647  1.00 56.18  ? 294  ASN A ND2 1 
ATOM   1891  N  N   . GLY A  1  267 ? 9.667   59.069  36.763  1.00 41.45  ? 295  GLY A N   1 
ATOM   1892  C  CA  . GLY A  1  267 ? 9.309   59.741  35.515  1.00 40.99  ? 295  GLY A CA  1 
ATOM   1893  C  C   . GLY A  1  267 ? 8.637   58.787  34.544  1.00 40.90  ? 295  GLY A C   1 
ATOM   1894  O  O   . GLY A  1  267 ? 8.303   57.652  34.889  1.00 40.85  ? 295  GLY A O   1 
ATOM   1895  N  N   . THR A  1  268 ? 8.430   59.250  33.319  1.00 41.05  ? 296  THR A N   1 
ATOM   1896  C  CA  . THR A  1  268 ? 7.857   58.413  32.259  1.00 41.05  ? 296  THR A CA  1 
ATOM   1897  C  C   . THR A  1  268 ? 8.769   58.469  31.044  1.00 40.47  ? 296  THR A C   1 
ATOM   1898  O  O   . THR A  1  268 ? 9.544   59.416  30.903  1.00 40.34  ? 296  THR A O   1 
ATOM   1899  C  CB  . THR A  1  268 ? 6.450   58.908  31.822  1.00 41.55  ? 296  THR A CB  1 
ATOM   1900  O  OG1 . THR A  1  268 ? 6.577   60.159  31.132  1.00 42.32  ? 296  THR A OG1 1 
ATOM   1901  C  CG2 . THR A  1  268 ? 5.490   59.062  33.033  1.00 41.45  ? 296  THR A CG2 1 
ATOM   1902  N  N   . GLY A  1  269 ? 8.674   57.461  30.173  1.00 39.75  ? 297  GLY A N   1 
ATOM   1903  C  CA  . GLY A  1  269 ? 9.424   57.455  28.916  1.00 38.48  ? 297  GLY A CA  1 
ATOM   1904  C  C   . GLY A  1  269 ? 10.666  56.583  28.914  1.00 38.05  ? 297  GLY A C   1 
ATOM   1905  O  O   . GLY A  1  269 ? 10.902  55.807  29.842  1.00 38.11  ? 297  GLY A O   1 
ATOM   1906  N  N   . GLY A  1  270 ? 11.466  56.725  27.862  1.00 37.46  ? 298  GLY A N   1 
ATOM   1907  C  CA  . GLY A  1  270 ? 12.656  55.910  27.655  1.00 36.82  ? 298  GLY A CA  1 
ATOM   1908  C  C   . GLY A  1  270 ? 13.705  55.891  28.760  1.00 36.47  ? 298  GLY A C   1 
ATOM   1909  O  O   . GLY A  1  270 ? 14.367  54.861  28.981  1.00 36.41  ? 298  GLY A O   1 
ATOM   1910  N  N   . SER A  1  271 ? 13.878  57.006  29.466  1.00 35.71  ? 299  SER A N   1 
ATOM   1911  C  CA  . SER A  1  271 ? 14.874  57.004  30.523  1.00 35.01  ? 299  SER A CA  1 
ATOM   1912  C  C   . SER A  1  271 ? 14.321  56.463  31.833  1.00 34.39  ? 299  SER A C   1 
ATOM   1913  O  O   . SER A  1  271 ? 15.008  56.508  32.844  1.00 34.07  ? 299  SER A O   1 
ATOM   1914  C  CB  . SER A  1  271 ? 15.544  58.376  30.694  1.00 35.00  ? 299  SER A CB  1 
ATOM   1915  O  OG  . SER A  1  271 ? 14.599  59.388  30.917  1.00 35.80  ? 299  SER A OG  1 
ATOM   1916  N  N   . TRP A  1  272 ? 13.096  55.926  31.811  1.00 33.87  ? 300  TRP A N   1 
ATOM   1917  C  CA  . TRP A  1  272 ? 12.436  55.442  33.047  1.00 33.40  ? 300  TRP A CA  1 
ATOM   1918  C  C   . TRP A  1  272 ? 11.817  54.057  32.947  1.00 33.66  ? 300  TRP A C   1 
ATOM   1919  O  O   . TRP A  1  272 ? 11.592  53.400  33.971  1.00 33.07  ? 300  TRP A O   1 
ATOM   1920  C  CB  . TRP A  1  272 ? 11.376  56.435  33.542  1.00 32.65  ? 300  TRP A CB  1 
ATOM   1921  C  CG  . TRP A  1  272 ? 11.960  57.723  33.954  1.00 31.70  ? 300  TRP A CG  1 
ATOM   1922  C  CD1 . TRP A  1  272 ? 12.074  58.843  33.195  1.00 31.26  ? 300  TRP A CD1 1 
ATOM   1923  C  CD2 . TRP A  1  272 ? 12.547  58.031  35.221  1.00 30.85  ? 300  TRP A CD2 1 
ATOM   1924  N  NE1 . TRP A  1  272 ? 12.679  59.849  33.915  1.00 31.22  ? 300  TRP A NE1 1 
ATOM   1925  C  CE2 . TRP A  1  272 ? 12.988  59.377  35.161  1.00 30.73  ? 300  TRP A CE2 1 
ATOM   1926  C  CE3 . TRP A  1  272 ? 12.735  57.307  36.404  1.00 29.42  ? 300  TRP A CE3 1 
ATOM   1927  C  CZ2 . TRP A  1  272 ? 13.616  60.012  36.232  1.00 30.67  ? 300  TRP A CZ2 1 
ATOM   1928  C  CZ3 . TRP A  1  272 ? 13.364  57.934  37.468  1.00 30.92  ? 300  TRP A CZ3 1 
ATOM   1929  C  CH2 . TRP A  1  272 ? 13.795  59.278  37.375  1.00 31.39  ? 300  TRP A CH2 1 
ATOM   1930  N  N   . SER A  1  273 ? 11.515  53.629  31.726  1.00 34.12  ? 301  SER A N   1 
ATOM   1931  C  CA  . SER A  1  273 ? 11.017  52.279  31.517  1.00 35.04  ? 301  SER A CA  1 
ATOM   1932  C  C   . SER A  1  273 ? 11.380  51.774  30.132  1.00 35.26  ? 301  SER A C   1 
ATOM   1933  O  O   . SER A  1  273 ? 11.925  52.528  29.320  1.00 35.31  ? 301  SER A O   1 
ATOM   1934  C  CB  . SER A  1  273 ? 9.499   52.179  31.789  1.00 35.13  ? 301  SER A CB  1 
ATOM   1935  O  OG  . SER A  1  273 ? 8.740   52.482  30.642  1.00 35.68  ? 301  SER A OG  1 
ATOM   1936  N  N   . LEU A  1  274 ? 11.083  50.495  29.896  1.00 35.42  ? 302  LEU A N   1 
ATOM   1937  C  CA  . LEU A  1  274 ? 11.345  49.814  28.637  1.00 35.92  ? 302  LEU A CA  1 
ATOM   1938  C  C   . LEU A  1  274 ? 10.054  49.423  27.925  1.00 36.50  ? 302  LEU A C   1 
ATOM   1939  O  O   . LEU A  1  274 ? 10.087  48.852  26.823  1.00 36.82  ? 302  LEU A O   1 
ATOM   1940  C  CB  . LEU A  1  274 ? 12.135  48.533  28.896  1.00 35.76  ? 302  LEU A CB  1 
ATOM   1941  C  CG  . LEU A  1  274 ? 13.642  48.547  29.028  1.00 35.45  ? 302  LEU A CG  1 
ATOM   1942  C  CD1 . LEU A  1  274 ? 14.069  47.201  29.532  1.00 35.05  ? 302  LEU A CD1 1 
ATOM   1943  C  CD2 . LEU A  1  274 ? 14.303  48.854  27.696  1.00 35.11  ? 302  LEU A CD2 1 
ATOM   1944  N  N   . LYS A  1  275 ? 8.924   49.714  28.560  1.00 36.82  ? 303  LYS A N   1 
ATOM   1945  C  CA  . LYS A  1  275 ? 7.627   49.294  28.056  1.00 37.32  ? 303  LYS A CA  1 
ATOM   1946  C  C   . LYS A  1  275 ? 7.082   50.302  27.057  1.00 37.22  ? 303  LYS A C   1 
ATOM   1947  O  O   . LYS A  1  275 ? 6.946   51.486  27.369  1.00 37.59  ? 303  LYS A O   1 
ATOM   1948  C  CB  . LYS A  1  275 ? 6.640   49.107  29.213  1.00 37.50  ? 303  LYS A CB  1 
ATOM   1949  C  CG  . LYS A  1  275 ? 5.441   48.289  28.838  1.00 38.63  ? 303  LYS A CG  1 
ATOM   1950  C  CD  . LYS A  1  275 ? 4.279   48.524  29.790  1.00 41.78  ? 303  LYS A CD  1 
ATOM   1951  C  CE  . LYS A  1  275 ? 2.940   48.241  29.097  1.00 43.03  ? 303  LYS A CE  1 
ATOM   1952  N  NZ  . LYS A  1  275 ? 2.944   47.023  28.198  1.00 43.13  ? 303  LYS A NZ  1 
ATOM   1953  N  N   . SER A  1  276 ? 6.774   49.829  25.855  1.00 37.33  ? 304  SER A N   1 
ATOM   1954  C  CA  . SER A  1  276 ? 6.259   50.703  24.804  1.00 37.13  ? 304  SER A CA  1 
ATOM   1955  C  C   . SER A  1  276 ? 4.865   51.174  25.172  1.00 37.54  ? 304  SER A C   1 
ATOM   1956  O  O   . SER A  1  276 ? 4.027   50.367  25.541  1.00 37.61  ? 304  SER A O   1 
ATOM   1957  C  CB  . SER A  1  276 ? 6.239   49.994  23.446  1.00 36.52  ? 304  SER A CB  1 
ATOM   1958  O  OG  . SER A  1  276 ? 5.586   50.789  22.472  1.00 34.59  ? 304  SER A OG  1 
ATOM   1959  N  N   . PRO A  1  277 ? 4.618   52.491  25.088  1.00 38.11  ? 305  PRO A N   1 
ATOM   1960  C  CA  . PRO A  1  277 ? 3.262   52.992  25.299  1.00 38.39  ? 305  PRO A CA  1 
ATOM   1961  C  C   . PRO A  1  277 ? 2.361   52.736  24.085  1.00 38.84  ? 305  PRO A C   1 
ATOM   1962  O  O   . PRO A  1  277 ? 1.188   53.132  24.092  1.00 38.96  ? 305  PRO A O   1 
ATOM   1963  C  CB  . PRO A  1  277 ? 3.480   54.493  25.506  1.00 38.25  ? 305  PRO A CB  1 
ATOM   1964  C  CG  . PRO A  1  277 ? 4.700   54.800  24.708  1.00 37.98  ? 305  PRO A CG  1 
ATOM   1965  C  CD  . PRO A  1  277 ? 5.579   53.581  24.818  1.00 38.09  ? 305  PRO A CD  1 
ATOM   1966  N  N   . VAL A  1  278 ? 2.903   52.072  23.062  1.00 39.01  ? 306  VAL A N   1 
ATOM   1967  C  CA  . VAL A  1  278 ? 2.167   51.825  21.820  1.00 39.15  ? 306  VAL A CA  1 
ATOM   1968  C  C   . VAL A  1  278 ? 1.660   50.377  21.760  1.00 39.26  ? 306  VAL A C   1 
ATOM   1969  O  O   . VAL A  1  278 ? 2.449   49.436  21.902  1.00 39.31  ? 306  VAL A O   1 
ATOM   1970  C  CB  . VAL A  1  278 ? 3.033   52.173  20.571  1.00 39.10  ? 306  VAL A CB  1 
ATOM   1971  C  CG1 . VAL A  1  278 ? 2.309   51.832  19.262  1.00 39.15  ? 306  VAL A CG1 1 
ATOM   1972  C  CG2 . VAL A  1  278 ? 3.427   53.653  20.585  1.00 39.42  ? 306  VAL A CG2 1 
ATOM   1973  N  N   . PRO A  1  279 ? 0.340   50.195  21.553  1.00 39.27  ? 307  PRO A N   1 
ATOM   1974  C  CA  . PRO A  1  279 ? -0.232  48.847  21.404  1.00 39.13  ? 307  PRO A CA  1 
ATOM   1975  C  C   . PRO A  1  279 ? 0.355   48.102  20.203  1.00 38.99  ? 307  PRO A C   1 
ATOM   1976  O  O   . PRO A  1  279 ? 0.729   48.728  19.198  1.00 38.76  ? 307  PRO A O   1 
ATOM   1977  C  CB  . PRO A  1  279 ? -1.728  49.110  21.159  1.00 39.23  ? 307  PRO A CB  1 
ATOM   1978  C  CG  . PRO A  1  279 ? -1.808  50.542  20.680  1.00 39.70  ? 307  PRO A CG  1 
ATOM   1979  C  CD  . PRO A  1  279 ? -0.689  51.245  21.430  1.00 39.42  ? 307  PRO A CD  1 
ATOM   1980  N  N   . PRO A  1  280 ? 0.457   46.767  20.314  1.00 38.72  ? 308  PRO A N   1 
ATOM   1981  C  CA  . PRO A  1  280 ? 0.834   45.954  19.165  1.00 38.40  ? 308  PRO A CA  1 
ATOM   1982  C  C   . PRO A  1  280 ? -0.112  46.154  17.976  1.00 38.34  ? 308  PRO A C   1 
ATOM   1983  O  O   . PRO A  1  280 ? -1.323  46.340  18.166  1.00 38.36  ? 308  PRO A O   1 
ATOM   1984  C  CB  . PRO A  1  280 ? 0.746   44.513  19.690  1.00 38.33  ? 308  PRO A CB  1 
ATOM   1985  C  CG  . PRO A  1  280 ? 0.078   44.598  21.032  1.00 38.38  ? 308  PRO A CG  1 
ATOM   1986  C  CD  . PRO A  1  280 ? 0.266   45.970  21.542  1.00 38.52  ? 308  PRO A CD  1 
ATOM   1987  N  N   . GLY A  1  281 ? 0.459   46.151  16.771  1.00 38.06  ? 309  GLY A N   1 
ATOM   1988  C  CA  . GLY A  1  281 ? -0.307  46.130  15.525  1.00 37.57  ? 309  GLY A CA  1 
ATOM   1989  C  C   . GLY A  1  281 ? -0.063  44.807  14.814  1.00 37.28  ? 309  GLY A C   1 
ATOM   1990  O  O   . GLY A  1  281 ? 0.174   43.790  15.471  1.00 37.22  ? 309  GLY A O   1 
ATOM   1991  N  N   . PRO A  1  282 ? -0.100  44.809  13.472  1.00 37.00  ? 310  PRO A N   1 
ATOM   1992  C  CA  . PRO A  1  282 ? 0.078   43.583  12.683  1.00 36.95  ? 310  PRO A CA  1 
ATOM   1993  C  C   . PRO A  1  282 ? 1.370   42.841  13.033  1.00 36.71  ? 310  PRO A C   1 
ATOM   1994  O  O   . PRO A  1  282 ? 2.383   43.471  13.323  1.00 36.86  ? 310  PRO A O   1 
ATOM   1995  C  CB  . PRO A  1  282 ? 0.113   44.096  11.241  1.00 36.87  ? 310  PRO A CB  1 
ATOM   1996  C  CG  . PRO A  1  282 ? -0.682  45.354  11.279  1.00 37.19  ? 310  PRO A CG  1 
ATOM   1997  C  CD  . PRO A  1  282 ? -0.336  45.980  12.612  1.00 37.30  ? 310  PRO A CD  1 
ATOM   1998  N  N   . ALA A  1  283 ? 1.326   41.514  13.027  1.00 36.35  ? 311  ALA A N   1 
ATOM   1999  C  CA  . ALA A  1  283 ? 2.468   40.723  13.468  1.00 36.44  ? 311  ALA A CA  1 
ATOM   2000  C  C   . ALA A  1  283 ? 3.687   40.899  12.551  1.00 36.59  ? 311  ALA A C   1 
ATOM   2001  O  O   . ALA A  1  283 ? 3.543   40.958  11.331  1.00 36.28  ? 311  ALA A O   1 
ATOM   2002  C  CB  . ALA A  1  283 ? 2.085   39.260  13.580  1.00 36.37  ? 311  ALA A CB  1 
ATOM   2003  N  N   . PRO A  1  284 ? 4.892   40.986  13.142  1.00 36.86  ? 312  PRO A N   1 
ATOM   2004  C  CA  . PRO A  1  284 ? 6.088   41.091  12.320  1.00 37.06  ? 312  PRO A CA  1 
ATOM   2005  C  C   . PRO A  1  284 ? 6.355   39.760  11.629  1.00 37.41  ? 312  PRO A C   1 
ATOM   2006  O  O   . PRO A  1  284 ? 5.832   38.730  12.078  1.00 37.51  ? 312  PRO A O   1 
ATOM   2007  C  CB  . PRO A  1  284 ? 7.189   41.423  13.332  1.00 37.02  ? 312  PRO A CB  1 
ATOM   2008  C  CG  . PRO A  1  284 ? 6.692   40.918  14.632  1.00 37.15  ? 312  PRO A CG  1 
ATOM   2009  C  CD  . PRO A  1  284 ? 5.201   40.979  14.585  1.00 36.91  ? 312  PRO A CD  1 
ATOM   2010  N  N   . PRO A  1  285 ? 7.147   39.775  10.535  1.00 37.59  ? 313  PRO A N   1 
ATOM   2011  C  CA  . PRO A  1  285 ? 7.407   38.552  9.770   1.00 37.76  ? 313  PRO A CA  1 
ATOM   2012  C  C   . PRO A  1  285 ? 8.061   37.456  10.607  1.00 38.02  ? 313  PRO A C   1 
ATOM   2013  O  O   . PRO A  1  285 ? 8.831   37.755  11.518  1.00 37.85  ? 313  PRO A O   1 
ATOM   2014  C  CB  . PRO A  1  285 ? 8.347   39.018  8.648   1.00 37.53  ? 313  PRO A CB  1 
ATOM   2015  C  CG  . PRO A  1  285 ? 8.875   40.320  9.092   1.00 37.32  ? 313  PRO A CG  1 
ATOM   2016  C  CD  . PRO A  1  285 ? 7.831   40.940  9.948   1.00 37.50  ? 313  PRO A CD  1 
ATOM   2017  N  N   . LEU A  1  286 ? 7.751   36.202  10.272  1.00 38.37  ? 314  LEU A N   1 
ATOM   2018  C  CA  . LEU A  1  286 ? 8.166   35.040  11.042  1.00 38.95  ? 314  LEU A CA  1 
ATOM   2019  C  C   . LEU A  1  286 ? 8.694   33.927  10.134  1.00 39.29  ? 314  LEU A C   1 
ATOM   2020  O  O   . LEU A  1  286 ? 8.097   33.607  9.105   1.00 39.39  ? 314  LEU A O   1 
ATOM   2021  C  CB  . LEU A  1  286 ? 6.989   34.541  11.886  1.00 38.86  ? 314  LEU A CB  1 
ATOM   2022  C  CG  . LEU A  1  286 ? 7.037   33.168  12.564  1.00 39.53  ? 314  LEU A CG  1 
ATOM   2023  C  CD1 . LEU A  1  286 ? 8.135   33.082  13.619  1.00 39.55  ? 314  LEU A CD1 1 
ATOM   2024  C  CD2 . LEU A  1  286 ? 5.669   32.832  13.179  1.00 39.71  ? 314  LEU A CD2 1 
ATOM   2025  N  N   . GLN A  1  287 ? 9.823   33.346  10.526  1.00 39.71  ? 315  GLN A N   1 
ATOM   2026  C  CA  . GLN A  1  287 ? 10.457  32.294  9.752   1.00 39.88  ? 315  GLN A CA  1 
ATOM   2027  C  C   . GLN A  1  287 ? 10.064  30.919  10.287  1.00 39.86  ? 315  GLN A C   1 
ATOM   2028  O  O   . GLN A  1  287 ? 10.057  30.701  11.499  1.00 40.09  ? 315  GLN A O   1 
ATOM   2029  C  CB  . GLN A  1  287 ? 11.973  32.474  9.811   1.00 40.19  ? 315  GLN A CB  1 
ATOM   2030  C  CG  . GLN A  1  287 ? 12.718  31.980  8.577   1.00 40.81  ? 315  GLN A CG  1 
ATOM   2031  C  CD  . GLN A  1  287 ? 14.055  32.703  8.365   1.00 40.69  ? 315  GLN A CD  1 
ATOM   2032  O  OE1 . GLN A  1  287 ? 14.108  33.820  7.841   1.00 39.90  ? 315  GLN A OE1 1 
ATOM   2033  N  NE2 . GLN A  1  287 ? 15.135  32.055  8.768   1.00 40.59  ? 315  GLN A NE2 1 
ATOM   2034  N  N   . PHE A  1  288 ? 9.729   29.996  9.388   1.00 39.48  ? 316  PHE A N   1 
ATOM   2035  C  CA  . PHE A  1  288 ? 9.461   28.610  9.783   1.00 39.24  ? 316  PHE A CA  1 
ATOM   2036  C  C   . PHE A  1  288 ? 10.125  27.602  8.839   1.00 39.34  ? 316  PHE A C   1 
ATOM   2037  O  O   . PHE A  1  288 ? 10.518  27.941  7.716   1.00 39.19  ? 316  PHE A O   1 
ATOM   2038  C  CB  . PHE A  1  288 ? 7.950   28.346  9.899   1.00 39.13  ? 316  PHE A CB  1 
ATOM   2039  C  CG  . PHE A  1  288 ? 7.261   28.173  8.582   1.00 38.28  ? 316  PHE A CG  1 
ATOM   2040  C  CD1 . PHE A  1  288 ? 6.841   26.914  8.170   1.00 37.90  ? 316  PHE A CD1 1 
ATOM   2041  C  CD2 . PHE A  1  288 ? 7.032   29.268  7.749   1.00 38.33  ? 316  PHE A CD2 1 
ATOM   2042  C  CE1 . PHE A  1  288 ? 6.195   26.739  6.940   1.00 38.37  ? 316  PHE A CE1 1 
ATOM   2043  C  CE2 . PHE A  1  288 ? 6.392   29.110  6.515   1.00 39.20  ? 316  PHE A CE2 1 
ATOM   2044  C  CZ  . PHE A  1  288 ? 5.969   27.833  6.109   1.00 38.83  ? 316  PHE A CZ  1 
ATOM   2045  N  N   . TYR A  1  289 ? 10.252  26.368  9.315   1.00 39.47  ? 317  TYR A N   1 
ATOM   2046  C  CA  . TYR A  1  289 ? 10.807  25.282  8.525   1.00 39.73  ? 317  TYR A CA  1 
ATOM   2047  C  C   . TYR A  1  289 ? 9.694   24.421  7.900   1.00 39.93  ? 317  TYR A C   1 
ATOM   2048  O  O   . TYR A  1  289 ? 9.111   23.576  8.583   1.00 40.11  ? 317  TYR A O   1 
ATOM   2049  C  CB  . TYR A  1  289 ? 11.707  24.412  9.392   1.00 39.86  ? 317  TYR A CB  1 
ATOM   2050  C  CG  . TYR A  1  289 ? 12.782  25.143  10.179  1.00 41.47  ? 317  TYR A CG  1 
ATOM   2051  C  CD1 . TYR A  1  289 ? 13.591  26.120  9.581   1.00 42.21  ? 317  TYR A CD1 1 
ATOM   2052  C  CD2 . TYR A  1  289 ? 13.017  24.831  11.522  1.00 42.47  ? 317  TYR A CD2 1 
ATOM   2053  C  CE1 . TYR A  1  289 ? 14.588  26.781  10.310  1.00 42.10  ? 317  TYR A CE1 1 
ATOM   2054  C  CE2 . TYR A  1  289 ? 14.012  25.479  12.253  1.00 42.98  ? 317  TYR A CE2 1 
ATOM   2055  C  CZ  . TYR A  1  289 ? 14.794  26.448  11.638  1.00 42.18  ? 317  TYR A CZ  1 
ATOM   2056  O  OH  . TYR A  1  289 ? 15.776  27.071  12.364  1.00 42.13  ? 317  TYR A OH  1 
ATOM   2057  N  N   . PRO A  1  290 ? 9.409   24.617  6.594   1.00 39.95  ? 318  PRO A N   1 
ATOM   2058  C  CA  . PRO A  1  290 ? 8.317   23.935  5.901   1.00 40.04  ? 318  PRO A CA  1 
ATOM   2059  C  C   . PRO A  1  290 ? 8.279   22.420  6.088   1.00 40.35  ? 318  PRO A C   1 
ATOM   2060  O  O   . PRO A  1  290 ? 7.198   21.855  6.158   1.00 40.83  ? 318  PRO A O   1 
ATOM   2061  C  CB  . PRO A  1  290 ? 8.571   24.279  4.436   1.00 39.95  ? 318  PRO A CB  1 
ATOM   2062  C  CG  . PRO A  1  290 ? 9.255   25.580  4.482   1.00 39.86  ? 318  PRO A CG  1 
ATOM   2063  C  CD  . PRO A  1  290 ? 10.142  25.517  5.684   1.00 40.08  ? 318  PRO A CD  1 
ATOM   2064  N  N   . GLN A  1  291 ? 9.436   21.769  6.169   1.00 40.64  ? 319  GLN A N   1 
ATOM   2065  C  CA  . GLN A  1  291 ? 9.490   20.325  6.405   1.00 40.87  ? 319  GLN A CA  1 
ATOM   2066  C  C   . GLN A  1  291 ? 10.340  19.995  7.625   1.00 40.84  ? 319  GLN A C   1 
ATOM   2067  O  O   . GLN A  1  291 ? 11.096  19.024  7.606   1.00 41.24  ? 319  GLN A O   1 
ATOM   2068  C  CB  . GLN A  1  291 ? 10.061  19.585  5.194   1.00 40.83  ? 319  GLN A CB  1 
ATOM   2069  C  CG  . GLN A  1  291 ? 9.255   19.708  3.930   1.00 42.32  ? 319  GLN A CG  1 
ATOM   2070  C  CD  . GLN A  1  291 ? 10.066  19.325  2.709   1.00 44.29  ? 319  GLN A CD  1 
ATOM   2071  O  OE1 . GLN A  1  291 ? 10.503  18.181  2.575   1.00 45.44  ? 319  GLN A OE1 1 
ATOM   2072  N  NE2 . GLN A  1  291 ? 10.273  20.281  1.810   1.00 44.10  ? 319  GLN A NE2 1 
ATOM   2073  N  N   . GLY A  1  292 ? 10.227  20.800  8.678   1.00 40.70  ? 320  GLY A N   1 
ATOM   2074  C  CA  . GLY A  1  292 ? 10.964  20.546  9.915   1.00 40.64  ? 320  GLY A CA  1 
ATOM   2075  C  C   . GLY A  1  292 ? 12.395  21.056  9.853   1.00 40.85  ? 320  GLY A C   1 
ATOM   2076  O  O   . GLY A  1  292 ? 12.877  21.433  8.779   1.00 40.91  ? 320  GLY A O   1 
ATOM   2077  N  N   . PRO A  1  293 ? 13.082  21.096  11.009  1.00 40.89  ? 321  PRO A N   1 
ATOM   2078  C  CA  . PRO A  1  293 ? 14.467  21.570  11.040  1.00 40.65  ? 321  PRO A CA  1 
ATOM   2079  C  C   . PRO A  1  293 ? 15.403  20.705  10.210  1.00 40.31  ? 321  PRO A C   1 
ATOM   2080  O  O   . PRO A  1  293 ? 15.091  19.558  9.921   1.00 40.24  ? 321  PRO A O   1 
ATOM   2081  C  CB  . PRO A  1  293 ? 14.838  21.534  12.531  1.00 41.01  ? 321  PRO A CB  1 
ATOM   2082  C  CG  . PRO A  1  293 ? 13.800  20.686  13.201  1.00 41.06  ? 321  PRO A CG  1 
ATOM   2083  C  CD  . PRO A  1  293 ? 12.570  20.739  12.349  1.00 41.20  ? 321  PRO A CD  1 
ATOM   2084  N  N   . ARG A  1  294 ? 16.536  21.280  9.817   1.00 40.19  ? 322  ARG A N   1 
ATOM   2085  C  CA  . ARG A  1  294 ? 17.488  20.626  8.915   1.00 39.57  ? 322  ARG A CA  1 
ATOM   2086  C  C   . ARG A  1  294 ? 18.844  20.386  9.586   1.00 39.25  ? 322  ARG A C   1 
ATOM   2087  O  O   . ARG A  1  294 ? 19.844  20.129  8.922   1.00 39.45  ? 322  ARG A O   1 
ATOM   2088  C  CB  . ARG A  1  294 ? 17.648  21.473  7.653   1.00 39.54  ? 322  ARG A CB  1 
ATOM   2089  C  CG  . ARG A  1  294 ? 16.636  21.164  6.578   1.00 39.08  ? 322  ARG A CG  1 
ATOM   2090  C  CD  . ARG A  1  294 ? 16.176  22.375  5.767   1.00 38.76  ? 322  ARG A CD  1 
ATOM   2091  N  NE  . ARG A  1  294 ? 17.160  23.450  5.616   1.00 37.80  ? 322  ARG A NE  1 
ATOM   2092  C  CZ  . ARG A  1  294 ? 17.754  23.808  4.477   1.00 36.17  ? 322  ARG A CZ  1 
ATOM   2093  N  NH1 . ARG A  1  294 ? 17.493  23.173  3.335   1.00 33.21  ? 322  ARG A NH1 1 
ATOM   2094  N  NH2 . ARG A  1  294 ? 18.617  24.821  4.490   1.00 34.61  ? 322  ARG A NH2 1 
ATOM   2095  N  N   . PHE A  1  295 ? 18.862  20.477  10.910  1.00 38.81  ? 323  PHE A N   1 
ATOM   2096  C  CA  . PHE A  1  295 ? 20.056  20.240  11.707  1.00 38.25  ? 323  PHE A CA  1 
ATOM   2097  C  C   . PHE A  1  295 ? 19.642  19.594  13.030  1.00 38.26  ? 323  PHE A C   1 
ATOM   2098  O  O   . PHE A  1  295 ? 18.537  19.828  13.515  1.00 38.06  ? 323  PHE A O   1 
ATOM   2099  C  CB  . PHE A  1  295 ? 20.793  21.561  11.966  1.00 37.59  ? 323  PHE A CB  1 
ATOM   2100  C  CG  . PHE A  1  295 ? 20.010  22.541  12.800  1.00 36.93  ? 323  PHE A CG  1 
ATOM   2101  C  CD1 . PHE A  1  295 ? 20.122  22.544  14.189  1.00 37.43  ? 323  PHE A CD1 1 
ATOM   2102  C  CD2 . PHE A  1  295 ? 19.155  23.460  12.201  1.00 36.54  ? 323  PHE A CD2 1 
ATOM   2103  C  CE1 . PHE A  1  295 ? 19.393  23.443  14.967  1.00 36.43  ? 323  PHE A CE1 1 
ATOM   2104  C  CE2 . PHE A  1  295 ? 18.429  24.365  12.967  1.00 35.37  ? 323  PHE A CE2 1 
ATOM   2105  C  CZ  . PHE A  1  295 ? 18.552  24.355  14.352  1.00 36.63  ? 323  PHE A CZ  1 
ATOM   2106  N  N   . SER A  1  296 ? 20.519  18.790  13.619  1.00 38.42  ? 324  SER A N   1 
ATOM   2107  C  CA  . SER A  1  296 ? 20.238  18.226  14.935  1.00 38.67  ? 324  SER A CA  1 
ATOM   2108  C  C   . SER A  1  296 ? 21.185  18.807  15.978  1.00 38.91  ? 324  SER A C   1 
ATOM   2109  O  O   . SER A  1  296 ? 22.311  19.196  15.663  1.00 39.15  ? 324  SER A O   1 
ATOM   2110  C  CB  . SER A  1  296 ? 20.364  16.703  14.907  1.00 38.44  ? 324  SER A CB  1 
ATOM   2111  O  OG  . SER A  1  296 ? 21.683  16.334  14.560  1.00 38.27  ? 324  SER A OG  1 
ATOM   2112  N  N   . VAL A  1  297 ? 20.713  18.870  17.217  1.00 39.31  ? 325  VAL A N   1 
ATOM   2113  C  CA  . VAL A  1  297 ? 21.524  19.292  18.351  1.00 39.68  ? 325  VAL A CA  1 
ATOM   2114  C  C   . VAL A  1  297 ? 21.534  18.139  19.342  1.00 40.18  ? 325  VAL A C   1 
ATOM   2115  O  O   . VAL A  1  297 ? 20.491  17.763  19.873  1.00 40.50  ? 325  VAL A O   1 
ATOM   2116  C  CB  . VAL A  1  297 ? 20.969  20.579  19.011  1.00 39.60  ? 325  VAL A CB  1 
ATOM   2117  C  CG1 . VAL A  1  297 ? 21.945  21.103  20.047  1.00 39.52  ? 325  VAL A CG1 1 
ATOM   2118  C  CG2 . VAL A  1  297 ? 20.705  21.664  17.958  1.00 39.07  ? 325  VAL A CG2 1 
ATOM   2119  N  N   . GLN A  1  298 ? 22.700  17.543  19.561  1.00 40.61  ? 326  GLN A N   1 
ATOM   2120  C  CA  . GLN A  1  298 ? 22.782  16.381  20.446  1.00 41.01  ? 326  GLN A CA  1 
ATOM   2121  C  C   . GLN A  1  298 ? 23.873  16.613  21.473  1.00 40.89  ? 326  GLN A C   1 
ATOM   2122  O  O   . GLN A  1  298 ? 25.064  16.565  21.145  1.00 40.92  ? 326  GLN A O   1 
ATOM   2123  C  CB  . GLN A  1  298 ? 23.029  15.088  19.658  1.00 41.35  ? 326  GLN A CB  1 
ATOM   2124  C  CG  . GLN A  1  298 ? 21.992  14.806  18.562  1.00 43.53  ? 326  GLN A CG  1 
ATOM   2125  C  CD  . GLN A  1  298 ? 21.788  13.314  18.284  1.00 46.38  ? 326  GLN A CD  1 
ATOM   2126  O  OE1 . GLN A  1  298 ? 22.444  12.729  17.415  1.00 47.57  ? 326  GLN A OE1 1 
ATOM   2127  N  NE2 . GLN A  1  298 ? 20.852  12.703  19.009  1.00 46.84  ? 326  GLN A NE2 1 
ATOM   2128  N  N   . GLY A  1  299 ? 23.462  16.871  22.714  1.00 40.64  ? 327  GLY A N   1 
ATOM   2129  C  CA  . GLY A  1  299 ? 24.397  17.222  23.772  1.00 40.49  ? 327  GLY A CA  1 
ATOM   2130  C  C   . GLY A  1  299 ? 24.996  18.575  23.442  1.00 40.65  ? 327  GLY A C   1 
ATOM   2131  O  O   . GLY A  1  299 ? 24.283  19.588  23.414  1.00 40.83  ? 327  GLY A O   1 
ATOM   2132  N  N   . SER A  1  300 ? 26.298  18.588  23.168  1.00 40.25  ? 328  SER A N   1 
ATOM   2133  C  CA  . SER A  1  300 ? 26.995  19.813  22.763  1.00 39.95  ? 328  SER A CA  1 
ATOM   2134  C  C   . SER A  1  300 ? 27.321  19.843  21.265  1.00 39.55  ? 328  SER A C   1 
ATOM   2135  O  O   . SER A  1  300 ? 27.880  20.821  20.780  1.00 39.35  ? 328  SER A O   1 
ATOM   2136  C  CB  . SER A  1  300 ? 28.279  20.010  23.587  1.00 40.01  ? 328  SER A CB  1 
ATOM   2137  O  OG  . SER A  1  300 ? 27.997  20.072  24.980  1.00 40.22  ? 328  SER A OG  1 
ATOM   2138  N  N   . ARG A  1  301 ? 26.967  18.782  20.541  1.00 39.12  ? 329  ARG A N   1 
ATOM   2139  C  CA  . ARG A  1  301 ? 27.292  18.677  19.116  1.00 39.48  ? 329  ARG A CA  1 
ATOM   2140  C  C   . ARG A  1  301 ? 26.133  19.095  18.214  1.00 38.99  ? 329  ARG A C   1 
ATOM   2141  O  O   . ARG A  1  301 ? 24.987  18.694  18.443  1.00 39.32  ? 329  ARG A O   1 
ATOM   2142  C  CB  . ARG A  1  301 ? 27.790  17.268  18.752  1.00 39.28  ? 329  ARG A CB  1 
ATOM   2143  C  CG  . ARG A  1  301 ? 29.122  16.881  19.432  1.00 40.75  ? 329  ARG A CG  1 
ATOM   2144  C  CD  . ARG A  1  301 ? 29.819  15.672  18.799  1.00 40.81  ? 329  ARG A CD  1 
ATOM   2145  N  NE  . ARG A  1  301 ? 30.343  15.973  17.462  1.00 46.03  ? 329  ARG A NE  1 
ATOM   2146  C  CZ  . ARG A  1  301 ? 31.568  16.439  17.196  1.00 47.86  ? 329  ARG A CZ  1 
ATOM   2147  N  NH1 . ARG A  1  301 ? 32.445  16.671  18.175  1.00 48.63  ? 329  ARG A NH1 1 
ATOM   2148  N  NH2 . ARG A  1  301 ? 31.925  16.670  15.936  1.00 48.54  ? 329  ARG A NH2 1 
ATOM   2149  N  N   . VAL A  1  302 ? 26.439  19.920  17.207  1.00 38.42  ? 330  VAL A N   1 
ATOM   2150  C  CA  . VAL A  1  302 ? 25.496  20.257  16.135  1.00 37.58  ? 330  VAL A CA  1 
ATOM   2151  C  C   . VAL A  1  302 ? 25.922  19.542  14.863  1.00 37.30  ? 330  VAL A C   1 
ATOM   2152  O  O   . VAL A  1  302 ? 27.119  19.344  14.639  1.00 37.45  ? 330  VAL A O   1 
ATOM   2153  C  CB  . VAL A  1  302 ? 25.448  21.772  15.854  1.00 37.42  ? 330  VAL A CB  1 
ATOM   2154  C  CG1 . VAL A  1  302 ? 24.681  22.068  14.575  1.00 37.33  ? 330  VAL A CG1 1 
ATOM   2155  C  CG2 . VAL A  1  302 ? 24.810  22.508  17.003  1.00 37.29  ? 330  VAL A CG2 1 
ATOM   2156  N  N   . ALA A  1  303 ? 24.947  19.137  14.046  1.00 36.59  ? 331  ALA A N   1 
ATOM   2157  C  CA  . ALA A  1  303 ? 25.228  18.639  12.689  1.00 35.94  ? 331  ALA A CA  1 
ATOM   2158  C  C   . ALA A  1  303 ? 24.139  19.027  11.691  1.00 35.29  ? 331  ALA A C   1 
ATOM   2159  O  O   . ALA A  1  303 ? 22.948  18.904  11.979  1.00 35.33  ? 331  ALA A O   1 
ATOM   2160  C  CB  . ALA A  1  303 ? 25.448  17.120  12.691  1.00 35.95  ? 331  ALA A CB  1 
ATOM   2161  N  N   . SER A  1  304 ? 24.559  19.510  10.529  1.00 34.66  ? 332  SER A N   1 
ATOM   2162  C  CA  . SER A  1  304 ? 23.652  19.779  9.419   1.00 34.54  ? 332  SER A CA  1 
ATOM   2163  C  C   . SER A  1  304 ? 24.263  19.081  8.221   1.00 34.37  ? 332  SER A C   1 
ATOM   2164  O  O   . SER A  1  304 ? 25.344  18.499  8.346   1.00 34.38  ? 332  SER A O   1 
ATOM   2165  C  CB  . SER A  1  304 ? 23.520  21.285  9.172   1.00 34.97  ? 332  SER A CB  1 
ATOM   2166  O  OG  . SER A  1  304 ? 24.625  21.820  8.442   1.00 36.05  ? 332  SER A OG  1 
ATOM   2167  N  N   . SER A  1  305 ? 23.606  19.127  7.063   1.00 34.05  ? 333  SER A N   1 
ATOM   2168  C  CA  . SER A  1  305 ? 24.168  18.447  5.884   1.00 33.86  ? 333  SER A CA  1 
ATOM   2169  C  C   . SER A  1  305 ? 25.546  18.974  5.476   1.00 33.61  ? 333  SER A C   1 
ATOM   2170  O  O   . SER A  1  305 ? 26.300  18.258  4.829   1.00 34.42  ? 333  SER A O   1 
ATOM   2171  C  CB  . SER A  1  305 ? 23.211  18.455  4.686   1.00 33.80  ? 333  SER A CB  1 
ATOM   2172  O  OG  . SER A  1  305 ? 23.081  19.758  4.148   1.00 34.37  ? 333  SER A OG  1 
ATOM   2173  N  N   . LEU A  1  306 ? 25.887  20.201  5.867   1.00 32.97  ? 334  LEU A N   1 
ATOM   2174  C  CA  . LEU A  1  306 ? 27.207  20.758  5.553   1.00 32.43  ? 334  LEU A CA  1 
ATOM   2175  C  C   . LEU A  1  306 ? 28.189  20.823  6.731   1.00 31.95  ? 334  LEU A C   1 
ATOM   2176  O  O   . LEU A  1  306 ? 29.386  20.643  6.546   1.00 31.71  ? 334  LEU A O   1 
ATOM   2177  C  CB  . LEU A  1  306 ? 27.073  22.151  4.925   1.00 32.60  ? 334  LEU A CB  1 
ATOM   2178  C  CG  . LEU A  1  306 ? 26.220  22.276  3.655   1.00 32.99  ? 334  LEU A CG  1 
ATOM   2179  C  CD1 . LEU A  1  306 ? 25.996  23.746  3.315   1.00 32.94  ? 334  LEU A CD1 1 
ATOM   2180  C  CD2 . LEU A  1  306 ? 26.817  21.510  2.467   1.00 32.55  ? 334  LEU A CD2 1 
ATOM   2181  N  N   . TRP A  1  307 ? 27.682  21.083  7.932   1.00 31.66  ? 335  TRP A N   1 
ATOM   2182  C  CA  . TRP A  1  307 ? 28.539  21.428  9.071   1.00 31.31  ? 335  TRP A CA  1 
ATOM   2183  C  C   . TRP A  1  307 ? 28.436  20.470  10.273  1.00 31.90  ? 335  TRP A C   1 
ATOM   2184  O  O   . TRP A  1  307 ? 27.354  19.942  10.613  1.00 32.05  ? 335  TRP A O   1 
ATOM   2185  C  CB  . TRP A  1  307 ? 28.224  22.837  9.568   1.00 30.42  ? 335  TRP A CB  1 
ATOM   2186  C  CG  . TRP A  1  307 ? 28.551  23.972  8.640   1.00 29.49  ? 335  TRP A CG  1 
ATOM   2187  C  CD1 . TRP A  1  307 ? 27.666  24.687  7.875   1.00 29.20  ? 335  TRP A CD1 1 
ATOM   2188  C  CD2 . TRP A  1  307 ? 29.834  24.575  8.432   1.00 28.57  ? 335  TRP A CD2 1 
ATOM   2189  N  NE1 . TRP A  1  307 ? 28.330  25.684  7.186   1.00 29.24  ? 335  TRP A NE1 1 
ATOM   2190  C  CE2 . TRP A  1  307 ? 29.659  25.633  7.509   1.00 28.36  ? 335  TRP A CE2 1 
ATOM   2191  C  CE3 . TRP A  1  307 ? 31.120  24.313  8.920   1.00 28.91  ? 335  TRP A CE3 1 
ATOM   2192  C  CZ2 . TRP A  1  307 ? 30.719  26.427  7.068   1.00 29.31  ? 335  TRP A CZ2 1 
ATOM   2193  C  CZ3 . TRP A  1  307 ? 32.176  25.101  8.472   1.00 29.33  ? 335  TRP A CZ3 1 
ATOM   2194  C  CH2 . TRP A  1  307 ? 31.967  26.146  7.555   1.00 29.21  ? 335  TRP A CH2 1 
ATOM   2195  N  N   . THR A  1  308 ? 29.576  20.285  10.931  1.00 31.80  ? 336  THR A N   1 
ATOM   2196  C  CA  . THR A  1  308 ? 29.660  19.519  12.157  1.00 31.86  ? 336  THR A CA  1 
ATOM   2197  C  C   . THR A  1  308 ? 30.542  20.291  13.118  1.00 31.66  ? 336  THR A C   1 
ATOM   2198  O  O   . THR A  1  308 ? 31.579  20.839  12.709  1.00 31.78  ? 336  THR A O   1 
ATOM   2199  C  CB  . THR A  1  308 ? 30.232  18.106  11.876  1.00 32.19  ? 336  THR A CB  1 
ATOM   2200  O  OG1 . THR A  1  308 ? 29.159  17.162  11.919  1.00 32.53  ? 336  THR A OG1 1 
ATOM   2201  C  CG2 . THR A  1  308 ? 31.298  17.701  12.901  1.00 32.67  ? 336  THR A CG2 1 
ATOM   2202  N  N   . PHE A  1  309 ? 30.130  20.341  14.388  1.00 31.02  ? 337  PHE A N   1 
ATOM   2203  C  CA  . PHE A  1  309 ? 30.904  21.024  15.420  1.00 30.34  ? 337  PHE A CA  1 
ATOM   2204  C  C   . PHE A  1  309 ? 30.371  20.810  16.837  1.00 30.64  ? 337  PHE A C   1 
ATOM   2205  O  O   . PHE A  1  309 ? 29.290  20.242  17.040  1.00 30.52  ? 337  PHE A O   1 
ATOM   2206  C  CB  . PHE A  1  309 ? 31.014  22.531  15.107  1.00 29.96  ? 337  PHE A CB  1 
ATOM   2207  C  CG  . PHE A  1  309 ? 29.693  23.258  15.114  1.00 28.72  ? 337  PHE A CG  1 
ATOM   2208  C  CD1 . PHE A  1  309 ? 29.122  23.683  16.305  1.00 26.75  ? 337  PHE A CD1 1 
ATOM   2209  C  CD2 . PHE A  1  309 ? 29.026  23.518  13.927  1.00 28.53  ? 337  PHE A CD2 1 
ATOM   2210  C  CE1 . PHE A  1  309 ? 27.907  24.355  16.315  1.00 27.48  ? 337  PHE A CE1 1 
ATOM   2211  C  CE2 . PHE A  1  309 ? 27.807  24.204  13.928  1.00 28.54  ? 337  PHE A CE2 1 
ATOM   2212  C  CZ  . PHE A  1  309 ? 27.247  24.620  15.133  1.00 28.14  ? 337  PHE A CZ  1 
ATOM   2213  N  N   . SER A  1  310 ? 31.141  21.310  17.808  1.00 30.98  ? 338  SER A N   1 
ATOM   2214  C  CA  . SER A  1  310 ? 30.796  21.265  19.231  1.00 30.97  ? 338  SER A CA  1 
ATOM   2215  C  C   . SER A  1  310 ? 30.929  22.653  19.859  1.00 30.56  ? 338  SER A C   1 
ATOM   2216  O  O   . SER A  1  310 ? 31.887  23.380  19.599  1.00 30.98  ? 338  SER A O   1 
ATOM   2217  C  CB  . SER A  1  310 ? 31.684  20.263  19.960  1.00 30.83  ? 338  SER A CB  1 
ATOM   2218  O  OG  . SER A  1  310 ? 31.199  20.034  21.272  1.00 33.72  ? 338  SER A OG  1 
ATOM   2219  N  N   . PHE A  1  311 ? 29.950  23.026  20.668  1.00 30.21  ? 339  PHE A N   1 
ATOM   2220  C  CA  . PHE A  1  311 ? 29.882  24.370  21.224  1.00 29.83  ? 339  PHE A CA  1 
ATOM   2221  C  C   . PHE A  1  311 ? 29.776  24.280  22.740  1.00 29.45  ? 339  PHE A C   1 
ATOM   2222  O  O   . PHE A  1  311 ? 29.351  23.266  23.285  1.00 29.32  ? 339  PHE A O   1 
ATOM   2223  C  CB  . PHE A  1  311 ? 28.675  25.121  20.655  1.00 29.54  ? 339  PHE A CB  1 
ATOM   2224  C  CG  . PHE A  1  311 ? 27.361  24.548  21.094  1.00 30.49  ? 339  PHE A CG  1 
ATOM   2225  C  CD1 . PHE A  1  311 ? 26.746  24.993  22.271  1.00 31.25  ? 339  PHE A CD1 1 
ATOM   2226  C  CD2 . PHE A  1  311 ? 26.747  23.532  20.358  1.00 30.57  ? 339  PHE A CD2 1 
ATOM   2227  C  CE1 . PHE A  1  311 ? 25.529  24.440  22.702  1.00 31.32  ? 339  PHE A CE1 1 
ATOM   2228  C  CE2 . PHE A  1  311 ? 25.530  22.974  20.781  1.00 31.27  ? 339  PHE A CE2 1 
ATOM   2229  C  CZ  . PHE A  1  311 ? 24.921  23.430  21.953  1.00 30.47  ? 339  PHE A CZ  1 
ATOM   2230  N  N   . GLY A  1  312 ? 30.149  25.357  23.413  1.00 29.42  ? 340  GLY A N   1 
ATOM   2231  C  CA  . GLY A  1  312 ? 30.075  25.429  24.861  1.00 29.34  ? 340  GLY A CA  1 
ATOM   2232  C  C   . GLY A  1  312 ? 30.358  26.840  25.321  1.00 29.50  ? 340  GLY A C   1 
ATOM   2233  O  O   . GLY A  1  312 ? 30.307  27.784  24.527  1.00 29.20  ? 340  GLY A O   1 
ATOM   2234  N  N   . LEU A  1  313 ? 30.685  26.967  26.602  1.00 29.33  ? 341  LEU A N   1 
ATOM   2235  C  CA  . LEU A  1  313 ? 30.809  28.249  27.249  1.00 29.51  ? 341  LEU A CA  1 
ATOM   2236  C  C   . LEU A  1  313 ? 31.791  28.098  28.401  1.00 29.57  ? 341  LEU A C   1 
ATOM   2237  O  O   . LEU A  1  313 ? 31.546  27.321  29.324  1.00 29.81  ? 341  LEU A O   1 
ATOM   2238  C  CB  . LEU A  1  313 ? 29.427  28.661  27.759  1.00 29.36  ? 341  LEU A CB  1 
ATOM   2239  C  CG  . LEU A  1  313 ? 28.914  30.081  28.008  1.00 29.75  ? 341  LEU A CG  1 
ATOM   2240  C  CD1 . LEU A  1  313 ? 29.218  31.036  26.896  1.00 30.37  ? 341  LEU A CD1 1 
ATOM   2241  C  CD2 . LEU A  1  313 ? 27.406  30.020  28.192  1.00 29.73  ? 341  LEU A CD2 1 
ATOM   2242  N  N   . GLY A  1  314 ? 32.914  28.814  28.324  1.00 29.57  ? 342  GLY A N   1 
ATOM   2243  C  CA  . GLY A  1  314 ? 33.843  28.938  29.448  1.00 29.64  ? 342  GLY A CA  1 
ATOM   2244  C  C   . GLY A  1  314 ? 33.275  29.887  30.495  1.00 30.01  ? 342  GLY A C   1 
ATOM   2245  O  O   . GLY A  1  314 ? 32.756  30.961  30.152  1.00 30.34  ? 342  GLY A O   1 
ATOM   2246  N  N   . ALA A  1  315 ? 33.368  29.514  31.771  1.00 29.90  ? 343  ALA A N   1 
ATOM   2247  C  CA  . ALA A  1  315 ? 32.783  30.328  32.832  1.00 30.16  ? 343  ALA A CA  1 
ATOM   2248  C  C   . ALA A  1  315 ? 33.222  31.772  32.697  1.00 30.60  ? 343  ALA A C   1 
ATOM   2249  O  O   . ALA A  1  315 ? 32.429  32.687  32.897  1.00 31.22  ? 343  ALA A O   1 
ATOM   2250  C  CB  . ALA A  1  315 ? 33.155  29.796  34.187  1.00 30.06  ? 343  ALA A CB  1 
ATOM   2251  N  N   . PHE A  1  316 ? 34.475  31.966  32.310  1.00 30.78  ? 344  PHE A N   1 
ATOM   2252  C  CA  . PHE A  1  316 ? 35.073  33.284  32.289  1.00 31.24  ? 344  PHE A CA  1 
ATOM   2253  C  C   . PHE A  1  316 ? 35.367  33.839  30.901  1.00 31.31  ? 344  PHE A C   1 
ATOM   2254  O  O   . PHE A  1  316 ? 35.178  35.034  30.667  1.00 31.49  ? 344  PHE A O   1 
ATOM   2255  C  CB  . PHE A  1  316 ? 36.312  33.319  33.196  1.00 31.50  ? 344  PHE A CB  1 
ATOM   2256  C  CG  . PHE A  1  316 ? 36.052  32.766  34.575  1.00 31.56  ? 344  PHE A CG  1 
ATOM   2257  C  CD1 . PHE A  1  316 ? 36.580  31.528  34.956  1.00 32.03  ? 344  PHE A CD1 1 
ATOM   2258  C  CD2 . PHE A  1  316 ? 35.255  33.467  35.478  1.00 31.49  ? 344  PHE A CD2 1 
ATOM   2259  C  CE1 . PHE A  1  316 ? 36.320  30.995  36.237  1.00 32.78  ? 344  PHE A CE1 1 
ATOM   2260  C  CE2 . PHE A  1  316 ? 34.992  32.957  36.749  1.00 32.79  ? 344  PHE A CE2 1 
ATOM   2261  C  CZ  . PHE A  1  316 ? 35.527  31.705  37.132  1.00 32.68  ? 344  PHE A CZ  1 
ATOM   2262  N  N   . SER A  1  317 ? 35.809  32.992  29.982  1.00 31.43  ? 345  SER A N   1 
ATOM   2263  C  CA  . SER A  1  317 ? 36.214  33.483  28.668  1.00 31.69  ? 345  SER A CA  1 
ATOM   2264  C  C   . SER A  1  317 ? 35.067  33.533  27.675  1.00 31.80  ? 345  SER A C   1 
ATOM   2265  O  O   . SER A  1  317 ? 35.185  34.199  26.642  1.00 32.36  ? 345  SER A O   1 
ATOM   2266  C  CB  . SER A  1  317 ? 37.375  32.666  28.097  1.00 31.89  ? 345  SER A CB  1 
ATOM   2267  O  OG  . SER A  1  317 ? 37.044  31.295  28.031  1.00 32.63  ? 345  SER A OG  1 
ATOM   2268  N  N   . GLY A  1  318 ? 33.980  32.817  27.972  1.00 31.11  ? 346  GLY A N   1 
ATOM   2269  C  CA  . GLY A  1  318 ? 32.778  32.844  27.137  1.00 30.91  ? 346  GLY A CA  1 
ATOM   2270  C  C   . GLY A  1  318 ? 32.617  31.795  26.038  1.00 30.85  ? 346  GLY A C   1 
ATOM   2271  O  O   . GLY A  1  318 ? 33.197  30.705  26.111  1.00 30.98  ? 346  GLY A O   1 
ATOM   2272  N  N   . PRO A  1  319 ? 31.808  32.116  25.009  1.00 30.71  ? 347  PRO A N   1 
ATOM   2273  C  CA  . PRO A  1  319 ? 31.456  31.175  23.937  1.00 30.75  ? 347  PRO A CA  1 
ATOM   2274  C  C   . PRO A  1  319 ? 32.642  30.602  23.178  1.00 30.75  ? 347  PRO A C   1 
ATOM   2275  O  O   . PRO A  1  319 ? 33.593  31.309  22.833  1.00 31.02  ? 347  PRO A O   1 
ATOM   2276  C  CB  . PRO A  1  319 ? 30.580  32.008  22.997  1.00 30.64  ? 347  PRO A CB  1 
ATOM   2277  C  CG  . PRO A  1  319 ? 30.049  33.094  23.857  1.00 30.87  ? 347  PRO A CG  1 
ATOM   2278  C  CD  . PRO A  1  319 ? 31.149  33.417  24.817  1.00 30.32  ? 347  PRO A CD  1 
ATOM   2279  N  N   . ARG A  1  320 ? 32.563  29.308  22.919  1.00 30.67  ? 348  ARG A N   1 
ATOM   2280  C  CA  . ARG A  1  320 ? 33.589  28.614  22.184  1.00 30.31  ? 348  ARG A CA  1 
ATOM   2281  C  C   . ARG A  1  320 ? 32.970  27.549  21.307  1.00 30.31  ? 348  ARG A C   1 
ATOM   2282  O  O   . ARG A  1  320 ? 31.930  26.991  21.625  1.00 29.92  ? 348  ARG A O   1 
ATOM   2283  C  CB  . ARG A  1  320 ? 34.617  28.004  23.149  1.00 30.24  ? 348  ARG A CB  1 
ATOM   2284  C  CG  . ARG A  1  320 ? 34.024  27.119  24.212  1.00 29.22  ? 348  ARG A CG  1 
ATOM   2285  C  CD  . ARG A  1  320 ? 35.029  26.843  25.280  1.00 28.07  ? 348  ARG A CD  1 
ATOM   2286  N  NE  . ARG A  1  320 ? 34.448  25.937  26.250  1.00 27.75  ? 348  ARG A NE  1 
ATOM   2287  C  CZ  . ARG A  1  320 ? 34.829  25.859  27.515  1.00 28.75  ? 348  ARG A CZ  1 
ATOM   2288  N  NH1 . ARG A  1  320 ? 35.814  26.629  27.956  1.00 27.94  ? 348  ARG A NH1 1 
ATOM   2289  N  NH2 . ARG A  1  320 ? 34.216  25.011  28.335  1.00 28.93  ? 348  ARG A NH2 1 
ATOM   2290  N  N   . ILE A  1  321 ? 33.631  27.287  20.190  1.00 31.18  ? 349  ILE A N   1 
ATOM   2291  C  CA  . ILE A  1  321 ? 33.265  26.206  19.291  1.00 31.77  ? 349  ILE A CA  1 
ATOM   2292  C  C   . ILE A  1  321 ? 34.508  25.374  18.953  1.00 32.18  ? 349  ILE A C   1 
ATOM   2293  O  O   . ILE A  1  321 ? 35.616  25.911  18.855  1.00 32.17  ? 349  ILE A O   1 
ATOM   2294  C  CB  . ILE A  1  321 ? 32.526  26.754  18.066  1.00 31.78  ? 349  ILE A CB  1 
ATOM   2295  C  CG1 . ILE A  1  321 ? 31.084  27.082  18.496  1.00 31.72  ? 349  ILE A CG1 1 
ATOM   2296  C  CG2 . ILE A  1  321 ? 32.555  25.753  16.926  1.00 32.08  ? 349  ILE A CG2 1 
ATOM   2297  C  CD1 . ILE A  1  321 ? 30.134  27.511  17.402  1.00 32.27  ? 349  ILE A CD1 1 
ATOM   2298  N  N   . PHE A  1  322 ? 34.315  24.062  18.820  1.00 32.72  ? 350  PHE A N   1 
ATOM   2299  C  CA  . PHE A  1  322 ? 35.413  23.100  18.681  1.00 32.81  ? 350  PHE A CA  1 
ATOM   2300  C  C   . PHE A  1  322 ? 35.155  22.107  17.573  1.00 33.23  ? 350  PHE A C   1 
ATOM   2301  O  O   . PHE A  1  322 ? 34.001  21.730  17.344  1.00 33.31  ? 350  PHE A O   1 
ATOM   2302  C  CB  . PHE A  1  322 ? 35.577  22.294  19.970  1.00 32.44  ? 350  PHE A CB  1 
ATOM   2303  C  CG  . PHE A  1  322 ? 36.243  23.041  21.066  1.00 31.83  ? 350  PHE A CG  1 
ATOM   2304  C  CD1 . PHE A  1  322 ? 35.489  23.595  22.096  1.00 30.84  ? 350  PHE A CD1 1 
ATOM   2305  C  CD2 . PHE A  1  322 ? 37.630  23.191  21.078  1.00 31.32  ? 350  PHE A CD2 1 
ATOM   2306  C  CE1 . PHE A  1  322 ? 36.098  24.288  23.124  1.00 30.25  ? 350  PHE A CE1 1 
ATOM   2307  C  CE2 . PHE A  1  322 ? 38.254  23.883  22.099  1.00 30.86  ? 350  PHE A CE2 1 
ATOM   2308  C  CZ  . PHE A  1  322 ? 37.480  24.441  23.132  1.00 31.38  ? 350  PHE A CZ  1 
ATOM   2309  N  N   . ASP A  1  323 ? 36.232  21.665  16.914  1.00 33.47  ? 351  ASP A N   1 
ATOM   2310  C  CA  . ASP A  1  323 ? 36.166  20.606  15.897  1.00 33.91  ? 351  ASP A CA  1 
ATOM   2311  C  C   . ASP A  1  323 ? 35.134  20.896  14.800  1.00 33.88  ? 351  ASP A C   1 
ATOM   2312  O  O   . ASP A  1  323 ? 34.196  20.120  14.580  1.00 33.88  ? 351  ASP A O   1 
ATOM   2313  C  CB  . ASP A  1  323 ? 35.897  19.250  16.570  1.00 34.18  ? 351  ASP A CB  1 
ATOM   2314  C  CG  . ASP A  1  323 ? 36.051  18.075  15.624  1.00 35.45  ? 351  ASP A CG  1 
ATOM   2315  O  OD1 . ASP A  1  323 ? 35.320  17.077  15.828  1.00 37.51  ? 351  ASP A OD1 1 
ATOM   2316  O  OD2 . ASP A  1  323 ? 36.885  18.144  14.686  1.00 36.01  ? 351  ASP A OD2 1 
ATOM   2317  N  N   . VAL A  1  324 ? 35.323  22.032  14.128  1.00 34.21  ? 352  VAL A N   1 
ATOM   2318  C  CA  . VAL A  1  324 ? 34.450  22.477  13.035  1.00 34.02  ? 352  VAL A CA  1 
ATOM   2319  C  C   . VAL A  1  324 ? 34.811  21.781  11.728  1.00 34.05  ? 352  VAL A C   1 
ATOM   2320  O  O   . VAL A  1  324 ? 35.893  21.993  11.168  1.00 33.68  ? 352  VAL A O   1 
ATOM   2321  C  CB  . VAL A  1  324 ? 34.489  24.007  12.842  1.00 33.97  ? 352  VAL A CB  1 
ATOM   2322  C  CG1 . VAL A  1  324 ? 33.591  24.418  11.688  1.00 33.89  ? 352  VAL A CG1 1 
ATOM   2323  C  CG2 . VAL A  1  324 ? 34.037  24.695  14.107  1.00 33.24  ? 352  VAL A CG2 1 
ATOM   2324  N  N   . ARG A  1  325 ? 33.885  20.949  11.260  1.00 34.04  ? 353  ARG A N   1 
ATOM   2325  C  CA  . ARG A  1  325 ? 34.070  20.203  10.033  1.00 34.39  ? 353  ARG A CA  1 
ATOM   2326  C  C   . ARG A  1  325 ? 33.077  20.645  8.974   1.00 34.23  ? 353  ARG A C   1 
ATOM   2327  O  O   . ARG A  1  325 ? 31.875  20.727  9.231   1.00 34.05  ? 353  ARG A O   1 
ATOM   2328  C  CB  . ARG A  1  325 ? 33.955  18.699  10.295  1.00 34.68  ? 353  ARG A CB  1 
ATOM   2329  C  CG  . ARG A  1  325 ? 34.793  18.240  11.471  1.00 35.87  ? 353  ARG A CG  1 
ATOM   2330  C  CD  . ARG A  1  325 ? 34.920  16.730  11.547  1.00 37.62  ? 353  ARG A CD  1 
ATOM   2331  N  NE  . ARG A  1  325 ? 35.460  16.314  12.846  1.00 38.12  ? 353  ARG A NE  1 
ATOM   2332  C  CZ  . ARG A  1  325 ? 35.709  15.054  13.185  1.00 37.99  ? 353  ARG A CZ  1 
ATOM   2333  N  NH1 . ARG A  1  325 ? 35.475  14.078  12.320  1.00 37.28  ? 353  ARG A NH1 1 
ATOM   2334  N  NH2 . ARG A  1  325 ? 36.196  14.770  14.386  1.00 37.64  ? 353  ARG A NH2 1 
ATOM   2335  N  N   . PHE A  1  326 ? 33.601  20.967  7.793   1.00 34.60  ? 354  PHE A N   1 
ATOM   2336  C  CA  . PHE A  1  326 ? 32.776  21.239  6.625   1.00 34.72  ? 354  PHE A CA  1 
ATOM   2337  C  C   . PHE A  1  326 ? 32.746  20.012  5.723   1.00 35.34  ? 354  PHE A C   1 
ATOM   2338  O  O   . PHE A  1  326 ? 33.801  19.522  5.291   1.00 35.07  ? 354  PHE A O   1 
ATOM   2339  C  CB  . PHE A  1  326 ? 33.307  22.428  5.846   1.00 34.53  ? 354  PHE A CB  1 
ATOM   2340  C  CG  . PHE A  1  326 ? 32.387  22.886  4.753   1.00 34.60  ? 354  PHE A CG  1 
ATOM   2341  C  CD1 . PHE A  1  326 ? 31.272  23.659  5.045   1.00 33.82  ? 354  PHE A CD1 1 
ATOM   2342  C  CD2 . PHE A  1  326 ? 32.626  22.537  3.432   1.00 34.61  ? 354  PHE A CD2 1 
ATOM   2343  C  CE1 . PHE A  1  326 ? 30.417  24.091  4.046   1.00 34.67  ? 354  PHE A CE1 1 
ATOM   2344  C  CE2 . PHE A  1  326 ? 31.772  22.965  2.418   1.00 34.76  ? 354  PHE A CE2 1 
ATOM   2345  C  CZ  . PHE A  1  326 ? 30.666  23.752  2.730   1.00 34.99  ? 354  PHE A CZ  1 
ATOM   2346  N  N   . GLN A  1  327 ? 31.539  19.511  5.461   1.00 35.45  ? 355  GLN A N   1 
ATOM   2347  C  CA  . GLN A  1  327 ? 31.353  18.339  4.615   1.00 36.17  ? 355  GLN A CA  1 
ATOM   2348  C  C   . GLN A  1  327 ? 32.370  17.253  4.979   1.00 35.81  ? 355  GLN A C   1 
ATOM   2349  O  O   . GLN A  1  327 ? 32.935  16.609  4.098   1.00 35.76  ? 355  GLN A O   1 
ATOM   2350  C  CB  . GLN A  1  327 ? 31.484  18.715  3.133   1.00 35.90  ? 355  GLN A CB  1 
ATOM   2351  C  CG  . GLN A  1  327 ? 30.237  19.312  2.476   1.00 36.72  ? 355  GLN A CG  1 
ATOM   2352  C  CD  . GLN A  1  327 ? 30.525  19.860  1.063   1.00 37.88  ? 355  GLN A CD  1 
ATOM   2353  O  OE1 . GLN A  1  327 ? 31.654  19.754  0.551   1.00 39.30  ? 355  GLN A OE1 1 
ATOM   2354  N  NE2 . GLN A  1  327 ? 29.508  20.461  0.437   1.00 39.89  ? 355  GLN A NE2 1 
ATOM   2355  N  N   . GLY A  1  328 ? 32.608  17.081  6.280   1.00 35.75  ? 356  GLY A N   1 
ATOM   2356  C  CA  . GLY A  1  328 ? 33.517  16.062  6.804   1.00 35.39  ? 356  GLY A CA  1 
ATOM   2357  C  C   . GLY A  1  328 ? 34.952  16.512  7.073   1.00 35.54  ? 356  GLY A C   1 
ATOM   2358  O  O   . GLY A  1  328 ? 35.724  15.785  7.692   1.00 35.39  ? 356  GLY A O   1 
ATOM   2359  N  N   . GLU A  1  329 ? 35.333  17.704  6.622   1.00 35.28  ? 357  GLU A N   1 
ATOM   2360  C  CA  . GLU A  1  329 ? 36.717  18.103  6.766   1.00 35.35  ? 357  GLU A CA  1 
ATOM   2361  C  C   . GLU A  1  329 ? 36.902  19.213  7.797   1.00 35.11  ? 357  GLU A C   1 
ATOM   2362  O  O   . GLU A  1  329 ? 36.252  20.266  7.718   1.00 35.08  ? 357  GLU A O   1 
ATOM   2363  C  CB  . GLU A  1  329 ? 37.284  18.484  5.401   1.00 35.95  ? 357  GLU A CB  1 
ATOM   2364  C  CG  . GLU A  1  329 ? 38.658  19.104  5.446   1.00 38.01  ? 357  GLU A CG  1 
ATOM   2365  C  CD  . GLU A  1  329 ? 39.397  18.984  4.127   1.00 41.05  ? 357  GLU A CD  1 
ATOM   2366  O  OE1 . GLU A  1  329 ? 38.743  19.121  3.054   1.00 40.64  ? 357  GLU A OE1 1 
ATOM   2367  O  OE2 . GLU A  1  329 ? 40.637  18.751  4.188   1.00 41.58  ? 357  GLU A OE2 1 
ATOM   2368  N  N   . ARG A  1  330 ? 37.797  18.973  8.758   1.00 34.57  ? 358  ARG A N   1 
ATOM   2369  C  CA  . ARG A  1  330 ? 38.052  19.943  9.816   1.00 34.20  ? 358  ARG A CA  1 
ATOM   2370  C  C   . ARG A  1  330 ? 38.736  21.208  9.317   1.00 33.85  ? 358  ARG A C   1 
ATOM   2371  O  O   . ARG A  1  330 ? 39.848  21.151  8.781   1.00 33.99  ? 358  ARG A O   1 
ATOM   2372  C  CB  . ARG A  1  330 ? 38.854  19.342  10.970  1.00 34.01  ? 358  ARG A CB  1 
ATOM   2373  C  CG  . ARG A  1  330 ? 39.062  20.345  12.134  1.00 34.59  ? 358  ARG A CG  1 
ATOM   2374  C  CD  . ARG A  1  330 ? 39.382  19.655  13.459  1.00 34.40  ? 358  ARG A CD  1 
ATOM   2375  N  NE  . ARG A  1  330 ? 40.478  18.723  13.257  1.00 35.77  ? 358  ARG A NE  1 
ATOM   2376  C  CZ  . ARG A  1  330 ? 40.407  17.409  13.414  1.00 34.21  ? 358  ARG A CZ  1 
ATOM   2377  N  NH1 . ARG A  1  330 ? 39.295  16.821  13.842  1.00 32.62  ? 358  ARG A NH1 1 
ATOM   2378  N  NH2 . ARG A  1  330 ? 41.485  16.695  13.162  1.00 34.47  ? 358  ARG A NH2 1 
ATOM   2379  N  N   . LEU A  1  331 ? 38.055  22.343  9.510   1.00 33.30  ? 359  LEU A N   1 
ATOM   2380  C  CA  . LEU A  1  331 ? 38.604  23.661  9.192   1.00 32.70  ? 359  LEU A CA  1 
ATOM   2381  C  C   . LEU A  1  331 ? 39.261  24.300  10.405  1.00 32.21  ? 359  LEU A C   1 
ATOM   2382  O  O   . LEU A  1  331 ? 40.261  24.988  10.275  1.00 33.02  ? 359  LEU A O   1 
ATOM   2383  C  CB  . LEU A  1  331 ? 37.515  24.601  8.674   1.00 32.79  ? 359  LEU A CB  1 
ATOM   2384  C  CG  . LEU A  1  331 ? 36.590  24.177  7.525   1.00 33.55  ? 359  LEU A CG  1 
ATOM   2385  C  CD1 . LEU A  1  331 ? 35.657  25.316  7.159   1.00 31.91  ? 359  LEU A CD1 1 
ATOM   2386  C  CD2 . LEU A  1  331 ? 37.379  23.709  6.300   1.00 33.60  ? 359  LEU A CD2 1 
ATOM   2387  N  N   . VAL A  1  332 ? 38.695  24.072  11.581  1.00 31.61  ? 360  VAL A N   1 
ATOM   2388  C  CA  . VAL A  1  332 ? 39.106  24.764  12.797  1.00 31.30  ? 360  VAL A CA  1 
ATOM   2389  C  C   . VAL A  1  332 ? 39.040  23.805  13.994  1.00 31.19  ? 360  VAL A C   1 
ATOM   2390  O  O   . VAL A  1  332 ? 38.018  23.132  14.203  1.00 30.83  ? 360  VAL A O   1 
ATOM   2391  C  CB  . VAL A  1  332 ? 38.162  25.967  13.104  1.00 31.66  ? 360  VAL A CB  1 
ATOM   2392  C  CG1 . VAL A  1  332 ? 38.681  26.749  14.271  1.00 31.73  ? 360  VAL A CG1 1 
ATOM   2393  C  CG2 . VAL A  1  332 ? 37.984  26.879  11.889  1.00 31.15  ? 360  VAL A CG2 1 
ATOM   2394  N  N   . TYR A  1  333 ? 40.115  23.757  14.780  1.00 30.64  ? 361  TYR A N   1 
ATOM   2395  C  CA  . TYR A  1  333 ? 40.121  22.971  16.007  1.00 31.11  ? 361  TYR A CA  1 
ATOM   2396  C  C   . TYR A  1  333 ? 39.340  23.677  17.138  1.00 31.65  ? 361  TYR A C   1 
ATOM   2397  O  O   . TYR A  1  333 ? 38.529  23.053  17.824  1.00 31.70  ? 361  TYR A O   1 
ATOM   2398  C  CB  . TYR A  1  333 ? 41.552  22.659  16.464  1.00 30.65  ? 361  TYR A CB  1 
ATOM   2399  C  CG  . TYR A  1  333 ? 41.599  21.959  17.804  1.00 30.73  ? 361  TYR A CG  1 
ATOM   2400  C  CD1 . TYR A  1  333 ? 41.558  20.562  17.895  1.00 31.58  ? 361  TYR A CD1 1 
ATOM   2401  C  CD2 . TYR A  1  333 ? 41.650  22.688  18.991  1.00 31.20  ? 361  TYR A CD2 1 
ATOM   2402  C  CE1 . TYR A  1  333 ? 41.581  19.911  19.148  1.00 30.44  ? 361  TYR A CE1 1 
ATOM   2403  C  CE2 . TYR A  1  333 ? 41.681  22.047  20.228  1.00 31.07  ? 361  TYR A CE2 1 
ATOM   2404  C  CZ  . TYR A  1  333 ? 41.644  20.663  20.301  1.00 29.83  ? 361  TYR A CZ  1 
ATOM   2405  O  OH  . TYR A  1  333 ? 41.674  20.057  21.536  1.00 30.05  ? 361  TYR A OH  1 
ATOM   2406  N  N   . GLU A  1  334 ? 39.607  24.971  17.316  1.00 32.17  ? 362  GLU A N   1 
ATOM   2407  C  CA  . GLU A  1  334 ? 38.986  25.791  18.350  1.00 32.96  ? 362  GLU A CA  1 
ATOM   2408  C  C   . GLU A  1  334 ? 38.745  27.215  17.829  1.00 32.71  ? 362  GLU A C   1 
ATOM   2409  O  O   . GLU A  1  334 ? 39.632  27.806  17.220  1.00 32.99  ? 362  GLU A O   1 
ATOM   2410  C  CB  . GLU A  1  334 ? 39.898  25.824  19.586  1.00 33.18  ? 362  GLU A CB  1 
ATOM   2411  C  CG  . GLU A  1  334 ? 39.497  26.829  20.676  1.00 33.96  ? 362  GLU A CG  1 
ATOM   2412  C  CD  . GLU A  1  334 ? 40.418  26.814  21.900  1.00 33.96  ? 362  GLU A CD  1 
ATOM   2413  O  OE1 . GLU A  1  334 ? 40.257  27.700  22.758  1.00 35.95  ? 362  GLU A OE1 1 
ATOM   2414  O  OE2 . GLU A  1  334 ? 41.298  25.933  22.014  1.00 35.16  ? 362  GLU A OE2 1 
ATOM   2415  N  N   . ILE A  1  335 ? 37.536  27.736  18.031  1.00 32.64  ? 363  ILE A N   1 
ATOM   2416  C  CA  . ILE A  1  335 ? 37.265  29.181  17.918  1.00 32.79  ? 363  ILE A CA  1 
ATOM   2417  C  C   . ILE A  1  335 ? 36.565  29.587  19.197  1.00 32.32  ? 363  ILE A C   1 
ATOM   2418  O  O   . ILE A  1  335 ? 35.473  29.090  19.474  1.00 32.75  ? 363  ILE A O   1 
ATOM   2419  C  CB  . ILE A  1  335 ? 36.354  29.563  16.715  1.00 33.07  ? 363  ILE A CB  1 
ATOM   2420  C  CG1 . ILE A  1  335 ? 37.120  29.466  15.405  1.00 34.20  ? 363  ILE A CG1 1 
ATOM   2421  C  CG2 . ILE A  1  335 ? 35.847  31.015  16.847  1.00 32.80  ? 363  ILE A CG2 1 
ATOM   2422  C  CD1 . ILE A  1  335 ? 36.225  29.472  14.175  1.00 36.76  ? 363  ILE A CD1 1 
ATOM   2423  N  N   . SER A  1  336 ? 37.179  30.473  19.973  1.00 31.68  ? 364  SER A N   1 
ATOM   2424  C  CA  . SER A  1  336 ? 36.632  30.845  21.275  1.00 31.74  ? 364  SER A CA  1 
ATOM   2425  C  C   . SER A  1  336 ? 36.829  32.329  21.630  1.00 31.75  ? 364  SER A C   1 
ATOM   2426  O  O   . SER A  1  336 ? 37.845  32.942  21.280  1.00 31.65  ? 364  SER A O   1 
ATOM   2427  C  CB  . SER A  1  336 ? 37.255  29.966  22.363  1.00 31.92  ? 364  SER A CB  1 
ATOM   2428  O  OG  . SER A  1  336 ? 38.647  30.214  22.476  1.00 31.69  ? 364  SER A OG  1 
ATOM   2429  N  N   . LEU A  1  337 ? 35.852  32.898  22.334  1.00 31.30  ? 365  LEU A N   1 
ATOM   2430  C  CA  . LEU A  1  337 ? 36.002  34.232  22.899  1.00 30.79  ? 365  LEU A CA  1 
ATOM   2431  C  C   . LEU A  1  337 ? 37.076  34.158  23.971  1.00 30.98  ? 365  LEU A C   1 
ATOM   2432  O  O   . LEU A  1  337 ? 37.211  33.129  24.631  1.00 31.30  ? 365  LEU A O   1 
ATOM   2433  C  CB  . LEU A  1  337 ? 34.679  34.721  23.489  1.00 30.58  ? 365  LEU A CB  1 
ATOM   2434  C  CG  . LEU A  1  337 ? 34.626  36.123  24.108  1.00 29.62  ? 365  LEU A CG  1 
ATOM   2435  C  CD1 . LEU A  1  337 ? 34.892  37.219  23.091  1.00 27.52  ? 365  LEU A CD1 1 
ATOM   2436  C  CD2 . LEU A  1  337 ? 33.282  36.321  24.758  1.00 30.32  ? 365  LEU A CD2 1 
ATOM   2437  N  N   . GLN A  1  338 ? 37.858  35.223  24.135  1.00 30.75  ? 366  GLN A N   1 
ATOM   2438  C  CA  . GLN A  1  338 ? 38.905  35.201  25.149  1.00 30.90  ? 366  GLN A CA  1 
ATOM   2439  C  C   . GLN A  1  338 ? 38.751  36.284  26.202  1.00 30.79  ? 366  GLN A C   1 
ATOM   2440  O  O   . GLN A  1  338 ? 38.999  36.047  27.384  1.00 31.08  ? 366  GLN A O   1 
ATOM   2441  C  CB  . GLN A  1  338 ? 40.287  35.244  24.514  1.00 30.63  ? 366  GLN A CB  1 
ATOM   2442  C  CG  . GLN A  1  338 ? 40.608  34.004  23.686  1.00 31.82  ? 366  GLN A CG  1 
ATOM   2443  C  CD  . GLN A  1  338 ? 41.016  32.794  24.530  1.00 33.08  ? 366  GLN A CD  1 
ATOM   2444  O  OE1 . GLN A  1  338 ? 41.935  32.882  25.348  1.00 33.84  ? 366  GLN A OE1 1 
ATOM   2445  N  NE2 . GLN A  1  338 ? 40.346  31.657  24.316  1.00 31.12  ? 366  GLN A NE2 1 
ATOM   2446  N  N   . GLU A  1  339 ? 38.345  37.469  25.776  1.00 30.49  ? 367  GLU A N   1 
ATOM   2447  C  CA  . GLU A  1  339 ? 38.214  38.589  26.683  1.00 30.40  ? 367  GLU A CA  1 
ATOM   2448  C  C   . GLU A  1  339 ? 37.373  39.651  26.010  1.00 30.35  ? 367  GLU A C   1 
ATOM   2449  O  O   . GLU A  1  339 ? 37.258  39.667  24.784  1.00 30.43  ? 367  GLU A O   1 
ATOM   2450  C  CB  . GLU A  1  339 ? 39.585  39.146  27.048  1.00 30.21  ? 367  GLU A CB  1 
ATOM   2451  C  CG  . GLU A  1  339 ? 39.626  39.975  28.333  1.00 31.55  ? 367  GLU A CG  1 
ATOM   2452  C  CD  . GLU A  1  339 ? 38.915  39.339  29.517  1.00 34.44  ? 367  GLU A CD  1 
ATOM   2453  O  OE1 . GLU A  1  339 ? 39.483  38.437  30.187  1.00 34.74  ? 367  GLU A OE1 1 
ATOM   2454  O  OE2 . GLU A  1  339 ? 37.782  39.774  29.803  1.00 36.43  ? 367  GLU A OE2 1 
ATOM   2455  N  N   . ALA A  1  340 ? 36.758  40.497  26.832  1.00 29.88  ? 368  ALA A N   1 
ATOM   2456  C  CA  . ALA A  1  340 ? 36.006  41.649  26.390  1.00 29.48  ? 368  ALA A CA  1 
ATOM   2457  C  C   . ALA A  1  340 ? 36.464  42.792  27.272  1.00 29.36  ? 368  ALA A C   1 
ATOM   2458  O  O   . ALA A  1  340 ? 36.689  42.594  28.464  1.00 30.12  ? 368  ALA A O   1 
ATOM   2459  C  CB  . ALA A  1  340 ? 34.543  41.409  26.571  1.00 29.80  ? 368  ALA A CB  1 
ATOM   2460  N  N   . LEU A  1  341 ? 36.616  43.974  26.689  1.00 28.44  ? 369  LEU A N   1 
ATOM   2461  C  CA  . LEU A  1  341 ? 37.190  45.122  27.389  1.00 27.79  ? 369  LEU A CA  1 
ATOM   2462  C  C   . LEU A  1  341 ? 36.370  46.387  27.119  1.00 27.91  ? 369  LEU A C   1 
ATOM   2463  O  O   . LEU A  1  341 ? 35.977  46.665  25.984  1.00 27.61  ? 369  LEU A O   1 
ATOM   2464  C  CB  . LEU A  1  341 ? 38.642  45.327  26.949  1.00 27.18  ? 369  LEU A CB  1 
ATOM   2465  C  CG  . LEU A  1  341 ? 39.505  46.405  27.597  1.00 25.99  ? 369  LEU A CG  1 
ATOM   2466  C  CD1 . LEU A  1  341 ? 39.978  46.014  29.007  1.00 23.99  ? 369  LEU A CD1 1 
ATOM   2467  C  CD2 . LEU A  1  341 ? 40.699  46.673  26.696  1.00 25.30  ? 369  LEU A CD2 1 
ATOM   2468  N  N   . ALA A  1  342 ? 36.097  47.143  28.168  1.00 28.22  ? 370  ALA A N   1 
ATOM   2469  C  CA  . ALA A  1  342 ? 35.443  48.435  28.001  1.00 28.98  ? 370  ALA A CA  1 
ATOM   2470  C  C   . ALA A  1  342 ? 36.268  49.457  28.743  1.00 29.32  ? 370  ALA A C   1 
ATOM   2471  O  O   . ALA A  1  342 ? 36.468  49.329  29.951  1.00 29.73  ? 370  ALA A O   1 
ATOM   2472  C  CB  . ALA A  1  342 ? 34.030  48.407  28.523  1.00 28.44  ? 370  ALA A CB  1 
ATOM   2473  N  N   . ILE A  1  343 ? 36.763  50.449  28.013  1.00 29.77  ? 371  ILE A N   1 
ATOM   2474  C  CA  . ILE A  1  343 ? 37.620  51.485  28.584  1.00 30.38  ? 371  ILE A CA  1 
ATOM   2475  C  C   . ILE A  1  343 ? 36.891  52.816  28.584  1.00 30.53  ? 371  ILE A C   1 
ATOM   2476  O  O   . ILE A  1  343 ? 36.507  53.309  27.536  1.00 30.85  ? 371  ILE A O   1 
ATOM   2477  C  CB  . ILE A  1  343 ? 38.972  51.548  27.835  1.00 30.66  ? 371  ILE A CB  1 
ATOM   2478  C  CG1 . ILE A  1  343 ? 39.736  50.241  28.108  1.00 31.70  ? 371  ILE A CG1 1 
ATOM   2479  C  CG2 . ILE A  1  343 ? 39.764  52.815  28.209  1.00 29.39  ? 371  ILE A CG2 1 
ATOM   2480  C  CD1 . ILE A  1  343 ? 41.187  50.245  27.664  1.00 36.15  ? 371  ILE A CD1 1 
ATOM   2481  N  N   . TYR A  1  344 ? 36.686  53.371  29.772  1.00 31.06  ? 372  TYR A N   1 
ATOM   2482  C  CA  . TYR A  1  344 ? 35.803  54.524  29.973  1.00 31.49  ? 372  TYR A CA  1 
ATOM   2483  C  C   . TYR A  1  344 ? 36.530  55.872  30.122  1.00 32.10  ? 372  TYR A C   1 
ATOM   2484  O  O   . TYR A  1  344 ? 37.705  55.944  30.510  1.00 31.79  ? 372  TYR A O   1 
ATOM   2485  C  CB  . TYR A  1  344 ? 34.886  54.272  31.187  1.00 31.62  ? 372  TYR A CB  1 
ATOM   2486  C  CG  . TYR A  1  344 ? 33.651  53.474  30.844  1.00 32.09  ? 372  TYR A CG  1 
ATOM   2487  C  CD1 . TYR A  1  344 ? 32.477  54.116  30.470  1.00 32.87  ? 372  TYR A CD1 1 
ATOM   2488  C  CD2 . TYR A  1  344 ? 33.658  52.078  30.861  1.00 32.68  ? 372  TYR A CD2 1 
ATOM   2489  C  CE1 . TYR A  1  344 ? 31.332  53.395  30.121  1.00 33.57  ? 372  TYR A CE1 1 
ATOM   2490  C  CE2 . TYR A  1  344 ? 32.509  51.342  30.528  1.00 32.71  ? 372  TYR A CE2 1 
ATOM   2491  C  CZ  . TYR A  1  344 ? 31.349  52.011  30.151  1.00 33.41  ? 372  TYR A CZ  1 
ATOM   2492  O  OH  . TYR A  1  344 ? 30.195  51.320  29.800  1.00 33.34  ? 372  TYR A OH  1 
ATOM   2493  N  N   . GLY A  1  345 ? 35.814  56.935  29.781  1.00 32.56  ? 373  GLY A N   1 
ATOM   2494  C  CA  . GLY A  1  345 ? 36.219  58.287  30.110  1.00 33.56  ? 373  GLY A CA  1 
ATOM   2495  C  C   . GLY A  1  345 ? 35.091  58.918  30.899  1.00 34.41  ? 373  GLY A C   1 
ATOM   2496  O  O   . GLY A  1  345 ? 33.968  58.405  30.891  1.00 34.89  ? 373  GLY A O   1 
ATOM   2497  N  N   . GLY A  1  346 ? 35.374  60.022  31.584  1.00 35.11  ? 374  GLY A N   1 
ATOM   2498  C  CA  . GLY A  1  346 ? 34.345  60.708  32.346  1.00 36.17  ? 374  GLY A CA  1 
ATOM   2499  C  C   . GLY A  1  346 ? 34.739  61.875  33.229  1.00 37.14  ? 374  GLY A C   1 
ATOM   2500  O  O   . GLY A  1  346 ? 35.925  62.162  33.453  1.00 36.95  ? 374  GLY A O   1 
ATOM   2501  N  N   . ASN A  1  347 ? 33.692  62.532  33.724  1.00 38.30  ? 375  ASN A N   1 
ATOM   2502  C  CA  . ASN A  1  347 ? 33.741  63.667  34.644  1.00 39.20  ? 375  ASN A CA  1 
ATOM   2503  C  C   . ASN A  1  347 ? 33.967  63.278  36.107  1.00 39.30  ? 375  ASN A C   1 
ATOM   2504  O  O   . ASN A  1  347 ? 34.429  64.081  36.916  1.00 39.30  ? 375  ASN A O   1 
ATOM   2505  C  CB  . ASN A  1  347 ? 32.403  64.403  34.551  1.00 39.68  ? 375  ASN A CB  1 
ATOM   2506  C  CG  . ASN A  1  347 ? 32.567  65.824  34.107  1.00 42.01  ? 375  ASN A CG  1 
ATOM   2507  O  OD1 . ASN A  1  347 ? 33.686  66.270  33.848  1.00 45.56  ? 375  ASN A OD1 1 
ATOM   2508  N  ND2 . ASN A  1  347 ? 31.461  66.562  34.032  1.00 43.10  ? 375  ASN A ND2 1 
ATOM   2509  N  N   . SER A  1  348 ? 33.597  62.047  36.435  1.00 39.40  ? 376  SER A N   1 
ATOM   2510  C  CA  . SER A  1  348 ? 33.590  61.550  37.795  1.00 39.39  ? 376  SER A CA  1 
ATOM   2511  C  C   . SER A  1  348 ? 34.628  60.441  37.943  1.00 38.93  ? 376  SER A C   1 
ATOM   2512  O  O   . SER A  1  348 ? 34.973  59.798  36.961  1.00 38.86  ? 376  SER A O   1 
ATOM   2513  C  CB  . SER A  1  348 ? 32.189  61.030  38.123  1.00 39.82  ? 376  SER A CB  1 
ATOM   2514  O  OG  . SER A  1  348 ? 31.227  62.070  37.982  1.00 41.05  ? 376  SER A OG  1 
ATOM   2515  N  N   . PRO A  1  349 ? 35.125  60.212  39.172  1.00 38.54  ? 377  PRO A N   1 
ATOM   2516  C  CA  . PRO A  1  349 ? 36.188  59.238  39.396  1.00 38.42  ? 377  PRO A CA  1 
ATOM   2517  C  C   . PRO A  1  349 ? 35.859  57.802  38.952  1.00 38.35  ? 377  PRO A C   1 
ATOM   2518  O  O   . PRO A  1  349 ? 36.744  57.098  38.465  1.00 37.91  ? 377  PRO A O   1 
ATOM   2519  C  CB  . PRO A  1  349 ? 36.381  59.285  40.918  1.00 38.38  ? 377  PRO A CB  1 
ATOM   2520  C  CG  . PRO A  1  349 ? 35.887  60.594  41.321  1.00 38.65  ? 377  PRO A CG  1 
ATOM   2521  C  CD  . PRO A  1  349 ? 34.717  60.851  40.432  1.00 38.30  ? 377  PRO A CD  1 
ATOM   2522  N  N   . ALA A  1  350 ? 34.611  57.372  39.127  1.00 38.27  ? 378  ALA A N   1 
ATOM   2523  C  CA  . ALA A  1  350 ? 34.216  56.040  38.702  1.00 38.64  ? 378  ALA A CA  1 
ATOM   2524  C  C   . ALA A  1  350 ? 34.439  55.857  37.199  1.00 38.89  ? 378  ALA A C   1 
ATOM   2525  O  O   . ALA A  1  350 ? 35.266  55.040  36.781  1.00 39.77  ? 378  ALA A O   1 
ATOM   2526  C  CB  . ALA A  1  350 ? 32.774  55.762  39.077  1.00 38.81  ? 378  ALA A CB  1 
ATOM   2527  N  N   . ALA A  1  351 ? 33.724  56.632  36.388  1.00 38.68  ? 379  ALA A N   1 
ATOM   2528  C  CA  . ALA A  1  351 ? 33.887  56.586  34.936  1.00 37.99  ? 379  ALA A CA  1 
ATOM   2529  C  C   . ALA A  1  351 ? 35.353  56.747  34.575  1.00 37.57  ? 379  ALA A C   1 
ATOM   2530  O  O   . ALA A  1  351 ? 35.905  55.945  33.819  1.00 37.94  ? 379  ALA A O   1 
ATOM   2531  C  CB  . ALA A  1  351 ? 33.049  57.687  34.266  1.00 37.78  ? 379  ALA A CB  1 
ATOM   2532  N  N   . MET A  1  352 ? 35.969  57.771  35.154  1.00 36.66  ? 380  MET A N   1 
ATOM   2533  C  CA  . MET A  1  352 ? 37.339  58.195  34.864  1.00 36.40  ? 380  MET A CA  1 
ATOM   2534  C  C   . MET A  1  352 ? 38.375  57.083  34.872  1.00 35.23  ? 380  MET A C   1 
ATOM   2535  O  O   . MET A  1  352 ? 39.300  57.104  34.071  1.00 35.26  ? 380  MET A O   1 
ATOM   2536  C  CB  . MET A  1  352 ? 37.764  59.220  35.899  1.00 36.33  ? 380  MET A CB  1 
ATOM   2537  C  CG  . MET A  1  352 ? 38.378  60.421  35.334  1.00 37.04  ? 380  MET A CG  1 
ATOM   2538  S  SD  . MET A  1  352 ? 38.691  61.598  36.653  1.00 38.24  ? 380  MET A SD  1 
ATOM   2539  C  CE  . MET A  1  352 ? 40.352  61.128  37.090  1.00 37.84  ? 380  MET A CE  1 
ATOM   2540  N  N   . THR A  1  353 ? 38.220  56.135  35.791  1.00 34.17  ? 381  THR A N   1 
ATOM   2541  C  CA  . THR A  1  353 ? 39.169  55.035  35.962  1.00 33.19  ? 381  THR A CA  1 
ATOM   2542  C  C   . THR A  1  353 ? 38.592  53.644  35.673  1.00 32.33  ? 381  THR A C   1 
ATOM   2543  O  O   . THR A  1  353 ? 39.202  52.633  36.029  1.00 32.34  ? 381  THR A O   1 
ATOM   2544  C  CB  . THR A  1  353 ? 39.713  55.003  37.389  1.00 33.24  ? 381  THR A CB  1 
ATOM   2545  O  OG1 . THR A  1  353 ? 38.607  54.898  38.299  1.00 33.16  ? 381  THR A OG1 1 
ATOM   2546  C  CG2 . THR A  1  353 ? 40.527  56.255  37.679  1.00 33.06  ? 381  THR A CG2 1 
ATOM   2547  N  N   . THR A  1  354 ? 37.427  53.578  35.039  1.00 31.41  ? 382  THR A N   1 
ATOM   2548  C  CA  . THR A  1  354 ? 36.868  52.279  34.688  1.00 30.66  ? 382  THR A CA  1 
ATOM   2549  C  C   . THR A  1  354 ? 37.542  51.637  33.466  1.00 29.99  ? 382  THR A C   1 
ATOM   2550  O  O   . THR A  1  354 ? 37.605  52.191  32.368  1.00 29.70  ? 382  THR A O   1 
ATOM   2551  C  CB  . THR A  1  354 ? 35.333  52.323  34.554  1.00 30.72  ? 382  THR A CB  1 
ATOM   2552  O  OG1 . THR A  1  354 ? 34.758  52.761  35.792  1.00 31.48  ? 382  THR A OG1 1 
ATOM   2553  C  CG2 . THR A  1  354 ? 34.789  50.958  34.265  1.00 31.26  ? 382  THR A CG2 1 
ATOM   2554  N  N   . ARG A  1  355 ? 38.081  50.460  33.698  1.00 29.61  ? 383  ARG A N   1 
ATOM   2555  C  CA  . ARG A  1  355 ? 38.574  49.626  32.642  1.00 29.75  ? 383  ARG A CA  1 
ATOM   2556  C  C   . ARG A  1  355 ? 38.096  48.213  32.997  1.00 30.03  ? 383  ARG A C   1 
ATOM   2557  O  O   . ARG A  1  355 ? 38.775  47.495  33.743  1.00 30.43  ? 383  ARG A O   1 
ATOM   2558  C  CB  . ARG A  1  355 ? 40.108  49.689  32.587  1.00 29.77  ? 383  ARG A CB  1 
ATOM   2559  C  CG  . ARG A  1  355 ? 40.708  50.988  32.060  1.00 29.20  ? 383  ARG A CG  1 
ATOM   2560  C  CD  . ARG A  1  355 ? 40.937  52.022  33.169  1.00 29.78  ? 383  ARG A CD  1 
ATOM   2561  N  NE  . ARG A  1  355 ? 41.597  53.227  32.665  1.00 30.43  ? 383  ARG A NE  1 
ATOM   2562  C  CZ  . ARG A  1  355 ? 40.971  54.217  32.033  1.00 30.76  ? 383  ARG A CZ  1 
ATOM   2563  N  NH1 . ARG A  1  355 ? 39.652  54.166  31.828  1.00 29.66  ? 383  ARG A NH1 1 
ATOM   2564  N  NH2 . ARG A  1  355 ? 41.663  55.262  31.604  1.00 29.39  ? 383  ARG A NH2 1 
ATOM   2565  N  N   . TYR A  1  356 ? 36.908  47.847  32.524  1.00 29.69  ? 384  TYR A N   1 
ATOM   2566  C  CA  . TYR A  1  356 ? 36.373  46.489  32.705  1.00 29.92  ? 384  TYR A CA  1 
ATOM   2567  C  C   . TYR A  1  356 ? 37.106  45.453  31.851  1.00 30.29  ? 384  TYR A C   1 
ATOM   2568  O  O   . TYR A  1  356 ? 37.198  45.589  30.636  1.00 30.17  ? 384  TYR A O   1 
ATOM   2569  C  CB  . TYR A  1  356 ? 34.863  46.405  32.385  1.00 29.62  ? 384  TYR A CB  1 
ATOM   2570  C  CG  . TYR A  1  356 ? 33.938  47.071  33.386  1.00 29.08  ? 384  TYR A CG  1 
ATOM   2571  C  CD1 . TYR A  1  356 ? 33.046  48.051  32.982  1.00 28.45  ? 384  TYR A CD1 1 
ATOM   2572  C  CD2 . TYR A  1  356 ? 33.967  46.733  34.735  1.00 28.42  ? 384  TYR A CD2 1 
ATOM   2573  C  CE1 . TYR A  1  356 ? 32.205  48.670  33.885  1.00 28.85  ? 384  TYR A CE1 1 
ATOM   2574  C  CE2 . TYR A  1  356 ? 33.132  47.348  35.645  1.00 27.56  ? 384  TYR A CE2 1 
ATOM   2575  C  CZ  . TYR A  1  356 ? 32.250  48.305  35.209  1.00 29.07  ? 384  TYR A CZ  1 
ATOM   2576  O  OH  . TYR A  1  356 ? 31.400  48.913  36.100  1.00 30.77  ? 384  TYR A OH  1 
ATOM   2577  N  N   . VAL A  1  357 ? 37.620  44.421  32.514  1.00 31.05  ? 385  VAL A N   1 
ATOM   2578  C  CA  . VAL A  1  357 ? 38.151  43.239  31.866  1.00 31.14  ? 385  VAL A CA  1 
ATOM   2579  C  C   . VAL A  1  357 ? 37.163  42.141  32.222  1.00 32.16  ? 385  VAL A C   1 
ATOM   2580  O  O   . VAL A  1  357 ? 37.284  41.500  33.275  1.00 33.01  ? 385  VAL A O   1 
ATOM   2581  C  CB  . VAL A  1  357 ? 39.544  42.901  32.391  1.00 30.95  ? 385  VAL A CB  1 
ATOM   2582  C  CG1 . VAL A  1  357 ? 40.158  41.776  31.558  1.00 30.74  ? 385  VAL A CG1 1 
ATOM   2583  C  CG2 . VAL A  1  357 ? 40.437  44.135  32.356  1.00 29.32  ? 385  VAL A CG2 1 
ATOM   2584  N  N   . ASP A  1  358 ? 36.184  41.935  31.343  1.00 32.45  ? 386  ASP A N   1 
ATOM   2585  C  CA  . ASP A  1  358 ? 34.945  41.238  31.692  1.00 32.60  ? 386  ASP A CA  1 
ATOM   2586  C  C   . ASP A  1  358 ? 35.053  39.768  32.049  1.00 32.91  ? 386  ASP A C   1 
ATOM   2587  O  O   . ASP A  1  358 ? 34.136  39.200  32.650  1.00 32.83  ? 386  ASP A O   1 
ATOM   2588  C  CB  . ASP A  1  358 ? 33.881  41.479  30.619  1.00 32.79  ? 386  ASP A CB  1 
ATOM   2589  C  CG  . ASP A  1  358 ? 33.255  42.855  30.740  1.00 32.39  ? 386  ASP A CG  1 
ATOM   2590  O  OD1 . ASP A  1  358 ? 32.856  43.231  31.860  1.00 31.60  ? 386  ASP A OD1 1 
ATOM   2591  O  OD2 . ASP A  1  358 ? 33.170  43.572  29.731  1.00 34.38  ? 386  ASP A OD2 1 
ATOM   2592  N  N   . GLY A  1  359 ? 36.180  39.157  31.702  1.00 33.33  ? 387  GLY A N   1 
ATOM   2593  C  CA  . GLY A  1  359 ? 36.469  37.786  32.112  1.00 33.37  ? 387  GLY A CA  1 
ATOM   2594  C  C   . GLY A  1  359 ? 36.662  37.655  33.612  1.00 33.32  ? 387  GLY A C   1 
ATOM   2595  O  O   . GLY A  1  359 ? 36.392  36.597  34.173  1.00 33.54  ? 387  GLY A O   1 
ATOM   2596  N  N   . GLY A  1  360 ? 37.128  38.727  34.258  1.00 33.61  ? 388  GLY A N   1 
ATOM   2597  C  CA  . GLY A  1  360 ? 37.235  38.794  35.727  1.00 34.15  ? 388  GLY A CA  1 
ATOM   2598  C  C   . GLY A  1  360 ? 35.889  38.660  36.432  1.00 34.38  ? 388  GLY A C   1 
ATOM   2599  O  O   . GLY A  1  360 ? 35.821  38.436  37.634  1.00 34.32  ? 388  GLY A O   1 
ATOM   2600  N  N   . PHE A  1  361 ? 34.816  38.810  35.666  1.00 34.91  ? 389  PHE A N   1 
ATOM   2601  C  CA  . PHE A  1  361 ? 33.474  38.469  36.117  1.00 35.54  ? 389  PHE A CA  1 
ATOM   2602  C  C   . PHE A  1  361 ? 33.047  37.136  35.509  1.00 35.34  ? 389  PHE A C   1 
ATOM   2603  O  O   . PHE A  1  361 ? 32.656  36.215  36.238  1.00 35.41  ? 389  PHE A O   1 
ATOM   2604  C  CB  . PHE A  1  361 ? 32.487  39.594  35.762  1.00 36.15  ? 389  PHE A CB  1 
ATOM   2605  C  CG  . PHE A  1  361 ? 32.851  40.912  36.368  1.00 36.40  ? 389  PHE A CG  1 
ATOM   2606  C  CD1 . PHE A  1  361 ? 33.678  41.796  35.689  1.00 37.86  ? 389  PHE A CD1 1 
ATOM   2607  C  CD2 . PHE A  1  361 ? 32.405  41.247  37.633  1.00 36.40  ? 389  PHE A CD2 1 
ATOM   2608  C  CE1 . PHE A  1  361 ? 34.040  43.003  36.256  1.00 38.43  ? 389  PHE A CE1 1 
ATOM   2609  C  CE2 . PHE A  1  361 ? 32.752  42.444  38.207  1.00 37.00  ? 389  PHE A CE2 1 
ATOM   2610  C  CZ  . PHE A  1  361 ? 33.576  43.332  37.517  1.00 38.19  ? 389  PHE A CZ  1 
ATOM   2611  N  N   . GLY A  1  362 ? 33.130  37.046  34.175  1.00 35.04  ? 390  GLY A N   1 
ATOM   2612  C  CA  . GLY A  1  362 ? 32.835  35.816  33.443  1.00 34.35  ? 390  GLY A CA  1 
ATOM   2613  C  C   . GLY A  1  362 ? 31.702  35.938  32.444  1.00 34.31  ? 390  GLY A C   1 
ATOM   2614  O  O   . GLY A  1  362 ? 30.537  36.105  32.834  1.00 34.17  ? 390  GLY A O   1 
ATOM   2615  N  N   . MET A  1  363 ? 32.037  35.842  31.153  1.00 34.11  ? 391  MET A N   1 
ATOM   2616  C  CA  . MET A  1  363 ? 31.028  35.912  30.088  1.00 33.84  ? 391  MET A CA  1 
ATOM   2617  C  C   . MET A  1  363 ? 30.115  34.702  30.129  1.00 33.75  ? 391  MET A C   1 
ATOM   2618  O  O   . MET A  1  363 ? 28.952  34.787  29.716  1.00 34.06  ? 391  MET A O   1 
ATOM   2619  C  CB  . MET A  1  363 ? 31.657  36.066  28.695  1.00 33.85  ? 391  MET A CB  1 
ATOM   2620  C  CG  . MET A  1  363 ? 32.027  37.505  28.337  1.00 33.32  ? 391  MET A CG  1 
ATOM   2621  S  SD  . MET A  1  363 ? 33.532  38.047  29.202  1.00 34.23  ? 391  MET A SD  1 
ATOM   2622  C  CE  . MET A  1  363 ? 34.844  37.511  28.104  1.00 31.21  ? 391  MET A CE  1 
ATOM   2623  N  N   . GLY A  1  364 ? 30.642  33.581  30.626  1.00 33.17  ? 392  GLY A N   1 
ATOM   2624  C  CA  . GLY A  1  364 ? 29.824  32.404  30.880  1.00 32.95  ? 392  GLY A CA  1 
ATOM   2625  C  C   . GLY A  1  364 ? 28.955  32.603  32.107  1.00 32.75  ? 392  GLY A C   1 
ATOM   2626  O  O   . GLY A  1  364 ? 27.736  32.552  32.030  1.00 33.27  ? 392  GLY A O   1 
ATOM   2627  N  N   . LYS A  1  365 ? 29.593  32.865  33.237  1.00 32.46  ? 393  LYS A N   1 
ATOM   2628  C  CA  . LYS A  1  365 ? 28.907  33.100  34.502  1.00 32.34  ? 393  LYS A CA  1 
ATOM   2629  C  C   . LYS A  1  365 ? 27.723  34.049  34.394  1.00 32.35  ? 393  LYS A C   1 
ATOM   2630  O  O   . LYS A  1  365 ? 26.697  33.823  35.019  1.00 32.49  ? 393  LYS A O   1 
ATOM   2631  C  CB  . LYS A  1  365 ? 29.912  33.639  35.516  1.00 32.54  ? 393  LYS A CB  1 
ATOM   2632  C  CG  . LYS A  1  365 ? 29.471  33.600  36.970  1.00 32.45  ? 393  LYS A CG  1 
ATOM   2633  C  CD  . LYS A  1  365 ? 30.641  33.928  37.883  1.00 32.10  ? 393  LYS A CD  1 
ATOM   2634  C  CE  . LYS A  1  365 ? 30.162  34.493  39.186  1.00 33.65  ? 393  LYS A CE  1 
ATOM   2635  N  NZ  . LYS A  1  365 ? 31.243  34.363  40.174  1.00 36.86  ? 393  LYS A NZ  1 
ATOM   2636  N  N   . TYR A  1  366 ? 27.874  35.113  33.610  1.00 32.78  ? 394  TYR A N   1 
ATOM   2637  C  CA  . TYR A  1  366 ? 26.832  36.132  33.440  1.00 32.49  ? 394  TYR A CA  1 
ATOM   2638  C  C   . TYR A  1  366 ? 26.040  35.949  32.145  1.00 32.35  ? 394  TYR A C   1 
ATOM   2639  O  O   . TYR A  1  366 ? 25.426  36.892  31.638  1.00 31.79  ? 394  TYR A O   1 
ATOM   2640  C  CB  . TYR A  1  366 ? 27.440  37.535  33.504  1.00 32.94  ? 394  TYR A CB  1 
ATOM   2641  C  CG  . TYR A  1  366 ? 27.916  37.937  34.881  1.00 33.92  ? 394  TYR A CG  1 
ATOM   2642  C  CD1 . TYR A  1  366 ? 27.234  38.913  35.627  1.00 35.23  ? 394  TYR A CD1 1 
ATOM   2643  C  CD2 . TYR A  1  366 ? 29.050  37.344  35.451  1.00 34.99  ? 394  TYR A CD2 1 
ATOM   2644  C  CE1 . TYR A  1  366 ? 27.678  39.292  36.907  1.00 34.82  ? 394  TYR A CE1 1 
ATOM   2645  C  CE2 . TYR A  1  366 ? 29.499  37.707  36.723  1.00 35.14  ? 394  TYR A CE2 1 
ATOM   2646  C  CZ  . TYR A  1  366 ? 28.809  38.682  37.445  1.00 35.10  ? 394  TYR A CZ  1 
ATOM   2647  O  OH  . TYR A  1  366 ? 29.266  39.034  38.702  1.00 35.33  ? 394  TYR A OH  1 
ATOM   2648  N  N   . THR A  1  367 ? 26.057  34.727  31.614  1.00 32.37  ? 395  THR A N   1 
ATOM   2649  C  CA  . THR A  1  367 ? 25.156  34.342  30.529  1.00 32.75  ? 395  THR A CA  1 
ATOM   2650  C  C   . THR A  1  367 ? 23.697  34.378  31.011  1.00 32.52  ? 395  THR A C   1 
ATOM   2651  O  O   . THR A  1  367 ? 23.399  34.048  32.160  1.00 32.29  ? 395  THR A O   1 
ATOM   2652  C  CB  . THR A  1  367 ? 25.531  32.954  29.975  1.00 32.90  ? 395  THR A CB  1 
ATOM   2653  O  OG1 . THR A  1  367 ? 26.449  33.112  28.887  1.00 34.41  ? 395  THR A OG1 1 
ATOM   2654  C  CG2 . THR A  1  367 ? 24.327  32.211  29.463  1.00 34.31  ? 395  THR A CG2 1 
ATOM   2655  N  N   . THR A  1  368 ? 22.795  34.796  30.136  1.00 32.27  ? 396  THR A N   1 
ATOM   2656  C  CA  . THR A  1  368 ? 21.406  34.980  30.525  1.00 32.52  ? 396  THR A CA  1 
ATOM   2657  C  C   . THR A  1  368 ? 20.482  34.207  29.591  1.00 32.68  ? 396  THR A C   1 
ATOM   2658  O  O   . THR A  1  368 ? 20.825  33.980  28.436  1.00 33.18  ? 396  THR A O   1 
ATOM   2659  C  CB  . THR A  1  368 ? 21.005  36.479  30.510  1.00 32.27  ? 396  THR A CB  1 
ATOM   2660  O  OG1 . THR A  1  368 ? 21.423  37.061  29.276  1.00 33.17  ? 396  THR A OG1 1 
ATOM   2661  C  CG2 . THR A  1  368 ? 21.647  37.230  31.659  1.00 30.96  ? 396  THR A CG2 1 
ATOM   2662  N  N   . PRO A  1  369 ? 19.302  33.807  30.084  1.00 32.60  ? 397  PRO A N   1 
ATOM   2663  C  CA  . PRO A  1  369 ? 18.359  33.083  29.230  1.00 32.76  ? 397  PRO A CA  1 
ATOM   2664  C  C   . PRO A  1  369 ? 18.046  33.914  28.001  1.00 32.62  ? 397  PRO A C   1 
ATOM   2665  O  O   . PRO A  1  369 ? 17.997  35.131  28.098  1.00 33.15  ? 397  PRO A O   1 
ATOM   2666  C  CB  . PRO A  1  369 ? 17.100  32.958  30.110  1.00 32.51  ? 397  PRO A CB  1 
ATOM   2667  C  CG  . PRO A  1  369 ? 17.594  33.067  31.495  1.00 32.27  ? 397  PRO A CG  1 
ATOM   2668  C  CD  . PRO A  1  369 ? 18.772  34.010  31.444  1.00 32.44  ? 397  PRO A CD  1 
ATOM   2669  N  N   . LEU A  1  370 ? 17.864  33.264  26.858  1.00 32.73  ? 398  LEU A N   1 
ATOM   2670  C  CA  . LEU A  1  370 ? 17.450  33.948  25.636  1.00 32.49  ? 398  LEU A CA  1 
ATOM   2671  C  C   . LEU A  1  370 ? 15.929  33.919  25.594  1.00 32.82  ? 398  LEU A C   1 
ATOM   2672  O  O   . LEU A  1  370 ? 15.319  32.874  25.831  1.00 32.53  ? 398  LEU A O   1 
ATOM   2673  C  CB  . LEU A  1  370 ? 18.047  33.250  24.414  1.00 32.20  ? 398  LEU A CB  1 
ATOM   2674  C  CG  . LEU A  1  370 ? 19.577  33.147  24.469  1.00 32.30  ? 398  LEU A CG  1 
ATOM   2675  C  CD1 . LEU A  1  370 ? 20.087  32.015  23.622  1.00 32.38  ? 398  LEU A CD1 1 
ATOM   2676  C  CD2 . LEU A  1  370 ? 20.254  34.471  24.089  1.00 31.52  ? 398  LEU A CD2 1 
ATOM   2677  N  N   . THR A  1  371 ? 15.325  35.079  25.355  1.00 33.11  ? 399  THR A N   1 
ATOM   2678  C  CA  . THR A  1  371 ? 13.881  35.190  25.237  1.00 33.48  ? 399  THR A CA  1 
ATOM   2679  C  C   . THR A  1  371 ? 13.451  34.799  23.817  1.00 34.26  ? 399  THR A C   1 
ATOM   2680  O  O   . THR A  1  371 ? 13.796  35.484  22.843  1.00 33.97  ? 399  THR A O   1 
ATOM   2681  C  CB  . THR A  1  371 ? 13.412  36.609  25.552  1.00 33.30  ? 399  THR A CB  1 
ATOM   2682  O  OG1 . THR A  1  371 ? 13.594  36.880  26.948  1.00 33.22  ? 399  THR A OG1 1 
ATOM   2683  C  CG2 . THR A  1  371 ? 11.933  36.786  25.195  1.00 33.28  ? 399  THR A CG2 1 
ATOM   2684  N  N   . ARG A  1  372 ? 12.702  33.695  23.723  1.00 34.84  ? 400  ARG A N   1 
ATOM   2685  C  CA  . ARG A  1  372 ? 12.258  33.120  22.458  1.00 35.63  ? 400  ARG A CA  1 
ATOM   2686  C  C   . ARG A  1  372 ? 11.523  34.169  21.625  1.00 35.46  ? 400  ARG A C   1 
ATOM   2687  O  O   . ARG A  1  372 ? 10.622  34.830  22.126  1.00 35.86  ? 400  ARG A O   1 
ATOM   2688  C  CB  . ARG A  1  372 ? 11.348  31.921  22.753  1.00 35.66  ? 400  ARG A CB  1 
ATOM   2689  C  CG  . ARG A  1  372 ? 10.878  31.126  21.525  1.00 37.53  ? 400  ARG A CG  1 
ATOM   2690  C  CD  . ARG A  1  372 ? 9.901   29.988  21.887  1.00 37.54  ? 400  ARG A CD  1 
ATOM   2691  N  NE  . ARG A  1  372 ? 10.523  28.654  21.971  1.00 41.41  ? 400  ARG A NE  1 
ATOM   2692  C  CZ  . ARG A  1  372 ? 11.245  28.206  23.007  1.00 42.28  ? 400  ARG A CZ  1 
ATOM   2693  N  NH1 . ARG A  1  372 ? 11.748  26.973  22.983  1.00 40.66  ? 400  ARG A NH1 1 
ATOM   2694  N  NH2 . ARG A  1  372 ? 11.475  28.979  24.074  1.00 42.03  ? 400  ARG A NH2 1 
ATOM   2695  N  N   . GLY A  1  373 ? 11.913  34.344  20.363  1.00 35.46  ? 401  GLY A N   1 
ATOM   2696  C  CA  . GLY A  1  373 ? 11.224  35.293  19.463  1.00 35.28  ? 401  GLY A CA  1 
ATOM   2697  C  C   . GLY A  1  373 ? 11.682  36.752  19.500  1.00 35.10  ? 401  GLY A C   1 
ATOM   2698  O  O   . GLY A  1  373 ? 11.172  37.590  18.745  1.00 34.62  ? 401  GLY A O   1 
ATOM   2699  N  N   . VAL A  1  374 ? 12.631  37.056  20.389  1.00 34.98  ? 402  VAL A N   1 
ATOM   2700  C  CA  . VAL A  1  374 ? 13.232  38.386  20.489  1.00 34.51  ? 402  VAL A CA  1 
ATOM   2701  C  C   . VAL A  1  374 ? 14.735  38.242  20.400  1.00 34.69  ? 402  VAL A C   1 
ATOM   2702  O  O   . VAL A  1  374 ? 15.377  38.919  19.591  1.00 35.21  ? 402  VAL A O   1 
ATOM   2703  C  CB  . VAL A  1  374 ? 12.890  39.103  21.830  1.00 34.74  ? 402  VAL A CB  1 
ATOM   2704  C  CG1 . VAL A  1  374 ? 13.721  40.403  22.002  1.00 33.29  ? 402  VAL A CG1 1 
ATOM   2705  C  CG2 . VAL A  1  374 ? 11.407  39.385  21.934  1.00 33.16  ? 402  VAL A CG2 1 
ATOM   2706  N  N   . ASP A  1  375 ? 15.292  37.372  21.245  1.00 34.21  ? 403  ASP A N   1 
ATOM   2707  C  CA  . ASP A  1  375 ? 16.740  37.115  21.270  1.00 33.54  ? 403  ASP A CA  1 
ATOM   2708  C  C   . ASP A  1  375 ? 17.181  36.206  20.124  1.00 33.33  ? 403  ASP A C   1 
ATOM   2709  O  O   . ASP A  1  375 ? 18.274  36.372  19.581  1.00 33.65  ? 403  ASP A O   1 
ATOM   2710  C  CB  . ASP A  1  375 ? 17.178  36.532  22.629  1.00 33.49  ? 403  ASP A CB  1 
ATOM   2711  C  CG  . ASP A  1  375 ? 17.211  37.586  23.741  1.00 31.43  ? 403  ASP A CG  1 
ATOM   2712  O  OD1 . ASP A  1  375 ? 17.536  38.744  23.420  1.00 29.08  ? 403  ASP A OD1 1 
ATOM   2713  O  OD2 . ASP A  1  375 ? 16.918  37.256  24.920  1.00 27.51  ? 403  ASP A OD2 1 
ATOM   2714  N  N   . CYS A  1  376 ? 16.327  35.253  19.768  1.00 32.83  ? 404  CYS A N   1 
ATOM   2715  C  CA  . CYS A  1  376 ? 16.545  34.382  18.619  1.00 32.82  ? 404  CYS A CA  1 
ATOM   2716  C  C   . CYS A  1  376 ? 15.206  34.198  17.918  1.00 32.89  ? 404  CYS A C   1 
ATOM   2717  O  O   . CYS A  1  376 ? 14.164  34.516  18.501  1.00 33.07  ? 404  CYS A O   1 
ATOM   2718  C  CB  . CYS A  1  376 ? 17.097  33.014  19.062  1.00 32.64  ? 404  CYS A CB  1 
ATOM   2719  S  SG  . CYS A  1  376 ? 18.579  33.068  20.097  1.00 32.82  ? 404  CYS A SG  1 
ATOM   2720  N  N   . PRO A  1  377 ? 15.205  33.666  16.682  1.00 32.78  ? 405  PRO A N   1 
ATOM   2721  C  CA  . PRO A  1  377 ? 13.912  33.485  16.072  1.00 32.98  ? 405  PRO A CA  1 
ATOM   2722  C  C   . PRO A  1  377 ? 13.093  32.549  16.938  1.00 33.31  ? 405  PRO A C   1 
ATOM   2723  O  O   . PRO A  1  377 ? 13.657  31.707  17.656  1.00 33.00  ? 405  PRO A O   1 
ATOM   2724  C  CB  . PRO A  1  377 ? 14.246  32.821  14.729  1.00 32.87  ? 405  PRO A CB  1 
ATOM   2725  C  CG  . PRO A  1  377 ? 15.610  33.184  14.458  1.00 32.55  ? 405  PRO A CG  1 
ATOM   2726  C  CD  . PRO A  1  377 ? 16.272  33.181  15.797  1.00 33.12  ? 405  PRO A CD  1 
ATOM   2727  N  N   . TYR A  1  378 ? 11.776  32.708  16.879  1.00 33.98  ? 406  TYR A N   1 
ATOM   2728  C  CA  . TYR A  1  378 ? 10.871  31.915  17.704  1.00 34.89  ? 406  TYR A CA  1 
ATOM   2729  C  C   . TYR A  1  378 ? 11.121  30.412  17.595  1.00 34.64  ? 406  TYR A C   1 
ATOM   2730  O  O   . TYR A  1  378 ? 11.034  29.704  18.596  1.00 34.77  ? 406  TYR A O   1 
ATOM   2731  C  CB  . TYR A  1  378 ? 9.412   32.223  17.355  1.00 35.70  ? 406  TYR A CB  1 
ATOM   2732  C  CG  . TYR A  1  378 ? 8.419   31.776  18.412  1.00 37.33  ? 406  TYR A CG  1 
ATOM   2733  C  CD1 . TYR A  1  378 ? 8.023   32.640  19.443  1.00 38.21  ? 406  TYR A CD1 1 
ATOM   2734  C  CD2 . TYR A  1  378 ? 7.879   30.489  18.389  1.00 38.61  ? 406  TYR A CD2 1 
ATOM   2735  C  CE1 . TYR A  1  378 ? 7.110   32.225  20.414  1.00 38.96  ? 406  TYR A CE1 1 
ATOM   2736  C  CE2 . TYR A  1  378 ? 6.966   30.068  19.357  1.00 38.56  ? 406  TYR A CE2 1 
ATOM   2737  C  CZ  . TYR A  1  378 ? 6.583   30.938  20.358  1.00 37.96  ? 406  TYR A CZ  1 
ATOM   2738  O  OH  . TYR A  1  378 ? 5.677   30.512  21.301  1.00 37.82  ? 406  TYR A OH  1 
ATOM   2739  N  N   . LEU A  1  379 ? 11.436  29.937  16.387  1.00 34.46  ? 407  LEU A N   1 
ATOM   2740  C  CA  . LEU A  1  379 ? 11.534  28.498  16.121  1.00 34.33  ? 407  LEU A CA  1 
ATOM   2741  C  C   . LEU A  1  379 ? 12.943  27.911  16.220  1.00 34.47  ? 407  LEU A C   1 
ATOM   2742  O  O   . LEU A  1  379 ? 13.189  26.807  15.741  1.00 34.31  ? 407  LEU A O   1 
ATOM   2743  C  CB  . LEU A  1  379 ? 10.877  28.145  14.778  1.00 34.18  ? 407  LEU A CB  1 
ATOM   2744  C  CG  . LEU A  1  379 ? 9.340   27.982  14.807  1.00 34.90  ? 407  LEU A CG  1 
ATOM   2745  C  CD1 . LEU A  1  379 ? 8.782   27.655  13.425  1.00 36.11  ? 407  LEU A CD1 1 
ATOM   2746  C  CD2 . LEU A  1  379 ? 8.838   26.931  15.822  1.00 34.75  ? 407  LEU A CD2 1 
ATOM   2747  N  N   . ALA A  1  380 ? 13.857  28.645  16.856  1.00 34.71  ? 408  ALA A N   1 
ATOM   2748  C  CA  . ALA A  1  380 ? 15.209  28.153  17.090  1.00 34.80  ? 408  ALA A CA  1 
ATOM   2749  C  C   . ALA A  1  380 ? 15.218  26.997  18.092  1.00 34.85  ? 408  ALA A C   1 
ATOM   2750  O  O   . ALA A  1  380 ? 14.268  26.810  18.852  1.00 35.04  ? 408  ALA A O   1 
ATOM   2751  C  CB  . ALA A  1  380 ? 16.088  29.272  17.586  1.00 35.03  ? 408  ALA A CB  1 
ATOM   2752  N  N   . THR A  1  381 ? 16.297  26.222  18.086  1.00 34.68  ? 409  THR A N   1 
ATOM   2753  C  CA  . THR A  1  381 ? 16.506  25.202  19.100  1.00 34.45  ? 409  THR A CA  1 
ATOM   2754  C  C   . THR A  1  381 ? 17.239  25.859  20.261  1.00 34.41  ? 409  THR A C   1 
ATOM   2755  O  O   . THR A  1  381 ? 18.281  26.488  20.071  1.00 34.19  ? 409  THR A O   1 
ATOM   2756  C  CB  . THR A  1  381 ? 17.320  24.019  18.544  1.00 34.50  ? 409  THR A CB  1 
ATOM   2757  O  OG1 . THR A  1  381 ? 16.636  23.472  17.411  1.00 35.29  ? 409  THR A OG1 1 
ATOM   2758  C  CG2 . THR A  1  381 ? 17.511  22.925  19.598  1.00 33.73  ? 409  THR A CG2 1 
ATOM   2759  N  N   . TYR A  1  382 ? 16.675  25.710  21.456  1.00 34.38  ? 410  TYR A N   1 
ATOM   2760  C  CA  . TYR A  1  382 ? 17.212  26.325  22.665  1.00 34.20  ? 410  TYR A CA  1 
ATOM   2761  C  C   . TYR A  1  382 ? 17.869  25.290  23.573  1.00 34.57  ? 410  TYR A C   1 
ATOM   2762  O  O   . TYR A  1  382 ? 17.382  24.160  23.669  1.00 34.48  ? 410  TYR A O   1 
ATOM   2763  C  CB  . TYR A  1  382 ? 16.102  27.079  23.386  1.00 33.38  ? 410  TYR A CB  1 
ATOM   2764  C  CG  . TYR A  1  382 ? 15.663  28.315  22.627  1.00 32.61  ? 410  TYR A CG  1 
ATOM   2765  C  CD1 . TYR A  1  382 ? 14.573  28.275  21.764  1.00 30.89  ? 410  TYR A CD1 1 
ATOM   2766  C  CD2 . TYR A  1  382 ? 16.359  29.529  22.761  1.00 31.41  ? 410  TYR A CD2 1 
ATOM   2767  C  CE1 . TYR A  1  382 ? 14.169  29.410  21.068  1.00 31.57  ? 410  TYR A CE1 1 
ATOM   2768  C  CE2 . TYR A  1  382 ? 15.969  30.669  22.069  1.00 30.37  ? 410  TYR A CE2 1 
ATOM   2769  C  CZ  . TYR A  1  382 ? 14.872  30.610  21.225  1.00 31.99  ? 410  TYR A CZ  1 
ATOM   2770  O  OH  . TYR A  1  382 ? 14.477  31.745  20.532  1.00 31.98  ? 410  TYR A OH  1 
ATOM   2771  N  N   . VAL A  1  383 ? 18.987  25.662  24.208  1.00 34.54  ? 411  VAL A N   1 
ATOM   2772  C  CA  . VAL A  1  383 ? 19.781  24.707  24.996  1.00 34.54  ? 411  VAL A CA  1 
ATOM   2773  C  C   . VAL A  1  383 ? 20.202  25.292  26.334  1.00 34.42  ? 411  VAL A C   1 
ATOM   2774  O  O   . VAL A  1  383 ? 20.651  26.427  26.407  1.00 34.61  ? 411  VAL A O   1 
ATOM   2775  C  CB  . VAL A  1  383 ? 21.045  24.214  24.240  1.00 34.84  ? 411  VAL A CB  1 
ATOM   2776  C  CG1 . VAL A  1  383 ? 21.806  23.176  25.057  1.00 34.96  ? 411  VAL A CG1 1 
ATOM   2777  C  CG2 . VAL A  1  383 ? 20.690  23.628  22.877  1.00 35.41  ? 411  VAL A CG2 1 
ATOM   2778  N  N   . ASP A  1  384 ? 20.065  24.498  27.391  1.00 34.39  ? 412  ASP A N   1 
ATOM   2779  C  CA  . ASP A  1  384 ? 20.451  24.911  28.733  1.00 34.09  ? 412  ASP A CA  1 
ATOM   2780  C  C   . ASP A  1  384 ? 21.962  24.863  28.963  1.00 34.26  ? 412  ASP A C   1 
ATOM   2781  O  O   . ASP A  1  384 ? 22.695  24.184  28.227  1.00 34.05  ? 412  ASP A O   1 
ATOM   2782  C  CB  . ASP A  1  384 ? 19.717  24.053  29.755  1.00 33.82  ? 412  ASP A CB  1 
ATOM   2783  C  CG  . ASP A  1  384 ? 18.215  24.254  29.704  1.00 33.28  ? 412  ASP A CG  1 
ATOM   2784  O  OD1 . ASP A  1  384 ? 17.769  25.154  28.969  1.00 33.59  ? 412  ASP A OD1 1 
ATOM   2785  O  OD2 . ASP A  1  384 ? 17.478  23.523  30.398  1.00 32.14  ? 412  ASP A OD2 1 
ATOM   2786  N  N   . TRP A  1  385 ? 22.421  25.604  29.975  1.00 34.35  ? 413  TRP A N   1 
ATOM   2787  C  CA  . TRP A  1  385 ? 23.827  25.560  30.404  1.00 34.25  ? 413  TRP A CA  1 
ATOM   2788  C  C   . TRP A  1  385 ? 23.941  25.294  31.893  1.00 33.99  ? 413  TRP A C   1 
ATOM   2789  O  O   . TRP A  1  385 ? 23.230  25.893  32.698  1.00 33.84  ? 413  TRP A O   1 
ATOM   2790  C  CB  . TRP A  1  385 ? 24.557  26.861  30.079  1.00 34.08  ? 413  TRP A CB  1 
ATOM   2791  C  CG  . TRP A  1  385 ? 26.052  26.845  30.373  1.00 34.06  ? 413  TRP A CG  1 
ATOM   2792  C  CD1 . TRP A  1  385 ? 26.998  26.015  29.817  1.00 33.97  ? 413  TRP A CD1 1 
ATOM   2793  C  CD2 . TRP A  1  385 ? 26.765  27.719  31.265  1.00 33.02  ? 413  TRP A CD2 1 
ATOM   2794  N  NE1 . TRP A  1  385 ? 28.250  26.320  30.310  1.00 33.31  ? 413  TRP A NE1 1 
ATOM   2795  C  CE2 . TRP A  1  385 ? 28.137  27.365  31.193  1.00 33.47  ? 413  TRP A CE2 1 
ATOM   2796  C  CE3 . TRP A  1  385 ? 26.380  28.764  32.112  1.00 32.34  ? 413  TRP A CE3 1 
ATOM   2797  C  CZ2 . TRP A  1  385 ? 29.119  28.019  31.942  1.00 33.32  ? 413  TRP A CZ2 1 
ATOM   2798  C  CZ3 . TRP A  1  385 ? 27.350  29.420  32.842  1.00 33.53  ? 413  TRP A CZ3 1 
ATOM   2799  C  CH2 . TRP A  1  385 ? 28.711  29.043  32.755  1.00 33.94  ? 413  TRP A CH2 1 
ATOM   2800  N  N   . HIS A  1  386 ? 24.861  24.401  32.247  1.00 33.74  ? 414  HIS A N   1 
ATOM   2801  C  CA  . HIS A  1  386 ? 25.082  24.048  33.632  1.00 33.38  ? 414  HIS A CA  1 
ATOM   2802  C  C   . HIS A  1  386 ? 26.420  24.595  34.114  1.00 32.71  ? 414  HIS A C   1 
ATOM   2803  O  O   . HIS A  1  386 ? 27.381  24.680  33.354  1.00 33.19  ? 414  HIS A O   1 
ATOM   2804  C  CB  . HIS A  1  386 ? 24.962  22.543  33.792  1.00 33.53  ? 414  HIS A CB  1 
ATOM   2805  C  CG  . HIS A  1  386 ? 23.765  21.973  33.095  1.00 35.43  ? 414  HIS A CG  1 
ATOM   2806  N  ND1 . HIS A  1  386 ? 22.476  22.154  33.556  1.00 36.76  ? 414  HIS A ND1 1 
ATOM   2807  C  CD2 . HIS A  1  386 ? 23.657  21.248  31.955  1.00 36.20  ? 414  HIS A CD2 1 
ATOM   2808  C  CE1 . HIS A  1  386 ? 21.627  21.552  32.740  1.00 36.11  ? 414  HIS A CE1 1 
ATOM   2809  N  NE2 . HIS A  1  386 ? 22.318  20.998  31.759  1.00 36.86  ? 414  HIS A NE2 1 
ATOM   2810  N  N   . PHE A  1  387 ? 26.455  25.011  35.372  1.00 31.98  ? 415  PHE A N   1 
ATOM   2811  C  CA  . PHE A  1  387 ? 27.624  25.643  35.949  1.00 31.72  ? 415  PHE A CA  1 
ATOM   2812  C  C   . PHE A  1  387 ? 27.649  25.431  37.465  1.00 31.67  ? 415  PHE A C   1 
ATOM   2813  O  O   . PHE A  1  387 ? 26.611  25.230  38.114  1.00 30.34  ? 415  PHE A O   1 
ATOM   2814  C  CB  . PHE A  1  387 ? 27.631  27.152  35.638  1.00 31.58  ? 415  PHE A CB  1 
ATOM   2815  C  CG  . PHE A  1  387 ? 26.476  27.909  36.265  1.00 31.96  ? 415  PHE A CG  1 
ATOM   2816  C  CD1 . PHE A  1  387 ? 26.611  28.494  37.531  1.00 32.08  ? 415  PHE A CD1 1 
ATOM   2817  C  CD2 . PHE A  1  387 ? 25.242  28.005  35.607  1.00 30.58  ? 415  PHE A CD2 1 
ATOM   2818  C  CE1 . PHE A  1  387 ? 25.535  29.192  38.129  1.00 32.81  ? 415  PHE A CE1 1 
ATOM   2819  C  CE2 . PHE A  1  387 ? 24.168  28.694  36.185  1.00 31.46  ? 415  PHE A CE2 1 
ATOM   2820  C  CZ  . PHE A  1  387 ? 24.308  29.291  37.446  1.00 32.33  ? 415  PHE A CZ  1 
ATOM   2821  N  N   . LEU A  1  388 ? 28.856  25.503  38.012  1.00 32.07  ? 416  LEU A N   1 
ATOM   2822  C  CA  . LEU A  1  388 ? 29.058  25.512  39.449  1.00 32.48  ? 416  LEU A CA  1 
ATOM   2823  C  C   . LEU A  1  388 ? 30.006  26.654  39.780  1.00 32.84  ? 416  LEU A C   1 
ATOM   2824  O  O   . LEU A  1  388 ? 31.228  26.517  39.690  1.00 32.82  ? 416  LEU A O   1 
ATOM   2825  C  CB  . LEU A  1  388 ? 29.594  24.173  39.933  1.00 32.23  ? 416  LEU A CB  1 
ATOM   2826  C  CG  . LEU A  1  388 ? 29.824  24.005  41.438  1.00 32.92  ? 416  LEU A CG  1 
ATOM   2827  C  CD1 . LEU A  1  388 ? 28.712  24.646  42.256  1.00 34.23  ? 416  LEU A CD1 1 
ATOM   2828  C  CD2 . LEU A  1  388 ? 29.931  22.527  41.763  1.00 33.12  ? 416  LEU A CD2 1 
ATOM   2829  N  N   . LEU A  1  389 ? 29.413  27.788  40.149  1.00 33.45  ? 417  LEU A N   1 
ATOM   2830  C  CA  . LEU A  1  389 ? 30.139  29.028  40.336  1.00 33.78  ? 417  LEU A CA  1 
ATOM   2831  C  C   . LEU A  1  389 ? 29.665  29.677  41.609  1.00 34.55  ? 417  LEU A C   1 
ATOM   2832  O  O   . LEU A  1  389 ? 28.478  29.995  41.744  1.00 34.70  ? 417  LEU A O   1 
ATOM   2833  C  CB  . LEU A  1  389 ? 29.912  29.961  39.145  1.00 33.38  ? 417  LEU A CB  1 
ATOM   2834  C  CG  . LEU A  1  389 ? 30.397  29.408  37.809  1.00 33.06  ? 417  LEU A CG  1 
ATOM   2835  C  CD1 . LEU A  1  389 ? 29.951  30.273  36.662  1.00 33.49  ? 417  LEU A CD1 1 
ATOM   2836  C  CD2 . LEU A  1  389 ? 31.900  29.230  37.791  1.00 32.08  ? 417  LEU A CD2 1 
ATOM   2837  N  N   . GLU A  1  390 ? 30.602  29.862  42.541  1.00 35.14  ? 418  GLU A N   1 
ATOM   2838  C  CA  . GLU A  1  390 ? 30.327  30.445  43.855  1.00 35.84  ? 418  GLU A CA  1 
ATOM   2839  C  C   . GLU A  1  390 ? 29.150  29.785  44.587  1.00 36.31  ? 418  GLU A C   1 
ATOM   2840  O  O   . GLU A  1  390 ? 28.297  30.468  45.147  1.00 36.79  ? 418  GLU A O   1 
ATOM   2841  C  CB  . GLU A  1  390 ? 30.103  31.960  43.747  1.00 35.53  ? 418  GLU A CB  1 
ATOM   2842  C  CG  . GLU A  1  390 ? 31.363  32.791  43.746  1.00 35.33  ? 418  GLU A CG  1 
ATOM   2843  C  CD  . GLU A  1  390 ? 31.080  34.294  43.748  1.00 36.38  ? 418  GLU A CD  1 
ATOM   2844  O  OE1 . GLU A  1  390 ? 30.526  34.816  44.749  1.00 36.78  ? 418  GLU A OE1 1 
ATOM   2845  O  OE2 . GLU A  1  390 ? 31.432  34.961  42.749  1.00 36.39  ? 418  GLU A OE2 1 
ATOM   2846  N  N   . SER A  1  391 ? 29.093  28.461  44.576  1.00 36.81  ? 419  SER A N   1 
ATOM   2847  C  CA  . SER A  1  391 ? 28.090  27.759  45.372  1.00 37.49  ? 419  SER A CA  1 
ATOM   2848  C  C   . SER A  1  391 ? 28.507  26.315  45.659  1.00 37.46  ? 419  SER A C   1 
ATOM   2849  O  O   . SER A  1  391 ? 29.527  25.856  45.163  1.00 37.18  ? 419  SER A O   1 
ATOM   2850  C  CB  . SER A  1  391 ? 26.713  27.815  44.696  1.00 37.68  ? 419  SER A CB  1 
ATOM   2851  O  OG  . SER A  1  391 ? 26.608  26.862  43.653  1.00 38.56  ? 419  SER A OG  1 
ATOM   2852  N  N   . GLN A  1  392 ? 27.711  25.622  46.472  1.00 37.88  ? 420  GLN A N   1 
ATOM   2853  C  CA  . GLN A  1  392 ? 27.976  24.232  46.844  1.00 38.10  ? 420  GLN A CA  1 
ATOM   2854  C  C   . GLN A  1  392 ? 27.384  23.238  45.842  1.00 37.48  ? 420  GLN A C   1 
ATOM   2855  O  O   . GLN A  1  392 ? 27.748  22.059  45.847  1.00 37.60  ? 420  GLN A O   1 
ATOM   2856  C  CB  . GLN A  1  392 ? 27.403  23.928  48.245  1.00 38.86  ? 420  GLN A CB  1 
ATOM   2857  C  CG  . GLN A  1  392 ? 28.139  24.554  49.449  1.00 40.33  ? 420  GLN A CG  1 
ATOM   2858  C  CD  . GLN A  1  392 ? 29.565  24.027  49.650  1.00 41.23  ? 420  GLN A CD  1 
ATOM   2859  O  OE1 . GLN A  1  392 ? 30.275  23.745  48.690  1.00 40.99  ? 420  GLN A OE1 1 
ATOM   2860  N  NE2 . GLN A  1  392 ? 29.983  23.912  50.904  1.00 40.73  ? 420  GLN A NE2 1 
ATOM   2861  N  N   . ALA A  1  393 ? 26.454  23.714  45.014  1.00 36.83  ? 421  ALA A N   1 
ATOM   2862  C  CA  . ALA A  1  393 ? 25.661  22.849  44.131  1.00 36.03  ? 421  ALA A CA  1 
ATOM   2863  C  C   . ALA A  1  393 ? 25.460  23.450  42.738  1.00 35.29  ? 421  ALA A C   1 
ATOM   2864  O  O   . ALA A  1  393 ? 25.296  24.654  42.601  1.00 35.18  ? 421  ALA A O   1 
ATOM   2865  C  CB  . ALA A  1  393 ? 24.307  22.536  44.775  1.00 36.04  ? 421  ALA A CB  1 
ATOM   2866  N  N   . PRO A  1  394 ? 25.469  22.608  41.695  1.00 34.96  ? 422  PRO A N   1 
ATOM   2867  C  CA  . PRO A  1  394 ? 25.325  23.164  40.359  1.00 34.62  ? 422  PRO A CA  1 
ATOM   2868  C  C   . PRO A  1  394 ? 23.948  23.784  40.121  1.00 34.42  ? 422  PRO A C   1 
ATOM   2869  O  O   . PRO A  1  394 ? 22.961  23.370  40.731  1.00 34.25  ? 422  PRO A O   1 
ATOM   2870  C  CB  . PRO A  1  394 ? 25.533  21.952  39.453  1.00 34.35  ? 422  PRO A CB  1 
ATOM   2871  C  CG  . PRO A  1  394 ? 25.126  20.793  40.287  1.00 34.95  ? 422  PRO A CG  1 
ATOM   2872  C  CD  . PRO A  1  394 ? 25.610  21.139  41.660  1.00 35.11  ? 422  PRO A CD  1 
ATOM   2873  N  N   . LYS A  1  395 ? 23.913  24.783  39.246  1.00 34.06  ? 423  LYS A N   1 
ATOM   2874  C  CA  . LYS A  1  395 ? 22.681  25.399  38.796  1.00 33.74  ? 423  LYS A CA  1 
ATOM   2875  C  C   . LYS A  1  395 ? 22.672  25.395  37.268  1.00 33.51  ? 423  LYS A C   1 
ATOM   2876  O  O   . LYS A  1  395 ? 23.660  25.016  36.626  1.00 33.22  ? 423  LYS A O   1 
ATOM   2877  C  CB  . LYS A  1  395 ? 22.576  26.831  39.315  1.00 33.72  ? 423  LYS A CB  1 
ATOM   2878  C  CG  . LYS A  1  395 ? 22.499  26.969  40.821  1.00 34.39  ? 423  LYS A CG  1 
ATOM   2879  C  CD  . LYS A  1  395 ? 22.646  28.431  41.224  1.00 36.00  ? 423  LYS A CD  1 
ATOM   2880  C  CE  . LYS A  1  395 ? 22.288  28.644  42.699  1.00 38.16  ? 423  LYS A CE  1 
ATOM   2881  N  NZ  . LYS A  1  395 ? 23.454  28.493  43.637  1.00 37.30  ? 423  LYS A NZ  1 
ATOM   2882  N  N   . THR A  1  396 ? 21.554  25.830  36.694  1.00 33.14  ? 424  THR A N   1 
ATOM   2883  C  CA  . THR A  1  396 ? 21.335  25.777  35.263  1.00 32.75  ? 424  THR A CA  1 
ATOM   2884  C  C   . THR A  1  396 ? 20.969  27.160  34.793  1.00 32.73  ? 424  THR A C   1 
ATOM   2885  O  O   . THR A  1  396 ? 20.249  27.864  35.484  1.00 33.33  ? 424  THR A O   1 
ATOM   2886  C  CB  . THR A  1  396 ? 20.144  24.828  34.943  1.00 32.94  ? 424  THR A CB  1 
ATOM   2887  O  OG1 . THR A  1  396 ? 20.436  23.513  35.423  1.00 32.62  ? 424  THR A OG1 1 
ATOM   2888  C  CG2 . THR A  1  396 ? 19.847  24.767  33.441  1.00 31.49  ? 424  THR A CG2 1 
ATOM   2889  N  N   . ILE A  1  397 ? 21.451  27.562  33.627  1.00 32.60  ? 425  ILE A N   1 
ATOM   2890  C  CA  . ILE A  1  397 ? 20.828  28.691  32.938  1.00 32.76  ? 425  ILE A CA  1 
ATOM   2891  C  C   . ILE A  1  397 ? 20.005  28.139  31.785  1.00 32.87  ? 425  ILE A C   1 
ATOM   2892  O  O   . ILE A  1  397 ? 20.545  27.547  30.838  1.00 32.59  ? 425  ILE A O   1 
ATOM   2893  C  CB  . ILE A  1  397 ? 21.829  29.764  32.461  1.00 32.86  ? 425  ILE A CB  1 
ATOM   2894  C  CG1 . ILE A  1  397 ? 22.409  30.504  33.667  1.00 33.77  ? 425  ILE A CG1 1 
ATOM   2895  C  CG2 . ILE A  1  397 ? 21.119  30.778  31.578  1.00 31.76  ? 425  ILE A CG2 1 
ATOM   2896  C  CD1 . ILE A  1  397 ? 23.784  31.051  33.419  1.00 37.24  ? 425  ILE A CD1 1 
ATOM   2897  N  N   . ARG A  1  398 ? 18.689  28.310  31.889  1.00 32.97  ? 426  ARG A N   1 
ATOM   2898  C  CA  . ARG A  1  398 ? 17.785  27.752  30.901  1.00 33.27  ? 426  ARG A CA  1 
ATOM   2899  C  C   . ARG A  1  398 ? 17.894  28.585  29.637  1.00 33.00  ? 426  ARG A C   1 
ATOM   2900  O  O   . ARG A  1  398 ? 18.070  29.806  29.710  1.00 32.81  ? 426  ARG A O   1 
ATOM   2901  C  CB  . ARG A  1  398 ? 16.351  27.708  31.436  1.00 33.63  ? 426  ARG A CB  1 
ATOM   2902  C  CG  . ARG A  1  398 ? 16.218  27.006  32.817  1.00 36.37  ? 426  ARG A CG  1 
ATOM   2903  C  CD  . ARG A  1  398 ? 15.061  26.005  32.908  1.00 40.99  ? 426  ARG A CD  1 
ATOM   2904  N  NE  . ARG A  1  398 ? 13.771  26.557  32.464  1.00 46.33  ? 426  ARG A NE  1 
ATOM   2905  C  CZ  . ARG A  1  398 ? 13.233  26.387  31.247  1.00 48.52  ? 426  ARG A CZ  1 
ATOM   2906  N  NH1 . ARG A  1  398 ? 13.866  25.676  30.298  1.00 48.44  ? 426  ARG A NH1 1 
ATOM   2907  N  NH2 . ARG A  1  398 ? 12.053  26.944  30.969  1.00 48.63  ? 426  ARG A NH2 1 
ATOM   2908  N  N   . ASP A  1  399 ? 17.836  27.923  28.484  1.00 32.44  ? 427  ASP A N   1 
ATOM   2909  C  CA  . ASP A  1  399 ? 17.875  28.605  27.197  1.00 32.24  ? 427  ASP A CA  1 
ATOM   2910  C  C   . ASP A  1  399 ? 19.113  29.510  27.026  1.00 32.00  ? 427  ASP A C   1 
ATOM   2911  O  O   . ASP A  1  399 ? 19.018  30.643  26.527  1.00 31.63  ? 427  ASP A O   1 
ATOM   2912  C  CB  . ASP A  1  399 ? 16.578  29.393  26.985  1.00 32.48  ? 427  ASP A CB  1 
ATOM   2913  C  CG  . ASP A  1  399 ? 15.335  28.506  26.992  1.00 33.60  ? 427  ASP A CG  1 
ATOM   2914  O  OD1 . ASP A  1  399 ? 14.229  29.070  27.046  1.00 35.46  ? 427  ASP A OD1 1 
ATOM   2915  O  OD2 . ASP A  1  399 ? 15.441  27.260  26.941  1.00 34.11  ? 427  ASP A OD2 1 
ATOM   2916  N  N   . ALA A  1  400 ? 20.269  29.002  27.448  1.00 31.79  ? 428  ALA A N   1 
ATOM   2917  C  CA  . ALA A  1  400 ? 21.527  29.744  27.358  1.00 31.76  ? 428  ALA A CA  1 
ATOM   2918  C  C   . ALA A  1  400 ? 22.034  29.869  25.921  1.00 31.91  ? 428  ALA A C   1 
ATOM   2919  O  O   . ALA A  1  400 ? 22.614  30.889  25.545  1.00 31.84  ? 428  ALA A O   1 
ATOM   2920  C  CB  . ALA A  1  400 ? 22.573  29.106  28.225  1.00 31.51  ? 428  ALA A CB  1 
ATOM   2921  N  N   . PHE A  1  401 ? 21.821  28.828  25.125  1.00 31.98  ? 429  PHE A N   1 
ATOM   2922  C  CA  . PHE A  1  401 ? 22.206  28.862  23.724  1.00 32.30  ? 429  PHE A CA  1 
ATOM   2923  C  C   . PHE A  1  401 ? 20.997  28.706  22.813  1.00 32.52  ? 429  PHE A C   1 
ATOM   2924  O  O   . PHE A  1  401 ? 20.011  28.032  23.160  1.00 32.50  ? 429  PHE A O   1 
ATOM   2925  C  CB  . PHE A  1  401 ? 23.160  27.715  23.377  1.00 32.24  ? 429  PHE A CB  1 
ATOM   2926  C  CG  . PHE A  1  401 ? 24.370  27.608  24.259  1.00 32.28  ? 429  PHE A CG  1 
ATOM   2927  C  CD1 . PHE A  1  401 ? 24.308  26.913  25.473  1.00 31.46  ? 429  PHE A CD1 1 
ATOM   2928  C  CD2 . PHE A  1  401 ? 25.586  28.130  23.845  1.00 30.12  ? 429  PHE A CD2 1 
ATOM   2929  C  CE1 . PHE A  1  401 ? 25.435  26.781  26.275  1.00 30.46  ? 429  PHE A CE1 1 
ATOM   2930  C  CE2 . PHE A  1  401 ? 26.717  27.991  24.640  1.00 30.26  ? 429  PHE A CE2 1 
ATOM   2931  C  CZ  . PHE A  1  401 ? 26.640  27.317  25.854  1.00 30.87  ? 429  PHE A CZ  1 
ATOM   2932  N  N   . CYS A  1  402 ? 21.098  29.308  21.631  1.00 32.45  ? 430  CYS A N   1 
ATOM   2933  C  CA  . CYS A  1  402 ? 20.181  29.001  20.550  1.00 32.21  ? 430  CYS A CA  1 
ATOM   2934  C  C   . CYS A  1  402 ? 20.917  28.648  19.246  1.00 32.00  ? 430  CYS A C   1 
ATOM   2935  O  O   . CYS A  1  402 ? 21.929  29.263  18.878  1.00 31.64  ? 430  CYS A O   1 
ATOM   2936  C  CB  . CYS A  1  402 ? 19.158  30.121  20.349  1.00 32.18  ? 430  CYS A CB  1 
ATOM   2937  S  SG  . CYS A  1  402 ? 19.766  31.550  19.438  1.00 33.23  ? 430  CYS A SG  1 
ATOM   2938  N  N   . VAL A  1  403 ? 20.390  27.633  18.570  1.00 31.83  ? 431  VAL A N   1 
ATOM   2939  C  CA  . VAL A  1  403 ? 20.872  27.207  17.277  1.00 31.54  ? 431  VAL A CA  1 
ATOM   2940  C  C   . VAL A  1  403 ? 19.685  27.288  16.335  1.00 32.07  ? 431  VAL A C   1 
ATOM   2941  O  O   . VAL A  1  403 ? 18.564  26.908  16.708  1.00 32.58  ? 431  VAL A O   1 
ATOM   2942  C  CB  . VAL A  1  403 ? 21.388  25.750  17.322  1.00 31.45  ? 431  VAL A CB  1 
ATOM   2943  C  CG1 . VAL A  1  403 ? 22.094  25.396  16.026  1.00 31.27  ? 431  VAL A CG1 1 
ATOM   2944  C  CG2 . VAL A  1  403 ? 22.329  25.530  18.516  1.00 31.03  ? 431  VAL A CG2 1 
ATOM   2945  N  N   . PHE A  1  404 ? 19.920  27.790  15.127  1.00 32.08  ? 432  PHE A N   1 
ATOM   2946  C  CA  . PHE A  1  404 ? 18.868  27.916  14.131  1.00 32.59  ? 432  PHE A CA  1 
ATOM   2947  C  C   . PHE A  1  404 ? 19.424  28.154  12.728  1.00 32.87  ? 432  PHE A C   1 
ATOM   2948  O  O   . PHE A  1  404 ? 20.525  28.654  12.567  1.00 33.15  ? 432  PHE A O   1 
ATOM   2949  C  CB  . PHE A  1  404 ? 17.890  29.048  14.511  1.00 32.84  ? 432  PHE A CB  1 
ATOM   2950  C  CG  . PHE A  1  404 ? 18.528  30.416  14.596  1.00 32.36  ? 432  PHE A CG  1 
ATOM   2951  C  CD1 . PHE A  1  404 ? 18.465  31.291  13.522  1.00 33.11  ? 432  PHE A CD1 1 
ATOM   2952  C  CD2 . PHE A  1  404 ? 19.179  30.827  15.751  1.00 32.35  ? 432  PHE A CD2 1 
ATOM   2953  C  CE1 . PHE A  1  404 ? 19.051  32.563  13.591  1.00 33.40  ? 432  PHE A CE1 1 
ATOM   2954  C  CE2 . PHE A  1  404 ? 19.772  32.090  15.834  1.00 32.75  ? 432  PHE A CE2 1 
ATOM   2955  C  CZ  . PHE A  1  404 ? 19.700  32.964  14.752  1.00 32.86  ? 432  PHE A CZ  1 
ATOM   2956  N  N   . GLU A  1  405 ? 18.646  27.776  11.723  1.00 33.26  ? 433  GLU A N   1 
ATOM   2957  C  CA  . GLU A  1  405 ? 18.899  28.155  10.346  1.00 33.42  ? 433  GLU A CA  1 
ATOM   2958  C  C   . GLU A  1  405 ? 18.150  29.442  10.071  1.00 33.57  ? 433  GLU A C   1 
ATOM   2959  O  O   . GLU A  1  405 ? 17.070  29.653  10.615  1.00 33.70  ? 433  GLU A O   1 
ATOM   2960  C  CB  . GLU A  1  405 ? 18.408  27.072  9.394   1.00 33.46  ? 433  GLU A CB  1 
ATOM   2961  C  CG  . GLU A  1  405 ? 19.400  25.964  9.125   1.00 34.05  ? 433  GLU A CG  1 
ATOM   2962  C  CD  . GLU A  1  405 ? 19.098  25.252  7.823   1.00 35.41  ? 433  GLU A CD  1 
ATOM   2963  O  OE1 . GLU A  1  405 ? 18.027  24.631  7.740   1.00 36.98  ? 433  GLU A OE1 1 
ATOM   2964  O  OE2 . GLU A  1  405 ? 19.914  25.316  6.881   1.00 35.81  ? 433  GLU A OE2 1 
ATOM   2965  N  N   . GLN A  1  406 ? 18.720  30.289  9.218   1.00 34.04  ? 434  GLN A N   1 
ATOM   2966  C  CA  . GLN A  1  406 ? 18.144  31.594  8.903   1.00 34.49  ? 434  GLN A CA  1 
ATOM   2967  C  C   . GLN A  1  406 ? 18.249  31.909  7.417   1.00 34.57  ? 434  GLN A C   1 
ATOM   2968  O  O   . GLN A  1  406 ? 19.355  31.983  6.882   1.00 35.24  ? 434  GLN A O   1 
ATOM   2969  C  CB  . GLN A  1  406 ? 18.851  32.694  9.713   1.00 34.70  ? 434  GLN A CB  1 
ATOM   2970  C  CG  . GLN A  1  406 ? 18.444  34.131  9.360   1.00 36.19  ? 434  GLN A CG  1 
ATOM   2971  C  CD  . GLN A  1  406 ? 17.098  34.548  9.955   1.00 38.32  ? 434  GLN A CD  1 
ATOM   2972  O  OE1 . GLN A  1  406 ? 16.381  33.739  10.549  1.00 40.37  ? 434  GLN A OE1 1 
ATOM   2973  N  NE2 . GLN A  1  406 ? 16.758  35.821  9.805   1.00 39.42  ? 434  GLN A NE2 1 
ATOM   2974  N  N   . ASN A  1  407 ? 17.107  32.107  6.757   1.00 34.42  ? 435  ASN A N   1 
ATOM   2975  C  CA  . ASN A  1  407 ? 17.087  32.625  5.401   1.00 34.13  ? 435  ASN A CA  1 
ATOM   2976  C  C   . ASN A  1  407 ? 17.486  34.090  5.426   1.00 34.59  ? 435  ASN A C   1 
ATOM   2977  O  O   . ASN A  1  407 ? 16.775  34.927  5.991   1.00 34.46  ? 435  ASN A O   1 
ATOM   2978  C  CB  . ASN A  1  407 ? 15.707  32.473  4.770   1.00 34.26  ? 435  ASN A CB  1 
ATOM   2979  C  CG  . ASN A  1  407 ? 15.731  32.686  3.271   1.00 34.22  ? 435  ASN A CG  1 
ATOM   2980  O  OD1 . ASN A  1  407 ? 16.311  33.662  2.775   1.00 35.82  ? 435  ASN A OD1 1 
ATOM   2981  N  ND2 . ASN A  1  407 ? 15.131  31.761  2.535   1.00 32.62  ? 435  ASN A ND2 1 
ATOM   2982  N  N   . GLN A  1  408 ? 18.634  34.394  4.825   1.00 34.86  ? 436  GLN A N   1 
ATOM   2983  C  CA  . GLN A  1  408 ? 19.173  35.748  4.852   1.00 35.10  ? 436  GLN A CA  1 
ATOM   2984  C  C   . GLN A  1  408 ? 18.335  36.735  4.052   1.00 35.14  ? 436  GLN A C   1 
ATOM   2985  O  O   . GLN A  1  408 ? 18.401  37.930  4.303   1.00 35.45  ? 436  GLN A O   1 
ATOM   2986  C  CB  . GLN A  1  408 ? 20.609  35.775  4.326   1.00 35.43  ? 436  GLN A CB  1 
ATOM   2987  C  CG  . GLN A  1  408 ? 21.616  34.994  5.146   1.00 36.18  ? 436  GLN A CG  1 
ATOM   2988  C  CD  . GLN A  1  408 ? 21.882  35.619  6.495   1.00 36.81  ? 436  GLN A CD  1 
ATOM   2989  O  OE1 . GLN A  1  408 ? 21.005  35.660  7.359   1.00 36.80  ? 436  GLN A OE1 1 
ATOM   2990  N  NE2 . GLN A  1  408 ? 23.101  36.100  6.687   1.00 37.11  ? 436  GLN A NE2 1 
ATOM   2991  N  N   . GLY A  1  409 ? 17.553  36.237  3.093   1.00 35.23  ? 437  GLY A N   1 
ATOM   2992  C  CA  . GLY A  1  409 ? 16.758  37.091  2.214   1.00 34.93  ? 437  GLY A CA  1 
ATOM   2993  C  C   . GLY A  1  409 ? 17.610  37.672  1.103   1.00 35.08  ? 437  GLY A C   1 
ATOM   2994  O  O   . GLY A  1  409 ? 17.192  38.596  0.390   1.00 35.43  ? 437  GLY A O   1 
ATOM   2995  N  N   . LEU A  1  410 ? 18.800  37.098  0.956   1.00 34.64  ? 438  LEU A N   1 
ATOM   2996  C  CA  . LEU A  1  410 ? 19.815  37.531  0.014   1.00 34.28  ? 438  LEU A CA  1 
ATOM   2997  C  C   . LEU A  1  410 ? 20.312  36.306  -0.769  1.00 33.42  ? 438  LEU A C   1 
ATOM   2998  O  O   . LEU A  1  410 ? 20.341  35.204  -0.222  1.00 33.26  ? 438  LEU A O   1 
ATOM   2999  C  CB  . LEU A  1  410 ? 20.963  38.143  0.822   1.00 34.75  ? 438  LEU A CB  1 
ATOM   3000  C  CG  . LEU A  1  410 ? 22.152  38.779  0.105   1.00 35.62  ? 438  LEU A CG  1 
ATOM   3001  C  CD1 . LEU A  1  410 ? 21.751  40.163  -0.425  1.00 37.17  ? 438  LEU A CD1 1 
ATOM   3002  C  CD2 . LEU A  1  410 ? 23.348  38.861  1.032   1.00 34.81  ? 438  LEU A CD2 1 
ATOM   3003  N  N   . PRO A  1  411 ? 20.692  36.476  -2.056  1.00 32.84  ? 439  PRO A N   1 
ATOM   3004  C  CA  . PRO A  1  411 ? 21.284  35.332  -2.767  1.00 31.92  ? 439  PRO A CA  1 
ATOM   3005  C  C   . PRO A  1  411 ? 22.728  35.051  -2.338  1.00 31.20  ? 439  PRO A C   1 
ATOM   3006  O  O   . PRO A  1  411 ? 23.478  35.977  -2.048  1.00 30.86  ? 439  PRO A O   1 
ATOM   3007  C  CB  . PRO A  1  411 ? 21.255  35.777  -4.235  1.00 31.97  ? 439  PRO A CB  1 
ATOM   3008  C  CG  . PRO A  1  411 ? 21.357  37.235  -4.190  1.00 32.25  ? 439  PRO A CG  1 
ATOM   3009  C  CD  . PRO A  1  411 ? 20.597  37.661  -2.928  1.00 32.99  ? 439  PRO A CD  1 
ATOM   3010  N  N   . LEU A  1  412 ? 23.108  33.778  -2.287  1.00 30.51  ? 440  LEU A N   1 
ATOM   3011  C  CA  . LEU A  1  412 ? 24.499  33.416  -2.051  1.00 29.83  ? 440  LEU A CA  1 
ATOM   3012  C  C   . LEU A  1  412 ? 25.294  33.705  -3.323  1.00 29.34  ? 440  LEU A C   1 
ATOM   3013  O  O   . LEU A  1  412 ? 26.436  34.153  -3.273  1.00 29.40  ? 440  LEU A O   1 
ATOM   3014  C  CB  . LEU A  1  412 ? 24.610  31.945  -1.669  1.00 29.59  ? 440  LEU A CB  1 
ATOM   3015  C  CG  . LEU A  1  412 ? 25.988  31.416  -1.265  1.00 29.13  ? 440  LEU A CG  1 
ATOM   3016  C  CD1 . LEU A  1  412 ? 26.432  31.991  0.057   1.00 28.31  ? 440  LEU A CD1 1 
ATOM   3017  C  CD2 . LEU A  1  412 ? 25.953  29.918  -1.178  1.00 27.70  ? 440  LEU A CD2 1 
ATOM   3018  N  N   . ARG A  1  413 ? 24.662  33.446  -4.459  1.00 28.82  ? 441  ARG A N   1 
ATOM   3019  C  CA  . ARG A  1  413 ? 25.256  33.622  -5.788  1.00 28.95  ? 441  ARG A CA  1 
ATOM   3020  C  C   . ARG A  1  413 ? 24.084  33.719  -6.713  1.00 28.54  ? 441  ARG A C   1 
ATOM   3021  O  O   . ARG A  1  413 ? 22.993  33.222  -6.401  1.00 28.86  ? 441  ARG A O   1 
ATOM   3022  C  CB  . ARG A  1  413 ? 26.163  32.444  -6.216  1.00 28.55  ? 441  ARG A CB  1 
ATOM   3023  C  CG  . ARG A  1  413 ? 25.877  31.127  -5.512  1.00 29.64  ? 441  ARG A CG  1 
ATOM   3024  C  CD  . ARG A  1  413 ? 26.438  29.927  -6.213  1.00 29.49  ? 441  ARG A CD  1 
ATOM   3025  N  NE  . ARG A  1  413 ? 25.493  29.444  -7.207  1.00 33.93  ? 441  ARG A NE  1 
ATOM   3026  C  CZ  . ARG A  1  413 ? 24.986  28.217  -7.247  1.00 34.51  ? 441  ARG A CZ  1 
ATOM   3027  N  NH1 . ARG A  1  413 ? 25.326  27.310  -6.356  1.00 36.30  ? 441  ARG A NH1 1 
ATOM   3028  N  NH2 . ARG A  1  413 ? 24.136  27.895  -8.199  1.00 35.97  ? 441  ARG A NH2 1 
ATOM   3029  N  N   . ARG A  1  414 ? 24.297  34.378  -7.841  1.00 28.38  ? 442  ARG A N   1 
ATOM   3030  C  CA  . ARG A  1  414 ? 23.237  34.573  -8.810  1.00 28.32  ? 442  ARG A CA  1 
ATOM   3031  C  C   . ARG A  1  414 ? 23.791  35.002  -10.158 1.00 28.59  ? 442  ARG A C   1 
ATOM   3032  O  O   . ARG A  1  414 ? 24.652  35.892  -10.217 1.00 28.34  ? 442  ARG A O   1 
ATOM   3033  C  CB  . ARG A  1  414 ? 22.309  35.670  -8.330  1.00 28.03  ? 442  ARG A CB  1 
ATOM   3034  C  CG  . ARG A  1  414 ? 21.550  36.204  -9.450  1.00 28.37  ? 442  ARG A CG  1 
ATOM   3035  C  CD  . ARG A  1  414 ? 21.354  37.650  -9.370  1.00 27.88  ? 442  ARG A CD  1 
ATOM   3036  N  NE  . ARG A  1  414 ? 20.006  37.867  -9.888  1.00 28.47  ? 442  ARG A NE  1 
ATOM   3037  C  CZ  . ARG A  1  414 ? 19.710  38.466  -11.024 1.00 26.17  ? 442  ARG A CZ  1 
ATOM   3038  N  NH1 . ARG A  1  414 ? 20.660  38.985  -11.783 1.00 25.99  ? 442  ARG A NH1 1 
ATOM   3039  N  NH2 . ARG A  1  414 ? 18.437  38.583  -11.363 1.00 28.54  ? 442  ARG A NH2 1 
ATOM   3040  N  N   . HIS A  1  415 ? 23.281  34.391  -11.232 1.00 28.94  ? 443  HIS A N   1 
ATOM   3041  C  CA  . HIS A  1  415 ? 23.511  34.913  -12.583 1.00 29.53  ? 443  HIS A CA  1 
ATOM   3042  C  C   . HIS A  1  415 ? 22.297  34.834  -13.495 1.00 30.37  ? 443  HIS A C   1 
ATOM   3043  O  O   . HIS A  1  415 ? 21.790  33.740  -13.784 1.00 30.57  ? 443  HIS A O   1 
ATOM   3044  C  CB  . HIS A  1  415 ? 24.725  34.281  -13.279 1.00 29.14  ? 443  HIS A CB  1 
ATOM   3045  C  CG  . HIS A  1  415 ? 25.070  34.938  -14.582 1.00 28.37  ? 443  HIS A CG  1 
ATOM   3046  N  ND1 . HIS A  1  415 ? 25.549  36.229  -14.659 1.00 27.06  ? 443  HIS A ND1 1 
ATOM   3047  C  CD2 . HIS A  1  415 ? 24.992  34.489  -15.858 1.00 28.65  ? 443  HIS A CD2 1 
ATOM   3048  C  CE1 . HIS A  1  415 ? 25.755  36.545  -15.926 1.00 27.56  ? 443  HIS A CE1 1 
ATOM   3049  N  NE2 . HIS A  1  415 ? 25.418  35.511  -16.676 1.00 27.55  ? 443  HIS A NE2 1 
ATOM   3050  N  N   . HIS A  1  416 ? 21.851  36.003  -13.949 1.00 31.08  ? 444  HIS A N   1 
ATOM   3051  C  CA  . HIS A  1  416 ? 20.841  36.094  -14.982 1.00 32.12  ? 444  HIS A CA  1 
ATOM   3052  C  C   . HIS A  1  416 ? 21.491  36.405  -16.336 1.00 32.98  ? 444  HIS A C   1 
ATOM   3053  O  O   . HIS A  1  416 ? 22.167  37.424  -16.498 1.00 33.16  ? 444  HIS A O   1 
ATOM   3054  C  CB  . HIS A  1  416 ? 19.819  37.170  -14.644 1.00 31.83  ? 444  HIS A CB  1 
ATOM   3055  C  CG  . HIS A  1  416 ? 18.777  37.336  -15.695 1.00 31.91  ? 444  HIS A CG  1 
ATOM   3056  N  ND1 . HIS A  1  416 ? 17.545  36.727  -15.617 1.00 32.34  ? 444  HIS A ND1 1 
ATOM   3057  C  CD2 . HIS A  1  416 ? 18.795  38.002  -16.872 1.00 32.34  ? 444  HIS A CD2 1 
ATOM   3058  C  CE1 . HIS A  1  416 ? 16.835  37.038  -16.687 1.00 32.00  ? 444  HIS A CE1 1 
ATOM   3059  N  NE2 . HIS A  1  416 ? 17.572  37.806  -17.468 1.00 31.62  ? 444  HIS A NE2 1 
ATOM   3060  N  N   . SER A  1  417 ? 21.280  35.530  -17.310 1.00 34.07  ? 445  SER A N   1 
ATOM   3061  C  CA  . SER A  1  417 ? 21.893  35.714  -18.618 1.00 34.88  ? 445  SER A CA  1 
ATOM   3062  C  C   . SER A  1  417 ? 20.881  36.028  -19.704 1.00 36.01  ? 445  SER A C   1 
ATOM   3063  O  O   . SER A  1  417 ? 19.972  35.232  -19.968 1.00 35.94  ? 445  SER A O   1 
ATOM   3064  C  CB  . SER A  1  417 ? 22.699  34.491  -19.017 1.00 34.47  ? 445  SER A CB  1 
ATOM   3065  O  OG  . SER A  1  417 ? 23.243  34.686  -20.306 1.00 34.13  ? 445  SER A OG  1 
ATOM   3066  N  N   . ASP A  1  418 ? 21.064  37.193  -20.326 1.00 37.49  ? 446  ASP A N   1 
ATOM   3067  C  CA  . ASP A  1  418 ? 20.291  37.626  -21.493 1.00 38.77  ? 446  ASP A CA  1 
ATOM   3068  C  C   . ASP A  1  418 ? 21.167  37.556  -22.730 1.00 39.35  ? 446  ASP A C   1 
ATOM   3069  O  O   . ASP A  1  418 ? 20.738  37.925  -23.830 1.00 39.49  ? 446  ASP A O   1 
ATOM   3070  C  CB  . ASP A  1  418 ? 19.842  39.080  -21.331 1.00 38.85  ? 446  ASP A CB  1 
ATOM   3071  C  CG  . ASP A  1  418 ? 18.677  39.235  -20.383 1.00 40.49  ? 446  ASP A CG  1 
ATOM   3072  O  OD1 . ASP A  1  418 ? 17.778  38.356  -20.373 1.00 41.43  ? 446  ASP A OD1 1 
ATOM   3073  O  OD2 . ASP A  1  418 ? 18.661  40.255  -19.652 1.00 42.07  ? 446  ASP A OD2 1 
ATOM   3074  N  N   . LEU A  1  419 ? 22.397  37.081  -22.540 1.00 39.83  ? 447  LEU A N   1 
ATOM   3075  C  CA  . LEU A  1  419 ? 23.445  37.207  -23.544 1.00 40.12  ? 447  LEU A CA  1 
ATOM   3076  C  C   . LEU A  1  419 ? 23.843  35.864  -24.142 1.00 40.38  ? 447  LEU A C   1 
ATOM   3077  O  O   . LEU A  1  419 ? 24.383  35.010  -23.436 1.00 40.76  ? 447  LEU A O   1 
ATOM   3078  C  CB  . LEU A  1  419 ? 24.656  37.891  -22.902 1.00 40.11  ? 447  LEU A CB  1 
ATOM   3079  C  CG  . LEU A  1  419 ? 25.887  38.290  -23.714 1.00 40.15  ? 447  LEU A CG  1 
ATOM   3080  C  CD1 . LEU A  1  419 ? 25.516  39.075  -24.982 1.00 39.11  ? 447  LEU A CD1 1 
ATOM   3081  C  CD2 . LEU A  1  419 ? 26.843  39.075  -22.800 1.00 39.69  ? 447  LEU A CD2 1 
ATOM   3082  N  N   . TYR A  1  420 ? 23.575  35.697  -25.440 1.00 40.52  ? 448  TYR A N   1 
ATOM   3083  C  CA  . TYR A  1  420 ? 23.952  34.505  -26.235 1.00 40.86  ? 448  TYR A CA  1 
ATOM   3084  C  C   . TYR A  1  420 ? 23.176  33.230  -25.890 1.00 40.91  ? 448  TYR A C   1 
ATOM   3085  O  O   . TYR A  1  420 ? 22.675  32.549  -26.789 1.00 41.11  ? 448  TYR A O   1 
ATOM   3086  C  CB  . TYR A  1  420 ? 25.475  34.244  -26.221 1.00 41.13  ? 448  TYR A CB  1 
ATOM   3087  C  CG  . TYR A  1  420 ? 26.328  35.426  -26.645 1.00 41.30  ? 448  TYR A CG  1 
ATOM   3088  C  CD1 . TYR A  1  420 ? 27.448  35.797  -25.904 1.00 41.62  ? 448  TYR A CD1 1 
ATOM   3089  C  CD2 . TYR A  1  420 ? 26.012  36.178  -27.780 1.00 42.17  ? 448  TYR A CD2 1 
ATOM   3090  C  CE1 . TYR A  1  420 ? 28.247  36.888  -26.281 1.00 41.80  ? 448  TYR A CE1 1 
ATOM   3091  C  CE2 . TYR A  1  420 ? 26.799  37.278  -28.168 1.00 42.72  ? 448  TYR A CE2 1 
ATOM   3092  C  CZ  . TYR A  1  420 ? 27.917  37.624  -27.413 1.00 42.12  ? 448  TYR A CZ  1 
ATOM   3093  O  OH  . TYR A  1  420 ? 28.697  38.702  -27.789 1.00 41.24  ? 448  TYR A OH  1 
ATOM   3094  N  N   . SER A  1  421 ? 23.113  32.914  -24.594 1.00 40.78  ? 449  SER A N   1 
ATOM   3095  C  CA  . SER A  1  421 ? 22.364  31.785  -24.037 1.00 40.45  ? 449  SER A CA  1 
ATOM   3096  C  C   . SER A  1  421 ? 21.525  32.314  -22.863 1.00 40.17  ? 449  SER A C   1 
ATOM   3097  O  O   . SER A  1  421 ? 22.049  33.017  -21.983 1.00 39.88  ? 449  SER A O   1 
ATOM   3098  C  CB  . SER A  1  421 ? 23.338  30.705  -23.554 1.00 40.62  ? 449  SER A CB  1 
ATOM   3099  O  OG  . SER A  1  421 ? 22.666  29.565  -23.034 1.00 41.55  ? 449  SER A OG  1 
ATOM   3100  N  N   . HIS A  1  422 ? 20.233  31.983  -22.856 1.00 39.71  ? 450  HIS A N   1 
ATOM   3101  C  CA  . HIS A  1  422 ? 19.282  32.523  -21.863 1.00 39.63  ? 450  HIS A CA  1 
ATOM   3102  C  C   . HIS A  1  422 ? 18.986  31.510  -20.752 1.00 38.76  ? 450  HIS A C   1 
ATOM   3103  O  O   . HIS A  1  422 ? 18.364  30.468  -20.997 1.00 38.78  ? 450  HIS A O   1 
ATOM   3104  C  CB  . HIS A  1  422 ? 17.977  32.970  -22.537 1.00 39.86  ? 450  HIS A CB  1 
ATOM   3105  C  CG  . HIS A  1  422 ? 18.152  34.075  -23.536 1.00 42.56  ? 450  HIS A CG  1 
ATOM   3106  N  ND1 . HIS A  1  422 ? 17.088  34.795  -24.038 1.00 45.45  ? 450  HIS A ND1 1 
ATOM   3107  C  CD2 . HIS A  1  422 ? 19.263  34.591  -24.119 1.00 44.64  ? 450  HIS A CD2 1 
ATOM   3108  C  CE1 . HIS A  1  422 ? 17.535  35.696  -24.898 1.00 45.97  ? 450  HIS A CE1 1 
ATOM   3109  N  NE2 . HIS A  1  422 ? 18.851  35.594  -24.964 1.00 45.79  ? 450  HIS A NE2 1 
ATOM   3110  N  N   . TYR A  1  423 ? 19.447  31.826  -19.541 1.00 37.48  ? 451  TYR A N   1 
ATOM   3111  C  CA  . TYR A  1  423 ? 19.340  30.934  -18.386 1.00 36.36  ? 451  TYR A CA  1 
ATOM   3112  C  C   . TYR A  1  423 ? 19.429  31.764  -17.097 1.00 36.02  ? 451  TYR A C   1 
ATOM   3113  O  O   . TYR A  1  423 ? 19.837  32.927  -17.122 1.00 36.01  ? 451  TYR A O   1 
ATOM   3114  C  CB  . TYR A  1  423 ? 20.452  29.860  -18.421 1.00 35.86  ? 451  TYR A CB  1 
ATOM   3115  C  CG  . TYR A  1  423 ? 21.848  30.451  -18.380 1.00 35.15  ? 451  TYR A CG  1 
ATOM   3116  C  CD1 . TYR A  1  423 ? 22.482  30.695  -17.170 1.00 34.34  ? 451  TYR A CD1 1 
ATOM   3117  C  CD2 . TYR A  1  423 ? 22.525  30.782  -19.550 1.00 34.91  ? 451  TYR A CD2 1 
ATOM   3118  C  CE1 . TYR A  1  423 ? 23.762  31.259  -17.120 1.00 35.29  ? 451  TYR A CE1 1 
ATOM   3119  C  CE2 . TYR A  1  423 ? 23.814  31.342  -19.511 1.00 35.30  ? 451  TYR A CE2 1 
ATOM   3120  C  CZ  . TYR A  1  423 ? 24.417  31.582  -18.291 1.00 34.91  ? 451  TYR A CZ  1 
ATOM   3121  O  OH  . TYR A  1  423 ? 25.661  32.146  -18.230 1.00 34.47  ? 451  TYR A OH  1 
ATOM   3122  N  N   . PHE A  1  424 ? 19.046  31.157  -15.979 1.00 35.41  ? 452  PHE A N   1 
ATOM   3123  C  CA  . PHE A  1  424 ? 19.264  31.740  -14.666 1.00 35.17  ? 452  PHE A CA  1 
ATOM   3124  C  C   . PHE A  1  424 ? 19.865  30.681  -13.744 1.00 35.49  ? 452  PHE A C   1 
ATOM   3125  O  O   . PHE A  1  424 ? 19.496  29.501  -13.823 1.00 36.09  ? 452  PHE A O   1 
ATOM   3126  C  CB  . PHE A  1  424 ? 17.954  32.285  -14.084 1.00 34.81  ? 452  PHE A CB  1 
ATOM   3127  C  CG  . PHE A  1  424 ? 18.077  32.775  -12.666 1.00 33.90  ? 452  PHE A CG  1 
ATOM   3128  C  CD1 . PHE A  1  424 ? 18.444  34.090  -12.399 1.00 32.97  ? 452  PHE A CD1 1 
ATOM   3129  C  CD2 . PHE A  1  424 ? 17.839  31.916  -11.597 1.00 33.11  ? 452  PHE A CD2 1 
ATOM   3130  C  CE1 . PHE A  1  424 ? 18.564  34.545  -11.088 1.00 33.35  ? 452  PHE A CE1 1 
ATOM   3131  C  CE2 . PHE A  1  424 ? 17.958  32.360  -10.285 1.00 33.53  ? 452  PHE A CE2 1 
ATOM   3132  C  CZ  . PHE A  1  424 ? 18.326  33.677  -10.030 1.00 33.92  ? 452  PHE A CZ  1 
ATOM   3133  N  N   . GLY A  1  425 ? 20.785  31.092  -12.880 1.00 34.93  ? 453  GLY A N   1 
ATOM   3134  C  CA  . GLY A  1  425 ? 21.368  30.170  -11.917 1.00 35.22  ? 453  GLY A CA  1 
ATOM   3135  C  C   . GLY A  1  425 ? 21.635  30.863  -10.602 1.00 35.47  ? 453  GLY A C   1 
ATOM   3136  O  O   . GLY A  1  425 ? 22.374  31.853  -10.553 1.00 35.82  ? 453  GLY A O   1 
ATOM   3137  N  N   . GLY A  1  426 ? 21.030  30.357  -9.530  1.00 35.60  ? 454  GLY A N   1 
ATOM   3138  C  CA  . GLY A  1  426 ? 21.121  31.028  -8.232  1.00 35.32  ? 454  GLY A CA  1 
ATOM   3139  C  C   . GLY A  1  426 ? 20.814  30.154  -7.035  1.00 35.20  ? 454  GLY A C   1 
ATOM   3140  O  O   . GLY A  1  426 ? 20.433  28.991  -7.176  1.00 34.88  ? 454  GLY A O   1 
ATOM   3141  N  N   . LEU A  1  427 ? 20.988  30.735  -5.853  1.00 34.98  ? 455  LEU A N   1 
ATOM   3142  C  CA  . LEU A  1  427 ? 20.719  30.061  -4.590  1.00 35.05  ? 455  LEU A CA  1 
ATOM   3143  C  C   . LEU A  1  427 ? 20.495  31.149  -3.539  1.00 34.96  ? 455  LEU A C   1 
ATOM   3144  O  O   . LEU A  1  427 ? 21.335  32.028  -3.388  1.00 35.26  ? 455  LEU A O   1 
ATOM   3145  C  CB  . LEU A  1  427 ? 21.918  29.165  -4.229  1.00 35.01  ? 455  LEU A CB  1 
ATOM   3146  C  CG  . LEU A  1  427 ? 22.143  28.520  -2.858  1.00 35.39  ? 455  LEU A CG  1 
ATOM   3147  C  CD1 . LEU A  1  427 ? 21.024  27.581  -2.469  1.00 36.38  ? 455  LEU A CD1 1 
ATOM   3148  C  CD2 . LEU A  1  427 ? 23.445  27.758  -2.875  1.00 34.97  ? 455  LEU A CD2 1 
ATOM   3149  N  N   . ALA A  1  428 ? 19.359  31.112  -2.840  1.00 34.76  ? 456  ALA A N   1 
ATOM   3150  C  CA  . ALA A  1  428 ? 19.133  31.997  -1.692  1.00 34.41  ? 456  ALA A CA  1 
ATOM   3151  C  C   . ALA A  1  428 ? 20.058  31.563  -0.573  1.00 34.55  ? 456  ALA A C   1 
ATOM   3152  O  O   . ALA A  1  428 ? 20.320  30.367  -0.428  1.00 34.78  ? 456  ALA A O   1 
ATOM   3153  C  CB  . ALA A  1  428 ? 17.710  31.903  -1.229  1.00 34.30  ? 456  ALA A CB  1 
ATOM   3154  N  N   . GLU A  1  429 ? 20.570  32.508  0.213   1.00 34.42  ? 457  GLU A N   1 
ATOM   3155  C  CA  . GLU A  1  429 ? 21.448  32.113  1.306   1.00 34.62  ? 457  GLU A CA  1 
ATOM   3156  C  C   . GLU A  1  429 ? 20.745  31.806  2.632   1.00 35.01  ? 457  GLU A C   1 
ATOM   3157  O  O   . GLU A  1  429 ? 20.044  32.654  3.215   1.00 35.41  ? 457  GLU A O   1 
ATOM   3158  C  CB  . GLU A  1  429 ? 22.588  33.084  1.536   1.00 34.35  ? 457  GLU A CB  1 
ATOM   3159  C  CG  . GLU A  1  429 ? 23.464  32.607  2.673   1.00 34.61  ? 457  GLU A CG  1 
ATOM   3160  C  CD  . GLU A  1  429 ? 24.574  33.559  3.036   1.00 34.52  ? 457  GLU A CD  1 
ATOM   3161  O  OE1 . GLU A  1  429 ? 24.357  34.786  3.062   1.00 35.16  ? 457  GLU A OE1 1 
ATOM   3162  O  OE2 . GLU A  1  429 ? 25.675  33.063  3.322   1.00 35.81  ? 457  GLU A OE2 1 
ATOM   3163  N  N   . THR A  1  430 ? 20.955  30.575  3.094   1.00 34.71  ? 458  THR A N   1 
ATOM   3164  C  CA  . THR A  1  430 ? 20.571  30.176  4.431   1.00 34.14  ? 458  THR A CA  1 
ATOM   3165  C  C   . THR A  1  430 ? 21.832  29.902  5.229   1.00 33.57  ? 458  THR A C   1 
ATOM   3166  O  O   . THR A  1  430 ? 22.776  29.266  4.731   1.00 33.98  ? 458  THR A O   1 
ATOM   3167  C  CB  . THR A  1  430 ? 19.694  28.929  4.404   1.00 34.31  ? 458  THR A CB  1 
ATOM   3168  O  OG1 . THR A  1  430 ? 18.501  29.210  3.658   1.00 35.14  ? 458  THR A OG1 1 
ATOM   3169  C  CG2 . THR A  1  430 ? 19.309  28.530  5.819   1.00 34.82  ? 458  THR A CG2 1 
ATOM   3170  N  N   . VAL A  1  431 ? 21.842  30.382  6.464   1.00 32.46  ? 459  VAL A N   1 
ATOM   3171  C  CA  . VAL A  1  431 ? 23.000  30.259  7.334   1.00 31.59  ? 459  VAL A CA  1 
ATOM   3172  C  C   . VAL A  1  431 ? 22.599  29.521  8.603   1.00 31.39  ? 459  VAL A C   1 
ATOM   3173  O  O   . VAL A  1  431 ? 21.413  29.439  8.926   1.00 31.33  ? 459  VAL A O   1 
ATOM   3174  C  CB  . VAL A  1  431 ? 23.586  31.649  7.693   1.00 31.48  ? 459  VAL A CB  1 
ATOM   3175  C  CG1 . VAL A  1  431 ? 24.121  32.346  6.441   1.00 31.44  ? 459  VAL A CG1 1 
ATOM   3176  C  CG2 . VAL A  1  431 ? 22.552  32.519  8.395   1.00 30.34  ? 459  VAL A CG2 1 
ATOM   3177  N  N   . LEU A  1  432 ? 23.589  28.995  9.316   1.00 30.68  ? 460  LEU A N   1 
ATOM   3178  C  CA  . LEU A  1  432 ? 23.352  28.276  10.550  1.00 30.23  ? 460  LEU A CA  1 
ATOM   3179  C  C   . LEU A  1  432 ? 24.045  29.050  11.659  1.00 30.40  ? 460  LEU A C   1 
ATOM   3180  O  O   . LEU A  1  432 ? 25.226  29.415  11.538  1.00 30.13  ? 460  LEU A O   1 
ATOM   3181  C  CB  . LEU A  1  432 ? 23.881  26.845  10.442  1.00 29.87  ? 460  LEU A CB  1 
ATOM   3182  C  CG  . LEU A  1  432 ? 23.821  25.925  11.662  1.00 30.19  ? 460  LEU A CG  1 
ATOM   3183  C  CD1 . LEU A  1  432 ? 22.417  25.357  11.896  1.00 30.36  ? 460  LEU A CD1 1 
ATOM   3184  C  CD2 . LEU A  1  432 ? 24.808  24.787  11.462  1.00 30.83  ? 460  LEU A CD2 1 
ATOM   3185  N  N   . VAL A  1  433 ? 23.308  29.293  12.745  1.00 30.38  ? 461  VAL A N   1 
ATOM   3186  C  CA  . VAL A  1  433 ? 23.716  30.266  13.755  1.00 30.15  ? 461  VAL A CA  1 
ATOM   3187  C  C   . VAL A  1  433 ? 23.715  29.686  15.154  1.00 30.46  ? 461  VAL A C   1 
ATOM   3188  O  O   . VAL A  1  433 ? 22.735  29.081  15.587  1.00 30.55  ? 461  VAL A O   1 
ATOM   3189  C  CB  . VAL A  1  433 ? 22.783  31.506  13.766  1.00 30.00  ? 461  VAL A CB  1 
ATOM   3190  C  CG1 . VAL A  1  433 ? 23.250  32.506  14.805  1.00 29.53  ? 461  VAL A CG1 1 
ATOM   3191  C  CG2 . VAL A  1  433 ? 22.713  32.152  12.389  1.00 29.12  ? 461  VAL A CG2 1 
ATOM   3192  N  N   . VAL A  1  434 ? 24.823  29.900  15.855  1.00 30.74  ? 462  VAL A N   1 
ATOM   3193  C  CA  . VAL A  1  434 ? 24.934  29.616  17.281  1.00 30.55  ? 462  VAL A CA  1 
ATOM   3194  C  C   . VAL A  1  434 ? 25.075  30.953  17.983  1.00 30.60  ? 462  VAL A C   1 
ATOM   3195  O  O   . VAL A  1  434 ? 25.956  31.752  17.634  1.00 30.19  ? 462  VAL A O   1 
ATOM   3196  C  CB  . VAL A  1  434 ? 26.172  28.753  17.600  1.00 30.58  ? 462  VAL A CB  1 
ATOM   3197  C  CG1 . VAL A  1  434 ? 26.185  28.376  19.078  1.00 29.76  ? 462  VAL A CG1 1 
ATOM   3198  C  CG2 . VAL A  1  434 ? 26.190  27.518  16.718  1.00 30.27  ? 462  VAL A CG2 1 
ATOM   3199  N  N   . ARG A  1  435 ? 24.203  31.191  18.966  1.00 30.76  ? 463  ARG A N   1 
ATOM   3200  C  CA  . ARG A  1  435 ? 24.155  32.475  19.666  1.00 30.63  ? 463  ARG A CA  1 
ATOM   3201  C  C   . ARG A  1  435 ? 24.012  32.325  21.171  1.00 31.16  ? 463  ARG A C   1 
ATOM   3202  O  O   . ARG A  1  435 ? 23.307  31.442  21.666  1.00 30.96  ? 463  ARG A O   1 
ATOM   3203  C  CB  . ARG A  1  435 ? 23.026  33.345  19.117  1.00 30.23  ? 463  ARG A CB  1 
ATOM   3204  C  CG  . ARG A  1  435 ? 22.843  34.655  19.846  1.00 29.60  ? 463  ARG A CG  1 
ATOM   3205  C  CD  . ARG A  1  435 ? 21.723  35.470  19.268  1.00 28.75  ? 463  ARG A CD  1 
ATOM   3206  N  NE  . ARG A  1  435 ? 21.992  35.809  17.875  1.00 28.66  ? 463  ARG A NE  1 
ATOM   3207  C  CZ  . ARG A  1  435 ? 21.055  35.970  16.945  1.00 28.44  ? 463  ARG A CZ  1 
ATOM   3208  N  NH1 . ARG A  1  435 ? 19.767  35.821  17.245  1.00 29.35  ? 463  ARG A NH1 1 
ATOM   3209  N  NH2 . ARG A  1  435 ? 21.408  36.269  15.708  1.00 26.89  ? 463  ARG A NH2 1 
ATOM   3210  N  N   . SER A  1  436 ? 24.688  33.224  21.878  1.00 32.11  ? 464  SER A N   1 
ATOM   3211  C  CA  . SER A  1  436 ? 24.681  33.304  23.329  1.00 32.72  ? 464  SER A CA  1 
ATOM   3212  C  C   . SER A  1  436 ? 24.695  34.774  23.710  1.00 32.87  ? 464  SER A C   1 
ATOM   3213  O  O   . SER A  1  436 ? 25.141  35.609  22.922  1.00 32.54  ? 464  SER A O   1 
ATOM   3214  C  CB  . SER A  1  436 ? 25.944  32.669  23.873  1.00 32.73  ? 464  SER A CB  1 
ATOM   3215  O  OG  . SER A  1  436 ? 25.597  31.851  24.957  1.00 34.96  ? 464  SER A OG  1 
ATOM   3216  N  N   . MET A  1  437 ? 24.227  35.090  24.915  1.00 33.10  ? 465  MET A N   1 
ATOM   3217  C  CA  . MET A  1  437 ? 24.223  36.467  25.365  1.00 33.81  ? 465  MET A CA  1 
ATOM   3218  C  C   . MET A  1  437 ? 24.668  36.591  26.802  1.00 34.04  ? 465  MET A C   1 
ATOM   3219  O  O   . MET A  1  437 ? 24.135  35.913  27.685  1.00 34.72  ? 465  MET A O   1 
ATOM   3220  C  CB  . MET A  1  437 ? 22.834  37.080  25.208  1.00 33.60  ? 465  MET A CB  1 
ATOM   3221  C  CG  . MET A  1  437 ? 22.439  37.314  23.779  1.00 33.53  ? 465  MET A CG  1 
ATOM   3222  S  SD  . MET A  1  437 ? 20.859  38.144  23.663  1.00 35.27  ? 465  MET A SD  1 
ATOM   3223  C  CE  . MET A  1  437 ? 20.472  37.813  21.942  1.00 34.82  ? 465  MET A CE  1 
ATOM   3224  N  N   . SER A  1  438 ? 25.625  37.474  27.055  1.00 33.99  ? 466  SER A N   1 
ATOM   3225  C  CA  . SER A  1  438 ? 26.006  37.730  28.437  1.00 34.03  ? 466  SER A CA  1 
ATOM   3226  C  C   . SER A  1  438 ? 25.682  39.133  28.861  1.00 34.01  ? 466  SER A C   1 
ATOM   3227  O  O   . SER A  1  438 ? 25.961  40.099  28.148  1.00 33.82  ? 466  SER A O   1 
ATOM   3228  C  CB  . SER A  1  438 ? 27.471  37.368  28.755  1.00 33.80  ? 466  SER A CB  1 
ATOM   3229  O  OG  . SER A  1  438 ? 28.290  37.344  27.608  1.00 34.24  ? 466  SER A OG  1 
ATOM   3230  N  N   . THR A  1  439 ? 25.078  39.227  30.039  1.00 34.05  ? 467  THR A N   1 
ATOM   3231  C  CA  . THR A  1  439 ? 24.760  40.498  30.624  1.00 34.25  ? 467  THR A CA  1 
ATOM   3232  C  C   . THR A  1  439 ? 25.672  40.759  31.799  1.00 34.71  ? 467  THR A C   1 
ATOM   3233  O  O   . THR A  1  439 ? 25.564  40.120  32.846  1.00 34.65  ? 467  THR A O   1 
ATOM   3234  C  CB  . THR A  1  439 ? 23.298  40.560  31.077  1.00 34.42  ? 467  THR A CB  1 
ATOM   3235  O  OG1 . THR A  1  439 ? 22.468  40.003  30.050  1.00 33.65  ? 467  THR A OG1 1 
ATOM   3236  C  CG2 . THR A  1  439 ? 22.892  42.018  31.373  1.00 33.05  ? 467  THR A CG2 1 
ATOM   3237  N  N   . LEU A  1  440 ? 26.569  41.715  31.601  1.00 35.22  ? 468  LEU A N   1 
ATOM   3238  C  CA  . LEU A  1  440 ? 27.496  42.137  32.629  1.00 35.95  ? 468  LEU A CA  1 
ATOM   3239  C  C   . LEU A  1  440 ? 27.124  43.549  32.996  1.00 36.35  ? 468  LEU A C   1 
ATOM   3240  O  O   . LEU A  1  440 ? 27.436  44.501  32.263  1.00 36.65  ? 468  LEU A O   1 
ATOM   3241  C  CB  . LEU A  1  440 ? 28.944  42.055  32.137  1.00 35.77  ? 468  LEU A CB  1 
ATOM   3242  C  CG  . LEU A  1  440 ? 29.344  40.607  31.869  1.00 36.73  ? 468  LEU A CG  1 
ATOM   3243  C  CD1 . LEU A  1  440 ? 29.345  40.338  30.384  1.00 37.80  ? 468  LEU A CD1 1 
ATOM   3244  C  CD2 . LEU A  1  440 ? 30.694  40.283  32.488  1.00 38.01  ? 468  LEU A CD2 1 
ATOM   3245  N  N   . LEU A  1  441 ? 26.429  43.658  34.128  1.00 36.79  ? 469  LEU A N   1 
ATOM   3246  C  CA  . LEU A  1  441 ? 25.893  44.913  34.638  1.00 37.18  ? 469  LEU A CA  1 
ATOM   3247  C  C   . LEU A  1  441 ? 24.985  45.554  33.584  1.00 37.28  ? 469  LEU A C   1 
ATOM   3248  O  O   . LEU A  1  441 ? 23.973  44.965  33.236  1.00 37.23  ? 469  LEU A O   1 
ATOM   3249  C  CB  . LEU A  1  441 ? 27.024  45.833  35.136  1.00 37.53  ? 469  LEU A CB  1 
ATOM   3250  C  CG  . LEU A  1  441 ? 28.087  45.169  36.028  1.00 37.70  ? 469  LEU A CG  1 
ATOM   3251  C  CD1 . LEU A  1  441 ? 29.375  45.993  36.052  1.00 39.23  ? 469  LEU A CD1 1 
ATOM   3252  C  CD2 . LEU A  1  441 ? 27.574  44.893  37.448  1.00 36.93  ? 469  LEU A CD2 1 
ATOM   3253  N  N   . ASN A  1  442 ? 25.355  46.714  33.046  1.00 37.86  ? 470  ASN A N   1 
ATOM   3254  C  CA  . ASN A  1  442 ? 24.472  47.448  32.133  1.00 38.57  ? 470  ASN A CA  1 
ATOM   3255  C  C   . ASN A  1  442 ? 24.380  46.864  30.731  1.00 39.42  ? 470  ASN A C   1 
ATOM   3256  O  O   . ASN A  1  442 ? 23.359  47.017  30.066  1.00 39.70  ? 470  ASN A O   1 
ATOM   3257  C  CB  . ASN A  1  442 ? 24.872  48.917  32.033  1.00 38.05  ? 470  ASN A CB  1 
ATOM   3258  C  CG  . ASN A  1  442 ? 26.341  49.090  31.770  1.00 37.68  ? 470  ASN A CG  1 
ATOM   3259  O  OD1 . ASN A  1  442 ? 27.159  48.777  32.622  1.00 37.50  ? 470  ASN A OD1 1 
ATOM   3260  N  ND2 . ASN A  1  442 ? 26.691  49.575  30.581  1.00 37.71  ? 470  ASN A ND2 1 
HETATM 3261  N  N   . TPQ A  1  443 ? 25.432  46.208  30.261  1.00 40.45  ? 471  TPQ A N   1 
HETATM 3262  C  CA  . TPQ A  1  443 ? 25.427  45.831  28.863  1.00 41.77  ? 471  TPQ A CA  1 
HETATM 3263  C  CB  . TPQ A  1  443 ? 26.596  46.382  28.034  1.00 44.24  ? 471  TPQ A CB  1 
HETATM 3264  C  C   . TPQ A  1  443 ? 25.164  44.383  28.582  1.00 40.70  ? 471  TPQ A C   1 
HETATM 3265  O  O   . TPQ A  1  443 ? 25.327  43.487  29.447  1.00 40.53  ? 471  TPQ A O   1 
HETATM 3266  C  C1  . TPQ A  1  443 ? 27.963  46.377  28.668  1.00 46.66  ? 471  TPQ A C1  1 
HETATM 3267  C  C2  . TPQ A  1  443 ? 28.776  47.618  28.542  1.00 49.92  ? 471  TPQ A C2  1 
HETATM 3268  O  O2  . TPQ A  1  443 ? 28.243  48.687  27.892  1.00 52.75  ? 471  TPQ A O2  1 
HETATM 3269  C  C3  . TPQ A  1  443 ? 30.059  47.715  29.074  1.00 50.40  ? 471  TPQ A C3  1 
HETATM 3270  C  C4  . TPQ A  1  443 ? 30.585  46.603  29.727  1.00 50.06  ? 471  TPQ A C4  1 
HETATM 3271  O  O4  . TPQ A  1  443 ? 31.836  46.622  30.268  1.00 49.97  ? 471  TPQ A O4  1 
HETATM 3272  C  C5  . TPQ A  1  443 ? 29.782  45.354  29.848  1.00 51.20  ? 471  TPQ A C5  1 
HETATM 3273  O  O5  . TPQ A  1  443 ? 30.360  44.312  30.511  1.00 51.42  ? 471  TPQ A O5  1 
HETATM 3274  C  C6  . TPQ A  1  443 ? 28.488  45.261  29.312  1.00 48.78  ? 471  TPQ A C6  1 
ATOM   3275  N  N   . ASP A  1  444 ? 24.720  44.153  27.353  1.00 39.32  ? 472  ASP A N   1 
ATOM   3276  C  CA  . ASP A  1  444 ? 24.411  42.834  26.868  1.00 38.00  ? 472  ASP A CA  1 
ATOM   3277  C  C   . ASP A  1  444 ? 25.224  42.600  25.626  1.00 37.57  ? 472  ASP A C   1 
ATOM   3278  O  O   . ASP A  1  444 ? 25.016  43.241  24.594  1.00 37.25  ? 472  ASP A O   1 
ATOM   3279  C  CB  . ASP A  1  444 ? 22.920  42.708  26.578  1.00 37.85  ? 472  ASP A CB  1 
ATOM   3280  C  CG  . ASP A  1  444 ? 22.076  42.904  27.816  1.00 36.82  ? 472  ASP A CG  1 
ATOM   3281  O  OD1 . ASP A  1  444 ? 21.936  44.049  28.259  1.00 36.15  ? 472  ASP A OD1 1 
ATOM   3282  O  OD2 . ASP A  1  444 ? 21.547  41.920  28.351  1.00 37.03  ? 472  ASP A OD2 1 
ATOM   3283  N  N   . TYR A  1  445 ? 26.199  41.712  25.765  1.00 37.18  ? 473  TYR A N   1 
ATOM   3284  C  CA  . TYR A  1  445 ? 26.961  41.206  24.650  1.00 36.91  ? 473  TYR A CA  1 
ATOM   3285  C  C   . TYR A  1  445 ? 26.202  40.060  23.949  1.00 35.71  ? 473  TYR A C   1 
ATOM   3286  O  O   . TYR A  1  445 ? 25.782  39.096  24.596  1.00 35.09  ? 473  TYR A O   1 
ATOM   3287  C  CB  . TYR A  1  445 ? 28.290  40.671  25.162  1.00 38.56  ? 473  TYR A CB  1 
ATOM   3288  C  CG  . TYR A  1  445 ? 29.251  41.695  25.746  1.00 40.15  ? 473  TYR A CG  1 
ATOM   3289  C  CD1 . TYR A  1  445 ? 29.661  41.612  27.085  1.00 41.60  ? 473  TYR A CD1 1 
ATOM   3290  C  CD2 . TYR A  1  445 ? 29.789  42.705  24.954  1.00 41.05  ? 473  TYR A CD2 1 
ATOM   3291  C  CE1 . TYR A  1  445 ? 30.575  42.536  27.627  1.00 42.32  ? 473  TYR A CE1 1 
ATOM   3292  C  CE2 . TYR A  1  445 ? 30.690  43.631  25.478  1.00 42.41  ? 473  TYR A CE2 1 
ATOM   3293  C  CZ  . TYR A  1  445 ? 31.083  43.541  26.809  1.00 42.39  ? 473  TYR A CZ  1 
ATOM   3294  O  OH  . TYR A  1  445 ? 31.984  44.462  27.308  1.00 43.02  ? 473  TYR A OH  1 
ATOM   3295  N  N   . VAL A  1  446 ? 26.027  40.184  22.632  1.00 34.46  ? 474  VAL A N   1 
ATOM   3296  C  CA  . VAL A  1  446 ? 25.467  39.129  21.794  1.00 33.25  ? 474  VAL A CA  1 
ATOM   3297  C  C   . VAL A  1  446 ? 26.625  38.492  21.042  1.00 33.01  ? 474  VAL A C   1 
ATOM   3298  O  O   . VAL A  1  446 ? 27.306  39.162  20.263  1.00 33.11  ? 474  VAL A O   1 
ATOM   3299  C  CB  . VAL A  1  446 ? 24.455  39.693  20.763  1.00 33.45  ? 474  VAL A CB  1 
ATOM   3300  C  CG1 . VAL A  1  446 ? 23.853  38.571  19.911  1.00 33.19  ? 474  VAL A CG1 1 
ATOM   3301  C  CG2 . VAL A  1  446 ? 23.344  40.504  21.452  1.00 33.26  ? 474  VAL A CG2 1 
ATOM   3302  N  N   . TRP A  1  447 ? 26.863  37.205  21.279  1.00 32.25  ? 475  TRP A N   1 
ATOM   3303  C  CA  . TRP A  1  447 ? 27.954  36.501  20.627  1.00 31.53  ? 475  TRP A CA  1 
ATOM   3304  C  C   . TRP A  1  447 ? 27.395  35.568  19.556  1.00 31.71  ? 475  TRP A C   1 
ATOM   3305  O  O   . TRP A  1  447 ? 26.759  34.564  19.877  1.00 32.23  ? 475  TRP A O   1 
ATOM   3306  C  CB  . TRP A  1  447 ? 28.779  35.706  21.646  1.00 30.97  ? 475  TRP A CB  1 
ATOM   3307  C  CG  . TRP A  1  447 ? 29.121  36.463  22.905  1.00 30.49  ? 475  TRP A CG  1 
ATOM   3308  C  CD1 . TRP A  1  447 ? 28.563  36.296  24.143  1.00 28.62  ? 475  TRP A CD1 1 
ATOM   3309  C  CD2 . TRP A  1  447 ? 30.111  37.495  23.050  1.00 30.46  ? 475  TRP A CD2 1 
ATOM   3310  N  NE1 . TRP A  1  447 ? 29.142  37.153  25.046  1.00 28.62  ? 475  TRP A NE1 1 
ATOM   3311  C  CE2 . TRP A  1  447 ? 30.086  37.910  24.399  1.00 30.70  ? 475  TRP A CE2 1 
ATOM   3312  C  CE3 . TRP A  1  447 ? 31.022  38.103  22.172  1.00 29.14  ? 475  TRP A CE3 1 
ATOM   3313  C  CZ2 . TRP A  1  447 ? 30.940  38.912  24.889  1.00 31.15  ? 475  TRP A CZ2 1 
ATOM   3314  C  CZ3 . TRP A  1  447 ? 31.854  39.107  22.655  1.00 28.45  ? 475  TRP A CZ3 1 
ATOM   3315  C  CH2 . TRP A  1  447 ? 31.813  39.495  23.996  1.00 29.85  ? 475  TRP A CH2 1 
ATOM   3316  N  N   . ASP A  1  448 ? 27.630  35.909  18.293  1.00 31.59  ? 476  ASP A N   1 
ATOM   3317  C  CA  . ASP A  1  448 ? 27.183  35.106  17.156  1.00 31.96  ? 476  ASP A CA  1 
ATOM   3318  C  C   . ASP A  1  448 ? 28.323  34.381  16.451  1.00 31.62  ? 476  ASP A C   1 
ATOM   3319  O  O   . ASP A  1  448 ? 29.361  34.969  16.154  1.00 32.15  ? 476  ASP A O   1 
ATOM   3320  C  CB  . ASP A  1  448 ? 26.476  35.993  16.122  1.00 32.41  ? 476  ASP A CB  1 
ATOM   3321  C  CG  . ASP A  1  448 ? 25.004  36.200  16.418  1.00 34.03  ? 476  ASP A CG  1 
ATOM   3322  O  OD1 . ASP A  1  448 ? 24.566  35.996  17.571  1.00 38.04  ? 476  ASP A OD1 1 
ATOM   3323  O  OD2 . ASP A  1  448 ? 24.277  36.579  15.487  1.00 35.45  ? 476  ASP A OD2 1 
ATOM   3324  N  N   . THR A  1  449 ? 28.120  33.099  16.189  1.00 31.44  ? 477  THR A N   1 
ATOM   3325  C  CA  . THR A  1  449 ? 28.936  32.353  15.237  1.00 31.31  ? 477  THR A CA  1 
ATOM   3326  C  C   . THR A  1  449 ? 27.994  31.848  14.137  1.00 31.19  ? 477  THR A C   1 
ATOM   3327  O  O   . THR A  1  449 ? 26.959  31.206  14.418  1.00 30.31  ? 477  THR A O   1 
ATOM   3328  C  CB  . THR A  1  449 ? 29.687  31.181  15.903  1.00 31.56  ? 477  THR A CB  1 
ATOM   3329  O  OG1 . THR A  1  449 ? 30.518  31.695  16.947  1.00 32.47  ? 477  THR A OG1 1 
ATOM   3330  C  CG2 . THR A  1  449 ? 30.570  30.452  14.894  1.00 31.07  ? 477  THR A CG2 1 
ATOM   3331  N  N   . VAL A  1  450 ? 28.357  32.181  12.897  1.00 31.12  ? 478  VAL A N   1 
ATOM   3332  C  CA  . VAL A  1  450 ? 27.535  31.939  11.720  1.00 31.06  ? 478  VAL A CA  1 
ATOM   3333  C  C   . VAL A  1  450 ? 28.316  31.078  10.738  1.00 31.52  ? 478  VAL A C   1 
ATOM   3334  O  O   . VAL A  1  450 ? 29.465  31.374  10.391  1.00 31.90  ? 478  VAL A O   1 
ATOM   3335  C  CB  . VAL A  1  450 ? 27.098  33.278  11.015  1.00 31.42  ? 478  VAL A CB  1 
ATOM   3336  C  CG1 . VAL A  1  450 ? 26.128  32.997  9.861   1.00 30.72  ? 478  VAL A CG1 1 
ATOM   3337  C  CG2 . VAL A  1  450 ? 26.488  34.292  12.015  1.00 29.91  ? 478  VAL A CG2 1 
ATOM   3338  N  N   . PHE A  1  451 ? 27.668  30.017  10.281  1.00 31.91  ? 479  PHE A N   1 
ATOM   3339  C  CA  . PHE A  1  451 ? 28.250  29.064  9.352   1.00 31.92  ? 479  PHE A CA  1 
ATOM   3340  C  C   . PHE A  1  451 ? 27.543  29.195  8.003   1.00 32.02  ? 479  PHE A C   1 
ATOM   3341  O  O   . PHE A  1  451 ? 26.322  29.000  7.898   1.00 31.80  ? 479  PHE A O   1 
ATOM   3342  C  CB  . PHE A  1  451 ? 28.100  27.649  9.911   1.00 32.08  ? 479  PHE A CB  1 
ATOM   3343  C  CG  . PHE A  1  451 ? 28.757  27.455  11.242  1.00 32.81  ? 479  PHE A CG  1 
ATOM   3344  C  CD1 . PHE A  1  451 ? 28.064  27.734  12.426  1.00 34.23  ? 479  PHE A CD1 1 
ATOM   3345  C  CD2 . PHE A  1  451 ? 30.074  26.993  11.320  1.00 32.76  ? 479  PHE A CD2 1 
ATOM   3346  C  CE1 . PHE A  1  451 ? 28.684  27.556  13.690  1.00 33.59  ? 479  PHE A CE1 1 
ATOM   3347  C  CE2 . PHE A  1  451 ? 30.698  26.807  12.552  1.00 32.91  ? 479  PHE A CE2 1 
ATOM   3348  C  CZ  . PHE A  1  451 ? 30.005  27.088  13.746  1.00 33.08  ? 479  PHE A CZ  1 
ATOM   3349  N  N   . HIS A  1  452 ? 28.312  29.548  6.976   1.00 31.86  ? 480  HIS A N   1 
ATOM   3350  C  CA  . HIS A  1  452 ? 27.746  29.825  5.661   1.00 31.57  ? 480  HIS A CA  1 
ATOM   3351  C  C   . HIS A  1  452 ? 27.812  28.585  4.757   1.00 31.19  ? 480  HIS A C   1 
ATOM   3352  O  O   . HIS A  1  452 ? 28.686  27.735  4.955   1.00 31.63  ? 480  HIS A O   1 
ATOM   3353  C  CB  . HIS A  1  452 ? 28.452  31.033  5.038   1.00 31.33  ? 480  HIS A CB  1 
ATOM   3354  C  CG  . HIS A  1  452 ? 28.228  32.315  5.784   1.00 31.92  ? 480  HIS A CG  1 
ATOM   3355  N  ND1 . HIS A  1  452 ? 27.363  33.294  5.342   1.00 31.22  ? 480  HIS A ND1 1 
ATOM   3356  C  CD2 . HIS A  1  452 ? 28.758  32.779  6.945   1.00 32.31  ? 480  HIS A CD2 1 
ATOM   3357  C  CE1 . HIS A  1  452 ? 27.375  34.307  6.190   1.00 30.99  ? 480  HIS A CE1 1 
ATOM   3358  N  NE2 . HIS A  1  452 ? 28.212  34.019  7.172   1.00 31.42  ? 480  HIS A NE2 1 
ATOM   3359  N  N   . PRO A  1  453 ? 26.882  28.465  3.776   1.00 30.53  ? 481  PRO A N   1 
ATOM   3360  C  CA  . PRO A  1  453 ? 26.923  27.309  2.856   1.00 30.17  ? 481  PRO A CA  1 
ATOM   3361  C  C   . PRO A  1  453 ? 28.107  27.324  1.864   1.00 29.82  ? 481  PRO A C   1 
ATOM   3362  O  O   . PRO A  1  453 ? 28.344  26.333  1.172   1.00 29.72  ? 481  PRO A O   1 
ATOM   3363  C  CB  . PRO A  1  453 ? 25.585  27.398  2.113   1.00 29.57  ? 481  PRO A CB  1 
ATOM   3364  C  CG  . PRO A  1  453 ? 25.224  28.827  2.176   1.00 29.96  ? 481  PRO A CG  1 
ATOM   3365  C  CD  . PRO A  1  453 ? 25.767  29.378  3.454   1.00 30.22  ? 481  PRO A CD  1 
ATOM   3366  N  N   . SER A  1  454 ? 28.836  28.434  1.802   1.00 29.53  ? 482  SER A N   1 
ATOM   3367  C  CA  . SER A  1  454 ? 30.040  28.520  0.977   1.00 29.52  ? 482  SER A CA  1 
ATOM   3368  C  C   . SER A  1  454 ? 31.292  27.956  1.674   1.00 29.62  ? 482  SER A C   1 
ATOM   3369  O  O   . SER A  1  454 ? 32.377  27.934  1.099   1.00 29.56  ? 482  SER A O   1 
ATOM   3370  C  CB  . SER A  1  454 ? 30.275  29.976  0.561   1.00 29.48  ? 482  SER A CB  1 
ATOM   3371  O  OG  . SER A  1  454 ? 30.539  30.790  1.691   1.00 29.19  ? 482  SER A OG  1 
ATOM   3372  N  N   . GLY A  1  455 ? 31.150  27.510  2.916   1.00 29.97  ? 483  GLY A N   1 
ATOM   3373  C  CA  . GLY A  1  455 ? 32.315  27.079  3.695   1.00 30.59  ? 483  GLY A CA  1 
ATOM   3374  C  C   . GLY A  1  455 ? 32.993  28.189  4.499   1.00 30.92  ? 483  GLY A C   1 
ATOM   3375  O  O   . GLY A  1  455 ? 34.060  27.977  5.076   1.00 30.80  ? 483  GLY A O   1 
ATOM   3376  N  N   . ALA A  1  456 ? 32.392  29.379  4.520   1.00 30.93  ? 484  ALA A N   1 
ATOM   3377  C  CA  . ALA A  1  456 ? 32.902  30.468  5.358   1.00 31.35  ? 484  ALA A CA  1 
ATOM   3378  C  C   . ALA A  1  456 ? 32.342  30.424  6.782   1.00 31.52  ? 484  ALA A C   1 
ATOM   3379  O  O   . ALA A  1  456 ? 31.208  30.000  7.010   1.00 31.44  ? 484  ALA A O   1 
ATOM   3380  C  CB  . ALA A  1  456 ? 32.618  31.823  4.717   1.00 31.37  ? 484  ALA A CB  1 
ATOM   3381  N  N   . ILE A  1  457 ? 33.148  30.846  7.747   1.00 32.02  ? 485  ILE A N   1 
ATOM   3382  C  CA  . ILE A  1  457 ? 32.668  30.974  9.122   1.00 32.31  ? 485  ILE A CA  1 
ATOM   3383  C  C   . ILE A  1  457 ? 32.692  32.455  9.480   1.00 32.60  ? 485  ILE A C   1 
ATOM   3384  O  O   . ILE A  1  457 ? 33.614  33.168  9.076   1.00 32.68  ? 485  ILE A O   1 
ATOM   3385  C  CB  . ILE A  1  457 ? 33.537  30.178  10.108  1.00 32.36  ? 485  ILE A CB  1 
ATOM   3386  C  CG1 . ILE A  1  457 ? 33.725  28.736  9.615   1.00 32.19  ? 485  ILE A CG1 1 
ATOM   3387  C  CG2 . ILE A  1  457 ? 32.921  30.222  11.499  1.00 32.60  ? 485  ILE A CG2 1 
ATOM   3388  C  CD1 . ILE A  1  457 ? 34.637  27.877  10.473  1.00 32.32  ? 485  ILE A CD1 1 
ATOM   3389  N  N   . GLU A  1  458 ? 31.675  32.919  10.204  1.00 32.87  ? 486  GLU A N   1 
ATOM   3390  C  CA  . GLU A  1  458 ? 31.591  34.326  10.595  1.00 33.31  ? 486  GLU A CA  1 
ATOM   3391  C  C   . GLU A  1  458 ? 31.362  34.485  12.108  1.00 33.88  ? 486  GLU A C   1 
ATOM   3392  O  O   . GLU A  1  458 ? 30.406  33.928  12.663  1.00 33.66  ? 486  GLU A O   1 
ATOM   3393  C  CB  . GLU A  1  458 ? 30.478  35.011  9.814   1.00 32.82  ? 486  GLU A CB  1 
ATOM   3394  C  CG  . GLU A  1  458 ? 30.300  36.491  10.092  1.00 32.75  ? 486  GLU A CG  1 
ATOM   3395  C  CD  . GLU A  1  458 ? 29.019  37.064  9.487   1.00 33.87  ? 486  GLU A CD  1 
ATOM   3396  O  OE1 . GLU A  1  458 ? 28.279  36.327  8.791   1.00 35.18  ? 486  GLU A OE1 1 
ATOM   3397  O  OE2 . GLU A  1  458 ? 28.733  38.263  9.710   1.00 35.56  ? 486  GLU A OE2 1 
ATOM   3398  N  N   . ILE A  1  459 ? 32.247  35.249  12.752  1.00 34.26  ? 487  ILE A N   1 
ATOM   3399  C  CA  . ILE A  1  459 ? 32.099  35.640  14.148  1.00 34.79  ? 487  ILE A CA  1 
ATOM   3400  C  C   . ILE A  1  459 ? 31.706  37.108  14.245  1.00 35.76  ? 487  ILE A C   1 
ATOM   3401  O  O   . ILE A  1  459 ? 32.379  37.997  13.716  1.00 35.95  ? 487  ILE A O   1 
ATOM   3402  C  CB  . ILE A  1  459 ? 33.395  35.383  14.965  1.00 34.97  ? 487  ILE A CB  1 
ATOM   3403  C  CG1 . ILE A  1  459 ? 33.519  33.904  15.327  1.00 34.45  ? 487  ILE A CG1 1 
ATOM   3404  C  CG2 . ILE A  1  459 ? 33.440  36.228  16.233  1.00 34.03  ? 487  ILE A CG2 1 
ATOM   3405  C  CD1 . ILE A  1  459 ? 34.222  33.091  14.258  1.00 33.94  ? 487  ILE A CD1 1 
ATOM   3406  N  N   . ARG A  1  460 ? 30.603  37.354  14.930  1.00 36.67  ? 488  ARG A N   1 
ATOM   3407  C  CA  . ARG A  1  460 ? 30.145  38.697  15.133  1.00 37.52  ? 488  ARG A CA  1 
ATOM   3408  C  C   . ARG A  1  460 ? 29.776  38.871  16.595  1.00 37.52  ? 488  ARG A C   1 
ATOM   3409  O  O   . ARG A  1  460 ? 29.313  37.932  17.245  1.00 37.26  ? 488  ARG A O   1 
ATOM   3410  C  CB  . ARG A  1  460 ? 28.945  38.949  14.242  1.00 38.21  ? 488  ARG A CB  1 
ATOM   3411  C  CG  . ARG A  1  460 ? 28.985  40.305  13.600  1.00 41.67  ? 488  ARG A CG  1 
ATOM   3412  C  CD  . ARG A  1  460 ? 28.194  40.344  12.284  1.00 47.58  ? 488  ARG A CD  1 
ATOM   3413  N  NE  . ARG A  1  460 ? 28.560  41.529  11.505  1.00 51.88  ? 488  ARG A NE  1 
ATOM   3414  C  CZ  . ARG A  1  460 ? 29.724  41.671  10.869  1.00 54.29  ? 488  ARG A CZ  1 
ATOM   3415  N  NH1 . ARG A  1  460 ? 30.635  40.699  10.910  1.00 55.49  ? 488  ARG A NH1 1 
ATOM   3416  N  NH2 . ARG A  1  460 ? 29.987  42.786  10.199  1.00 55.08  ? 488  ARG A NH2 1 
ATOM   3417  N  N   . PHE A  1  461 ? 30.022  40.059  17.131  1.00 37.57  ? 489  PHE A N   1 
ATOM   3418  C  CA  . PHE A  1  461 ? 29.496  40.386  18.443  1.00 37.61  ? 489  PHE A CA  1 
ATOM   3419  C  C   . PHE A  1  461 ? 28.883  41.779  18.459  1.00 37.49  ? 489  PHE A C   1 
ATOM   3420  O  O   . PHE A  1  461 ? 29.315  42.677  17.708  1.00 38.02  ? 489  PHE A O   1 
ATOM   3421  C  CB  . PHE A  1  461 ? 30.538  40.171  19.544  1.00 37.82  ? 489  PHE A CB  1 
ATOM   3422  C  CG  . PHE A  1  461 ? 31.315  41.401  19.927  1.00 38.75  ? 489  PHE A CG  1 
ATOM   3423  C  CD1 . PHE A  1  461 ? 30.809  42.300  20.870  1.00 39.33  ? 489  PHE A CD1 1 
ATOM   3424  C  CD2 . PHE A  1  461 ? 32.584  41.640  19.380  1.00 39.62  ? 489  PHE A CD2 1 
ATOM   3425  C  CE1 . PHE A  1  461 ? 31.544  43.446  21.241  1.00 40.41  ? 489  PHE A CE1 1 
ATOM   3426  C  CE2 . PHE A  1  461 ? 33.329  42.773  19.748  1.00 39.24  ? 489  PHE A CE2 1 
ATOM   3427  C  CZ  . PHE A  1  461 ? 32.809  43.679  20.678  1.00 39.05  ? 489  PHE A CZ  1 
ATOM   3428  N  N   . TYR A  1  462 ? 27.867  41.945  19.302  1.00 36.36  ? 490  TYR A N   1 
ATOM   3429  C  CA  . TYR A  1  462 ? 27.132  43.197  19.412  1.00 35.36  ? 490  TYR A CA  1 
ATOM   3430  C  C   . TYR A  1  462 ? 27.094  43.576  20.869  1.00 35.21  ? 490  TYR A C   1 
ATOM   3431  O  O   . TYR A  1  462 ? 27.041  42.700  21.744  1.00 35.59  ? 490  TYR A O   1 
ATOM   3432  C  CB  . TYR A  1  462 ? 25.698  43.030  18.915  1.00 34.76  ? 490  TYR A CB  1 
ATOM   3433  C  CG  . TYR A  1  462 ? 25.585  42.502  17.514  1.00 33.45  ? 490  TYR A CG  1 
ATOM   3434  C  CD1 . TYR A  1  462 ? 25.673  41.134  17.250  1.00 31.83  ? 490  TYR A CD1 1 
ATOM   3435  C  CD2 . TYR A  1  462 ? 25.372  43.365  16.446  1.00 33.30  ? 490  TYR A CD2 1 
ATOM   3436  C  CE1 . TYR A  1  462 ? 25.571  40.644  15.959  1.00 31.23  ? 490  TYR A CE1 1 
ATOM   3437  C  CE2 . TYR A  1  462 ? 25.265  42.880  15.145  1.00 32.33  ? 490  TYR A CE2 1 
ATOM   3438  C  CZ  . TYR A  1  462 ? 25.370  41.526  14.916  1.00 32.35  ? 490  TYR A CZ  1 
ATOM   3439  O  OH  . TYR A  1  462 ? 25.263  41.057  13.633  1.00 34.80  ? 490  TYR A OH  1 
ATOM   3440  N  N   . ALA A  1  463 ? 27.132  44.876  21.138  1.00 34.66  ? 491  ALA A N   1 
ATOM   3441  C  CA  . ALA A  1  463 ? 26.943  45.369  22.495  1.00 34.17  ? 491  ALA A CA  1 
ATOM   3442  C  C   . ALA A  1  463 ? 25.664  46.178  22.520  1.00 33.48  ? 491  ALA A C   1 
ATOM   3443  O  O   . ALA A  1  463 ? 25.580  47.228  21.877  1.00 34.73  ? 491  ALA A O   1 
ATOM   3444  C  CB  . ALA A  1  463 ? 28.122  46.210  22.944  1.00 34.38  ? 491  ALA A CB  1 
ATOM   3445  N  N   . THR A  1  464 ? 24.660  45.660  23.226  1.00 31.77  ? 492  THR A N   1 
ATOM   3446  C  CA  . THR A  1  464 ? 23.360  46.319  23.372  1.00 29.65  ? 492  THR A CA  1 
ATOM   3447  C  C   . THR A  1  464 ? 23.131  46.456  24.876  1.00 28.95  ? 492  THR A C   1 
ATOM   3448  O  O   . THR A  1  464 ? 24.097  46.378  25.638  1.00 28.31  ? 492  THR A O   1 
ATOM   3449  C  CB  . THR A  1  464 ? 22.223  45.541  22.618  1.00 29.38  ? 492  THR A CB  1 
ATOM   3450  O  OG1 . THR A  1  464 ? 20.938  46.144  22.861  1.00 28.58  ? 492  THR A OG1 1 
ATOM   3451  C  CG2 . THR A  1  464 ? 22.188  44.075  23.023  1.00 28.42  ? 492  THR A CG2 1 
ATOM   3452  N  N   . GLY A  1  465 ? 21.884  46.653  25.304  1.00 28.15  ? 493  GLY A N   1 
ATOM   3453  C  CA  . GLY A  1  465 ? 21.576  46.901  26.720  1.00 28.03  ? 493  GLY A CA  1 
ATOM   3454  C  C   . GLY A  1  465 ? 21.673  48.365  27.117  1.00 27.82  ? 493  GLY A C   1 
ATOM   3455  O  O   . GLY A  1  465 ? 21.570  49.247  26.278  1.00 27.86  ? 493  GLY A O   1 
ATOM   3456  N  N   . TYR A  1  466 ? 21.870  48.622  28.398  1.00 27.74  ? 494  TYR A N   1 
ATOM   3457  C  CA  . TYR A  1  466 ? 21.993  49.979  28.894  1.00 28.23  ? 494  TYR A CA  1 
ATOM   3458  C  C   . TYR A  1  466 ? 23.422  50.502  28.771  1.00 28.76  ? 494  TYR A C   1 
ATOM   3459  O  O   . TYR A  1  466 ? 24.387  49.749  28.904  1.00 29.21  ? 494  TYR A O   1 
ATOM   3460  C  CB  . TYR A  1  466 ? 21.548  50.053  30.361  1.00 27.86  ? 494  TYR A CB  1 
ATOM   3461  C  CG  . TYR A  1  466 ? 20.051  50.060  30.532  1.00 28.35  ? 494  TYR A CG  1 
ATOM   3462  C  CD1 . TYR A  1  466 ? 19.340  48.878  30.765  1.00 27.90  ? 494  TYR A CD1 1 
ATOM   3463  C  CD2 . TYR A  1  466 ? 19.335  51.254  30.440  1.00 28.37  ? 494  TYR A CD2 1 
ATOM   3464  C  CE1 . TYR A  1  466 ? 17.936  48.898  30.899  1.00 28.35  ? 494  TYR A CE1 1 
ATOM   3465  C  CE2 . TYR A  1  466 ? 17.946  51.289  30.578  1.00 27.32  ? 494  TYR A CE2 1 
ATOM   3466  C  CZ  . TYR A  1  466 ? 17.253  50.117  30.802  1.00 28.17  ? 494  TYR A CZ  1 
ATOM   3467  O  OH  . TYR A  1  466 ? 15.880  50.186  30.936  1.00 28.23  ? 494  TYR A OH  1 
ATOM   3468  N  N   . ILE A  1  467 ? 23.553  51.798  28.524  1.00 29.13  ? 495  ILE A N   1 
ATOM   3469  C  CA  . ILE A  1  467 ? 24.823  52.468  28.746  1.00 29.47  ? 495  ILE A CA  1 
ATOM   3470  C  C   . ILE A  1  467 ? 25.064  52.700  30.245  1.00 30.46  ? 495  ILE A C   1 
ATOM   3471  O  O   . ILE A  1  467 ? 24.140  52.722  31.066  1.00 30.41  ? 495  ILE A O   1 
ATOM   3472  C  CB  . ILE A  1  467 ? 24.932  53.824  27.978  1.00 29.31  ? 495  ILE A CB  1 
ATOM   3473  C  CG1 . ILE A  1  467 ? 23.919  54.835  28.501  1.00 27.44  ? 495  ILE A CG1 1 
ATOM   3474  C  CG2 . ILE A  1  467 ? 24.786  53.620  26.463  1.00 27.78  ? 495  ILE A CG2 1 
ATOM   3475  C  CD1 . ILE A  1  467 ? 24.232  56.204  28.076  1.00 27.58  ? 495  ILE A CD1 1 
ATOM   3476  N  N   . SER A  1  468 ? 26.330  52.868  30.588  1.00 31.74  ? 496  SER A N   1 
ATOM   3477  C  CA  . SER A  1  468 ? 26.740  53.281  31.919  1.00 32.52  ? 496  SER A CA  1 
ATOM   3478  C  C   . SER A  1  468 ? 26.677  54.811  31.940  1.00 32.48  ? 496  SER A C   1 
ATOM   3479  O  O   . SER A  1  468 ? 27.101  55.449  30.981  1.00 32.73  ? 496  SER A O   1 
ATOM   3480  C  CB  . SER A  1  468 ? 28.169  52.822  32.147  1.00 32.07  ? 496  SER A CB  1 
ATOM   3481  O  OG  . SER A  1  468 ? 28.374  52.556  33.515  1.00 35.41  ? 496  SER A OG  1 
ATOM   3482  N  N   . SER A  1  469 ? 26.146  55.406  33.000  1.00 33.10  ? 497  SER A N   1 
ATOM   3483  C  CA  . SER A  1  469 ? 26.046  56.875  33.042  1.00 33.74  ? 497  SER A CA  1 
ATOM   3484  C  C   . SER A  1  469 ? 26.541  57.520  34.343  1.00 34.01  ? 497  SER A C   1 
ATOM   3485  O  O   . SER A  1  469 ? 26.742  56.851  35.359  1.00 34.10  ? 497  SER A O   1 
ATOM   3486  C  CB  . SER A  1  469 ? 24.617  57.330  32.729  1.00 33.71  ? 497  SER A CB  1 
ATOM   3487  O  OG  . SER A  1  469 ? 23.730  56.960  33.773  1.00 34.52  ? 497  SER A OG  1 
ATOM   3488  N  N   . ALA A  1  470 ? 26.743  58.829  34.303  1.00 34.25  ? 498  ALA A N   1 
ATOM   3489  C  CA  . ALA A  1  470 ? 27.181  59.561  35.484  1.00 34.42  ? 498  ALA A CA  1 
ATOM   3490  C  C   . ALA A  1  470 ? 26.335  60.814  35.616  1.00 34.53  ? 498  ALA A C   1 
ATOM   3491  O  O   . ALA A  1  470 ? 25.711  61.256  34.642  1.00 34.96  ? 498  ALA A O   1 
ATOM   3492  C  CB  . ALA A  1  470 ? 28.673  59.912  35.377  1.00 34.34  ? 498  ALA A CB  1 
ATOM   3493  N  N   . PHE A  1  471 ? 26.296  61.377  36.820  1.00 34.28  ? 499  PHE A N   1 
ATOM   3494  C  CA  . PHE A  1  471 ? 25.599  62.640  37.038  1.00 34.05  ? 499  PHE A CA  1 
ATOM   3495  C  C   . PHE A  1  471 ? 26.288  63.800  36.292  1.00 34.51  ? 499  PHE A C   1 
ATOM   3496  O  O   . PHE A  1  471 ? 27.514  63.944  36.351  1.00 34.46  ? 499  PHE A O   1 
ATOM   3497  C  CB  . PHE A  1  471 ? 25.476  62.946  38.541  1.00 33.11  ? 499  PHE A CB  1 
ATOM   3498  C  CG  . PHE A  1  471 ? 25.010  64.341  38.835  1.00 31.86  ? 499  PHE A CG  1 
ATOM   3499  C  CD1 . PHE A  1  471 ? 23.675  64.696  38.651  1.00 29.87  ? 499  PHE A CD1 1 
ATOM   3500  C  CD2 . PHE A  1  471 ? 25.919  65.320  39.274  1.00 30.82  ? 499  PHE A CD2 1 
ATOM   3501  C  CE1 . PHE A  1  471 ? 23.244  66.004  38.912  1.00 29.83  ? 499  PHE A CE1 1 
ATOM   3502  C  CE2 . PHE A  1  471 ? 25.494  66.630  39.541  1.00 28.30  ? 499  PHE A CE2 1 
ATOM   3503  C  CZ  . PHE A  1  471 ? 24.163  66.974  39.363  1.00 29.32  ? 499  PHE A CZ  1 
ATOM   3504  N  N   . LEU A  1  472 ? 25.483  64.631  35.630  1.00 34.91  ? 500  LEU A N   1 
ATOM   3505  C  CA  . LEU A  1  472 ? 25.985  65.688  34.772  1.00 35.69  ? 500  LEU A CA  1 
ATOM   3506  C  C   . LEU A  1  472 ? 26.338  66.935  35.565  1.00 36.36  ? 500  LEU A C   1 
ATOM   3507  O  O   . LEU A  1  472 ? 25.501  67.494  36.273  1.00 37.03  ? 500  LEU A O   1 
ATOM   3508  C  CB  . LEU A  1  472 ? 24.967  66.019  33.678  1.00 35.37  ? 500  LEU A CB  1 
ATOM   3509  C  CG  . LEU A  1  472 ? 25.399  66.946  32.532  1.00 36.12  ? 500  LEU A CG  1 
ATOM   3510  C  CD1 . LEU A  1  472 ? 25.984  66.167  31.393  1.00 36.23  ? 500  LEU A CD1 1 
ATOM   3511  C  CD2 . LEU A  1  472 ? 24.226  67.785  32.015  1.00 37.26  ? 500  LEU A CD2 1 
ATOM   3512  N  N   . PHE A  1  473 ? 27.591  67.362  35.457  1.00 37.04  ? 501  PHE A N   1 
ATOM   3513  C  CA  . PHE A  1  473 ? 28.011  68.645  36.011  1.00 38.04  ? 501  PHE A CA  1 
ATOM   3514  C  C   . PHE A  1  473 ? 29.135  69.182  35.127  1.00 39.32  ? 501  PHE A C   1 
ATOM   3515  O  O   . PHE A  1  473 ? 29.741  68.417  34.357  1.00 39.13  ? 501  PHE A O   1 
ATOM   3516  C  CB  . PHE A  1  473 ? 28.508  68.491  37.454  1.00 37.20  ? 501  PHE A CB  1 
ATOM   3517  C  CG  . PHE A  1  473 ? 29.882  67.884  37.540  1.00 36.19  ? 501  PHE A CG  1 
ATOM   3518  C  CD1 . PHE A  1  473 ? 31.018  68.705  37.623  1.00 33.20  ? 501  PHE A CD1 1 
ATOM   3519  C  CD2 . PHE A  1  473 ? 30.045  66.496  37.491  1.00 32.79  ? 501  PHE A CD2 1 
ATOM   3520  C  CE1 . PHE A  1  473 ? 32.284  68.153  37.671  1.00 33.21  ? 501  PHE A CE1 1 
ATOM   3521  C  CE2 . PHE A  1  473 ? 31.306  65.937  37.540  1.00 33.11  ? 501  PHE A CE2 1 
ATOM   3522  C  CZ  . PHE A  1  473 ? 32.436  66.762  37.628  1.00 34.11  ? 501  PHE A CZ  1 
ATOM   3523  N  N   . GLY A  1  474 ? 29.403  70.487  35.252  1.00 40.73  ? 502  GLY A N   1 
ATOM   3524  C  CA  . GLY A  1  474 ? 30.534  71.155  34.596  1.00 42.29  ? 502  GLY A CA  1 
ATOM   3525  C  C   . GLY A  1  474 ? 30.514  71.147  33.078  1.00 43.85  ? 502  GLY A C   1 
ATOM   3526  O  O   . GLY A  1  474 ? 29.472  70.891  32.451  1.00 43.64  ? 502  GLY A O   1 
ATOM   3527  N  N   . ALA A  1  475 ? 31.688  71.416  32.500  1.00 45.31  ? 503  ALA A N   1 
ATOM   3528  C  CA  . ALA A  1  475 ? 31.869  71.555  31.051  1.00 46.70  ? 503  ALA A CA  1 
ATOM   3529  C  C   . ALA A  1  475 ? 31.597  70.252  30.289  1.00 47.57  ? 503  ALA A C   1 
ATOM   3530  O  O   . ALA A  1  475 ? 32.424  69.312  30.284  1.00 48.25  ? 503  ALA A O   1 
ATOM   3531  C  CB  . ALA A  1  475 ? 33.268  72.088  30.734  1.00 46.52  ? 503  ALA A CB  1 
ATOM   3532  N  N   . THR A  1  476 ? 30.419  70.196  29.665  1.00 47.91  ? 504  THR A N   1 
ATOM   3533  C  CA  . THR A  1  476 ? 30.052  69.081  28.791  1.00 47.46  ? 504  THR A CA  1 
ATOM   3534  C  C   . THR A  1  476 ? 30.766  69.316  27.466  1.00 46.88  ? 504  THR A C   1 
ATOM   3535  O  O   . THR A  1  476 ? 30.708  70.418  26.901  1.00 47.20  ? 504  THR A O   1 
ATOM   3536  C  CB  . THR A  1  476 ? 28.501  69.016  28.552  1.00 47.85  ? 504  THR A CB  1 
ATOM   3537  O  OG1 . THR A  1  476 ? 27.819  68.892  29.810  1.00 47.61  ? 504  THR A OG1 1 
ATOM   3538  C  CG2 . THR A  1  476 ? 28.101  67.838  27.600  1.00 47.01  ? 504  THR A CG2 1 
ATOM   3539  N  N   . GLY A  1  477 ? 31.442  68.289  26.973  1.00 45.76  ? 505  GLY A N   1 
ATOM   3540  C  CA  . GLY A  1  477 ? 32.031  68.367  25.652  1.00 44.21  ? 505  GLY A CA  1 
ATOM   3541  C  C   . GLY A  1  477 ? 33.117  67.343  25.460  1.00 43.31  ? 505  GLY A C   1 
ATOM   3542  O  O   . GLY A  1  477 ? 33.366  66.906  24.341  1.00 43.67  ? 505  GLY A O   1 
ATOM   3543  N  N   . LYS A  1  478 ? 33.749  66.936  26.550  1.00 42.02  ? 506  LYS A N   1 
ATOM   3544  C  CA  . LYS A  1  478 ? 34.986  66.189  26.441  1.00 41.17  ? 506  LYS A CA  1 
ATOM   3545  C  C   . LYS A  1  478 ? 34.826  64.737  26.889  1.00 40.31  ? 506  LYS A C   1 
ATOM   3546  O  O   . LYS A  1  478 ? 35.687  63.911  26.615  1.00 39.97  ? 506  LYS A O   1 
ATOM   3547  C  CB  . LYS A  1  478 ? 36.073  66.905  27.253  1.00 41.56  ? 506  LYS A CB  1 
ATOM   3548  C  CG  . LYS A  1  478 ? 37.288  67.318  26.454  1.00 42.02  ? 506  LYS A CG  1 
ATOM   3549  C  CD  . LYS A  1  478 ? 38.097  68.397  27.190  1.00 43.31  ? 506  LYS A CD  1 
ATOM   3550  C  CE  . LYS A  1  478 ? 38.915  69.262  26.208  1.00 43.79  ? 506  LYS A CE  1 
ATOM   3551  N  NZ  . LYS A  1  478 ? 39.588  70.413  26.894  1.00 44.86  ? 506  LYS A NZ  1 
ATOM   3552  N  N   . TYR A  1  479 ? 33.712  64.426  27.553  1.00 39.57  ? 507  TYR A N   1 
ATOM   3553  C  CA  . TYR A  1  479 ? 33.511  63.098  28.158  1.00 38.71  ? 507  TYR A CA  1 
ATOM   3554  C  C   . TYR A  1  479 ? 32.246  62.336  27.712  1.00 37.84  ? 507  TYR A C   1 
ATOM   3555  O  O   . TYR A  1  479 ? 31.948  61.253  28.234  1.00 37.82  ? 507  TYR A O   1 
ATOM   3556  C  CB  . TYR A  1  479 ? 33.607  63.204  29.688  1.00 38.95  ? 507  TYR A CB  1 
ATOM   3557  C  CG  . TYR A  1  479 ? 34.887  63.868  30.120  1.00 39.68  ? 507  TYR A CG  1 
ATOM   3558  C  CD1 . TYR A  1  479 ? 36.114  63.202  29.989  1.00 40.23  ? 507  TYR A CD1 1 
ATOM   3559  C  CD2 . TYR A  1  479 ? 34.893  65.180  30.614  1.00 39.89  ? 507  TYR A CD2 1 
ATOM   3560  C  CE1 . TYR A  1  479 ? 37.304  63.820  30.347  1.00 39.45  ? 507  TYR A CE1 1 
ATOM   3561  C  CE2 . TYR A  1  479 ? 36.082  65.803  30.989  1.00 39.24  ? 507  TYR A CE2 1 
ATOM   3562  C  CZ  . TYR A  1  479 ? 37.283  65.110  30.848  1.00 39.82  ? 507  TYR A CZ  1 
ATOM   3563  O  OH  . TYR A  1  479 ? 38.479  65.698  31.206  1.00 41.49  ? 507  TYR A OH  1 
ATOM   3564  N  N   . GLY A  1  480 ? 31.527  62.895  26.737  1.00 36.66  ? 508  GLY A N   1 
ATOM   3565  C  CA  . GLY A  1  480 ? 30.300  62.292  26.213  1.00 35.05  ? 508  GLY A CA  1 
ATOM   3566  C  C   . GLY A  1  480 ? 29.190  63.315  26.056  1.00 34.32  ? 508  GLY A C   1 
ATOM   3567  O  O   . GLY A  1  480 ? 29.380  64.499  26.326  1.00 34.21  ? 508  GLY A O   1 
ATOM   3568  N  N   . ASN A  1  481 ? 28.024  62.850  25.625  1.00 33.62  ? 509  ASN A N   1 
ATOM   3569  C  CA  . ASN A  1  481 ? 26.859  63.710  25.474  1.00 33.00  ? 509  ASN A CA  1 
ATOM   3570  C  C   . ASN A  1  481 ? 25.855  63.547  26.630  1.00 32.77  ? 509  ASN A C   1 
ATOM   3571  O  O   . ASN A  1  481 ? 25.759  62.464  27.237  1.00 32.36  ? 509  ASN A O   1 
ATOM   3572  C  CB  . ASN A  1  481 ? 26.152  63.417  24.145  1.00 32.89  ? 509  ASN A CB  1 
ATOM   3573  C  CG  . ASN A  1  481 ? 27.067  63.554  22.946  1.00 33.57  ? 509  ASN A CG  1 
ATOM   3574  O  OD1 . ASN A  1  481 ? 27.732  64.579  22.766  1.00 34.84  ? 509  ASN A OD1 1 
ATOM   3575  N  ND2 . ASN A  1  481 ? 27.105  62.517  22.109  1.00 33.22  ? 509  ASN A ND2 1 
ATOM   3576  N  N   . GLN A  1  482 ? 25.118  64.624  26.927  1.00 32.10  ? 510  GLN A N   1 
ATOM   3577  C  CA  . GLN A  1  482 ? 23.909  64.523  27.740  1.00 31.71  ? 510  GLN A CA  1 
ATOM   3578  C  C   . GLN A  1  482 ? 22.875  63.737  26.935  1.00 31.25  ? 510  GLN A C   1 
ATOM   3579  O  O   . GLN A  1  482 ? 22.617  64.050  25.764  1.00 30.75  ? 510  GLN A O   1 
ATOM   3580  C  CB  . GLN A  1  482 ? 23.364  65.906  28.142  1.00 31.68  ? 510  GLN A CB  1 
ATOM   3581  C  CG  . GLN A  1  482 ? 22.253  65.839  29.206  1.00 31.34  ? 510  GLN A CG  1 
ATOM   3582  C  CD  . GLN A  1  482 ? 21.670  67.200  29.603  1.00 32.12  ? 510  GLN A CD  1 
ATOM   3583  O  OE1 . GLN A  1  482 ? 22.167  68.251  29.205  1.00 32.40  ? 510  GLN A OE1 1 
ATOM   3584  N  NE2 . GLN A  1  482 ? 20.612  67.174  30.409  1.00 32.39  ? 510  GLN A NE2 1 
ATOM   3585  N  N   . VAL A  1  483 ? 22.301  62.714  27.566  1.00 31.06  ? 511  VAL A N   1 
ATOM   3586  C  CA  . VAL A  1  483 ? 21.401  61.774  26.880  1.00 30.92  ? 511  VAL A CA  1 
ATOM   3587  C  C   . VAL A  1  483 ? 20.029  61.764  27.519  1.00 31.83  ? 511  VAL A C   1 
ATOM   3588  O  O   . VAL A  1  483 ? 19.067  61.259  26.937  1.00 31.88  ? 511  VAL A O   1 
ATOM   3589  C  CB  . VAL A  1  483 ? 21.980  60.325  26.811  1.00 30.42  ? 511  VAL A CB  1 
ATOM   3590  C  CG1 . VAL A  1  483 ? 23.247  60.312  25.975  1.00 30.28  ? 511  VAL A CG1 1 
ATOM   3591  C  CG2 . VAL A  1  483 ? 22.267  59.746  28.201  1.00 28.86  ? 511  VAL A CG2 1 
ATOM   3592  N  N   . SER A  1  484 ? 19.960  62.311  28.728  1.00 32.75  ? 512  SER A N   1 
ATOM   3593  C  CA  . SER A  1  484 ? 18.703  62.527  29.447  1.00 34.37  ? 512  SER A CA  1 
ATOM   3594  C  C   . SER A  1  484 ? 18.945  63.578  30.516  1.00 34.79  ? 512  SER A C   1 
ATOM   3595  O  O   . SER A  1  484 ? 20.047  64.117  30.614  1.00 34.77  ? 512  SER A O   1 
ATOM   3596  C  CB  . SER A  1  484 ? 18.128  61.230  30.054  1.00 34.53  ? 512  SER A CB  1 
ATOM   3597  O  OG  . SER A  1  484 ? 19.100  60.473  30.772  1.00 35.80  ? 512  SER A OG  1 
ATOM   3598  N  N   . GLU A  1  485 ? 17.930  63.885  31.315  1.00 35.84  ? 513  GLU A N   1 
ATOM   3599  C  CA  . GLU A  1  485 ? 18.107  64.950  32.293  1.00 36.54  ? 513  GLU A CA  1 
ATOM   3600  C  C   . GLU A  1  485 ? 19.091  64.508  33.364  1.00 36.31  ? 513  GLU A C   1 
ATOM   3601  O  O   . GLU A  1  485 ? 19.129  63.319  33.741  1.00 36.31  ? 513  GLU A O   1 
ATOM   3602  C  CB  . GLU A  1  485 ? 16.782  65.479  32.873  1.00 36.92  ? 513  GLU A CB  1 
ATOM   3603  C  CG  . GLU A  1  485 ? 16.884  66.958  33.456  1.00 39.90  ? 513  GLU A CG  1 
ATOM   3604  C  CD  . GLU A  1  485 ? 17.992  67.847  32.787  1.00 41.28  ? 513  GLU A CD  1 
ATOM   3605  O  OE1 . GLU A  1  485 ? 17.815  68.253  31.613  1.00 43.56  ? 513  GLU A OE1 1 
ATOM   3606  O  OE2 . GLU A  1  485 ? 19.027  68.140  33.433  1.00 37.66  ? 513  GLU A OE2 1 
ATOM   3607  N  N   . HIS A  1  486 ? 19.941  65.453  33.770  1.00 35.56  ? 514  HIS A N   1 
ATOM   3608  C  CA  . HIS A  1  486 ? 20.955  65.233  34.799  1.00 35.19  ? 514  HIS A CA  1 
ATOM   3609  C  C   . HIS A  1  486 ? 21.971  64.143  34.490  1.00 34.51  ? 514  HIS A C   1 
ATOM   3610  O  O   . HIS A  1  486 ? 22.757  63.773  35.362  1.00 34.39  ? 514  HIS A O   1 
ATOM   3611  C  CB  . HIS A  1  486 ? 20.281  64.980  36.148  1.00 35.60  ? 514  HIS A CB  1 
ATOM   3612  C  CG  . HIS A  1  486 ? 19.372  66.092  36.567  1.00 36.94  ? 514  HIS A CG  1 
ATOM   3613  N  ND1 . HIS A  1  486 ? 18.050  65.887  36.906  1.00 38.87  ? 514  HIS A ND1 1 
ATOM   3614  C  CD2 . HIS A  1  486 ? 19.583  67.428  36.655  1.00 37.02  ? 514  HIS A CD2 1 
ATOM   3615  C  CE1 . HIS A  1  486 ? 17.492  67.048  37.207  1.00 39.51  ? 514  HIS A CE1 1 
ATOM   3616  N  NE2 . HIS A  1  486 ? 18.402  67.998  37.063  1.00 38.52  ? 514  HIS A NE2 1 
ATOM   3617  N  N   . THR A  1  487 ? 21.985  63.670  33.243  1.00 33.76  ? 515  THR A N   1 
ATOM   3618  C  CA  . THR A  1  487 ? 22.736  62.473  32.885  1.00 33.11  ? 515  THR A CA  1 
ATOM   3619  C  C   . THR A  1  487 ? 23.747  62.639  31.738  1.00 32.75  ? 515  THR A C   1 
ATOM   3620  O  O   . THR A  1  487 ? 23.399  63.075  30.633  1.00 33.04  ? 515  THR A O   1 
ATOM   3621  C  CB  . THR A  1  487 ? 21.756  61.324  32.583  1.00 33.25  ? 515  THR A CB  1 
ATOM   3622  O  OG1 . THR A  1  487 ? 21.050  60.983  33.787  1.00 32.98  ? 515  THR A OG1 1 
ATOM   3623  C  CG2 . THR A  1  487 ? 22.490  60.091  32.055  1.00 32.89  ? 515  THR A CG2 1 
ATOM   3624  N  N   . LEU A  1  488 ? 24.999  62.283  32.019  1.00 31.80  ? 516  LEU A N   1 
ATOM   3625  C  CA  . LEU A  1  488 ? 26.041  62.216  31.009  1.00 31.09  ? 516  LEU A CA  1 
ATOM   3626  C  C   . LEU A  1  488 ? 26.208  60.777  30.552  1.00 30.74  ? 516  LEU A C   1 
ATOM   3627  O  O   . LEU A  1  488 ? 26.446  59.902  31.377  1.00 30.83  ? 516  LEU A O   1 
ATOM   3628  C  CB  . LEU A  1  488 ? 27.371  62.707  31.587  1.00 31.28  ? 516  LEU A CB  1 
ATOM   3629  C  CG  . LEU A  1  488 ? 28.631  62.575  30.721  1.00 31.16  ? 516  LEU A CG  1 
ATOM   3630  C  CD1 . LEU A  1  488 ? 28.737  63.752  29.761  1.00 31.87  ? 516  LEU A CD1 1 
ATOM   3631  C  CD2 . LEU A  1  488 ? 29.868  62.509  31.587  1.00 30.51  ? 516  LEU A CD2 1 
ATOM   3632  N  N   . GLY A  1  489 ? 26.084  60.528  29.246  1.00 30.47  ? 517  GLY A N   1 
ATOM   3633  C  CA  . GLY A  1  489 ? 26.410  59.212  28.683  1.00 29.90  ? 517  GLY A CA  1 
ATOM   3634  C  C   . GLY A  1  489 ? 27.911  59.188  28.492  1.00 29.73  ? 517  GLY A C   1 
ATOM   3635  O  O   . GLY A  1  489 ? 28.433  59.913  27.643  1.00 30.29  ? 517  GLY A O   1 
ATOM   3636  N  N   . THR A  1  490 ? 28.610  58.383  29.294  1.00 29.28  ? 518  THR A N   1 
ATOM   3637  C  CA  . THR A  1  490 ? 30.099  58.399  29.355  1.00 28.45  ? 518  THR A CA  1 
ATOM   3638  C  C   . THR A  1  490 ? 30.804  57.696  28.188  1.00 27.64  ? 518  THR A C   1 
ATOM   3639  O  O   . THR A  1  490 ? 30.519  56.536  27.862  1.00 27.28  ? 518  THR A O   1 
ATOM   3640  C  CB  . THR A  1  490 ? 30.612  57.739  30.650  1.00 28.80  ? 518  THR A CB  1 
ATOM   3641  O  OG1 . THR A  1  490 ? 30.066  56.411  30.738  1.00 28.02  ? 518  THR A OG1 1 
ATOM   3642  C  CG2 . THR A  1  490 ? 30.217  58.554  31.869  1.00 27.62  ? 518  THR A CG2 1 
ATOM   3643  N  N   . VAL A  1  491 ? 31.752  58.398  27.591  1.00 27.02  ? 519  VAL A N   1 
ATOM   3644  C  CA  . VAL A  1  491 ? 32.466  57.897  26.420  1.00 26.60  ? 519  VAL A CA  1 
ATOM   3645  C  C   . VAL A  1  491 ? 33.246  56.650  26.778  1.00 26.93  ? 519  VAL A C   1 
ATOM   3646  O  O   . VAL A  1  491 ? 33.724  56.524  27.902  1.00 27.20  ? 519  VAL A O   1 
ATOM   3647  C  CB  . VAL A  1  491 ? 33.370  58.993  25.797  1.00 26.33  ? 519  VAL A CB  1 
ATOM   3648  C  CG1 . VAL A  1  491 ? 34.403  59.526  26.799  1.00 25.27  ? 519  VAL A CG1 1 
ATOM   3649  C  CG2 . VAL A  1  491 ? 34.032  58.499  24.528  1.00 25.73  ? 519  VAL A CG2 1 
ATOM   3650  N  N   . HIS A  1  492 ? 33.352  55.716  25.839  1.00 27.44  ? 520  HIS A N   1 
ATOM   3651  C  CA  . HIS A  1  492 ? 34.077  54.470  26.090  1.00 28.19  ? 520  HIS A CA  1 
ATOM   3652  C  C   . HIS A  1  492 ? 34.273  53.680  24.822  1.00 28.96  ? 520  HIS A C   1 
ATOM   3653  O  O   . HIS A  1  492 ? 33.523  53.867  23.854  1.00 29.26  ? 520  HIS A O   1 
ATOM   3654  C  CB  . HIS A  1  492 ? 33.303  53.586  27.061  1.00 28.17  ? 520  HIS A CB  1 
ATOM   3655  C  CG  . HIS A  1  492 ? 31.954  53.200  26.555  1.00 28.38  ? 520  HIS A CG  1 
ATOM   3656  N  ND1 . HIS A  1  492 ? 30.859  54.032  26.660  1.00 27.28  ? 520  HIS A ND1 1 
ATOM   3657  C  CD2 . HIS A  1  492 ? 31.530  52.092  25.904  1.00 28.21  ? 520  HIS A CD2 1 
ATOM   3658  C  CE1 . HIS A  1  492 ? 29.813  53.444  26.111  1.00 28.40  ? 520  HIS A CE1 1 
ATOM   3659  N  NE2 . HIS A  1  492 ? 30.192  52.266  25.644  1.00 29.30  ? 520  HIS A NE2 1 
ATOM   3660  N  N   . THR A  1  493 ? 35.248  52.766  24.855  1.00 29.30  ? 521  THR A N   1 
ATOM   3661  C  CA  . THR A  1  493 ? 35.490  51.839  23.758  1.00 29.83  ? 521  THR A CA  1 
ATOM   3662  C  C   . THR A  1  493 ? 35.089  50.426  24.162  1.00 30.41  ? 521  THR A C   1 
ATOM   3663  O  O   . THR A  1  493 ? 35.167  50.073  25.338  1.00 30.90  ? 521  THR A O   1 
ATOM   3664  C  CB  . THR A  1  493 ? 36.983  51.800  23.348  1.00 29.97  ? 521  THR A CB  1 
ATOM   3665  O  OG1 . THR A  1  493 ? 37.770  51.415  24.481  1.00 30.41  ? 521  THR A OG1 1 
ATOM   3666  C  CG2 . THR A  1  493 ? 37.448  53.151  22.841  1.00 28.57  ? 521  THR A CG2 1 
ATOM   3667  N  N   . HIS A  1  494 ? 34.661  49.630  23.184  1.00 30.56  ? 522  HIS A N   1 
ATOM   3668  C  CA  . HIS A  1  494 ? 34.487  48.199  23.354  1.00 30.89  ? 522  HIS A CA  1 
ATOM   3669  C  C   . HIS A  1  494 ? 35.522  47.435  22.531  1.00 31.02  ? 522  HIS A C   1 
ATOM   3670  O  O   . HIS A  1  494 ? 35.853  47.824  21.416  1.00 31.24  ? 522  HIS A O   1 
ATOM   3671  C  CB  . HIS A  1  494 ? 33.107  47.774  22.889  1.00 31.22  ? 522  HIS A CB  1 
ATOM   3672  C  CG  . HIS A  1  494 ? 31.976  48.411  23.638  1.00 32.80  ? 522  HIS A CG  1 
ATOM   3673  N  ND1 . HIS A  1  494 ? 31.450  47.871  24.794  1.00 34.11  ? 522  HIS A ND1 1 
ATOM   3674  C  CD2 . HIS A  1  494 ? 31.228  49.506  23.359  1.00 32.53  ? 522  HIS A CD2 1 
ATOM   3675  C  CE1 . HIS A  1  494 ? 30.438  48.618  25.205  1.00 34.64  ? 522  HIS A CE1 1 
ATOM   3676  N  NE2 . HIS A  1  494 ? 30.280  49.613  24.350  1.00 33.72  ? 522  HIS A NE2 1 
ATOM   3677  N  N   . SER A  1  495 ? 36.027  46.338  23.085  1.00 31.37  ? 523  SER A N   1 
ATOM   3678  C  CA  . SER A  1  495 ? 36.922  45.427  22.358  1.00 31.64  ? 523  SER A CA  1 
ATOM   3679  C  C   . SER A  1  495 ? 36.687  44.017  22.839  1.00 31.71  ? 523  SER A C   1 
ATOM   3680  O  O   . SER A  1  495 ? 36.347  43.801  24.013  1.00 31.89  ? 523  SER A O   1 
ATOM   3681  C  CB  . SER A  1  495 ? 38.387  45.766  22.609  1.00 31.54  ? 523  SER A CB  1 
ATOM   3682  O  OG  . SER A  1  495 ? 38.660  47.096  22.218  1.00 33.21  ? 523  SER A OG  1 
ATOM   3683  N  N   . ALA A  1  496 ? 36.869  43.064  21.934  1.00 31.25  ? 524  ALA A N   1 
ATOM   3684  C  CA  . ALA A  1  496 ? 36.864  41.665  22.285  1.00 31.09  ? 524  ALA A CA  1 
ATOM   3685  C  C   . ALA A  1  496 ? 38.009  40.978  21.571  1.00 31.24  ? 524  ALA A C   1 
ATOM   3686  O  O   . ALA A  1  496 ? 38.357  41.347  20.443  1.00 31.31  ? 524  ALA A O   1 
ATOM   3687  C  CB  . ALA A  1  496 ? 35.548  41.028  21.913  1.00 30.98  ? 524  ALA A CB  1 
ATOM   3688  N  N   . HIS A  1  497 ? 38.582  39.976  22.226  1.00 31.22  ? 525  HIS A N   1 
ATOM   3689  C  CA  . HIS A  1  497 ? 39.685  39.200  21.661  1.00 31.77  ? 525  HIS A CA  1 
ATOM   3690  C  C   . HIS A  1  497 ? 39.280  37.751  21.406  1.00 31.67  ? 525  HIS A C   1 
ATOM   3691  O  O   . HIS A  1  497 ? 38.760  37.089  22.317  1.00 32.59  ? 525  HIS A O   1 
ATOM   3692  C  CB  . HIS A  1  497 ? 40.863  39.225  22.621  1.00 31.68  ? 525  HIS A CB  1 
ATOM   3693  C  CG  . HIS A  1  497 ? 42.165  38.906  21.968  1.00 33.34  ? 525  HIS A CG  1 
ATOM   3694  N  ND1 . HIS A  1  497 ? 42.957  37.850  22.363  1.00 33.53  ? 525  HIS A ND1 1 
ATOM   3695  C  CD2 . HIS A  1  497 ? 42.809  39.498  20.933  1.00 32.92  ? 525  HIS A CD2 1 
ATOM   3696  C  CE1 . HIS A  1  497 ? 44.037  37.811  21.604  1.00 33.49  ? 525  HIS A CE1 1 
ATOM   3697  N  NE2 . HIS A  1  497 ? 43.972  38.799  20.729  1.00 32.51  ? 525  HIS A NE2 1 
ATOM   3698  N  N   . PHE A  1  498 ? 39.502  37.259  20.189  1.00 30.90  ? 526  PHE A N   1 
ATOM   3699  C  CA  . PHE A  1  498 ? 39.124  35.877  19.838  1.00 30.28  ? 526  PHE A CA  1 
ATOM   3700  C  C   . PHE A  1  498 ? 40.322  35.001  19.519  1.00 30.25  ? 526  PHE A C   1 
ATOM   3701  O  O   . PHE A  1  498 ? 41.297  35.469  18.938  1.00 30.48  ? 526  PHE A O   1 
ATOM   3702  C  CB  . PHE A  1  498 ? 38.188  35.856  18.631  1.00 29.88  ? 526  PHE A CB  1 
ATOM   3703  C  CG  . PHE A  1  498 ? 36.862  36.479  18.890  1.00 29.23  ? 526  PHE A CG  1 
ATOM   3704  C  CD1 . PHE A  1  498 ? 36.681  37.856  18.727  1.00 28.41  ? 526  PHE A CD1 1 
ATOM   3705  C  CD2 . PHE A  1  498 ? 35.789  35.699  19.308  1.00 27.80  ? 526  PHE A CD2 1 
ATOM   3706  C  CE1 . PHE A  1  498 ? 35.449  38.438  18.975  1.00 27.35  ? 526  PHE A CE1 1 
ATOM   3707  C  CE2 . PHE A  1  498 ? 34.564  36.271  19.569  1.00 26.93  ? 526  PHE A CE2 1 
ATOM   3708  C  CZ  . PHE A  1  498 ? 34.390  37.649  19.399  1.00 27.59  ? 526  PHE A CZ  1 
ATOM   3709  N  N   . LYS A  1  499 ? 40.233  33.724  19.885  1.00 30.41  ? 527  LYS A N   1 
ATOM   3710  C  CA  . LYS A  1  499 ? 41.239  32.726  19.541  1.00 30.18  ? 527  LYS A CA  1 
ATOM   3711  C  C   . LYS A  1  499 ? 40.745  31.903  18.346  1.00 30.52  ? 527  LYS A C   1 
ATOM   3712  O  O   . LYS A  1  499 ? 39.664  31.304  18.397  1.00 30.87  ? 527  LYS A O   1 
ATOM   3713  C  CB  . LYS A  1  499 ? 41.511  31.832  20.743  1.00 30.09  ? 527  LYS A CB  1 
ATOM   3714  C  CG  . LYS A  1  499 ? 42.635  30.832  20.543  1.00 30.26  ? 527  LYS A CG  1 
ATOM   3715  C  CD  . LYS A  1  499 ? 42.743  29.881  21.724  1.00 30.25  ? 527  LYS A CD  1 
ATOM   3716  C  CE  . LYS A  1  499 ? 43.998  29.018  21.616  1.00 30.56  ? 527  LYS A CE  1 
ATOM   3717  N  NZ  . LYS A  1  499 ? 44.110  28.061  22.754  1.00 29.30  ? 527  LYS A NZ  1 
ATOM   3718  N  N   . VAL A  1  500 ? 41.529  31.881  17.271  1.00 30.16  ? 528  VAL A N   1 
ATOM   3719  C  CA  . VAL A  1  500 ? 41.138  31.199  16.040  1.00 30.22  ? 528  VAL A CA  1 
ATOM   3720  C  C   . VAL A  1  500 ? 42.166  30.147  15.643  1.00 30.77  ? 528  VAL A C   1 
ATOM   3721  O  O   . VAL A  1  500 ? 43.132  30.436  14.919  1.00 30.64  ? 528  VAL A O   1 
ATOM   3722  C  CB  . VAL A  1  500 ? 40.937  32.209  14.888  1.00 30.32  ? 528  VAL A CB  1 
ATOM   3723  C  CG1 . VAL A  1  500 ? 40.524  31.511  13.611  1.00 29.22  ? 528  VAL A CG1 1 
ATOM   3724  C  CG2 . VAL A  1  500 ? 39.901  33.266  15.279  1.00 30.38  ? 528  VAL A CG2 1 
ATOM   3725  N  N   . ASP A  1  501 ? 41.961  28.925  16.128  1.00 31.29  ? 529  ASP A N   1 
ATOM   3726  C  CA  . ASP A  1  501 ? 42.858  27.820  15.825  1.00 32.06  ? 529  ASP A CA  1 
ATOM   3727  C  C   . ASP A  1  501 ? 42.396  27.083  14.567  1.00 32.43  ? 529  ASP A C   1 
ATOM   3728  O  O   . ASP A  1  501 ? 41.729  26.034  14.630  1.00 32.46  ? 529  ASP A O   1 
ATOM   3729  C  CB  . ASP A  1  501 ? 42.991  26.871  17.024  1.00 32.36  ? 529  ASP A CB  1 
ATOM   3730  C  CG  . ASP A  1  501 ? 44.107  25.831  16.845  1.00 33.99  ? 529  ASP A CG  1 
ATOM   3731  O  OD1 . ASP A  1  501 ? 44.832  25.879  15.818  1.00 35.21  ? 529  ASP A OD1 1 
ATOM   3732  O  OD2 . ASP A  1  501 ? 44.253  24.954  17.737  1.00 33.74  ? 529  ASP A OD2 1 
ATOM   3733  N  N   . LEU A  1  502 ? 42.744  27.672  13.423  1.00 32.82  ? 530  LEU A N   1 
ATOM   3734  C  CA  . LEU A  1  502 ? 42.577  27.046  12.117  1.00 32.63  ? 530  LEU A CA  1 
ATOM   3735  C  C   . LEU A  1  502 ? 43.619  25.968  11.994  1.00 32.67  ? 530  LEU A C   1 
ATOM   3736  O  O   . LEU A  1  502 ? 44.780  26.191  12.334  1.00 32.19  ? 530  LEU A O   1 
ATOM   3737  C  CB  . LEU A  1  502 ? 42.792  28.077  11.002  1.00 32.47  ? 530  LEU A CB  1 
ATOM   3738  C  CG  . LEU A  1  502 ? 41.707  29.136  10.764  1.00 33.26  ? 530  LEU A CG  1 
ATOM   3739  C  CD1 . LEU A  1  502 ? 42.327  30.450  10.277  1.00 34.18  ? 530  LEU A CD1 1 
ATOM   3740  C  CD2 . LEU A  1  502 ? 40.609  28.639  9.792   1.00 32.91  ? 530  LEU A CD2 1 
ATOM   3741  N  N   . ASP A  1  503 ? 43.199  24.785  11.558  1.00 33.27  ? 531  ASP A N   1 
ATOM   3742  C  CA  . ASP A  1  503 ? 44.134  23.735  11.149  1.00 33.87  ? 531  ASP A CA  1 
ATOM   3743  C  C   . ASP A  1  503 ? 43.855  23.480  9.675   1.00 34.06  ? 531  ASP A C   1 
ATOM   3744  O  O   . ASP A  1  503 ? 43.133  22.531  9.344   1.00 34.70  ? 531  ASP A O   1 
ATOM   3745  C  CB  . ASP A  1  503 ? 43.897  22.434  11.931  1.00 34.00  ? 531  ASP A CB  1 
ATOM   3746  C  CG  . ASP A  1  503 ? 44.338  22.506  13.379  1.00 34.42  ? 531  ASP A CG  1 
ATOM   3747  O  OD1 . ASP A  1  503 ? 45.046  23.462  13.764  1.00 34.27  ? 531  ASP A OD1 1 
ATOM   3748  O  OD2 . ASP A  1  503 ? 43.983  21.561  14.129  1.00 35.11  ? 531  ASP A OD2 1 
ATOM   3749  N  N   . VAL A  1  504 ? 44.395  24.326  8.795   1.00 34.19  ? 532  VAL A N   1 
ATOM   3750  C  CA  . VAL A  1  504 ? 44.003  24.312  7.370   1.00 34.27  ? 532  VAL A CA  1 
ATOM   3751  C  C   . VAL A  1  504 ? 44.514  23.064  6.680   1.00 34.35  ? 532  VAL A C   1 
ATOM   3752  O  O   . VAL A  1  504 ? 45.698  22.958  6.395   1.00 34.47  ? 532  VAL A O   1 
ATOM   3753  C  CB  . VAL A  1  504 ? 44.483  25.575  6.598   1.00 34.36  ? 532  VAL A CB  1 
ATOM   3754  C  CG1 . VAL A  1  504 ? 44.009  25.534  5.148   1.00 33.48  ? 532  VAL A CG1 1 
ATOM   3755  C  CG2 . VAL A  1  504 ? 43.998  26.856  7.282   1.00 33.91  ? 532  VAL A CG2 1 
ATOM   3756  N  N   . ALA A  1  505 ? 43.617  22.112  6.430   1.00 34.64  ? 533  ALA A N   1 
ATOM   3757  C  CA  . ALA A  1  505 ? 43.996  20.838  5.807   1.00 34.96  ? 533  ALA A CA  1 
ATOM   3758  C  C   . ALA A  1  505 ? 45.131  20.121  6.545   1.00 35.02  ? 533  ALA A C   1 
ATOM   3759  O  O   . ALA A  1  505 ? 45.975  19.482  5.920   1.00 35.46  ? 533  ALA A O   1 
ATOM   3760  C  CB  . ALA A  1  505 ? 44.371  21.047  4.306   1.00 34.56  ? 533  ALA A CB  1 
ATOM   3761  N  N   . GLY A  1  506 ? 45.151  20.221  7.867   1.00 35.19  ? 534  GLY A N   1 
ATOM   3762  C  CA  . GLY A  1  506 ? 46.236  19.640  8.671   1.00 35.23  ? 534  GLY A CA  1 
ATOM   3763  C  C   . GLY A  1  506 ? 46.809  20.662  9.636   1.00 35.29  ? 534  GLY A C   1 
ATOM   3764  O  O   . GLY A  1  506 ? 46.506  21.856  9.537   1.00 35.55  ? 534  GLY A O   1 
ATOM   3765  N  N   . LEU A  1  507 ? 47.641  20.195  10.564  1.00 35.34  ? 535  LEU A N   1 
ATOM   3766  C  CA  . LEU A  1  507 ? 48.225  21.045  11.608  1.00 35.36  ? 535  LEU A CA  1 
ATOM   3767  C  C   . LEU A  1  507 ? 49.224  22.053  11.069  1.00 34.90  ? 535  LEU A C   1 
ATOM   3768  O  O   . LEU A  1  507 ? 49.220  23.208  11.485  1.00 34.67  ? 535  LEU A O   1 
ATOM   3769  C  CB  . LEU A  1  507 ? 48.957  20.198  12.651  1.00 35.65  ? 535  LEU A CB  1 
ATOM   3770  C  CG  . LEU A  1  507 ? 48.177  19.350  13.641  1.00 37.27  ? 535  LEU A CG  1 
ATOM   3771  C  CD1 . LEU A  1  507 ? 48.967  18.080  13.926  1.00 37.19  ? 535  LEU A CD1 1 
ATOM   3772  C  CD2 . LEU A  1  507 ? 47.888  20.138  14.918  1.00 37.49  ? 535  LEU A CD2 1 
ATOM   3773  N  N   . GLU A  1  508 ? 50.105  21.598  10.178  1.00 34.41  ? 536  GLU A N   1 
ATOM   3774  C  CA  . GLU A  1  508 ? 51.232  22.418  9.739   1.00 34.33  ? 536  GLU A CA  1 
ATOM   3775  C  C   . GLU A  1  508 ? 50.721  23.500  8.804   1.00 33.12  ? 536  GLU A C   1 
ATOM   3776  O  O   . GLU A  1  508 ? 50.272  23.199  7.699   1.00 33.32  ? 536  GLU A O   1 
ATOM   3777  C  CB  . GLU A  1  508 ? 52.328  21.576  9.042   1.00 34.91  ? 536  GLU A CB  1 
ATOM   3778  C  CG  . GLU A  1  508 ? 52.512  20.134  9.559   1.00 37.64  ? 536  GLU A CG  1 
ATOM   3779  C  CD  . GLU A  1  508 ? 52.886  20.070  11.033  1.00 41.89  ? 536  GLU A CD  1 
ATOM   3780  O  OE1 . GLU A  1  508 ? 53.528  21.034  11.521  1.00 43.98  ? 536  GLU A OE1 1 
ATOM   3781  O  OE2 . GLU A  1  508 ? 52.537  19.062  11.706  1.00 42.40  ? 536  GLU A OE2 1 
ATOM   3782  N  N   . ASN A  1  509 ? 50.770  24.749  9.263   1.00 31.60  ? 537  ASN A N   1 
ATOM   3783  C  CA  . ASN A  1  509 ? 50.341  25.886  8.450   1.00 30.25  ? 537  ASN A CA  1 
ATOM   3784  C  C   . ASN A  1  509 ? 51.413  26.954  8.214   1.00 29.44  ? 537  ASN A C   1 
ATOM   3785  O  O   . ASN A  1  509 ? 52.417  27.041  8.930   1.00 28.60  ? 537  ASN A O   1 
ATOM   3786  C  CB  . ASN A  1  509 ? 49.072  26.523  9.019   1.00 29.85  ? 537  ASN A CB  1 
ATOM   3787  C  CG  . ASN A  1  509 ? 47.833  25.654  8.816   1.00 30.72  ? 537  ASN A CG  1 
ATOM   3788  O  OD1 . ASN A  1  509 ? 46.803  25.866  9.468   1.00 31.32  ? 537  ASN A OD1 1 
ATOM   3789  N  ND2 . ASN A  1  509 ? 47.923  24.678  7.913   1.00 29.50  ? 537  ASN A ND2 1 
ATOM   3790  N  N   . TRP A  1  510 ? 51.156  27.756  7.188   1.00 28.58  ? 538  TRP A N   1 
ATOM   3791  C  CA  . TRP A  1  510 ? 51.991  28.861  6.779   1.00 28.25  ? 538  TRP A CA  1 
ATOM   3792  C  C   . TRP A  1  510 ? 51.111  30.123  6.653   1.00 28.61  ? 538  TRP A C   1 
ATOM   3793  O  O   . TRP A  1  510 ? 49.882  30.025  6.498   1.00 28.08  ? 538  TRP A O   1 
ATOM   3794  C  CB  . TRP A  1  510 ? 52.607  28.522  5.421   1.00 27.38  ? 538  TRP A CB  1 
ATOM   3795  C  CG  . TRP A  1  510 ? 53.788  27.569  5.450   1.00 26.86  ? 538  TRP A CG  1 
ATOM   3796  C  CD1 . TRP A  1  510 ? 55.098  27.914  5.370   1.00 26.61  ? 538  TRP A CD1 1 
ATOM   3797  C  CD2 . TRP A  1  510 ? 53.759  26.133  5.515   1.00 25.91  ? 538  TRP A CD2 1 
ATOM   3798  N  NE1 . TRP A  1  510 ? 55.891  26.798  5.394   1.00 26.34  ? 538  TRP A NE1 1 
ATOM   3799  C  CE2 . TRP A  1  510 ? 55.095  25.690  5.486   1.00 26.51  ? 538  TRP A CE2 1 
ATOM   3800  C  CE3 . TRP A  1  510 ? 52.737  25.180  5.603   1.00 26.81  ? 538  TRP A CE3 1 
ATOM   3801  C  CZ2 . TRP A  1  510 ? 55.442  24.330  5.546   1.00 26.22  ? 538  TRP A CZ2 1 
ATOM   3802  C  CZ3 . TRP A  1  510 ? 53.081  23.835  5.681   1.00 26.33  ? 538  TRP A CZ3 1 
ATOM   3803  C  CH2 . TRP A  1  510 ? 54.421  23.423  5.642   1.00 25.98  ? 538  TRP A CH2 1 
ATOM   3804  N  N   . VAL A  1  511 ? 51.726  31.307  6.700   1.00 28.89  ? 539  VAL A N   1 
ATOM   3805  C  CA  . VAL A  1  511 ? 50.951  32.550  6.555   1.00 29.10  ? 539  VAL A CA  1 
ATOM   3806  C  C   . VAL A  1  511 ? 51.348  33.308  5.297   1.00 29.70  ? 539  VAL A C   1 
ATOM   3807  O  O   . VAL A  1  511 ? 52.539  33.629  5.093   1.00 29.97  ? 539  VAL A O   1 
ATOM   3808  C  CB  . VAL A  1  511 ? 51.079  33.498  7.774   1.00 29.00  ? 539  VAL A CB  1 
ATOM   3809  C  CG1 . VAL A  1  511 ? 50.064  34.606  7.672   1.00 28.91  ? 539  VAL A CG1 1 
ATOM   3810  C  CG2 . VAL A  1  511 ? 50.886  32.748  9.084   1.00 28.09  ? 539  VAL A CG2 1 
ATOM   3811  N  N   . TRP A  1  512 ? 50.351  33.599  4.459   1.00 29.77  ? 540  TRP A N   1 
ATOM   3812  C  CA  . TRP A  1  512 ? 50.585  34.346  3.227   1.00 29.94  ? 540  TRP A CA  1 
ATOM   3813  C  C   . TRP A  1  512 ? 49.942  35.718  3.276   1.00 30.13  ? 540  TRP A C   1 
ATOM   3814  O  O   . TRP A  1  512 ? 48.820  35.862  3.752   1.00 31.00  ? 540  TRP A O   1 
ATOM   3815  C  CB  . TRP A  1  512 ? 50.054  33.591  2.011   1.00 29.54  ? 540  TRP A CB  1 
ATOM   3816  C  CG  . TRP A  1  512 ? 50.783  32.338  1.723   1.00 29.36  ? 540  TRP A CG  1 
ATOM   3817  C  CD1 . TRP A  1  512 ? 50.420  31.074  2.096   1.00 29.05  ? 540  TRP A CD1 1 
ATOM   3818  C  CD2 . TRP A  1  512 ? 52.015  32.210  1.006   1.00 29.33  ? 540  TRP A CD2 1 
ATOM   3819  N  NE1 . TRP A  1  512 ? 51.352  30.164  1.656   1.00 29.07  ? 540  TRP A NE1 1 
ATOM   3820  C  CE2 . TRP A  1  512 ? 52.340  30.834  0.980   1.00 29.33  ? 540  TRP A CE2 1 
ATOM   3821  C  CE3 . TRP A  1  512 ? 52.881  33.126  0.387   1.00 28.64  ? 540  TRP A CE3 1 
ATOM   3822  C  CZ2 . TRP A  1  512 ? 53.485  30.349  0.345   1.00 29.10  ? 540  TRP A CZ2 1 
ATOM   3823  C  CZ3 . TRP A  1  512 ? 54.013  32.651  -0.233  1.00 28.87  ? 540  TRP A CZ3 1 
ATOM   3824  C  CH2 . TRP A  1  512 ? 54.310  31.267  -0.251  1.00 29.47  ? 540  TRP A CH2 1 
ATOM   3825  N  N   . ALA A  1  513 ? 50.652  36.714  2.757   1.00 30.18  ? 541  ALA A N   1 
ATOM   3826  C  CA  . ALA A  1  513 ? 50.102  38.043  2.563   1.00 30.22  ? 541  ALA A CA  1 
ATOM   3827  C  C   . ALA A  1  513 ? 49.974  38.337  1.063   1.00 30.87  ? 541  ALA A C   1 
ATOM   3828  O  O   . ALA A  1  513 ? 50.965  38.351  0.314   1.00 31.02  ? 541  ALA A O   1 
ATOM   3829  C  CB  . ALA A  1  513 ? 50.974  39.080  3.248   1.00 29.69  ? 541  ALA A CB  1 
ATOM   3830  N  N   . GLU A  1  514 ? 48.748  38.549  0.610   1.00 31.14  ? 542  GLU A N   1 
ATOM   3831  C  CA  . GLU A  1  514 ? 48.560  39.014  -0.747  1.00 31.49  ? 542  GLU A CA  1 
ATOM   3832  C  C   . GLU A  1  514 ? 47.952  40.394  -0.782  1.00 31.65  ? 542  GLU A C   1 
ATOM   3833  O  O   . GLU A  1  514 ? 47.160  40.753  0.090   1.00 31.67  ? 542  GLU A O   1 
ATOM   3834  C  CB  . GLU A  1  514 ? 47.749  38.026  -1.564  1.00 31.23  ? 542  GLU A CB  1 
ATOM   3835  C  CG  . GLU A  1  514 ? 48.638  36.957  -2.149  1.00 32.09  ? 542  GLU A CG  1 
ATOM   3836  C  CD  . GLU A  1  514 ? 47.873  35.776  -2.660  1.00 32.81  ? 542  GLU A CD  1 
ATOM   3837  O  OE1 . GLU A  1  514 ? 46.712  35.961  -3.075  1.00 32.57  ? 542  GLU A OE1 1 
ATOM   3838  O  OE2 . GLU A  1  514 ? 48.444  34.660  -2.646  1.00 34.07  ? 542  GLU A OE2 1 
ATOM   3839  N  N   . ASP A  1  515 ? 48.353  41.163  -1.790  1.00 31.68  ? 543  ASP A N   1 
ATOM   3840  C  CA  . ASP A  1  515 ? 47.854  42.509  -1.980  1.00 31.61  ? 543  ASP A CA  1 
ATOM   3841  C  C   . ASP A  1  515 ? 48.009  42.947  -3.442  1.00 31.41  ? 543  ASP A C   1 
ATOM   3842  O  O   . ASP A  1  515 ? 48.261  42.127  -4.315  1.00 31.34  ? 543  ASP A O   1 
ATOM   3843  C  CB  . ASP A  1  515 ? 48.533  43.476  -1.004  1.00 31.63  ? 543  ASP A CB  1 
ATOM   3844  C  CG  . ASP A  1  515 ? 47.587  44.565  -0.521  1.00 32.55  ? 543  ASP A CG  1 
ATOM   3845  O  OD1 . ASP A  1  515 ? 47.021  45.281  -1.373  1.00 33.59  ? 543  ASP A OD1 1 
ATOM   3846  O  OD2 . ASP A  1  515 ? 47.391  44.698  0.702   1.00 32.66  ? 543  ASP A OD2 1 
ATOM   3847  N  N   . MET A  1  516 ? 47.834  44.235  -3.709  1.00 31.17  ? 544  MET A N   1 
ATOM   3848  C  CA  . MET A  1  516 ? 47.833  44.742  -5.077  1.00 30.73  ? 544  MET A CA  1 
ATOM   3849  C  C   . MET A  1  516 ? 48.847  45.874  -5.242  1.00 30.33  ? 544  MET A C   1 
ATOM   3850  O  O   . MET A  1  516 ? 49.276  46.499  -4.268  1.00 30.52  ? 544  MET A O   1 
ATOM   3851  C  CB  . MET A  1  516 ? 46.436  45.232  -5.448  1.00 30.53  ? 544  MET A CB  1 
ATOM   3852  C  CG  . MET A  1  516 ? 46.037  46.469  -4.662  1.00 30.42  ? 544  MET A CG  1 
ATOM   3853  S  SD  . MET A  1  516 ? 44.380  47.057  -5.002  1.00 31.45  ? 544  MET A SD  1 
ATOM   3854  C  CE  . MET A  1  516 ? 44.629  47.915  -6.559  1.00 29.26  ? 544  MET A CE  1 
ATOM   3855  N  N   . VAL A  1  517 ? 49.233  46.131  -6.481  1.00 29.90  ? 545  VAL A N   1 
ATOM   3856  C  CA  . VAL A  1  517 ? 50.191  47.178  -6.764  1.00 29.81  ? 545  VAL A CA  1 
ATOM   3857  C  C   . VAL A  1  517 ? 50.070  47.499  -8.244  1.00 30.07  ? 545  VAL A C   1 
ATOM   3858  O  O   . VAL A  1  517 ? 49.664  46.648  -9.031  1.00 29.79  ? 545  VAL A O   1 
ATOM   3859  C  CB  . VAL A  1  517 ? 51.640  46.744  -6.385  1.00 30.14  ? 545  VAL A CB  1 
ATOM   3860  C  CG1 . VAL A  1  517 ? 52.210  45.697  -7.398  1.00 28.93  ? 545  VAL A CG1 1 
ATOM   3861  C  CG2 . VAL A  1  517 ? 52.562  47.963  -6.226  1.00 28.91  ? 545  VAL A CG2 1 
ATOM   3862  N  N   . PHE A  1  518 ? 50.391  48.738  -8.609  1.00 30.46  ? 546  PHE A N   1 
ATOM   3863  C  CA  . PHE A  1  518 ? 50.431  49.144  -10.008 1.00 30.87  ? 546  PHE A CA  1 
ATOM   3864  C  C   . PHE A  1  518 ? 51.870  49.400  -10.391 1.00 31.49  ? 546  PHE A C   1 
ATOM   3865  O  O   . PHE A  1  518 ? 52.614  50.042  -9.644  1.00 32.32  ? 546  PHE A O   1 
ATOM   3866  C  CB  . PHE A  1  518 ? 49.615  50.411  -10.252 1.00 30.19  ? 546  PHE A CB  1 
ATOM   3867  C  CG  . PHE A  1  518 ? 48.132  50.229  -10.098 1.00 29.81  ? 546  PHE A CG  1 
ATOM   3868  C  CD1 . PHE A  1  518 ? 47.497  50.543  -8.891  1.00 29.38  ? 546  PHE A CD1 1 
ATOM   3869  C  CD2 . PHE A  1  518 ? 47.354  49.762  -11.161 1.00 29.32  ? 546  PHE A CD2 1 
ATOM   3870  C  CE1 . PHE A  1  518 ? 46.123  50.397  -8.755  1.00 26.08  ? 546  PHE A CE1 1 
ATOM   3871  C  CE2 . PHE A  1  518 ? 45.976  49.614  -11.028 1.00 25.91  ? 546  PHE A CE2 1 
ATOM   3872  C  CZ  . PHE A  1  518 ? 45.371  49.924  -9.823  1.00 27.16  ? 546  PHE A CZ  1 
ATOM   3873  N  N   . VAL A  1  519 ? 52.267  48.874  -11.542 1.00 32.00  ? 547  VAL A N   1 
ATOM   3874  C  CA  . VAL A  1  519 ? 53.584  49.132  -12.094 1.00 32.35  ? 547  VAL A CA  1 
ATOM   3875  C  C   . VAL A  1  519 ? 53.411  49.828  -13.443 1.00 33.09  ? 547  VAL A C   1 
ATOM   3876  O  O   . VAL A  1  519 ? 52.822  49.260  -14.355 1.00 32.91  ? 547  VAL A O   1 
ATOM   3877  C  CB  . VAL A  1  519 ? 54.400  47.821  -12.244 1.00 32.41  ? 547  VAL A CB  1 
ATOM   3878  C  CG1 . VAL A  1  519 ? 55.809  48.088  -12.817 1.00 31.25  ? 547  VAL A CG1 1 
ATOM   3879  C  CG2 . VAL A  1  519 ? 54.484  47.089  -10.899 1.00 32.43  ? 547  VAL A CG2 1 
ATOM   3880  N  N   . PRO A  1  520 ? 53.887  51.083  -13.561 1.00 34.15  ? 548  PRO A N   1 
ATOM   3881  C  CA  . PRO A  1  520 ? 53.961  51.739  -14.887 1.00 34.66  ? 548  PRO A CA  1 
ATOM   3882  C  C   . PRO A  1  520 ? 54.789  50.953  -15.914 1.00 35.32  ? 548  PRO A C   1 
ATOM   3883  O  O   . PRO A  1  520 ? 55.901  50.526  -15.618 1.00 34.88  ? 548  PRO A O   1 
ATOM   3884  C  CB  . PRO A  1  520 ? 54.628  53.092  -14.590 1.00 34.57  ? 548  PRO A CB  1 
ATOM   3885  C  CG  . PRO A  1  520 ? 55.128  53.020  -13.170 1.00 34.28  ? 548  PRO A CG  1 
ATOM   3886  C  CD  . PRO A  1  520 ? 54.328  51.971  -12.465 1.00 33.99  ? 548  PRO A CD  1 
ATOM   3887  N  N   . MET A  1  521 ? 54.207  50.725  -17.089 1.00 36.39  ? 549  MET A N   1 
ATOM   3888  C  CA  . MET A  1  521 ? 54.928  50.190  -18.254 1.00 37.86  ? 549  MET A CA  1 
ATOM   3889  C  C   . MET A  1  521 ? 54.378  50.739  -19.561 1.00 37.39  ? 549  MET A C   1 
ATOM   3890  O  O   . MET A  1  521 ? 53.242  51.222  -19.633 1.00 37.69  ? 549  MET A O   1 
ATOM   3891  C  CB  . MET A  1  521 ? 54.969  48.644  -18.310 1.00 37.93  ? 549  MET A CB  1 
ATOM   3892  C  CG  . MET A  1  521 ? 54.025  47.875  -17.391 1.00 39.11  ? 549  MET A CG  1 
ATOM   3893  S  SD  . MET A  1  521 ? 54.281  46.079  -17.431 1.00 40.76  ? 549  MET A SD  1 
ATOM   3894  C  CE  . MET A  1  521 ? 56.008  45.919  -16.927 1.00 40.40  ? 549  MET A CE  1 
ATOM   3895  N  N   . ALA A  1  522 ? 55.206  50.671  -20.591 1.00 37.32  ? 550  ALA A N   1 
ATOM   3896  C  CA  . ALA A  1  522 ? 54.795  51.060  -21.927 1.00 37.00  ? 550  ALA A CA  1 
ATOM   3897  C  C   . ALA A  1  522 ? 53.816  50.016  -22.444 1.00 36.81  ? 550  ALA A C   1 
ATOM   3898  O  O   . ALA A  1  522 ? 53.936  48.838  -22.134 1.00 36.56  ? 550  ALA A O   1 
ATOM   3899  C  CB  . ALA A  1  522 ? 55.998  51.150  -22.828 1.00 36.74  ? 550  ALA A CB  1 
ATOM   3900  N  N   . VAL A  1  523 ? 52.830  50.450  -23.210 1.00 36.96  ? 551  VAL A N   1 
ATOM   3901  C  CA  . VAL A  1  523 ? 51.889  49.513  -23.801 1.00 37.18  ? 551  VAL A CA  1 
ATOM   3902  C  C   . VAL A  1  523 ? 52.652  48.654  -24.814 1.00 37.62  ? 551  VAL A C   1 
ATOM   3903  O  O   . VAL A  1  523 ? 53.263  49.189  -25.757 1.00 37.39  ? 551  VAL A O   1 
ATOM   3904  C  CB  . VAL A  1  523 ? 50.704  50.236  -24.481 1.00 37.09  ? 551  VAL A CB  1 
ATOM   3905  C  CG1 . VAL A  1  523 ? 49.704  49.235  -24.970 1.00 36.74  ? 551  VAL A CG1 1 
ATOM   3906  C  CG2 . VAL A  1  523 ? 50.036  51.207  -23.518 1.00 36.86  ? 551  VAL A CG2 1 
ATOM   3907  N  N   . PRO A  1  524 ? 52.653  47.321  -24.609 1.00 37.98  ? 552  PRO A N   1 
ATOM   3908  C  CA  . PRO A  1  524 ? 53.375  46.453  -25.537 1.00 38.22  ? 552  PRO A CA  1 
ATOM   3909  C  C   . PRO A  1  524 ? 53.087  46.787  -27.007 1.00 38.68  ? 552  PRO A C   1 
ATOM   3910  O  O   . PRO A  1  524 ? 54.027  46.923  -27.792 1.00 38.65  ? 552  PRO A O   1 
ATOM   3911  C  CB  . PRO A  1  524 ? 52.872  45.056  -25.162 1.00 38.14  ? 552  PRO A CB  1 
ATOM   3912  C  CG  . PRO A  1  524 ? 52.623  45.167  -23.681 1.00 38.25  ? 552  PRO A CG  1 
ATOM   3913  C  CD  . PRO A  1  524 ? 52.027  46.551  -23.516 1.00 37.96  ? 552  PRO A CD  1 
ATOM   3914  N  N   . TRP A  1  525 ? 51.812  46.961  -27.363 1.00 38.99  ? 553  TRP A N   1 
ATOM   3915  C  CA  . TRP A  1  525 ? 51.444  47.189  -28.765 1.00 39.24  ? 553  TRP A CA  1 
ATOM   3916  C  C   . TRP A  1  525 ? 51.529  48.647  -29.215 1.00 39.66  ? 553  TRP A C   1 
ATOM   3917  O  O   . TRP A  1  525 ? 51.329  48.949  -30.397 1.00 40.16  ? 553  TRP A O   1 
ATOM   3918  C  CB  . TRP A  1  525 ? 50.056  46.613  -29.083 1.00 38.81  ? 553  TRP A CB  1 
ATOM   3919  C  CG  . TRP A  1  525 ? 48.941  47.135  -28.224 1.00 38.49  ? 553  TRP A CG  1 
ATOM   3920  C  CD1 . TRP A  1  525 ? 48.061  48.142  -28.531 1.00 37.68  ? 553  TRP A CD1 1 
ATOM   3921  C  CD2 . TRP A  1  525 ? 48.565  46.654  -26.929 1.00 38.07  ? 553  TRP A CD2 1 
ATOM   3922  N  NE1 . TRP A  1  525 ? 47.168  48.326  -27.495 1.00 38.08  ? 553  TRP A NE1 1 
ATOM   3923  C  CE2 . TRP A  1  525 ? 47.453  47.422  -26.502 1.00 38.41  ? 553  TRP A CE2 1 
ATOM   3924  C  CE3 . TRP A  1  525 ? 49.061  45.654  -26.085 1.00 37.83  ? 553  TRP A CE3 1 
ATOM   3925  C  CZ2 . TRP A  1  525 ? 46.840  47.225  -25.262 1.00 38.20  ? 553  TRP A CZ2 1 
ATOM   3926  C  CZ3 . TRP A  1  525 ? 48.445  45.456  -24.854 1.00 37.92  ? 553  TRP A CZ3 1 
ATOM   3927  C  CH2 . TRP A  1  525 ? 47.348  46.241  -24.455 1.00 37.83  ? 553  TRP A CH2 1 
ATOM   3928  N  N   . SER A  1  526 ? 51.833  49.548  -28.289 1.00 39.95  ? 554  SER A N   1 
ATOM   3929  C  CA  . SER A  1  526 ? 51.857  50.978  -28.597 1.00 40.32  ? 554  SER A CA  1 
ATOM   3930  C  C   . SER A  1  526 ? 52.766  51.700  -27.593 1.00 40.57  ? 554  SER A C   1 
ATOM   3931  O  O   . SER A  1  526 ? 52.283  52.496  -26.778 1.00 40.83  ? 554  SER A O   1 
ATOM   3932  C  CB  . SER A  1  526 ? 50.431  51.539  -28.563 1.00 39.99  ? 554  SER A CB  1 
ATOM   3933  O  OG  . SER A  1  526 ? 50.399  52.892  -28.958 1.00 40.57  ? 554  SER A OG  1 
ATOM   3934  N  N   . PRO A  1  527 ? 54.090  51.431  -27.666 1.00 40.73  ? 555  PRO A N   1 
ATOM   3935  C  CA  . PRO A  1  527 ? 55.074  51.766  -26.630 1.00 40.69  ? 555  PRO A CA  1 
ATOM   3936  C  C   . PRO A  1  527 ? 55.200  53.251  -26.363 1.00 40.64  ? 555  PRO A C   1 
ATOM   3937  O  O   . PRO A  1  527 ? 55.797  53.650  -25.371 1.00 40.73  ? 555  PRO A O   1 
ATOM   3938  C  CB  . PRO A  1  527 ? 56.383  51.216  -27.204 1.00 40.84  ? 555  PRO A CB  1 
ATOM   3939  C  CG  . PRO A  1  527 ? 55.948  50.154  -28.186 1.00 40.71  ? 555  PRO A CG  1 
ATOM   3940  C  CD  . PRO A  1  527 ? 54.740  50.770  -28.814 1.00 40.78  ? 555  PRO A CD  1 
ATOM   3941  N  N   . GLU A  1  528 ? 54.632  54.059  -27.243 1.00 40.74  ? 556  GLU A N   1 
ATOM   3942  C  CA  . GLU A  1  528 ? 54.563  55.498  -27.048 1.00 40.91  ? 556  GLU A CA  1 
ATOM   3943  C  C   . GLU A  1  528 ? 53.604  55.860  -25.917 1.00 40.50  ? 556  GLU A C   1 
ATOM   3944  O  O   . GLU A  1  528 ? 53.647  56.977  -25.399 1.00 40.69  ? 556  GLU A O   1 
ATOM   3945  C  CB  . GLU A  1  528 ? 54.087  56.158  -28.333 1.00 41.34  ? 556  GLU A CB  1 
ATOM   3946  C  CG  . GLU A  1  528 ? 52.613  55.872  -28.642 1.00 42.71  ? 556  GLU A CG  1 
ATOM   3947  C  CD  . GLU A  1  528 ? 52.370  55.582  -30.109 1.00 44.79  ? 556  GLU A CD  1 
ATOM   3948  O  OE1 . GLU A  1  528 ? 51.848  56.484  -30.816 1.00 44.93  ? 556  GLU A OE1 1 
ATOM   3949  O  OE2 . GLU A  1  528 ? 52.713  54.456  -30.545 1.00 45.43  ? 556  GLU A OE2 1 
ATOM   3950  N  N   . HIS A  1  529 ? 52.734  54.920  -25.551 1.00 39.90  ? 557  HIS A N   1 
ATOM   3951  C  CA  . HIS A  1  529 ? 51.751  55.133  -24.488 1.00 39.34  ? 557  HIS A CA  1 
ATOM   3952  C  C   . HIS A  1  529 ? 52.102  54.369  -23.205 1.00 38.89  ? 557  HIS A C   1 
ATOM   3953  O  O   . HIS A  1  529 ? 52.862  53.401  -23.234 1.00 38.89  ? 557  HIS A O   1 
ATOM   3954  C  CB  . HIS A  1  529 ? 50.352  54.743  -24.973 1.00 39.26  ? 557  HIS A CB  1 
ATOM   3955  C  CG  . HIS A  1  529 ? 49.745  55.722  -25.929 1.00 39.34  ? 557  HIS A CG  1 
ATOM   3956  N  ND1 . HIS A  1  529 ? 49.673  55.489  -27.286 1.00 39.17  ? 557  HIS A ND1 1 
ATOM   3957  C  CD2 . HIS A  1  529 ? 49.171  56.932  -25.723 1.00 38.94  ? 557  HIS A CD2 1 
ATOM   3958  C  CE1 . HIS A  1  529 ? 49.088  56.518  -27.876 1.00 38.59  ? 557  HIS A CE1 1 
ATOM   3959  N  NE2 . HIS A  1  529 ? 48.777  57.407  -26.950 1.00 38.32  ? 557  HIS A NE2 1 
ATOM   3960  N  N   . GLN A  1  530 ? 51.533  54.811  -22.089 1.00 38.48  ? 558  GLN A N   1 
ATOM   3961  C  CA  . GLN A  1  530 ? 51.740  54.185  -20.785 1.00 38.30  ? 558  GLN A CA  1 
ATOM   3962  C  C   . GLN A  1  530 ? 50.470  53.499  -20.314 1.00 37.81  ? 558  GLN A C   1 
ATOM   3963  O  O   . GLN A  1  530 ? 49.364  53.959  -20.580 1.00 37.81  ? 558  GLN A O   1 
ATOM   3964  C  CB  . GLN A  1  530 ? 52.122  55.246  -19.744 1.00 38.51  ? 558  GLN A CB  1 
ATOM   3965  C  CG  . GLN A  1  530 ? 53.526  55.852  -19.897 1.00 39.84  ? 558  GLN A CG  1 
ATOM   3966  C  CD  . GLN A  1  530 ? 54.597  55.098  -19.105 1.00 41.50  ? 558  GLN A CD  1 
ATOM   3967  O  OE1 . GLN A  1  530 ? 55.478  54.448  -19.696 1.00 42.11  ? 558  GLN A OE1 1 
ATOM   3968  N  NE2 . GLN A  1  530 ? 54.524  55.176  -17.763 1.00 40.00  ? 558  GLN A NE2 1 
ATOM   3969  N  N   . LEU A  1  531 ? 50.619  52.395  -19.604 1.00 37.26  ? 559  LEU A N   1 
ATOM   3970  C  CA  . LEU A  1  531 ? 49.505  51.892  -18.813 1.00 36.71  ? 559  LEU A CA  1 
ATOM   3971  C  C   . LEU A  1  531 ? 49.942  51.690  -17.364 1.00 35.96  ? 559  LEU A C   1 
ATOM   3972  O  O   . LEU A  1  531 ? 51.134  51.684  -17.066 1.00 36.20  ? 559  LEU A O   1 
ATOM   3973  C  CB  . LEU A  1  531 ? 48.907  50.615  -19.412 1.00 36.59  ? 559  LEU A CB  1 
ATOM   3974  C  CG  . LEU A  1  531 ? 49.781  49.409  -19.761 1.00 36.96  ? 559  LEU A CG  1 
ATOM   3975  C  CD1 . LEU A  1  531 ? 50.435  48.782  -18.548 1.00 36.71  ? 559  LEU A CD1 1 
ATOM   3976  C  CD2 . LEU A  1  531 ? 48.909  48.382  -20.440 1.00 37.50  ? 559  LEU A CD2 1 
ATOM   3977  N  N   . GLN A  1  532 ? 48.974  51.561  -16.467 1.00 35.15  ? 560  GLN A N   1 
ATOM   3978  C  CA  . GLN A  1  532 ? 49.255  51.180  -15.088 1.00 34.53  ? 560  GLN A CA  1 
ATOM   3979  C  C   . GLN A  1  532 ? 48.963  49.693  -14.926 1.00 33.69  ? 560  GLN A C   1 
ATOM   3980  O  O   . GLN A  1  532 ? 47.821  49.267  -14.968 1.00 33.35  ? 560  GLN A O   1 
ATOM   3981  C  CB  . GLN A  1  532 ? 48.430  52.029  -14.124 1.00 34.46  ? 560  GLN A CB  1 
ATOM   3982  C  CG  . GLN A  1  532 ? 48.604  53.528  -14.363 1.00 35.40  ? 560  GLN A CG  1 
ATOM   3983  C  CD  . GLN A  1  532 ? 50.028  53.996  -14.101 1.00 36.90  ? 560  GLN A CD  1 
ATOM   3984  O  OE1 . GLN A  1  532 ? 50.569  53.798  -13.009 1.00 36.49  ? 560  GLN A OE1 1 
ATOM   3985  N  NE2 . GLN A  1  532 ? 50.642  54.619  -15.107 1.00 37.19  ? 560  GLN A NE2 1 
ATOM   3986  N  N   . ARG A  1  533 ? 50.010  48.901  -14.776 1.00 33.14  ? 561  ARG A N   1 
ATOM   3987  C  CA  . ARG A  1  533 ? 49.863  47.465  -14.773 1.00 32.97  ? 561  ARG A CA  1 
ATOM   3988  C  C   . ARG A  1  533 ? 49.481  46.985  -13.385 1.00 32.75  ? 561  ARG A C   1 
ATOM   3989  O  O   . ARG A  1  533 ? 50.285  47.055  -12.446 1.00 32.70  ? 561  ARG A O   1 
ATOM   3990  C  CB  . ARG A  1  533 ? 51.163  46.804  -15.219 1.00 33.20  ? 561  ARG A CB  1 
ATOM   3991  C  CG  . ARG A  1  533 ? 51.014  45.344  -15.578 1.00 34.20  ? 561  ARG A CG  1 
ATOM   3992  C  CD  . ARG A  1  533 ? 50.518  45.185  -16.989 1.00 34.68  ? 561  ARG A CD  1 
ATOM   3993  N  NE  . ARG A  1  533 ? 50.274  43.780  -17.291 1.00 36.78  ? 561  ARG A NE  1 
ATOM   3994  C  CZ  . ARG A  1  533 ? 51.161  42.975  -17.868 1.00 36.60  ? 561  ARG A CZ  1 
ATOM   3995  N  NH1 . ARG A  1  533 ? 52.355  43.447  -18.204 1.00 36.08  ? 561  ARG A NH1 1 
ATOM   3996  N  NH2 . ARG A  1  533 ? 50.850  41.703  -18.108 1.00 36.06  ? 561  ARG A NH2 1 
ATOM   3997  N  N   . LEU A  1  534 ? 48.248  46.503  -13.256 1.00 32.12  ? 562  LEU A N   1 
ATOM   3998  C  CA  . LEU A  1  534 ? 47.779  45.988  -11.977 1.00 31.28  ? 562  LEU A CA  1 
ATOM   3999  C  C   . LEU A  1  534 ? 48.390  44.619  -11.735 1.00 31.00  ? 562  LEU A C   1 
ATOM   4000  O  O   . LEU A  1  534 ? 48.331  43.728  -12.599 1.00 30.40  ? 562  LEU A O   1 
ATOM   4001  C  CB  . LEU A  1  534 ? 46.250  45.928  -11.931 1.00 31.20  ? 562  LEU A CB  1 
ATOM   4002  C  CG  . LEU A  1  534 ? 45.549  45.496  -10.638 1.00 31.24  ? 562  LEU A CG  1 
ATOM   4003  C  CD1 . LEU A  1  534 ? 46.094  46.231  -9.439  1.00 30.96  ? 562  LEU A CD1 1 
ATOM   4004  C  CD2 . LEU A  1  534 ? 44.027  45.709  -10.749 1.00 31.21  ? 562  LEU A CD2 1 
ATOM   4005  N  N   . GLN A  1  535 ? 48.999  44.466  -10.566 1.00 30.67  ? 563  GLN A N   1 
ATOM   4006  C  CA  . GLN A  1  535 ? 49.576  43.194  -10.188 1.00 30.61  ? 563  GLN A CA  1 
ATOM   4007  C  C   . GLN A  1  535 ? 49.254  42.818  -8.751  1.00 30.74  ? 563  GLN A C   1 
ATOM   4008  O  O   . GLN A  1  535 ? 48.973  43.671  -7.917  1.00 30.30  ? 563  GLN A O   1 
ATOM   4009  C  CB  . GLN A  1  535 ? 51.090  43.199  -10.390 1.00 30.37  ? 563  GLN A CB  1 
ATOM   4010  C  CG  . GLN A  1  535 ? 51.556  43.731  -11.709 1.00 30.88  ? 563  GLN A CG  1 
ATOM   4011  C  CD  . GLN A  1  535 ? 53.039  43.566  -11.904 1.00 32.13  ? 563  GLN A CD  1 
ATOM   4012  O  OE1 . GLN A  1  535 ? 53.813  43.588  -10.946 1.00 32.19  ? 563  GLN A OE1 1 
ATOM   4013  N  NE2 . GLN A  1  535 ? 53.451  43.371  -13.155 1.00 32.97  ? 563  GLN A NE2 1 
ATOM   4014  N  N   . VAL A  1  536 ? 49.315  41.516  -8.493  1.00 31.13  ? 564  VAL A N   1 
ATOM   4015  C  CA  . VAL A  1  536 ? 49.234  40.944  -7.165  1.00 31.46  ? 564  VAL A CA  1 
ATOM   4016  C  C   . VAL A  1  536 ? 50.634  40.877  -6.555  1.00 32.42  ? 564  VAL A C   1 
ATOM   4017  O  O   . VAL A  1  536 ? 51.597  40.495  -7.235  1.00 33.13  ? 564  VAL A O   1 
ATOM   4018  C  CB  . VAL A  1  536 ? 48.698  39.522  -7.241  1.00 31.19  ? 564  VAL A CB  1 
ATOM   4019  C  CG1 . VAL A  1  536 ? 48.605  38.916  -5.857  1.00 30.77  ? 564  VAL A CG1 1 
ATOM   4020  C  CG2 . VAL A  1  536 ? 47.344  39.496  -7.948  1.00 30.66  ? 564  VAL A CG2 1 
ATOM   4021  N  N   . THR A  1  537 ? 50.756  41.271  -5.290  1.00 32.88  ? 565  THR A N   1 
ATOM   4022  C  CA  . THR A  1  537 ? 51.972  41.022  -4.522  1.00 33.25  ? 565  THR A CA  1 
ATOM   4023  C  C   . THR A  1  537 ? 51.724  39.835  -3.613  1.00 33.51  ? 565  THR A C   1 
ATOM   4024  O  O   . THR A  1  537 ? 50.593  39.554  -3.219  1.00 33.23  ? 565  THR A O   1 
ATOM   4025  C  CB  . THR A  1  537 ? 52.407  42.225  -3.652  1.00 33.05  ? 565  THR A CB  1 
ATOM   4026  O  OG1 . THR A  1  537 ? 51.281  42.739  -2.927  1.00 33.72  ? 565  THR A OG1 1 
ATOM   4027  C  CG2 . THR A  1  537 ? 52.988  43.315  -4.508  1.00 33.89  ? 565  THR A CG2 1 
ATOM   4028  N  N   . ARG A  1  538 ? 52.796  39.151  -3.267  1.00 33.86  ? 566  ARG A N   1 
ATOM   4029  C  CA  . ARG A  1  538 ? 52.698  37.964  -2.473  1.00 34.85  ? 566  ARG A CA  1 
ATOM   4030  C  C   . ARG A  1  538 ? 53.923  37.936  -1.591  1.00 34.59  ? 566  ARG A C   1 
ATOM   4031  O  O   . ARG A  1  538 ? 55.017  38.232  -2.042  1.00 34.43  ? 566  ARG A O   1 
ATOM   4032  C  CB  . ARG A  1  538 ? 52.609  36.719  -3.368  1.00 34.71  ? 566  ARG A CB  1 
ATOM   4033  C  CG  . ARG A  1  538 ? 52.436  35.397  -2.605  1.00 35.67  ? 566  ARG A CG  1 
ATOM   4034  C  CD  . ARG A  1  538 ? 52.160  34.222  -3.557  1.00 36.36  ? 566  ARG A CD  1 
ATOM   4035  N  NE  . ARG A  1  538 ? 50.775  34.239  -4.038  1.00 38.23  ? 566  ARG A NE  1 
ATOM   4036  C  CZ  . ARG A  1  538 ? 50.394  34.510  -5.287  1.00 39.27  ? 566  ARG A CZ  1 
ATOM   4037  N  NH1 . ARG A  1  538 ? 51.290  34.782  -6.232  1.00 39.27  ? 566  ARG A NH1 1 
ATOM   4038  N  NH2 . ARG A  1  538 ? 49.099  34.505  -5.593  1.00 39.19  ? 566  ARG A NH2 1 
ATOM   4039  N  N   . LYS A  1  539 ? 53.724  37.603  -0.325  1.00 34.69  ? 567  LYS A N   1 
ATOM   4040  C  CA  . LYS A  1  539 ? 54.815  37.536  0.613   1.00 35.34  ? 567  LYS A CA  1 
ATOM   4041  C  C   . LYS A  1  539 ? 54.509  36.443  1.627   1.00 34.99  ? 567  LYS A C   1 
ATOM   4042  O  O   . LYS A  1  539 ? 53.384  36.354  2.130   1.00 34.47  ? 567  LYS A O   1 
ATOM   4043  C  CB  . LYS A  1  539 ? 54.978  38.898  1.308   1.00 35.74  ? 567  LYS A CB  1 
ATOM   4044  C  CG  . LYS A  1  539 ? 56.288  39.099  2.064   1.00 36.46  ? 567  LYS A CG  1 
ATOM   4045  C  CD  . LYS A  1  539 ? 56.201  40.305  3.005   1.00 37.13  ? 567  LYS A CD  1 
ATOM   4046  C  CE  . LYS A  1  539 ? 57.463  40.480  3.863   1.00 38.19  ? 567  LYS A CE  1 
ATOM   4047  N  NZ  . LYS A  1  539 ? 57.127  41.181  5.150   1.00 38.79  ? 567  LYS A NZ  1 
ATOM   4048  N  N   . LEU A  1  540 ? 55.510  35.605  1.904   1.00 34.78  ? 568  LEU A N   1 
ATOM   4049  C  CA  . LEU A  1  540 ? 55.442  34.646  3.002   1.00 34.43  ? 568  LEU A CA  1 
ATOM   4050  C  C   . LEU A  1  540 ? 55.848  35.323  4.298   1.00 34.74  ? 568  LEU A C   1 
ATOM   4051  O  O   . LEU A  1  540 ? 56.866  35.997  4.351   1.00 35.22  ? 568  LEU A O   1 
ATOM   4052  C  CB  . LEU A  1  540 ? 56.351  33.452  2.730   1.00 34.14  ? 568  LEU A CB  1 
ATOM   4053  C  CG  . LEU A  1  540 ? 56.378  32.330  3.760   1.00 33.28  ? 568  LEU A CG  1 
ATOM   4054  C  CD1 . LEU A  1  540 ? 55.023  31.626  3.868   1.00 31.46  ? 568  LEU A CD1 1 
ATOM   4055  C  CD2 . LEU A  1  540 ? 57.479  31.341  3.386   1.00 33.84  ? 568  LEU A CD2 1 
ATOM   4056  N  N   . LEU A  1  541 ? 55.038  35.164  5.337   1.00 35.35  ? 569  LEU A N   1 
ATOM   4057  C  CA  . LEU A  1  541 ? 55.356  35.737  6.648   1.00 35.65  ? 569  LEU A CA  1 
ATOM   4058  C  C   . LEU A  1  541 ? 55.909  34.601  7.482   1.00 36.10  ? 569  LEU A C   1 
ATOM   4059  O  O   . LEU A  1  541 ? 55.176  33.667  7.820   1.00 35.95  ? 569  LEU A O   1 
ATOM   4060  C  CB  . LEU A  1  541 ? 54.112  36.353  7.298   1.00 35.27  ? 569  LEU A CB  1 
ATOM   4061  C  CG  . LEU A  1  541 ? 53.321  37.349  6.441   1.00 34.92  ? 569  LEU A CG  1 
ATOM   4062  C  CD1 . LEU A  1  541 ? 52.067  37.786  7.179   1.00 35.46  ? 569  LEU A CD1 1 
ATOM   4063  C  CD2 . LEU A  1  541 ? 54.147  38.572  6.036   1.00 32.95  ? 569  LEU A CD2 1 
ATOM   4064  N  N   . GLU A  1  542 ? 57.204  34.673  7.781   1.00 36.57  ? 570  GLU A N   1 
ATOM   4065  C  CA  . GLU A  1  542 ? 57.949  33.521  8.303   1.00 37.76  ? 570  GLU A CA  1 
ATOM   4066  C  C   . GLU A  1  542 ? 58.060  33.490  9.826   1.00 38.25  ? 570  GLU A C   1 
ATOM   4067  O  O   . GLU A  1  542 ? 58.227  32.421  10.413  1.00 38.60  ? 570  GLU A O   1 
ATOM   4068  C  CB  . GLU A  1  542 ? 59.350  33.437  7.661   1.00 37.52  ? 570  GLU A CB  1 
ATOM   4069  C  CG  . GLU A  1  542 ? 59.303  33.274  6.150   1.00 38.41  ? 570  GLU A CG  1 
ATOM   4070  C  CD  . GLU A  1  542 ? 60.666  33.226  5.499   1.00 38.41  ? 570  GLU A CD  1 
ATOM   4071  O  OE1 . GLU A  1  542 ? 61.536  32.482  5.999   1.00 39.95  ? 570  GLU A OE1 1 
ATOM   4072  O  OE2 . GLU A  1  542 ? 60.858  33.916  4.467   1.00 39.05  ? 570  GLU A OE2 1 
ATOM   4073  N  N   . MET A  1  543 ? 57.960  34.664  10.451  1.00 38.84  ? 571  MET A N   1 
ATOM   4074  C  CA  . MET A  1  543 ? 58.148  34.839  11.896  1.00 39.31  ? 571  MET A CA  1 
ATOM   4075  C  C   . MET A  1  543 ? 56.903  35.474  12.489  1.00 38.67  ? 571  MET A C   1 
ATOM   4076  O  O   . MET A  1  543 ? 56.209  36.214  11.797  1.00 38.62  ? 571  MET A O   1 
ATOM   4077  C  CB  . MET A  1  543 ? 59.340  35.771  12.182  1.00 39.67  ? 571  MET A CB  1 
ATOM   4078  C  CG  . MET A  1  543 ? 60.575  35.504  11.347  1.00 42.27  ? 571  MET A CG  1 
ATOM   4079  S  SD  . MET A  1  543 ? 61.295  33.907  11.760  1.00 48.17  ? 571  MET A SD  1 
ATOM   4080  C  CE  . MET A  1  543 ? 62.151  34.303  13.293  1.00 45.18  ? 571  MET A CE  1 
ATOM   4081  N  N   . GLU A  1  544 ? 56.660  35.225  13.775  1.00 38.20  ? 572  GLU A N   1 
ATOM   4082  C  CA  . GLU A  1  544 ? 55.504  35.774  14.493  1.00 38.08  ? 572  GLU A CA  1 
ATOM   4083  C  C   . GLU A  1  544 ? 55.366  37.291  14.367  1.00 37.97  ? 572  GLU A C   1 
ATOM   4084  O  O   . GLU A  1  544 ? 54.266  37.795  14.180  1.00 37.78  ? 572  GLU A O   1 
ATOM   4085  C  CB  . GLU A  1  544 ? 55.532  35.357  15.969  1.00 37.77  ? 572  GLU A CB  1 
ATOM   4086  C  CG  . GLU A  1  544 ? 55.123  33.897  16.193  1.00 38.23  ? 572  GLU A CG  1 
ATOM   4087  C  CD  . GLU A  1  544 ? 55.266  33.401  17.633  1.00 38.10  ? 572  GLU A CD  1 
ATOM   4088  O  OE1 . GLU A  1  544 ? 54.803  32.274  17.912  1.00 37.93  ? 572  GLU A OE1 1 
ATOM   4089  O  OE2 . GLU A  1  544 ? 55.836  34.109  18.491  1.00 37.38  ? 572  GLU A OE2 1 
ATOM   4090  N  N   . GLU A  1  545 ? 56.487  38.003  14.440  1.00 38.25  ? 573  GLU A N   1 
ATOM   4091  C  CA  . GLU A  1  545 ? 56.491  39.467  14.402  1.00 38.81  ? 573  GLU A CA  1 
ATOM   4092  C  C   . GLU A  1  545 ? 55.940  40.008  13.080  1.00 38.31  ? 573  GLU A C   1 
ATOM   4093  O  O   . GLU A  1  545 ? 55.279  41.055  13.055  1.00 38.14  ? 573  GLU A O   1 
ATOM   4094  C  CB  . GLU A  1  545 ? 57.894  40.018  14.667  1.00 39.14  ? 573  GLU A CB  1 
ATOM   4095  C  CG  . GLU A  1  545 ? 58.624  39.343  15.847  1.00 42.19  ? 573  GLU A CG  1 
ATOM   4096  C  CD  . GLU A  1  545 ? 58.125  39.813  17.214  1.00 45.84  ? 573  GLU A CD  1 
ATOM   4097  O  OE1 . GLU A  1  545 ? 57.111  40.563  17.259  1.00 49.73  ? 573  GLU A OE1 1 
ATOM   4098  O  OE2 . GLU A  1  545 ? 58.737  39.437  18.245  1.00 44.91  ? 573  GLU A OE2 1 
ATOM   4099  N  N   . GLN A  1  546 ? 56.189  39.273  11.999  1.00 37.59  ? 574  GLN A N   1 
ATOM   4100  C  CA  . GLN A  1  546 ? 55.647  39.612  10.678  1.00 37.09  ? 574  GLN A CA  1 
ATOM   4101  C  C   . GLN A  1  546 ? 54.111  39.533  10.599  1.00 36.50  ? 574  GLN A C   1 
ATOM   4102  O  O   . GLN A  1  546 ? 53.498  40.209  9.764   1.00 36.29  ? 574  GLN A O   1 
ATOM   4103  C  CB  . GLN A  1  546 ? 56.288  38.737  9.587   1.00 37.06  ? 574  GLN A CB  1 
ATOM   4104  C  CG  . GLN A  1  546 ? 57.747  39.072  9.253   1.00 36.88  ? 574  GLN A CG  1 
ATOM   4105  C  CD  . GLN A  1  546 ? 58.344  38.055  8.311   1.00 37.42  ? 574  GLN A CD  1 
ATOM   4106  O  OE1 . GLN A  1  546 ? 58.746  36.983  8.737   1.00 38.26  ? 574  GLN A OE1 1 
ATOM   4107  N  NE2 . GLN A  1  546 ? 58.388  38.376  7.016   1.00 38.09  ? 574  GLN A NE2 1 
ATOM   4108  N  N   . ALA A  1  547 ? 53.509  38.718  11.468  1.00 35.72  ? 575  ALA A N   1 
ATOM   4109  C  CA  . ALA A  1  547 ? 52.067  38.511  11.481  1.00 35.37  ? 575  ALA A CA  1 
ATOM   4110  C  C   . ALA A  1  547 ? 51.387  39.145  12.695  1.00 35.45  ? 575  ALA A C   1 
ATOM   4111  O  O   . ALA A  1  547 ? 50.247  38.790  13.041  1.00 35.36  ? 575  ALA A O   1 
ATOM   4112  C  CB  . ALA A  1  547 ? 51.744  37.037  11.408  1.00 35.44  ? 575  ALA A CB  1 
ATOM   4113  N  N   . ALA A  1  548 ? 52.087  40.085  13.331  1.00 35.13  ? 576  ALA A N   1 
ATOM   4114  C  CA  . ALA A  1  548 ? 51.512  40.900  14.400  1.00 34.75  ? 576  ALA A CA  1 
ATOM   4115  C  C   . ALA A  1  548 ? 51.163  42.281  13.853  1.00 34.72  ? 576  ALA A C   1 
ATOM   4116  O  O   . ALA A  1  548 ? 52.049  43.034  13.447  1.00 34.83  ? 576  ALA A O   1 
ATOM   4117  C  CB  . ALA A  1  548 ? 52.483  41.009  15.559  1.00 34.24  ? 576  ALA A CB  1 
ATOM   4118  N  N   . PHE A  1  549 ? 49.877  42.611  13.822  1.00 34.63  ? 577  PHE A N   1 
ATOM   4119  C  CA  . PHE A  1  549 ? 49.456  43.877  13.229  1.00 34.64  ? 577  PHE A CA  1 
ATOM   4120  C  C   . PHE A  1  549 ? 48.790  44.781  14.246  1.00 35.27  ? 577  PHE A C   1 
ATOM   4121  O  O   . PHE A  1  549 ? 47.667  44.521  14.688  1.00 35.39  ? 577  PHE A O   1 
ATOM   4122  C  CB  . PHE A  1  549 ? 48.518  43.642  12.040  1.00 34.18  ? 577  PHE A CB  1 
ATOM   4123  C  CG  . PHE A  1  549 ? 49.141  42.875  10.908  1.00 33.39  ? 577  PHE A CG  1 
ATOM   4124  C  CD1 . PHE A  1  549 ? 48.914  41.505  10.768  1.00 33.84  ? 577  PHE A CD1 1 
ATOM   4125  C  CD2 . PHE A  1  549 ? 49.949  43.517  9.974   1.00 32.69  ? 577  PHE A CD2 1 
ATOM   4126  C  CE1 . PHE A  1  549 ? 49.488  40.774  9.701   1.00 32.81  ? 577  PHE A CE1 1 
ATOM   4127  C  CE2 . PHE A  1  549 ? 50.535  42.805  8.918   1.00 32.81  ? 577  PHE A CE2 1 
ATOM   4128  C  CZ  . PHE A  1  549 ? 50.302  41.428  8.781   1.00 32.90  ? 577  PHE A CZ  1 
ATOM   4129  N  N   . LEU A  1  550 ? 49.490  45.854  14.603  1.00 36.15  ? 578  LEU A N   1 
ATOM   4130  C  CA  . LEU A  1  550 ? 49.019  46.809  15.607  1.00 37.04  ? 578  LEU A CA  1 
ATOM   4131  C  C   . LEU A  1  550 ? 47.800  47.564  15.115  1.00 37.79  ? 578  LEU A C   1 
ATOM   4132  O  O   . LEU A  1  550 ? 47.635  47.741  13.901  1.00 38.17  ? 578  LEU A O   1 
ATOM   4133  C  CB  . LEU A  1  550 ? 50.132  47.793  15.978  1.00 36.92  ? 578  LEU A CB  1 
ATOM   4134  C  CG  . LEU A  1  550 ? 51.361  47.176  16.656  1.00 37.69  ? 578  LEU A CG  1 
ATOM   4135  C  CD1 . LEU A  1  550 ? 52.504  48.190  16.816  1.00 36.82  ? 578  LEU A CD1 1 
ATOM   4136  C  CD2 . LEU A  1  550 ? 50.963  46.590  18.002  1.00 38.49  ? 578  LEU A CD2 1 
ATOM   4137  N  N   . VAL A  1  551 ? 46.943  47.994  16.047  1.00 38.41  ? 579  VAL A N   1 
ATOM   4138  C  CA  . VAL A  1  551 ? 45.785  48.823  15.702  1.00 39.37  ? 579  VAL A CA  1 
ATOM   4139  C  C   . VAL A  1  551 ? 46.259  50.031  14.906  1.00 39.90  ? 579  VAL A C   1 
ATOM   4140  O  O   . VAL A  1  551 ? 47.333  50.574  15.186  1.00 40.07  ? 579  VAL A O   1 
ATOM   4141  C  CB  . VAL A  1  551 ? 45.009  49.301  16.955  1.00 39.69  ? 579  VAL A CB  1 
ATOM   4142  C  CG1 . VAL A  1  551 ? 43.928  50.362  16.574  1.00 39.34  ? 579  VAL A CG1 1 
ATOM   4143  C  CG2 . VAL A  1  551 ? 44.370  48.105  17.677  1.00 39.79  ? 579  VAL A CG2 1 
ATOM   4144  N  N   . GLY A  1  552 ? 45.491  50.431  13.896  1.00 40.30  ? 580  GLY A N   1 
ATOM   4145  C  CA  . GLY A  1  552 ? 45.855  51.615  13.120  1.00 41.03  ? 580  GLY A CA  1 
ATOM   4146  C  C   . GLY A  1  552 ? 46.876  51.404  12.005  1.00 41.51  ? 580  GLY A C   1 
ATOM   4147  O  O   . GLY A  1  552 ? 47.053  52.294  11.168  1.00 41.95  ? 580  GLY A O   1 
ATOM   4148  N  N   . SER A  1  553 ? 47.566  50.255  11.997  1.00 41.40  ? 581  SER A N   1 
ATOM   4149  C  CA  . SER A  1  553 ? 48.368  49.828  10.839  1.00 40.95  ? 581  SER A CA  1 
ATOM   4150  C  C   . SER A  1  553 ? 47.432  49.375  9.738   1.00 40.45  ? 581  SER A C   1 
ATOM   4151  O  O   . SER A  1  553 ? 46.317  48.923  10.018  1.00 40.54  ? 581  SER A O   1 
ATOM   4152  C  CB  . SER A  1  553 ? 49.267  48.635  11.194  1.00 41.20  ? 581  SER A CB  1 
ATOM   4153  O  OG  . SER A  1  553 ? 50.528  49.032  11.720  1.00 42.49  ? 581  SER A OG  1 
ATOM   4154  N  N   . ALA A  1  554 ? 47.876  49.497  8.490   1.00 39.56  ? 582  ALA A N   1 
ATOM   4155  C  CA  . ALA A  1  554 ? 47.208  48.827  7.378   1.00 38.29  ? 582  ALA A CA  1 
ATOM   4156  C  C   . ALA A  1  554 ? 47.657  47.374  7.374   1.00 37.53  ? 582  ALA A C   1 
ATOM   4157  O  O   . ALA A  1  554 ? 48.834  47.077  7.620   1.00 37.04  ? 582  ALA A O   1 
ATOM   4158  C  CB  . ALA A  1  554 ? 47.556  49.490  6.051   1.00 38.60  ? 582  ALA A CB  1 
ATOM   4159  N  N   . THR A  1  555 ? 46.715  46.474  7.112   1.00 36.44  ? 583  THR A N   1 
ATOM   4160  C  CA  . THR A  1  555 ? 47.031  45.058  6.966   1.00 35.64  ? 583  THR A CA  1 
ATOM   4161  C  C   . THR A  1  555 ? 46.922  44.624  5.509   1.00 34.90  ? 583  THR A C   1 
ATOM   4162  O  O   . THR A  1  555 ? 46.243  45.284  4.728   1.00 34.78  ? 583  THR A O   1 
ATOM   4163  C  CB  . THR A  1  555 ? 46.104  44.178  7.805   1.00 35.79  ? 583  THR A CB  1 
ATOM   4164  O  OG1 . THR A  1  555 ? 44.731  44.448  7.473   1.00 36.05  ? 583  THR A OG1 1 
ATOM   4165  C  CG2 . THR A  1  555 ? 46.335  44.441  9.259   1.00 36.10  ? 583  THR A CG2 1 
ATOM   4166  N  N   . PRO A  1  556 ? 47.596  43.513  5.138   1.00 34.35  ? 584  PRO A N   1 
ATOM   4167  C  CA  . PRO A  1  556 ? 47.455  42.949  3.792   1.00 33.53  ? 584  PRO A CA  1 
ATOM   4168  C  C   . PRO A  1  556 ? 45.994  42.712  3.443   1.00 32.81  ? 584  PRO A C   1 
ATOM   4169  O  O   . PRO A  1  556 ? 45.253  42.178  4.261   1.00 32.95  ? 584  PRO A O   1 
ATOM   4170  C  CB  . PRO A  1  556 ? 48.175  41.606  3.912   1.00 33.69  ? 584  PRO A CB  1 
ATOM   4171  C  CG  . PRO A  1  556 ? 49.196  41.822  4.980   1.00 33.61  ? 584  PRO A CG  1 
ATOM   4172  C  CD  . PRO A  1  556 ? 48.540  42.724  5.962   1.00 34.05  ? 584  PRO A CD  1 
ATOM   4173  N  N   . ARG A  1  557 ? 45.581  43.106  2.245   1.00 31.84  ? 585  ARG A N   1 
ATOM   4174  C  CA  . ARG A  1  557 ? 44.189  42.958  1.855   1.00 31.28  ? 585  ARG A CA  1 
ATOM   4175  C  C   . ARG A  1  557 ? 43.731  41.508  1.847   1.00 31.39  ? 585  ARG A C   1 
ATOM   4176  O  O   . ARG A  1  557 ? 42.553  41.212  2.108   1.00 31.45  ? 585  ARG A O   1 
ATOM   4177  C  CB  . ARG A  1  557 ? 43.942  43.588  0.490   1.00 31.32  ? 585  ARG A CB  1 
ATOM   4178  C  CG  . ARG A  1  557 ? 43.621  45.053  0.571   1.00 29.41  ? 585  ARG A CG  1 
ATOM   4179  C  CD  . ARG A  1  557 ? 43.466  45.632  -0.794  1.00 27.45  ? 585  ARG A CD  1 
ATOM   4180  N  NE  . ARG A  1  557 ? 43.285  47.068  -0.699  1.00 29.18  ? 585  ARG A NE  1 
ATOM   4181  C  CZ  . ARG A  1  557 ? 44.260  47.975  -0.764  1.00 27.64  ? 585  ARG A CZ  1 
ATOM   4182  N  NH1 . ARG A  1  557 ? 45.519  47.627  -0.951  1.00 24.45  ? 585  ARG A NH1 1 
ATOM   4183  N  NH2 . ARG A  1  557 ? 43.952  49.253  -0.648  1.00 28.50  ? 585  ARG A NH2 1 
ATOM   4184  N  N   . TYR A  1  558 ? 44.656  40.608  1.524   1.00 31.14  ? 586  TYR A N   1 
ATOM   4185  C  CA  . TYR A  1  558 ? 44.376  39.186  1.552   1.00 31.00  ? 586  TYR A CA  1 
ATOM   4186  C  C   . TYR A  1  558 ? 45.359  38.544  2.498   1.00 31.25  ? 586  TYR A C   1 
ATOM   4187  O  O   . TYR A  1  558 ? 46.503  38.296  2.143   1.00 32.58  ? 586  TYR A O   1 
ATOM   4188  C  CB  . TYR A  1  558 ? 44.506  38.576  0.155   1.00 30.73  ? 586  TYR A CB  1 
ATOM   4189  C  CG  . TYR A  1  558 ? 43.251  38.623  -0.696  1.00 30.17  ? 586  TYR A CG  1 
ATOM   4190  C  CD1 . TYR A  1  558 ? 42.792  39.819  -1.230  1.00 29.84  ? 586  TYR A CD1 1 
ATOM   4191  C  CD2 . TYR A  1  558 ? 42.535  37.466  -0.979  1.00 30.86  ? 586  TYR A CD2 1 
ATOM   4192  C  CE1 . TYR A  1  558 ? 41.645  39.870  -2.017  1.00 29.99  ? 586  TYR A CE1 1 
ATOM   4193  C  CE2 . TYR A  1  558 ? 41.381  37.500  -1.772  1.00 30.21  ? 586  TYR A CE2 1 
ATOM   4194  C  CZ  . TYR A  1  558 ? 40.948  38.705  -2.290  1.00 30.24  ? 586  TYR A CZ  1 
ATOM   4195  O  OH  . TYR A  1  558 ? 39.811  38.758  -3.072  1.00 30.40  ? 586  TYR A OH  1 
ATOM   4196  N  N   . LEU A  1  559 ? 44.925  38.285  3.716   1.00 31.22  ? 587  LEU A N   1 
ATOM   4197  C  CA  . LEU A  1  559 ? 45.769  37.593  4.660   1.00 31.25  ? 587  LEU A CA  1 
ATOM   4198  C  C   . LEU A  1  559 ? 45.174  36.213  4.960   1.00 31.07  ? 587  LEU A C   1 
ATOM   4199  O  O   . LEU A  1  559 ? 43.985  36.115  5.298   1.00 30.71  ? 587  LEU A O   1 
ATOM   4200  C  CB  . LEU A  1  559 ? 45.927  38.418  5.940   1.00 31.25  ? 587  LEU A CB  1 
ATOM   4201  C  CG  . LEU A  1  559 ? 47.015  37.744  6.763   1.00 32.37  ? 587  LEU A CG  1 
ATOM   4202  C  CD1 . LEU A  1  559 ? 48.202  38.640  6.996   1.00 32.80  ? 587  LEU A CD1 1 
ATOM   4203  C  CD2 . LEU A  1  559 ? 46.437  37.146  8.036   1.00 32.77  ? 587  LEU A CD2 1 
ATOM   4204  N  N   . TYR A  1  560 ? 45.994  35.162  4.848   1.00 30.40  ? 588  TYR A N   1 
ATOM   4205  C  CA  . TYR A  1  560 ? 45.475  33.797  4.992   1.00 30.41  ? 588  TYR A CA  1 
ATOM   4206  C  C   . TYR A  1  560 ? 46.460  32.776  5.535   1.00 30.21  ? 588  TYR A C   1 
ATOM   4207  O  O   . TYR A  1  560 ? 47.666  32.896  5.324   1.00 30.36  ? 588  TYR A O   1 
ATOM   4208  C  CB  . TYR A  1  560 ? 44.835  33.289  3.677   1.00 30.66  ? 588  TYR A CB  1 
ATOM   4209  C  CG  . TYR A  1  560 ? 45.733  33.110  2.458   1.00 30.36  ? 588  TYR A CG  1 
ATOM   4210  C  CD1 . TYR A  1  560 ? 46.266  31.859  2.134   1.00 30.54  ? 588  TYR A CD1 1 
ATOM   4211  C  CD2 . TYR A  1  560 ? 46.006  34.177  1.602   1.00 31.06  ? 588  TYR A CD2 1 
ATOM   4212  C  CE1 . TYR A  1  560 ? 47.067  31.681  0.994   1.00 31.02  ? 588  TYR A CE1 1 
ATOM   4213  C  CE2 . TYR A  1  560 ? 46.813  34.019  0.458   1.00 30.43  ? 588  TYR A CE2 1 
ATOM   4214  C  CZ  . TYR A  1  560 ? 47.330  32.768  0.153   1.00 31.52  ? 588  TYR A CZ  1 
ATOM   4215  O  OH  . TYR A  1  560 ? 48.132  32.601  -0.971  1.00 31.53  ? 588  TYR A OH  1 
ATOM   4216  N  N   . LEU A  1  561 ? 45.935  31.786  6.251   1.00 30.17  ? 589  LEU A N   1 
ATOM   4217  C  CA  . LEU A  1  561 ? 46.726  30.623  6.651   1.00 30.38  ? 589  LEU A CA  1 
ATOM   4218  C  C   . LEU A  1  561 ? 46.475  29.545  5.637   1.00 30.11  ? 589  LEU A C   1 
ATOM   4219  O  O   . LEU A  1  561 ? 45.359  29.388  5.158   1.00 29.76  ? 589  LEU A O   1 
ATOM   4220  C  CB  . LEU A  1  561 ? 46.369  30.097  8.040   1.00 30.22  ? 589  LEU A CB  1 
ATOM   4221  C  CG  . LEU A  1  561 ? 46.441  31.011  9.265   1.00 31.64  ? 589  LEU A CG  1 
ATOM   4222  C  CD1 . LEU A  1  561 ? 46.691  30.177  10.507  1.00 31.15  ? 589  LEU A CD1 1 
ATOM   4223  C  CD2 . LEU A  1  561 ? 47.495  32.082  9.139   1.00 32.49  ? 589  LEU A CD2 1 
ATOM   4224  N  N   . ALA A  1  562 ? 47.523  28.807  5.310   1.00 30.41  ? 590  ALA A N   1 
ATOM   4225  C  CA  . ALA A  1  562 ? 47.469  27.908  4.186   1.00 30.80  ? 590  ALA A CA  1 
ATOM   4226  C  C   . ALA A  1  562 ? 48.116  26.628  4.554   1.00 31.37  ? 590  ALA A C   1 
ATOM   4227  O  O   . ALA A  1  562 ? 49.094  26.602  5.317   1.00 31.42  ? 590  ALA A O   1 
ATOM   4228  C  CB  . ALA A  1  562 ? 48.189  28.501  3.002   1.00 30.55  ? 590  ALA A CB  1 
ATOM   4229  N  N   . SER A  1  563 ? 47.586  25.551  3.996   1.00 32.12  ? 591  SER A N   1 
ATOM   4230  C  CA  . SER A  1  563 ? 48.366  24.353  3.976   1.00 32.84  ? 591  SER A CA  1 
ATOM   4231  C  C   . SER A  1  563 ? 49.494  24.515  2.983   1.00 33.86  ? 591  SER A C   1 
ATOM   4232  O  O   . SER A  1  563 ? 49.697  25.551  2.323   1.00 33.55  ? 591  SER A O   1 
ATOM   4233  C  CB  . SER A  1  563 ? 47.568  23.104  3.615   1.00 33.02  ? 591  SER A CB  1 
ATOM   4234  O  OG  . SER A  1  563 ? 48.456  21.987  3.488   1.00 31.39  ? 591  SER A OG  1 
ATOM   4235  N  N   . ASN A  1  564 ? 50.196  23.410  2.900   1.00 34.82  ? 592  ASN A N   1 
ATOM   4236  C  CA  . ASN A  1  564 ? 51.417  23.224  2.216   1.00 35.51  ? 592  ASN A CA  1 
ATOM   4237  C  C   . ASN A  1  564 ? 51.034  22.577  0.888   1.00 35.32  ? 592  ASN A C   1 
ATOM   4238  O  O   . ASN A  1  564 ? 51.734  22.708  -0.115  1.00 35.04  ? 592  ASN A O   1 
ATOM   4239  C  CB  . ASN A  1  564 ? 52.138  22.244  3.126   1.00 35.91  ? 592  ASN A CB  1 
ATOM   4240  C  CG  . ASN A  1  564 ? 53.341  21.703  2.543   1.00 38.89  ? 592  ASN A CG  1 
ATOM   4241  O  OD1 . ASN A  1  564 ? 54.264  22.439  2.196   1.00 42.64  ? 592  ASN A OD1 1 
ATOM   4242  N  ND2 . ASN A  1  564 ? 53.372  20.380  2.421   1.00 43.19  ? 592  ASN A ND2 1 
ATOM   4243  N  N   . HIS A  1  565 ? 49.894  21.891  0.906   1.00 35.46  ? 593  HIS A N   1 
ATOM   4244  C  CA  . HIS A  1  565 ? 49.381  21.161  -0.243  1.00 35.76  ? 593  HIS A CA  1 
ATOM   4245  C  C   . HIS A  1  565 ? 48.482  22.053  -1.071  1.00 35.66  ? 593  HIS A C   1 
ATOM   4246  O  O   . HIS A  1  565 ? 47.931  23.030  -0.562  1.00 35.51  ? 593  HIS A O   1 
ATOM   4247  C  CB  . HIS A  1  565 ? 48.611  19.910  0.198   1.00 35.94  ? 593  HIS A CB  1 
ATOM   4248  C  CG  . HIS A  1  565 ? 49.410  18.984  1.054   1.00 36.84  ? 593  HIS A CG  1 
ATOM   4249  N  ND1 . HIS A  1  565 ? 49.419  19.067  2.430   1.00 38.97  ? 593  HIS A ND1 1 
ATOM   4250  C  CD2 . HIS A  1  565 ? 50.238  17.964  0.734   1.00 38.66  ? 593  HIS A CD2 1 
ATOM   4251  C  CE1 . HIS A  1  565 ? 50.206  18.126  2.924   1.00 38.24  ? 593  HIS A CE1 1 
ATOM   4252  N  NE2 . HIS A  1  565 ? 50.720  17.446  1.916   1.00 39.37  ? 593  HIS A NE2 1 
ATOM   4253  N  N   . SER A  1  566 ? 48.340  21.704  -2.349  1.00 35.56  ? 594  SER A N   1 
ATOM   4254  C  CA  . SER A  1  566 ? 47.611  22.524  -3.303  1.00 35.56  ? 594  SER A CA  1 
ATOM   4255  C  C   . SER A  1  566 ? 46.202  22.019  -3.591  1.00 35.22  ? 594  SER A C   1 
ATOM   4256  O  O   . SER A  1  566 ? 45.900  20.843  -3.384  1.00 35.32  ? 594  SER A O   1 
ATOM   4257  C  CB  . SER A  1  566 ? 48.398  22.598  -4.608  1.00 35.90  ? 594  SER A CB  1 
ATOM   4258  O  OG  . SER A  1  566 ? 49.390  23.602  -4.516  1.00 37.38  ? 594  SER A OG  1 
ATOM   4259  N  N   . ASN A  1  567 ? 45.336  22.914  -4.062  1.00 34.56  ? 595  ASN A N   1 
ATOM   4260  C  CA  . ASN A  1  567 ? 44.089  22.480  -4.666  1.00 34.21  ? 595  ASN A CA  1 
ATOM   4261  C  C   . ASN A  1  567 ? 44.422  21.964  -6.057  1.00 34.34  ? 595  ASN A C   1 
ATOM   4262  O  O   . ASN A  1  567 ? 45.559  22.092  -6.508  1.00 34.29  ? 595  ASN A O   1 
ATOM   4263  C  CB  . ASN A  1  567 ? 43.068  23.620  -4.730  1.00 33.89  ? 595  ASN A CB  1 
ATOM   4264  C  CG  . ASN A  1  567 ? 43.545  24.802  -5.565  1.00 33.56  ? 595  ASN A CG  1 
ATOM   4265  O  OD1 . ASN A  1  567 ? 44.704  24.854  -6.020  1.00 32.17  ? 595  ASN A OD1 1 
ATOM   4266  N  ND2 . ASN A  1  567 ? 42.650  25.766  -5.770  1.00 31.76  ? 595  ASN A ND2 1 
ATOM   4267  N  N   . LYS A  1  568 ? 43.432  21.392  -6.737  1.00 34.43  ? 596  LYS A N   1 
ATOM   4268  C  CA  . LYS A  1  568 ? 43.600  20.870  -8.093  1.00 34.45  ? 596  LYS A CA  1 
ATOM   4269  C  C   . LYS A  1  568 ? 44.339  21.852  -9.044  1.00 34.02  ? 596  LYS A C   1 
ATOM   4270  O  O   . LYS A  1  568 ? 44.931  21.428  -10.040 1.00 33.69  ? 596  LYS A O   1 
ATOM   4271  C  CB  . LYS A  1  568 ? 42.224  20.476  -8.646  1.00 34.28  ? 596  LYS A CB  1 
ATOM   4272  C  CG  . LYS A  1  568 ? 42.210  19.995  -10.083 1.00 35.83  ? 596  LYS A CG  1 
ATOM   4273  C  CD  . LYS A  1  568 ? 40.827  19.486  -10.484 1.00 35.80  ? 596  LYS A CD  1 
ATOM   4274  C  CE  . LYS A  1  568 ? 40.930  18.451  -11.612 1.00 36.15  ? 596  LYS A CE  1 
ATOM   4275  N  NZ  . LYS A  1  568 ? 39.699  17.622  -11.630 1.00 36.35  ? 596  LYS A NZ  1 
ATOM   4276  N  N   . TRP A  1  569 ? 44.326  23.148  -8.721  1.00 33.40  ? 597  TRP A N   1 
ATOM   4277  C  CA  . TRP A  1  569 ? 44.861  24.167  -9.627  1.00 32.98  ? 597  TRP A CA  1 
ATOM   4278  C  C   . TRP A  1  569 ? 46.257  24.671  -9.246  1.00 33.09  ? 597  TRP A C   1 
ATOM   4279  O  O   . TRP A  1  569 ? 46.690  25.718  -9.711  1.00 33.12  ? 597  TRP A O   1 
ATOM   4280  C  CB  . TRP A  1  569 ? 43.867  25.328  -9.790  1.00 32.49  ? 597  TRP A CB  1 
ATOM   4281  C  CG  . TRP A  1  569 ? 42.464  24.860  -10.064 1.00 32.43  ? 597  TRP A CG  1 
ATOM   4282  C  CD1 . TRP A  1  569 ? 41.357  25.106  -9.299  1.00 32.53  ? 597  TRP A CD1 1 
ATOM   4283  C  CD2 . TRP A  1  569 ? 42.023  24.030  -11.149 1.00 32.21  ? 597  TRP A CD2 1 
ATOM   4284  N  NE1 . TRP A  1  569 ? 40.256  24.499  -9.844  1.00 32.65  ? 597  TRP A NE1 1 
ATOM   4285  C  CE2 . TRP A  1  569 ? 40.630  23.832  -10.981 1.00 32.43  ? 597  TRP A CE2 1 
ATOM   4286  C  CE3 . TRP A  1  569 ? 42.669  23.436  -12.250 1.00 32.15  ? 597  TRP A CE3 1 
ATOM   4287  C  CZ2 . TRP A  1  569 ? 39.866  23.063  -11.868 1.00 31.92  ? 597  TRP A CZ2 1 
ATOM   4288  C  CZ3 . TRP A  1  569 ? 41.909  22.668  -13.136 1.00 32.35  ? 597  TRP A CZ3 1 
ATOM   4289  C  CH2 . TRP A  1  569 ? 40.521  22.489  -12.937 1.00 32.43  ? 597  TRP A CH2 1 
ATOM   4290  N  N   . GLY A  1  570 ? 46.964  23.922  -8.407  1.00 33.04  ? 598  GLY A N   1 
ATOM   4291  C  CA  . GLY A  1  570 ? 48.352  24.246  -8.098  1.00 32.79  ? 598  GLY A CA  1 
ATOM   4292  C  C   . GLY A  1  570 ? 48.583  25.291  -7.021  1.00 33.03  ? 598  GLY A C   1 
ATOM   4293  O  O   . GLY A  1  570 ? 49.744  25.671  -6.785  1.00 32.97  ? 598  GLY A O   1 
ATOM   4294  N  N   . HIS A  1  571 ? 47.501  25.732  -6.354  1.00 32.51  ? 599  HIS A N   1 
ATOM   4295  C  CA  . HIS A  1  571 ? 47.580  26.770  -5.317  1.00 32.22  ? 599  HIS A CA  1 
ATOM   4296  C  C   . HIS A  1  571 ? 47.423  26.226  -3.902  1.00 31.94  ? 599  HIS A C   1 
ATOM   4297  O  O   . HIS A  1  571 ? 46.571  25.360  -3.658  1.00 32.16  ? 599  HIS A O   1 
ATOM   4298  C  CB  . HIS A  1  571 ? 46.575  27.895  -5.582  1.00 32.22  ? 599  HIS A CB  1 
ATOM   4299  C  CG  . HIS A  1  571 ? 46.826  28.626  -6.862  1.00 33.66  ? 599  HIS A CG  1 
ATOM   4300  N  ND1 . HIS A  1  571 ? 47.848  29.542  -7.006  1.00 34.87  ? 599  HIS A ND1 1 
ATOM   4301  C  CD2 . HIS A  1  571 ? 46.213  28.553  -8.068  1.00 34.42  ? 599  HIS A CD2 1 
ATOM   4302  C  CE1 . HIS A  1  571 ? 47.847  30.010  -8.242  1.00 34.70  ? 599  HIS A CE1 1 
ATOM   4303  N  NE2 . HIS A  1  571 ? 46.869  29.421  -8.909  1.00 35.85  ? 599  HIS A NE2 1 
ATOM   4304  N  N   . PRO A  1  572 ? 48.259  26.715  -2.965  1.00 31.43  ? 600  PRO A N   1 
ATOM   4305  C  CA  . PRO A  1  572 ? 48.205  26.260  -1.577  1.00 31.16  ? 600  PRO A CA  1 
ATOM   4306  C  C   . PRO A  1  572 ? 46.825  26.458  -1.008  1.00 31.16  ? 600  PRO A C   1 
ATOM   4307  O  O   . PRO A  1  572 ? 46.252  27.535  -1.160  1.00 31.80  ? 600  PRO A O   1 
ATOM   4308  C  CB  . PRO A  1  572 ? 49.208  27.172  -0.876  1.00 31.03  ? 600  PRO A CB  1 
ATOM   4309  C  CG  . PRO A  1  572 ? 50.198  27.494  -1.958  1.00 31.70  ? 600  PRO A CG  1 
ATOM   4310  C  CD  . PRO A  1  572 ? 49.333  27.701  -3.169  1.00 31.14  ? 600  PRO A CD  1 
ATOM   4311  N  N   . ARG A  1  573 ? 46.269  25.425  -0.378  1.00 31.12  ? 601  ARG A N   1 
ATOM   4312  C  CA  . ARG A  1  573 ? 44.912  25.550  0.132   1.00 30.85  ? 601  ARG A CA  1 
ATOM   4313  C  C   . ARG A  1  573 ? 44.892  26.374  1.396   1.00 30.75  ? 601  ARG A C   1 
ATOM   4314  O  O   . ARG A  1  573 ? 45.600  26.080  2.346   1.00 31.05  ? 601  ARG A O   1 
ATOM   4315  C  CB  . ARG A  1  573 ? 44.183  24.204  0.269   1.00 30.76  ? 601  ARG A CB  1 
ATOM   4316  C  CG  . ARG A  1  573 ? 45.027  22.960  0.151   1.00 30.88  ? 601  ARG A CG  1 
ATOM   4317  C  CD  . ARG A  1  573 ? 44.214  21.779  -0.364  1.00 30.44  ? 601  ARG A CD  1 
ATOM   4318  N  NE  . ARG A  1  573 ? 42.792  21.885  -0.043  1.00 29.88  ? 601  ARG A NE  1 
ATOM   4319  C  CZ  . ARG A  1  573 ? 42.133  21.080  0.786   1.00 29.40  ? 601  ARG A CZ  1 
ATOM   4320  N  NH1 . ARG A  1  573 ? 42.750  20.084  1.405   1.00 29.37  ? 601  ARG A NH1 1 
ATOM   4321  N  NH2 . ARG A  1  573 ? 40.843  21.272  0.993   1.00 28.59  ? 601  ARG A NH2 1 
ATOM   4322  N  N   . GLY A  1  574 ? 44.102  27.441  1.369   1.00 30.86  ? 602  GLY A N   1 
ATOM   4323  C  CA  . GLY A  1  574 ? 44.085  28.426  2.440   1.00 30.59  ? 602  GLY A CA  1 
ATOM   4324  C  C   . GLY A  1  574 ? 42.703  28.889  2.875   1.00 30.82  ? 602  GLY A C   1 
ATOM   4325  O  O   . GLY A  1  574 ? 41.723  28.807  2.125   1.00 30.17  ? 602  GLY A O   1 
ATOM   4326  N  N   . TYR A  1  575 ? 42.643  29.356  4.118   1.00 31.05  ? 603  TYR A N   1 
ATOM   4327  C  CA  . TYR A  1  575 ? 41.474  30.019  4.663   1.00 31.60  ? 603  TYR A CA  1 
ATOM   4328  C  C   . TYR A  1  575 ? 41.916  31.412  5.061   1.00 32.02  ? 603  TYR A C   1 
ATOM   4329  O  O   . TYR A  1  575 ? 42.871  31.565  5.827   1.00 32.39  ? 603  TYR A O   1 
ATOM   4330  C  CB  . TYR A  1  575 ? 40.912  29.228  5.854   1.00 31.44  ? 603  TYR A CB  1 
ATOM   4331  C  CG  . TYR A  1  575 ? 39.629  28.518  5.500   1.00 30.76  ? 603  TYR A CG  1 
ATOM   4332  C  CD1 . TYR A  1  575 ? 39.645  27.306  4.813   1.00 30.59  ? 603  TYR A CD1 1 
ATOM   4333  C  CD2 . TYR A  1  575 ? 38.399  29.088  5.811   1.00 30.17  ? 603  TYR A CD2 1 
ATOM   4334  C  CE1 . TYR A  1  575 ? 38.462  26.671  4.459   1.00 30.11  ? 603  TYR A CE1 1 
ATOM   4335  C  CE2 . TYR A  1  575 ? 37.224  28.476  5.465   1.00 30.85  ? 603  TYR A CE2 1 
ATOM   4336  C  CZ  . TYR A  1  575 ? 37.257  27.265  4.788   1.00 30.98  ? 603  TYR A CZ  1 
ATOM   4337  O  OH  . TYR A  1  575 ? 36.072  26.659  4.451   1.00 30.60  ? 603  TYR A OH  1 
ATOM   4338  N  N   . ARG A  1  576 ? 41.261  32.428  4.504   1.00 32.22  ? 604  ARG A N   1 
ATOM   4339  C  CA  . ARG A  1  576 ? 41.656  33.804  4.776   1.00 32.30  ? 604  ARG A CA  1 
ATOM   4340  C  C   . ARG A  1  576 ? 40.925  34.417  5.976   1.00 32.64  ? 604  ARG A C   1 
ATOM   4341  O  O   . ARG A  1  576 ? 39.791  34.055  6.282   1.00 32.26  ? 604  ARG A O   1 
ATOM   4342  C  CB  . ARG A  1  576 ? 41.530  34.684  3.519   1.00 31.96  ? 604  ARG A CB  1 
ATOM   4343  C  CG  . ARG A  1  576 ? 40.194  35.309  3.317   1.00 32.73  ? 604  ARG A CG  1 
ATOM   4344  C  CD  . ARG A  1  576 ? 40.104  36.083  2.025   1.00 34.03  ? 604  ARG A CD  1 
ATOM   4345  N  NE  . ARG A  1  576 ? 40.366  37.515  2.169   1.00 35.20  ? 604  ARG A NE  1 
ATOM   4346  C  CZ  . ARG A  1  576 ? 39.788  38.451  1.414   1.00 35.29  ? 604  ARG A CZ  1 
ATOM   4347  N  NH1 . ARG A  1  576 ? 38.901  38.106  0.486   1.00 35.49  ? 604  ARG A NH1 1 
ATOM   4348  N  NH2 . ARG A  1  576 ? 40.082  39.731  1.588   1.00 35.00  ? 604  ARG A NH2 1 
ATOM   4349  N  N   . ILE A  1  577 ? 41.589  35.353  6.644   1.00 33.49  ? 605  ILE A N   1 
ATOM   4350  C  CA  . ILE A  1  577 ? 40.981  36.089  7.747   1.00 34.36  ? 605  ILE A CA  1 
ATOM   4351  C  C   . ILE A  1  577 ? 40.583  37.510  7.312   1.00 35.22  ? 605  ILE A C   1 
ATOM   4352  O  O   . ILE A  1  577 ? 41.436  38.352  7.037   1.00 35.11  ? 605  ILE A O   1 
ATOM   4353  C  CB  . ILE A  1  577 ? 41.906  36.075  8.984   1.00 34.01  ? 605  ILE A CB  1 
ATOM   4354  C  CG1 . ILE A  1  577 ? 42.169  34.629  9.393   1.00 33.81  ? 605  ILE A CG1 1 
ATOM   4355  C  CG2 . ILE A  1  577 ? 41.269  36.797  10.166  1.00 34.05  ? 605  ILE A CG2 1 
ATOM   4356  C  CD1 . ILE A  1  577 ? 43.349  34.446  10.294  1.00 33.94  ? 605  ILE A CD1 1 
ATOM   4357  N  N   . GLN A  1  578 ? 39.284  37.765  7.226   1.00 36.60  ? 606  GLN A N   1 
ATOM   4358  C  CA  . GLN A  1  578 ? 38.819  39.093  6.839   1.00 38.79  ? 606  GLN A CA  1 
ATOM   4359  C  C   . GLN A  1  578 ? 38.186  39.827  8.020   1.00 39.88  ? 606  GLN A C   1 
ATOM   4360  O  O   . GLN A  1  578 ? 37.191  39.366  8.582   1.00 39.97  ? 606  GLN A O   1 
ATOM   4361  C  CB  . GLN A  1  578 ? 37.839  39.018  5.678   1.00 38.61  ? 606  GLN A CB  1 
ATOM   4362  C  CG  . GLN A  1  578 ? 37.471  40.368  5.127   1.00 40.81  ? 606  GLN A CG  1 
ATOM   4363  C  CD  . GLN A  1  578 ? 36.370  40.293  4.084   1.00 44.68  ? 606  GLN A CD  1 
ATOM   4364  O  OE1 . GLN A  1  578 ? 36.644  40.289  2.879   1.00 46.89  ? 606  GLN A OE1 1 
ATOM   4365  N  NE2 . GLN A  1  578 ? 35.118  40.236  4.536   1.00 45.04  ? 606  GLN A NE2 1 
ATOM   4366  N  N   . MET A  1  579 ? 38.751  40.978  8.378   1.00 41.30  ? 607  MET A N   1 
ATOM   4367  C  CA  . MET A  1  579 ? 38.313  41.682  9.583   1.00 43.09  ? 607  MET A CA  1 
ATOM   4368  C  C   . MET A  1  579 ? 37.433  42.882  9.314   1.00 44.10  ? 607  MET A C   1 
ATOM   4369  O  O   . MET A  1  579 ? 37.654  43.618  8.362   1.00 44.37  ? 607  MET A O   1 
ATOM   4370  C  CB  . MET A  1  579 ? 39.497  42.088  10.433  1.00 42.78  ? 607  MET A CB  1 
ATOM   4371  C  CG  . MET A  1  579 ? 40.242  40.899  11.004  1.00 42.98  ? 607  MET A CG  1 
ATOM   4372  S  SD  . MET A  1  579 ? 41.842  41.439  11.577  1.00 44.38  ? 607  MET A SD  1 
ATOM   4373  C  CE  . MET A  1  579 ? 41.307  42.534  12.911  1.00 47.89  ? 607  MET A CE  1 
ATOM   4374  N  N   . LEU A  1  580 ? 36.416  43.033  10.165  1.00 45.61  ? 608  LEU A N   1 
ATOM   4375  C  CA  . LEU A  1  580 ? 35.466  44.141  10.130  1.00 46.84  ? 608  LEU A CA  1 
ATOM   4376  C  C   . LEU A  1  580 ? 35.514  44.785  11.520  1.00 47.52  ? 608  LEU A C   1 
ATOM   4377  O  O   . LEU A  1  580 ? 34.876  44.304  12.487  1.00 47.19  ? 608  LEU A O   1 
ATOM   4378  C  CB  . LEU A  1  580 ? 34.048  43.638  9.838   1.00 47.16  ? 608  LEU A CB  1 
ATOM   4379  C  CG  . LEU A  1  580 ? 33.894  42.454  8.872   1.00 48.51  ? 608  LEU A CG  1 
ATOM   4380  C  CD1 . LEU A  1  580 ? 32.946  41.399  9.441   1.00 49.22  ? 608  LEU A CD1 1 
ATOM   4381  C  CD2 . LEU A  1  580 ? 33.464  42.893  7.478   1.00 49.47  ? 608  LEU A CD2 1 
ATOM   4382  N  N   . SER A  1  581 ? 36.292  45.864  11.613  1.00 48.04  ? 609  SER A N   1 
ATOM   4383  C  CA  . SER A  1  581 ? 36.548  46.526  12.882  1.00 48.29  ? 609  SER A CA  1 
ATOM   4384  C  C   . SER A  1  581 ? 36.852  48.011  12.721  1.00 48.66  ? 609  SER A C   1 
ATOM   4385  O  O   . SER A  1  581 ? 37.612  48.417  11.836  1.00 48.37  ? 609  SER A O   1 
ATOM   4386  C  CB  . SER A  1  581 ? 37.698  45.836  13.618  1.00 48.17  ? 609  SER A CB  1 
ATOM   4387  O  OG  . SER A  1  581 ? 37.773  46.303  14.945  1.00 47.11  ? 609  SER A OG  1 
ATOM   4388  N  N   . PHE A  1  582 ? 36.248  48.799  13.609  1.00 48.93  ? 610  PHE A N   1 
ATOM   4389  C  CA  . PHE A  1  582 ? 36.473  50.237  13.696  1.00 49.23  ? 610  PHE A CA  1 
ATOM   4390  C  C   . PHE A  1  582 ? 37.218  50.538  15.000  1.00 48.61  ? 610  PHE A C   1 
ATOM   4391  O  O   . PHE A  1  582 ? 36.886  51.507  15.711  1.00 48.43  ? 610  PHE A O   1 
ATOM   4392  C  CB  . PHE A  1  582 ? 35.130  50.980  13.677  1.00 50.07  ? 610  PHE A CB  1 
ATOM   4393  C  CG  . PHE A  1  582 ? 34.167  50.471  12.642  1.00 51.88  ? 610  PHE A CG  1 
ATOM   4394  C  CD1 . PHE A  1  582 ? 33.220  49.494  12.974  1.00 52.54  ? 610  PHE A CD1 1 
ATOM   4395  C  CD2 . PHE A  1  582 ? 34.206  50.968  11.328  1.00 53.67  ? 610  PHE A CD2 1 
ATOM   4396  C  CE1 . PHE A  1  582 ? 32.329  49.012  12.016  1.00 53.17  ? 610  PHE A CE1 1 
ATOM   4397  C  CE2 . PHE A  1  582 ? 33.318  50.498  10.359  1.00 53.91  ? 610  PHE A CE2 1 
ATOM   4398  C  CZ  . PHE A  1  582 ? 32.377  49.515  10.702  1.00 53.08  ? 610  PHE A CZ  1 
ATOM   4399  N  N   . ALA A  1  583 ? 38.233  49.716  15.284  1.00 47.57  ? 611  ALA A N   1 
ATOM   4400  C  CA  . ALA A  1  583 ? 38.802  49.594  16.630  1.00 46.72  ? 611  ALA A CA  1 
ATOM   4401  C  C   . ALA A  1  583 ? 39.239  50.915  17.227  1.00 46.21  ? 611  ALA A C   1 
ATOM   4402  O  O   . ALA A  1  583 ? 39.774  51.776  16.526  1.00 46.01  ? 611  ALA A O   1 
ATOM   4403  C  CB  . ALA A  1  583 ? 39.939  48.585  16.650  1.00 46.68  ? 611  ALA A CB  1 
ATOM   4404  N  N   . GLY A  1  584 ? 38.980  51.068  18.525  1.00 45.74  ? 612  GLY A N   1 
ATOM   4405  C  CA  . GLY A  1  584 ? 39.389  52.247  19.273  1.00 45.22  ? 612  GLY A CA  1 
ATOM   4406  C  C   . GLY A  1  584 ? 40.890  52.357  19.465  1.00 45.13  ? 612  GLY A C   1 
ATOM   4407  O  O   . GLY A  1  584 ? 41.624  51.377  19.325  1.00 44.22  ? 612  GLY A O   1 
ATOM   4408  N  N   . GLU A  1  585 ? 41.347  53.571  19.762  1.00 45.39  ? 613  GLU A N   1 
ATOM   4409  C  CA  . GLU A  1  585 ? 42.726  53.791  20.161  1.00 46.18  ? 613  GLU A CA  1 
ATOM   4410  C  C   . GLU A  1  585 ? 42.923  53.018  21.472  1.00 45.60  ? 613  GLU A C   1 
ATOM   4411  O  O   . GLU A  1  585 ? 42.219  53.260  22.457  1.00 45.53  ? 613  GLU A O   1 
ATOM   4412  C  CB  . GLU A  1  585 ? 42.994  55.293  20.330  1.00 46.18  ? 613  GLU A CB  1 
ATOM   4413  C  CG  . GLU A  1  585 ? 44.472  55.708  20.513  1.00 48.12  ? 613  GLU A CG  1 
ATOM   4414  C  CD  . GLU A  1  585 ? 44.656  57.238  20.671  1.00 48.61  ? 613  GLU A CD  1 
ATOM   4415  O  OE1 . GLU A  1  585 ? 43.961  58.014  19.956  1.00 52.64  ? 613  GLU A OE1 1 
ATOM   4416  O  OE2 . GLU A  1  585 ? 45.501  57.669  21.502  1.00 50.46  ? 613  GLU A OE2 1 
ATOM   4417  N  N   . PRO A  1  586 ? 43.853  52.049  21.477  1.00 45.43  ? 614  PRO A N   1 
ATOM   4418  C  CA  . PRO A  1  586 ? 44.097  51.234  22.668  1.00 44.85  ? 614  PRO A CA  1 
ATOM   4419  C  C   . PRO A  1  586 ? 44.604  52.096  23.812  1.00 44.54  ? 614  PRO A C   1 
ATOM   4420  O  O   . PRO A  1  586 ? 45.178  53.165  23.571  1.00 44.25  ? 614  PRO A O   1 
ATOM   4421  C  CB  . PRO A  1  586 ? 45.225  50.302  22.220  1.00 44.98  ? 614  PRO A CB  1 
ATOM   4422  C  CG  . PRO A  1  586 ? 45.912  51.050  21.095  1.00 45.18  ? 614  PRO A CG  1 
ATOM   4423  C  CD  . PRO A  1  586 ? 44.764  51.687  20.374  1.00 45.37  ? 614  PRO A CD  1 
ATOM   4424  N  N   . LEU A  1  587 ? 44.407  51.637  25.045  1.00 44.17  ? 615  LEU A N   1 
ATOM   4425  C  CA  . LEU A  1  587 ? 44.979  52.340  26.188  1.00 43.89  ? 615  LEU A CA  1 
ATOM   4426  C  C   . LEU A  1  587 ? 46.481  52.449  25.954  1.00 43.98  ? 615  LEU A C   1 
ATOM   4427  O  O   . LEU A  1  587 ? 47.122  51.453  25.587  1.00 44.11  ? 615  LEU A O   1 
ATOM   4428  C  CB  . LEU A  1  587 ? 44.676  51.621  27.506  1.00 43.79  ? 615  LEU A CB  1 
ATOM   4429  C  CG  . LEU A  1  587 ? 44.820  52.417  28.809  1.00 43.21  ? 615  LEU A CG  1 
ATOM   4430  C  CD1 . LEU A  1  587 ? 43.772  53.501  28.933  1.00 42.28  ? 615  LEU A CD1 1 
ATOM   4431  C  CD2 . LEU A  1  587 ? 44.749  51.492  29.992  1.00 43.38  ? 615  LEU A CD2 1 
ATOM   4432  N  N   . PRO A  1  588 ? 47.041  53.664  26.120  1.00 43.89  ? 616  PRO A N   1 
ATOM   4433  C  CA  . PRO A  1  588 ? 48.459  53.899  25.846  1.00 43.91  ? 616  PRO A CA  1 
ATOM   4434  C  C   . PRO A  1  588 ? 49.380  52.961  26.621  1.00 43.93  ? 616  PRO A C   1 
ATOM   4435  O  O   . PRO A  1  588 ? 49.233  52.793  27.836  1.00 43.77  ? 616  PRO A O   1 
ATOM   4436  C  CB  . PRO A  1  588 ? 48.666  55.357  26.289  1.00 43.78  ? 616  PRO A CB  1 
ATOM   4437  C  CG  . PRO A  1  588 ? 47.342  55.971  26.161  1.00 43.96  ? 616  PRO A CG  1 
ATOM   4438  C  CD  . PRO A  1  588 ? 46.370  54.897  26.566  1.00 43.83  ? 616  PRO A CD  1 
ATOM   4439  N  N   . GLN A  1  589 ? 50.318  52.361  25.896  1.00 44.26  ? 617  GLN A N   1 
ATOM   4440  C  CA  . GLN A  1  589 ? 51.321  51.437  26.436  1.00 44.79  ? 617  GLN A CA  1 
ATOM   4441  C  C   . GLN A  1  589 ? 52.049  51.951  27.697  1.00 44.45  ? 617  GLN A C   1 
ATOM   4442  O  O   . GLN A  1  589 ? 52.570  51.162  28.489  1.00 44.19  ? 617  GLN A O   1 
ATOM   4443  C  CB  . GLN A  1  589 ? 52.336  51.141  25.340  1.00 45.06  ? 617  GLN A CB  1 
ATOM   4444  C  CG  . GLN A  1  589 ? 52.972  49.770  25.404  1.00 47.45  ? 617  GLN A CG  1 
ATOM   4445  C  CD  . GLN A  1  589 ? 53.878  49.512  24.213  1.00 49.92  ? 617  GLN A CD  1 
ATOM   4446  O  OE1 . GLN A  1  589 ? 53.822  50.236  23.214  1.00 51.84  ? 617  GLN A OE1 1 
ATOM   4447  N  NE2 . GLN A  1  589 ? 54.721  48.486  24.311  1.00 50.30  ? 617  GLN A NE2 1 
ATOM   4448  N  N   . ASN A  1  590 ? 52.064  53.275  27.860  1.00 44.10  ? 618  ASN A N   1 
ATOM   4449  C  CA  . ASN A  1  590 ? 52.674  53.967  28.999  1.00 43.65  ? 618  ASN A CA  1 
ATOM   4450  C  C   . ASN A  1  590 ? 51.905  53.775  30.321  1.00 42.92  ? 618  ASN A C   1 
ATOM   4451  O  O   . ASN A  1  590 ? 52.460  53.998  31.410  1.00 42.60  ? 618  ASN A O   1 
ATOM   4452  C  CB  . ASN A  1  590 ? 52.759  55.461  28.676  1.00 44.14  ? 618  ASN A CB  1 
ATOM   4453  C  CG  . ASN A  1  590 ? 54.094  56.082  29.067  1.00 45.75  ? 618  ASN A CG  1 
ATOM   4454  O  OD1 . ASN A  1  590 ? 54.777  56.676  28.217  1.00 47.13  ? 618  ASN A OD1 1 
ATOM   4455  N  ND2 . ASN A  1  590 ? 54.471  55.964  30.355  1.00 46.04  ? 618  ASN A ND2 1 
ATOM   4456  N  N   . SER A  1  591 ? 50.629  53.386  30.214  1.00 41.70  ? 619  SER A N   1 
ATOM   4457  C  CA  . SER A  1  591 ? 49.797  53.064  31.374  1.00 40.35  ? 619  SER A CA  1 
ATOM   4458  C  C   . SER A  1  591 ? 50.286  51.782  32.015  1.00 39.34  ? 619  SER A C   1 
ATOM   4459  O  O   . SER A  1  591 ? 50.432  50.752  31.341  1.00 39.02  ? 619  SER A O   1 
ATOM   4460  C  CB  . SER A  1  591 ? 48.334  52.889  30.965  1.00 40.58  ? 619  SER A CB  1 
ATOM   4461  O  OG  . SER A  1  591 ? 47.543  52.440  32.061  1.00 41.46  ? 619  SER A OG  1 
ATOM   4462  N  N   . SER A  1  592 ? 50.529  51.849  33.321  1.00 38.17  ? 620  SER A N   1 
ATOM   4463  C  CA  . SER A  1  592 ? 51.078  50.716  34.064  1.00 36.68  ? 620  SER A CA  1 
ATOM   4464  C  C   . SER A  1  592 ? 50.123  49.531  34.073  1.00 35.88  ? 620  SER A C   1 
ATOM   4465  O  O   . SER A  1  592 ? 50.506  48.433  34.472  1.00 36.04  ? 620  SER A O   1 
ATOM   4466  C  CB  . SER A  1  592 ? 51.434  51.120  35.492  1.00 36.73  ? 620  SER A CB  1 
ATOM   4467  O  OG  . SER A  1  592 ? 50.301  51.609  36.178  1.00 36.07  ? 620  SER A OG  1 
ATOM   4468  N  N   . MET A  1  593 ? 48.891  49.740  33.616  1.00 34.57  ? 621  MET A N   1 
ATOM   4469  C  CA  . MET A  1  593 ? 47.924  48.645  33.596  1.00 33.47  ? 621  MET A CA  1 
ATOM   4470  C  C   . MET A  1  593 ? 47.742  48.036  32.217  1.00 33.46  ? 621  MET A C   1 
ATOM   4471  O  O   . MET A  1  593 ? 47.137  46.973  32.089  1.00 32.93  ? 621  MET A O   1 
ATOM   4472  C  CB  . MET A  1  593 ? 46.574  49.066  34.195  1.00 33.37  ? 621  MET A CB  1 
ATOM   4473  C  CG  . MET A  1  593 ? 45.674  49.900  33.295  1.00 31.77  ? 621  MET A CG  1 
ATOM   4474  S  SD  . MET A  1  593 ? 44.023  50.105  34.028  1.00 32.48  ? 621  MET A SD  1 
ATOM   4475  C  CE  . MET A  1  593 ? 44.405  51.111  35.467  1.00 31.72  ? 621  MET A CE  1 
ATOM   4476  N  N   . ALA A  1  594 ? 48.280  48.701  31.197  1.00 33.45  ? 622  ALA A N   1 
ATOM   4477  C  CA  . ALA A  1  594 ? 48.079  48.271  29.816  1.00 34.03  ? 622  ALA A CA  1 
ATOM   4478  C  C   . ALA A  1  594 ? 48.413  46.791  29.578  1.00 34.40  ? 622  ALA A C   1 
ATOM   4479  O  O   . ALA A  1  594 ? 47.819  46.159  28.708  1.00 34.72  ? 622  ALA A O   1 
ATOM   4480  C  CB  . ALA A  1  594 ? 48.844  49.172  28.835  1.00 33.62  ? 622  ALA A CB  1 
ATOM   4481  N  N   . ARG A  1  595 ? 49.346  46.238  30.347  1.00 35.01  ? 623  ARG A N   1 
ATOM   4482  C  CA  . ARG A  1  595 ? 49.774  44.848  30.139  1.00 35.86  ? 623  ARG A CA  1 
ATOM   4483  C  C   . ARG A  1  595 ? 48.717  43.839  30.566  1.00 35.39  ? 623  ARG A C   1 
ATOM   4484  O  O   . ARG A  1  595 ? 48.808  42.673  30.206  1.00 35.79  ? 623  ARG A O   1 
ATOM   4485  C  CB  . ARG A  1  595 ? 51.095  44.544  30.853  1.00 36.25  ? 623  ARG A CB  1 
ATOM   4486  C  CG  . ARG A  1  595 ? 52.296  45.358  30.377  1.00 39.63  ? 623  ARG A CG  1 
ATOM   4487  C  CD  . ARG A  1  595 ? 52.932  44.765  29.130  1.00 44.89  ? 623  ARG A CD  1 
ATOM   4488  N  NE  . ARG A  1  595 ? 54.288  45.277  28.915  1.00 48.58  ? 623  ARG A NE  1 
ATOM   4489  C  CZ  . ARG A  1  595 ? 54.972  45.166  27.776  1.00 49.64  ? 623  ARG A CZ  1 
ATOM   4490  N  NH1 . ARG A  1  595 ? 54.442  44.554  26.720  1.00 49.94  ? 623  ARG A NH1 1 
ATOM   4491  N  NH2 . ARG A  1  595 ? 56.194  45.670  27.696  1.00 49.90  ? 623  ARG A NH2 1 
ATOM   4492  N  N   . GLY A  1  596 ? 47.717  44.282  31.321  1.00 34.93  ? 624  GLY A N   1 
ATOM   4493  C  CA  . GLY A  1  596 ? 46.633  43.394  31.756  1.00 34.81  ? 624  GLY A CA  1 
ATOM   4494  C  C   . GLY A  1  596 ? 45.664  43.020  30.646  1.00 34.78  ? 624  GLY A C   1 
ATOM   4495  O  O   . GLY A  1  596 ? 44.749  42.214  30.836  1.00 34.76  ? 624  GLY A O   1 
ATOM   4496  N  N   . PHE A  1  597 ? 45.854  43.620  29.480  1.00 34.75  ? 625  PHE A N   1 
ATOM   4497  C  CA  . PHE A  1  597 ? 45.024  43.322  28.326  1.00 34.83  ? 625  PHE A CA  1 
ATOM   4498  C  C   . PHE A  1  597 ? 45.764  43.752  27.063  1.00 35.22  ? 625  PHE A C   1 
ATOM   4499  O  O   . PHE A  1  597 ? 45.210  44.456  26.204  1.00 35.48  ? 625  PHE A O   1 
ATOM   4500  C  CB  . PHE A  1  597 ? 43.642  43.996  28.447  1.00 34.08  ? 625  PHE A CB  1 
ATOM   4501  C  CG  . PHE A  1  597 ? 43.675  45.389  29.059  1.00 33.06  ? 625  PHE A CG  1 
ATOM   4502  C  CD1 . PHE A  1  597 ? 43.950  46.505  28.278  1.00 30.94  ? 625  PHE A CD1 1 
ATOM   4503  C  CD2 . PHE A  1  597 ? 43.403  45.575  30.422  1.00 31.85  ? 625  PHE A CD2 1 
ATOM   4504  C  CE1 . PHE A  1  597 ? 43.959  47.782  28.840  1.00 31.81  ? 625  PHE A CE1 1 
ATOM   4505  C  CE2 . PHE A  1  597 ? 43.415  46.849  31.002  1.00 30.20  ? 625  PHE A CE2 1 
ATOM   4506  C  CZ  . PHE A  1  597 ? 43.687  47.956  30.211  1.00 31.70  ? 625  PHE A CZ  1 
ATOM   4507  N  N   . SER A  1  598 ? 47.024  43.327  26.955  1.00 35.52  ? 626  SER A N   1 
ATOM   4508  C  CA  . SER A  1  598 ? 47.912  43.822  25.883  1.00 35.78  ? 626  SER A CA  1 
ATOM   4509  C  C   . SER A  1  598 ? 47.486  43.405  24.472  1.00 35.13  ? 626  SER A C   1 
ATOM   4510  O  O   . SER A  1  598 ? 48.047  43.886  23.491  1.00 34.71  ? 626  SER A O   1 
ATOM   4511  C  CB  . SER A  1  598 ? 49.365  43.441  26.153  1.00 35.76  ? 626  SER A CB  1 
ATOM   4512  O  OG  . SER A  1  598 ? 49.487  42.037  26.224  1.00 37.86  ? 626  SER A OG  1 
ATOM   4513  N  N   . TRP A  1  599 ? 46.478  42.531  24.391  1.00 35.03  ? 627  TRP A N   1 
ATOM   4514  C  CA  . TRP A  1  599 ? 45.881  42.102  23.126  1.00 34.78  ? 627  TRP A CA  1 
ATOM   4515  C  C   . TRP A  1  599 ? 45.105  43.222  22.456  1.00 35.78  ? 627  TRP A C   1 
ATOM   4516  O  O   . TRP A  1  599 ? 44.791  43.151  21.264  1.00 36.05  ? 627  TRP A O   1 
ATOM   4517  C  CB  . TRP A  1  599 ? 44.938  40.938  23.358  1.00 34.07  ? 627  TRP A CB  1 
ATOM   4518  C  CG  . TRP A  1  599 ? 43.892  41.191  24.422  1.00 33.75  ? 627  TRP A CG  1 
ATOM   4519  C  CD1 . TRP A  1  599 ? 43.963  40.831  25.737  1.00 32.58  ? 627  TRP A CD1 1 
ATOM   4520  C  CD2 . TRP A  1  599 ? 42.618  41.834  24.252  1.00 32.39  ? 627  TRP A CD2 1 
ATOM   4521  N  NE1 . TRP A  1  599 ? 42.816  41.202  26.397  1.00 31.80  ? 627  TRP A NE1 1 
ATOM   4522  C  CE2 . TRP A  1  599 ? 41.974  41.825  25.515  1.00 32.42  ? 627  TRP A CE2 1 
ATOM   4523  C  CE3 . TRP A  1  599 ? 41.956  42.411  23.158  1.00 32.50  ? 627  TRP A CE3 1 
ATOM   4524  C  CZ2 . TRP A  1  599 ? 40.703  42.390  25.722  1.00 31.91  ? 627  TRP A CZ2 1 
ATOM   4525  C  CZ3 . TRP A  1  599 ? 40.690  42.965  23.357  1.00 32.59  ? 627  TRP A CZ3 1 
ATOM   4526  C  CH2 . TRP A  1  599 ? 40.077  42.944  24.636  1.00 33.01  ? 627  TRP A CH2 1 
ATOM   4527  N  N   . GLU A  1  600 ? 44.770  44.245  23.230  1.00 36.69  ? 628  GLU A N   1 
ATOM   4528  C  CA  . GLU A  1  600 ? 44.043  45.394  22.721  1.00 37.60  ? 628  GLU A CA  1 
ATOM   4529  C  C   . GLU A  1  600 ? 44.859  46.086  21.633  1.00 37.92  ? 628  GLU A C   1 
ATOM   4530  O  O   . GLU A  1  600 ? 44.299  46.696  20.728  1.00 37.89  ? 628  GLU A O   1 
ATOM   4531  C  CB  . GLU A  1  600 ? 43.763  46.375  23.858  1.00 37.84  ? 628  GLU A CB  1 
ATOM   4532  C  CG  . GLU A  1  600 ? 42.698  47.419  23.544  1.00 39.83  ? 628  GLU A CG  1 
ATOM   4533  C  CD  . GLU A  1  600 ? 42.798  48.655  24.441  1.00 43.83  ? 628  GLU A CD  1 
ATOM   4534  O  OE1 . GLU A  1  600 ? 43.809  48.807  25.195  1.00 43.96  ? 628  GLU A OE1 1 
ATOM   4535  O  OE2 . GLU A  1  600 ? 41.857  49.485  24.375  1.00 45.60  ? 628  GLU A OE2 1 
ATOM   4536  N  N   . ARG A  1  601 ? 46.183  45.985  21.721  1.00 38.21  ? 629  ARG A N   1 
ATOM   4537  C  CA  . ARG A  1  601 ? 47.048  46.727  20.818  1.00 38.76  ? 629  ARG A CA  1 
ATOM   4538  C  C   . ARG A  1  601 ? 47.103  46.101  19.437  1.00 38.50  ? 629  ARG A C   1 
ATOM   4539  O  O   . ARG A  1  601 ? 47.577  46.710  18.498  1.00 38.81  ? 629  ARG A O   1 
ATOM   4540  C  CB  . ARG A  1  601 ? 48.447  46.854  21.400  1.00 39.22  ? 629  ARG A CB  1 
ATOM   4541  C  CG  . ARG A  1  601 ? 48.491  47.642  22.699  1.00 41.91  ? 629  ARG A CG  1 
ATOM   4542  C  CD  . ARG A  1  601 ? 49.904  48.027  23.075  1.00 46.11  ? 629  ARG A CD  1 
ATOM   4543  N  NE  . ARG A  1  601 ? 50.752  46.848  23.244  1.00 50.03  ? 629  ARG A NE  1 
ATOM   4544  C  CZ  . ARG A  1  601 ? 51.792  46.549  22.465  1.00 52.35  ? 629  ARG A CZ  1 
ATOM   4545  N  NH1 . ARG A  1  601 ? 52.123  47.348  21.448  1.00 52.71  ? 629  ARG A NH1 1 
ATOM   4546  N  NH2 . ARG A  1  601 ? 52.507  45.447  22.708  1.00 52.59  ? 629  ARG A NH2 1 
ATOM   4547  N  N   . TYR A  1  602 ? 46.596  44.886  19.308  1.00 38.38  ? 630  TYR A N   1 
ATOM   4548  C  CA  . TYR A  1  602 ? 46.674  44.174  18.047  1.00 37.92  ? 630  TYR A CA  1 
ATOM   4549  C  C   . TYR A  1  602 ? 45.332  44.084  17.341  1.00 37.80  ? 630  TYR A C   1 
ATOM   4550  O  O   . TYR A  1  602 ? 44.291  43.989  17.985  1.00 37.91  ? 630  TYR A O   1 
ATOM   4551  C  CB  . TYR A  1  602 ? 47.254  42.788  18.287  1.00 38.04  ? 630  TYR A CB  1 
ATOM   4552  C  CG  . TYR A  1  602 ? 48.672  42.830  18.814  1.00 38.26  ? 630  TYR A CG  1 
ATOM   4553  C  CD1 . TYR A  1  602 ? 48.922  42.831  20.181  1.00 37.89  ? 630  TYR A CD1 1 
ATOM   4554  C  CD2 . TYR A  1  602 ? 49.763  42.886  17.943  1.00 37.94  ? 630  TYR A CD2 1 
ATOM   4555  C  CE1 . TYR A  1  602 ? 50.221  42.872  20.674  1.00 38.26  ? 630  TYR A CE1 1 
ATOM   4556  C  CE2 . TYR A  1  602 ? 51.066  42.929  18.425  1.00 38.35  ? 630  TYR A CE2 1 
ATOM   4557  C  CZ  . TYR A  1  602 ? 51.283  42.921  19.794  1.00 38.72  ? 630  TYR A CZ  1 
ATOM   4558  O  OH  . TYR A  1  602 ? 52.564  42.961  20.293  1.00 40.01  ? 630  TYR A OH  1 
ATOM   4559  N  N   . GLN A  1  603 ? 45.360  44.148  16.014  1.00 37.51  ? 631  GLN A N   1 
ATOM   4560  C  CA  . GLN A  1  603 ? 44.204  43.780  15.205  1.00 37.21  ? 631  GLN A CA  1 
ATOM   4561  C  C   . GLN A  1  603 ? 44.221  42.267  15.085  1.00 36.82  ? 631  GLN A C   1 
ATOM   4562  O  O   . GLN A  1  603 ? 43.198  41.585  15.242  1.00 37.14  ? 631  GLN A O   1 
ATOM   4563  C  CB  . GLN A  1  603 ? 44.303  44.385  13.807  1.00 37.21  ? 631  GLN A CB  1 
ATOM   4564  C  CG  . GLN A  1  603 ? 44.275  45.897  13.756  1.00 37.75  ? 631  GLN A CG  1 
ATOM   4565  C  CD  . GLN A  1  603 ? 44.372  46.432  12.327  1.00 37.52  ? 631  GLN A CD  1 
ATOM   4566  O  OE1 . GLN A  1  603 ? 43.607  46.031  11.447  1.00 37.58  ? 631  GLN A OE1 1 
ATOM   4567  N  NE2 . GLN A  1  603 ? 45.313  47.348  12.099  1.00 36.99  ? 631  GLN A NE2 1 
ATOM   4568  N  N   . LEU A  1  604 ? 45.419  41.758  14.824  1.00 36.12  ? 632  LEU A N   1 
ATOM   4569  C  CA  . LEU A  1  604 ? 45.622  40.387  14.433  1.00 35.37  ? 632  LEU A CA  1 
ATOM   4570  C  C   . LEU A  1  604 ? 47.019  39.960  14.838  1.00 34.50  ? 632  LEU A C   1 
ATOM   4571  O  O   . LEU A  1  604 ? 47.975  40.720  14.690  1.00 34.53  ? 632  LEU A O   1 
ATOM   4572  C  CB  . LEU A  1  604 ? 45.453  40.285  12.916  1.00 35.34  ? 632  LEU A CB  1 
ATOM   4573  C  CG  . LEU A  1  604 ? 45.647  38.958  12.190  1.00 35.79  ? 632  LEU A CG  1 
ATOM   4574  C  CD1 . LEU A  1  604 ? 44.408  38.085  12.338  1.00 37.30  ? 632  LEU A CD1 1 
ATOM   4575  C  CD2 . LEU A  1  604 ? 45.919  39.246  10.733  1.00 35.59  ? 632  LEU A CD2 1 
ATOM   4576  N  N   . ALA A  1  605 ? 47.131  38.750  15.365  1.00 33.87  ? 633  ALA A N   1 
ATOM   4577  C  CA  . ALA A  1  605 ? 48.435  38.120  15.565  1.00 33.60  ? 633  ALA A CA  1 
ATOM   4578  C  C   . ALA A  1  605 ? 48.346  36.652  15.220  1.00 33.21  ? 633  ALA A C   1 
ATOM   4579  O  O   . ALA A  1  605 ? 47.302  36.031  15.385  1.00 33.88  ? 633  ALA A O   1 
ATOM   4580  C  CB  . ALA A  1  605 ? 48.931  38.304  16.994  1.00 33.28  ? 633  ALA A CB  1 
ATOM   4581  N  N   . VAL A  1  606 ? 49.439  36.102  14.721  1.00 32.83  ? 634  VAL A N   1 
ATOM   4582  C  CA  . VAL A  1  606 ? 49.511  34.676  14.467  1.00 32.49  ? 634  VAL A CA  1 
ATOM   4583  C  C   . VAL A  1  606 ? 50.724  34.136  15.202  1.00 32.45  ? 634  VAL A C   1 
ATOM   4584  O  O   . VAL A  1  606 ? 51.838  34.625  15.015  1.00 33.05  ? 634  VAL A O   1 
ATOM   4585  C  CB  . VAL A  1  606 ? 49.571  34.330  12.944  1.00 32.16  ? 634  VAL A CB  1 
ATOM   4586  C  CG1 . VAL A  1  606 ? 49.427  32.840  12.740  1.00 31.90  ? 634  VAL A CG1 1 
ATOM   4587  C  CG2 . VAL A  1  606 ? 48.460  35.035  12.170  1.00 31.86  ? 634  VAL A CG2 1 
ATOM   4588  N  N   . THR A  1  607 ? 50.494  33.142  16.050  1.00 32.02  ? 635  THR A N   1 
ATOM   4589  C  CA  . THR A  1  607 ? 51.538  32.558  16.884  1.00 31.87  ? 635  THR A CA  1 
ATOM   4590  C  C   . THR A  1  607 ? 51.510  31.028  16.758  1.00 32.46  ? 635  THR A C   1 
ATOM   4591  O  O   . THR A  1  607 ? 50.523  30.452  16.277  1.00 33.11  ? 635  THR A O   1 
ATOM   4592  C  CB  . THR A  1  607 ? 51.332  32.929  18.374  1.00 31.63  ? 635  THR A CB  1 
ATOM   4593  O  OG1 . THR A  1  607 ? 50.090  32.389  18.836  1.00 29.84  ? 635  THR A OG1 1 
ATOM   4594  C  CG2 . THR A  1  607 ? 51.314  34.446  18.576  1.00 31.94  ? 635  THR A CG2 1 
ATOM   4595  N  N   . GLN A  1  608 ? 52.582  30.371  17.184  1.00 32.41  ? 636  GLN A N   1 
ATOM   4596  C  CA  . GLN A  1  608 ? 52.544  28.931  17.373  1.00 32.66  ? 636  GLN A CA  1 
ATOM   4597  C  C   . GLN A  1  608 ? 51.533  28.618  18.470  1.00 33.02  ? 636  GLN A C   1 
ATOM   4598  O  O   . GLN A  1  608 ? 51.582  29.206  19.549  1.00 32.89  ? 636  GLN A O   1 
ATOM   4599  C  CB  . GLN A  1  608 ? 53.923  28.399  17.773  1.00 32.29  ? 636  GLN A CB  1 
ATOM   4600  C  CG  . GLN A  1  608 ? 54.998  28.583  16.710  1.00 32.52  ? 636  GLN A CG  1 
ATOM   4601  C  CD  . GLN A  1  608 ? 56.324  27.915  17.061  1.00 32.20  ? 636  GLN A CD  1 
ATOM   4602  O  OE1 . GLN A  1  608 ? 56.419  27.136  18.016  1.00 30.55  ? 636  GLN A OE1 1 
ATOM   4603  N  NE2 . GLN A  1  608 ? 57.355  28.219  16.280  1.00 30.58  ? 636  GLN A NE2 1 
ATOM   4604  N  N   . ARG A  1  609 ? 50.605  27.711  18.184  1.00 33.77  ? 637  ARG A N   1 
ATOM   4605  C  CA  . ARG A  1  609 ? 49.709  27.192  19.214  1.00 34.76  ? 637  ARG A CA  1 
ATOM   4606  C  C   . ARG A  1  609 ? 50.523  26.308  20.164  1.00 35.08  ? 637  ARG A C   1 
ATOM   4607  O  O   . ARG A  1  609 ? 51.218  25.381  19.734  1.00 35.29  ? 637  ARG A O   1 
ATOM   4608  C  CB  . ARG A  1  609 ? 48.440  26.547  18.580  1.00 35.05  ? 637  ARG A CB  1 
ATOM   4609  C  CG  . ARG A  1  609 ? 47.931  25.137  19.011  1.00 35.45  ? 637  ARG A CG  1 
ATOM   4610  C  CD  . ARG A  1  609 ? 47.654  25.008  20.463  1.00 37.23  ? 637  ARG A CD  1 
ATOM   4611  N  NE  . ARG A  1  609 ? 46.325  24.488  20.785  1.00 38.51  ? 637  ARG A NE  1 
ATOM   4612  C  CZ  . ARG A  1  609 ? 46.095  23.525  21.673  1.00 38.50  ? 637  ARG A CZ  1 
ATOM   4613  N  NH1 . ARG A  1  609 ? 44.847  23.145  21.941  1.00 38.19  ? 637  ARG A NH1 1 
ATOM   4614  N  NH2 . ARG A  1  609 ? 47.114  22.939  22.293  1.00 37.82  ? 637  ARG A NH2 1 
ATOM   4615  N  N   . LYS A  1  610 ? 50.490  26.668  21.445  1.00 35.55  ? 638  LYS A N   1 
ATOM   4616  C  CA  . LYS A  1  610 ? 51.220  25.943  22.493  1.00 35.86  ? 638  LYS A CA  1 
ATOM   4617  C  C   . LYS A  1  610 ? 50.263  25.584  23.616  1.00 36.19  ? 638  LYS A C   1 
ATOM   4618  O  O   . LYS A  1  610 ? 49.333  26.345  23.924  1.00 35.71  ? 638  LYS A O   1 
ATOM   4619  C  CB  . LYS A  1  610 ? 52.366  26.791  23.069  1.00 35.91  ? 638  LYS A CB  1 
ATOM   4620  C  CG  . LYS A  1  610 ? 53.374  27.334  22.052  1.00 35.84  ? 638  LYS A CG  1 
ATOM   4621  C  CD  . LYS A  1  610 ? 54.525  28.039  22.759  1.00 35.57  ? 638  LYS A CD  1 
ATOM   4622  C  CE  . LYS A  1  610 ? 55.717  28.169  21.830  1.00 35.12  ? 638  LYS A CE  1 
ATOM   4623  N  NZ  . LYS A  1  610 ? 56.716  29.164  22.301  1.00 34.89  ? 638  LYS A NZ  1 
ATOM   4624  N  N   . GLU A  1  611 ? 50.509  24.440  24.245  1.00 36.88  ? 639  GLU A N   1 
ATOM   4625  C  CA  . GLU A  1  611 ? 49.650  23.977  25.329  1.00 37.59  ? 639  GLU A CA  1 
ATOM   4626  C  C   . GLU A  1  611 ? 49.675  24.898  26.547  1.00 37.85  ? 639  GLU A C   1 
ATOM   4627  O  O   . GLU A  1  611 ? 48.666  25.016  27.238  1.00 38.16  ? 639  GLU A O   1 
ATOM   4628  C  CB  . GLU A  1  611 ? 49.973  22.534  25.724  1.00 37.71  ? 639  GLU A CB  1 
ATOM   4629  C  CG  . GLU A  1  611 ? 48.750  21.761  26.241  1.00 38.39  ? 639  GLU A CG  1 
ATOM   4630  C  CD  . GLU A  1  611 ? 47.694  21.548  25.159  1.00 38.85  ? 639  GLU A CD  1 
ATOM   4631  O  OE1 . GLU A  1  611 ? 48.034  20.944  24.115  1.00 37.07  ? 639  GLU A OE1 1 
ATOM   4632  O  OE2 . GLU A  1  611 ? 46.531  21.986  25.353  1.00 38.96  ? 639  GLU A OE2 1 
ATOM   4633  N  N   . GLU A  1  612 ? 50.803  25.572  26.779  1.00 38.25  ? 640  GLU A N   1 
ATOM   4634  C  CA  . GLU A  1  612 ? 50.954  26.510  27.902  1.00 39.02  ? 640  GLU A CA  1 
ATOM   4635  C  C   . GLU A  1  612 ? 50.521  27.936  27.535  1.00 39.02  ? 640  GLU A C   1 
ATOM   4636  O  O   . GLU A  1  612 ? 50.753  28.881  28.296  1.00 39.26  ? 640  GLU A O   1 
ATOM   4637  C  CB  . GLU A  1  612 ? 52.393  26.538  28.442  1.00 39.18  ? 640  GLU A CB  1 
ATOM   4638  C  CG  . GLU A  1  612 ? 53.258  25.344  28.086  1.00 41.80  ? 640  GLU A CG  1 
ATOM   4639  C  CD  . GLU A  1  612 ? 53.522  25.249  26.577  1.00 44.52  ? 640  GLU A CD  1 
ATOM   4640  O  OE1 . GLU A  1  612 ? 54.073  26.218  25.995  1.00 45.76  ? 640  GLU A OE1 1 
ATOM   4641  O  OE2 . GLU A  1  612 ? 53.157  24.208  25.977  1.00 44.58  ? 640  GLU A OE2 1 
ATOM   4642  N  N   . GLU A  1  613 ? 49.892  28.094  26.375  1.00 38.91  ? 641  GLU A N   1 
ATOM   4643  C  CA  . GLU A  1  613 ? 49.354  29.388  25.959  1.00 38.57  ? 641  GLU A CA  1 
ATOM   4644  C  C   . GLU A  1  613 ? 47.920  29.218  25.478  1.00 38.32  ? 641  GLU A C   1 
ATOM   4645  O  O   . GLU A  1  613 ? 47.630  29.455  24.298  1.00 38.31  ? 641  GLU A O   1 
ATOM   4646  C  CB  . GLU A  1  613 ? 50.220  30.018  24.860  1.00 38.69  ? 641  GLU A CB  1 
ATOM   4647  C  CG  . GLU A  1  613 ? 51.593  30.510  25.328  1.00 38.23  ? 641  GLU A CG  1 
ATOM   4648  C  CD  . GLU A  1  613 ? 52.441  31.093  24.196  1.00 38.54  ? 641  GLU A CD  1 
ATOM   4649  O  OE1 . GLU A  1  613 ? 52.012  31.071  23.019  1.00 38.14  ? 641  GLU A OE1 1 
ATOM   4650  O  OE2 . GLU A  1  613 ? 53.547  31.584  24.492  1.00 38.24  ? 641  GLU A OE2 1 
ATOM   4651  N  N   . PRO A  1  614 ? 47.016  28.814  26.390  1.00 37.95  ? 642  PRO A N   1 
ATOM   4652  C  CA  . PRO A  1  614 ? 45.669  28.462  25.960  1.00 37.80  ? 642  PRO A CA  1 
ATOM   4653  C  C   . PRO A  1  614 ? 44.730  29.674  25.906  1.00 37.97  ? 642  PRO A C   1 
ATOM   4654  O  O   . PRO A  1  614 ? 43.693  29.628  25.238  1.00 37.86  ? 642  PRO A O   1 
ATOM   4655  C  CB  . PRO A  1  614 ? 45.216  27.472  27.042  1.00 37.67  ? 642  PRO A CB  1 
ATOM   4656  C  CG  . PRO A  1  614 ? 45.963  27.889  28.296  1.00 36.97  ? 642  PRO A CG  1 
ATOM   4657  C  CD  . PRO A  1  614 ? 47.178  28.689  27.858  1.00 38.00  ? 642  PRO A CD  1 
ATOM   4658  N  N   . SER A  1  615 ? 45.092  30.744  26.613  1.00 38.18  ? 643  SER A N   1 
ATOM   4659  C  CA  . SER A  1  615 ? 44.259  31.944  26.704  1.00 38.21  ? 643  SER A CA  1 
ATOM   4660  C  C   . SER A  1  615 ? 45.080  33.226  26.599  1.00 37.62  ? 643  SER A C   1 
ATOM   4661  O  O   . SER A  1  615 ? 46.175  33.322  27.136  1.00 37.73  ? 643  SER A O   1 
ATOM   4662  C  CB  . SER A  1  615 ? 43.461  31.957  28.017  1.00 38.49  ? 643  SER A CB  1 
ATOM   4663  O  OG  . SER A  1  615 ? 42.688  30.780  28.165  1.00 39.73  ? 643  SER A OG  1 
ATOM   4664  N  N   . SER A  1  616 ? 44.525  34.219  25.922  1.00 36.85  ? 644  SER A N   1 
ATOM   4665  C  CA  . SER A  1  616 ? 45.162  35.513  25.839  1.00 35.95  ? 644  SER A CA  1 
ATOM   4666  C  C   . SER A  1  616 ? 44.843  36.360  27.064  1.00 35.48  ? 644  SER A C   1 
ATOM   4667  O  O   . SER A  1  616 ? 45.388  37.457  27.220  1.00 35.85  ? 644  SER A O   1 
ATOM   4668  C  CB  . SER A  1  616 ? 44.694  36.222  24.591  1.00 35.95  ? 644  SER A CB  1 
ATOM   4669  O  OG  . SER A  1  616 ? 43.290  36.145  24.507  1.00 35.88  ? 644  SER A OG  1 
ATOM   4670  N  N   . SER A  1  617 ? 43.965  35.855  27.931  1.00 34.52  ? 645  SER A N   1 
ATOM   4671  C  CA  . SER A  1  617 ? 43.607  36.557  29.157  1.00 33.65  ? 645  SER A CA  1 
ATOM   4672  C  C   . SER A  1  617 ? 43.469  35.608  30.340  1.00 33.26  ? 645  SER A C   1 
ATOM   4673  O  O   . SER A  1  617 ? 43.845  34.437  30.268  1.00 33.62  ? 645  SER A O   1 
ATOM   4674  C  CB  . SER A  1  617 ? 42.321  37.373  28.962  1.00 34.03  ? 645  SER A CB  1 
ATOM   4675  O  OG  . SER A  1  617 ? 42.128  38.290  30.029  1.00 33.18  ? 645  SER A OG  1 
ATOM   4676  N  N   . SER A  1  618 ? 42.932  36.128  31.433  1.00 32.64  ? 646  SER A N   1 
ATOM   4677  C  CA  . SER A  1  618 ? 42.798  35.386  32.673  1.00 32.04  ? 646  SER A CA  1 
ATOM   4678  C  C   . SER A  1  618 ? 41.810  36.084  33.586  1.00 31.91  ? 646  SER A C   1 
ATOM   4679  O  O   . SER A  1  618 ? 41.814  37.318  33.711  1.00 31.78  ? 646  SER A O   1 
ATOM   4680  C  CB  . SER A  1  618 ? 44.143  35.277  33.393  1.00 31.60  ? 646  SER A CB  1 
ATOM   4681  O  OG  . SER A  1  618 ? 43.966  34.898  34.745  1.00 31.07  ? 646  SER A OG  1 
ATOM   4682  N  N   . VAL A  1  619 ? 40.988  35.273  34.244  1.00 31.84  ? 647  VAL A N   1 
ATOM   4683  C  CA  . VAL A  1  619 ? 40.050  35.746  35.255  1.00 31.42  ? 647  VAL A CA  1 
ATOM   4684  C  C   . VAL A  1  619 ? 40.730  36.621  36.327  1.00 31.27  ? 647  VAL A C   1 
ATOM   4685  O  O   . VAL A  1  619 ? 40.091  37.487  36.907  1.00 31.49  ? 647  VAL A O   1 
ATOM   4686  C  CB  . VAL A  1  619 ? 39.296  34.559  35.898  1.00 31.19  ? 647  VAL A CB  1 
ATOM   4687  C  CG1 . VAL A  1  619 ? 40.240  33.729  36.767  1.00 31.24  ? 647  VAL A CG1 1 
ATOM   4688  C  CG2 . VAL A  1  619 ? 38.100  35.045  36.693  1.00 30.79  ? 647  VAL A CG2 1 
ATOM   4689  N  N   . PHE A  1  620 ? 42.021  36.413  36.571  1.00 31.05  ? 648  PHE A N   1 
ATOM   4690  C  CA  . PHE A  1  620 ? 42.729  37.189  37.592  1.00 31.06  ? 648  PHE A CA  1 
ATOM   4691  C  C   . PHE A  1  620 ? 43.280  38.531  37.108  1.00 31.27  ? 648  PHE A C   1 
ATOM   4692  O  O   . PHE A  1  620 ? 43.769  39.326  37.909  1.00 31.37  ? 648  PHE A O   1 
ATOM   4693  C  CB  . PHE A  1  620 ? 43.820  36.343  38.258  1.00 30.79  ? 648  PHE A CB  1 
ATOM   4694  C  CG  . PHE A  1  620 ? 43.336  34.988  38.700  1.00 31.25  ? 648  PHE A CG  1 
ATOM   4695  C  CD1 . PHE A  1  620 ? 43.748  33.837  38.034  1.00 30.43  ? 648  PHE A CD1 1 
ATOM   4696  C  CD2 . PHE A  1  620 ? 42.439  34.864  39.765  1.00 30.88  ? 648  PHE A CD2 1 
ATOM   4697  C  CE1 . PHE A  1  620 ? 43.286  32.590  38.423  1.00 29.19  ? 648  PHE A CE1 1 
ATOM   4698  C  CE2 . PHE A  1  620 ? 41.974  33.612  40.160  1.00 30.78  ? 648  PHE A CE2 1 
ATOM   4699  C  CZ  . PHE A  1  620 ? 42.394  32.476  39.479  1.00 29.90  ? 648  PHE A CZ  1 
ATOM   4700  N  N   . ASN A  1  621 ? 43.184  38.805  35.810  1.00 31.69  ? 649  ASN A N   1 
ATOM   4701  C  CA  . ASN A  1  621 ? 43.685  40.074  35.278  1.00 31.91  ? 649  ASN A CA  1 
ATOM   4702  C  C   . ASN A  1  621 ? 42.896  41.311  35.737  1.00 31.86  ? 649  ASN A C   1 
ATOM   4703  O  O   . ASN A  1  621 ? 43.483  42.362  35.921  1.00 31.92  ? 649  ASN A O   1 
ATOM   4704  C  CB  . ASN A  1  621 ? 43.819  40.027  33.744  1.00 32.02  ? 649  ASN A CB  1 
ATOM   4705  C  CG  . ASN A  1  621 ? 45.125  39.348  33.272  1.00 34.07  ? 649  ASN A CG  1 
ATOM   4706  O  OD1 . ASN A  1  621 ? 45.605  38.370  33.860  1.00 35.89  ? 649  ASN A OD1 1 
ATOM   4707  N  ND2 . ASN A  1  621 ? 45.694  39.871  32.202  1.00 34.96  ? 649  ASN A ND2 1 
ATOM   4708  N  N   . GLN A  1  622 ? 41.587  41.180  35.945  1.00 31.93  ? 650  GLN A N   1 
ATOM   4709  C  CA  . GLN A  1  622 ? 40.714  42.322  36.241  1.00 32.30  ? 650  GLN A CA  1 
ATOM   4710  C  C   . GLN A  1  622 ? 41.088  43.065  37.525  1.00 32.90  ? 650  GLN A C   1 
ATOM   4711  O  O   . GLN A  1  622 ? 41.147  44.304  37.548  1.00 33.13  ? 650  GLN A O   1 
ATOM   4712  C  CB  . GLN A  1  622 ? 39.259  41.851  36.299  1.00 32.78  ? 650  GLN A CB  1 
ATOM   4713  C  CG  . GLN A  1  622 ? 38.236  42.862  36.796  1.00 33.44  ? 650  GLN A CG  1 
ATOM   4714  C  CD  . GLN A  1  622 ? 37.996  44.011  35.826  1.00 35.14  ? 650  GLN A CD  1 
ATOM   4715  O  OE1 . GLN A  1  622 ? 36.996  44.024  35.095  1.00 35.62  ? 650  GLN A OE1 1 
ATOM   4716  N  NE2 . GLN A  1  622 ? 38.901  44.994  35.827  1.00 34.00  ? 650  GLN A NE2 1 
ATOM   4717  N  N   . ASN A  1  623 ? 41.357  42.303  38.585  1.00 33.18  ? 651  ASN A N   1 
ATOM   4718  C  CA  . ASN A  1  623 ? 41.764  42.867  39.877  1.00 33.15  ? 651  ASN A CA  1 
ATOM   4719  C  C   . ASN A  1  623 ? 43.269  43.078  40.082  1.00 33.38  ? 651  ASN A C   1 
ATOM   4720  O  O   . ASN A  1  623 ? 43.687  43.586  41.131  1.00 33.29  ? 651  ASN A O   1 
ATOM   4721  C  CB  . ASN A  1  623 ? 41.180  42.049  41.030  1.00 32.73  ? 651  ASN A CB  1 
ATOM   4722  C  CG  . ASN A  1  623 ? 39.686  42.188  41.130  1.00 32.58  ? 651  ASN A CG  1 
ATOM   4723  O  OD1 . ASN A  1  623 ? 39.090  43.125  40.580  1.00 32.22  ? 651  ASN A OD1 1 
ATOM   4724  N  ND2 . ASN A  1  623 ? 39.059  41.252  41.826  1.00 32.65  ? 651  ASN A ND2 1 
ATOM   4725  N  N   . ASP A  1  624 ? 44.079  42.693  39.094  1.00 33.30  ? 652  ASP A N   1 
ATOM   4726  C  CA  . ASP A  1  624 ? 45.509  43.030  39.107  1.00 33.26  ? 652  ASP A CA  1 
ATOM   4727  C  C   . ASP A  1  624 ? 46.093  43.157  37.677  1.00 33.38  ? 652  ASP A C   1 
ATOM   4728  O  O   . ASP A  1  624 ? 46.957  42.354  37.276  1.00 33.11  ? 652  ASP A O   1 
ATOM   4729  C  CB  . ASP A  1  624 ? 46.290  42.006  39.949  1.00 33.38  ? 652  ASP A CB  1 
ATOM   4730  C  CG  . ASP A  1  624 ? 47.647  42.535  40.430  1.00 33.45  ? 652  ASP A CG  1 
ATOM   4731  O  OD1 . ASP A  1  624 ? 48.064  43.632  39.994  1.00 33.16  ? 652  ASP A OD1 1 
ATOM   4732  O  OD2 . ASP A  1  624 ? 48.301  41.843  41.248  1.00 32.56  ? 652  ASP A OD2 1 
ATOM   4733  N  N   . PRO A  1  625 ? 45.608  44.153  36.896  1.00 33.17  ? 653  PRO A N   1 
ATOM   4734  C  CA  . PRO A  1  625 ? 46.171  44.352  35.573  1.00 33.25  ? 653  PRO A CA  1 
ATOM   4735  C  C   . PRO A  1  625 ? 47.608  44.841  35.624  1.00 33.67  ? 653  PRO A C   1 
ATOM   4736  O  O   . PRO A  1  625 ? 48.323  44.682  34.640  1.00 33.96  ? 653  PRO A O   1 
ATOM   4737  C  CB  . PRO A  1  625 ? 45.262  45.414  34.951  1.00 33.34  ? 653  PRO A CB  1 
ATOM   4738  C  CG  . PRO A  1  625 ? 44.649  46.120  36.084  1.00 33.13  ? 653  PRO A CG  1 
ATOM   4739  C  CD  . PRO A  1  625 ? 44.508  45.100  37.170  1.00 33.47  ? 653  PRO A CD  1 
ATOM   4740  N  N   . TRP A  1  626 ? 48.022  45.418  36.754  1.00 33.75  ? 654  TRP A N   1 
ATOM   4741  C  CA  . TRP A  1  626 ? 49.407  45.910  36.947  1.00 33.97  ? 654  TRP A CA  1 
ATOM   4742  C  C   . TRP A  1  626 ? 50.451  44.799  36.997  1.00 34.03  ? 654  TRP A C   1 
ATOM   4743  O  O   . TRP A  1  626 ? 51.616  45.011  36.638  1.00 33.76  ? 654  TRP A O   1 
ATOM   4744  C  CB  . TRP A  1  626 ? 49.512  46.786  38.202  1.00 33.59  ? 654  TRP A CB  1 
ATOM   4745  C  CG  . TRP A  1  626 ? 48.507  47.873  38.184  1.00 33.82  ? 654  TRP A CG  1 
ATOM   4746  C  CD1 . TRP A  1  626 ? 48.588  49.049  37.495  1.00 33.93  ? 654  TRP A CD1 1 
ATOM   4747  C  CD2 . TRP A  1  626 ? 47.232  47.875  38.841  1.00 33.87  ? 654  TRP A CD2 1 
ATOM   4748  N  NE1 . TRP A  1  626 ? 47.449  49.795  37.699  1.00 34.76  ? 654  TRP A NE1 1 
ATOM   4749  C  CE2 . TRP A  1  626 ? 46.602  49.100  38.522  1.00 33.57  ? 654  TRP A CE2 1 
ATOM   4750  C  CE3 . TRP A  1  626 ? 46.572  46.973  39.689  1.00 33.52  ? 654  TRP A CE3 1 
ATOM   4751  C  CZ2 . TRP A  1  626 ? 45.348  49.446  39.016  1.00 33.25  ? 654  TRP A CZ2 1 
ATOM   4752  C  CZ3 . TRP A  1  626 ? 45.325  47.315  40.181  1.00 33.98  ? 654  TRP A CZ3 1 
ATOM   4753  C  CH2 . TRP A  1  626 ? 44.725  48.544  39.845  1.00 33.98  ? 654  TRP A CH2 1 
ATOM   4754  N  N   . ALA A  1  627 ? 50.025  43.628  37.465  1.00 34.12  ? 655  ALA A N   1 
ATOM   4755  C  CA  . ALA A  1  627 ? 50.846  42.422  37.415  1.00 34.12  ? 655  ALA A CA  1 
ATOM   4756  C  C   . ALA A  1  627 ? 49.988  41.307  36.815  1.00 34.10  ? 655  ALA A C   1 
ATOM   4757  O  O   . ALA A  1  627 ? 49.351  40.534  37.543  1.00 34.44  ? 655  ALA A O   1 
ATOM   4758  C  CB  . ALA A  1  627 ? 51.365  42.049  38.807  1.00 33.77  ? 655  ALA A CB  1 
ATOM   4759  N  N   . PRO A  1  628 ? 49.975  41.218  35.478  1.00 33.68  ? 656  PRO A N   1 
ATOM   4760  C  CA  . PRO A  1  628 ? 49.034  40.356  34.786  1.00 33.52  ? 656  PRO A CA  1 
ATOM   4761  C  C   . PRO A  1  628 ? 49.350  38.889  35.003  1.00 33.38  ? 656  PRO A C   1 
ATOM   4762  O  O   . PRO A  1  628 ? 50.508  38.520  35.127  1.00 33.82  ? 656  PRO A O   1 
ATOM   4763  C  CB  . PRO A  1  628 ? 49.223  40.723  33.305  1.00 33.74  ? 656  PRO A CB  1 
ATOM   4764  C  CG  . PRO A  1  628 ? 50.195  41.845  33.255  1.00 33.34  ? 656  PRO A CG  1 
ATOM   4765  C  CD  . PRO A  1  628 ? 50.905  41.892  34.557  1.00 33.89  ? 656  PRO A CD  1 
ATOM   4766  N  N   . THR A  1  629 ? 48.316  38.062  35.042  1.00 33.32  ? 657  THR A N   1 
ATOM   4767  C  CA  . THR A  1  629 ? 48.464  36.630  35.234  1.00 32.78  ? 657  THR A CA  1 
ATOM   4768  C  C   . THR A  1  629 ? 48.752  35.986  33.884  1.00 32.80  ? 657  THR A C   1 
ATOM   4769  O  O   . THR A  1  629 ? 49.526  35.025  33.792  1.00 32.60  ? 657  THR A O   1 
ATOM   4770  C  CB  . THR A  1  629 ? 47.196  36.047  35.870  1.00 32.88  ? 657  THR A CB  1 
ATOM   4771  O  OG1 . THR A  1  629 ? 46.860  36.817  37.032  1.00 33.31  ? 657  THR A OG1 1 
ATOM   4772  C  CG2 . THR A  1  629 ? 47.388  34.593  36.262  1.00 32.43  ? 657  THR A CG2 1 
ATOM   4773  N  N   . VAL A  1  630 ? 48.113  36.519  32.845  1.00 32.97  ? 658  VAL A N   1 
ATOM   4774  C  CA  . VAL A  1  630 ? 48.494  36.246  31.453  1.00 33.30  ? 658  VAL A CA  1 
ATOM   4775  C  C   . VAL A  1  630 ? 48.756  37.576  30.724  1.00 33.22  ? 658  VAL A C   1 
ATOM   4776  O  O   . VAL A  1  630 ? 47.946  38.500  30.808  1.00 33.02  ? 658  VAL A O   1 
ATOM   4777  C  CB  . VAL A  1  630 ? 47.429  35.409  30.689  1.00 33.14  ? 658  VAL A CB  1 
ATOM   4778  C  CG1 . VAL A  1  630 ? 47.965  35.002  29.334  1.00 34.30  ? 658  VAL A CG1 1 
ATOM   4779  C  CG2 . VAL A  1  630 ? 47.085  34.160  31.448  1.00 33.46  ? 658  VAL A CG2 1 
ATOM   4780  N  N   . ASP A  1  631 ? 49.902  37.669  30.045  1.00 33.31  ? 659  ASP A N   1 
ATOM   4781  C  CA  . ASP A  1  631 ? 50.264  38.848  29.243  1.00 33.67  ? 659  ASP A CA  1 
ATOM   4782  C  C   . ASP A  1  631 ? 50.402  38.393  27.802  1.00 33.60  ? 659  ASP A C   1 
ATOM   4783  O  O   . ASP A  1  631 ? 51.358  37.695  27.455  1.00 33.95  ? 659  ASP A O   1 
ATOM   4784  C  CB  . ASP A  1  631 ? 51.581  39.472  29.736  1.00 33.67  ? 659  ASP A CB  1 
ATOM   4785  C  CG  . ASP A  1  631 ? 51.935  40.802  29.034  1.00 34.37  ? 659  ASP A CG  1 
ATOM   4786  O  OD1 . ASP A  1  631 ? 51.521  41.052  27.877  1.00 33.92  ? 659  ASP A OD1 1 
ATOM   4787  O  OD2 . ASP A  1  631 ? 52.668  41.605  29.656  1.00 36.16  ? 659  ASP A OD2 1 
ATOM   4788  N  N   . PHE A  1  632 ? 49.450  38.798  26.966  1.00 33.63  ? 660  PHE A N   1 
ATOM   4789  C  CA  . PHE A  1  632 ? 49.342  38.287  25.595  1.00 33.53  ? 660  PHE A CA  1 
ATOM   4790  C  C   . PHE A  1  632 ? 50.571  38.569  24.749  1.00 33.63  ? 660  PHE A C   1 
ATOM   4791  O  O   . PHE A  1  632 ? 51.006  37.696  24.002  1.00 33.65  ? 660  PHE A O   1 
ATOM   4792  C  CB  . PHE A  1  632 ? 48.076  38.813  24.895  1.00 33.15  ? 660  PHE A CB  1 
ATOM   4793  C  CG  . PHE A  1  632 ? 47.988  38.432  23.432  1.00 33.41  ? 660  PHE A CG  1 
ATOM   4794  C  CD1 . PHE A  1  632 ? 47.588  37.150  23.050  1.00 32.60  ? 660  PHE A CD1 1 
ATOM   4795  C  CD2 . PHE A  1  632 ? 48.314  39.351  22.436  1.00 32.35  ? 660  PHE A CD2 1 
ATOM   4796  C  CE1 . PHE A  1  632 ? 47.503  36.802  21.705  1.00 31.13  ? 660  PHE A CE1 1 
ATOM   4797  C  CE2 . PHE A  1  632 ? 48.237  38.998  21.093  1.00 31.66  ? 660  PHE A CE2 1 
ATOM   4798  C  CZ  . PHE A  1  632 ? 47.826  37.722  20.733  1.00 31.26  ? 660  PHE A CZ  1 
ATOM   4799  N  N   . SER A  1  633 ? 51.127  39.775  24.870  1.00 34.02  ? 661  SER A N   1 
ATOM   4800  C  CA  . SER A  1  633 ? 52.287  40.166  24.055  1.00 34.92  ? 661  SER A CA  1 
ATOM   4801  C  C   . SER A  1  633 ? 53.477  39.227  24.244  1.00 35.35  ? 661  SER A C   1 
ATOM   4802  O  O   . SER A  1  633 ? 54.364  39.166  23.387  1.00 35.66  ? 661  SER A O   1 
ATOM   4803  C  CB  . SER A  1  633 ? 52.705  41.615  24.301  1.00 34.50  ? 661  SER A CB  1 
ATOM   4804  O  OG  . SER A  1  633 ? 53.013  41.820  25.663  1.00 35.53  ? 661  SER A OG  1 
ATOM   4805  N  N   . ASP A  1  634 ? 53.494  38.497  25.359  1.00 35.77  ? 662  ASP A N   1 
ATOM   4806  C  CA  . ASP A  1  634 ? 54.515  37.475  25.577  1.00 36.35  ? 662  ASP A CA  1 
ATOM   4807  C  C   . ASP A  1  634 ? 54.455  36.338  24.557  1.00 36.21  ? 662  ASP A C   1 
ATOM   4808  O  O   . ASP A  1  634 ? 55.478  35.749  24.247  1.00 36.37  ? 662  ASP A O   1 
ATOM   4809  C  CB  . ASP A  1  634 ? 54.446  36.913  26.999  1.00 36.42  ? 662  ASP A CB  1 
ATOM   4810  C  CG  . ASP A  1  634 ? 54.877  37.926  28.052  1.00 38.43  ? 662  ASP A CG  1 
ATOM   4811  O  OD1 . ASP A  1  634 ? 54.909  37.564  29.260  1.00 39.87  ? 662  ASP A OD1 1 
ATOM   4812  O  OD2 . ASP A  1  634 ? 55.176  39.087  27.674  1.00 39.61  ? 662  ASP A OD2 1 
ATOM   4813  N  N   . PHE A  1  635 ? 53.267  36.027  24.040  1.00 36.34  ? 663  PHE A N   1 
ATOM   4814  C  CA  . PHE A  1  635 ? 53.135  34.948  23.050  1.00 36.29  ? 663  PHE A CA  1 
ATOM   4815  C  C   . PHE A  1  635 ? 53.861  35.285  21.757  1.00 36.37  ? 663  PHE A C   1 
ATOM   4816  O  O   . PHE A  1  635 ? 54.164  34.396  20.968  1.00 36.69  ? 663  PHE A O   1 
ATOM   4817  C  CB  . PHE A  1  635 ? 51.667  34.649  22.705  1.00 36.06  ? 663  PHE A CB  1 
ATOM   4818  C  CG  . PHE A  1  635 ? 50.807  34.291  23.878  1.00 35.35  ? 663  PHE A CG  1 
ATOM   4819  C  CD1 . PHE A  1  635 ? 51.332  34.188  25.163  1.00 35.64  ? 663  PHE A CD1 1 
ATOM   4820  C  CD2 . PHE A  1  635 ? 49.462  34.023  23.686  1.00 34.52  ? 663  PHE A CD2 1 
ATOM   4821  C  CE1 . PHE A  1  635 ? 50.521  33.849  26.238  1.00 35.32  ? 663  PHE A CE1 1 
ATOM   4822  C  CE2 . PHE A  1  635 ? 48.651  33.683  24.756  1.00 35.77  ? 663  PHE A CE2 1 
ATOM   4823  C  CZ  . PHE A  1  635 ? 49.186  33.598  26.039  1.00 34.72  ? 663  PHE A CZ  1 
ATOM   4824  N  N   . ILE A  1  636 ? 54.107  36.573  21.526  1.00 36.55  ? 664  ILE A N   1 
ATOM   4825  C  CA  . ILE A  1  636 ? 54.809  37.016  20.328  1.00 36.43  ? 664  ILE A CA  1 
ATOM   4826  C  C   . ILE A  1  636 ? 56.288  37.211  20.630  1.00 37.28  ? 664  ILE A C   1 
ATOM   4827  O  O   . ILE A  1  636 ? 56.678  38.147  21.329  1.00 37.38  ? 664  ILE A O   1 
ATOM   4828  C  CB  . ILE A  1  636 ? 54.194  38.303  19.727  1.00 36.16  ? 664  ILE A CB  1 
ATOM   4829  C  CG1 . ILE A  1  636 ? 52.672  38.160  19.595  1.00 34.91  ? 664  ILE A CG1 1 
ATOM   4830  C  CG2 . ILE A  1  636 ? 54.824  38.614  18.375  1.00 34.78  ? 664  ILE A CG2 1 
ATOM   4831  C  CD1 . ILE A  1  636 ? 51.934  39.462  19.405  1.00 32.52  ? 664  ILE A CD1 1 
ATOM   4832  N  N   . ASN A  1  637 ? 57.096  36.292  20.112  1.00 38.27  ? 665  ASN A N   1 
ATOM   4833  C  CA  . ASN A  1  637 ? 58.554  36.391  20.140  1.00 39.13  ? 665  ASN A CA  1 
ATOM   4834  C  C   . ASN A  1  637 ? 59.143  36.096  18.763  1.00 39.70  ? 665  ASN A C   1 
ATOM   4835  O  O   . ASN A  1  637 ? 58.450  36.203  17.752  1.00 40.06  ? 665  ASN A O   1 
ATOM   4836  C  CB  . ASN A  1  637 ? 59.172  35.499  21.228  1.00 39.24  ? 665  ASN A CB  1 
ATOM   4837  C  CG  . ASN A  1  637 ? 58.393  34.207  21.474  1.00 39.62  ? 665  ASN A CG  1 
ATOM   4838  O  OD1 . ASN A  1  637 ? 57.434  33.869  20.778  1.00 39.42  ? 665  ASN A OD1 1 
ATOM   4839  N  ND2 . ASN A  1  637 ? 58.817  33.479  22.485  1.00 40.74  ? 665  ASN A ND2 1 
ATOM   4840  N  N   . ASN A  1  638 ? 60.419  35.740  18.703  1.00 40.31  ? 666  ASN A N   1 
ATOM   4841  C  CA  . ASN A  1  638 ? 61.075  35.543  17.404  1.00 40.68  ? 666  ASN A CA  1 
ATOM   4842  C  C   . ASN A  1  638 ? 60.861  34.156  16.774  1.00 40.28  ? 666  ASN A C   1 
ATOM   4843  O  O   . ASN A  1  638 ? 61.728  33.665  16.056  1.00 41.00  ? 666  ASN A O   1 
ATOM   4844  C  CB  . ASN A  1  638 ? 62.582  35.836  17.520  1.00 41.26  ? 666  ASN A CB  1 
ATOM   4845  C  CG  . ASN A  1  638 ? 62.920  37.307  17.283  1.00 43.09  ? 666  ASN A CG  1 
ATOM   4846  O  OD1 . ASN A  1  638 ? 64.086  37.655  17.029  1.00 44.63  ? 666  ASN A OD1 1 
ATOM   4847  N  ND2 . ASN A  1  638 ? 61.906  38.176  17.361  1.00 43.35  ? 666  ASN A ND2 1 
ATOM   4848  N  N   . GLU A  1  639 ? 59.723  33.521  17.024  1.00 39.26  ? 667  GLU A N   1 
ATOM   4849  C  CA  . GLU A  1  639 ? 59.566  32.129  16.611  1.00 38.19  ? 667  GLU A CA  1 
ATOM   4850  C  C   . GLU A  1  639 ? 59.087  32.025  15.169  1.00 37.45  ? 667  GLU A C   1 
ATOM   4851  O  O   . GLU A  1  639 ? 58.502  32.968  14.630  1.00 37.58  ? 667  GLU A O   1 
ATOM   4852  C  CB  . GLU A  1  639 ? 58.607  31.386  17.541  1.00 38.43  ? 667  GLU A CB  1 
ATOM   4853  C  CG  . GLU A  1  639 ? 58.983  31.456  19.018  1.00 38.64  ? 667  GLU A CG  1 
ATOM   4854  C  CD  . GLU A  1  639 ? 58.193  30.483  19.870  1.00 38.85  ? 667  GLU A CD  1 
ATOM   4855  O  OE1 . GLU A  1  639 ? 56.938  30.432  19.766  1.00 37.66  ? 667  GLU A OE1 1 
ATOM   4856  O  OE2 . GLU A  1  639 ? 58.840  29.763  20.646  1.00 38.50  ? 667  GLU A OE2 1 
ATOM   4857  N  N   . THR A  1  640 ? 59.339  30.875  14.549  1.00 36.21  ? 668  THR A N   1 
ATOM   4858  C  CA  . THR A  1  640 ? 58.839  30.610  13.201  1.00 34.75  ? 668  THR A CA  1 
ATOM   4859  C  C   . THR A  1  640 ? 57.323  30.352  13.162  1.00 34.25  ? 668  THR A C   1 
ATOM   4860  O  O   . THR A  1  640 ? 56.735  29.817  14.104  1.00 33.98  ? 668  THR A O   1 
ATOM   4861  C  CB  . THR A  1  640 ? 59.632  29.474  12.482  1.00 34.58  ? 668  THR A CB  1 
ATOM   4862  O  OG1 . THR A  1  640 ? 59.159  29.330  11.136  1.00 34.37  ? 668  THR A OG1 1 
ATOM   4863  C  CG2 . THR A  1  640 ? 59.518  28.144  13.210  1.00 33.61  ? 668  THR A CG2 1 
ATOM   4864  N  N   . ILE A  1  641 ? 56.708  30.764  12.062  1.00 33.66  ? 669  ILE A N   1 
ATOM   4865  C  CA  . ILE A  1  641 ? 55.327  30.437  11.757  1.00 33.16  ? 669  ILE A CA  1 
ATOM   4866  C  C   . ILE A  1  641 ? 55.283  29.818  10.354  1.00 33.11  ? 669  ILE A C   1 
ATOM   4867  O  O   . ILE A  1  641 ? 54.284  29.917  9.631   1.00 33.16  ? 669  ILE A O   1 
ATOM   4868  C  CB  . ILE A  1  641 ? 54.380  31.676  11.896  1.00 33.09  ? 669  ILE A CB  1 
ATOM   4869  C  CG1 . ILE A  1  641 ? 54.882  32.855  11.057  1.00 32.00  ? 669  ILE A CG1 1 
ATOM   4870  C  CG2 . ILE A  1  641 ? 54.237  32.080  13.371  1.00 32.24  ? 669  ILE A CG2 1 
ATOM   4871  C  CD1 . ILE A  1  641 ? 53.854  33.920  10.815  1.00 31.19  ? 669  ILE A CD1 1 
ATOM   4872  N  N   . ALA A  1  642 ? 56.379  29.165  9.984   1.00 32.87  ? 670  ALA A N   1 
ATOM   4873  C  CA  . ALA A  1  642 ? 56.478  28.506  8.685   1.00 32.99  ? 670  ALA A CA  1 
ATOM   4874  C  C   . ALA A  1  642 ? 56.394  27.008  8.868   1.00 32.83  ? 670  ALA A C   1 
ATOM   4875  O  O   . ALA A  1  642 ? 57.404  26.355  9.094   1.00 33.19  ? 670  ALA A O   1 
ATOM   4876  C  CB  . ALA A  1  642 ? 57.783  28.883  7.977   1.00 32.27  ? 670  ALA A CB  1 
ATOM   4877  N  N   . GLY A  1  643 ? 55.186  26.469  8.774   1.00 32.83  ? 671  GLY A N   1 
ATOM   4878  C  CA  . GLY A  1  643 ? 54.991  25.031  8.850   1.00 32.57  ? 671  GLY A CA  1 
ATOM   4879  C  C   . GLY A  1  643 ? 54.956  24.563  10.279  1.00 32.56  ? 671  GLY A C   1 
ATOM   4880  O  O   . GLY A  1  643 ? 55.731  23.697  10.683  1.00 33.20  ? 671  GLY A O   1 
ATOM   4881  N  N   . LYS A  1  644 ? 54.051  25.152  11.041  1.00 32.39  ? 672  LYS A N   1 
ATOM   4882  C  CA  . LYS A  1  644 ? 53.867  24.828  12.450  1.00 32.56  ? 672  LYS A CA  1 
ATOM   4883  C  C   . LYS A  1  644 ? 52.375  24.832  12.739  1.00 31.96  ? 672  LYS A C   1 
ATOM   4884  O  O   . LYS A  1  644 ? 51.587  25.255  11.887  1.00 32.17  ? 672  LYS A O   1 
ATOM   4885  C  CB  . LYS A  1  644 ? 54.575  25.869  13.327  1.00 32.77  ? 672  LYS A CB  1 
ATOM   4886  C  CG  . LYS A  1  644 ? 56.090  25.730  13.354  1.00 33.90  ? 672  LYS A CG  1 
ATOM   4887  C  CD  . LYS A  1  644 ? 56.508  24.617  14.295  1.00 36.36  ? 672  LYS A CD  1 
ATOM   4888  C  CE  . LYS A  1  644 ? 57.996  24.347  14.191  1.00 37.71  ? 672  LYS A CE  1 
ATOM   4889  N  NZ  . LYS A  1  644 ? 58.485  23.895  15.516  1.00 39.13  ? 672  LYS A NZ  1 
ATOM   4890  N  N   . ASP A  1  645 ? 51.981  24.353  13.916  1.00 31.29  ? 673  ASP A N   1 
ATOM   4891  C  CA  . ASP A  1  645 ? 50.592  24.493  14.341  1.00 30.82  ? 673  ASP A CA  1 
ATOM   4892  C  C   . ASP A  1  645 ? 50.343  25.949  14.725  1.00 30.48  ? 673  ASP A C   1 
ATOM   4893  O  O   . ASP A  1  645 ? 50.876  26.438  15.723  1.00 30.94  ? 673  ASP A O   1 
ATOM   4894  C  CB  . ASP A  1  645 ? 50.262  23.556  15.497  1.00 30.56  ? 673  ASP A CB  1 
ATOM   4895  C  CG  . ASP A  1  645 ? 48.799  23.626  15.906  1.00 30.36  ? 673  ASP A CG  1 
ATOM   4896  O  OD1 . ASP A  1  645 ? 48.046  24.398  15.277  1.00 30.54  ? 673  ASP A OD1 1 
ATOM   4897  O  OD2 . ASP A  1  645 ? 48.401  22.908  16.863  1.00 30.26  ? 673  ASP A OD2 1 
ATOM   4898  N  N   . LEU A  1  646 ? 49.549  26.638  13.914  1.00 29.82  ? 674  LEU A N   1 
ATOM   4899  C  CA  . LEU A  1  646 ? 49.338  28.075  14.090  1.00 29.14  ? 674  LEU A CA  1 
ATOM   4900  C  C   . LEU A  1  646 ? 47.999  28.389  14.711  1.00 29.43  ? 674  LEU A C   1 
ATOM   4901  O  O   . LEU A  1  646 ? 47.019  27.667  14.487  1.00 29.39  ? 674  LEU A O   1 
ATOM   4902  C  CB  . LEU A  1  646 ? 49.421  28.804  12.756  1.00 28.34  ? 674  LEU A CB  1 
ATOM   4903  C  CG  . LEU A  1  646 ? 50.708  28.696  11.955  1.00 26.96  ? 674  LEU A CG  1 
ATOM   4904  C  CD1 . LEU A  1  646 ? 50.652  29.723  10.864  1.00 26.27  ? 674  LEU A CD1 1 
ATOM   4905  C  CD2 . LEU A  1  646 ? 51.929  28.902  12.818  1.00 25.24  ? 674  LEU A CD2 1 
ATOM   4906  N  N   . VAL A  1  647 ? 47.969  29.469  15.491  1.00 29.55  ? 675  VAL A N   1 
ATOM   4907  C  CA  . VAL A  1  647 ? 46.719  30.052  15.969  1.00 29.85  ? 675  VAL A CA  1 
ATOM   4908  C  C   . VAL A  1  647 ? 46.726  31.558  15.670  1.00 30.12  ? 675  VAL A C   1 
ATOM   4909  O  O   . VAL A  1  647 ? 47.728  32.250  15.887  1.00 29.76  ? 675  VAL A O   1 
ATOM   4910  C  CB  . VAL A  1  647 ? 46.463  29.757  17.503  1.00 30.03  ? 675  VAL A CB  1 
ATOM   4911  C  CG1 . VAL A  1  647 ? 47.690  30.082  18.361  1.00 30.37  ? 675  VAL A CG1 1 
ATOM   4912  C  CG2 . VAL A  1  647 ? 45.281  30.531  18.021  1.00 29.00  ? 675  VAL A CG2 1 
ATOM   4913  N  N   . ALA A  1  648 ? 45.601  32.048  15.164  1.00 30.41  ? 676  ALA A N   1 
ATOM   4914  C  CA  . ALA A  1  648 ? 45.424  33.469  14.898  1.00 30.70  ? 676  ALA A CA  1 
ATOM   4915  C  C   . ALA A  1  648 ? 44.635  34.100  16.026  1.00 30.69  ? 676  ALA A C   1 
ATOM   4916  O  O   . ALA A  1  648 ? 43.675  33.524  16.509  1.00 31.06  ? 676  ALA A O   1 
ATOM   4917  C  CB  . ALA A  1  648 ? 44.707  33.677  13.570  1.00 30.51  ? 676  ALA A CB  1 
ATOM   4918  N  N   . TRP A  1  649 ? 45.037  35.289  16.447  1.00 30.71  ? 677  TRP A N   1 
ATOM   4919  C  CA  . TRP A  1  649 ? 44.320  35.977  17.503  1.00 30.46  ? 677  TRP A CA  1 
ATOM   4920  C  C   . TRP A  1  649 ? 43.780  37.269  16.906  1.00 30.76  ? 677  TRP A C   1 
ATOM   4921  O  O   . TRP A  1  649 ? 44.544  38.092  16.393  1.00 30.75  ? 677  TRP A O   1 
ATOM   4922  C  CB  . TRP A  1  649 ? 45.231  36.258  18.707  1.00 30.28  ? 677  TRP A CB  1 
ATOM   4923  C  CG  . TRP A  1  649 ? 45.992  35.061  19.251  1.00 30.14  ? 677  TRP A CG  1 
ATOM   4924  C  CD1 . TRP A  1  649 ? 47.183  34.567  18.785  1.00 30.38  ? 677  TRP A CD1 1 
ATOM   4925  C  CD2 . TRP A  1  649 ? 45.632  34.232  20.368  1.00 30.07  ? 677  TRP A CD2 1 
ATOM   4926  N  NE1 . TRP A  1  649 ? 47.582  33.485  19.535  1.00 29.98  ? 677  TRP A NE1 1 
ATOM   4927  C  CE2 . TRP A  1  649 ? 46.652  33.260  20.515  1.00 30.24  ? 677  TRP A CE2 1 
ATOM   4928  C  CE3 . TRP A  1  649 ? 44.558  34.224  21.269  1.00 29.42  ? 677  TRP A CE3 1 
ATOM   4929  C  CZ2 . TRP A  1  649 ? 46.618  32.283  21.514  1.00 30.66  ? 677  TRP A CZ2 1 
ATOM   4930  C  CZ3 . TRP A  1  649 ? 44.528  33.262  22.261  1.00 29.67  ? 677  TRP A CZ3 1 
ATOM   4931  C  CH2 . TRP A  1  649 ? 45.548  32.299  22.375  1.00 30.68  ? 677  TRP A CH2 1 
ATOM   4932  N  N   . VAL A  1  650 ? 42.458  37.429  16.965  1.00 30.83  ? 678  VAL A N   1 
ATOM   4933  C  CA  . VAL A  1  650 ? 41.770  38.553  16.334  1.00 31.06  ? 678  VAL A CA  1 
ATOM   4934  C  C   . VAL A  1  650 ? 41.077  39.465  17.358  1.00 31.45  ? 678  VAL A C   1 
ATOM   4935  O  O   . VAL A  1  650 ? 40.301  38.990  18.195  1.00 31.68  ? 678  VAL A O   1 
ATOM   4936  C  CB  . VAL A  1  650 ? 40.716  38.051  15.326  1.00 31.11  ? 678  VAL A CB  1 
ATOM   4937  C  CG1 . VAL A  1  650 ? 40.009  39.228  14.633  1.00 30.72  ? 678  VAL A CG1 1 
ATOM   4938  C  CG2 . VAL A  1  650 ? 41.354  37.109  14.319  1.00 30.73  ? 678  VAL A CG2 1 
ATOM   4939  N  N   . THR A  1  651 ? 41.357  40.766  17.265  1.00 31.59  ? 679  THR A N   1 
ATOM   4940  C  CA  . THR A  1  651 ? 40.713  41.789  18.086  1.00 31.99  ? 679  THR A CA  1 
ATOM   4941  C  C   . THR A  1  651 ? 39.672  42.583  17.286  1.00 31.80  ? 679  THR A C   1 
ATOM   4942  O  O   . THR A  1  651 ? 39.933  42.977  16.161  1.00 32.93  ? 679  THR A O   1 
ATOM   4943  C  CB  . THR A  1  651 ? 41.751  42.786  18.643  1.00 31.88  ? 679  THR A CB  1 
ATOM   4944  O  OG1 . THR A  1  651 ? 42.802  42.065  19.292  1.00 32.48  ? 679  THR A OG1 1 
ATOM   4945  C  CG2 . THR A  1  651 ? 41.107  43.738  19.654  1.00 32.00  ? 679  THR A CG2 1 
ATOM   4946  N  N   . ALA A  1  652 ? 38.507  42.829  17.868  1.00 31.39  ? 680  ALA A N   1 
ATOM   4947  C  CA  . ALA A  1  652 ? 37.472  43.641  17.215  1.00 30.86  ? 680  ALA A CA  1 
ATOM   4948  C  C   . ALA A  1  652 ? 36.791  44.593  18.210  1.00 30.45  ? 680  ALA A C   1 
ATOM   4949  O  O   . ALA A  1  652 ? 36.539  44.227  19.346  1.00 30.44  ? 680  ALA A O   1 
ATOM   4950  C  CB  . ALA A  1  652 ? 36.441  42.748  16.527  1.00 30.32  ? 680  ALA A CB  1 
ATOM   4951  N  N   . GLY A  1  653 ? 36.501  45.813  17.778  1.00 30.49  ? 681  GLY A N   1 
ATOM   4952  C  CA  . GLY A  1  653 ? 35.845  46.793  18.643  1.00 30.71  ? 681  GLY A CA  1 
ATOM   4953  C  C   . GLY A  1  653 ? 35.576  48.138  17.994  1.00 30.62  ? 681  GLY A C   1 
ATOM   4954  O  O   . GLY A  1  653 ? 35.781  48.314  16.799  1.00 30.97  ? 681  GLY A O   1 
ATOM   4955  N  N   . PHE A  1  654 ? 35.119  49.095  18.794  1.00 30.59  ? 682  PHE A N   1 
ATOM   4956  C  CA  . PHE A  1  654 ? 34.714  50.410  18.286  1.00 30.07  ? 682  PHE A CA  1 
ATOM   4957  C  C   . PHE A  1  654 ? 34.661  51.413  19.433  1.00 29.66  ? 682  PHE A C   1 
ATOM   4958  O  O   . PHE A  1  654 ? 34.628  51.032  20.599  1.00 29.52  ? 682  PHE A O   1 
ATOM   4959  C  CB  . PHE A  1  654 ? 33.346  50.332  17.593  1.00 30.00  ? 682  PHE A CB  1 
ATOM   4960  C  CG  . PHE A  1  654 ? 32.275  49.708  18.440  1.00 29.56  ? 682  PHE A CG  1 
ATOM   4961  C  CD1 . PHE A  1  654 ? 31.430  50.502  19.215  1.00 29.50  ? 682  PHE A CD1 1 
ATOM   4962  C  CD2 . PHE A  1  654 ? 32.109  48.319  18.468  1.00 30.37  ? 682  PHE A CD2 1 
ATOM   4963  C  CE1 . PHE A  1  654 ? 30.437  49.923  20.018  1.00 29.29  ? 682  PHE A CE1 1 
ATOM   4964  C  CE2 . PHE A  1  654 ? 31.112  47.723  19.270  1.00 29.82  ? 682  PHE A CE2 1 
ATOM   4965  C  CZ  . PHE A  1  654 ? 30.278  48.538  20.044  1.00 29.91  ? 682  PHE A CZ  1 
ATOM   4966  N  N   . LEU A  1  655 ? 34.669  52.695  19.088  1.00 29.06  ? 683  LEU A N   1 
ATOM   4967  C  CA  . LEU A  1  655 ? 34.481  53.751  20.054  1.00 28.33  ? 683  LEU A CA  1 
ATOM   4968  C  C   . LEU A  1  655 ? 32.992  53.980  20.148  1.00 28.21  ? 683  LEU A C   1 
ATOM   4969  O  O   . LEU A  1  655 ? 32.290  53.968  19.140  1.00 27.74  ? 683  LEU A O   1 
ATOM   4970  C  CB  . LEU A  1  655 ? 35.153  55.025  19.574  1.00 28.28  ? 683  LEU A CB  1 
ATOM   4971  C  CG  . LEU A  1  655 ? 34.794  56.341  20.259  1.00 27.98  ? 683  LEU A CG  1 
ATOM   4972  C  CD1 . LEU A  1  655 ? 35.417  56.387  21.654  1.00 26.47  ? 683  LEU A CD1 1 
ATOM   4973  C  CD2 . LEU A  1  655 ? 35.277  57.500  19.396  1.00 26.29  ? 683  LEU A CD2 1 
ATOM   4974  N  N   . HIS A  1  656 ? 32.513  54.186  21.364  1.00 27.93  ? 684  HIS A N   1 
ATOM   4975  C  CA  . HIS A  1  656 ? 31.113  54.484  21.570  1.00 28.03  ? 684  HIS A CA  1 
ATOM   4976  C  C   . HIS A  1  656 ? 30.945  55.800  22.354  1.00 27.67  ? 684  HIS A C   1 
ATOM   4977  O  O   . HIS A  1  656 ? 31.249  55.870  23.549  1.00 27.46  ? 684  HIS A O   1 
ATOM   4978  C  CB  . HIS A  1  656 ? 30.422  53.278  22.231  1.00 27.91  ? 684  HIS A CB  1 
ATOM   4979  C  CG  . HIS A  1  656 ? 28.954  53.454  22.438  1.00 28.83  ? 684  HIS A CG  1 
ATOM   4980  N  ND1 . HIS A  1  656 ? 28.215  52.610  23.242  1.00 29.85  ? 684  HIS A ND1 1 
ATOM   4981  C  CD2 . HIS A  1  656 ? 28.092  54.395  21.984  1.00 28.23  ? 684  HIS A CD2 1 
ATOM   4982  C  CE1 . HIS A  1  656 ? 26.958  53.016  23.262  1.00 29.58  ? 684  HIS A CE1 1 
ATOM   4983  N  NE2 . HIS A  1  656 ? 26.857  54.095  22.505  1.00 29.76  ? 684  HIS A NE2 1 
ATOM   4984  N  N   . ILE A  1  657 ? 30.505  56.847  21.650  1.00 27.37  ? 685  ILE A N   1 
ATOM   4985  C  CA  . ILE A  1  657 ? 30.178  58.132  22.277  1.00 26.96  ? 685  ILE A CA  1 
ATOM   4986  C  C   . ILE A  1  657 ? 28.665  58.156  22.431  1.00 26.94  ? 685  ILE A C   1 
ATOM   4987  O  O   . ILE A  1  657 ? 27.941  58.387  21.464  1.00 27.44  ? 685  ILE A O   1 
ATOM   4988  C  CB  . ILE A  1  657 ? 30.637  59.335  21.432  1.00 26.74  ? 685  ILE A CB  1 
ATOM   4989  C  CG1 . ILE A  1  657 ? 32.048  59.095  20.887  1.00 26.88  ? 685  ILE A CG1 1 
ATOM   4990  C  CG2 . ILE A  1  657 ? 30.562  60.613  22.252  1.00 26.59  ? 685  ILE A CG2 1 
ATOM   4991  C  CD1 . ILE A  1  657 ? 32.590  60.200  20.025  1.00 26.60  ? 685  ILE A CD1 1 
ATOM   4992  N  N   . PRO A  1  658 ? 28.170  57.869  23.634  1.00 27.02  ? 686  PRO A N   1 
ATOM   4993  C  CA  . PRO A  1  658 ? 26.723  57.779  23.793  1.00 27.30  ? 686  PRO A CA  1 
ATOM   4994  C  C   . PRO A  1  658 ? 26.002  59.024  23.283  1.00 27.75  ? 686  PRO A C   1 
ATOM   4995  O  O   . PRO A  1  658 ? 26.549  60.133  23.294  1.00 27.46  ? 686  PRO A O   1 
ATOM   4996  C  CB  . PRO A  1  658 ? 26.543  57.640  25.304  1.00 27.38  ? 686  PRO A CB  1 
ATOM   4997  C  CG  . PRO A  1  658 ? 27.820  56.986  25.753  1.00 27.46  ? 686  PRO A CG  1 
ATOM   4998  C  CD  . PRO A  1  658 ? 28.883  57.613  24.898  1.00 26.97  ? 686  PRO A CD  1 
ATOM   4999  N  N   . HIS A  1  659 ? 24.781  58.810  22.813  1.00 28.28  ? 687  HIS A N   1 
ATOM   5000  C  CA  . HIS A  1  659 ? 23.956  59.860  22.242  1.00 28.67  ? 687  HIS A CA  1 
ATOM   5001  C  C   . HIS A  1  659 ? 22.523  59.536  22.625  1.00 28.81  ? 687  HIS A C   1 
ATOM   5002  O  O   . HIS A  1  659 ? 22.251  58.427  23.095  1.00 29.14  ? 687  HIS A O   1 
ATOM   5003  C  CB  . HIS A  1  659 ? 24.134  59.940  20.711  1.00 28.74  ? 687  HIS A CB  1 
ATOM   5004  C  CG  . HIS A  1  659 ? 24.281  58.609  20.035  1.00 29.05  ? 687  HIS A CG  1 
ATOM   5005  N  ND1 . HIS A  1  659 ? 23.271  58.036  19.290  1.00 29.33  ? 687  HIS A ND1 1 
ATOM   5006  C  CD2 . HIS A  1  659 ? 25.328  57.745  19.979  1.00 28.68  ? 687  HIS A CD2 1 
ATOM   5007  C  CE1 . HIS A  1  659 ? 23.684  56.869  18.819  1.00 30.42  ? 687  HIS A CE1 1 
ATOM   5008  N  NE2 . HIS A  1  659 ? 24.933  56.675  19.211  1.00 29.17  ? 687  HIS A NE2 1 
ATOM   5009  N  N   . ALA A  1  660 ? 21.622  60.504  22.458  1.00 28.59  ? 688  ALA A N   1 
ATOM   5010  C  CA  . ALA A  1  660 ? 20.210  60.332  22.814  1.00 28.41  ? 688  ALA A CA  1 
ATOM   5011  C  C   . ALA A  1  660 ? 19.615  58.992  22.351  1.00 28.34  ? 688  ALA A C   1 
ATOM   5012  O  O   . ALA A  1  660 ? 18.839  58.369  23.083  1.00 28.32  ? 688  ALA A O   1 
ATOM   5013  C  CB  . ALA A  1  660 ? 19.378  61.497  22.278  1.00 28.27  ? 688  ALA A CB  1 
ATOM   5014  N  N   . GLU A  1  661 ? 19.989  58.554  21.152  1.00 27.78  ? 689  GLU A N   1 
ATOM   5015  C  CA  . GLU A  1  661 ? 19.456  57.319  20.583  1.00 27.95  ? 689  GLU A CA  1 
ATOM   5016  C  C   . GLU A  1  661 ? 19.881  56.032  21.316  1.00 28.49  ? 689  GLU A C   1 
ATOM   5017  O  O   . GLU A  1  661 ? 19.396  54.951  20.970  1.00 28.62  ? 689  GLU A O   1 
ATOM   5018  C  CB  . GLU A  1  661 ? 19.792  57.216  19.090  1.00 27.32  ? 689  GLU A CB  1 
ATOM   5019  C  CG  . GLU A  1  661 ? 19.141  58.266  18.221  1.00 26.84  ? 689  GLU A CG  1 
ATOM   5020  C  CD  . GLU A  1  661 ? 19.912  59.578  18.154  1.00 27.81  ? 689  GLU A CD  1 
ATOM   5021  O  OE1 . GLU A  1  661 ? 20.980  59.691  18.776  1.00 28.84  ? 689  GLU A OE1 1 
ATOM   5022  O  OE2 . GLU A  1  661 ? 19.457  60.506  17.454  1.00 28.44  ? 689  GLU A OE2 1 
ATOM   5023  N  N   . ASP A  1  662 ? 20.770  56.147  22.311  1.00 28.95  ? 690  ASP A N   1 
ATOM   5024  C  CA  . ASP A  1  662 ? 21.149  55.021  23.176  1.00 29.67  ? 690  ASP A CA  1 
ATOM   5025  C  C   . ASP A  1  662 ? 20.182  54.882  24.362  1.00 29.88  ? 690  ASP A C   1 
ATOM   5026  O  O   . ASP A  1  662 ? 20.385  54.037  25.234  1.00 30.22  ? 690  ASP A O   1 
ATOM   5027  C  CB  . ASP A  1  662 ? 22.580  55.187  23.722  1.00 30.00  ? 690  ASP A CB  1 
ATOM   5028  C  CG  . ASP A  1  662 ? 23.678  54.904  22.673  1.00 32.04  ? 690  ASP A CG  1 
ATOM   5029  O  OD1 . ASP A  1  662 ? 23.546  53.940  21.880  1.00 34.97  ? 690  ASP A OD1 1 
ATOM   5030  O  OD2 . ASP A  1  662 ? 24.695  55.643  22.655  1.00 31.87  ? 690  ASP A OD2 1 
ATOM   5031  N  N   . ILE A  1  663 ? 19.154  55.731  24.414  1.00 29.77  ? 691  ILE A N   1 
ATOM   5032  C  CA  . ILE A  1  663 ? 18.175  55.722  25.500  1.00 29.44  ? 691  ILE A CA  1 
ATOM   5033  C  C   . ILE A  1  663 ? 16.843  55.192  24.955  1.00 29.84  ? 691  ILE A C   1 
ATOM   5034  O  O   . ILE A  1  663 ? 16.344  55.685  23.933  1.00 29.57  ? 691  ILE A O   1 
ATOM   5035  C  CB  . ILE A  1  663 ? 18.025  57.141  26.123  1.00 29.52  ? 691  ILE A CB  1 
ATOM   5036  C  CG1 . ILE A  1  663 ? 19.374  57.672  26.624  1.00 28.98  ? 691  ILE A CG1 1 
ATOM   5037  C  CG2 . ILE A  1  663 ? 16.991  57.175  27.244  1.00 29.80  ? 691  ILE A CG2 1 
ATOM   5038  C  CD1 . ILE A  1  663 ? 20.085  56.795  27.625  1.00 28.53  ? 691  ILE A CD1 1 
ATOM   5039  N  N   . PRO A  1  664 ? 16.268  54.164  25.602  1.00 30.32  ? 692  PRO A N   1 
ATOM   5040  C  CA  . PRO A  1  664 ? 16.719  53.418  26.783  1.00 30.84  ? 692  PRO A CA  1 
ATOM   5041  C  C   . PRO A  1  664 ? 17.909  52.482  26.568  1.00 31.30  ? 692  PRO A C   1 
ATOM   5042  O  O   . PRO A  1  664 ? 18.705  52.319  27.488  1.00 31.63  ? 692  PRO A O   1 
ATOM   5043  C  CB  . PRO A  1  664 ? 15.478  52.610  27.182  1.00 30.50  ? 692  PRO A CB  1 
ATOM   5044  C  CG  . PRO A  1  664 ? 14.727  52.441  25.917  1.00 30.71  ? 692  PRO A CG  1 
ATOM   5045  C  CD  . PRO A  1  664 ? 14.956  53.686  25.123  1.00 30.29  ? 692  PRO A CD  1 
ATOM   5046  N  N   . ASN A  1  665 ? 18.028  51.870  25.389  1.00 31.80  ? 693  ASN A N   1 
ATOM   5047  C  CA  . ASN A  1  665 ? 19.110  50.903  25.106  1.00 32.43  ? 693  ASN A CA  1 
ATOM   5048  C  C   . ASN A  1  665 ? 19.928  51.263  23.861  1.00 32.98  ? 693  ASN A C   1 
ATOM   5049  O  O   . ASN A  1  665 ? 19.413  51.926  22.954  1.00 33.18  ? 693  ASN A O   1 
ATOM   5050  C  CB  . ASN A  1  665 ? 18.534  49.495  24.901  1.00 32.26  ? 693  ASN A CB  1 
ATOM   5051  C  CG  . ASN A  1  665 ? 18.246  48.764  26.203  1.00 33.21  ? 693  ASN A CG  1 
ATOM   5052  O  OD1 . ASN A  1  665 ? 17.881  47.581  26.188  1.00 33.18  ? 693  ASN A OD1 1 
ATOM   5053  N  ND2 . ASN A  1  665 ? 18.414  49.451  27.335  1.00 32.95  ? 693  ASN A ND2 1 
ATOM   5054  N  N   . THR A  1  666 ? 21.188  50.819  23.819  1.00 33.27  ? 694  THR A N   1 
ATOM   5055  C  CA  . THR A  1  666 ? 22.018  50.916  22.619  1.00 33.79  ? 694  THR A CA  1 
ATOM   5056  C  C   . THR A  1  666 ? 21.534  49.851  21.645  1.00 34.24  ? 694  THR A C   1 
ATOM   5057  O  O   . THR A  1  666 ? 21.479  48.674  22.002  1.00 34.37  ? 694  THR A O   1 
ATOM   5058  C  CB  . THR A  1  666 ? 23.522  50.645  22.927  1.00 33.85  ? 694  THR A CB  1 
ATOM   5059  O  OG1 . THR A  1  666 ? 23.963  51.520  23.966  1.00 35.06  ? 694  THR A OG1 1 
ATOM   5060  C  CG2 . THR A  1  666 ? 24.401  50.880  21.711  1.00 32.22  ? 694  THR A CG2 1 
ATOM   5061  N  N   . VAL A  1  667 ? 21.182  50.257  20.425  1.00 34.48  ? 695  VAL A N   1 
ATOM   5062  C  CA  . VAL A  1  667 ? 20.706  49.299  19.428  1.00 34.61  ? 695  VAL A CA  1 
ATOM   5063  C  C   . VAL A  1  667 ? 21.890  48.655  18.723  1.00 34.91  ? 695  VAL A C   1 
ATOM   5064  O  O   . VAL A  1  667 ? 22.977  49.219  18.680  1.00 34.80  ? 695  VAL A O   1 
ATOM   5065  C  CB  . VAL A  1  667 ? 19.740  49.934  18.388  1.00 34.68  ? 695  VAL A CB  1 
ATOM   5066  C  CG1 . VAL A  1  667 ? 18.602  50.658  19.075  1.00 34.55  ? 695  VAL A CG1 1 
ATOM   5067  C  CG2 . VAL A  1  667 ? 20.488  50.882  17.450  1.00 34.60  ? 695  VAL A CG2 1 
ATOM   5068  N  N   . THR A  1  668 ? 21.655  47.477  18.153  1.00 35.53  ? 696  THR A N   1 
ATOM   5069  C  CA  . THR A  1  668 ? 22.698  46.664  17.541  1.00 35.32  ? 696  THR A CA  1 
ATOM   5070  C  C   . THR A  1  668 ? 22.994  47.056  16.093  1.00 36.13  ? 696  THR A C   1 
ATOM   5071  O  O   . THR A  1  668 ? 23.909  46.498  15.495  1.00 36.14  ? 696  THR A O   1 
ATOM   5072  C  CB  . THR A  1  668 ? 22.303  45.167  17.563  1.00 35.56  ? 696  THR A CB  1 
ATOM   5073  O  OG1 . THR A  1  668 ? 21.121  44.965  16.773  1.00 33.76  ? 696  THR A OG1 1 
ATOM   5074  C  CG2 . THR A  1  668 ? 22.041  44.678  18.995  1.00 34.35  ? 696  THR A CG2 1 
ATOM   5075  N  N   . VAL A  1  669 ? 22.233  48.000  15.531  1.00 36.71  ? 697  VAL A N   1 
ATOM   5076  C  CA  . VAL A  1  669 ? 22.369  48.365  14.106  1.00 37.53  ? 697  VAL A CA  1 
ATOM   5077  C  C   . VAL A  1  669 ? 23.785  48.845  13.773  1.00 38.42  ? 697  VAL A C   1 
ATOM   5078  O  O   . VAL A  1  669 ? 24.272  49.828  14.343  1.00 38.63  ? 697  VAL A O   1 
ATOM   5079  C  CB  . VAL A  1  669 ? 21.361  49.475  13.651  1.00 37.40  ? 697  VAL A CB  1 
ATOM   5080  C  CG1 . VAL A  1  669 ? 21.623  49.869  12.210  1.00 37.36  ? 697  VAL A CG1 1 
ATOM   5081  C  CG2 . VAL A  1  669 ? 19.905  49.034  13.807  1.00 36.81  ? 697  VAL A CG2 1 
ATOM   5082  N  N   . GLY A  1  670 ? 24.443  48.148  12.850  1.00 39.19  ? 698  GLY A N   1 
ATOM   5083  C  CA  . GLY A  1  670 ? 25.772  48.567  12.368  1.00 40.40  ? 698  GLY A CA  1 
ATOM   5084  C  C   . GLY A  1  670 ? 26.850  48.609  13.437  1.00 41.03  ? 698  GLY A C   1 
ATOM   5085  O  O   . GLY A  1  670 ? 27.970  49.070  13.184  1.00 41.05  ? 698  GLY A O   1 
ATOM   5086  N  N   . ASN A  1  671 ? 26.488  48.125  14.627  1.00 41.72  ? 699  ASN A N   1 
ATOM   5087  C  CA  . ASN A  1  671 ? 27.354  48.049  15.800  1.00 42.40  ? 699  ASN A CA  1 
ATOM   5088  C  C   . ASN A  1  671 ? 27.837  46.629  16.082  1.00 42.31  ? 699  ASN A C   1 
ATOM   5089  O  O   . ASN A  1  671 ? 28.109  46.275  17.242  1.00 43.32  ? 699  ASN A O   1 
ATOM   5090  C  CB  . ASN A  1  671 ? 26.593  48.556  17.017  1.00 42.80  ? 699  ASN A CB  1 
ATOM   5091  C  CG  . ASN A  1  671 ? 26.701  50.057  17.184  1.00 44.91  ? 699  ASN A CG  1 
ATOM   5092  O  OD1 . ASN A  1  671 ? 27.631  50.699  16.657  1.00 45.47  ? 699  ASN A OD1 1 
ATOM   5093  N  ND2 . ASN A  1  671 ? 25.764  50.631  17.942  1.00 46.00  ? 699  ASN A ND2 1 
ATOM   5094  N  N   . GLY A  1  672 ? 27.892  45.820  15.025  1.00 41.10  ? 700  GLY A N   1 
ATOM   5095  C  CA  . GLY A  1  672 ? 28.419  44.478  15.081  1.00 39.70  ? 700  GLY A CA  1 
ATOM   5096  C  C   . GLY A  1  672 ? 29.784  44.458  14.436  1.00 38.88  ? 700  GLY A C   1 
ATOM   5097  O  O   . GLY A  1  672 ? 29.974  44.995  13.349  1.00 39.50  ? 700  GLY A O   1 
ATOM   5098  N  N   . VAL A  1  673 ? 30.744  43.855  15.121  1.00 37.18  ? 701  VAL A N   1 
ATOM   5099  C  CA  . VAL A  1  673 ? 32.096  43.763  14.618  1.00 35.39  ? 701  VAL A CA  1 
ATOM   5100  C  C   . VAL A  1  673 ? 32.576  42.326  14.778  1.00 34.39  ? 701  VAL A C   1 
ATOM   5101  O  O   . VAL A  1  673 ? 32.002  41.547  15.532  1.00 34.10  ? 701  VAL A O   1 
ATOM   5102  C  CB  . VAL A  1  673 ? 33.054  44.728  15.370  1.00 35.31  ? 701  VAL A CB  1 
ATOM   5103  C  CG1 . VAL A  1  673 ? 32.791  46.174  14.983  1.00 34.95  ? 701  VAL A CG1 1 
ATOM   5104  C  CG2 . VAL A  1  673 ? 32.934  44.558  16.852  1.00 34.06  ? 701  VAL A CG2 1 
ATOM   5105  N  N   . GLY A  1  674 ? 33.629  41.979  14.058  1.00 33.59  ? 702  GLY A N   1 
ATOM   5106  C  CA  . GLY A  1  674 ? 34.200  40.643  14.149  1.00 32.72  ? 702  GLY A CA  1 
ATOM   5107  C  C   . GLY A  1  674 ? 35.015  40.306  12.930  1.00 31.99  ? 702  GLY A C   1 
ATOM   5108  O  O   . GLY A  1  674 ? 35.897  41.083  12.526  1.00 32.05  ? 702  GLY A O   1 
ATOM   5109  N  N   . PHE A  1  675 ? 34.710  39.153  12.333  1.00 30.96  ? 703  PHE A N   1 
ATOM   5110  C  CA  . PHE A  1  675 ? 35.508  38.653  11.229  1.00 29.82  ? 703  PHE A CA  1 
ATOM   5111  C  C   . PHE A  1  675 ? 34.916  37.463  10.496  1.00 29.88  ? 703  PHE A C   1 
ATOM   5112  O  O   . PHE A  1  675 ? 34.019  36.756  10.980  1.00 29.91  ? 703  PHE A O   1 
ATOM   5113  C  CB  . PHE A  1  675 ? 36.937  38.337  11.696  1.00 29.10  ? 703  PHE A CB  1 
ATOM   5114  C  CG  . PHE A  1  675 ? 37.009  37.326  12.794  1.00 28.17  ? 703  PHE A CG  1 
ATOM   5115  C  CD1 . PHE A  1  675 ? 37.189  35.978  12.505  1.00 27.19  ? 703  PHE A CD1 1 
ATOM   5116  C  CD2 . PHE A  1  675 ? 36.894  37.711  14.124  1.00 27.04  ? 703  PHE A CD2 1 
ATOM   5117  C  CE1 . PHE A  1  675 ? 37.256  35.042  13.527  1.00 27.36  ? 703  PHE A CE1 1 
ATOM   5118  C  CE2 . PHE A  1  675 ? 36.968  36.770  15.150  1.00 25.92  ? 703  PHE A CE2 1 
ATOM   5119  C  CZ  . PHE A  1  675 ? 37.147  35.441  14.853  1.00 25.83  ? 703  PHE A CZ  1 
ATOM   5120  N  N   . PHE A  1  676 ? 35.453  37.269  9.303   1.00 29.90  ? 704  PHE A N   1 
ATOM   5121  C  CA  . PHE A  1  676 ? 35.091  36.201  8.419   1.00 29.82  ? 704  PHE A CA  1 
ATOM   5122  C  C   . PHE A  1  676 ? 36.307  35.318  8.242   1.00 29.70  ? 704  PHE A C   1 
ATOM   5123  O  O   . PHE A  1  676 ? 37.436  35.826  8.148   1.00 29.81  ? 704  PHE A O   1 
ATOM   5124  C  CB  . PHE A  1  676 ? 34.717  36.782  7.061   1.00 30.04  ? 704  PHE A CB  1 
ATOM   5125  C  CG  . PHE A  1  676 ? 33.274  37.157  6.933   1.00 30.36  ? 704  PHE A CG  1 
ATOM   5126  C  CD1 . PHE A  1  676 ? 32.860  38.467  7.153   1.00 31.17  ? 704  PHE A CD1 1 
ATOM   5127  C  CD2 . PHE A  1  676 ? 32.327  36.204  6.572   1.00 30.73  ? 704  PHE A CD2 1 
ATOM   5128  C  CE1 . PHE A  1  676 ? 31.513  38.832  7.029   1.00 30.72  ? 704  PHE A CE1 1 
ATOM   5129  C  CE2 . PHE A  1  676 ? 30.980  36.550  6.448   1.00 31.66  ? 704  PHE A CE2 1 
ATOM   5130  C  CZ  . PHE A  1  676 ? 30.575  37.879  6.681   1.00 31.13  ? 704  PHE A CZ  1 
ATOM   5131  N  N   . LEU A  1  677 ? 36.068  34.007  8.225   1.00 29.37  ? 705  LEU A N   1 
ATOM   5132  C  CA  . LEU A  1  677 ? 37.034  33.008  7.750   1.00 29.55  ? 705  LEU A CA  1 
ATOM   5133  C  C   . LEU A  1  677 ? 36.496  32.430  6.439   1.00 29.69  ? 705  LEU A C   1 
ATOM   5134  O  O   . LEU A  1  677 ? 35.458  31.764  6.436   1.00 30.15  ? 705  LEU A O   1 
ATOM   5135  C  CB  . LEU A  1  677 ? 37.238  31.896  8.797   1.00 29.07  ? 705  LEU A CB  1 
ATOM   5136  C  CG  . LEU A  1  677 ? 37.506  32.297  10.262  1.00 29.37  ? 705  LEU A CG  1 
ATOM   5137  C  CD1 . LEU A  1  677 ? 37.572  31.073  11.170  1.00 28.07  ? 705  LEU A CD1 1 
ATOM   5138  C  CD2 . LEU A  1  677 ? 38.770  33.159  10.399  1.00 27.61  ? 705  LEU A CD2 1 
ATOM   5139  N  N   . ARG A  1  678 ? 37.180  32.704  5.328   1.00 29.91  ? 706  ARG A N   1 
ATOM   5140  C  CA  . ARG A  1  678 ? 36.659  32.374  3.985   1.00 30.21  ? 706  ARG A CA  1 
ATOM   5141  C  C   . ARG A  1  678 ? 37.661  31.550  3.228   1.00 29.64  ? 706  ARG A C   1 
ATOM   5142  O  O   . ARG A  1  678 ? 38.846  31.860  3.272   1.00 29.99  ? 706  ARG A O   1 
ATOM   5143  C  CB  . ARG A  1  678 ? 36.335  33.625  3.152   1.00 30.51  ? 706  ARG A CB  1 
ATOM   5144  C  CG  . ARG A  1  678 ? 35.924  34.827  3.956   1.00 32.76  ? 706  ARG A CG  1 
ATOM   5145  C  CD  . ARG A  1  678 ? 34.895  35.649  3.251   1.00 36.64  ? 706  ARG A CD  1 
ATOM   5146  N  NE  . ARG A  1  678 ? 35.463  36.367  2.121   1.00 40.28  ? 706  ARG A NE  1 
ATOM   5147  C  CZ  . ARG A  1  678 ? 35.085  36.182  0.858   1.00 42.99  ? 706  ARG A CZ  1 
ATOM   5148  N  NH1 . ARG A  1  678 ? 34.114  35.296  0.558   1.00 43.36  ? 706  ARG A NH1 1 
ATOM   5149  N  NH2 . ARG A  1  678 ? 35.674  36.895  -0.102  1.00 42.51  ? 706  ARG A NH2 1 
ATOM   5150  N  N   . PRO A  1  679 ? 37.185  30.505  2.520   1.00 29.35  ? 707  PRO A N   1 
ATOM   5151  C  CA  . PRO A  1  679 ? 38.045  29.576  1.807   1.00 28.75  ? 707  PRO A CA  1 
ATOM   5152  C  C   . PRO A  1  679 ? 38.714  30.291  0.655   1.00 28.67  ? 707  PRO A C   1 
ATOM   5153  O  O   . PRO A  1  679 ? 38.082  31.083  -0.036  1.00 28.45  ? 707  PRO A O   1 
ATOM   5154  C  CB  . PRO A  1  679 ? 37.068  28.535  1.269   1.00 28.28  ? 707  PRO A CB  1 
ATOM   5155  C  CG  . PRO A  1  679 ? 35.794  29.269  1.104   1.00 28.73  ? 707  PRO A CG  1 
ATOM   5156  C  CD  . PRO A  1  679 ? 35.759  30.165  2.327   1.00 29.69  ? 707  PRO A CD  1 
ATOM   5157  N  N   . TYR A  1  680 ? 39.997  30.017  0.468   1.00 28.61  ? 708  TYR A N   1 
ATOM   5158  C  CA  . TYR A  1  680 ? 40.780  30.697  -0.534  1.00 28.37  ? 708  TYR A CA  1 
ATOM   5159  C  C   . TYR A  1  680 ? 41.734  29.669  -1.121  1.00 28.47  ? 708  TYR A C   1 
ATOM   5160  O  O   . TYR A  1  680 ? 42.773  29.354  -0.534  1.00 28.10  ? 708  TYR A O   1 
ATOM   5161  C  CB  . TYR A  1  680 ? 41.508  31.901  0.072   1.00 27.83  ? 708  TYR A CB  1 
ATOM   5162  C  CG  . TYR A  1  680 ? 42.310  32.667  -0.939  1.00 28.00  ? 708  TYR A CG  1 
ATOM   5163  C  CD1 . TYR A  1  680 ? 43.695  32.635  -0.923  1.00 28.13  ? 708  TYR A CD1 1 
ATOM   5164  C  CD2 . TYR A  1  680 ? 41.686  33.412  -1.926  1.00 27.49  ? 708  TYR A CD2 1 
ATOM   5165  C  CE1 . TYR A  1  680 ? 44.441  33.333  -1.865  1.00 28.67  ? 708  TYR A CE1 1 
ATOM   5166  C  CE2 . TYR A  1  680 ? 42.422  34.123  -2.862  1.00 28.30  ? 708  TYR A CE2 1 
ATOM   5167  C  CZ  . TYR A  1  680 ? 43.800  34.082  -2.832  1.00 28.34  ? 708  TYR A CZ  1 
ATOM   5168  O  OH  . TYR A  1  680 ? 44.533  34.775  -3.785  1.00 28.25  ? 708  TYR A OH  1 
ATOM   5169  N  N   . ASN A  1  681 ? 41.332  29.133  -2.271  1.00 28.76  ? 709  ASN A N   1 
ATOM   5170  C  CA  . ASN A  1  681 ? 42.019  28.027  -2.941  1.00 29.32  ? 709  ASN A CA  1 
ATOM   5171  C  C   . ASN A  1  681 ? 42.015  26.748  -2.104  1.00 29.69  ? 709  ASN A C   1 
ATOM   5172  O  O   . ASN A  1  681 ? 42.812  25.833  -2.335  1.00 30.22  ? 709  ASN A O   1 
ATOM   5173  C  CB  . ASN A  1  681 ? 43.437  28.437  -3.366  1.00 29.08  ? 709  ASN A CB  1 
ATOM   5174  C  CG  . ASN A  1  681 ? 43.429  29.612  -4.322  1.00 29.03  ? 709  ASN A CG  1 
ATOM   5175  O  OD1 . ASN A  1  681 ? 42.610  29.665  -5.245  1.00 28.57  ? 709  ASN A OD1 1 
ATOM   5176  N  ND2 . ASN A  1  681 ? 44.333  30.570  -4.103  1.00 28.27  ? 709  ASN A ND2 1 
ATOM   5177  N  N   . PHE A  1  682 ? 41.097  26.692  -1.142  1.00 30.03  ? 710  PHE A N   1 
ATOM   5178  C  CA  . PHE A  1  682 ? 40.919  25.528  -0.281  1.00 29.95  ? 710  PHE A CA  1 
ATOM   5179  C  C   . PHE A  1  682 ? 40.264  24.402  -1.074  1.00 30.23  ? 710  PHE A C   1 
ATOM   5180  O  O   . PHE A  1  682 ? 40.779  23.283  -1.117  1.00 30.16  ? 710  PHE A O   1 
ATOM   5181  C  CB  . PHE A  1  682 ? 40.081  25.896  0.953   1.00 29.97  ? 710  PHE A CB  1 
ATOM   5182  C  CG  . PHE A  1  682 ? 39.965  24.791  1.960   1.00 29.92  ? 710  PHE A CG  1 
ATOM   5183  C  CD1 . PHE A  1  682 ? 38.848  23.959  1.971   1.00 29.54  ? 710  PHE A CD1 1 
ATOM   5184  C  CD2 . PHE A  1  682 ? 40.980  24.576  2.903   1.00 30.46  ? 710  PHE A CD2 1 
ATOM   5185  C  CE1 . PHE A  1  682 ? 38.739  22.920  2.905   1.00 30.01  ? 710  PHE A CE1 1 
ATOM   5186  C  CE2 . PHE A  1  682 ? 40.890  23.540  3.841   1.00 29.51  ? 710  PHE A CE2 1 
ATOM   5187  C  CZ  . PHE A  1  682 ? 39.764  22.707  3.841   1.00 29.69  ? 710  PHE A CZ  1 
ATOM   5188  N  N   . PHE A  1  683 ? 39.137  24.713  -1.714  1.00 30.52  ? 711  PHE A N   1 
ATOM   5189  C  CA  . PHE A  1  683 ? 38.422  23.739  -2.543  1.00 30.67  ? 711  PHE A CA  1 
ATOM   5190  C  C   . PHE A  1  683 ? 38.920  23.783  -3.999  1.00 31.21  ? 711  PHE A C   1 
ATOM   5191  O  O   . PHE A  1  683 ? 39.781  24.581  -4.342  1.00 31.37  ? 711  PHE A O   1 
ATOM   5192  C  CB  . PHE A  1  683 ? 36.919  24.005  -2.487  1.00 29.81  ? 711  PHE A CB  1 
ATOM   5193  C  CG  . PHE A  1  683 ? 36.363  24.076  -1.090  1.00 30.11  ? 711  PHE A CG  1 
ATOM   5194  C  CD1 . PHE A  1  683 ? 36.247  25.320  -0.424  1.00 28.98  ? 711  PHE A CD1 1 
ATOM   5195  C  CD2 . PHE A  1  683 ? 35.934  22.920  -0.437  1.00 29.26  ? 711  PHE A CD2 1 
ATOM   5196  C  CE1 . PHE A  1  683 ? 35.726  25.404  0.871   1.00 28.15  ? 711  PHE A CE1 1 
ATOM   5197  C  CE2 . PHE A  1  683 ? 35.409  22.990  0.878   1.00 30.21  ? 711  PHE A CE2 1 
ATOM   5198  C  CZ  . PHE A  1  683 ? 35.301  24.240  1.528   1.00 29.27  ? 711  PHE A CZ  1 
ATOM   5199  N  N   . ASP A  1  684 ? 38.387  22.919  -4.853  1.00 31.80  ? 712  ASP A N   1 
ATOM   5200  C  CA  . ASP A  1  684 ? 38.695  22.991  -6.275  1.00 32.45  ? 712  ASP A CA  1 
ATOM   5201  C  C   . ASP A  1  684 ? 37.663  23.844  -7.000  1.00 33.23  ? 712  ASP A C   1 
ATOM   5202  O  O   . ASP A  1  684 ? 37.905  24.338  -8.114  1.00 32.87  ? 712  ASP A O   1 
ATOM   5203  C  CB  . ASP A  1  684 ? 38.813  21.591  -6.860  1.00 32.04  ? 712  ASP A CB  1 
ATOM   5204  C  CG  . ASP A  1  684 ? 39.893  20.790  -6.172  1.00 32.49  ? 712  ASP A CG  1 
ATOM   5205  O  OD1 . ASP A  1  684 ? 39.783  19.551  -6.102  1.00 32.69  ? 712  ASP A OD1 1 
ATOM   5206  O  OD2 . ASP A  1  684 ? 40.855  21.417  -5.669  1.00 33.17  ? 712  ASP A OD2 1 
ATOM   5207  N  N   . GLU A  1  685 ? 36.522  24.023  -6.337  1.00 34.07  ? 713  GLU A N   1 
ATOM   5208  C  CA  . GLU A  1  685 ? 35.453  24.903  -6.801  1.00 35.43  ? 713  GLU A CA  1 
ATOM   5209  C  C   . GLU A  1  685 ? 34.545  25.241  -5.625  1.00 35.31  ? 713  GLU A C   1 
ATOM   5210  O  O   . GLU A  1  685 ? 34.625  24.602  -4.577  1.00 35.85  ? 713  GLU A O   1 
ATOM   5211  C  CB  . GLU A  1  685 ? 34.659  24.247  -7.937  1.00 35.17  ? 713  GLU A CB  1 
ATOM   5212  C  CG  . GLU A  1  685 ? 33.987  22.930  -7.575  1.00 35.96  ? 713  GLU A CG  1 
ATOM   5213  C  CD  . GLU A  1  685 ? 33.301  22.269  -8.767  1.00 37.90  ? 713  GLU A CD  1 
ATOM   5214  O  OE1 . GLU A  1  685 ? 33.583  22.658  -9.930  1.00 39.79  ? 713  GLU A OE1 1 
ATOM   5215  O  OE2 . GLU A  1  685 ? 32.476  21.341  -8.542  1.00 42.63  ? 713  GLU A OE2 1 
ATOM   5216  N  N   . ASP A  1  686 ? 33.679  26.234  -5.803  1.00 35.35  ? 714  ASP A N   1 
ATOM   5217  C  CA  . ASP A  1  686 ? 32.713  26.617  -4.776  1.00 35.24  ? 714  ASP A CA  1 
ATOM   5218  C  C   . ASP A  1  686 ? 31.773  25.466  -4.395  1.00 35.18  ? 714  ASP A C   1 
ATOM   5219  O  O   . ASP A  1  686 ? 31.010  24.977  -5.231  1.00 34.88  ? 714  ASP A O   1 
ATOM   5220  C  CB  . ASP A  1  686 ? 31.906  27.816  -5.259  1.00 35.30  ? 714  ASP A CB  1 
ATOM   5221  C  CG  . ASP A  1  686 ? 30.662  28.049  -4.448  1.00 35.78  ? 714  ASP A CG  1 
ATOM   5222  O  OD1 . ASP A  1  686 ? 29.631  28.361  -5.077  1.00 37.60  ? 714  ASP A OD1 1 
ATOM   5223  O  OD2 . ASP A  1  686 ? 30.708  27.926  -3.203  1.00 35.76  ? 714  ASP A OD2 1 
ATOM   5224  N  N   . PRO A  1  687 ? 31.827  25.033  -3.123  1.00 35.27  ? 715  PRO A N   1 
ATOM   5225  C  CA  . PRO A  1  687 ? 30.994  23.925  -2.644  1.00 35.31  ? 715  PRO A CA  1 
ATOM   5226  C  C   . PRO A  1  687 ? 29.507  24.120  -2.925  1.00 35.90  ? 715  PRO A C   1 
ATOM   5227  O  O   . PRO A  1  687 ? 28.797  23.129  -3.116  1.00 36.08  ? 715  PRO A O   1 
ATOM   5228  C  CB  . PRO A  1  687 ? 31.240  23.924  -1.139  1.00 35.22  ? 715  PRO A CB  1 
ATOM   5229  C  CG  . PRO A  1  687 ? 32.559  24.561  -0.962  1.00 34.76  ? 715  PRO A CG  1 
ATOM   5230  C  CD  . PRO A  1  687 ? 32.712  25.558  -2.064  1.00 35.03  ? 715  PRO A CD  1 
ATOM   5231  N  N   . SER A  1  688 ? 29.045  25.374  -2.979  1.00 36.00  ? 716  SER A N   1 
ATOM   5232  C  CA  . SER A  1  688 ? 27.614  25.662  -3.144  1.00 35.92  ? 716  SER A CA  1 
ATOM   5233  C  C   . SER A  1  688 ? 27.092  25.251  -4.519  1.00 36.33  ? 716  SER A C   1 
ATOM   5234  O  O   . SER A  1  688 ? 25.873  25.249  -4.741  1.00 36.33  ? 716  SER A O   1 
ATOM   5235  C  CB  . SER A  1  688 ? 27.293  27.142  -2.861  1.00 35.95  ? 716  SER A CB  1 
ATOM   5236  O  OG  . SER A  1  688 ? 27.256  27.929  -4.045  1.00 34.35  ? 716  SER A OG  1 
ATOM   5237  N  N   . PHE A  1  689 ? 28.002  24.904  -5.436  1.00 36.42  ? 717  PHE A N   1 
ATOM   5238  C  CA  . PHE A  1  689 ? 27.607  24.349  -6.733  1.00 36.67  ? 717  PHE A CA  1 
ATOM   5239  C  C   . PHE A  1  689 ? 26.825  23.048  -6.559  1.00 37.41  ? 717  PHE A C   1 
ATOM   5240  O  O   . PHE A  1  689 ? 25.909  22.757  -7.324  1.00 37.54  ? 717  PHE A O   1 
ATOM   5241  C  CB  . PHE A  1  689 ? 28.832  24.104  -7.626  1.00 36.48  ? 717  PHE A CB  1 
ATOM   5242  C  CG  . PHE A  1  689 ? 28.516  23.353  -8.897  1.00 35.05  ? 717  PHE A CG  1 
ATOM   5243  C  CD1 . PHE A  1  689 ? 27.746  23.948  -9.902  1.00 33.37  ? 717  PHE A CD1 1 
ATOM   5244  C  CD2 . PHE A  1  689 ? 28.966  22.050  -9.075  1.00 34.03  ? 717  PHE A CD2 1 
ATOM   5245  C  CE1 . PHE A  1  689 ? 27.432  23.266  -11.066 1.00 33.47  ? 717  PHE A CE1 1 
ATOM   5246  C  CE2 . PHE A  1  689 ? 28.658  21.338  -10.245 1.00 34.88  ? 717  PHE A CE2 1 
ATOM   5247  C  CZ  . PHE A  1  689 ? 27.894  21.953  -11.248 1.00 35.58  ? 717  PHE A CZ  1 
ATOM   5248  N  N   . TYR A  1  690 ? 27.218  22.283  -5.543  1.00 38.29  ? 718  TYR A N   1 
ATOM   5249  C  CA  . TYR A  1  690 ? 26.651  20.980  -5.196  1.00 38.64  ? 718  TYR A CA  1 
ATOM   5250  C  C   . TYR A  1  690 ? 25.445  21.077  -4.251  1.00 38.37  ? 718  TYR A C   1 
ATOM   5251  O  O   . TYR A  1  690 ? 24.953  20.048  -3.752  1.00 38.36  ? 718  TYR A O   1 
ATOM   5252  C  CB  . TYR A  1  690 ? 27.741  20.144  -4.512  1.00 39.38  ? 718  TYR A CB  1 
ATOM   5253  C  CG  . TYR A  1  690 ? 28.852  19.725  -5.436  1.00 40.86  ? 718  TYR A CG  1 
ATOM   5254  C  CD1 . TYR A  1  690 ? 30.129  20.285  -5.338  1.00 41.00  ? 718  TYR A CD1 1 
ATOM   5255  C  CD2 . TYR A  1  690 ? 28.622  18.750  -6.428  1.00 43.35  ? 718  TYR A CD2 1 
ATOM   5256  C  CE1 . TYR A  1  690 ? 31.157  19.883  -6.214  1.00 41.77  ? 718  TYR A CE1 1 
ATOM   5257  C  CE2 . TYR A  1  690 ? 29.637  18.337  -7.309  1.00 42.25  ? 718  TYR A CE2 1 
ATOM   5258  C  CZ  . TYR A  1  690 ? 30.895  18.906  -7.197  1.00 42.30  ? 718  TYR A CZ  1 
ATOM   5259  O  OH  . TYR A  1  690 ? 31.869  18.476  -8.074  1.00 42.25  ? 718  TYR A OH  1 
ATOM   5260  N  N   . SER A  1  691 ? 24.982  22.296  -3.984  1.00 37.67  ? 719  SER A N   1 
ATOM   5261  C  CA  . SER A  1  691 ? 23.922  22.502  -2.998  1.00 37.28  ? 719  SER A CA  1 
ATOM   5262  C  C   . SER A  1  691 ? 22.599  21.916  -3.439  1.00 37.13  ? 719  SER A C   1 
ATOM   5263  O  O   . SER A  1  691 ? 22.216  22.024  -4.605  1.00 37.27  ? 719  SER A O   1 
ATOM   5264  C  CB  . SER A  1  691 ? 23.717  23.978  -2.707  1.00 37.26  ? 719  SER A CB  1 
ATOM   5265  O  OG  . SER A  1  691 ? 22.633  24.165  -1.812  1.00 37.36  ? 719  SER A OG  1 
ATOM   5266  N  N   . ALA A  1  692 ? 21.900  21.321  -2.480  1.00 36.87  ? 720  ALA A N   1 
ATOM   5267  C  CA  . ALA A  1  692 ? 20.590  20.726  -2.697  1.00 36.35  ? 720  ALA A CA  1 
ATOM   5268  C  C   . ALA A  1  692 ? 19.502  21.772  -2.989  1.00 36.20  ? 720  ALA A C   1 
ATOM   5269  O  O   . ALA A  1  692 ? 18.426  21.433  -3.485  1.00 36.44  ? 720  ALA A O   1 
ATOM   5270  C  CB  . ALA A  1  692 ? 20.214  19.895  -1.480  1.00 36.07  ? 720  ALA A CB  1 
ATOM   5271  N  N   . ASP A  1  693 ? 19.786  23.040  -2.699  1.00 35.83  ? 721  ASP A N   1 
ATOM   5272  C  CA  . ASP A  1  693 ? 18.762  24.095  -2.709  1.00 35.56  ? 721  ASP A CA  1 
ATOM   5273  C  C   . ASP A  1  693 ? 18.957  25.102  -3.828  1.00 35.17  ? 721  ASP A C   1 
ATOM   5274  O  O   . ASP A  1  693 ? 18.187  26.058  -3.970  1.00 35.04  ? 721  ASP A O   1 
ATOM   5275  C  CB  . ASP A  1  693 ? 18.745  24.815  -1.364  1.00 35.45  ? 721  ASP A CB  1 
ATOM   5276  C  CG  . ASP A  1  693 ? 18.439  23.885  -0.212  1.00 36.47  ? 721  ASP A CG  1 
ATOM   5277  O  OD1 . ASP A  1  693 ? 17.559  23.011  -0.375  1.00 38.35  ? 721  ASP A OD1 1 
ATOM   5278  O  OD2 . ASP A  1  693 ? 19.076  24.024  0.861   1.00 37.83  ? 721  ASP A OD2 1 
ATOM   5279  N  N   . SER A  1  694 ? 20.014  24.877  -4.597  1.00 35.09  ? 722  SER A N   1 
ATOM   5280  C  CA  . SER A  1  694 ? 20.355  25.659  -5.781  1.00 34.85  ? 722  SER A CA  1 
ATOM   5281  C  C   . SER A  1  694 ? 19.296  25.497  -6.875  1.00 34.81  ? 722  SER A C   1 
ATOM   5282  O  O   . SER A  1  694 ? 18.647  24.453  -6.985  1.00 34.59  ? 722  SER A O   1 
ATOM   5283  C  CB  . SER A  1  694 ? 21.745  25.231  -6.278  1.00 34.72  ? 722  SER A CB  1 
ATOM   5284  O  OG  . SER A  1  694 ? 21.828  25.176  -7.686  1.00 35.25  ? 722  SER A OG  1 
ATOM   5285  N  N   . ILE A  1  695 ? 19.128  26.547  -7.672  1.00 34.96  ? 723  ILE A N   1 
ATOM   5286  C  CA  . ILE A  1  695 ? 18.101  26.599  -8.696  1.00 34.81  ? 723  ILE A CA  1 
ATOM   5287  C  C   . ILE A  1  695 ? 18.701  26.940  -10.056 1.00 35.54  ? 723  ILE A C   1 
ATOM   5288  O  O   . ILE A  1  695 ? 19.701  27.683  -10.146 1.00 35.48  ? 723  ILE A O   1 
ATOM   5289  C  CB  . ILE A  1  695 ? 16.949  27.533  -8.262  1.00 34.82  ? 723  ILE A CB  1 
ATOM   5290  C  CG1 . ILE A  1  695 ? 16.008  26.747  -7.344  1.00 34.61  ? 723  ILE A CG1 1 
ATOM   5291  C  CG2 . ILE A  1  695 ? 16.161  28.082  -9.452  1.00 33.68  ? 723  ILE A CG2 1 
ATOM   5292  C  CD1 . ILE A  1  695 ? 15.325  27.566  -6.332  1.00 35.55  ? 723  ILE A CD1 1 
ATOM   5293  N  N   . TYR A  1  696 ? 18.093  26.367  -11.102 1.00 35.92  ? 724  TYR A N   1 
ATOM   5294  C  CA  . TYR A  1  696 ? 18.528  26.542  -12.473 1.00 36.34  ? 724  TYR A CA  1 
ATOM   5295  C  C   . TYR A  1  696 ? 17.393  26.314  -13.477 1.00 37.34  ? 724  TYR A C   1 
ATOM   5296  O  O   . TYR A  1  696 ? 16.578  25.409  -13.303 1.00 37.61  ? 724  TYR A O   1 
ATOM   5297  C  CB  . TYR A  1  696 ? 19.698  25.601  -12.783 1.00 35.77  ? 724  TYR A CB  1 
ATOM   5298  C  CG  . TYR A  1  696 ? 20.139  25.731  -14.217 1.00 35.53  ? 724  TYR A CG  1 
ATOM   5299  C  CD1 . TYR A  1  696 ? 20.918  26.814  -14.621 1.00 35.24  ? 724  TYR A CD1 1 
ATOM   5300  C  CD2 . TYR A  1  696 ? 19.732  24.818  -15.178 1.00 33.73  ? 724  TYR A CD2 1 
ATOM   5301  C  CE1 . TYR A  1  696 ? 21.295  26.965  -15.923 1.00 34.55  ? 724  TYR A CE1 1 
ATOM   5302  C  CE2 . TYR A  1  696 ? 20.109  24.967  -16.492 1.00 34.00  ? 724  TYR A CE2 1 
ATOM   5303  C  CZ  . TYR A  1  696 ? 20.891  26.041  -16.853 1.00 34.16  ? 724  TYR A CZ  1 
ATOM   5304  O  OH  . TYR A  1  696 ? 21.279  26.212  -18.150 1.00 34.39  ? 724  TYR A OH  1 
ATOM   5305  N  N   . PHE A  1  697 ? 17.354  27.129  -14.531 1.00 38.78  ? 725  PHE A N   1 
ATOM   5306  C  CA  . PHE A  1  697 ? 16.410  26.956  -15.643 1.00 40.45  ? 725  PHE A CA  1 
ATOM   5307  C  C   . PHE A  1  697 ? 16.842  27.753  -16.870 1.00 42.44  ? 725  PHE A C   1 
ATOM   5308  O  O   . PHE A  1  697 ? 17.596  28.708  -16.754 1.00 42.94  ? 725  PHE A O   1 
ATOM   5309  C  CB  . PHE A  1  697 ? 14.970  27.323  -15.245 1.00 39.73  ? 725  PHE A CB  1 
ATOM   5310  C  CG  . PHE A  1  697 ? 14.831  28.674  -14.601 1.00 38.75  ? 725  PHE A CG  1 
ATOM   5311  C  CD1 . PHE A  1  697 ? 14.624  29.813  -15.374 1.00 38.36  ? 725  PHE A CD1 1 
ATOM   5312  C  CD2 . PHE A  1  697 ? 14.881  28.806  -13.217 1.00 36.67  ? 725  PHE A CD2 1 
ATOM   5313  C  CE1 . PHE A  1  697 ? 14.495  31.069  -14.774 1.00 37.58  ? 725  PHE A CE1 1 
ATOM   5314  C  CE2 . PHE A  1  697 ? 14.748  30.047  -12.612 1.00 35.94  ? 725  PHE A CE2 1 
ATOM   5315  C  CZ  . PHE A  1  697 ? 14.558  31.181  -13.386 1.00 37.16  ? 725  PHE A CZ  1 
ATOM   5316  N  N   . ARG A  1  698 ? 16.363  27.357  -18.044 1.00 44.89  ? 726  ARG A N   1 
ATOM   5317  C  CA  . ARG A  1  698 ? 16.655  28.084  -19.274 1.00 47.21  ? 726  ARG A CA  1 
ATOM   5318  C  C   . ARG A  1  698 ? 15.396  28.757  -19.791 1.00 48.71  ? 726  ARG A C   1 
ATOM   5319  O  O   . ARG A  1  698 ? 14.305  28.525  -19.275 1.00 48.70  ? 726  ARG A O   1 
ATOM   5320  C  CB  . ARG A  1  698 ? 17.207  27.146  -20.346 1.00 47.37  ? 726  ARG A CB  1 
ATOM   5321  C  CG  . ARG A  1  698 ? 18.141  26.097  -19.834 1.00 48.94  ? 726  ARG A CG  1 
ATOM   5322  C  CD  . ARG A  1  698 ? 18.563  25.127  -20.913 1.00 52.39  ? 726  ARG A CD  1 
ATOM   5323  N  NE  . ARG A  1  698 ? 19.674  24.318  -20.406 1.00 56.05  ? 726  ARG A NE  1 
ATOM   5324  C  CZ  . ARG A  1  698 ? 20.687  23.858  -21.149 1.00 58.02  ? 726  ARG A CZ  1 
ATOM   5325  N  NH1 . ARG A  1  698 ? 20.752  24.111  -22.469 1.00 58.76  ? 726  ARG A NH1 1 
ATOM   5326  N  NH2 . ARG A  1  698 ? 21.648  23.145  -20.560 1.00 58.30  ? 726  ARG A NH2 1 
ATOM   5327  N  N   . GLY A  1  699 ? 15.558  29.594  -20.811 1.00 50.92  ? 727  GLY A N   1 
ATOM   5328  C  CA  . GLY A  1  699 ? 14.436  30.257  -21.473 1.00 53.94  ? 727  GLY A CA  1 
ATOM   5329  C  C   . GLY A  1  699 ? 13.550  29.332  -22.300 1.00 56.11  ? 727  GLY A C   1 
ATOM   5330  O  O   . GLY A  1  699 ? 12.381  29.651  -22.545 1.00 56.14  ? 727  GLY A O   1 
ATOM   5331  N  N   . ASP A  1  700 ? 14.101  28.196  -22.743 1.00 58.29  ? 728  ASP A N   1 
ATOM   5332  C  CA  . ASP A  1  700 ? 13.304  27.172  -23.450 1.00 60.50  ? 728  ASP A CA  1 
ATOM   5333  C  C   . ASP A  1  700 ? 12.535  26.257  -22.480 1.00 61.91  ? 728  ASP A C   1 
ATOM   5334  O  O   . ASP A  1  700 ? 11.517  25.658  -22.854 1.00 62.03  ? 728  ASP A O   1 
ATOM   5335  C  CB  . ASP A  1  700 ? 14.140  26.364  -24.473 1.00 60.38  ? 728  ASP A CB  1 
ATOM   5336  C  CG  . ASP A  1  700 ? 15.507  25.916  -23.930 1.00 60.99  ? 728  ASP A CG  1 
ATOM   5337  O  OD1 . ASP A  1  700 ? 15.653  25.722  -22.704 1.00 61.53  ? 728  ASP A OD1 1 
ATOM   5338  O  OD2 . ASP A  1  700 ? 16.443  25.744  -24.742 1.00 60.49  ? 728  ASP A OD2 1 
ATOM   5339  N  N   . GLN A  1  701 ? 13.024  26.182  -21.239 1.00 63.67  ? 729  GLN A N   1 
ATOM   5340  C  CA  . GLN A  1  701 ? 12.417  25.385  -20.164 1.00 65.32  ? 729  GLN A CA  1 
ATOM   5341  C  C   . GLN A  1  701 ? 11.205  26.074  -19.516 1.00 66.36  ? 729  GLN A C   1 
ATOM   5342  O  O   . GLN A  1  701 ? 10.933  27.249  -19.765 1.00 66.31  ? 729  GLN A O   1 
ATOM   5343  C  CB  . GLN A  1  701 ? 13.462  25.068  -19.080 1.00 65.34  ? 729  GLN A CB  1 
ATOM   5344  C  CG  . GLN A  1  701 ? 14.233  23.751  -19.253 1.00 65.56  ? 729  GLN A CG  1 
ATOM   5345  C  CD  . GLN A  1  701 ? 15.220  23.489  -18.108 1.00 65.42  ? 729  GLN A CD  1 
ATOM   5346  O  OE1 . GLN A  1  701 ? 16.204  24.212  -17.939 1.00 65.20  ? 729  GLN A OE1 1 
ATOM   5347  N  NE2 . GLN A  1  701 ? 14.955  22.449  -17.324 1.00 65.38  ? 729  GLN A NE2 1 
ATOM   5348  N  N   . ASP A  1  702 ? 10.494  25.324  -18.676 1.00 67.86  ? 730  ASP A N   1 
ATOM   5349  C  CA  . ASP A  1  702 ? 9.318   25.822  -17.966 1.00 69.29  ? 730  ASP A CA  1 
ATOM   5350  C  C   . ASP A  1  702 ? 9.696   26.269  -16.549 1.00 70.29  ? 730  ASP A C   1 
ATOM   5351  O  O   . ASP A  1  702 ? 9.751   25.455  -15.617 1.00 70.33  ? 730  ASP A O   1 
ATOM   5352  C  CB  . ASP A  1  702 ? 8.222   24.739  -17.945 1.00 69.24  ? 730  ASP A CB  1 
ATOM   5353  C  CG  . ASP A  1  702 ? 6.846   25.274  -17.539 1.00 69.17  ? 730  ASP A CG  1 
ATOM   5354  O  OD1 . ASP A  1  702 ? 6.705   26.480  -17.236 1.00 68.68  ? 730  ASP A OD1 1 
ATOM   5355  O  OD2 . ASP A  1  702 ? 5.892   24.466  -17.522 1.00 69.13  ? 730  ASP A OD2 1 
ATOM   5356  N  N   . ALA A  1  703 ? 9.956   27.570  -16.405 1.00 71.70  ? 731  ALA A N   1 
ATOM   5357  C  CA  . ALA A  1  703 ? 10.341  28.179  -15.122 1.00 73.04  ? 731  ALA A CA  1 
ATOM   5358  C  C   . ALA A  1  703 ? 9.318   27.947  -13.997 1.00 74.00  ? 731  ALA A C   1 
ATOM   5359  O  O   . ALA A  1  703 ? 9.654   28.030  -12.813 1.00 73.98  ? 731  ALA A O   1 
ATOM   5360  C  CB  . ALA A  1  703 ? 10.613  29.676  -15.305 1.00 72.96  ? 731  ALA A CB  1 
ATOM   5361  N  N   . GLY A  1  704 ? 8.079   27.642  -14.378 1.00 75.19  ? 732  GLY A N   1 
ATOM   5362  C  CA  . GLY A  1  704 ? 7.003   27.388  -13.420 1.00 76.62  ? 732  GLY A CA  1 
ATOM   5363  C  C   . GLY A  1  704 ? 6.639   25.927  -13.200 1.00 77.60  ? 732  GLY A C   1 
ATOM   5364  O  O   . GLY A  1  704 ? 5.733   25.632  -12.424 1.00 77.62  ? 732  GLY A O   1 
ATOM   5365  N  N   . ALA A  1  705 ? 7.329   25.013  -13.880 1.00 78.64  ? 733  ALA A N   1 
ATOM   5366  C  CA  . ALA A  1  705 ? 7.104   23.582  -13.673 1.00 79.89  ? 733  ALA A CA  1 
ATOM   5367  C  C   . ALA A  1  705 ? 7.974   23.064  -12.534 1.00 80.75  ? 733  ALA A C   1 
ATOM   5368  O  O   . ALA A  1  705 ? 9.136   23.456  -12.406 1.00 80.79  ? 733  ALA A O   1 
ATOM   5369  C  CB  . ALA A  1  705 ? 7.364   22.795  -14.952 1.00 79.85  ? 733  ALA A CB  1 
ATOM   5370  N  N   . CYS A  1  706 ? 7.408   22.173  -11.721 1.00 82.19  ? 734  CYS A N   1 
ATOM   5371  C  CA  . CYS A  1  706 ? 8.059   21.703  -10.493 1.00 82.87  ? 734  CYS A CA  1 
ATOM   5372  C  C   . CYS A  1  706 ? 9.279   20.788  -10.692 1.00 83.22  ? 734  CYS A C   1 
ATOM   5373  O  O   . CYS A  1  706 ? 10.226  20.839  -9.903  1.00 83.21  ? 734  CYS A O   1 
ATOM   5374  C  CB  . CYS A  1  706 ? 7.050   21.032  -9.556  1.00 82.99  ? 734  CYS A CB  1 
ATOM   5375  S  SG  . CYS A  1  706 ? 7.884   20.229  -8.170  1.00 83.73  ? 734  CYS A SG  1 
ATOM   5376  N  N   . GLU A  1  707 ? 9.249   19.946  -11.724 1.00 83.67  ? 735  GLU A N   1 
ATOM   5377  C  CA  . GLU A  1  707 ? 10.388  19.073  -12.038 1.00 84.17  ? 735  GLU A CA  1 
ATOM   5378  C  C   . GLU A  1  707 ? 11.638  19.871  -12.439 1.00 84.29  ? 735  GLU A C   1 
ATOM   5379  O  O   . GLU A  1  707 ? 12.766  19.388  -12.286 1.00 84.26  ? 735  GLU A O   1 
ATOM   5380  C  CB  . GLU A  1  707 ? 10.024  18.058  -13.133 1.00 84.14  ? 735  GLU A CB  1 
ATOM   5381  C  CG  . GLU A  1  707 ? 9.757   18.659  -14.518 1.00 84.50  ? 735  GLU A CG  1 
ATOM   5382  C  CD  . GLU A  1  707 ? 9.903   17.639  -15.637 1.00 84.64  ? 735  GLU A CD  1 
ATOM   5383  O  OE1 . GLU A  1  707 ? 10.888  17.731  -16.404 1.00 85.15  ? 735  GLU A OE1 1 
ATOM   5384  O  OE2 . GLU A  1  707 ? 9.041   16.739  -15.744 1.00 85.26  ? 735  GLU A OE2 1 
ATOM   5385  N  N   . VAL A  1  708 ? 11.412  21.085  -12.950 1.00 84.45  ? 736  VAL A N   1 
ATOM   5386  C  CA  . VAL A  1  708 ? 12.468  21.992  -13.414 1.00 84.48  ? 736  VAL A CA  1 
ATOM   5387  C  C   . VAL A  1  708 ? 12.957  22.883  -12.268 1.00 84.56  ? 736  VAL A C   1 
ATOM   5388  O  O   . VAL A  1  708 ? 14.146  22.922  -11.956 1.00 84.50  ? 736  VAL A O   1 
ATOM   5389  C  CB  . VAL A  1  708 ? 11.969  22.877  -14.602 1.00 84.46  ? 736  VAL A CB  1 
ATOM   5390  C  CG1 . VAL A  1  708 ? 12.987  23.958  -14.957 1.00 84.10  ? 736  VAL A CG1 1 
ATOM   5391  C  CG2 . VAL A  1  708 ? 11.631  22.017  -15.825 1.00 84.29  ? 736  VAL A CG2 1 
ATOM   5392  N  N   . ASN A  1  709 ? 12.020  23.591  -11.647 1.00 84.86  ? 737  ASN A N   1 
ATOM   5393  C  CA  . ASN A  1  709 ? 12.322  24.533  -10.582 1.00 85.06  ? 737  ASN A CA  1 
ATOM   5394  C  C   . ASN A  1  709 ? 11.602  24.140  -9.290  1.00 85.18  ? 737  ASN A C   1 
ATOM   5395  O  O   . ASN A  1  709 ? 10.393  24.365  -9.163  1.00 85.29  ? 737  ASN A O   1 
ATOM   5396  C  CB  . ASN A  1  709 ? 11.938  25.951  -11.024 1.00 85.05  ? 737  ASN A CB  1 
ATOM   5397  C  CG  . ASN A  1  709 ? 12.144  26.990  -9.932  1.00 85.46  ? 737  ASN A CG  1 
ATOM   5398  O  OD1 . ASN A  1  709 ? 13.100  26.924  -9.159  1.00 86.02  ? 737  ASN A OD1 1 
ATOM   5399  N  ND2 . ASN A  1  709 ? 11.246  27.964  -9.874  1.00 85.82  ? 737  ASN A ND2 1 
ATOM   5400  N  N   . PRO A  1  710 ? 12.338  23.537  -8.330  1.00 85.30  ? 738  PRO A N   1 
ATOM   5401  C  CA  . PRO A  1  710 ? 11.785  23.166  -7.014  1.00 85.46  ? 738  PRO A CA  1 
ATOM   5402  C  C   . PRO A  1  710 ? 11.224  24.343  -6.191  1.00 85.60  ? 738  PRO A C   1 
ATOM   5403  O  O   . PRO A  1  710 ? 10.840  24.157  -5.028  1.00 85.63  ? 738  PRO A O   1 
ATOM   5404  C  CB  . PRO A  1  710 ? 12.982  22.522  -6.289  1.00 85.54  ? 738  PRO A CB  1 
ATOM   5405  C  CG  . PRO A  1  710 ? 14.194  22.949  -7.047  1.00 85.31  ? 738  PRO A CG  1 
ATOM   5406  C  CD  . PRO A  1  710 ? 13.754  23.141  -8.462  1.00 85.31  ? 738  PRO A CD  1 
ATOM   5407  N  N   . LEU A  1  711 ? 11.170  25.531  -6.799  1.00 85.60  ? 739  LEU A N   1 
ATOM   5408  C  CA  . LEU A  1  711 ? 10.644  26.737  -6.151  1.00 85.61  ? 739  LEU A CA  1 
ATOM   5409  C  C   . LEU A  1  711 ? 9.216   27.051  -6.598  1.00 85.59  ? 739  LEU A C   1 
ATOM   5410  O  O   . LEU A  1  711 ? 8.468   27.739  -5.896  1.00 85.39  ? 739  LEU A O   1 
ATOM   5411  C  CB  . LEU A  1  711 ? 11.569  27.931  -6.410  1.00 85.55  ? 739  LEU A CB  1 
ATOM   5412  C  CG  . LEU A  1  711 ? 11.577  29.098  -5.421  1.00 85.47  ? 739  LEU A CG  1 
ATOM   5413  C  CD1 . LEU A  1  711 ? 11.682  28.634  -3.974  1.00 85.42  ? 739  LEU A CD1 1 
ATOM   5414  C  CD2 . LEU A  1  711 ? 12.733  30.001  -5.758  1.00 85.61  ? 739  LEU A CD2 1 
ATOM   5415  N  N   . ALA A  1  712 ? 8.849   26.538  -7.771  1.00 85.70  ? 740  ALA A N   1 
ATOM   5416  C  CA  . ALA A  1  712 ? 7.464   26.555  -8.230  1.00 85.90  ? 740  ALA A CA  1 
ATOM   5417  C  C   . ALA A  1  712 ? 6.659   25.506  -7.462  1.00 86.05  ? 740  ALA A C   1 
ATOM   5418  O  O   . ALA A  1  712 ? 5.430   25.460  -7.544  1.00 86.00  ? 740  ALA A O   1 
ATOM   5419  C  CB  . ALA A  1  712 ? 7.402   26.295  -9.722  1.00 85.78  ? 740  ALA A CB  1 
ATOM   5420  N  N   . CYS A  1  713 ? 7.379   24.683  -6.704  1.00 86.31  ? 741  CYS A N   1 
ATOM   5421  C  CA  . CYS A  1  713 ? 6.816   23.584  -5.934  1.00 86.60  ? 741  CYS A CA  1 
ATOM   5422  C  C   . CYS A  1  713 ? 6.583   23.951  -4.463  1.00 86.84  ? 741  CYS A C   1 
ATOM   5423  O  O   . CYS A  1  713 ? 5.888   23.232  -3.739  1.00 86.83  ? 741  CYS A O   1 
ATOM   5424  C  CB  . CYS A  1  713 ? 7.758   22.385  -6.027  1.00 86.41  ? 741  CYS A CB  1 
ATOM   5425  S  SG  . CYS A  1  713 ? 6.909   20.874  -6.499  1.00 87.17  ? 741  CYS A SG  1 
ATOM   5426  N  N   . LEU A  1  714 ? 7.166   25.075  -4.039  1.00 87.16  ? 742  LEU A N   1 
ATOM   5427  C  CA  . LEU A  1  714 ? 7.113   25.549  -2.651  1.00 87.26  ? 742  LEU A CA  1 
ATOM   5428  C  C   . LEU A  1  714 ? 5.768   26.143  -2.195  1.00 87.36  ? 742  LEU A C   1 
ATOM   5429  O  O   . LEU A  1  714 ? 5.379   25.923  -1.048  1.00 87.39  ? 742  LEU A O   1 
ATOM   5430  C  CB  . LEU A  1  714 ? 8.261   26.538  -2.371  1.00 87.39  ? 742  LEU A CB  1 
ATOM   5431  C  CG  . LEU A  1  714 ? 8.478   27.110  -0.960  1.00 87.30  ? 742  LEU A CG  1 
ATOM   5432  C  CD1 . LEU A  1  714 ? 8.630   26.015  0.093   1.00 87.50  ? 742  LEU A CD1 1 
ATOM   5433  C  CD2 . LEU A  1  714 ? 9.687   28.036  -0.932  1.00 87.33  ? 742  LEU A CD2 1 
ATOM   5434  N  N   . PRO A  1  715 ? 5.068   26.912  -3.064  1.00 87.41  ? 743  PRO A N   1 
ATOM   5435  C  CA  . PRO A  1  715 ? 3.760   27.448  -2.648  1.00 87.50  ? 743  PRO A CA  1 
ATOM   5436  C  C   . PRO A  1  715 ? 2.791   26.398  -2.084  1.00 87.52  ? 743  PRO A C   1 
ATOM   5437  O  O   . PRO A  1  715 ? 2.194   26.616  -1.030  1.00 87.49  ? 743  PRO A O   1 
ATOM   5438  C  CB  . PRO A  1  715 ? 3.198   28.079  -3.936  1.00 87.48  ? 743  PRO A CB  1 
ATOM   5439  C  CG  . PRO A  1  715 ? 4.091   27.628  -5.041  1.00 87.34  ? 743  PRO A CG  1 
ATOM   5440  C  CD  . PRO A  1  715 ? 5.419   27.364  -4.423  1.00 87.40  ? 743  PRO A CD  1 
ATOM   5441  N  N   . GLN A  1  716 ? 2.660   25.271  -2.777  1.00 87.67  ? 744  GLN A N   1 
ATOM   5442  C  CA  . GLN A  1  716 ? 1.778   24.180  -2.359  1.00 87.82  ? 744  GLN A CA  1 
ATOM   5443  C  C   . GLN A  1  716 ? 2.394   23.279  -1.278  1.00 87.79  ? 744  GLN A C   1 
ATOM   5444  O  O   . GLN A  1  716 ? 1.670   22.690  -0.470  1.00 87.74  ? 744  GLN A O   1 
ATOM   5445  C  CB  . GLN A  1  716 ? 1.353   23.352  -3.575  1.00 87.88  ? 744  GLN A CB  1 
ATOM   5446  C  CG  . GLN A  1  716 ? 2.502   22.980  -4.512  1.00 88.29  ? 744  GLN A CG  1 
ATOM   5447  C  CD  . GLN A  1  716 ? 2.053   22.800  -5.949  1.00 89.11  ? 744  GLN A CD  1 
ATOM   5448  O  OE1 . GLN A  1  716 ? 1.033   23.347  -6.367  1.00 89.51  ? 744  GLN A OE1 1 
ATOM   5449  N  NE2 . GLN A  1  716 ? 2.821   22.036  -6.718  1.00 89.47  ? 744  GLN A NE2 1 
ATOM   5450  N  N   . ALA A  1  717 ? 3.724   23.177  -1.275  1.00 87.82  ? 745  ALA A N   1 
ATOM   5451  C  CA  . ALA A  1  717 ? 4.455   22.383  -0.280  1.00 87.78  ? 745  ALA A CA  1 
ATOM   5452  C  C   . ALA A  1  717 ? 4.553   23.093  1.075   1.00 87.75  ? 745  ALA A C   1 
ATOM   5453  O  O   . ALA A  1  717 ? 4.690   22.440  2.115   1.00 87.73  ? 745  ALA A O   1 
ATOM   5454  C  CB  . ALA A  1  717 ? 5.846   22.014  -0.798  1.00 87.75  ? 745  ALA A CB  1 
ATOM   5455  N  N   . ALA A  1  718 ? 4.483   24.425  1.054   1.00 87.64  ? 746  ALA A N   1 
ATOM   5456  C  CA  . ALA A  1  718 ? 4.488   25.236  2.275   1.00 87.49  ? 746  ALA A CA  1 
ATOM   5457  C  C   . ALA A  1  718 ? 3.076   25.680  2.672   1.00 87.42  ? 746  ALA A C   1 
ATOM   5458  O  O   . ALA A  1  718 ? 2.894   26.701  3.345   1.00 87.36  ? 746  ALA A O   1 
ATOM   5459  C  CB  . ALA A  1  718 ? 5.410   26.440  2.117   1.00 87.52  ? 746  ALA A CB  1 
ATOM   5460  N  N   . ALA A  1  719 ? 2.081   24.901  2.254   1.00 87.29  ? 747  ALA A N   1 
ATOM   5461  C  CA  . ALA A  1  719 ? 0.692   25.140  2.631   1.00 87.10  ? 747  ALA A CA  1 
ATOM   5462  C  C   . ALA A  1  719 ? 0.348   24.423  3.943   1.00 86.97  ? 747  ALA A C   1 
ATOM   5463  O  O   . ALA A  1  719 ? -0.760  23.907  4.108   1.00 86.92  ? 747  ALA A O   1 
ATOM   5464  C  CB  . ALA A  1  719 ? -0.251  24.710  1.502   1.00 87.07  ? 747  ALA A CB  1 
ATOM   5465  N  N   . CYS A  1  720 ? 1.311   24.386  4.866   1.00 86.72  ? 748  CYS A N   1 
ATOM   5466  C  CA  . CYS A  1  720 ? 1.083   23.843  6.205   1.00 86.53  ? 748  CYS A CA  1 
ATOM   5467  C  C   . CYS A  1  720 ? 1.025   24.959  7.257   1.00 86.14  ? 748  CYS A C   1 
ATOM   5468  O  O   . CYS A  1  720 ? 1.652   26.011  7.095   1.00 86.03  ? 748  CYS A O   1 
ATOM   5469  C  CB  . CYS A  1  720 ? 2.135   22.771  6.566   1.00 86.61  ? 748  CYS A CB  1 
ATOM   5470  S  SG  . CYS A  1  720 ? 3.796   23.351  7.110   1.00 87.59  ? 748  CYS A SG  1 
ATOM   5471  N  N   . ALA A  1  721 ? 0.248   24.731  8.315   1.00 85.72  ? 749  ALA A N   1 
ATOM   5472  C  CA  . ALA A  1  721 ? 0.187   25.643  9.454   1.00 85.39  ? 749  ALA A CA  1 
ATOM   5473  C  C   . ALA A  1  721 ? 1.336   25.329  10.417  1.00 85.18  ? 749  ALA A C   1 
ATOM   5474  O  O   . ALA A  1  721 ? 1.371   24.239  10.996  1.00 85.17  ? 749  ALA A O   1 
ATOM   5475  C  CB  . ALA A  1  721 ? -1.157  25.531  10.158  1.00 85.29  ? 749  ALA A CB  1 
ATOM   5476  N  N   . PRO A  1  722 ? 2.284   26.279  10.580  1.00 84.91  ? 750  PRO A N   1 
ATOM   5477  C  CA  . PRO A  1  722 ? 3.506   26.089  11.379  1.00 84.71  ? 750  PRO A CA  1 
ATOM   5478  C  C   . PRO A  1  722 ? 3.269   25.802  12.872  1.00 84.59  ? 750  PRO A C   1 
ATOM   5479  O  O   . PRO A  1  722 ? 2.568   26.562  13.554  1.00 84.48  ? 750  PRO A O   1 
ATOM   5480  C  CB  . PRO A  1  722 ? 4.255   27.415  11.198  1.00 84.71  ? 750  PRO A CB  1 
ATOM   5481  C  CG  . PRO A  1  722 ? 3.216   28.399  10.789  1.00 84.72  ? 750  PRO A CG  1 
ATOM   5482  C  CD  . PRO A  1  722 ? 2.234   27.624  9.976   1.00 84.87  ? 750  PRO A CD  1 
ATOM   5483  N  N   . ASP A  1  723 ? 3.863   24.707  13.356  1.00 84.43  ? 751  ASP A N   1 
ATOM   5484  C  CA  . ASP A  1  723 ? 3.748   24.279  14.757  1.00 84.17  ? 751  ASP A CA  1 
ATOM   5485  C  C   . ASP A  1  723 ? 4.636   25.106  15.676  1.00 83.74  ? 751  ASP A C   1 
ATOM   5486  O  O   . ASP A  1  723 ? 5.853   24.906  15.729  1.00 83.72  ? 751  ASP A O   1 
ATOM   5487  C  CB  . ASP A  1  723 ? 4.107   22.795  14.908  1.00 84.33  ? 751  ASP A CB  1 
ATOM   5488  C  CG  . ASP A  1  723 ? 3.084   21.875  14.273  1.00 84.99  ? 751  ASP A CG  1 
ATOM   5489  O  OD1 . ASP A  1  723 ? 1.963   21.746  14.822  1.00 84.90  ? 751  ASP A OD1 1 
ATOM   5490  O  OD2 . ASP A  1  723 ? 3.414   21.267  13.228  1.00 86.13  ? 751  ASP A OD2 1 
ATOM   5491  N  N   . LEU A  1  724 ? 4.018   26.034  16.400  1.00 83.24  ? 752  LEU A N   1 
ATOM   5492  C  CA  . LEU A  1  724 ? 4.739   26.878  17.343  1.00 82.77  ? 752  LEU A CA  1 
ATOM   5493  C  C   . LEU A  1  724 ? 4.499   26.376  18.768  1.00 82.52  ? 752  LEU A C   1 
ATOM   5494  O  O   . LEU A  1  724 ? 3.365   26.424  19.253  1.00 82.56  ? 752  LEU A O   1 
ATOM   5495  C  CB  . LEU A  1  724 ? 4.311   28.347  17.192  1.00 82.69  ? 752  LEU A CB  1 
ATOM   5496  C  CG  . LEU A  1  724 ? 4.485   29.020  15.821  1.00 82.44  ? 752  LEU A CG  1 
ATOM   5497  C  CD1 . LEU A  1  724 ? 3.557   30.209  15.654  1.00 81.80  ? 752  LEU A CD1 1 
ATOM   5498  C  CD2 . LEU A  1  724 ? 5.931   29.428  15.572  1.00 82.12  ? 752  LEU A CD2 1 
ATOM   5499  N  N   . PRO A  1  725 ? 5.559   25.869  19.437  1.00 82.24  ? 753  PRO A N   1 
ATOM   5500  C  CA  . PRO A  1  725 ? 5.429   25.459  20.842  1.00 81.95  ? 753  PRO A CA  1 
ATOM   5501  C  C   . PRO A  1  725 ? 4.997   26.632  21.720  1.00 81.62  ? 753  PRO A C   1 
ATOM   5502  O  O   . PRO A  1  725 ? 5.317   27.782  21.406  1.00 81.59  ? 753  PRO A O   1 
ATOM   5503  C  CB  . PRO A  1  725 ? 6.847   24.996  21.217  1.00 82.01  ? 753  PRO A CB  1 
ATOM   5504  C  CG  . PRO A  1  725 ? 7.751   25.547  20.159  1.00 82.07  ? 753  PRO A CG  1 
ATOM   5505  C  CD  . PRO A  1  725 ? 6.922   25.639  18.919  1.00 82.24  ? 753  PRO A CD  1 
ATOM   5506  N  N   . ALA A  1  726 ? 4.261   26.345  22.793  1.00 81.28  ? 754  ALA A N   1 
ATOM   5507  C  CA  . ALA A  1  726 ? 3.785   27.388  23.703  1.00 81.06  ? 754  ALA A CA  1 
ATOM   5508  C  C   . ALA A  1  726 ? 4.965   28.104  24.370  1.00 80.94  ? 754  ALA A C   1 
ATOM   5509  O  O   . ALA A  1  726 ? 5.928   27.462  24.801  1.00 80.93  ? 754  ALA A O   1 
ATOM   5510  C  CB  . ALA A  1  726 ? 2.836   26.811  24.741  1.00 80.97  ? 754  ALA A CB  1 
ATOM   5511  N  N   . PHE A  1  727 ? 4.880   29.432  24.431  1.00 80.65  ? 755  PHE A N   1 
ATOM   5512  C  CA  . PHE A  1  727 ? 5.965   30.277  24.919  1.00 80.41  ? 755  PHE A CA  1 
ATOM   5513  C  C   . PHE A  1  727 ? 6.311   30.035  26.395  1.00 80.31  ? 755  PHE A C   1 
ATOM   5514  O  O   . PHE A  1  727 ? 5.436   30.081  27.265  1.00 80.23  ? 755  PHE A O   1 
ATOM   5515  C  CB  . PHE A  1  727 ? 5.624   31.759  24.688  1.00 80.40  ? 755  PHE A CB  1 
ATOM   5516  C  CG  . PHE A  1  727 ? 6.724   32.707  25.092  1.00 80.52  ? 755  PHE A CG  1 
ATOM   5517  C  CD1 . PHE A  1  727 ? 7.704   33.085  24.180  1.00 80.21  ? 755  PHE A CD1 1 
ATOM   5518  C  CD2 . PHE A  1  727 ? 6.787   33.214  26.390  1.00 80.55  ? 755  PHE A CD2 1 
ATOM   5519  C  CE1 . PHE A  1  727 ? 8.730   33.953  24.553  1.00 80.23  ? 755  PHE A CE1 1 
ATOM   5520  C  CE2 . PHE A  1  727 ? 7.814   34.082  26.773  1.00 80.39  ? 755  PHE A CE2 1 
ATOM   5521  C  CZ  . PHE A  1  727 ? 8.786   34.451  25.851  1.00 80.15  ? 755  PHE A CZ  1 
ATOM   5522  N  N   . SER A  1  728 ? 7.593   29.778  26.658  1.00 80.18  ? 756  SER A N   1 
ATOM   5523  C  CA  . SER A  1  728 ? 8.125   29.704  28.022  1.00 79.96  ? 756  SER A CA  1 
ATOM   5524  C  C   . SER A  1  728 ? 9.371   30.587  28.158  1.00 79.86  ? 756  SER A C   1 
ATOM   5525  O  O   . SER A  1  728 ? 10.075  30.830  27.170  1.00 79.68  ? 756  SER A O   1 
ATOM   5526  C  CB  . SER A  1  728 ? 8.449   28.256  28.410  1.00 80.00  ? 756  SER A CB  1 
ATOM   5527  O  OG  . SER A  1  728 ? 9.754   27.890  27.995  1.00 79.75  ? 756  SER A OG  1 
ATOM   5528  N  N   . HIS A  1  729 ? 9.628   31.069  29.376  1.00 79.74  ? 757  HIS A N   1 
ATOM   5529  C  CA  . HIS A  1  729 ? 10.805  31.902  29.654  1.00 79.51  ? 757  HIS A CA  1 
ATOM   5530  C  C   . HIS A  1  729 ? 11.763  31.273  30.676  1.00 79.59  ? 757  HIS A C   1 
ATOM   5531  O  O   . HIS A  1  729 ? 11.328  30.689  31.674  1.00 79.49  ? 757  HIS A O   1 
ATOM   5532  C  CB  . HIS A  1  729 ? 10.407  33.320  30.088  1.00 79.32  ? 757  HIS A CB  1 
ATOM   5533  C  CG  . HIS A  1  729 ? 11.563  34.274  30.136  1.00 79.05  ? 757  HIS A CG  1 
ATOM   5534  N  ND1 . HIS A  1  729 ? 12.105  34.730  31.319  1.00 78.93  ? 757  HIS A ND1 1 
ATOM   5535  C  CD2 . HIS A  1  729 ? 12.304  34.827  29.146  1.00 78.34  ? 757  HIS A CD2 1 
ATOM   5536  C  CE1 . HIS A  1  729 ? 13.121  35.533  31.054  1.00 78.60  ? 757  HIS A CE1 1 
ATOM   5537  N  NE2 . HIS A  1  729 ? 13.261  35.610  29.743  1.00 78.12  ? 757  HIS A NE2 1 
ATOM   5538  N  N   . GLY A  1  730 ? 13.065  31.419  30.414  1.00 79.66  ? 758  GLY A N   1 
ATOM   5539  C  CA  . GLY A  1  730 ? 14.130  30.812  31.219  1.00 79.75  ? 758  GLY A CA  1 
ATOM   5540  C  C   . GLY A  1  730 ? 14.204  31.197  32.691  1.00 79.84  ? 758  GLY A C   1 
ATOM   5541  O  O   . GLY A  1  730 ? 14.764  30.446  33.494  1.00 79.75  ? 758  GLY A O   1 
ATOM   5542  N  N   . GLY A  1  731 ? 13.657  32.365  33.040  1.00 80.00  ? 759  GLY A N   1 
ATOM   5543  C  CA  . GLY A  1  731 ? 13.602  32.836  34.429  1.00 80.13  ? 759  GLY A CA  1 
ATOM   5544  C  C   . GLY A  1  731 ? 14.635  33.880  34.842  1.00 80.38  ? 759  GLY A C   1 
ATOM   5545  O  O   . GLY A  1  731 ? 15.385  34.411  34.009  1.00 80.08  ? 759  GLY A O   1 
ATOM   5546  N  N   . PHE A  1  732 ? 14.657  34.168  36.147  1.00 80.68  ? 760  PHE A N   1 
ATOM   5547  C  CA  . PHE A  1  732 ? 15.532  35.182  36.756  1.00 80.95  ? 760  PHE A CA  1 
ATOM   5548  C  C   . PHE A  1  732 ? 16.156  34.648  38.051  1.00 81.23  ? 760  PHE A C   1 
ATOM   5549  O  O   . PHE A  1  732 ? 15.515  33.887  38.785  1.00 81.46  ? 760  PHE A O   1 
ATOM   5550  C  CB  . PHE A  1  732 ? 14.742  36.462  37.069  1.00 80.79  ? 760  PHE A CB  1 
ATOM   5551  C  CG  . PHE A  1  732 ? 14.058  37.076  35.871  1.00 80.56  ? 760  PHE A CG  1 
ATOM   5552  C  CD1 . PHE A  1  732 ? 12.760  36.700  35.521  1.00 80.09  ? 760  PHE A CD1 1 
ATOM   5553  C  CD2 . PHE A  1  732 ? 14.705  38.042  35.103  1.00 80.24  ? 760  PHE A CD2 1 
ATOM   5554  C  CE1 . PHE A  1  732 ? 12.122  37.260  34.418  1.00 79.68  ? 760  PHE A CE1 1 
ATOM   5555  C  CE2 . PHE A  1  732 ? 14.075  38.612  33.999  1.00 80.29  ? 760  PHE A CE2 1 
ATOM   5556  C  CZ  . PHE A  1  732 ? 12.780  38.220  33.657  1.00 80.16  ? 760  PHE A CZ  1 
ATOM   5557  N  N   . SER A  1  733 ? 17.394  35.055  38.337  1.00 81.45  ? 761  SER A N   1 
ATOM   5558  C  CA  . SER A  1  733 ? 18.084  34.632  39.567  1.00 81.64  ? 761  SER A CA  1 
ATOM   5559  C  C   . SER A  1  733 ? 18.047  35.695  40.678  1.00 81.87  ? 761  SER A C   1 
ATOM   5560  O  O   . SER A  1  733 ? 17.314  35.552  41.664  1.00 82.08  ? 761  SER A O   1 
ATOM   5561  C  CB  . SER A  1  733 ? 19.526  34.184  39.275  1.00 81.48  ? 761  SER A CB  1 
ATOM   5562  O  OG  . SER A  1  733 ? 20.300  35.243  38.743  1.00 80.92  ? 761  SER A OG  1 
ATOM   5563  N  N   . HIS A  1  734 ? 18.735  36.722  40.630  1.00 81.97  ? 762  HIS A N   1 
ATOM   5564  N  N   . PRO B  1  11  ? -7.134  28.500  8.054   1.00 98.11  ? 39   PRO B N   1 
ATOM   5565  C  CA  . PRO B  1  11  ? -7.402  29.165  6.776   1.00 98.10  ? 39   PRO B CA  1 
ATOM   5566  C  C   . PRO B  1  11  ? -6.158  29.851  6.181   1.00 98.11  ? 39   PRO B C   1 
ATOM   5567  O  O   . PRO B  1  11  ? -5.052  29.687  6.698   1.00 97.99  ? 39   PRO B O   1 
ATOM   5568  C  CB  . PRO B  1  11  ? -8.484  30.194  7.139   1.00 98.06  ? 39   PRO B CB  1 
ATOM   5569  C  CG  . PRO B  1  11  ? -8.303  30.439  8.602   1.00 98.02  ? 39   PRO B CG  1 
ATOM   5570  C  CD  . PRO B  1  11  ? -7.868  29.121  9.171   1.00 98.08  ? 39   PRO B CD  1 
ATOM   5571  N  N   . HIS B  1  12  ? -6.356  30.604  5.098   1.00 98.17  ? 40   HIS B N   1 
ATOM   5572  C  CA  . HIS B  1  12  ? -5.286  31.336  4.411   1.00 98.25  ? 40   HIS B CA  1 
ATOM   5573  C  C   . HIS B  1  12  ? -4.952  32.631  5.168   1.00 97.86  ? 40   HIS B C   1 
ATOM   5574  O  O   . HIS B  1  12  ? -5.859  33.349  5.594   1.00 97.89  ? 40   HIS B O   1 
ATOM   5575  C  CB  . HIS B  1  12  ? -5.738  31.670  2.979   1.00 98.58  ? 40   HIS B CB  1 
ATOM   5576  C  CG  . HIS B  1  12  ? -4.843  31.122  1.903   1.00 99.74  ? 40   HIS B CG  1 
ATOM   5577  N  ND1 . HIS B  1  12  ? -4.117  31.929  1.051   1.00 100.71 ? 40   HIS B ND1 1 
ATOM   5578  C  CD2 . HIS B  1  12  ? -4.576  29.844  1.530   1.00 100.47 ? 40   HIS B CD2 1 
ATOM   5579  C  CE1 . HIS B  1  12  ? -3.434  31.174  0.205   1.00 100.74 ? 40   HIS B CE1 1 
ATOM   5580  N  NE2 . HIS B  1  12  ? -3.694  29.905  0.476   1.00 100.92 ? 40   HIS B NE2 1 
ATOM   5581  N  N   . CYS B  1  13  ? -3.661  32.928  5.332   1.00 97.41  ? 41   CYS B N   1 
ATOM   5582  C  CA  . CYS B  1  13  ? -3.221  34.160  6.008   1.00 96.90  ? 41   CYS B CA  1 
ATOM   5583  C  C   . CYS B  1  13  ? -3.552  35.404  5.162   1.00 97.07  ? 41   CYS B C   1 
ATOM   5584  O  O   . CYS B  1  13  ? -3.312  35.398  3.949   1.00 97.02  ? 41   CYS B O   1 
ATOM   5585  C  CB  . CYS B  1  13  ? -1.716  34.121  6.332   1.00 96.60  ? 41   CYS B CB  1 
ATOM   5586  S  SG  . CYS B  1  13  ? -1.085  32.645  7.217   1.00 94.90  ? 41   CYS B SG  1 
ATOM   5587  N  N   . PRO B  1  14  ? -4.107  36.467  5.798   1.00 97.15  ? 42   PRO B N   1 
ATOM   5588  C  CA  . PRO B  1  14  ? -4.545  37.707  5.122   1.00 97.16  ? 42   PRO B CA  1 
ATOM   5589  C  C   . PRO B  1  14  ? -3.540  38.318  4.134   1.00 97.13  ? 42   PRO B C   1 
ATOM   5590  O  O   . PRO B  1  14  ? -2.338  38.060  4.217   1.00 97.02  ? 42   PRO B O   1 
ATOM   5591  C  CB  . PRO B  1  14  ? -4.794  38.667  6.291   1.00 97.13  ? 42   PRO B CB  1 
ATOM   5592  C  CG  . PRO B  1  14  ? -5.210  37.776  7.408   1.00 97.12  ? 42   PRO B CG  1 
ATOM   5593  C  CD  . PRO B  1  14  ? -4.374  36.529  7.252   1.00 97.15  ? 42   PRO B CD  1 
ATOM   5594  N  N   . GLN B  1  30  ? 3.488   62.150  -9.075  1.00 44.92  ? 58   GLN B N   1 
ATOM   5595  C  CA  . GLN B  1  30  ? 4.607   61.678  -8.268  1.00 44.68  ? 58   GLN B CA  1 
ATOM   5596  C  C   . GLN B  1  30  ? 5.924   62.218  -8.823  1.00 43.99  ? 58   GLN B C   1 
ATOM   5597  O  O   . GLN B  1  30  ? 6.565   61.596  -9.681  1.00 44.06  ? 58   GLN B O   1 
ATOM   5598  C  CB  . GLN B  1  30  ? 4.625   60.144  -8.202  1.00 45.09  ? 58   GLN B CB  1 
ATOM   5599  C  CG  . GLN B  1  30  ? 3.761   59.528  -7.079  1.00 45.84  ? 58   GLN B CG  1 
ATOM   5600  C  CD  . GLN B  1  30  ? 3.791   57.980  -7.061  1.00 45.57  ? 58   GLN B CD  1 
ATOM   5601  O  OE1 . GLN B  1  30  ? 4.412   57.330  -7.921  1.00 45.65  ? 58   GLN B OE1 1 
ATOM   5602  N  NE2 . GLN B  1  30  ? 3.109   57.394  -6.072  1.00 45.01  ? 58   GLN B NE2 1 
ATOM   5603  N  N   . LEU B  1  31  ? 6.297   63.393  -8.320  1.00 42.76  ? 59   LEU B N   1 
ATOM   5604  C  CA  . LEU B  1  31  ? 7.519   64.131  -8.670  1.00 41.27  ? 59   LEU B CA  1 
ATOM   5605  C  C   . LEU B  1  31  ? 8.738   63.315  -9.146  1.00 40.17  ? 59   LEU B C   1 
ATOM   5606  O  O   . LEU B  1  31  ? 9.411   63.694  -10.108 1.00 40.14  ? 59   LEU B O   1 
ATOM   5607  C  CB  . LEU B  1  31  ? 7.926   64.928  -7.427  1.00 41.63  ? 59   LEU B CB  1 
ATOM   5608  C  CG  . LEU B  1  31  ? 8.355   66.390  -7.499  1.00 42.06  ? 59   LEU B CG  1 
ATOM   5609  C  CD1 . LEU B  1  31  ? 7.582   67.181  -8.564  1.00 42.93  ? 59   LEU B CD1 1 
ATOM   5610  C  CD2 . LEU B  1  31  ? 8.160   66.996  -6.129  1.00 41.09  ? 59   LEU B CD2 1 
ATOM   5611  N  N   . PHE B  1  32  ? 9.027   62.213  -8.454  1.00 38.51  ? 60   PHE B N   1 
ATOM   5612  C  CA  . PHE B  1  32  ? 10.276  61.481  -8.646  1.00 36.82  ? 60   PHE B CA  1 
ATOM   5613  C  C   . PHE B  1  32  ? 10.129  60.146  -9.372  1.00 36.15  ? 60   PHE B C   1 
ATOM   5614  O  O   . PHE B  1  32  ? 11.134  59.480  -9.619  1.00 35.99  ? 60   PHE B O   1 
ATOM   5615  C  CB  . PHE B  1  32  ? 10.977  61.254  -7.306  1.00 36.30  ? 60   PHE B CB  1 
ATOM   5616  C  CG  . PHE B  1  32  ? 11.223  62.510  -6.531  1.00 35.81  ? 60   PHE B CG  1 
ATOM   5617  C  CD1 . PHE B  1  32  ? 10.356  62.887  -5.492  1.00 35.42  ? 60   PHE B CD1 1 
ATOM   5618  C  CD2 . PHE B  1  32  ? 12.316  63.323  -6.827  1.00 35.19  ? 60   PHE B CD2 1 
ATOM   5619  C  CE1 . PHE B  1  32  ? 10.568  64.059  -4.754  1.00 33.58  ? 60   PHE B CE1 1 
ATOM   5620  C  CE2 . PHE B  1  32  ? 12.549  64.495  -6.100  1.00 35.19  ? 60   PHE B CE2 1 
ATOM   5621  C  CZ  . PHE B  1  32  ? 11.663  64.865  -5.056  1.00 35.53  ? 60   PHE B CZ  1 
ATOM   5622  N  N   . ALA B  1  33  ? 8.899   59.763  -9.713  1.00 35.25  ? 61   ALA B N   1 
ATOM   5623  C  CA  . ALA B  1  33  ? 8.646   58.508  -10.424 1.00 35.03  ? 61   ALA B CA  1 
ATOM   5624  C  C   . ALA B  1  33  ? 9.289   58.508  -11.801 1.00 35.01  ? 61   ALA B C   1 
ATOM   5625  O  O   . ALA B  1  33  ? 9.293   59.530  -12.494 1.00 34.76  ? 61   ALA B O   1 
ATOM   5626  C  CB  . ALA B  1  33  ? 7.145   58.229  -10.549 1.00 34.67  ? 61   ALA B CB  1 
ATOM   5627  N  N   . ASP B  1  34  ? 9.840   57.360  -12.188 1.00 34.83  ? 62   ASP B N   1 
ATOM   5628  C  CA  . ASP B  1  34  ? 10.317  57.177  -13.540 1.00 35.17  ? 62   ASP B CA  1 
ATOM   5629  C  C   . ASP B  1  34  ? 9.136   57.312  -14.508 1.00 35.70  ? 62   ASP B C   1 
ATOM   5630  O  O   . ASP B  1  34  ? 7.965   57.145  -14.112 1.00 36.00  ? 62   ASP B O   1 
ATOM   5631  C  CB  . ASP B  1  34  ? 11.001  55.811  -13.691 1.00 35.42  ? 62   ASP B CB  1 
ATOM   5632  C  CG  . ASP B  1  34  ? 12.289  55.702  -12.883 1.00 34.78  ? 62   ASP B CG  1 
ATOM   5633  O  OD1 . ASP B  1  34  ? 12.679  54.570  -12.546 1.00 31.96  ? 62   ASP B OD1 1 
ATOM   5634  O  OD2 . ASP B  1  34  ? 12.903  56.752  -12.574 1.00 36.43  ? 62   ASP B OD2 1 
ATOM   5635  N  N   . LEU B  1  35  ? 9.433   57.643  -15.763 1.00 35.88  ? 63   LEU B N   1 
ATOM   5636  C  CA  . LEU B  1  35  ? 8.388   57.830  -16.771 1.00 36.12  ? 63   LEU B CA  1 
ATOM   5637  C  C   . LEU B  1  35  ? 7.650   56.533  -17.073 1.00 36.77  ? 63   LEU B C   1 
ATOM   5638  O  O   . LEU B  1  35  ? 8.273   55.483  -17.251 1.00 37.12  ? 63   LEU B O   1 
ATOM   5639  C  CB  . LEU B  1  35  ? 8.962   58.431  -18.050 1.00 35.57  ? 63   LEU B CB  1 
ATOM   5640  C  CG  . LEU B  1  35  ? 9.756   59.723  -17.884 1.00 35.11  ? 63   LEU B CG  1 
ATOM   5641  C  CD1 . LEU B  1  35  ? 10.453  60.075  -19.182 1.00 35.24  ? 63   LEU B CD1 1 
ATOM   5642  C  CD2 . LEU B  1  35  ? 8.852   60.849  -17.443 1.00 34.62  ? 63   LEU B CD2 1 
ATOM   5643  N  N   . SER B  1  36  ? 6.321   56.613  -17.107 1.00 37.76  ? 64   SER B N   1 
ATOM   5644  C  CA  . SER B  1  36  ? 5.456   55.473  -17.433 1.00 38.56  ? 64   SER B CA  1 
ATOM   5645  C  C   . SER B  1  36  ? 5.490   55.165  -18.938 1.00 39.42  ? 64   SER B C   1 
ATOM   5646  O  O   . SER B  1  36  ? 5.975   55.983  -19.731 1.00 39.36  ? 64   SER B O   1 
ATOM   5647  C  CB  . SER B  1  36  ? 4.038   55.781  -16.994 1.00 38.16  ? 64   SER B CB  1 
ATOM   5648  O  OG  . SER B  1  36  ? 3.623   57.010  -17.553 1.00 38.31  ? 64   SER B OG  1 
ATOM   5649  N  N   . ARG B  1  37  ? 4.993   53.987  -19.330 1.00 40.30  ? 65   ARG B N   1 
ATOM   5650  C  CA  . ARG B  1  37  ? 4.949   53.610  -20.753 1.00 41.45  ? 65   ARG B CA  1 
ATOM   5651  C  C   . ARG B  1  37  ? 4.389   54.770  -21.576 1.00 40.92  ? 65   ARG B C   1 
ATOM   5652  O  O   . ARG B  1  37  ? 5.040   55.245  -22.510 1.00 40.60  ? 65   ARG B O   1 
ATOM   5653  C  CB  . ARG B  1  37  ? 4.121   52.338  -20.980 1.00 41.45  ? 65   ARG B CB  1 
ATOM   5654  C  CG  . ARG B  1  37  ? 4.667   51.076  -20.268 1.00 43.39  ? 65   ARG B CG  1 
ATOM   5655  C  CD  . ARG B  1  37  ? 3.930   49.801  -20.726 1.00 43.86  ? 65   ARG B CD  1 
ATOM   5656  N  NE  . ARG B  1  37  ? 4.141   49.538  -22.157 1.00 47.76  ? 65   ARG B NE  1 
ATOM   5657  C  CZ  . ARG B  1  37  ? 5.024   48.668  -22.657 1.00 48.23  ? 65   ARG B CZ  1 
ATOM   5658  N  NH1 . ARG B  1  37  ? 5.784   47.937  -21.853 1.00 48.39  ? 65   ARG B NH1 1 
ATOM   5659  N  NH2 . ARG B  1  37  ? 5.141   48.526  -23.975 1.00 48.96  ? 65   ARG B NH2 1 
ATOM   5660  N  N   . GLU B  1  38  ? 3.205   55.244  -21.174 1.00 41.01  ? 66   GLU B N   1 
ATOM   5661  C  CA  . GLU B  1  38  ? 2.498   56.365  -21.815 1.00 40.93  ? 66   GLU B CA  1 
ATOM   5662  C  C   . GLU B  1  38  ? 3.378   57.601  -21.990 1.00 40.20  ? 66   GLU B C   1 
ATOM   5663  O  O   . GLU B  1  38  ? 3.434   58.171  -23.083 1.00 40.13  ? 66   GLU B O   1 
ATOM   5664  C  CB  . GLU B  1  38  ? 1.230   56.737  -21.029 1.00 41.33  ? 66   GLU B CB  1 
ATOM   5665  C  CG  . GLU B  1  38  ? 0.079   55.698  -21.065 1.00 44.15  ? 66   GLU B CG  1 
ATOM   5666  C  CD  . GLU B  1  38  ? 0.360   54.409  -20.253 1.00 47.69  ? 66   GLU B CD  1 
ATOM   5667  O  OE1 . GLU B  1  38  ? 0.920   54.493  -19.123 1.00 47.79  ? 66   GLU B OE1 1 
ATOM   5668  O  OE2 . GLU B  1  38  ? 0.010   53.309  -20.755 1.00 48.50  ? 66   GLU B OE2 1 
ATOM   5669  N  N   . GLU B  1  39  ? 4.067   57.999  -20.917 1.00 39.47  ? 67   GLU B N   1 
ATOM   5670  C  CA  . GLU B  1  39  ? 4.930   59.186  -20.933 1.00 38.66  ? 67   GLU B CA  1 
ATOM   5671  C  C   . GLU B  1  39  ? 6.075   59.041  -21.935 1.00 38.33  ? 67   GLU B C   1 
ATOM   5672  O  O   . GLU B  1  39  ? 6.296   59.932  -22.759 1.00 38.07  ? 67   GLU B O   1 
ATOM   5673  C  CB  . GLU B  1  39  ? 5.462   59.511  -19.533 1.00 38.30  ? 67   GLU B CB  1 
ATOM   5674  C  CG  . GLU B  1  39  ? 4.508   60.313  -18.643 1.00 38.39  ? 67   GLU B CG  1 
ATOM   5675  C  CD  . GLU B  1  39  ? 4.901   60.260  -17.160 1.00 38.68  ? 67   GLU B CD  1 
ATOM   5676  O  OE1 . GLU B  1  39  ? 4.272   60.941  -16.318 1.00 37.71  ? 67   GLU B OE1 1 
ATOM   5677  O  OE2 . GLU B  1  39  ? 5.845   59.522  -16.828 1.00 38.70  ? 67   GLU B OE2 1 
ATOM   5678  N  N   . LEU B  1  40  ? 6.782   57.911  -21.862 1.00 38.23  ? 68   LEU B N   1 
ATOM   5679  C  CA  . LEU B  1  40  ? 7.840   57.561  -22.810 1.00 37.94  ? 68   LEU B CA  1 
ATOM   5680  C  C   . LEU B  1  40  ? 7.315   57.591  -24.237 1.00 38.02  ? 68   LEU B C   1 
ATOM   5681  O  O   . LEU B  1  40  ? 7.953   58.152  -25.122 1.00 37.79  ? 68   LEU B O   1 
ATOM   5682  C  CB  . LEU B  1  40  ? 8.417   56.175  -22.490 1.00 37.94  ? 68   LEU B CB  1 
ATOM   5683  C  CG  . LEU B  1  40  ? 9.261   56.004  -21.218 1.00 37.40  ? 68   LEU B CG  1 
ATOM   5684  C  CD1 . LEU B  1  40  ? 9.440   54.552  -20.872 1.00 36.33  ? 68   LEU B CD1 1 
ATOM   5685  C  CD2 . LEU B  1  40  ? 10.625  56.663  -21.362 1.00 37.63  ? 68   LEU B CD2 1 
ATOM   5686  N  N   . THR B  1  41  ? 6.138   57.006  -24.447 1.00 38.51  ? 69   THR B N   1 
ATOM   5687  C  CA  . THR B  1  41  ? 5.501   56.983  -25.764 1.00 39.02  ? 69   THR B CA  1 
ATOM   5688  C  C   . THR B  1  41  ? 5.331   58.411  -26.282 1.00 39.18  ? 69   THR B C   1 
ATOM   5689  O  O   . THR B  1  41  ? 5.708   58.710  -27.413 1.00 39.42  ? 69   THR B O   1 
ATOM   5690  C  CB  . THR B  1  41  ? 4.117   56.250  -25.728 1.00 39.41  ? 69   THR B CB  1 
ATOM   5691  O  OG1 . THR B  1  41  ? 4.258   54.951  -25.129 1.00 39.69  ? 69   THR B OG1 1 
ATOM   5692  C  CG2 . THR B  1  41  ? 3.512   56.103  -27.139 1.00 38.74  ? 69   THR B CG2 1 
ATOM   5693  N  N   . ALA B  1  42  ? 4.792   59.287  -25.435 1.00 39.21  ? 70   ALA B N   1 
ATOM   5694  C  CA  . ALA B  1  42  ? 4.517   60.676  -25.805 1.00 39.45  ? 70   ALA B CA  1 
ATOM   5695  C  C   . ALA B  1  42  ? 5.774   61.473  -26.145 1.00 39.71  ? 70   ALA B C   1 
ATOM   5696  O  O   . ALA B  1  42  ? 5.759   62.273  -27.075 1.00 39.66  ? 70   ALA B O   1 
ATOM   5697  C  CB  . ALA B  1  42  ? 3.721   61.373  -24.713 1.00 39.21  ? 70   ALA B CB  1 
ATOM   5698  N  N   . VAL B  1  43  ? 6.855   61.260  -25.397 1.00 40.22  ? 71   VAL B N   1 
ATOM   5699  C  CA  . VAL B  1  43  ? 8.123   61.918  -25.708 1.00 40.89  ? 71   VAL B CA  1 
ATOM   5700  C  C   . VAL B  1  43  ? 8.643   61.449  -27.068 1.00 41.52  ? 71   VAL B C   1 
ATOM   5701  O  O   . VAL B  1  43  ? 9.050   62.266  -27.894 1.00 41.93  ? 71   VAL B O   1 
ATOM   5702  C  CB  . VAL B  1  43  ? 9.208   61.680  -24.636 1.00 40.78  ? 71   VAL B CB  1 
ATOM   5703  C  CG1 . VAL B  1  43  ? 10.485  62.411  -25.016 1.00 41.00  ? 71   VAL B CG1 1 
ATOM   5704  C  CG2 . VAL B  1  43  ? 8.743   62.156  -23.289 1.00 40.49  ? 71   VAL B CG2 1 
ATOM   5705  N  N   . MET B  1  44  ? 8.617   60.138  -27.301 1.00 41.92  ? 72   MET B N   1 
ATOM   5706  C  CA  . MET B  1  44  ? 9.074   59.582  -28.569 1.00 42.41  ? 72   MET B CA  1 
ATOM   5707  C  C   . MET B  1  44  ? 8.267   60.138  -29.749 1.00 42.48  ? 72   MET B C   1 
ATOM   5708  O  O   . MET B  1  44  ? 8.829   60.487  -30.789 1.00 42.50  ? 72   MET B O   1 
ATOM   5709  C  CB  . MET B  1  44  ? 9.029   58.049  -28.540 1.00 42.59  ? 72   MET B CB  1 
ATOM   5710  C  CG  . MET B  1  44  ? 9.738   57.396  -29.707 1.00 43.40  ? 72   MET B CG  1 
ATOM   5711  S  SD  . MET B  1  44  ? 11.430  58.008  -29.870 1.00 47.02  ? 72   MET B SD  1 
ATOM   5712  C  CE  . MET B  1  44  ? 12.401  56.684  -29.170 1.00 45.87  ? 72   MET B CE  1 
ATOM   5713  N  N   . ARG B  1  45  ? 6.954   60.227  -29.563 1.00 42.61  ? 73   ARG B N   1 
ATOM   5714  C  CA  . ARG B  1  45  ? 6.044   60.747  -30.575 1.00 42.91  ? 73   ARG B CA  1 
ATOM   5715  C  C   . ARG B  1  45  ? 6.349   62.206  -30.932 1.00 42.87  ? 73   ARG B C   1 
ATOM   5716  O  O   . ARG B  1  45  ? 6.233   62.608  -32.099 1.00 43.12  ? 73   ARG B O   1 
ATOM   5717  C  CB  . ARG B  1  45  ? 4.595   60.577  -30.101 1.00 42.81  ? 73   ARG B CB  1 
ATOM   5718  C  CG  . ARG B  1  45  ? 3.557   61.269  -30.958 1.00 43.26  ? 73   ARG B CG  1 
ATOM   5719  C  CD  . ARG B  1  45  ? 2.136   60.840  -30.613 1.00 43.63  ? 73   ARG B CD  1 
ATOM   5720  N  NE  . ARG B  1  45  ? 1.233   61.992  -30.598 1.00 45.43  ? 73   ARG B NE  1 
ATOM   5721  C  CZ  . ARG B  1  45  ? 0.817   62.653  -31.680 1.00 46.23  ? 73   ARG B CZ  1 
ATOM   5722  N  NH1 . ARG B  1  45  ? 1.207   62.286  -32.903 1.00 45.95  ? 73   ARG B NH1 1 
ATOM   5723  N  NH2 . ARG B  1  45  ? 0.005   63.693  -31.534 1.00 46.22  ? 73   ARG B NH2 1 
ATOM   5724  N  N   . PHE B  1  46  ? 6.744   62.987  -29.928 1.00 42.84  ? 74   PHE B N   1 
ATOM   5725  C  CA  . PHE B  1  46  ? 7.118   64.389  -30.124 1.00 42.88  ? 74   PHE B CA  1 
ATOM   5726  C  C   . PHE B  1  46  ? 8.495   64.514  -30.780 1.00 43.36  ? 74   PHE B C   1 
ATOM   5727  O  O   . PHE B  1  46  ? 8.738   65.442  -31.556 1.00 43.36  ? 74   PHE B O   1 
ATOM   5728  C  CB  . PHE B  1  46  ? 7.080   65.142  -28.791 1.00 42.32  ? 74   PHE B CB  1 
ATOM   5729  C  CG  . PHE B  1  46  ? 7.327   66.627  -28.908 1.00 41.58  ? 74   PHE B CG  1 
ATOM   5730  C  CD1 . PHE B  1  46  ? 6.297   67.497  -29.261 1.00 40.40  ? 74   PHE B CD1 1 
ATOM   5731  C  CD2 . PHE B  1  46  ? 8.586   67.162  -28.631 1.00 40.48  ? 74   PHE B CD2 1 
ATOM   5732  C  CE1 . PHE B  1  46  ? 6.526   68.871  -29.354 1.00 39.63  ? 74   PHE B CE1 1 
ATOM   5733  C  CE2 . PHE B  1  46  ? 8.819   68.536  -28.722 1.00 39.35  ? 74   PHE B CE2 1 
ATOM   5734  C  CZ  . PHE B  1  46  ? 7.791   69.387  -29.085 1.00 39.93  ? 74   PHE B CZ  1 
ATOM   5735  N  N   . LEU B  1  47  ? 9.390   63.580  -30.467 1.00 43.99  ? 75   LEU B N   1 
ATOM   5736  C  CA  . LEU B  1  47  ? 10.730  63.569  -31.062 1.00 44.65  ? 75   LEU B CA  1 
ATOM   5737  C  C   . LEU B  1  47  ? 10.712  63.156  -32.530 1.00 45.31  ? 75   LEU B C   1 
ATOM   5738  O  O   . LEU B  1  47  ? 11.420  63.752  -33.343 1.00 45.17  ? 75   LEU B O   1 
ATOM   5739  C  CB  . LEU B  1  47  ? 11.677  62.667  -30.270 1.00 44.47  ? 75   LEU B CB  1 
ATOM   5740  C  CG  . LEU B  1  47  ? 12.187  63.161  -28.913 1.00 43.99  ? 75   LEU B CG  1 
ATOM   5741  C  CD1 . LEU B  1  47  ? 13.102  62.121  -28.330 1.00 43.46  ? 75   LEU B CD1 1 
ATOM   5742  C  CD2 . LEU B  1  47  ? 12.917  64.493  -29.030 1.00 43.32  ? 75   LEU B CD2 1 
ATOM   5743  N  N   . THR B  1  48  ? 9.899   62.145  -32.855 1.00 46.34  ? 76   THR B N   1 
ATOM   5744  C  CA  . THR B  1  48  ? 9.721   61.666  -34.236 1.00 47.42  ? 76   THR B CA  1 
ATOM   5745  C  C   . THR B  1  48  ? 8.959   62.667  -35.114 1.00 48.08  ? 76   THR B C   1 
ATOM   5746  O  O   . THR B  1  48  ? 8.552   62.330  -36.221 1.00 48.30  ? 76   THR B O   1 
ATOM   5747  C  CB  . THR B  1  48  ? 9.017   60.267  -34.308 1.00 47.30  ? 76   THR B CB  1 
ATOM   5748  O  OG1 . THR B  1  48  ? 8.088   60.134  -33.231 1.00 48.67  ? 76   THR B OG1 1 
ATOM   5749  C  CG2 . THR B  1  48  ? 10.016  59.128  -34.207 1.00 47.47  ? 76   THR B CG2 1 
ATOM   5750  N  N   . GLN B  1  49  ? 8.760   63.889  -34.619 1.00 48.81  ? 77   GLN B N   1 
ATOM   5751  C  CA  . GLN B  1  49  ? 8.195   64.962  -35.434 1.00 49.73  ? 77   GLN B CA  1 
ATOM   5752  C  C   . GLN B  1  49  ? 9.215   66.074  -35.642 1.00 49.78  ? 77   GLN B C   1 
ATOM   5753  O  O   . GLN B  1  49  ? 9.445   66.517  -36.768 1.00 49.98  ? 77   GLN B O   1 
ATOM   5754  C  CB  . GLN B  1  49  ? 6.927   65.531  -34.804 1.00 49.58  ? 77   GLN B CB  1 
ATOM   5755  C  CG  . GLN B  1  49  ? 5.759   64.559  -34.731 1.00 50.73  ? 77   GLN B CG  1 
ATOM   5756  C  CD  . GLN B  1  49  ? 4.480   65.203  -34.181 1.00 51.19  ? 77   GLN B CD  1 
ATOM   5757  O  OE1 . GLN B  1  49  ? 4.499   66.335  -33.674 1.00 52.72  ? 77   GLN B OE1 1 
ATOM   5758  N  NE2 . GLN B  1  49  ? 3.360   64.478  -34.286 1.00 53.02  ? 77   GLN B NE2 1 
ATOM   5759  N  N   . ARG B  1  50  ? 9.836   66.506  -34.551 1.00 49.97  ? 78   ARG B N   1 
ATOM   5760  C  CA  . ARG B  1  50  ? 10.752  67.636  -34.575 1.00 50.10  ? 78   ARG B CA  1 
ATOM   5761  C  C   . ARG B  1  50  ? 12.103  67.331  -35.222 1.00 50.14  ? 78   ARG B C   1 
ATOM   5762  O  O   . ARG B  1  50  ? 12.687  68.204  -35.853 1.00 50.41  ? 78   ARG B O   1 
ATOM   5763  C  CB  . ARG B  1  50  ? 10.961  68.175  -33.158 1.00 50.10  ? 78   ARG B CB  1 
ATOM   5764  C  CG  . ARG B  1  50  ? 9.691   68.636  -32.472 1.00 50.81  ? 78   ARG B CG  1 
ATOM   5765  C  CD  . ARG B  1  50  ? 9.183   69.937  -33.070 1.00 52.84  ? 78   ARG B CD  1 
ATOM   5766  N  NE  . ARG B  1  50  ? 7.724   70.046  -33.012 1.00 54.01  ? 78   ARG B NE  1 
ATOM   5767  C  CZ  . ARG B  1  50  ? 7.058   70.851  -32.187 1.00 54.63  ? 78   ARG B CZ  1 
ATOM   5768  N  NH1 . ARG B  1  50  ? 7.715   71.632  -31.333 1.00 54.31  ? 78   ARG B NH1 1 
ATOM   5769  N  NH2 . ARG B  1  50  ? 5.728   70.880  -32.221 1.00 54.68  ? 78   ARG B NH2 1 
ATOM   5770  N  N   . LEU B  1  51  ? 12.600  66.105  -35.077 1.00 50.07  ? 79   LEU B N   1 
ATOM   5771  C  CA  . LEU B  1  51  ? 13.975  65.796  -35.482 1.00 50.18  ? 79   LEU B CA  1 
ATOM   5772  C  C   . LEU B  1  51  ? 14.152  65.491  -36.970 1.00 50.67  ? 79   LEU B C   1 
ATOM   5773  O  O   . LEU B  1  51  ? 15.262  65.196  -37.429 1.00 50.82  ? 79   LEU B O   1 
ATOM   5774  C  CB  . LEU B  1  51  ? 14.552  64.662  -34.635 1.00 50.04  ? 79   LEU B CB  1 
ATOM   5775  C  CG  . LEU B  1  51  ? 14.674  64.922  -33.133 1.00 49.60  ? 79   LEU B CG  1 
ATOM   5776  C  CD1 . LEU B  1  51  ? 15.032  63.639  -32.410 1.00 48.84  ? 79   LEU B CD1 1 
ATOM   5777  C  CD2 . LEU B  1  51  ? 15.689  66.023  -32.836 1.00 49.09  ? 79   LEU B CD2 1 
ATOM   5778  N  N   . GLY B  1  52  ? 13.065  65.572  -37.726 1.00 50.98  ? 80   GLY B N   1 
ATOM   5779  C  CA  . GLY B  1  52  ? 13.123  65.319  -39.159 1.00 51.33  ? 80   GLY B CA  1 
ATOM   5780  C  C   . GLY B  1  52  ? 12.751  63.892  -39.515 1.00 51.46  ? 80   GLY B C   1 
ATOM   5781  O  O   . GLY B  1  52  ? 12.636  63.032  -38.629 1.00 51.55  ? 80   GLY B O   1 
ATOM   5782  N  N   . PRO B  1  53  ? 12.579  63.624  -40.819 1.00 51.41  ? 81   PRO B N   1 
ATOM   5783  C  CA  . PRO B  1  53  ? 12.034  62.343  -41.268 1.00 51.31  ? 81   PRO B CA  1 
ATOM   5784  C  C   . PRO B  1  53  ? 13.092  61.250  -41.527 1.00 50.92  ? 81   PRO B C   1 
ATOM   5785  O  O   . PRO B  1  53  ? 12.729  60.102  -41.821 1.00 51.04  ? 81   PRO B O   1 
ATOM   5786  C  CB  . PRO B  1  53  ? 11.303  62.720  -42.569 1.00 51.37  ? 81   PRO B CB  1 
ATOM   5787  C  CG  . PRO B  1  53  ? 12.027  63.972  -43.082 1.00 51.41  ? 81   PRO B CG  1 
ATOM   5788  C  CD  . PRO B  1  53  ? 12.896  64.515  -41.954 1.00 51.49  ? 81   PRO B CD  1 
ATOM   5789  N  N   . GLY B  1  54  ? 14.376  61.600  -41.412 1.00 50.25  ? 82   GLY B N   1 
ATOM   5790  C  CA  . GLY B  1  54  ? 15.464  60.655  -41.696 1.00 49.20  ? 82   GLY B CA  1 
ATOM   5791  C  C   . GLY B  1  54  ? 15.983  59.973  -40.446 1.00 48.44  ? 82   GLY B C   1 
ATOM   5792  O  O   . GLY B  1  54  ? 17.128  59.491  -40.417 1.00 48.43  ? 82   GLY B O   1 
ATOM   5793  N  N   . LEU B  1  55  ? 15.128  59.936  -39.420 1.00 47.44  ? 83   LEU B N   1 
ATOM   5794  C  CA  . LEU B  1  55  ? 15.469  59.421  -38.086 1.00 46.45  ? 83   LEU B CA  1 
ATOM   5795  C  C   . LEU B  1  55  ? 15.289  57.907  -38.022 1.00 45.65  ? 83   LEU B C   1 
ATOM   5796  O  O   . LEU B  1  55  ? 14.195  57.391  -38.277 1.00 45.77  ? 83   LEU B O   1 
ATOM   5797  C  CB  . LEU B  1  55  ? 14.603  60.110  -37.027 1.00 46.24  ? 83   LEU B CB  1 
ATOM   5798  C  CG  . LEU B  1  55  ? 14.701  59.728  -35.552 1.00 46.33  ? 83   LEU B CG  1 
ATOM   5799  C  CD1 . LEU B  1  55  ? 15.992  60.239  -34.906 1.00 45.41  ? 83   LEU B CD1 1 
ATOM   5800  C  CD2 . LEU B  1  55  ? 13.487  60.285  -34.822 1.00 46.57  ? 83   LEU B CD2 1 
ATOM   5801  N  N   . VAL B  1  56  ? 16.366  57.208  -37.676 1.00 44.43  ? 84   VAL B N   1 
ATOM   5802  C  CA  . VAL B  1  56  ? 16.413  55.745  -37.712 1.00 43.42  ? 84   VAL B CA  1 
ATOM   5803  C  C   . VAL B  1  56  ? 16.163  55.164  -36.328 1.00 42.36  ? 84   VAL B C   1 
ATOM   5804  O  O   . VAL B  1  56  ? 16.626  55.707  -35.340 1.00 42.20  ? 84   VAL B O   1 
ATOM   5805  C  CB  . VAL B  1  56  ? 17.800  55.255  -38.230 1.00 43.66  ? 84   VAL B CB  1 
ATOM   5806  C  CG1 . VAL B  1  56  ? 17.843  53.725  -38.392 1.00 43.41  ? 84   VAL B CG1 1 
ATOM   5807  C  CG2 . VAL B  1  56  ? 18.145  55.938  -39.547 1.00 44.10  ? 84   VAL B CG2 1 
ATOM   5808  N  N   . ASP B  1  57  ? 15.426  54.064  -36.257 1.00 41.54  ? 85   ASP B N   1 
ATOM   5809  C  CA  . ASP B  1  57  ? 15.344  53.292  -35.019 1.00 41.14  ? 85   ASP B CA  1 
ATOM   5810  C  C   . ASP B  1  57  ? 16.760  52.890  -34.564 1.00 40.54  ? 85   ASP B C   1 
ATOM   5811  O  O   . ASP B  1  57  ? 17.517  52.271  -35.317 1.00 40.19  ? 85   ASP B O   1 
ATOM   5812  C  CB  . ASP B  1  57  ? 14.458  52.055  -35.222 1.00 41.23  ? 85   ASP B CB  1 
ATOM   5813  C  CG  . ASP B  1  57  ? 14.288  51.215  -33.953 1.00 42.58  ? 85   ASP B CG  1 
ATOM   5814  O  OD1 . ASP B  1  57  ? 14.935  51.488  -32.909 1.00 43.15  ? 85   ASP B OD1 1 
ATOM   5815  O  OD2 . ASP B  1  57  ? 13.493  50.252  -34.011 1.00 44.16  ? 85   ASP B OD2 1 
ATOM   5816  N  N   . ALA B  1  58  ? 17.096  53.242  -33.326 1.00 39.79  ? 86   ALA B N   1 
ATOM   5817  C  CA  . ALA B  1  58  ? 18.417  52.990  -32.770 1.00 39.49  ? 86   ALA B CA  1 
ATOM   5818  C  C   . ALA B  1  58  ? 18.826  51.514  -32.716 1.00 39.17  ? 86   ALA B C   1 
ATOM   5819  O  O   . ALA B  1  58  ? 20.011  51.200  -32.783 1.00 38.65  ? 86   ALA B O   1 
ATOM   5820  C  CB  . ALA B  1  58  ? 18.522  53.610  -31.405 1.00 39.84  ? 86   ALA B CB  1 
ATOM   5821  N  N   . ALA B  1  59  ? 17.845  50.619  -32.600 1.00 39.18  ? 87   ALA B N   1 
ATOM   5822  C  CA  . ALA B  1  59  ? 18.096  49.172  -32.596 1.00 39.12  ? 87   ALA B CA  1 
ATOM   5823  C  C   . ALA B  1  59  ? 18.763  48.671  -33.885 1.00 39.29  ? 87   ALA B C   1 
ATOM   5824  O  O   . ALA B  1  59  ? 19.401  47.621  -33.879 1.00 39.51  ? 87   ALA B O   1 
ATOM   5825  C  CB  . ALA B  1  59  ? 16.802  48.403  -32.326 1.00 38.83  ? 87   ALA B CB  1 
ATOM   5826  N  N   . GLN B  1  60  ? 18.614  49.420  -34.978 1.00 39.29  ? 88   GLN B N   1 
ATOM   5827  C  CA  . GLN B  1  60  ? 19.225  49.080  -36.268 1.00 39.59  ? 88   GLN B CA  1 
ATOM   5828  C  C   . GLN B  1  60  ? 20.041  50.228  -36.847 1.00 38.99  ? 88   GLN B C   1 
ATOM   5829  O  O   . GLN B  1  60  ? 20.259  50.281  -38.056 1.00 38.96  ? 88   GLN B O   1 
ATOM   5830  C  CB  . GLN B  1  60  ? 18.151  48.706  -37.292 1.00 39.90  ? 88   GLN B CB  1 
ATOM   5831  C  CG  . GLN B  1  60  ? 17.751  47.252  -37.307 1.00 42.36  ? 88   GLN B CG  1 
ATOM   5832  C  CD  . GLN B  1  60  ? 16.245  47.107  -37.226 1.00 45.49  ? 88   GLN B CD  1 
ATOM   5833  O  OE1 . GLN B  1  60  ? 15.566  46.922  -38.241 1.00 46.91  ? 88   GLN B OE1 1 
ATOM   5834  N  NE2 . GLN B  1  60  ? 15.707  47.234  -36.012 1.00 45.70  ? 88   GLN B NE2 1 
ATOM   5835  N  N   . ALA B  1  61  ? 20.476  51.151  -36.002 1.00 38.57  ? 89   ALA B N   1 
ATOM   5836  C  CA  . ALA B  1  61  ? 21.130  52.350  -36.502 1.00 38.39  ? 89   ALA B CA  1 
ATOM   5837  C  C   . ALA B  1  61  ? 22.596  52.111  -36.825 1.00 38.38  ? 89   ALA B C   1 
ATOM   5838  O  O   . ALA B  1  61  ? 23.292  51.340  -36.152 1.00 38.32  ? 89   ALA B O   1 
ATOM   5839  C  CB  . ALA B  1  61  ? 20.963  53.505  -35.538 1.00 38.12  ? 89   ALA B CB  1 
ATOM   5840  N  N   . ARG B  1  62  ? 23.048  52.768  -37.883 1.00 38.49  ? 90   ARG B N   1 
ATOM   5841  C  CA  . ARG B  1  62  ? 24.443  52.724  -38.285 1.00 38.79  ? 90   ARG B CA  1 
ATOM   5842  C  C   . ARG B  1  62  ? 25.131  53.972  -37.705 1.00 38.29  ? 90   ARG B C   1 
ATOM   5843  O  O   . ARG B  1  62  ? 24.442  54.909  -37.282 1.00 38.29  ? 90   ARG B O   1 
ATOM   5844  C  CB  . ARG B  1  62  ? 24.520  52.687  -39.812 1.00 39.01  ? 90   ARG B CB  1 
ATOM   5845  C  CG  . ARG B  1  62  ? 25.498  51.670  -40.384 1.00 41.64  ? 90   ARG B CG  1 
ATOM   5846  C  CD  . ARG B  1  62  ? 25.297  50.260  -39.799 1.00 45.16  ? 90   ARG B CD  1 
ATOM   5847  N  NE  . ARG B  1  62  ? 24.034  49.651  -40.213 1.00 48.00  ? 90   ARG B NE  1 
ATOM   5848  C  CZ  . ARG B  1  62  ? 23.884  48.360  -40.507 1.00 49.59  ? 90   ARG B CZ  1 
ATOM   5849  N  NH1 . ARG B  1  62  ? 24.916  47.525  -40.445 1.00 49.05  ? 90   ARG B NH1 1 
ATOM   5850  N  NH2 . ARG B  1  62  ? 22.697  47.907  -40.882 1.00 50.76  ? 90   ARG B NH2 1 
ATOM   5851  N  N   . PRO B  1  63  ? 26.483  53.987  -37.647 1.00 37.76  ? 91   PRO B N   1 
ATOM   5852  C  CA  . PRO B  1  63  ? 27.154  55.206  -37.175 1.00 37.24  ? 91   PRO B CA  1 
ATOM   5853  C  C   . PRO B  1  63  ? 26.732  56.507  -37.895 1.00 37.08  ? 91   PRO B C   1 
ATOM   5854  O  O   . PRO B  1  63  ? 26.644  57.555  -37.250 1.00 37.08  ? 91   PRO B O   1 
ATOM   5855  C  CB  . PRO B  1  63  ? 28.638  54.901  -37.418 1.00 37.17  ? 91   PRO B CB  1 
ATOM   5856  C  CG  . PRO B  1  63  ? 28.729  53.419  -37.350 1.00 36.81  ? 91   PRO B CG  1 
ATOM   5857  C  CD  . PRO B  1  63  ? 27.454  52.917  -37.956 1.00 37.62  ? 91   PRO B CD  1 
ATOM   5858  N  N   . SER B  1  64  ? 26.454  56.443  -39.198 1.00 36.64  ? 92   SER B N   1 
ATOM   5859  C  CA  . SER B  1  64  ? 26.109  57.649  -39.973 1.00 36.36  ? 92   SER B CA  1 
ATOM   5860  C  C   . SER B  1  64  ? 24.619  58.054  -39.909 1.00 36.14  ? 92   SER B C   1 
ATOM   5861  O  O   . SER B  1  64  ? 24.165  58.920  -40.669 1.00 36.19  ? 92   SER B O   1 
ATOM   5862  C  CB  . SER B  1  64  ? 26.577  57.508  -41.433 1.00 36.30  ? 92   SER B CB  1 
ATOM   5863  O  OG  . SER B  1  64  ? 25.761  56.604  -42.156 1.00 36.00  ? 92   SER B OG  1 
ATOM   5864  N  N   . ASP B  1  65  ? 23.877  57.430  -38.996 1.00 35.53  ? 93   ASP B N   1 
ATOM   5865  C  CA  . ASP B  1  65  ? 22.447  57.647  -38.859 1.00 34.93  ? 93   ASP B CA  1 
ATOM   5866  C  C   . ASP B  1  65  ? 22.122  58.630  -37.734 1.00 34.70  ? 93   ASP B C   1 
ATOM   5867  O  O   . ASP B  1  65  ? 22.917  58.812  -36.815 1.00 34.61  ? 93   ASP B O   1 
ATOM   5868  C  CB  . ASP B  1  65  ? 21.748  56.311  -38.582 1.00 34.90  ? 93   ASP B CB  1 
ATOM   5869  C  CG  . ASP B  1  65  ? 21.631  55.431  -39.819 1.00 35.22  ? 93   ASP B CG  1 
ATOM   5870  O  OD1 . ASP B  1  65  ? 21.605  55.975  -40.939 1.00 36.77  ? 93   ASP B OD1 1 
ATOM   5871  O  OD2 . ASP B  1  65  ? 21.543  54.191  -39.675 1.00 34.73  ? 93   ASP B OD2 1 
ATOM   5872  N  N   . ASN B  1  66  ? 20.959  59.271  -37.822 1.00 34.33  ? 94   ASN B N   1 
ATOM   5873  C  CA  . ASN B  1  66  ? 20.385  59.955  -36.673 1.00 34.18  ? 94   ASN B CA  1 
ATOM   5874  C  C   . ASN B  1  66  ? 19.470  58.984  -35.935 1.00 33.83  ? 94   ASN B C   1 
ATOM   5875  O  O   . ASN B  1  66  ? 18.576  58.390  -36.543 1.00 33.87  ? 94   ASN B O   1 
ATOM   5876  C  CB  . ASN B  1  66  ? 19.598  61.200  -37.094 1.00 34.23  ? 94   ASN B CB  1 
ATOM   5877  C  CG  . ASN B  1  66  ? 20.485  62.316  -37.604 1.00 34.71  ? 94   ASN B CG  1 
ATOM   5878  O  OD1 . ASN B  1  66  ? 21.711  62.206  -37.609 1.00 35.44  ? 94   ASN B OD1 1 
ATOM   5879  N  ND2 . ASN B  1  66  ? 19.863  63.414  -38.025 1.00 34.72  ? 94   ASN B ND2 1 
ATOM   5880  N  N   . CYS B  1  67  ? 19.690  58.821  -34.630 1.00 33.40  ? 95   CYS B N   1 
ATOM   5881  C  CA  . CYS B  1  67  ? 18.837  57.951  -33.819 1.00 32.81  ? 95   CYS B CA  1 
ATOM   5882  C  C   . CYS B  1  67  ? 18.731  58.451  -32.395 1.00 32.47  ? 95   CYS B C   1 
ATOM   5883  O  O   . CYS B  1  67  ? 19.577  59.215  -31.932 1.00 32.43  ? 95   CYS B O   1 
ATOM   5884  C  CB  . CYS B  1  67  ? 19.352  56.511  -33.825 1.00 32.67  ? 95   CYS B CB  1 
ATOM   5885  S  SG  . CYS B  1  67  ? 20.880  56.280  -32.910 1.00 32.77  ? 95   CYS B SG  1 
ATOM   5886  N  N   . VAL B  1  68  ? 17.678  58.003  -31.717 1.00 32.05  ? 96   VAL B N   1 
ATOM   5887  C  CA  . VAL B  1  68  ? 17.428  58.330  -30.328 1.00 31.43  ? 96   VAL B CA  1 
ATOM   5888  C  C   . VAL B  1  68  ? 17.887  57.148  -29.494 1.00 31.52  ? 96   VAL B C   1 
ATOM   5889  O  O   . VAL B  1  68  ? 17.365  56.031  -29.627 1.00 31.31  ? 96   VAL B O   1 
ATOM   5890  C  CB  . VAL B  1  68  ? 15.938  58.617  -30.077 1.00 31.68  ? 96   VAL B CB  1 
ATOM   5891  C  CG1 . VAL B  1  68  ? 15.629  58.633  -28.586 1.00 30.96  ? 96   VAL B CG1 1 
ATOM   5892  C  CG2 . VAL B  1  68  ? 15.530  59.943  -30.737 1.00 31.51  ? 96   VAL B CG2 1 
ATOM   5893  N  N   . PHE B  1  69  ? 18.876  57.418  -28.644 1.00 31.18  ? 97   PHE B N   1 
ATOM   5894  C  CA  . PHE B  1  69  ? 19.568  56.401  -27.889 1.00 31.13  ? 97   PHE B CA  1 
ATOM   5895  C  C   . PHE B  1  69  ? 18.835  56.074  -26.598 1.00 31.34  ? 97   PHE B C   1 
ATOM   5896  O  O   . PHE B  1  69  ? 18.751  54.905  -26.220 1.00 31.92  ? 97   PHE B O   1 
ATOM   5897  C  CB  . PHE B  1  69  ? 20.998  56.861  -27.589 1.00 31.25  ? 97   PHE B CB  1 
ATOM   5898  C  CG  . PHE B  1  69  ? 21.745  55.973  -26.613 1.00 30.77  ? 97   PHE B CG  1 
ATOM   5899  C  CD1 . PHE B  1  69  ? 22.177  54.711  -26.991 1.00 29.90  ? 97   PHE B CD1 1 
ATOM   5900  C  CD2 . PHE B  1  69  ? 22.041  56.424  -25.328 1.00 31.25  ? 97   PHE B CD2 1 
ATOM   5901  C  CE1 . PHE B  1  69  ? 22.870  53.898  -26.104 1.00 30.36  ? 97   PHE B CE1 1 
ATOM   5902  C  CE2 . PHE B  1  69  ? 22.735  55.620  -24.425 1.00 31.12  ? 97   PHE B CE2 1 
ATOM   5903  C  CZ  . PHE B  1  69  ? 23.153  54.350  -24.816 1.00 31.35  ? 97   PHE B CZ  1 
ATOM   5904  N  N   . SER B  1  70  ? 18.327  57.105  -25.923 1.00 31.01  ? 98   SER B N   1 
ATOM   5905  C  CA  . SER B  1  70  ? 17.627  56.941  -24.651 1.00 30.72  ? 98   SER B CA  1 
ATOM   5906  C  C   . SER B  1  70  ? 16.648  58.075  -24.367 1.00 30.45  ? 98   SER B C   1 
ATOM   5907  O  O   . SER B  1  70  ? 16.896  59.235  -24.706 1.00 30.41  ? 98   SER B O   1 
ATOM   5908  C  CB  . SER B  1  70  ? 18.625  56.839  -23.497 1.00 30.45  ? 98   SER B CB  1 
ATOM   5909  O  OG  . SER B  1  70  ? 19.310  58.065  -23.299 1.00 31.07  ? 98   SER B OG  1 
ATOM   5910  N  N   . VAL B  1  71  ? 15.535  57.725  -23.739 1.00 30.36  ? 99   VAL B N   1 
ATOM   5911  C  CA  . VAL B  1  71  ? 14.603  58.711  -23.203 1.00 30.64  ? 99   VAL B CA  1 
ATOM   5912  C  C   . VAL B  1  71  ? 14.294  58.299  -21.764 1.00 30.85  ? 99   VAL B C   1 
ATOM   5913  O  O   . VAL B  1  71  ? 13.900  57.156  -21.519 1.00 31.43  ? 99   VAL B O   1 
ATOM   5914  C  CB  . VAL B  1  71  ? 13.299  58.796  -24.042 1.00 30.58  ? 99   VAL B CB  1 
ATOM   5915  C  CG1 . VAL B  1  71  ? 12.281  59.709  -23.374 1.00 30.65  ? 99   VAL B CG1 1 
ATOM   5916  C  CG2 . VAL B  1  71  ? 13.591  59.280  -25.463 1.00 30.26  ? 99   VAL B CG2 1 
ATOM   5917  N  N   . GLU B  1  72  ? 14.503  59.213  -20.818 1.00 30.83  ? 100  GLU B N   1 
ATOM   5918  C  CA  . GLU B  1  72  ? 14.190  58.960  -19.400 1.00 31.13  ? 100  GLU B CA  1 
ATOM   5919  C  C   . GLU B  1  72  ? 13.940  60.256  -18.622 1.00 30.95  ? 100  GLU B C   1 
ATOM   5920  O  O   . GLU B  1  72  ? 14.231  61.349  -19.115 1.00 30.99  ? 100  GLU B O   1 
ATOM   5921  C  CB  . GLU B  1  72  ? 15.317  58.183  -18.716 1.00 31.44  ? 100  GLU B CB  1 
ATOM   5922  C  CG  . GLU B  1  72  ? 16.685  58.849  -18.862 1.00 31.92  ? 100  GLU B CG  1 
ATOM   5923  C  CD  . GLU B  1  72  ? 17.711  58.369  -17.860 1.00 32.04  ? 100  GLU B CD  1 
ATOM   5924  O  OE1 . GLU B  1  72  ? 17.343  57.677  -16.877 1.00 31.22  ? 100  GLU B OE1 1 
ATOM   5925  O  OE2 . GLU B  1  72  ? 18.901  58.697  -18.074 1.00 33.18  ? 100  GLU B OE2 1 
ATOM   5926  N  N   . LEU B  1  73  ? 13.420  60.108  -17.403 1.00 30.45  ? 101  LEU B N   1 
ATOM   5927  C  CA  . LEU B  1  73  ? 13.120  61.231  -16.516 1.00 29.95  ? 101  LEU B CA  1 
ATOM   5928  C  C   . LEU B  1  73  ? 14.277  62.227  -16.350 1.00 29.74  ? 101  LEU B C   1 
ATOM   5929  O  O   . LEU B  1  73  ? 15.436  61.834  -16.162 1.00 29.20  ? 101  LEU B O   1 
ATOM   5930  C  CB  . LEU B  1  73  ? 12.694  60.711  -15.145 1.00 29.38  ? 101  LEU B CB  1 
ATOM   5931  C  CG  . LEU B  1  73  ? 12.325  61.778  -14.126 1.00 29.78  ? 101  LEU B CG  1 
ATOM   5932  C  CD1 . LEU B  1  73  ? 10.997  62.453  -14.509 1.00 29.86  ? 101  LEU B CD1 1 
ATOM   5933  C  CD2 . LEU B  1  73  ? 12.253  61.177  -12.715 1.00 30.02  ? 101  LEU B CD2 1 
ATOM   5934  N  N   . GLN B  1  74  ? 13.940  63.514  -16.447 1.00 29.50  ? 102  GLN B N   1 
ATOM   5935  C  CA  . GLN B  1  74  ? 14.859  64.599  -16.114 1.00 29.39  ? 102  GLN B CA  1 
ATOM   5936  C  C   . GLN B  1  74  ? 14.504  65.035  -14.699 1.00 29.43  ? 102  GLN B C   1 
ATOM   5937  O  O   . GLN B  1  74  ? 13.526  65.753  -14.511 1.00 30.13  ? 102  GLN B O   1 
ATOM   5938  C  CB  . GLN B  1  74  ? 14.696  65.758  -17.113 1.00 29.29  ? 102  GLN B CB  1 
ATOM   5939  C  CG  . GLN B  1  74  ? 15.486  67.055  -16.808 1.00 29.39  ? 102  GLN B CG  1 
ATOM   5940  C  CD  . GLN B  1  74  ? 16.969  66.815  -16.523 1.00 30.01  ? 102  GLN B CD  1 
ATOM   5941  O  OE1 . GLN B  1  74  ? 17.724  66.361  -17.384 1.00 28.98  ? 102  GLN B OE1 1 
ATOM   5942  N  NE2 . GLN B  1  74  ? 17.383  67.118  -15.304 1.00 29.71  ? 102  GLN B NE2 1 
ATOM   5943  N  N   . LEU B  1  75  ? 15.267  64.581  -13.704 1.00 29.08  ? 103  LEU B N   1 
ATOM   5944  C  CA  . LEU B  1  75  ? 14.956  64.861  -12.298 1.00 28.77  ? 103  LEU B CA  1 
ATOM   5945  C  C   . LEU B  1  75  ? 14.665  66.347  -12.124 1.00 28.79  ? 103  LEU B C   1 
ATOM   5946  O  O   . LEU B  1  75  ? 15.342  67.181  -12.715 1.00 29.60  ? 103  LEU B O   1 
ATOM   5947  C  CB  . LEU B  1  75  ? 16.108  64.438  -11.378 1.00 28.55  ? 103  LEU B CB  1 
ATOM   5948  C  CG  . LEU B  1  75  ? 16.598  62.990  -11.440 1.00 28.81  ? 103  LEU B CG  1 
ATOM   5949  C  CD1 . LEU B  1  75  ? 17.913  62.859  -10.687 1.00 29.26  ? 103  LEU B CD1 1 
ATOM   5950  C  CD2 . LEU B  1  75  ? 15.549  62.012  -10.909 1.00 29.18  ? 103  LEU B CD2 1 
ATOM   5951  N  N   . PRO B  1  76  ? 13.646  66.690  -11.327 1.00 28.64  ? 104  PRO B N   1 
ATOM   5952  C  CA  . PRO B  1  76  ? 13.291  68.096  -11.192 1.00 28.56  ? 104  PRO B CA  1 
ATOM   5953  C  C   . PRO B  1  76  ? 14.332  68.892  -10.393 1.00 28.45  ? 104  PRO B C   1 
ATOM   5954  O  O   . PRO B  1  76  ? 15.095  68.296  -9.624  1.00 28.10  ? 104  PRO B O   1 
ATOM   5955  C  CB  . PRO B  1  76  ? 11.978  68.039  -10.418 1.00 28.85  ? 104  PRO B CB  1 
ATOM   5956  C  CG  . PRO B  1  76  ? 12.048  66.769  -9.646  1.00 28.59  ? 104  PRO B CG  1 
ATOM   5957  C  CD  . PRO B  1  76  ? 12.779  65.814  -10.517 1.00 28.33  ? 104  PRO B CD  1 
ATOM   5958  N  N   . PRO B  1  77  ? 14.361  70.230  -10.576 1.00 28.44  ? 105  PRO B N   1 
ATOM   5959  C  CA  . PRO B  1  77  ? 15.234  71.090  -9.749  1.00 28.13  ? 105  PRO B CA  1 
ATOM   5960  C  C   . PRO B  1  77  ? 14.750  71.035  -8.310  1.00 28.29  ? 105  PRO B C   1 
ATOM   5961  O  O   . PRO B  1  77  ? 13.540  71.084  -8.076  1.00 28.70  ? 105  PRO B O   1 
ATOM   5962  C  CB  . PRO B  1  77  ? 15.012  72.503  -10.303 1.00 28.12  ? 105  PRO B CB  1 
ATOM   5963  C  CG  . PRO B  1  77  ? 14.159  72.349  -11.560 1.00 28.34  ? 105  PRO B CG  1 
ATOM   5964  C  CD  . PRO B  1  77  ? 13.552  70.986  -11.557 1.00 28.05  ? 105  PRO B CD  1 
ATOM   5965  N  N   . LYS B  1  78  ? 15.679  70.959  -7.360  1.00 28.06  ? 106  LYS B N   1 
ATOM   5966  C  CA  . LYS B  1  78  ? 15.342  70.779  -5.947  1.00 27.56  ? 106  LYS B CA  1 
ATOM   5967  C  C   . LYS B  1  78  ? 14.443  71.869  -5.343  1.00 27.88  ? 106  LYS B C   1 
ATOM   5968  O  O   . LYS B  1  78  ? 13.523  71.551  -4.570  1.00 28.51  ? 106  LYS B O   1 
ATOM   5969  C  CB  . LYS B  1  78  ? 16.623  70.634  -5.124  1.00 27.18  ? 106  LYS B CB  1 
ATOM   5970  C  CG  . LYS B  1  78  ? 16.436  70.167  -3.694  1.00 26.53  ? 106  LYS B CG  1 
ATOM   5971  C  CD  . LYS B  1  78  ? 17.793  69.838  -3.065  1.00 26.41  ? 106  LYS B CD  1 
ATOM   5972  C  CE  . LYS B  1  78  ? 17.691  69.519  -1.584  1.00 25.91  ? 106  LYS B CE  1 
ATOM   5973  N  NZ  . LYS B  1  78  ? 19.012  69.100  -1.037  1.00 24.31  ? 106  LYS B NZ  1 
ATOM   5974  N  N   . ALA B  1  79  ? 14.699  73.140  -5.666  1.00 27.40  ? 107  ALA B N   1 
ATOM   5975  C  CA  . ALA B  1  79  ? 13.963  74.223  -5.001  1.00 27.13  ? 107  ALA B CA  1 
ATOM   5976  C  C   . ALA B  1  79  ? 12.470  74.173  -5.344  1.00 27.09  ? 107  ALA B C   1 
ATOM   5977  O  O   . ALA B  1  79  ? 11.621  74.272  -4.455  1.00 27.46  ? 107  ALA B O   1 
ATOM   5978  C  CB  . ALA B  1  79  ? 14.569  75.607  -5.301  1.00 26.45  ? 107  ALA B CB  1 
ATOM   5979  N  N   . ALA B  1  80  ? 12.161  73.987  -6.621  1.00 26.57  ? 108  ALA B N   1 
ATOM   5980  C  CA  . ALA B  1  80  ? 10.784  73.841  -7.051  1.00 26.75  ? 108  ALA B CA  1 
ATOM   5981  C  C   . ALA B  1  80  ? 10.172  72.528  -6.560  1.00 26.92  ? 108  ALA B C   1 
ATOM   5982  O  O   . ALA B  1  80  ? 8.995   72.500  -6.207  1.00 26.81  ? 108  ALA B O   1 
ATOM   5983  C  CB  . ALA B  1  80  ? 10.665  73.967  -8.580  1.00 26.51  ? 108  ALA B CB  1 
ATOM   5984  N  N   . ALA B  1  81  ? 10.965  71.453  -6.541  1.00 27.21  ? 109  ALA B N   1 
ATOM   5985  C  CA  . ALA B  1  81  ? 10.533  70.180  -5.959  1.00 27.72  ? 109  ALA B CA  1 
ATOM   5986  C  C   . ALA B  1  81  ? 10.107  70.330  -4.498  1.00 28.11  ? 109  ALA B C   1 
ATOM   5987  O  O   . ALA B  1  81  ? 9.038   69.867  -4.113  1.00 27.98  ? 109  ALA B O   1 
ATOM   5988  C  CB  . ALA B  1  81  ? 11.619  69.137  -6.073  1.00 27.78  ? 109  ALA B CB  1 
ATOM   5989  N  N   . LEU B  1  82  ? 10.941  70.972  -3.687  1.00 28.71  ? 110  LEU B N   1 
ATOM   5990  C  CA  . LEU B  1  82  ? 10.658  71.094  -2.254  1.00 29.36  ? 110  LEU B CA  1 
ATOM   5991  C  C   . LEU B  1  82  ? 9.491   72.022  -1.965  1.00 29.72  ? 110  LEU B C   1 
ATOM   5992  O  O   . LEU B  1  82  ? 8.640   71.701  -1.131  1.00 29.70  ? 110  LEU B O   1 
ATOM   5993  C  CB  . LEU B  1  82  ? 11.895  71.538  -1.479  1.00 29.35  ? 110  LEU B CB  1 
ATOM   5994  C  CG  . LEU B  1  82  ? 12.956  70.445  -1.345  1.00 30.68  ? 110  LEU B CG  1 
ATOM   5995  C  CD1 . LEU B  1  82  ? 14.232  71.051  -0.821  1.00 33.48  ? 110  LEU B CD1 1 
ATOM   5996  C  CD2 . LEU B  1  82  ? 12.483  69.335  -0.422  1.00 30.76  ? 110  LEU B CD2 1 
ATOM   5997  N  N   . ALA B  1  83  ? 9.450   73.162  -2.655  1.00 29.94  ? 111  ALA B N   1 
ATOM   5998  C  CA  . ALA B  1  83  ? 8.354   74.110  -2.500  1.00 30.43  ? 111  ALA B CA  1 
ATOM   5999  C  C   . ALA B  1  83  ? 7.010   73.418  -2.746  1.00 30.96  ? 111  ALA B C   1 
ATOM   6000  O  O   . ALA B  1  83  ? 6.044   73.702  -2.045  1.00 31.23  ? 111  ALA B O   1 
ATOM   6001  C  CB  . ALA B  1  83  ? 8.533   75.319  -3.436  1.00 30.10  ? 111  ALA B CB  1 
ATOM   6002  N  N   . HIS B  1  84  ? 6.957   72.504  -3.722  1.00 31.43  ? 112  HIS B N   1 
ATOM   6003  C  CA  . HIS B  1  84  ? 5.745   71.725  -3.976  1.00 32.11  ? 112  HIS B CA  1 
ATOM   6004  C  C   . HIS B  1  84  ? 5.408   70.784  -2.829  1.00 32.38  ? 112  HIS B C   1 
ATOM   6005  O  O   . HIS B  1  84  ? 4.256   70.694  -2.414  1.00 32.71  ? 112  HIS B O   1 
ATOM   6006  C  CB  . HIS B  1  84  ? 5.840   70.914  -5.269  1.00 32.06  ? 112  HIS B CB  1 
ATOM   6007  C  CG  . HIS B  1  84  ? 4.676   69.987  -5.477  1.00 33.85  ? 112  HIS B CG  1 
ATOM   6008  N  ND1 . HIS B  1  84  ? 3.403   70.438  -5.767  1.00 34.84  ? 112  HIS B ND1 1 
ATOM   6009  C  CD2 . HIS B  1  84  ? 4.587   68.635  -5.412  1.00 34.23  ? 112  HIS B CD2 1 
ATOM   6010  C  CE1 . HIS B  1  84  ? 2.587   69.406  -5.888  1.00 34.62  ? 112  HIS B CE1 1 
ATOM   6011  N  NE2 . HIS B  1  84  ? 3.280   68.300  -5.677  1.00 34.01  ? 112  HIS B NE2 1 
ATOM   6012  N  N   . LEU B  1  85  ? 6.418   70.079  -2.338  1.00 32.80  ? 113  LEU B N   1 
ATOM   6013  C  CA  . LEU B  1  85  ? 6.241   69.096  -1.289  1.00 33.29  ? 113  LEU B CA  1 
ATOM   6014  C  C   . LEU B  1  85  ? 5.952   69.744  0.054   1.00 33.87  ? 113  LEU B C   1 
ATOM   6015  O  O   . LEU B  1  85  ? 5.213   69.192  0.853   1.00 33.73  ? 113  LEU B O   1 
ATOM   6016  C  CB  . LEU B  1  85  ? 7.479   68.208  -1.185  1.00 33.05  ? 113  LEU B CB  1 
ATOM   6017  C  CG  . LEU B  1  85  ? 7.813   67.305  -2.374  1.00 33.17  ? 113  LEU B CG  1 
ATOM   6018  C  CD1 . LEU B  1  85  ? 9.217   66.776  -2.229  1.00 33.39  ? 113  LEU B CD1 1 
ATOM   6019  C  CD2 . LEU B  1  85  ? 6.828   66.153  -2.510  1.00 33.42  ? 113  LEU B CD2 1 
ATOM   6020  N  N   . ASP B  1  86  ? 6.533   70.918  0.294   1.00 34.83  ? 114  ASP B N   1 
ATOM   6021  C  CA  . ASP B  1  86  ? 6.372   71.624  1.565   1.00 35.42  ? 114  ASP B CA  1 
ATOM   6022  C  C   . ASP B  1  86  ? 5.114   72.478  1.653   1.00 35.66  ? 114  ASP B C   1 
ATOM   6023  O  O   . ASP B  1  86  ? 4.274   72.212  2.507   1.00 35.69  ? 114  ASP B O   1 
ATOM   6024  C  CB  . ASP B  1  86  ? 7.622   72.438  1.893   1.00 35.71  ? 114  ASP B CB  1 
ATOM   6025  C  CG  . ASP B  1  86  ? 8.854   71.548  2.115   1.00 37.85  ? 114  ASP B CG  1 
ATOM   6026  O  OD1 . ASP B  1  86  ? 8.708   70.287  2.053   1.00 38.23  ? 114  ASP B OD1 1 
ATOM   6027  O  OD2 . ASP B  1  86  ? 9.959   72.115  2.348   1.00 37.96  ? 114  ASP B OD2 1 
ATOM   6028  N  N   . ARG B  1  87  ? 4.970   73.487  0.791   1.00 35.97  ? 115  ARG B N   1 
ATOM   6029  C  CA  . ARG B  1  87  ? 3.798   74.363  0.870   1.00 36.55  ? 115  ARG B CA  1 
ATOM   6030  C  C   . ARG B  1  87  ? 2.814   74.246  -0.282  1.00 36.08  ? 115  ARG B C   1 
ATOM   6031  O  O   . ARG B  1  87  ? 1.974   75.123  -0.478  1.00 36.38  ? 115  ARG B O   1 
ATOM   6032  C  CB  . ARG B  1  87  ? 4.182   75.831  1.147   1.00 37.20  ? 115  ARG B CB  1 
ATOM   6033  C  CG  . ARG B  1  87  ? 4.867   76.611  0.012   1.00 40.69  ? 115  ARG B CG  1 
ATOM   6034  C  CD  . ARG B  1  87  ? 5.956   77.532  0.587   1.00 45.41  ? 115  ARG B CD  1 
ATOM   6035  N  NE  . ARG B  1  87  ? 7.022   76.721  1.195   1.00 50.05  ? 115  ARG B NE  1 
ATOM   6036  C  CZ  . ARG B  1  87  ? 8.215   76.483  0.643   1.00 52.69  ? 115  ARG B CZ  1 
ATOM   6037  N  NH1 . ARG B  1  87  ? 8.541   77.033  -0.533  1.00 53.73  ? 115  ARG B NH1 1 
ATOM   6038  N  NH2 . ARG B  1  87  ? 9.095   75.710  1.277   1.00 52.73  ? 115  ARG B NH2 1 
ATOM   6039  N  N   . GLY B  1  88  ? 2.892   73.149  -1.021  1.00 35.74  ? 116  GLY B N   1 
ATOM   6040  C  CA  . GLY B  1  88  ? 1.953   72.908  -2.112  1.00 35.42  ? 116  GLY B CA  1 
ATOM   6041  C  C   . GLY B  1  88  ? 1.999   73.882  -3.283  1.00 35.25  ? 116  GLY B C   1 
ATOM   6042  O  O   . GLY B  1  88  ? 0.975   74.118  -3.922  1.00 35.30  ? 116  GLY B O   1 
ATOM   6043  N  N   . SER B  1  89  ? 3.174   74.447  -3.577  1.00 34.81  ? 117  SER B N   1 
ATOM   6044  C  CA  . SER B  1  89  ? 3.359   75.228  -4.801  1.00 34.42  ? 117  SER B CA  1 
ATOM   6045  C  C   . SER B  1  89  ? 3.181   74.285  -5.994  1.00 34.34  ? 117  SER B C   1 
ATOM   6046  O  O   . SER B  1  89  ? 3.415   73.085  -5.850  1.00 34.35  ? 117  SER B O   1 
ATOM   6047  C  CB  . SER B  1  89  ? 4.753   75.853  -4.840  1.00 34.46  ? 117  SER B CB  1 
ATOM   6048  O  OG  . SER B  1  89  ? 4.921   76.845  -3.843  1.00 34.54  ? 117  SER B OG  1 
ATOM   6049  N  N   . PRO B  1  90  ? 2.745   74.807  -7.163  1.00 34.17  ? 118  PRO B N   1 
ATOM   6050  C  CA  . PRO B  1  90  ? 2.649   73.986  -8.371  1.00 33.98  ? 118  PRO B CA  1 
ATOM   6051  C  C   . PRO B  1  90  ? 3.906   73.140  -8.596  1.00 33.83  ? 118  PRO B C   1 
ATOM   6052  O  O   . PRO B  1  90  ? 5.023   73.624  -8.378  1.00 33.89  ? 118  PRO B O   1 
ATOM   6053  C  CB  . PRO B  1  90  ? 2.531   75.026  -9.494  1.00 34.51  ? 118  PRO B CB  1 
ATOM   6054  C  CG  . PRO B  1  90  ? 2.694   76.398  -8.826  1.00 34.16  ? 118  PRO B CG  1 
ATOM   6055  C  CD  . PRO B  1  90  ? 2.297   76.187  -7.422  1.00 34.29  ? 118  PRO B CD  1 
ATOM   6056  N  N   . PRO B  1  91  ? 3.740   71.877  -9.020  1.00 33.48  ? 119  PRO B N   1 
ATOM   6057  C  CA  . PRO B  1  91  ? 4.957   71.079  -9.215  1.00 33.17  ? 119  PRO B CA  1 
ATOM   6058  C  C   . PRO B  1  91  ? 5.785   71.671  -10.351 1.00 32.78  ? 119  PRO B C   1 
ATOM   6059  O  O   . PRO B  1  91  ? 5.227   72.352  -11.216 1.00 32.76  ? 119  PRO B O   1 
ATOM   6060  C  CB  . PRO B  1  91  ? 4.421   69.694  -9.597  1.00 33.07  ? 119  PRO B CB  1 
ATOM   6061  C  CG  . PRO B  1  91  ? 3.026   69.955  -10.137 1.00 33.52  ? 119  PRO B CG  1 
ATOM   6062  C  CD  . PRO B  1  91  ? 2.509   71.132  -9.352  1.00 33.46  ? 119  PRO B CD  1 
ATOM   6063  N  N   . PRO B  1  92  ? 7.109   71.436  -10.351 1.00 32.45  ? 120  PRO B N   1 
ATOM   6064  C  CA  . PRO B  1  92  ? 7.867   71.849  -11.531 1.00 32.30  ? 120  PRO B CA  1 
ATOM   6065  C  C   . PRO B  1  92  ? 7.492   70.953  -12.712 1.00 31.95  ? 120  PRO B C   1 
ATOM   6066  O  O   . PRO B  1  92  ? 7.149   69.781  -12.516 1.00 31.80  ? 120  PRO B O   1 
ATOM   6067  C  CB  . PRO B  1  92  ? 9.330   71.595  -11.118 1.00 32.31  ? 120  PRO B CB  1 
ATOM   6068  C  CG  . PRO B  1  92  ? 9.249   70.503  -10.122 1.00 32.12  ? 120  PRO B CG  1 
ATOM   6069  C  CD  . PRO B  1  92  ? 7.971   70.791  -9.345  1.00 32.35  ? 120  PRO B CD  1 
ATOM   6070  N  N   . ALA B  1  93  ? 7.548   71.504  -13.920 1.00 31.65  ? 121  ALA B N   1 
ATOM   6071  C  CA  . ALA B  1  93  ? 7.305   70.732  -15.138 1.00 31.56  ? 121  ALA B CA  1 
ATOM   6072  C  C   . ALA B  1  93  ? 7.932   69.307  -15.116 1.00 31.56  ? 121  ALA B C   1 
ATOM   6073  O  O   . ALA B  1  93  ? 9.100   69.140  -14.738 1.00 31.28  ? 121  ALA B O   1 
ATOM   6074  C  CB  . ALA B  1  93  ? 7.805   71.520  -16.330 1.00 31.46  ? 121  ALA B CB  1 
ATOM   6075  N  N   . ARG B  1  94  ? 7.132   68.297  -15.481 1.00 31.63  ? 122  ARG B N   1 
ATOM   6076  C  CA  . ARG B  1  94  ? 7.616   66.925  -15.732 1.00 31.51  ? 122  ARG B CA  1 
ATOM   6077  C  C   . ARG B  1  94  ? 8.362   66.917  -17.053 1.00 31.74  ? 122  ARG B C   1 
ATOM   6078  O  O   . ARG B  1  94  ? 7.754   67.126  -18.113 1.00 31.69  ? 122  ARG B O   1 
ATOM   6079  C  CB  . ARG B  1  94  ? 6.451   65.948  -15.902 1.00 31.67  ? 122  ARG B CB  1 
ATOM   6080  C  CG  . ARG B  1  94  ? 5.892   65.318  -14.670 1.00 31.13  ? 122  ARG B CG  1 
ATOM   6081  C  CD  . ARG B  1  94  ? 6.807   64.248  -14.149 1.00 31.10  ? 122  ARG B CD  1 
ATOM   6082  N  NE  . ARG B  1  94  ? 6.607   62.912  -14.710 1.00 27.96  ? 122  ARG B NE  1 
ATOM   6083  C  CZ  . ARG B  1  94  ? 7.088   61.816  -14.121 1.00 27.34  ? 122  ARG B CZ  1 
ATOM   6084  N  NH1 . ARG B  1  94  ? 7.746   61.931  -12.971 1.00 26.42  ? 122  ARG B NH1 1 
ATOM   6085  N  NH2 . ARG B  1  94  ? 6.912   60.612  -14.648 1.00 25.49  ? 122  ARG B NH2 1 
ATOM   6086  N  N   . GLU B  1  95  ? 9.661   66.648  -17.007 1.00 31.53  ? 123  GLU B N   1 
ATOM   6087  C  CA  . GLU B  1  95  ? 10.471  66.695  -18.208 1.00 31.49  ? 123  GLU B CA  1 
ATOM   6088  C  C   . GLU B  1  95  ? 11.216  65.387  -18.461 1.00 31.49  ? 123  GLU B C   1 
ATOM   6089  O  O   . GLU B  1  95  ? 11.470  64.605  -17.545 1.00 31.34  ? 123  GLU B O   1 
ATOM   6090  C  CB  . GLU B  1  95  ? 11.443  67.874  -18.141 1.00 31.77  ? 123  GLU B CB  1 
ATOM   6091  C  CG  . GLU B  1  95  ? 10.766  69.200  -17.796 1.00 32.90  ? 123  GLU B CG  1 
ATOM   6092  C  CD  . GLU B  1  95  ? 11.620  70.416  -18.102 1.00 33.95  ? 123  GLU B CD  1 
ATOM   6093  O  OE1 . GLU B  1  95  ? 12.733  70.547  -17.550 1.00 33.34  ? 123  GLU B OE1 1 
ATOM   6094  O  OE2 . GLU B  1  95  ? 11.163  71.253  -18.901 1.00 35.71  ? 123  GLU B OE2 1 
ATOM   6095  N  N   . ALA B  1  96  ? 11.547  65.146  -19.725 1.00 31.40  ? 124  ALA B N   1 
ATOM   6096  C  CA  . ALA B  1  96  ? 12.357  64.001  -20.085 1.00 31.39  ? 124  ALA B CA  1 
ATOM   6097  C  C   . ALA B  1  96  ? 13.680  64.495  -20.654 1.00 31.55  ? 124  ALA B C   1 
ATOM   6098  O  O   . ALA B  1  96  ? 13.749  65.599  -21.201 1.00 31.69  ? 124  ALA B O   1 
ATOM   6099  C  CB  . ALA B  1  96  ? 11.639  63.151  -21.091 1.00 31.44  ? 124  ALA B CB  1 
ATOM   6100  N  N   . LEU B  1  97  ? 14.724  63.690  -20.500 1.00 31.19  ? 125  LEU B N   1 
ATOM   6101  C  CA  . LEU B  1  97  ? 15.967  63.929  -21.201 1.00 31.21  ? 125  LEU B CA  1 
ATOM   6102  C  C   . LEU B  1  97  ? 16.197  62.839  -22.253 1.00 31.29  ? 125  LEU B C   1 
ATOM   6103  O  O   . LEU B  1  97  ? 16.326  61.645  -21.917 1.00 31.92  ? 125  LEU B O   1 
ATOM   6104  C  CB  . LEU B  1  97  ? 17.158  63.974  -20.238 1.00 31.24  ? 125  LEU B CB  1 
ATOM   6105  C  CG  . LEU B  1  97  ? 18.452  64.308  -20.983 1.00 30.59  ? 125  LEU B CG  1 
ATOM   6106  C  CD1 . LEU B  1  97  ? 18.776  65.793  -20.880 1.00 29.15  ? 125  LEU B CD1 1 
ATOM   6107  C  CD2 . LEU B  1  97  ? 19.583  63.457  -20.479 1.00 30.58  ? 125  LEU B CD2 1 
ATOM   6108  N  N   . ALA B  1  98  ? 16.259  63.264  -23.515 1.00 30.52  ? 126  ALA B N   1 
ATOM   6109  C  CA  . ALA B  1  98  ? 16.604  62.386  -24.623 1.00 29.83  ? 126  ALA B CA  1 
ATOM   6110  C  C   . ALA B  1  98  ? 18.053  62.585  -25.072 1.00 29.42  ? 126  ALA B C   1 
ATOM   6111  O  O   . ALA B  1  98  ? 18.489  63.709  -25.319 1.00 29.13  ? 126  ALA B O   1 
ATOM   6112  C  CB  . ALA B  1  98  ? 15.669  62.624  -25.771 1.00 29.82  ? 126  ALA B CB  1 
ATOM   6113  N  N   . ILE B  1  99  ? 18.797  61.485  -25.145 1.00 28.97  ? 127  ILE B N   1 
ATOM   6114  C  CA  . ILE B  1  99  ? 20.113  61.478  -25.758 1.00 28.54  ? 127  ILE B CA  1 
ATOM   6115  C  C   . ILE B  1  99  ? 19.947  61.057  -27.237 1.00 28.89  ? 127  ILE B C   1 
ATOM   6116  O  O   . ILE B  1  99  ? 19.500  59.943  -27.549 1.00 28.42  ? 127  ILE B O   1 
ATOM   6117  C  CB  . ILE B  1  99  ? 21.097  60.550  -25.000 1.00 28.18  ? 127  ILE B CB  1 
ATOM   6118  C  CG1 . ILE B  1  99  ? 21.381  61.100  -23.595 1.00 27.93  ? 127  ILE B CG1 1 
ATOM   6119  C  CG2 . ILE B  1  99  ? 22.397  60.440  -25.753 1.00 27.31  ? 127  ILE B CG2 1 
ATOM   6120  C  CD1 . ILE B  1  99  ? 21.838  60.069  -22.601 1.00 23.27  ? 127  ILE B CD1 1 
ATOM   6121  N  N   . VAL B  1  100 ? 20.279  61.970  -28.140 1.00 29.23  ? 128  VAL B N   1 
ATOM   6122  C  CA  . VAL B  1  100 ? 20.126  61.718  -29.577 1.00 29.96  ? 128  VAL B CA  1 
ATOM   6123  C  C   . VAL B  1  100 ? 21.512  61.589  -30.219 1.00 30.46  ? 128  VAL B C   1 
ATOM   6124  O  O   . VAL B  1  100 ? 22.395  62.409  -29.957 1.00 30.95  ? 128  VAL B O   1 
ATOM   6125  C  CB  . VAL B  1  100 ? 19.272  62.850  -30.272 1.00 29.80  ? 128  VAL B CB  1 
ATOM   6126  C  CG1 . VAL B  1  100 ? 19.105  62.604  -31.789 1.00 29.45  ? 128  VAL B CG1 1 
ATOM   6127  C  CG2 . VAL B  1  100 ? 17.911  62.973  -29.619 1.00 28.88  ? 128  VAL B CG2 1 
ATOM   6128  N  N   . PHE B  1  101 ? 21.720  60.545  -31.017 1.00 30.95  ? 129  PHE B N   1 
ATOM   6129  C  CA  . PHE B  1  101 ? 22.964  60.425  -31.800 1.00 31.84  ? 129  PHE B CA  1 
ATOM   6130  C  C   . PHE B  1  101 ? 22.776  61.053  -33.177 1.00 32.73  ? 129  PHE B C   1 
ATOM   6131  O  O   . PHE B  1  101 ? 22.018  60.524  -34.004 1.00 32.85  ? 129  PHE B O   1 
ATOM   6132  C  CB  . PHE B  1  101 ? 23.407  58.957  -31.951 1.00 31.49  ? 129  PHE B CB  1 
ATOM   6133  C  CG  . PHE B  1  101 ? 23.830  58.297  -30.657 1.00 31.00  ? 129  PHE B CG  1 
ATOM   6134  C  CD1 . PHE B  1  101 ? 24.115  56.942  -30.629 1.00 30.41  ? 129  PHE B CD1 1 
ATOM   6135  C  CD2 . PHE B  1  101 ? 23.933  59.025  -29.469 1.00 30.13  ? 129  PHE B CD2 1 
ATOM   6136  C  CE1 . PHE B  1  101 ? 24.511  56.323  -29.446 1.00 30.68  ? 129  PHE B CE1 1 
ATOM   6137  C  CE2 . PHE B  1  101 ? 24.318  58.413  -28.290 1.00 30.33  ? 129  PHE B CE2 1 
ATOM   6138  C  CZ  . PHE B  1  101 ? 24.614  57.055  -28.280 1.00 30.60  ? 129  PHE B CZ  1 
ATOM   6139  N  N   . PHE B  1  102 ? 23.442  62.185  -33.416 1.00 33.62  ? 130  PHE B N   1 
ATOM   6140  C  CA  . PHE B  1  102 ? 23.315  62.897  -34.696 1.00 34.56  ? 130  PHE B CA  1 
ATOM   6141  C  C   . PHE B  1  102 ? 24.430  62.508  -35.662 1.00 35.49  ? 130  PHE B C   1 
ATOM   6142  O  O   . PHE B  1  102 ? 25.435  63.205  -35.769 1.00 35.60  ? 130  PHE B O   1 
ATOM   6143  C  CB  . PHE B  1  102 ? 23.283  64.423  -34.493 1.00 34.35  ? 130  PHE B CB  1 
ATOM   6144  C  CG  . PHE B  1  102 ? 21.939  64.960  -34.063 1.00 33.51  ? 130  PHE B CG  1 
ATOM   6145  C  CD1 . PHE B  1  102 ? 21.770  65.506  -32.791 1.00 33.37  ? 130  PHE B CD1 1 
ATOM   6146  C  CD2 . PHE B  1  102 ? 20.850  64.926  -34.931 1.00 32.45  ? 130  PHE B CD2 1 
ATOM   6147  C  CE1 . PHE B  1  102 ? 20.536  66.002  -32.380 1.00 33.64  ? 130  PHE B CE1 1 
ATOM   6148  C  CE2 . PHE B  1  102 ? 19.611  65.419  -34.542 1.00 33.05  ? 130  PHE B CE2 1 
ATOM   6149  C  CZ  . PHE B  1  102 ? 19.448  65.966  -33.258 1.00 34.19  ? 130  PHE B CZ  1 
ATOM   6150  N  N   . GLY B  1  103 ? 24.244  61.389  -36.358 1.00 36.62  ? 131  GLY B N   1 
ATOM   6151  C  CA  . GLY B  1  103 ? 25.254  60.864  -37.284 1.00 37.93  ? 131  GLY B CA  1 
ATOM   6152  C  C   . GLY B  1  103 ? 25.146  61.395  -38.705 1.00 38.85  ? 131  GLY B C   1 
ATOM   6153  O  O   . GLY B  1  103 ? 26.160  61.643  -39.353 1.00 38.99  ? 131  GLY B O   1 
ATOM   6154  N  N   . ARG B  1  104 ? 23.919  61.589  -39.176 1.00 39.64  ? 132  ARG B N   1 
ATOM   6155  C  CA  . ARG B  1  104 ? 23.658  61.997  -40.550 1.00 40.83  ? 132  ARG B CA  1 
ATOM   6156  C  C   . ARG B  1  104 ? 23.906  63.489  -40.804 1.00 40.99  ? 132  ARG B C   1 
ATOM   6157  O  O   . ARG B  1  104 ? 22.980  64.217  -41.163 1.00 40.89  ? 132  ARG B O   1 
ATOM   6158  C  CB  . ARG B  1  104 ? 22.216  61.618  -40.924 1.00 41.39  ? 132  ARG B CB  1 
ATOM   6159  C  CG  . ARG B  1  104 ? 21.918  61.578  -42.424 1.00 43.72  ? 132  ARG B CG  1 
ATOM   6160  C  CD  . ARG B  1  104 ? 22.448  60.297  -43.081 1.00 48.18  ? 132  ARG B CD  1 
ATOM   6161  N  NE  . ARG B  1  104 ? 21.785  59.090  -42.562 1.00 51.50  ? 132  ARG B NE  1 
ATOM   6162  C  CZ  . ARG B  1  104 ? 20.629  58.597  -43.016 1.00 51.81  ? 132  ARG B CZ  1 
ATOM   6163  N  NH1 . ARG B  1  104 ? 19.978  59.199  -44.009 1.00 52.24  ? 132  ARG B NH1 1 
ATOM   6164  N  NH2 . ARG B  1  104 ? 20.119  57.499  -42.471 1.00 51.34  ? 132  ARG B NH2 1 
ATOM   6165  N  N   . GLN B  1  105 ? 25.152  63.937  -40.627 1.00 41.58  ? 133  GLN B N   1 
ATOM   6166  C  CA  . GLN B  1  105 ? 25.542  65.343  -40.888 1.00 42.08  ? 133  GLN B CA  1 
ATOM   6167  C  C   . GLN B  1  105 ? 27.059  65.536  -41.085 1.00 42.57  ? 133  GLN B C   1 
ATOM   6168  O  O   . GLN B  1  105 ? 27.851  64.705  -40.638 1.00 42.34  ? 133  GLN B O   1 
ATOM   6169  C  CB  . GLN B  1  105 ? 25.018  66.282  -39.788 1.00 41.86  ? 133  GLN B CB  1 
ATOM   6170  C  CG  . GLN B  1  105 ? 25.626  66.047  -38.413 1.00 42.14  ? 133  GLN B CG  1 
ATOM   6171  C  CD  . GLN B  1  105 ? 24.809  66.659  -37.288 1.00 41.83  ? 133  GLN B CD  1 
ATOM   6172  O  OE1 . GLN B  1  105 ? 23.577  66.735  -37.354 1.00 40.62  ? 133  GLN B OE1 1 
ATOM   6173  N  NE2 . GLN B  1  105 ? 25.495  67.084  -36.237 1.00 41.31  ? 133  GLN B NE2 1 
ATOM   6174  N  N   . PRO B  1  106 ? 27.466  66.630  -41.771 1.00 43.27  ? 134  PRO B N   1 
ATOM   6175  C  CA  . PRO B  1  106 ? 28.897  66.963  -41.928 1.00 43.55  ? 134  PRO B CA  1 
ATOM   6176  C  C   . PRO B  1  106 ? 29.738  66.913  -40.629 1.00 43.57  ? 134  PRO B C   1 
ATOM   6177  O  O   . PRO B  1  106 ? 30.893  66.473  -40.662 1.00 43.86  ? 134  PRO B O   1 
ATOM   6178  C  CB  . PRO B  1  106 ? 28.875  68.384  -42.528 1.00 43.81  ? 134  PRO B CB  1 
ATOM   6179  C  CG  . PRO B  1  106 ? 27.422  68.857  -42.444 1.00 43.52  ? 134  PRO B CG  1 
ATOM   6180  C  CD  . PRO B  1  106 ? 26.607  67.601  -42.482 1.00 43.33  ? 134  PRO B CD  1 
ATOM   6181  N  N   . GLN B  1  107 ? 29.180  67.352  -39.504 1.00 43.52  ? 135  GLN B N   1 
ATOM   6182  C  CA  . GLN B  1  107 ? 29.872  67.212  -38.204 1.00 43.31  ? 135  GLN B CA  1 
ATOM   6183  C  C   . GLN B  1  107 ? 29.013  66.561  -37.123 1.00 42.25  ? 135  GLN B C   1 
ATOM   6184  O  O   . GLN B  1  107 ? 28.297  67.249  -36.386 1.00 42.09  ? 135  GLN B O   1 
ATOM   6185  C  CB  . GLN B  1  107 ? 30.482  68.536  -37.737 1.00 43.57  ? 135  GLN B CB  1 
ATOM   6186  C  CG  . GLN B  1  107 ? 31.919  68.675  -38.205 1.00 45.94  ? 135  GLN B CG  1 
ATOM   6187  C  CD  . GLN B  1  107 ? 32.271  70.081  -38.625 1.00 49.20  ? 135  GLN B CD  1 
ATOM   6188  O  OE1 . GLN B  1  107 ? 32.017  71.045  -37.893 1.00 50.85  ? 135  GLN B OE1 1 
ATOM   6189  N  NE2 . GLN B  1  107 ? 32.872  70.212  -39.812 1.00 49.35  ? 135  GLN B NE2 1 
ATOM   6190  N  N   . PRO B  1  108 ? 29.081  65.215  -37.041 1.00 41.30  ? 136  PRO B N   1 
ATOM   6191  C  CA  . PRO B  1  108 ? 28.265  64.412  -36.133 1.00 40.47  ? 136  PRO B CA  1 
ATOM   6192  C  C   . PRO B  1  108 ? 28.508  64.770  -34.681 1.00 39.64  ? 136  PRO B C   1 
ATOM   6193  O  O   . PRO B  1  108 ? 29.637  65.055  -34.306 1.00 39.66  ? 136  PRO B O   1 
ATOM   6194  C  CB  . PRO B  1  108 ? 28.737  62.978  -36.420 1.00 40.38  ? 136  PRO B CB  1 
ATOM   6195  C  CG  . PRO B  1  108 ? 29.259  63.038  -37.822 1.00 40.16  ? 136  PRO B CG  1 
ATOM   6196  C  CD  . PRO B  1  108 ? 29.964  64.359  -37.852 1.00 41.03  ? 136  PRO B CD  1 
ATOM   6197  N  N   . ASN B  1  109 ? 27.443  64.782  -33.889 1.00 38.92  ? 137  ASN B N   1 
ATOM   6198  C  CA  . ASN B  1  109 ? 27.548  64.982  -32.444 1.00 38.54  ? 137  ASN B CA  1 
ATOM   6199  C  C   . ASN B  1  109 ? 26.490  64.147  -31.709 1.00 38.01  ? 137  ASN B C   1 
ATOM   6200  O  O   . ASN B  1  109 ? 25.575  63.607  -32.336 1.00 38.00  ? 137  ASN B O   1 
ATOM   6201  C  CB  . ASN B  1  109 ? 27.449  66.480  -32.074 1.00 38.48  ? 137  ASN B CB  1 
ATOM   6202  C  CG  . ASN B  1  109 ? 26.034  67.055  -32.247 1.00 38.77  ? 137  ASN B CG  1 
ATOM   6203  O  OD1 . ASN B  1  109 ? 25.064  66.543  -31.672 1.00 36.84  ? 137  ASN B OD1 1 
ATOM   6204  N  ND2 . ASN B  1  109 ? 25.927  68.142  -33.034 1.00 40.52  ? 137  ASN B ND2 1 
ATOM   6205  N  N   . VAL B  1  110 ? 26.636  64.019  -30.395 1.00 37.28  ? 138  VAL B N   1 
ATOM   6206  C  CA  . VAL B  1  110 ? 25.538  63.539  -29.565 1.00 36.74  ? 138  VAL B CA  1 
ATOM   6207  C  C   . VAL B  1  110 ? 24.999  64.722  -28.755 1.00 36.65  ? 138  VAL B C   1 
ATOM   6208  O  O   . VAL B  1  110 ? 25.764  65.540  -28.249 1.00 36.47  ? 138  VAL B O   1 
ATOM   6209  C  CB  . VAL B  1  110 ? 25.891  62.252  -28.714 1.00 36.74  ? 138  VAL B CB  1 
ATOM   6210  C  CG1 . VAL B  1  110 ? 27.380  61.964  -28.703 1.00 36.38  ? 138  VAL B CG1 1 
ATOM   6211  C  CG2 . VAL B  1  110 ? 25.313  62.310  -27.293 1.00 35.79  ? 138  VAL B CG2 1 
ATOM   6212  N  N   . SER B  1  111 ? 23.674  64.828  -28.694 1.00 36.52  ? 139  SER B N   1 
ATOM   6213  C  CA  . SER B  1  111 ? 23.006  65.947  -28.048 1.00 36.43  ? 139  SER B CA  1 
ATOM   6214  C  C   . SER B  1  111 ? 22.088  65.473  -26.924 1.00 36.44  ? 139  SER B C   1 
ATOM   6215  O  O   . SER B  1  111 ? 21.504  64.389  -26.995 1.00 36.42  ? 139  SER B O   1 
ATOM   6216  C  CB  . SER B  1  111 ? 22.220  66.768  -29.080 1.00 36.49  ? 139  SER B CB  1 
ATOM   6217  O  OG  . SER B  1  111 ? 23.076  67.544  -29.909 1.00 36.30  ? 139  SER B OG  1 
ATOM   6218  N  N   . GLU B  1  112 ? 21.997  66.290  -25.879 1.00 36.55  ? 140  GLU B N   1 
ATOM   6219  C  CA  . GLU B  1  112 ? 21.103  66.056  -24.758 1.00 36.71  ? 140  GLU B CA  1 
ATOM   6220  C  C   . GLU B  1  112 ? 19.928  67.012  -24.911 1.00 36.17  ? 140  GLU B C   1 
ATOM   6221  O  O   . GLU B  1  112 ? 20.117  68.224  -25.029 1.00 36.32  ? 140  GLU B O   1 
ATOM   6222  C  CB  . GLU B  1  112 ? 21.847  66.291  -23.445 1.00 36.91  ? 140  GLU B CB  1 
ATOM   6223  C  CG  . GLU B  1  112 ? 22.835  65.163  -23.087 1.00 38.04  ? 140  GLU B CG  1 
ATOM   6224  C  CD  . GLU B  1  112 ? 23.794  65.524  -21.948 1.00 38.31  ? 140  GLU B CD  1 
ATOM   6225  O  OE1 . GLU B  1  112 ? 24.797  66.215  -22.215 1.00 38.96  ? 140  GLU B OE1 1 
ATOM   6226  O  OE2 . GLU B  1  112 ? 23.561  65.101  -20.787 1.00 41.42  ? 140  GLU B OE2 1 
ATOM   6227  N  N   . LEU B  1  113 ? 18.715  66.465  -24.953 1.00 35.61  ? 141  LEU B N   1 
ATOM   6228  C  CA  . LEU B  1  113 ? 17.525  67.271  -25.226 1.00 35.05  ? 141  LEU B CA  1 
ATOM   6229  C  C   . LEU B  1  113 ? 16.461  67.080  -24.166 1.00 35.03  ? 141  LEU B C   1 
ATOM   6230  O  O   . LEU B  1  113 ? 15.931  65.985  -24.014 1.00 34.83  ? 141  LEU B O   1 
ATOM   6231  C  CB  . LEU B  1  113 ? 16.924  66.940  -26.598 1.00 34.78  ? 141  LEU B CB  1 
ATOM   6232  C  CG  . LEU B  1  113 ? 17.784  66.986  -27.868 1.00 34.62  ? 141  LEU B CG  1 
ATOM   6233  C  CD1 . LEU B  1  113 ? 16.946  66.635  -29.084 1.00 32.77  ? 141  LEU B CD1 1 
ATOM   6234  C  CD2 . LEU B  1  113 ? 18.452  68.338  -28.051 1.00 34.40  ? 141  LEU B CD2 1 
ATOM   6235  N  N   . VAL B  1  114 ? 16.149  68.156  -23.445 1.00 35.18  ? 142  VAL B N   1 
ATOM   6236  C  CA  . VAL B  1  114 ? 15.054  68.150  -22.491 1.00 35.57  ? 142  VAL B CA  1 
ATOM   6237  C  C   . VAL B  1  114 ? 13.733  68.358  -23.226 1.00 36.11  ? 142  VAL B C   1 
ATOM   6238  O  O   . VAL B  1  114 ? 13.547  69.385  -23.878 1.00 36.55  ? 142  VAL B O   1 
ATOM   6239  C  CB  . VAL B  1  114 ? 15.246  69.228  -21.385 1.00 35.75  ? 142  VAL B CB  1 
ATOM   6240  C  CG1 . VAL B  1  114 ? 14.011  69.325  -20.478 1.00 34.99  ? 142  VAL B CG1 1 
ATOM   6241  C  CG2 . VAL B  1  114 ? 16.503  68.936  -20.562 1.00 34.78  ? 142  VAL B CG2 1 
ATOM   6242  N  N   . VAL B  1  115 ? 12.830  67.377  -23.126 1.00 36.50  ? 143  VAL B N   1 
ATOM   6243  C  CA  . VAL B  1  115 ? 11.485  67.463  -23.731 1.00 36.69  ? 143  VAL B CA  1 
ATOM   6244  C  C   . VAL B  1  115 ? 10.421  67.668  -22.655 1.00 37.11  ? 143  VAL B C   1 
ATOM   6245  O  O   . VAL B  1  115 ? 10.436  66.989  -21.617 1.00 37.12  ? 143  VAL B O   1 
ATOM   6246  C  CB  . VAL B  1  115 ? 11.117  66.185  -24.505 1.00 36.50  ? 143  VAL B CB  1 
ATOM   6247  C  CG1 . VAL B  1  115 ? 9.787   66.351  -25.206 1.00 35.96  ? 143  VAL B CG1 1 
ATOM   6248  C  CG2 . VAL B  1  115 ? 12.207  65.827  -25.504 1.00 37.19  ? 143  VAL B CG2 1 
ATOM   6249  N  N   . GLY B  1  116 ? 9.494   68.591  -22.902 1.00 37.42  ? 144  GLY B N   1 
ATOM   6250  C  CA  . GLY B  1  116 ? 8.424   68.851  -21.945 1.00 37.86  ? 144  GLY B CA  1 
ATOM   6251  C  C   . GLY B  1  116 ? 7.274   69.690  -22.469 1.00 38.21  ? 144  GLY B C   1 
ATOM   6252  O  O   . GLY B  1  116 ? 7.301   70.133  -23.625 1.00 38.64  ? 144  GLY B O   1 
ATOM   6253  N  N   . PRO B  1  117 ? 6.232   69.875  -21.635 1.00 38.26  ? 145  PRO B N   1 
ATOM   6254  C  CA  . PRO B  1  117 ? 6.106   69.142  -20.374 1.00 38.26  ? 145  PRO B CA  1 
ATOM   6255  C  C   . PRO B  1  117 ? 5.347   67.825  -20.581 1.00 38.37  ? 145  PRO B C   1 
ATOM   6256  O  O   . PRO B  1  117 ? 4.833   67.566  -21.658 1.00 38.41  ? 145  PRO B O   1 
ATOM   6257  C  CB  . PRO B  1  117 ? 5.287   70.100  -19.493 1.00 38.14  ? 145  PRO B CB  1 
ATOM   6258  C  CG  . PRO B  1  117 ? 4.514   70.972  -20.452 1.00 37.85  ? 145  PRO B CG  1 
ATOM   6259  C  CD  . PRO B  1  117 ? 5.106   70.809  -21.842 1.00 38.03  ? 145  PRO B CD  1 
ATOM   6260  N  N   . LEU B  1  118 ? 5.288   66.992  -19.562 1.00 38.85  ? 146  LEU B N   1 
ATOM   6261  C  CA  . LEU B  1  118 ? 4.442   65.819  -19.624 1.00 39.32  ? 146  LEU B CA  1 
ATOM   6262  C  C   . LEU B  1  118 ? 3.189   66.158  -18.833 1.00 39.83  ? 146  LEU B C   1 
ATOM   6263  O  O   . LEU B  1  118 ? 3.272   66.911  -17.868 1.00 40.39  ? 146  LEU B O   1 
ATOM   6264  C  CB  . LEU B  1  118 ? 5.189   64.600  -19.082 1.00 39.25  ? 146  LEU B CB  1 
ATOM   6265  C  CG  . LEU B  1  118 ? 6.278   64.163  -20.079 1.00 38.91  ? 146  LEU B CG  1 
ATOM   6266  C  CD1 . LEU B  1  118 ? 7.562   63.742  -19.406 1.00 38.74  ? 146  LEU B CD1 1 
ATOM   6267  C  CD2 . LEU B  1  118 ? 5.765   63.084  -21.011 1.00 39.13  ? 146  LEU B CD2 1 
ATOM   6268  N  N   . PRO B  1  119 ? 2.024   65.620  -19.227 1.00 40.05  ? 147  PRO B N   1 
ATOM   6269  C  CA  . PRO B  1  119 ? 1.801   64.552  -20.200 1.00 40.34  ? 147  PRO B CA  1 
ATOM   6270  C  C   . PRO B  1  119 ? 1.757   64.949  -21.688 1.00 40.69  ? 147  PRO B C   1 
ATOM   6271  O  O   . PRO B  1  119 ? 1.773   64.058  -22.548 1.00 40.84  ? 147  PRO B O   1 
ATOM   6272  C  CB  . PRO B  1  119 ? 0.455   63.950  -19.758 1.00 40.46  ? 147  PRO B CB  1 
ATOM   6273  C  CG  . PRO B  1  119 ? -0.141  64.931  -18.720 1.00 40.45  ? 147  PRO B CG  1 
ATOM   6274  C  CD  . PRO B  1  119 ? 0.757   66.124  -18.665 1.00 40.23  ? 147  PRO B CD  1 
ATOM   6275  N  N   . HIS B  1  120 ? 1.719   66.249  -21.998 1.00 40.95  ? 148  HIS B N   1 
ATOM   6276  C  CA  . HIS B  1  120 ? 1.600   66.696  -23.401 1.00 41.01  ? 148  HIS B CA  1 
ATOM   6277  C  C   . HIS B  1  120 ? 2.741   67.593  -23.897 1.00 40.59  ? 148  HIS B C   1 
ATOM   6278  O  O   . HIS B  1  120 ? 2.656   68.812  -23.811 1.00 40.54  ? 148  HIS B O   1 
ATOM   6279  C  CB  . HIS B  1  120 ? 0.246   67.356  -23.635 1.00 41.29  ? 148  HIS B CB  1 
ATOM   6280  C  CG  . HIS B  1  120 ? -0.915  66.472  -23.301 1.00 43.28  ? 148  HIS B CG  1 
ATOM   6281  N  ND1 . HIS B  1  120 ? -1.113  65.244  -23.901 1.00 44.27  ? 148  HIS B ND1 1 
ATOM   6282  C  CD2 . HIS B  1  120 ? -1.940  66.635  -22.428 1.00 44.39  ? 148  HIS B CD2 1 
ATOM   6283  C  CE1 . HIS B  1  120 ? -2.211  64.691  -23.415 1.00 44.92  ? 148  HIS B CE1 1 
ATOM   6284  N  NE2 . HIS B  1  120 ? -2.731  65.514  -22.520 1.00 45.57  ? 148  HIS B NE2 1 
ATOM   6285  N  N   . PRO B  1  121 ? 3.814   66.986  -24.435 1.00 40.58  ? 149  PRO B N   1 
ATOM   6286  C  CA  . PRO B  1  121 ? 5.045   67.721  -24.789 1.00 40.17  ? 149  PRO B CA  1 
ATOM   6287  C  C   . PRO B  1  121 ? 4.837   68.802  -25.853 1.00 39.81  ? 149  PRO B C   1 
ATOM   6288  O  O   . PRO B  1  121 ? 4.098   68.586  -26.827 1.00 39.47  ? 149  PRO B O   1 
ATOM   6289  C  CB  . PRO B  1  121 ? 5.970   66.623  -25.318 1.00 40.03  ? 149  PRO B CB  1 
ATOM   6290  C  CG  . PRO B  1  121 ? 5.408   65.351  -24.786 1.00 40.40  ? 149  PRO B CG  1 
ATOM   6291  C  CD  . PRO B  1  121 ? 3.933   65.548  -24.742 1.00 40.67  ? 149  PRO B CD  1 
ATOM   6292  N  N   . SER B  1  122 ? 5.488   69.948  -25.652 1.00 39.23  ? 150  SER B N   1 
ATOM   6293  C  CA  . SER B  1  122 ? 5.362   71.087  -26.561 1.00 38.91  ? 150  SER B CA  1 
ATOM   6294  C  C   . SER B  1  122 ? 6.692   71.767  -26.858 1.00 38.72  ? 150  SER B C   1 
ATOM   6295  O  O   . SER B  1  122 ? 6.798   72.494  -27.845 1.00 38.84  ? 150  SER B O   1 
ATOM   6296  C  CB  . SER B  1  122 ? 4.361   72.113  -26.026 1.00 38.76  ? 150  SER B CB  1 
ATOM   6297  O  OG  . SER B  1  122 ? 4.901   72.837  -24.937 1.00 38.74  ? 150  SER B OG  1 
ATOM   6298  N  N   . TYR B  1  123 ? 7.692   71.550  -26.002 1.00 38.47  ? 151  TYR B N   1 
ATOM   6299  C  CA  . TYR B  1  123 ? 9.035   72.078  -26.243 1.00 38.49  ? 151  TYR B CA  1 
ATOM   6300  C  C   . TYR B  1  123 ? 10.128  71.018  -26.154 1.00 38.83  ? 151  TYR B C   1 
ATOM   6301  O  O   . TYR B  1  123 ? 9.948   69.956  -25.556 1.00 38.73  ? 151  TYR B O   1 
ATOM   6302  C  CB  . TYR B  1  123 ? 9.365   73.243  -25.301 1.00 38.24  ? 151  TYR B CB  1 
ATOM   6303  C  CG  . TYR B  1  123 ? 9.281   72.885  -23.836 1.00 38.18  ? 151  TYR B CG  1 
ATOM   6304  C  CD1 . TYR B  1  123 ? 10.293  72.158  -23.214 1.00 37.33  ? 151  TYR B CD1 1 
ATOM   6305  C  CD2 . TYR B  1  123 ? 8.181   73.277  -23.071 1.00 37.61  ? 151  TYR B CD2 1 
ATOM   6306  C  CE1 . TYR B  1  123 ? 10.210  71.825  -21.865 1.00 37.83  ? 151  TYR B CE1 1 
ATOM   6307  C  CE2 . TYR B  1  123 ? 8.088   72.951  -21.731 1.00 36.86  ? 151  TYR B CE2 1 
ATOM   6308  C  CZ  . TYR B  1  123 ? 9.103   72.225  -21.130 1.00 37.86  ? 151  TYR B CZ  1 
ATOM   6309  O  OH  . TYR B  1  123 ? 9.004   71.901  -19.794 1.00 37.80  ? 151  TYR B OH  1 
ATOM   6310  N  N   . MET B  1  124 ? 11.269  71.357  -26.746 1.00 39.30  ? 152  MET B N   1 
ATOM   6311  C  CA  . MET B  1  124 ? 12.459  70.526  -26.802 1.00 39.93  ? 152  MET B CA  1 
ATOM   6312  C  C   . MET B  1  124 ? 13.660  71.468  -26.762 1.00 39.99  ? 152  MET B C   1 
ATOM   6313  O  O   . MET B  1  124 ? 13.776  72.350  -27.609 1.00 40.26  ? 152  MET B O   1 
ATOM   6314  C  CB  . MET B  1  124 ? 12.447  69.730  -28.109 1.00 39.99  ? 152  MET B CB  1 
ATOM   6315  C  CG  . MET B  1  124 ? 13.746  69.045  -28.466 1.00 40.07  ? 152  MET B CG  1 
ATOM   6316  S  SD  . MET B  1  124 ? 13.610  68.133  -30.015 1.00 40.67  ? 152  MET B SD  1 
ATOM   6317  C  CE  . MET B  1  124 ? 13.552  69.451  -31.233 1.00 41.49  ? 152  MET B CE  1 
ATOM   6318  N  N   . ARG B  1  125 ? 14.550  71.294  -25.788 1.00 40.23  ? 153  ARG B N   1 
ATOM   6319  C  CA  . ARG B  1  125 ? 15.647  72.252  -25.579 1.00 40.29  ? 153  ARG B CA  1 
ATOM   6320  C  C   . ARG B  1  125 ? 17.017  71.588  -25.499 1.00 39.90  ? 153  ARG B C   1 
ATOM   6321  O  O   . ARG B  1  125 ? 17.248  70.715  -24.659 1.00 39.78  ? 153  ARG B O   1 
ATOM   6322  C  CB  . ARG B  1  125 ? 15.387  73.111  -24.334 1.00 40.60  ? 153  ARG B CB  1 
ATOM   6323  C  CG  . ARG B  1  125 ? 14.117  73.974  -24.422 1.00 42.37  ? 153  ARG B CG  1 
ATOM   6324  C  CD  . ARG B  1  125 ? 13.541  74.260  -23.031 1.00 44.70  ? 153  ARG B CD  1 
ATOM   6325  N  NE  . ARG B  1  125 ? 12.412  75.195  -23.059 1.00 45.94  ? 153  ARG B NE  1 
ATOM   6326  C  CZ  . ARG B  1  125 ? 11.611  75.450  -22.022 1.00 46.34  ? 153  ARG B CZ  1 
ATOM   6327  N  NH1 . ARG B  1  125 ? 11.790  74.835  -20.856 1.00 46.06  ? 153  ARG B NH1 1 
ATOM   6328  N  NH2 . ARG B  1  125 ? 10.617  76.319  -22.152 1.00 46.55  ? 153  ARG B NH2 1 
ATOM   6329  N  N   . ASP B  1  126 ? 17.912  72.011  -26.390 1.00 39.66  ? 154  ASP B N   1 
ATOM   6330  C  CA  . ASP B  1  126 ? 19.289  71.525  -26.431 1.00 39.43  ? 154  ASP B CA  1 
ATOM   6331  C  C   . ASP B  1  126 ? 20.059  72.069  -25.227 1.00 39.21  ? 154  ASP B C   1 
ATOM   6332  O  O   . ASP B  1  126 ? 20.325  73.266  -25.135 1.00 39.18  ? 154  ASP B O   1 
ATOM   6333  C  CB  . ASP B  1  126 ? 19.961  71.950  -27.746 1.00 39.34  ? 154  ASP B CB  1 
ATOM   6334  C  CG  . ASP B  1  126 ? 21.263  71.189  -28.042 1.00 40.05  ? 154  ASP B CG  1 
ATOM   6335  O  OD1 . ASP B  1  126 ? 21.677  70.314  -27.246 1.00 41.40  ? 154  ASP B OD1 1 
ATOM   6336  O  OD2 . ASP B  1  126 ? 21.878  71.467  -29.098 1.00 39.74  ? 154  ASP B OD2 1 
ATOM   6337  N  N   . VAL B  1  127 ? 20.406  71.185  -24.299 1.00 38.88  ? 155  VAL B N   1 
ATOM   6338  C  CA  . VAL B  1  127 ? 21.141  71.598  -23.103 1.00 38.39  ? 155  VAL B CA  1 
ATOM   6339  C  C   . VAL B  1  127 ? 22.606  71.168  -23.136 1.00 38.33  ? 155  VAL B C   1 
ATOM   6340  O  O   . VAL B  1  127 ? 23.330  71.386  -22.167 1.00 38.10  ? 155  VAL B O   1 
ATOM   6341  C  CB  . VAL B  1  127 ? 20.456  71.127  -21.772 1.00 38.42  ? 155  VAL B CB  1 
ATOM   6342  C  CG1 . VAL B  1  127 ? 19.100  71.809  -21.590 1.00 38.00  ? 155  VAL B CG1 1 
ATOM   6343  C  CG2 . VAL B  1  127 ? 20.325  69.616  -21.708 1.00 37.70  ? 155  VAL B CG2 1 
ATOM   6344  N  N   . THR B  1  128 ? 23.034  70.576  -24.253 1.00 38.16  ? 156  THR B N   1 
ATOM   6345  C  CA  . THR B  1  128 ? 24.411  70.117  -24.417 1.00 38.37  ? 156  THR B CA  1 
ATOM   6346  C  C   . THR B  1  128 ? 25.442  71.193  -24.077 1.00 38.91  ? 156  THR B C   1 
ATOM   6347  O  O   . THR B  1  128 ? 26.343  70.960  -23.256 1.00 39.23  ? 156  THR B O   1 
ATOM   6348  C  CB  . THR B  1  128 ? 24.674  69.640  -25.853 1.00 38.34  ? 156  THR B CB  1 
ATOM   6349  O  OG1 . THR B  1  128 ? 23.671  68.697  -26.236 1.00 38.69  ? 156  THR B OG1 1 
ATOM   6350  C  CG2 . THR B  1  128 ? 26.039  68.997  -25.961 1.00 37.40  ? 156  THR B CG2 1 
ATOM   6351  N  N   . VAL B  1  129 ? 25.297  72.358  -24.711 1.00 39.27  ? 157  VAL B N   1 
ATOM   6352  C  CA  . VAL B  1  129 ? 26.269  73.452  -24.640 1.00 39.90  ? 157  VAL B CA  1 
ATOM   6353  C  C   . VAL B  1  129 ? 26.268  74.094  -23.250 1.00 40.18  ? 157  VAL B C   1 
ATOM   6354  O  O   . VAL B  1  129 ? 27.315  74.359  -22.657 1.00 40.27  ? 157  VAL B O   1 
ATOM   6355  C  CB  . VAL B  1  129 ? 25.959  74.528  -25.721 1.00 40.22  ? 157  VAL B CB  1 
ATOM   6356  C  CG1 . VAL B  1  129 ? 27.053  75.605  -25.771 1.00 39.94  ? 157  VAL B CG1 1 
ATOM   6357  C  CG2 . VAL B  1  129 ? 25.771  73.874  -27.095 1.00 40.57  ? 157  VAL B CG2 1 
ATOM   6358  N  N   . GLU B  1  130 ? 25.068  74.339  -22.746 1.00 40.39  ? 158  GLU B N   1 
ATOM   6359  C  CA  . GLU B  1  130 ? 24.845  74.840  -21.406 1.00 40.77  ? 158  GLU B CA  1 
ATOM   6360  C  C   . GLU B  1  130 ? 25.517  73.934  -20.359 1.00 40.16  ? 158  GLU B C   1 
ATOM   6361  O  O   . GLU B  1  130 ? 26.061  74.429  -19.370 1.00 40.36  ? 158  GLU B O   1 
ATOM   6362  C  CB  . GLU B  1  130 ? 23.331  74.943  -21.198 1.00 40.71  ? 158  GLU B CB  1 
ATOM   6363  C  CG  . GLU B  1  130 ? 22.823  75.272  -19.799 1.00 42.54  ? 158  GLU B CG  1 
ATOM   6364  C  CD  . GLU B  1  130 ? 21.320  75.026  -19.697 1.00 42.48  ? 158  GLU B CD  1 
ATOM   6365  O  OE1 . GLU B  1  130 ? 20.577  75.486  -20.595 1.00 45.52  ? 158  GLU B OE1 1 
ATOM   6366  O  OE2 . GLU B  1  130 ? 20.888  74.349  -18.743 1.00 43.70  ? 158  GLU B OE2 1 
ATOM   6367  N  N   . ARG B  1  131 ? 25.513  72.621  -20.598 1.00 39.45  ? 159  ARG B N   1 
ATOM   6368  C  CA  . ARG B  1  131 ? 26.109  71.665  -19.656 1.00 38.53  ? 159  ARG B CA  1 
ATOM   6369  C  C   . ARG B  1  131 ? 27.596  71.399  -19.867 1.00 38.22  ? 159  ARG B C   1 
ATOM   6370  O  O   . ARG B  1  131 ? 28.309  71.182  -18.902 1.00 37.80  ? 159  ARG B O   1 
ATOM   6371  C  CB  . ARG B  1  131 ? 25.369  70.331  -19.679 1.00 38.18  ? 159  ARG B CB  1 
ATOM   6372  C  CG  . ARG B  1  131 ? 23.994  70.367  -19.093 1.00 37.44  ? 159  ARG B CG  1 
ATOM   6373  C  CD  . ARG B  1  131 ? 23.283  69.057  -19.385 1.00 36.93  ? 159  ARG B CD  1 
ATOM   6374  N  NE  . ARG B  1  131 ? 21.954  69.012  -18.778 1.00 37.04  ? 159  ARG B NE  1 
ATOM   6375  C  CZ  . ARG B  1  131 ? 21.227  67.906  -18.630 1.00 35.54  ? 159  ARG B CZ  1 
ATOM   6376  N  NH1 . ARG B  1  131 ? 21.682  66.732  -19.054 1.00 34.32  ? 159  ARG B NH1 1 
ATOM   6377  N  NH2 . ARG B  1  131 ? 20.035  67.978  -18.057 1.00 34.45  ? 159  ARG B NH2 1 
ATOM   6378  N  N   . HIS B  1  132 ? 28.066  71.408  -21.110 1.00 38.20  ? 160  HIS B N   1 
ATOM   6379  C  CA  . HIS B  1  132 ? 29.442  70.962  -21.388 1.00 38.66  ? 160  HIS B CA  1 
ATOM   6380  C  C   . HIS B  1  132 ? 30.377  71.971  -22.048 1.00 38.97  ? 160  HIS B C   1 
ATOM   6381  O  O   . HIS B  1  132 ? 31.549  71.660  -22.271 1.00 39.10  ? 160  HIS B O   1 
ATOM   6382  C  CB  . HIS B  1  132 ? 29.428  69.662  -22.200 1.00 38.43  ? 160  HIS B CB  1 
ATOM   6383  C  CG  . HIS B  1  132 ? 28.508  68.632  -21.640 1.00 37.98  ? 160  HIS B CG  1 
ATOM   6384  N  ND1 . HIS B  1  132 ? 28.679  68.094  -20.385 1.00 37.30  ? 160  HIS B ND1 1 
ATOM   6385  C  CD2 . HIS B  1  132 ? 27.385  68.071  -22.143 1.00 37.79  ? 160  HIS B CD2 1 
ATOM   6386  C  CE1 . HIS B  1  132 ? 27.705  67.236  -20.141 1.00 37.82  ? 160  HIS B CE1 1 
ATOM   6387  N  NE2 . HIS B  1  132 ? 26.916  67.192  -21.198 1.00 38.56  ? 160  HIS B NE2 1 
ATOM   6388  N  N   . GLY B  1  133 ? 29.857  73.158  -22.362 1.00 39.17  ? 161  GLY B N   1 
ATOM   6389  C  CA  . GLY B  1  133 ? 30.651  74.238  -22.954 1.00 39.27  ? 161  GLY B CA  1 
ATOM   6390  C  C   . GLY B  1  133 ? 30.767  74.135  -24.464 1.00 39.38  ? 161  GLY B C   1 
ATOM   6391  O  O   . GLY B  1  133 ? 31.462  74.929  -25.101 1.00 39.35  ? 161  GLY B O   1 
ATOM   6392  N  N   . GLY B  1  134 ? 30.074  73.158  -25.041 1.00 39.48  ? 162  GLY B N   1 
ATOM   6393  C  CA  . GLY B  1  134 ? 30.155  72.896  -26.479 1.00 39.17  ? 162  GLY B CA  1 
ATOM   6394  C  C   . GLY B  1  134 ? 29.732  71.476  -26.818 1.00 38.72  ? 162  GLY B C   1 
ATOM   6395  O  O   . GLY B  1  134 ? 29.259  70.748  -25.942 1.00 38.72  ? 162  GLY B O   1 
ATOM   6396  N  N   . PRO B  1  135 ? 29.897  71.073  -28.090 1.00 38.46  ? 163  PRO B N   1 
ATOM   6397  C  CA  . PRO B  1  135 ? 29.382  69.777  -28.573 1.00 38.17  ? 163  PRO B CA  1 
ATOM   6398  C  C   . PRO B  1  135 ? 29.893  68.581  -27.770 1.00 37.60  ? 163  PRO B C   1 
ATOM   6399  O  O   . PRO B  1  135 ? 31.018  68.612  -27.252 1.00 37.79  ? 163  PRO B O   1 
ATOM   6400  C  CB  . PRO B  1  135 ? 29.899  69.696  -30.028 1.00 38.33  ? 163  PRO B CB  1 
ATOM   6401  C  CG  . PRO B  1  135 ? 30.989  70.743  -30.123 1.00 38.70  ? 163  PRO B CG  1 
ATOM   6402  C  CD  . PRO B  1  135 ? 30.594  71.823  -29.153 1.00 38.47  ? 163  PRO B CD  1 
ATOM   6403  N  N   . LEU B  1  136 ? 29.057  67.551  -27.641 1.00 36.75  ? 164  LEU B N   1 
ATOM   6404  C  CA  . LEU B  1  136 ? 29.529  66.262  -27.131 1.00 35.93  ? 164  LEU B CA  1 
ATOM   6405  C  C   . LEU B  1  136 ? 30.106  65.490  -28.307 1.00 35.37  ? 164  LEU B C   1 
ATOM   6406  O  O   . LEU B  1  136 ? 29.354  65.101  -29.212 1.00 35.38  ? 164  LEU B O   1 
ATOM   6407  C  CB  . LEU B  1  136 ? 28.395  65.474  -26.486 1.00 35.76  ? 164  LEU B CB  1 
ATOM   6408  C  CG  . LEU B  1  136 ? 28.019  65.860  -25.061 1.00 34.53  ? 164  LEU B CG  1 
ATOM   6409  C  CD1 . LEU B  1  136 ? 26.823  65.045  -24.668 1.00 32.33  ? 164  LEU B CD1 1 
ATOM   6410  C  CD2 . LEU B  1  136 ? 29.193  65.586  -24.136 1.00 33.16  ? 164  LEU B CD2 1 
ATOM   6411  N  N   . PRO B  1  137 ? 31.440  65.302  -28.325 1.00 34.71  ? 165  PRO B N   1 
ATOM   6412  C  CA  . PRO B  1  137 ? 32.075  64.623  -29.457 1.00 34.53  ? 165  PRO B CA  1 
ATOM   6413  C  C   . PRO B  1  137 ? 31.497  63.221  -29.650 1.00 34.20  ? 165  PRO B C   1 
ATOM   6414  O  O   . PRO B  1  137 ? 31.205  62.510  -28.680 1.00 33.71  ? 165  PRO B O   1 
ATOM   6415  C  CB  . PRO B  1  137 ? 33.559  64.553  -29.055 1.00 34.29  ? 165  PRO B CB  1 
ATOM   6416  C  CG  . PRO B  1  137 ? 33.730  65.596  -28.051 1.00 34.55  ? 165  PRO B CG  1 
ATOM   6417  C  CD  . PRO B  1  137 ? 32.425  65.685  -27.303 1.00 34.62  ? 165  PRO B CD  1 
ATOM   6418  N  N   . TYR B  1  138 ? 31.349  62.847  -30.911 1.00 34.14  ? 166  TYR B N   1 
ATOM   6419  C  CA  . TYR B  1  138 ? 30.656  61.634  -31.312 1.00 34.12  ? 166  TYR B CA  1 
ATOM   6420  C  C   . TYR B  1  138 ? 31.305  60.330  -30.833 1.00 34.46  ? 166  TYR B C   1 
ATOM   6421  O  O   . TYR B  1  138 ? 30.615  59.333  -30.607 1.00 34.72  ? 166  TYR B O   1 
ATOM   6422  C  CB  . TYR B  1  138 ? 30.517  61.633  -32.830 1.00 33.57  ? 166  TYR B CB  1 
ATOM   6423  C  CG  . TYR B  1  138 ? 29.353  60.831  -33.334 1.00 32.97  ? 166  TYR B CG  1 
ATOM   6424  C  CD1 . TYR B  1  138 ? 28.044  61.178  -33.000 1.00 32.04  ? 166  TYR B CD1 1 
ATOM   6425  C  CD2 . TYR B  1  138 ? 29.559  59.729  -34.161 1.00 32.28  ? 166  TYR B CD2 1 
ATOM   6426  C  CE1 . TYR B  1  138 ? 26.962  60.442  -33.474 1.00 32.19  ? 166  TYR B CE1 1 
ATOM   6427  C  CE2 . TYR B  1  138 ? 28.495  58.988  -34.642 1.00 32.29  ? 166  TYR B CE2 1 
ATOM   6428  C  CZ  . TYR B  1  138 ? 27.196  59.344  -34.299 1.00 32.80  ? 166  TYR B CZ  1 
ATOM   6429  O  OH  . TYR B  1  138 ? 26.142  58.596  -34.779 1.00 32.23  ? 166  TYR B OH  1 
ATOM   6430  N  N   . HIS B  1  139 ? 32.621  60.337  -30.662 1.00 34.79  ? 167  HIS B N   1 
ATOM   6431  C  CA  . HIS B  1  139 ? 33.334  59.129  -30.226 1.00 35.32  ? 167  HIS B CA  1 
ATOM   6432  C  C   . HIS B  1  139 ? 33.113  58.820  -28.742 1.00 35.26  ? 167  HIS B C   1 
ATOM   6433  O  O   . HIS B  1  139 ? 33.573  57.792  -28.239 1.00 35.65  ? 167  HIS B O   1 
ATOM   6434  C  CB  . HIS B  1  139 ? 34.826  59.269  -30.502 1.00 35.41  ? 167  HIS B CB  1 
ATOM   6435  C  CG  . HIS B  1  139 ? 35.469  60.372  -29.726 1.00 36.19  ? 167  HIS B CG  1 
ATOM   6436  N  ND1 . HIS B  1  139 ? 35.767  61.597  -30.282 1.00 36.13  ? 167  HIS B ND1 1 
ATOM   6437  C  CD2 . HIS B  1  139 ? 35.839  60.445  -28.426 1.00 36.12  ? 167  HIS B CD2 1 
ATOM   6438  C  CE1 . HIS B  1  139 ? 36.316  62.371  -29.365 1.00 36.61  ? 167  HIS B CE1 1 
ATOM   6439  N  NE2 . HIS B  1  139 ? 36.371  61.695  -28.229 1.00 37.03  ? 167  HIS B NE2 1 
ATOM   6440  N  N   . ARG B  1  140 ? 32.420  59.718  -28.048 1.00 35.15  ? 168  ARG B N   1 
ATOM   6441  C  CA  . ARG B  1  140 ? 32.059  59.512  -26.648 1.00 34.79  ? 168  ARG B CA  1 
ATOM   6442  C  C   . ARG B  1  140 ? 30.739  58.757  -26.507 1.00 34.43  ? 168  ARG B C   1 
ATOM   6443  O  O   . ARG B  1  140 ? 30.364  58.368  -25.407 1.00 34.63  ? 168  ARG B O   1 
ATOM   6444  C  CB  . ARG B  1  140 ? 31.980  60.845  -25.908 1.00 34.73  ? 168  ARG B CB  1 
ATOM   6445  C  CG  . ARG B  1  140 ? 33.311  61.573  -25.798 1.00 36.31  ? 168  ARG B CG  1 
ATOM   6446  C  CD  . ARG B  1  140 ? 33.314  62.554  -24.626 1.00 37.36  ? 168  ARG B CD  1 
ATOM   6447  N  NE  . ARG B  1  140 ? 34.401  63.532  -24.695 1.00 37.65  ? 168  ARG B NE  1 
ATOM   6448  C  CZ  . ARG B  1  140 ? 34.347  64.740  -24.131 1.00 38.58  ? 168  ARG B CZ  1 
ATOM   6449  N  NH1 . ARG B  1  140 ? 33.263  65.112  -23.459 1.00 39.08  ? 168  ARG B NH1 1 
ATOM   6450  N  NH2 . ARG B  1  140 ? 35.369  65.583  -24.234 1.00 37.53  ? 168  ARG B NH2 1 
ATOM   6451  N  N   . ARG B  1  141 ? 30.041  58.535  -27.616 1.00 34.14  ? 169  ARG B N   1 
ATOM   6452  C  CA  . ARG B  1  141 ? 28.777  57.805  -27.575 1.00 33.88  ? 169  ARG B CA  1 
ATOM   6453  C  C   . ARG B  1  141 ? 29.012  56.342  -27.217 1.00 34.25  ? 169  ARG B C   1 
ATOM   6454  O  O   . ARG B  1  141 ? 29.976  55.730  -27.697 1.00 34.67  ? 169  ARG B O   1 
ATOM   6455  C  CB  . ARG B  1  141 ? 28.030  57.915  -28.915 1.00 33.90  ? 169  ARG B CB  1 
ATOM   6456  C  CG  . ARG B  1  141 ? 28.495  56.950  -30.005 1.00 32.34  ? 169  ARG B CG  1 
ATOM   6457  C  CD  . ARG B  1  141 ? 28.048  57.390  -31.380 1.00 30.92  ? 169  ARG B CD  1 
ATOM   6458  N  NE  . ARG B  1  141 ? 28.301  56.352  -32.383 1.00 29.35  ? 169  ARG B NE  1 
ATOM   6459  C  CZ  . ARG B  1  141 ? 29.470  56.140  -32.986 1.00 27.87  ? 169  ARG B CZ  1 
ATOM   6460  N  NH1 . ARG B  1  141 ? 29.581  55.160  -33.875 1.00 27.86  ? 169  ARG B NH1 1 
ATOM   6461  N  NH2 . ARG B  1  141 ? 30.523  56.896  -32.704 1.00 26.16  ? 169  ARG B NH2 1 
ATOM   6462  N  N   . PRO B  1  142 ? 28.148  55.777  -26.356 1.00 34.27  ? 170  PRO B N   1 
ATOM   6463  C  CA  . PRO B  1  142 ? 28.120  54.332  -26.138 1.00 34.25  ? 170  PRO B CA  1 
ATOM   6464  C  C   . PRO B  1  142 ? 28.016  53.545  -27.452 1.00 34.03  ? 170  PRO B C   1 
ATOM   6465  O  O   . PRO B  1  142 ? 27.327  53.971  -28.375 1.00 33.64  ? 170  PRO B O   1 
ATOM   6466  C  CB  . PRO B  1  142 ? 26.840  54.134  -25.309 1.00 34.26  ? 170  PRO B CB  1 
ATOM   6467  C  CG  . PRO B  1  142 ? 26.710  55.384  -24.551 1.00 34.21  ? 170  PRO B CG  1 
ATOM   6468  C  CD  . PRO B  1  142 ? 27.180  56.476  -25.492 1.00 34.35  ? 170  PRO B CD  1 
ATOM   6469  N  N   . VAL B  1  143 ? 28.708  52.409  -27.516 1.00 33.87  ? 171  VAL B N   1 
ATOM   6470  C  CA  . VAL B  1  143 ? 28.576  51.478  -28.626 1.00 33.46  ? 171  VAL B CA  1 
ATOM   6471  C  C   . VAL B  1  143 ? 27.181  50.867  -28.616 1.00 33.69  ? 171  VAL B C   1 
ATOM   6472  O  O   . VAL B  1  143 ? 26.764  50.274  -27.620 1.00 33.63  ? 171  VAL B O   1 
ATOM   6473  C  CB  . VAL B  1  143 ? 29.625  50.345  -28.548 1.00 33.25  ? 171  VAL B CB  1 
ATOM   6474  C  CG1 . VAL B  1  143 ? 29.385  49.326  -29.639 1.00 32.03  ? 171  VAL B CG1 1 
ATOM   6475  C  CG2 . VAL B  1  143 ? 31.035  50.913  -28.664 1.00 32.75  ? 171  VAL B CG2 1 
ATOM   6476  N  N   . LEU B  1  144 ? 26.477  51.008  -29.736 1.00 33.96  ? 172  LEU B N   1 
ATOM   6477  C  CA  . LEU B  1  144 ? 25.111  50.510  -29.875 1.00 34.44  ? 172  LEU B CA  1 
ATOM   6478  C  C   . LEU B  1  144 ? 25.065  48.997  -29.982 1.00 34.65  ? 172  LEU B C   1 
ATOM   6479  O  O   . LEU B  1  144 ? 26.052  48.379  -30.377 1.00 34.87  ? 172  LEU B O   1 
ATOM   6480  C  CB  . LEU B  1  144 ? 24.475  51.101  -31.132 1.00 34.47  ? 172  LEU B CB  1 
ATOM   6481  C  CG  . LEU B  1  144 ? 24.277  52.607  -31.221 1.00 34.47  ? 172  LEU B CG  1 
ATOM   6482  C  CD1 . LEU B  1  144 ? 23.797  52.953  -32.616 1.00 33.66  ? 172  LEU B CD1 1 
ATOM   6483  C  CD2 . LEU B  1  144 ? 23.279  53.049  -30.165 1.00 34.64  ? 172  LEU B CD2 1 
ATOM   6484  N  N   . PHE B  1  145 ? 23.918  48.408  -29.657 1.00 34.96  ? 173  PHE B N   1 
ATOM   6485  C  CA  . PHE B  1  145 ? 23.691  46.990  -29.925 1.00 35.84  ? 173  PHE B CA  1 
ATOM   6486  C  C   . PHE B  1  145 ? 23.960  46.639  -31.382 1.00 35.81  ? 173  PHE B C   1 
ATOM   6487  O  O   . PHE B  1  145 ? 24.630  45.635  -31.653 1.00 36.65  ? 173  PHE B O   1 
ATOM   6488  C  CB  . PHE B  1  145 ? 22.278  46.550  -29.536 1.00 36.29  ? 173  PHE B CB  1 
ATOM   6489  C  CG  . PHE B  1  145 ? 22.022  46.557  -28.042 1.00 38.96  ? 173  PHE B CG  1 
ATOM   6490  C  CD1 . PHE B  1  145 ? 20.804  47.061  -27.527 1.00 39.40  ? 173  PHE B CD1 1 
ATOM   6491  C  CD2 . PHE B  1  145 ? 22.996  46.070  -27.139 1.00 39.32  ? 173  PHE B CD2 1 
ATOM   6492  C  CE1 . PHE B  1  145 ? 20.553  47.070  -26.142 1.00 39.24  ? 173  PHE B CE1 1 
ATOM   6493  C  CE2 . PHE B  1  145 ? 22.758  46.079  -25.752 1.00 39.79  ? 173  PHE B CE2 1 
ATOM   6494  C  CZ  . PHE B  1  145 ? 21.529  46.582  -25.253 1.00 38.89  ? 173  PHE B CZ  1 
ATOM   6495  N  N   . GLN B  1  146 ? 23.470  47.464  -32.310 1.00 35.38  ? 174  GLN B N   1 
ATOM   6496  C  CA  . GLN B  1  146 ? 23.714  47.251  -33.746 1.00 35.30  ? 174  GLN B CA  1 
ATOM   6497  C  C   . GLN B  1  146 ? 25.200  47.349  -34.120 1.00 35.19  ? 174  GLN B C   1 
ATOM   6498  O  O   . GLN B  1  146 ? 25.651  46.673  -35.057 1.00 35.03  ? 174  GLN B O   1 
ATOM   6499  C  CB  . GLN B  1  146 ? 22.893  48.221  -34.607 1.00 35.47  ? 174  GLN B CB  1 
ATOM   6500  C  CG  . GLN B  1  146 ? 23.081  48.040  -36.122 1.00 36.32  ? 174  GLN B CG  1 
ATOM   6501  C  CD  . GLN B  1  146 ? 22.526  46.720  -36.642 1.00 37.25  ? 174  GLN B CD  1 
ATOM   6502  O  OE1 . GLN B  1  146 ? 21.361  46.394  -36.412 1.00 37.66  ? 174  GLN B OE1 1 
ATOM   6503  N  NE2 . GLN B  1  146 ? 23.354  45.962  -37.354 1.00 36.20  ? 174  GLN B NE2 1 
ATOM   6504  N  N   . GLU B  1  147 ? 25.940  48.191  -33.387 1.00 34.75  ? 175  GLU B N   1 
ATOM   6505  C  CA  . GLU B  1  147 ? 27.375  48.376  -33.587 1.00 34.35  ? 175  GLU B CA  1 
ATOM   6506  C  C   . GLU B  1  147 ? 28.146  47.115  -33.204 1.00 34.38  ? 175  GLU B C   1 
ATOM   6507  O  O   . GLU B  1  147 ? 29.027  46.683  -33.943 1.00 33.98  ? 175  GLU B O   1 
ATOM   6508  C  CB  . GLU B  1  147 ? 27.889  49.594  -32.812 1.00 34.38  ? 175  GLU B CB  1 
ATOM   6509  C  CG  . GLU B  1  147 ? 29.225  50.164  -33.330 1.00 33.99  ? 175  GLU B CG  1 
ATOM   6510  C  CD  . GLU B  1  147 ? 29.664  51.431  -32.605 1.00 34.27  ? 175  GLU B CD  1 
ATOM   6511  O  OE1 . GLU B  1  147 ? 28.791  52.130  -32.046 1.00 35.08  ? 175  GLU B OE1 1 
ATOM   6512  O  OE2 . GLU B  1  147 ? 30.885  51.724  -32.578 1.00 33.15  ? 175  GLU B OE2 1 
ATOM   6513  N  N   . TYR B  1  148 ? 27.799  46.527  -32.060 1.00 34.48  ? 176  TYR B N   1 
ATOM   6514  C  CA  . TYR B  1  148 ? 28.366  45.247  -31.653 1.00 34.99  ? 176  TYR B CA  1 
ATOM   6515  C  C   . TYR B  1  148 ? 28.057  44.198  -32.729 1.00 35.76  ? 176  TYR B C   1 
ATOM   6516  O  O   . TYR B  1  148 ? 28.929  43.398  -33.078 1.00 36.18  ? 176  TYR B O   1 
ATOM   6517  C  CB  . TYR B  1  148 ? 27.822  44.780  -30.287 1.00 34.31  ? 176  TYR B CB  1 
ATOM   6518  C  CG  . TYR B  1  148 ? 28.287  45.592  -29.090 1.00 34.20  ? 176  TYR B CG  1 
ATOM   6519  C  CD1 . TYR B  1  148 ? 27.381  46.319  -28.311 1.00 33.74  ? 176  TYR B CD1 1 
ATOM   6520  C  CD2 . TYR B  1  148 ? 29.636  45.624  -28.721 1.00 33.30  ? 176  TYR B CD2 1 
ATOM   6521  C  CE1 . TYR B  1  148 ? 27.826  47.059  -27.183 1.00 33.85  ? 176  TYR B CE1 1 
ATOM   6522  C  CE2 . TYR B  1  148 ? 30.076  46.355  -27.618 1.00 31.89  ? 176  TYR B CE2 1 
ATOM   6523  C  CZ  . TYR B  1  148 ? 29.179  47.071  -26.856 1.00 32.53  ? 176  TYR B CZ  1 
ATOM   6524  O  OH  . TYR B  1  148 ? 29.647  47.797  -25.774 1.00 32.52  ? 176  TYR B OH  1 
ATOM   6525  N  N   . LEU B  1  149 ? 26.832  44.226  -33.271 1.00 36.17  ? 177  LEU B N   1 
ATOM   6526  C  CA  . LEU B  1  149 ? 26.427  43.280  -34.321 1.00 36.36  ? 177  LEU B CA  1 
ATOM   6527  C  C   . LEU B  1  149 ? 27.270  43.390  -35.590 1.00 36.07  ? 177  LEU B C   1 
ATOM   6528  O  O   . LEU B  1  149 ? 27.713  42.379  -36.127 1.00 36.34  ? 177  LEU B O   1 
ATOM   6529  C  CB  . LEU B  1  149 ? 24.925  43.373  -34.635 1.00 36.73  ? 177  LEU B CB  1 
ATOM   6530  C  CG  . LEU B  1  149 ? 23.946  42.615  -33.715 1.00 37.85  ? 177  LEU B CG  1 
ATOM   6531  C  CD1 . LEU B  1  149 ? 22.482  42.803  -34.175 1.00 38.52  ? 177  LEU B CD1 1 
ATOM   6532  C  CD2 . LEU B  1  149 ? 24.287  41.113  -33.583 1.00 37.52  ? 177  LEU B CD2 1 
ATOM   6533  N  N   . ASP B  1  150 ? 27.506  44.615  -36.046 1.00 35.89  ? 178  ASP B N   1 
ATOM   6534  C  CA  . ASP B  1  150 ? 28.425  44.873  -37.162 1.00 35.79  ? 178  ASP B CA  1 
ATOM   6535  C  C   . ASP B  1  150 ? 29.862  44.456  -36.867 1.00 35.50  ? 178  ASP B C   1 
ATOM   6536  O  O   . ASP B  1  150 ? 30.546  43.976  -37.758 1.00 35.69  ? 178  ASP B O   1 
ATOM   6537  C  CB  . ASP B  1  150 ? 28.406  46.352  -37.557 1.00 35.80  ? 178  ASP B CB  1 
ATOM   6538  C  CG  . ASP B  1  150 ? 27.045  46.816  -38.036 1.00 36.62  ? 178  ASP B CG  1 
ATOM   6539  O  OD1 . ASP B  1  150 ? 26.255  45.987  -38.542 1.00 36.60  ? 178  ASP B OD1 1 
ATOM   6540  O  OD2 . ASP B  1  150 ? 26.768  48.025  -37.907 1.00 38.69  ? 178  ASP B OD2 1 
ATOM   6541  N  N   . ILE B  1  151 ? 30.324  44.660  -35.634 1.00 35.41  ? 179  ILE B N   1 
ATOM   6542  C  CA  . ILE B  1  151 ? 31.654  44.200  -35.228 1.00 35.50  ? 179  ILE B CA  1 
ATOM   6543  C  C   . ILE B  1  151 ? 31.731  42.675  -35.371 1.00 35.76  ? 179  ILE B C   1 
ATOM   6544  O  O   . ILE B  1  151 ? 32.664  42.156  -35.991 1.00 34.93  ? 179  ILE B O   1 
ATOM   6545  C  CB  . ILE B  1  151 ? 32.049  44.676  -33.787 1.00 35.62  ? 179  ILE B CB  1 
ATOM   6546  C  CG1 . ILE B  1  151 ? 32.135  46.205  -33.730 1.00 35.52  ? 179  ILE B CG1 1 
ATOM   6547  C  CG2 . ILE B  1  151 ? 33.395  44.104  -33.367 1.00 35.12  ? 179  ILE B CG2 1 
ATOM   6548  C  CD1 . ILE B  1  151 ? 32.279  46.788  -32.326 1.00 35.05  ? 179  ILE B CD1 1 
ATOM   6549  N  N   . ASP B  1  152 ? 30.729  41.975  -34.835 1.00 36.30  ? 180  ASP B N   1 
ATOM   6550  C  CA  . ASP B  1  152 ? 30.612  40.525  -35.013 1.00 37.49  ? 180  ASP B CA  1 
ATOM   6551  C  C   . ASP B  1  152 ? 30.484  40.107  -36.481 1.00 37.98  ? 180  ASP B C   1 
ATOM   6552  O  O   . ASP B  1  152 ? 31.116  39.141  -36.919 1.00 37.88  ? 180  ASP B O   1 
ATOM   6553  C  CB  . ASP B  1  152 ? 29.452  39.965  -34.197 1.00 37.65  ? 180  ASP B CB  1 
ATOM   6554  C  CG  . ASP B  1  152 ? 29.789  39.844  -32.724 1.00 39.18  ? 180  ASP B CG  1 
ATOM   6555  O  OD1 . ASP B  1  152 ? 30.989  39.970  -32.366 1.00 41.56  ? 180  ASP B OD1 1 
ATOM   6556  O  OD2 . ASP B  1  152 ? 28.861  39.623  -31.918 1.00 39.83  ? 180  ASP B OD2 1 
ATOM   6557  N  N   . GLN B  1  153 ? 29.682  40.851  -37.236 1.00 38.56  ? 181  GLN B N   1 
ATOM   6558  C  CA  . GLN B  1  153 ? 29.582  40.655  -38.677 1.00 39.38  ? 181  GLN B CA  1 
ATOM   6559  C  C   . GLN B  1  153 ? 30.959  40.739  -39.328 1.00 39.26  ? 181  GLN B C   1 
ATOM   6560  O  O   . GLN B  1  153 ? 31.289  39.914  -40.176 1.00 39.14  ? 181  GLN B O   1 
ATOM   6561  C  CB  . GLN B  1  153 ? 28.652  41.703  -39.294 1.00 40.08  ? 181  GLN B CB  1 
ATOM   6562  C  CG  . GLN B  1  153 ? 27.933  41.249  -40.553 1.00 42.79  ? 181  GLN B CG  1 
ATOM   6563  C  CD  . GLN B  1  153 ? 27.171  39.936  -40.342 1.00 46.80  ? 181  GLN B CD  1 
ATOM   6564  O  OE1 . GLN B  1  153 ? 26.654  39.662  -39.247 1.00 47.18  ? 181  GLN B OE1 1 
ATOM   6565  N  NE2 . GLN B  1  153 ? 27.105  39.116  -41.397 1.00 47.24  ? 181  GLN B NE2 1 
ATOM   6566  N  N   . MET B  1  154 ? 31.758  41.728  -38.917 1.00 39.01  ? 182  MET B N   1 
ATOM   6567  C  CA  . MET B  1  154 ? 33.126  41.879  -39.419 1.00 39.03  ? 182  MET B CA  1 
ATOM   6568  C  C   . MET B  1  154 ? 34.043  40.738  -38.982 1.00 38.43  ? 182  MET B C   1 
ATOM   6569  O  O   . MET B  1  154 ? 34.726  40.149  -39.820 1.00 38.74  ? 182  MET B O   1 
ATOM   6570  C  CB  . MET B  1  154 ? 33.726  43.233  -39.029 1.00 38.72  ? 182  MET B CB  1 
ATOM   6571  C  CG  . MET B  1  154 ? 35.183  43.394  -39.387 1.00 38.61  ? 182  MET B CG  1 
ATOM   6572  S  SD  . MET B  1  154 ? 35.967  44.765  -38.521 1.00 41.03  ? 182  MET B SD  1 
ATOM   6573  C  CE  . MET B  1  154 ? 37.687  44.515  -38.947 1.00 40.61  ? 182  MET B CE  1 
ATOM   6574  N  N   . ILE B  1  155 ? 34.055  40.425  -37.687 1.00 38.00  ? 183  ILE B N   1 
ATOM   6575  C  CA  . ILE B  1  155 ? 34.953  39.392  -37.153 1.00 37.24  ? 183  ILE B CA  1 
ATOM   6576  C  C   . ILE B  1  155 ? 34.621  38.021  -37.739 1.00 37.11  ? 183  ILE B C   1 
ATOM   6577  O  O   . ILE B  1  155 ? 35.503  37.319  -38.224 1.00 37.34  ? 183  ILE B O   1 
ATOM   6578  C  CB  . ILE B  1  155 ? 34.927  39.321  -35.588 1.00 37.38  ? 183  ILE B CB  1 
ATOM   6579  C  CG1 . ILE B  1  155 ? 35.453  40.614  -34.962 1.00 36.65  ? 183  ILE B CG1 1 
ATOM   6580  C  CG2 . ILE B  1  155 ? 35.721  38.116  -35.063 1.00 36.40  ? 183  ILE B CG2 1 
ATOM   6581  C  CD1 . ILE B  1  155 ? 35.103  40.764  -33.486 1.00 36.61  ? 183  ILE B CD1 1 
ATOM   6582  N  N   . PHE B  1  156 ? 33.350  37.645  -37.708 1.00 36.85  ? 184  PHE B N   1 
ATOM   6583  C  CA  . PHE B  1  156 ? 32.984  36.293  -38.110 1.00 36.80  ? 184  PHE B CA  1 
ATOM   6584  C  C   . PHE B  1  156 ? 32.917  36.041  -39.607 1.00 37.04  ? 184  PHE B C   1 
ATOM   6585  O  O   . PHE B  1  156 ? 33.068  34.907  -40.051 1.00 37.15  ? 184  PHE B O   1 
ATOM   6586  C  CB  . PHE B  1  156 ? 31.711  35.839  -37.411 1.00 36.21  ? 184  PHE B CB  1 
ATOM   6587  C  CG  . PHE B  1  156 ? 31.913  35.548  -35.954 1.00 35.92  ? 184  PHE B CG  1 
ATOM   6588  C  CD1 . PHE B  1  156 ? 31.574  36.490  -34.992 1.00 34.66  ? 184  PHE B CD1 1 
ATOM   6589  C  CD2 . PHE B  1  156 ? 32.467  34.337  -35.546 1.00 35.09  ? 184  PHE B CD2 1 
ATOM   6590  C  CE1 . PHE B  1  156 ? 31.762  36.229  -33.641 1.00 34.87  ? 184  PHE B CE1 1 
ATOM   6591  C  CE2 . PHE B  1  156 ? 32.663  34.064  -34.196 1.00 35.13  ? 184  PHE B CE2 1 
ATOM   6592  C  CZ  . PHE B  1  156 ? 32.312  35.019  -33.239 1.00 35.26  ? 184  PHE B CZ  1 
ATOM   6593  N  N   . ASN B  1  157 ? 32.717  37.086  -40.393 1.00 37.49  ? 185  ASN B N   1 
ATOM   6594  C  CA  . ASN B  1  157 ? 32.559  36.883  -41.822 1.00 38.05  ? 185  ASN B CA  1 
ATOM   6595  C  C   . ASN B  1  157 ? 33.765  37.275  -42.644 1.00 38.28  ? 185  ASN B C   1 
ATOM   6596  O  O   . ASN B  1  157 ? 34.015  36.660  -43.666 1.00 38.52  ? 185  ASN B O   1 
ATOM   6597  C  CB  . ASN B  1  157 ? 31.277  37.543  -42.348 1.00 38.19  ? 185  ASN B CB  1 
ATOM   6598  C  CG  . ASN B  1  157 ? 30.002  36.907  -41.768 1.00 39.09  ? 185  ASN B CG  1 
ATOM   6599  O  OD1 . ASN B  1  157 ? 29.072  37.616  -41.409 1.00 41.91  ? 185  ASN B OD1 1 
ATOM   6600  N  ND2 . ASN B  1  157 ? 29.964  35.575  -41.668 1.00 38.40  ? 185  ASN B ND2 1 
ATOM   6601  N  N   . ARG B  1  158 ? 34.513  38.282  -42.191 1.00 38.67  ? 186  ARG B N   1 
ATOM   6602  C  CA  . ARG B  1  158 ? 35.666  38.799  -42.939 1.00 39.13  ? 186  ARG B CA  1 
ATOM   6603  C  C   . ARG B  1  158 ? 37.004  38.432  -42.306 1.00 38.77  ? 186  ARG B C   1 
ATOM   6604  O  O   . ARG B  1  158 ? 38.028  38.401  -42.990 1.00 38.99  ? 186  ARG B O   1 
ATOM   6605  C  CB  . ARG B  1  158 ? 35.610  40.331  -43.072 1.00 39.32  ? 186  ARG B CB  1 
ATOM   6606  C  CG  . ARG B  1  158 ? 34.487  40.890  -43.946 1.00 40.29  ? 186  ARG B CG  1 
ATOM   6607  C  CD  . ARG B  1  158 ? 34.851  42.269  -44.520 1.00 40.32  ? 186  ARG B CD  1 
ATOM   6608  N  NE  . ARG B  1  158 ? 34.667  43.400  -43.598 1.00 42.78  ? 186  ARG B NE  1 
ATOM   6609  C  CZ  . ARG B  1  158 ? 35.647  44.182  -43.135 1.00 43.19  ? 186  ARG B CZ  1 
ATOM   6610  N  NH1 . ARG B  1  158 ? 36.911  43.953  -43.473 1.00 43.51  ? 186  ARG B NH1 1 
ATOM   6611  N  NH2 . ARG B  1  158 ? 35.365  45.194  -42.319 1.00 42.81  ? 186  ARG B NH2 1 
ATOM   6612  N  N   . GLU B  1  159 ? 37.009  38.181  -41.000 1.00 38.21  ? 187  GLU B N   1 
ATOM   6613  C  CA  . GLU B  1  159 ? 38.273  38.107  -40.281 1.00 37.31  ? 187  GLU B CA  1 
ATOM   6614  C  C   . GLU B  1  159 ? 38.654  36.701  -39.852 1.00 36.86  ? 187  GLU B C   1 
ATOM   6615  O  O   . GLU B  1  159 ? 39.721  36.219  -40.228 1.00 37.39  ? 187  GLU B O   1 
ATOM   6616  C  CB  . GLU B  1  159 ? 38.299  39.098  -39.119 1.00 37.19  ? 187  GLU B CB  1 
ATOM   6617  C  CG  . GLU B  1  159 ? 38.163  40.581  -39.548 1.00 37.47  ? 187  GLU B CG  1 
ATOM   6618  C  CD  . GLU B  1  159 ? 39.353  41.123  -40.359 1.00 38.05  ? 187  GLU B CD  1 
ATOM   6619  O  OE1 . GLU B  1  159 ? 40.500  40.691  -40.124 1.00 38.70  ? 187  GLU B OE1 1 
ATOM   6620  O  OE2 . GLU B  1  159 ? 39.146  42.003  -41.227 1.00 38.79  ? 187  GLU B OE2 1 
ATOM   6621  N  N   . LEU B  1  160 ? 37.784  36.023  -39.109 1.00 35.88  ? 188  LEU B N   1 
ATOM   6622  C  CA  . LEU B  1  160 ? 38.083  34.660  -38.655 1.00 34.80  ? 188  LEU B CA  1 
ATOM   6623  C  C   . LEU B  1  160 ? 38.271  33.618  -39.775 1.00 34.81  ? 188  LEU B C   1 
ATOM   6624  O  O   . LEU B  1  160 ? 39.159  32.772  -39.659 1.00 34.99  ? 188  LEU B O   1 
ATOM   6625  C  CB  . LEU B  1  160 ? 37.071  34.184  -37.608 1.00 34.51  ? 188  LEU B CB  1 
ATOM   6626  C  CG  . LEU B  1  160 ? 37.090  34.906  -36.255 1.00 32.80  ? 188  LEU B CG  1 
ATOM   6627  C  CD1 . LEU B  1  160 ? 36.245  34.138  -35.257 1.00 31.28  ? 188  LEU B CD1 1 
ATOM   6628  C  CD2 . LEU B  1  160 ? 38.502  35.100  -35.697 1.00 29.22  ? 188  LEU B CD2 1 
ATOM   6629  N  N   . PRO B  1  161 ? 37.441  33.661  -40.850 1.00 34.48  ? 189  PRO B N   1 
ATOM   6630  C  CA  . PRO B  1  161 ? 37.664  32.819  -42.044 1.00 34.17  ? 189  PRO B CA  1 
ATOM   6631  C  C   . PRO B  1  161 ? 39.115  32.744  -42.552 1.00 33.74  ? 189  PRO B C   1 
ATOM   6632  O  O   . PRO B  1  161 ? 39.539  31.700  -43.028 1.00 33.37  ? 189  PRO B O   1 
ATOM   6633  C  CB  . PRO B  1  161 ? 36.767  33.476  -43.094 1.00 34.08  ? 189  PRO B CB  1 
ATOM   6634  C  CG  . PRO B  1  161 ? 35.623  33.951  -42.312 1.00 33.86  ? 189  PRO B CG  1 
ATOM   6635  C  CD  . PRO B  1  161 ? 36.202  34.451  -41.002 1.00 34.46  ? 189  PRO B CD  1 
ATOM   6636  N  N   . GLN B  1  162 ? 39.863  33.834  -42.426 1.00 33.56  ? 190  GLN B N   1 
ATOM   6637  C  CA  . GLN B  1  162 ? 41.267  33.856  -42.811 1.00 33.33  ? 190  GLN B CA  1 
ATOM   6638  C  C   . GLN B  1  162 ? 42.152  33.000  -41.913 1.00 33.48  ? 190  GLN B C   1 
ATOM   6639  O  O   . GLN B  1  162 ? 43.238  32.595  -42.317 1.00 33.60  ? 190  GLN B O   1 
ATOM   6640  C  CB  . GLN B  1  162 ? 41.788  35.279  -42.800 1.00 33.48  ? 190  GLN B CB  1 
ATOM   6641  C  CG  . GLN B  1  162 ? 41.134  36.199  -43.812 1.00 33.28  ? 190  GLN B CG  1 
ATOM   6642  C  CD  . GLN B  1  162 ? 41.623  37.611  -43.646 1.00 34.23  ? 190  GLN B CD  1 
ATOM   6643  O  OE1 . GLN B  1  162 ? 42.819  37.878  -43.778 1.00 34.35  ? 190  GLN B OE1 1 
ATOM   6644  N  NE2 . GLN B  1  162 ? 40.709  38.528  -43.333 1.00 34.31  ? 190  GLN B NE2 1 
ATOM   6645  N  N   . ALA B  1  163 ? 41.699  32.739  -40.691 1.00 33.55  ? 191  ALA B N   1 
ATOM   6646  C  CA  . ALA B  1  163 ? 42.429  31.870  -39.781 1.00 33.52  ? 191  ALA B CA  1 
ATOM   6647  C  C   . ALA B  1  163 ? 41.722  30.513  -39.682 1.00 33.74  ? 191  ALA B C   1 
ATOM   6648  O  O   . ALA B  1  163 ? 41.894  29.768  -38.726 1.00 33.95  ? 191  ALA B O   1 
ATOM   6649  C  CB  . ALA B  1  163 ? 42.569  32.530  -38.418 1.00 33.15  ? 191  ALA B CB  1 
ATOM   6650  N  N   . SER B  1  164 ? 40.934  30.194  -40.700 1.00 34.09  ? 192  SER B N   1 
ATOM   6651  C  CA  . SER B  1  164 ? 40.151  28.964  -40.736 1.00 34.21  ? 192  SER B CA  1 
ATOM   6652  C  C   . SER B  1  164 ? 40.950  27.728  -40.339 1.00 34.11  ? 192  SER B C   1 
ATOM   6653  O  O   . SER B  1  164 ? 40.431  26.855  -39.633 1.00 33.73  ? 192  SER B O   1 
ATOM   6654  C  CB  . SER B  1  164 ? 39.577  28.752  -42.135 1.00 34.28  ? 192  SER B CB  1 
ATOM   6655  O  OG  . SER B  1  164 ? 38.519  27.814  -42.094 1.00 35.75  ? 192  SER B OG  1 
ATOM   6656  N  N   . GLY B  1  165 ? 42.197  27.657  -40.813 1.00 33.80  ? 193  GLY B N   1 
ATOM   6657  C  CA  . GLY B  1  165 ? 43.058  26.507  -40.576 1.00 33.38  ? 193  GLY B CA  1 
ATOM   6658  C  C   . GLY B  1  165 ? 43.362  26.345  -39.103 1.00 33.56  ? 193  GLY B C   1 
ATOM   6659  O  O   . GLY B  1  165 ? 43.083  25.293  -38.515 1.00 33.56  ? 193  GLY B O   1 
ATOM   6660  N  N   . LEU B  1  166 ? 43.930  27.397  -38.512 1.00 33.46  ? 194  LEU B N   1 
ATOM   6661  C  CA  . LEU B  1  166 ? 44.270  27.431  -37.094 1.00 33.50  ? 194  LEU B CA  1 
ATOM   6662  C  C   . LEU B  1  166 ? 43.056  27.140  -36.222 1.00 33.40  ? 194  LEU B C   1 
ATOM   6663  O  O   . LEU B  1  166 ? 43.126  26.325  -35.297 1.00 33.40  ? 194  LEU B O   1 
ATOM   6664  C  CB  . LEU B  1  166 ? 44.866  28.795  -36.714 1.00 33.51  ? 194  LEU B CB  1 
ATOM   6665  C  CG  . LEU B  1  166 ? 44.934  29.055  -35.203 1.00 34.22  ? 194  LEU B CG  1 
ATOM   6666  C  CD1 . LEU B  1  166 ? 45.946  28.116  -34.567 1.00 35.26  ? 194  LEU B CD1 1 
ATOM   6667  C  CD2 . LEU B  1  166 ? 45.281  30.484  -34.887 1.00 33.73  ? 194  LEU B CD2 1 
ATOM   6668  N  N   . LEU B  1  167 ? 41.949  27.811  -36.530 1.00 33.56  ? 195  LEU B N   1 
ATOM   6669  C  CA  . LEU B  1  167 ? 40.734  27.722  -35.732 1.00 33.71  ? 195  LEU B CA  1 
ATOM   6670  C  C   . LEU B  1  167 ? 40.123  26.339  -35.807 1.00 34.43  ? 195  LEU B C   1 
ATOM   6671  O  O   . LEU B  1  167 ? 39.644  25.830  -34.805 1.00 34.65  ? 195  LEU B O   1 
ATOM   6672  C  CB  . LEU B  1  167 ? 39.721  28.792  -36.146 1.00 33.43  ? 195  LEU B CB  1 
ATOM   6673  C  CG  . LEU B  1  167 ? 40.068  30.237  -35.790 1.00 32.37  ? 195  LEU B CG  1 
ATOM   6674  C  CD1 . LEU B  1  167 ? 39.052  31.183  -36.399 1.00 30.96  ? 195  LEU B CD1 1 
ATOM   6675  C  CD2 . LEU B  1  167 ? 40.148  30.421  -34.277 1.00 31.36  ? 195  LEU B CD2 1 
ATOM   6676  N  N   . HIS B  1  168 ? 40.155  25.735  -36.989 1.00 35.39  ? 196  HIS B N   1 
ATOM   6677  C  CA  . HIS B  1  168 ? 39.742  24.342  -37.184 1.00 36.86  ? 196  HIS B CA  1 
ATOM   6678  C  C   . HIS B  1  168 ? 40.476  23.392  -36.230 1.00 36.87  ? 196  HIS B C   1 
ATOM   6679  O  O   . HIS B  1  168 ? 39.862  22.521  -35.604 1.00 36.99  ? 196  HIS B O   1 
ATOM   6680  C  CB  . HIS B  1  168 ? 39.974  23.925  -38.643 1.00 37.21  ? 196  HIS B CB  1 
ATOM   6681  C  CG  . HIS B  1  168 ? 39.560  22.519  -38.954 1.00 41.01  ? 196  HIS B CG  1 
ATOM   6682  N  ND1 . HIS B  1  168 ? 38.254  22.082  -38.847 1.00 44.19  ? 196  HIS B ND1 1 
ATOM   6683  C  CD2 . HIS B  1  168 ? 40.278  21.453  -39.394 1.00 44.09  ? 196  HIS B CD2 1 
ATOM   6684  C  CE1 . HIS B  1  168 ? 38.188  20.805  -39.189 1.00 45.12  ? 196  HIS B CE1 1 
ATOM   6685  N  NE2 . HIS B  1  168 ? 39.400  20.402  -39.535 1.00 45.03  ? 196  HIS B NE2 1 
ATOM   6686  N  N   . HIS B  1  169 ? 41.786  23.585  -36.114 1.00 36.76  ? 197  HIS B N   1 
ATOM   6687  C  CA  . HIS B  1  169 ? 42.634  22.766  -35.255 1.00 36.63  ? 197  HIS B CA  1 
ATOM   6688  C  C   . HIS B  1  169 ? 42.454  23.012  -33.739 1.00 36.35  ? 197  HIS B C   1 
ATOM   6689  O  O   . HIS B  1  169 ? 42.445  22.055  -32.959 1.00 36.16  ? 197  HIS B O   1 
ATOM   6690  C  CB  . HIS B  1  169 ? 44.092  22.973  -35.658 1.00 36.61  ? 197  HIS B CB  1 
ATOM   6691  C  CG  . HIS B  1  169 ? 45.052  22.092  -34.930 1.00 37.38  ? 197  HIS B CG  1 
ATOM   6692  N  ND1 . HIS B  1  169 ? 45.252  20.771  -35.266 1.00 39.18  ? 197  HIS B ND1 1 
ATOM   6693  C  CD2 . HIS B  1  169 ? 45.880  22.346  -33.892 1.00 38.37  ? 197  HIS B CD2 1 
ATOM   6694  C  CE1 . HIS B  1  169 ? 46.165  20.247  -34.468 1.00 39.20  ? 197  HIS B CE1 1 
ATOM   6695  N  NE2 . HIS B  1  169 ? 46.559  21.182  -33.622 1.00 39.55  ? 197  HIS B NE2 1 
ATOM   6696  N  N   . CYS B  1  170 ? 42.331  24.275  -33.323 1.00 36.06  ? 198  CYS B N   1 
ATOM   6697  C  CA  . CYS B  1  170 ? 42.254  24.614  -31.879 1.00 36.15  ? 198  CYS B CA  1 
ATOM   6698  C  C   . CYS B  1  170 ? 40.849  24.639  -31.280 1.00 36.22  ? 198  CYS B C   1 
ATOM   6699  O  O   . CYS B  1  170 ? 40.678  24.406  -30.095 1.00 36.08  ? 198  CYS B O   1 
ATOM   6700  C  CB  . CYS B  1  170 ? 42.879  25.984  -31.594 1.00 35.73  ? 198  CYS B CB  1 
ATOM   6701  S  SG  . CYS B  1  170 ? 41.937  27.403  -32.262 1.00 36.07  ? 198  CYS B SG  1 
ATOM   6702  N  N   . CYS B  1  171 ? 39.851  24.949  -32.094 1.00 36.61  ? 199  CYS B N   1 
ATOM   6703  C  CA  . CYS B  1  171 ? 38.672  25.600  -31.566 1.00 37.45  ? 199  CYS B CA  1 
ATOM   6704  C  C   . CYS B  1  171 ? 37.344  25.102  -32.124 1.00 37.94  ? 199  CYS B C   1 
ATOM   6705  O  O   . CYS B  1  171 ? 36.326  25.785  -31.994 1.00 37.95  ? 199  CYS B O   1 
ATOM   6706  C  CB  . CYS B  1  171 ? 38.834  27.113  -31.755 1.00 37.08  ? 199  CYS B CB  1 
ATOM   6707  S  SG  . CYS B  1  171 ? 40.361  27.753  -30.974 1.00 38.63  ? 199  CYS B SG  1 
ATOM   6708  N  N   . PHE B  1  172 ? 37.365  23.909  -32.722 1.00 38.99  ? 200  PHE B N   1 
ATOM   6709  C  CA  . PHE B  1  172 ? 36.156  23.211  -33.201 1.00 40.18  ? 200  PHE B CA  1 
ATOM   6710  C  C   . PHE B  1  172 ? 35.329  24.081  -34.156 1.00 41.38  ? 200  PHE B C   1 
ATOM   6711  O  O   . PHE B  1  172 ? 34.098  24.077  -34.122 1.00 41.55  ? 200  PHE B O   1 
ATOM   6712  C  CB  . PHE B  1  172 ? 35.296  22.710  -32.019 1.00 39.63  ? 200  PHE B CB  1 
ATOM   6713  C  CG  . PHE B  1  172 ? 36.050  21.853  -31.032 1.00 39.02  ? 200  PHE B CG  1 
ATOM   6714  C  CD1 . PHE B  1  172 ? 36.620  22.414  -29.893 1.00 37.64  ? 200  PHE B CD1 1 
ATOM   6715  C  CD2 . PHE B  1  172 ? 36.203  20.487  -31.246 1.00 38.34  ? 200  PHE B CD2 1 
ATOM   6716  C  CE1 . PHE B  1  172 ? 37.325  21.622  -28.982 1.00 37.10  ? 200  PHE B CE1 1 
ATOM   6717  C  CE2 . PHE B  1  172 ? 36.906  19.682  -30.327 1.00 37.44  ? 200  PHE B CE2 1 
ATOM   6718  C  CZ  . PHE B  1  172 ? 37.464  20.250  -29.202 1.00 36.97  ? 200  PHE B CZ  1 
ATOM   6719  N  N   . TYR B  1  173 ? 36.036  24.819  -35.005 1.00 42.87  ? 201  TYR B N   1 
ATOM   6720  C  CA  . TYR B  1  173 ? 35.457  25.796  -35.919 1.00 44.43  ? 201  TYR B CA  1 
ATOM   6721  C  C   . TYR B  1  173 ? 34.869  25.099  -37.140 1.00 46.19  ? 201  TYR B C   1 
ATOM   6722  O  O   . TYR B  1  173 ? 35.415  24.094  -37.610 1.00 46.28  ? 201  TYR B O   1 
ATOM   6723  C  CB  . TYR B  1  173 ? 36.576  26.755  -36.324 1.00 43.59  ? 201  TYR B CB  1 
ATOM   6724  C  CG  . TYR B  1  173 ? 36.241  27.891  -37.259 1.00 42.61  ? 201  TYR B CG  1 
ATOM   6725  C  CD1 . TYR B  1  173 ? 35.691  29.085  -36.782 1.00 40.76  ? 201  TYR B CD1 1 
ATOM   6726  C  CD2 . TYR B  1  173 ? 36.540  27.803  -38.614 1.00 42.20  ? 201  TYR B CD2 1 
ATOM   6727  C  CE1 . TYR B  1  173 ? 35.414  30.145  -37.638 1.00 39.43  ? 201  TYR B CE1 1 
ATOM   6728  C  CE2 . TYR B  1  173 ? 36.263  28.866  -39.482 1.00 42.15  ? 201  TYR B CE2 1 
ATOM   6729  C  CZ  . TYR B  1  173 ? 35.709  30.031  -38.981 1.00 41.26  ? 201  TYR B CZ  1 
ATOM   6730  O  OH  . TYR B  1  173 ? 35.450  31.065  -39.842 1.00 41.81  ? 201  TYR B OH  1 
ATOM   6731  N  N   . LYS B  1  174 ? 33.748  25.622  -37.632 1.00 48.63  ? 202  LYS B N   1 
ATOM   6732  C  CA  . LYS B  1  174 ? 33.120  25.143  -38.873 1.00 51.30  ? 202  LYS B CA  1 
ATOM   6733  C  C   . LYS B  1  174 ? 32.831  26.336  -39.791 1.00 53.08  ? 202  LYS B C   1 
ATOM   6734  O  O   . LYS B  1  174 ? 32.734  27.473  -39.314 1.00 53.55  ? 202  LYS B O   1 
ATOM   6735  C  CB  . LYS B  1  174 ? 31.812  24.375  -38.590 1.00 51.43  ? 202  LYS B CB  1 
ATOM   6736  C  CG  . LYS B  1  174 ? 31.842  23.363  -37.424 1.00 52.05  ? 202  LYS B CG  1 
ATOM   6737  C  CD  . LYS B  1  174 ? 32.807  22.190  -37.675 1.00 53.26  ? 202  LYS B CD  1 
ATOM   6738  C  CE  . LYS B  1  174 ? 32.593  21.033  -36.683 1.00 53.40  ? 202  LYS B CE  1 
ATOM   6739  N  NZ  . LYS B  1  174 ? 32.711  21.434  -35.240 1.00 53.07  ? 202  LYS B NZ  1 
ATOM   6740  N  N   . HIS B  1  175 ? 32.676  26.067  -41.093 1.00 55.37  ? 203  HIS B N   1 
ATOM   6741  C  CA  . HIS B  1  175 ? 32.413  27.085  -42.141 1.00 57.51  ? 203  HIS B CA  1 
ATOM   6742  C  C   . HIS B  1  175 ? 31.512  28.240  -41.678 1.00 57.98  ? 203  HIS B C   1 
ATOM   6743  O  O   . HIS B  1  175 ? 31.972  29.378  -41.529 1.00 58.20  ? 203  HIS B O   1 
ATOM   6744  C  CB  . HIS B  1  175 ? 31.792  26.435  -43.389 1.00 58.26  ? 203  HIS B CB  1 
ATOM   6745  C  CG  . HIS B  1  175 ? 32.568  25.265  -43.929 1.00 61.76  ? 203  HIS B CG  1 
ATOM   6746  N  ND1 . HIS B  1  175 ? 33.140  25.267  -45.188 1.00 64.43  ? 203  HIS B ND1 1 
ATOM   6747  C  CD2 . HIS B  1  175 ? 32.848  24.049  -43.391 1.00 63.79  ? 203  HIS B CD2 1 
ATOM   6748  C  CE1 . HIS B  1  175 ? 33.739  24.107  -45.400 1.00 64.96  ? 203  HIS B CE1 1 
ATOM   6749  N  NE2 . HIS B  1  175 ? 33.579  23.351  -44.325 1.00 65.16  ? 203  HIS B NE2 1 
ATOM   6750  N  N   . ARG B  1  176 ? 30.231  27.936  -41.463 1.00 58.57  ? 204  ARG B N   1 
ATOM   6751  C  CA  . ARG B  1  176 ? 29.273  28.887  -40.882 1.00 59.21  ? 204  ARG B CA  1 
ATOM   6752  C  C   . ARG B  1  176 ? 29.475  28.934  -39.367 1.00 58.42  ? 204  ARG B C   1 
ATOM   6753  O  O   . ARG B  1  176 ? 30.024  29.913  -38.836 1.00 58.58  ? 204  ARG B O   1 
ATOM   6754  C  CB  . ARG B  1  176 ? 27.837  28.468  -41.211 1.00 59.30  ? 204  ARG B CB  1 
ATOM   6755  C  CG  . ARG B  1  176 ? 27.666  27.918  -42.624 1.00 60.52  ? 204  ARG B CG  1 
ATOM   6756  C  CD  . ARG B  1  176 ? 26.224  27.509  -42.898 1.00 61.06  ? 204  ARG B CD  1 
ATOM   6757  N  NE  . ARG B  1  176 ? 25.978  27.379  -44.336 1.00 65.43  ? 204  ARG B NE  1 
ATOM   6758  C  CZ  . ARG B  1  176 ? 24.773  27.407  -44.904 1.00 67.01  ? 204  ARG B CZ  1 
ATOM   6759  N  NH1 . ARG B  1  176 ? 23.680  27.560  -44.156 1.00 68.12  ? 204  ARG B NH1 1 
ATOM   6760  N  NH2 . ARG B  1  176 ? 24.659  27.288  -46.224 1.00 67.41  ? 204  ARG B NH2 1 
ATOM   6761  N  N   . GLY B  1  177 ? 29.016  27.873  -38.694 1.00 57.55  ? 205  GLY B N   1 
ATOM   6762  C  CA  . GLY B  1  177 ? 29.356  27.583  -37.291 1.00 56.27  ? 205  GLY B CA  1 
ATOM   6763  C  C   . GLY B  1  177 ? 28.912  28.585  -36.241 1.00 55.11  ? 205  GLY B C   1 
ATOM   6764  O  O   . GLY B  1  177 ? 27.940  28.341  -35.521 1.00 55.36  ? 205  GLY B O   1 
ATOM   6765  N  N   . ARG B  1  178 ? 29.640  29.705  -36.150 1.00 53.79  ? 206  ARG B N   1 
ATOM   6766  C  CA  . ARG B  1  178 ? 29.427  30.727  -35.111 1.00 51.87  ? 206  ARG B CA  1 
ATOM   6767  C  C   . ARG B  1  178 ? 29.392  30.100  -33.708 1.00 49.99  ? 206  ARG B C   1 
ATOM   6768  O  O   . ARG B  1  178 ? 28.532  30.450  -32.891 1.00 49.90  ? 206  ARG B O   1 
ATOM   6769  C  CB  . ARG B  1  178 ? 28.131  31.524  -35.374 1.00 52.38  ? 206  ARG B CB  1 
ATOM   6770  C  CG  . ARG B  1  178 ? 28.015  32.219  -36.755 1.00 53.78  ? 206  ARG B CG  1 
ATOM   6771  C  CD  . ARG B  1  178 ? 28.585  33.649  -36.753 1.00 55.47  ? 206  ARG B CD  1 
ATOM   6772  N  NE  . ARG B  1  178 ? 28.486  34.270  -35.431 1.00 56.34  ? 206  ARG B NE  1 
ATOM   6773  C  CZ  . ARG B  1  178 ? 28.260  35.564  -35.194 1.00 57.73  ? 206  ARG B CZ  1 
ATOM   6774  N  NH1 . ARG B  1  178 ? 28.091  36.433  -36.193 1.00 57.29  ? 206  ARG B NH1 1 
ATOM   6775  N  NH2 . ARG B  1  178 ? 28.193  35.989  -33.935 1.00 57.98  ? 206  ARG B NH2 1 
ATOM   6776  N  N   . ASN B  1  179 ? 30.315  29.170  -33.444 1.00 47.49  ? 207  ASN B N   1 
ATOM   6777  C  CA  . ASN B  1  179 ? 30.436  28.516  -32.129 1.00 44.90  ? 207  ASN B CA  1 
ATOM   6778  C  C   . ASN B  1  179 ? 31.321  29.298  -31.158 1.00 42.89  ? 207  ASN B C   1 
ATOM   6779  O  O   . ASN B  1  179 ? 31.523  28.873  -30.022 1.00 42.37  ? 207  ASN B O   1 
ATOM   6780  C  CB  . ASN B  1  179 ? 30.987  27.099  -32.272 1.00 45.07  ? 207  ASN B CB  1 
ATOM   6781  C  CG  . ASN B  1  179 ? 32.484  27.082  -32.580 1.00 45.52  ? 207  ASN B CG  1 
ATOM   6782  O  OD1 . ASN B  1  179 ? 32.940  27.719  -33.545 1.00 45.73  ? 207  ASN B OD1 1 
ATOM   6783  N  ND2 . ASN B  1  179 ? 33.262  26.366  -31.746 1.00 43.95  ? 207  ASN B ND2 1 
ATOM   6784  N  N   . LEU B  1  180 ? 31.873  30.414  -31.632 1.00 40.62  ? 208  LEU B N   1 
ATOM   6785  C  CA  . LEU B  1  180 ? 32.631  31.336  -30.793 1.00 38.72  ? 208  LEU B CA  1 
ATOM   6786  C  C   . LEU B  1  180 ? 31.825  32.605  -30.566 1.00 37.59  ? 208  LEU B C   1 
ATOM   6787  O  O   . LEU B  1  180 ? 30.988  32.956  -31.392 1.00 38.08  ? 208  LEU B O   1 
ATOM   6788  C  CB  . LEU B  1  180 ? 33.977  31.688  -31.428 1.00 38.17  ? 208  LEU B CB  1 
ATOM   6789  C  CG  . LEU B  1  180 ? 34.966  30.573  -31.771 1.00 38.09  ? 208  LEU B CG  1 
ATOM   6790  C  CD1 . LEU B  1  180 ? 36.118  31.107  -32.629 1.00 37.46  ? 208  LEU B CD1 1 
ATOM   6791  C  CD2 . LEU B  1  180 ? 35.492  29.873  -30.540 1.00 36.76  ? 208  LEU B CD2 1 
ATOM   6792  N  N   . VAL B  1  181 ? 32.058  33.272  -29.440 1.00 35.84  ? 209  VAL B N   1 
ATOM   6793  C  CA  . VAL B  1  181 ? 31.423  34.558  -29.153 1.00 34.63  ? 209  VAL B CA  1 
ATOM   6794  C  C   . VAL B  1  181 ? 32.439  35.603  -28.675 1.00 34.31  ? 209  VAL B C   1 
ATOM   6795  O  O   . VAL B  1  181 ? 33.518  35.261  -28.188 1.00 33.53  ? 209  VAL B O   1 
ATOM   6796  C  CB  . VAL B  1  181 ? 30.252  34.442  -28.143 1.00 34.40  ? 209  VAL B CB  1 
ATOM   6797  C  CG1 . VAL B  1  181 ? 29.118  33.620  -28.740 1.00 35.24  ? 209  VAL B CG1 1 
ATOM   6798  C  CG2 . VAL B  1  181 ? 30.709  33.870  -26.817 1.00 32.33  ? 209  VAL B CG2 1 
ATOM   6799  N  N   . THR B  1  182 ? 32.091  36.874  -28.835 1.00 33.84  ? 210  THR B N   1 
ATOM   6800  C  CA  . THR B  1  182 ? 32.983  37.950  -28.434 1.00 33.86  ? 210  THR B CA  1 
ATOM   6801  C  C   . THR B  1  182 ? 32.506  38.554  -27.131 1.00 34.02  ? 210  THR B C   1 
ATOM   6802  O  O   . THR B  1  182 ? 31.327  38.444  -26.794 1.00 33.70  ? 210  THR B O   1 
ATOM   6803  C  CB  . THR B  1  182 ? 33.032  39.085  -29.477 1.00 33.72  ? 210  THR B CB  1 
ATOM   6804  O  OG1 . THR B  1  182 ? 31.711  39.599  -29.676 1.00 33.22  ? 210  THR B OG1 1 
ATOM   6805  C  CG2 . THR B  1  182 ? 33.601  38.603  -30.796 1.00 33.30  ? 210  THR B CG2 1 
ATOM   6806  N  N   . MET B  1  183 ? 33.430  39.190  -26.409 1.00 34.25  ? 211  MET B N   1 
ATOM   6807  C  CA  . MET B  1  183 ? 33.072  40.059  -25.289 1.00 34.95  ? 211  MET B CA  1 
ATOM   6808  C  C   . MET B  1  183 ? 33.866  41.358  -25.331 1.00 34.66  ? 211  MET B C   1 
ATOM   6809  O  O   . MET B  1  183 ? 35.104  41.346  -25.349 1.00 34.44  ? 211  MET B O   1 
ATOM   6810  C  CB  . MET B  1  183 ? 33.288  39.374  -23.941 1.00 34.65  ? 211  MET B CB  1 
ATOM   6811  C  CG  . MET B  1  183 ? 32.396  39.938  -22.851 1.00 35.49  ? 211  MET B CG  1 
ATOM   6812  S  SD  . MET B  1  183 ? 32.661  39.269  -21.201 1.00 37.57  ? 211  MET B SD  1 
ATOM   6813  C  CE  . MET B  1  183 ? 34.199  40.076  -20.701 1.00 38.01  ? 211  MET B CE  1 
ATOM   6814  N  N   . THR B  1  184 ? 33.145  42.478  -25.324 1.00 34.41  ? 212  THR B N   1 
ATOM   6815  C  CA  . THR B  1  184 ? 33.775  43.787  -25.302 1.00 33.99  ? 212  THR B CA  1 
ATOM   6816  C  C   . THR B  1  184 ? 34.613  43.981  -24.032 1.00 34.07  ? 212  THR B C   1 
ATOM   6817  O  O   . THR B  1  184 ? 34.373  43.364  -23.001 1.00 34.13  ? 212  THR B O   1 
ATOM   6818  C  CB  . THR B  1  184 ? 32.723  44.919  -25.440 1.00 33.93  ? 212  THR B CB  1 
ATOM   6819  O  OG1 . THR B  1  184 ? 33.371  46.163  -25.717 1.00 33.47  ? 212  THR B OG1 1 
ATOM   6820  C  CG2 . THR B  1  184 ? 31.870  45.064  -24.166 1.00 34.06  ? 212  THR B CG2 1 
ATOM   6821  N  N   . THR B  1  185 ? 35.634  44.808  -24.140 1.00 33.93  ? 213  THR B N   1 
ATOM   6822  C  CA  . THR B  1  185 ? 36.253  45.397  -22.981 1.00 33.68  ? 213  THR B CA  1 
ATOM   6823  C  C   . THR B  1  185 ? 36.058  46.901  -23.137 1.00 33.49  ? 213  THR B C   1 
ATOM   6824  O  O   . THR B  1  185 ? 35.326  47.343  -24.031 1.00 33.71  ? 213  THR B O   1 
ATOM   6825  C  CB  . THR B  1  185 ? 37.738  45.043  -22.899 1.00 33.95  ? 213  THR B CB  1 
ATOM   6826  O  OG1 . THR B  1  185 ? 38.376  45.374  -24.141 1.00 35.07  ? 213  THR B OG1 1 
ATOM   6827  C  CG2 . THR B  1  185 ? 37.913  43.559  -22.609 1.00 33.62  ? 213  THR B CG2 1 
ATOM   6828  N  N   . ALA B  1  186 ? 36.702  47.678  -22.272 1.00 33.28  ? 214  ALA B N   1 
ATOM   6829  C  CA  . ALA B  1  186 ? 36.589  49.141  -22.247 1.00 33.15  ? 214  ALA B CA  1 
ATOM   6830  C  C   . ALA B  1  186 ? 37.686  49.686  -21.324 1.00 33.11  ? 214  ALA B C   1 
ATOM   6831  O  O   . ALA B  1  186 ? 38.098  48.994  -20.390 1.00 34.05  ? 214  ALA B O   1 
ATOM   6832  C  CB  . ALA B  1  186 ? 35.204  49.564  -21.749 1.00 32.36  ? 214  ALA B CB  1 
ATOM   6833  N  N   . PRO B  1  187 ? 38.167  50.915  -21.563 1.00 32.79  ? 215  PRO B N   1 
ATOM   6834  C  CA  . PRO B  1  187 ? 37.806  51.829  -22.641 1.00 32.94  ? 215  PRO B CA  1 
ATOM   6835  C  C   . PRO B  1  187 ? 38.385  51.361  -23.981 1.00 33.07  ? 215  PRO B C   1 
ATOM   6836  O  O   . PRO B  1  187 ? 39.043  50.318  -24.051 1.00 33.43  ? 215  PRO B O   1 
ATOM   6837  C  CB  . PRO B  1  187 ? 38.460  53.146  -22.203 1.00 33.00  ? 215  PRO B CB  1 
ATOM   6838  C  CG  . PRO B  1  187 ? 39.657  52.710  -21.428 1.00 32.66  ? 215  PRO B CG  1 
ATOM   6839  C  CD  . PRO B  1  187 ? 39.191  51.497  -20.675 1.00 32.43  ? 215  PRO B CD  1 
ATOM   6840  N  N   . ARG B  1  188 ? 38.184  52.155  -25.022 1.00 32.72  ? 216  ARG B N   1 
ATOM   6841  C  CA  . ARG B  1  188 ? 38.462  51.712  -26.364 1.00 32.55  ? 216  ARG B CA  1 
ATOM   6842  C  C   . ARG B  1  188 ? 39.608  52.521  -26.968 1.00 32.85  ? 216  ARG B C   1 
ATOM   6843  O  O   . ARG B  1  188 ? 39.406  53.401  -27.813 1.00 33.02  ? 216  ARG B O   1 
ATOM   6844  C  CB  . ARG B  1  188 ? 37.174  51.806  -27.181 1.00 32.54  ? 216  ARG B CB  1 
ATOM   6845  C  CG  . ARG B  1  188 ? 35.955  51.409  -26.356 1.00 31.72  ? 216  ARG B CG  1 
ATOM   6846  C  CD  . ARG B  1  188 ? 34.655  51.518  -27.085 1.00 31.11  ? 216  ARG B CD  1 
ATOM   6847  N  NE  . ARG B  1  188 ? 33.544  51.073  -26.240 1.00 31.03  ? 216  ARG B NE  1 
ATOM   6848  C  CZ  . ARG B  1  188 ? 33.135  49.806  -26.118 1.00 31.11  ? 216  ARG B CZ  1 
ATOM   6849  N  NH1 . ARG B  1  188 ? 33.738  48.823  -26.786 1.00 30.10  ? 216  ARG B NH1 1 
ATOM   6850  N  NH2 . ARG B  1  188 ? 32.112  49.522  -25.323 1.00 29.85  ? 216  ARG B NH2 1 
ATOM   6851  N  N   . GLY B  1  189 ? 40.821  52.225  -26.519 1.00 32.83  ? 217  GLY B N   1 
ATOM   6852  C  CA  . GLY B  1  189 ? 42.002  52.863  -27.081 1.00 33.66  ? 217  GLY B CA  1 
ATOM   6853  C  C   . GLY B  1  189 ? 42.895  53.421  -26.008 1.00 34.01  ? 217  GLY B C   1 
ATOM   6854  O  O   . GLY B  1  189 ? 42.845  52.970  -24.871 1.00 34.37  ? 217  GLY B O   1 
ATOM   6855  N  N   . LEU B  1  190 ? 43.696  54.421  -26.361 1.00 34.50  ? 218  LEU B N   1 
ATOM   6856  C  CA  . LEU B  1  190 ? 44.746  54.906  -25.469 1.00 34.93  ? 218  LEU B CA  1 
ATOM   6857  C  C   . LEU B  1  190 ? 44.741  56.414  -25.252 1.00 35.10  ? 218  LEU B C   1 
ATOM   6858  O  O   . LEU B  1  190 ? 45.487  56.918  -24.415 1.00 35.49  ? 218  LEU B O   1 
ATOM   6859  C  CB  . LEU B  1  190 ? 46.122  54.427  -25.955 1.00 35.09  ? 218  LEU B CB  1 
ATOM   6860  C  CG  . LEU B  1  190 ? 46.250  52.919  -26.232 1.00 34.77  ? 218  LEU B CG  1 
ATOM   6861  C  CD1 . LEU B  1  190 ? 47.296  52.649  -27.297 1.00 34.03  ? 218  LEU B CD1 1 
ATOM   6862  C  CD2 . LEU B  1  190 ? 46.510  52.123  -24.965 1.00 34.18  ? 218  LEU B CD2 1 
ATOM   6863  N  N   . GLN B  1  191 ? 43.894  57.129  -25.984 1.00 35.45  ? 219  GLN B N   1 
ATOM   6864  C  CA  . GLN B  1  191 ? 43.778  58.593  -25.846 1.00 35.91  ? 219  GLN B CA  1 
ATOM   6865  C  C   . GLN B  1  191 ? 42.432  59.112  -26.361 1.00 35.94  ? 219  GLN B C   1 
ATOM   6866  O  O   . GLN B  1  191 ? 41.697  58.391  -27.039 1.00 36.35  ? 219  GLN B O   1 
ATOM   6867  C  CB  . GLN B  1  191 ? 44.919  59.289  -26.585 1.00 35.63  ? 219  GLN B CB  1 
ATOM   6868  C  CG  . GLN B  1  191 ? 44.743  59.281  -28.092 1.00 36.78  ? 219  GLN B CG  1 
ATOM   6869  C  CD  . GLN B  1  191 ? 46.035  59.476  -28.832 1.00 38.19  ? 219  GLN B CD  1 
ATOM   6870  O  OE1 . GLN B  1  191 ? 47.115  59.202  -28.306 1.00 40.04  ? 219  GLN B OE1 1 
ATOM   6871  N  NE2 . GLN B  1  191 ? 45.938  59.934  -30.068 1.00 38.77  ? 219  GLN B NE2 1 
ATOM   6872  N  N   . SER B  1  192 ? 42.115  60.366  -26.066 1.00 36.21  ? 220  SER B N   1 
ATOM   6873  C  CA  . SER B  1  192 ? 40.832  60.929  -26.490 1.00 36.62  ? 220  SER B CA  1 
ATOM   6874  C  C   . SER B  1  192 ? 40.636  60.843  -28.006 1.00 36.73  ? 220  SER B C   1 
ATOM   6875  O  O   . SER B  1  192 ? 41.508  61.267  -28.778 1.00 36.62  ? 220  SER B O   1 
ATOM   6876  C  CB  . SER B  1  192 ? 40.684  62.369  -26.014 1.00 36.59  ? 220  SER B CB  1 
ATOM   6877  O  OG  . SER B  1  192 ? 39.357  62.815  -26.206 1.00 37.74  ? 220  SER B OG  1 
ATOM   6878  N  N   . GLY B  1  193 ? 39.499  60.273  -28.415 1.00 36.80  ? 221  GLY B N   1 
ATOM   6879  C  CA  . GLY B  1  193 ? 39.137  60.130  -29.832 1.00 36.51  ? 221  GLY B CA  1 
ATOM   6880  C  C   . GLY B  1  193 ? 39.376  58.740  -30.413 1.00 36.66  ? 221  GLY B C   1 
ATOM   6881  O  O   . GLY B  1  193 ? 39.011  58.458  -31.559 1.00 36.90  ? 221  GLY B O   1 
ATOM   6882  N  N   . ASP B  1  194 ? 40.012  57.872  -29.637 1.00 36.46  ? 222  ASP B N   1 
ATOM   6883  C  CA  . ASP B  1  194 ? 40.188  56.488  -30.036 1.00 36.34  ? 222  ASP B CA  1 
ATOM   6884  C  C   . ASP B  1  194 ? 38.855  55.738  -29.908 1.00 36.21  ? 222  ASP B C   1 
ATOM   6885  O  O   . ASP B  1  194 ? 38.014  56.093  -29.086 1.00 36.35  ? 222  ASP B O   1 
ATOM   6886  C  CB  . ASP B  1  194 ? 41.277  55.827  -29.179 1.00 36.57  ? 222  ASP B CB  1 
ATOM   6887  C  CG  . ASP B  1  194 ? 42.705  56.265  -29.569 1.00 37.17  ? 222  ASP B CG  1 
ATOM   6888  O  OD1 . ASP B  1  194 ? 42.889  57.085  -30.497 1.00 38.00  ? 222  ASP B OD1 1 
ATOM   6889  O  OD2 . ASP B  1  194 ? 43.662  55.771  -28.937 1.00 37.99  ? 222  ASP B OD2 1 
ATOM   6890  N  N   . ARG B  1  195 ? 38.649  54.731  -30.748 1.00 35.75  ? 223  ARG B N   1 
ATOM   6891  C  CA  . ARG B  1  195 ? 37.491  53.846  -30.615 1.00 35.40  ? 223  ARG B CA  1 
ATOM   6892  C  C   . ARG B  1  195 ? 37.895  52.433  -31.065 1.00 35.21  ? 223  ARG B C   1 
ATOM   6893  O  O   . ARG B  1  195 ? 37.298  51.845  -31.969 1.00 35.20  ? 223  ARG B O   1 
ATOM   6894  C  CB  . ARG B  1  195 ? 36.289  54.390  -31.393 1.00 34.90  ? 223  ARG B CB  1 
ATOM   6895  C  CG  . ARG B  1  195 ? 34.952  53.845  -30.929 1.00 35.68  ? 223  ARG B CG  1 
ATOM   6896  C  CD  . ARG B  1  195 ? 33.807  54.540  -31.656 1.00 35.89  ? 223  ARG B CD  1 
ATOM   6897  N  NE  . ARG B  1  195 ? 32.488  53.975  -31.372 1.00 35.82  ? 223  ARG B NE  1 
ATOM   6898  C  CZ  . ARG B  1  195 ? 31.662  54.423  -30.425 1.00 37.02  ? 223  ARG B CZ  1 
ATOM   6899  N  NH1 . ARG B  1  195 ? 32.018  55.437  -29.638 1.00 35.07  ? 223  ARG B NH1 1 
ATOM   6900  N  NH2 . ARG B  1  195 ? 30.471  53.848  -30.258 1.00 38.02  ? 223  ARG B NH2 1 
ATOM   6901  N  N   . ALA B  1  196 ? 38.929  51.911  -30.407 1.00 35.13  ? 224  ALA B N   1 
ATOM   6902  C  CA  . ALA B  1  196 ? 39.513  50.607  -30.716 1.00 35.03  ? 224  ALA B CA  1 
ATOM   6903  C  C   . ALA B  1  196 ? 39.371  49.681  -29.522 1.00 34.88  ? 224  ALA B C   1 
ATOM   6904  O  O   . ALA B  1  196 ? 40.049  49.856  -28.501 1.00 34.64  ? 224  ALA B O   1 
ATOM   6905  C  CB  . ALA B  1  196 ? 40.977  50.755  -31.100 1.00 35.10  ? 224  ALA B CB  1 
ATOM   6906  N  N   . THR B  1  197 ? 38.491  48.692  -29.670 1.00 34.44  ? 225  THR B N   1 
ATOM   6907  C  CA  . THR B  1  197 ? 38.145  47.782  -28.592 1.00 34.02  ? 225  THR B CA  1 
ATOM   6908  C  C   . THR B  1  197 ? 38.838  46.434  -28.750 1.00 33.35  ? 225  THR B C   1 
ATOM   6909  O  O   . THR B  1  197 ? 38.871  45.880  -29.845 1.00 33.84  ? 225  THR B O   1 
ATOM   6910  C  CB  . THR B  1  197 ? 36.635  47.550  -28.565 1.00 34.46  ? 225  THR B CB  1 
ATOM   6911  O  OG1 . THR B  1  197 ? 35.963  48.812  -28.433 1.00 35.53  ? 225  THR B OG1 1 
ATOM   6912  C  CG2 . THR B  1  197 ? 36.247  46.626  -27.406 1.00 34.69  ? 225  THR B CG2 1 
ATOM   6913  N  N   . TRP B  1  198 ? 39.386  45.921  -27.651 1.00 32.33  ? 226  TRP B N   1 
ATOM   6914  C  CA  . TRP B  1  198 ? 39.916  44.564  -27.585 1.00 31.35  ? 226  TRP B CA  1 
ATOM   6915  C  C   . TRP B  1  198 ? 38.788  43.595  -27.277 1.00 31.01  ? 226  TRP B C   1 
ATOM   6916  O  O   . TRP B  1  198 ? 38.213  43.629  -26.185 1.00 30.94  ? 226  TRP B O   1 
ATOM   6917  C  CB  . TRP B  1  198 ? 40.970  44.445  -26.486 1.00 30.70  ? 226  TRP B CB  1 
ATOM   6918  C  CG  . TRP B  1  198 ? 42.343  44.828  -26.883 1.00 30.80  ? 226  TRP B CG  1 
ATOM   6919  C  CD1 . TRP B  1  198 ? 43.006  45.975  -26.539 1.00 30.21  ? 226  TRP B CD1 1 
ATOM   6920  C  CD2 . TRP B  1  198 ? 43.252  44.066  -27.691 1.00 29.96  ? 226  TRP B CD2 1 
ATOM   6921  N  NE1 . TRP B  1  198 ? 44.260  45.978  -27.092 1.00 30.28  ? 226  TRP B NE1 1 
ATOM   6922  C  CE2 . TRP B  1  198 ? 44.443  44.816  -27.795 1.00 29.40  ? 226  TRP B CE2 1 
ATOM   6923  C  CE3 . TRP B  1  198 ? 43.173  42.827  -28.339 1.00 30.70  ? 226  TRP B CE3 1 
ATOM   6924  C  CZ2 . TRP B  1  198 ? 45.543  44.373  -28.514 1.00 28.92  ? 226  TRP B CZ2 1 
ATOM   6925  C  CZ3 . TRP B  1  198 ? 44.273  42.382  -29.061 1.00 30.59  ? 226  TRP B CZ3 1 
ATOM   6926  C  CH2 . TRP B  1  198 ? 45.442  43.159  -29.141 1.00 30.37  ? 226  TRP B CH2 1 
ATOM   6927  N  N   . PHE B  1  199 ? 38.480  42.733  -28.238 1.00 30.79  ? 227  PHE B N   1 
ATOM   6928  C  CA  . PHE B  1  199 ? 37.476  41.693  -28.056 1.00 30.85  ? 227  PHE B CA  1 
ATOM   6929  C  C   . PHE B  1  199 ? 38.139  40.334  -27.845 1.00 31.21  ? 227  PHE B C   1 
ATOM   6930  O  O   . PHE B  1  199 ? 38.990  39.923  -28.639 1.00 31.66  ? 227  PHE B O   1 
ATOM   6931  C  CB  . PHE B  1  199 ? 36.570  41.618  -29.281 1.00 30.44  ? 227  PHE B CB  1 
ATOM   6932  C  CG  . PHE B  1  199 ? 35.564  42.732  -29.375 1.00 30.00  ? 227  PHE B CG  1 
ATOM   6933  C  CD1 . PHE B  1  199 ? 35.865  43.909  -30.052 1.00 30.44  ? 227  PHE B CD1 1 
ATOM   6934  C  CD2 . PHE B  1  199 ? 34.298  42.589  -28.821 1.00 29.93  ? 227  PHE B CD2 1 
ATOM   6935  C  CE1 . PHE B  1  199 ? 34.924  44.938  -30.153 1.00 31.33  ? 227  PHE B CE1 1 
ATOM   6936  C  CE2 . PHE B  1  199 ? 33.347  43.612  -28.916 1.00 30.10  ? 227  PHE B CE2 1 
ATOM   6937  C  CZ  . PHE B  1  199 ? 33.660  44.786  -29.574 1.00 30.64  ? 227  PHE B CZ  1 
ATOM   6938  N  N   . GLY B  1  200 ? 37.766  39.646  -26.770 1.00 31.28  ? 228  GLY B N   1 
ATOM   6939  C  CA  . GLY B  1  200 ? 38.152  38.246  -26.575 1.00 31.04  ? 228  GLY B CA  1 
ATOM   6940  C  C   . GLY B  1  200 ? 37.115  37.310  -27.175 1.00 31.39  ? 228  GLY B C   1 
ATOM   6941  O  O   . GLY B  1  200 ? 35.945  37.671  -27.331 1.00 30.83  ? 228  GLY B O   1 
ATOM   6942  N  N   . LEU B  1  201 ? 37.554  36.103  -27.523 1.00 32.09  ? 229  LEU B N   1 
ATOM   6943  C  CA  . LEU B  1  201 ? 36.687  35.099  -28.132 1.00 32.31  ? 229  LEU B CA  1 
ATOM   6944  C  C   . LEU B  1  201 ? 36.561  33.884  -27.241 1.00 32.48  ? 229  LEU B C   1 
ATOM   6945  O  O   . LEU B  1  201 ? 37.554  33.412  -26.691 1.00 32.49  ? 229  LEU B O   1 
ATOM   6946  C  CB  . LEU B  1  201 ? 37.192  34.723  -29.515 1.00 32.54  ? 229  LEU B CB  1 
ATOM   6947  C  CG  . LEU B  1  201 ? 36.609  35.717  -30.513 1.00 33.38  ? 229  LEU B CG  1 
ATOM   6948  C  CD1 . LEU B  1  201 ? 37.704  36.553  -31.168 1.00 33.44  ? 229  LEU B CD1 1 
ATOM   6949  C  CD2 . LEU B  1  201 ? 35.725  34.995  -31.529 1.00 33.06  ? 229  LEU B CD2 1 
ATOM   6950  N  N   . TYR B  1  202 ? 35.325  33.406  -27.094 1.00 32.72  ? 230  TYR B N   1 
ATOM   6951  C  CA  . TYR B  1  202 ? 34.978  32.378  -26.125 1.00 32.86  ? 230  TYR B CA  1 
ATOM   6952  C  C   . TYR B  1  202 ? 34.050  31.374  -26.762 1.00 33.42  ? 230  TYR B C   1 
ATOM   6953  O  O   . TYR B  1  202 ? 33.275  31.720  -27.650 1.00 33.28  ? 230  TYR B O   1 
ATOM   6954  C  CB  . TYR B  1  202 ? 34.247  32.984  -24.931 1.00 32.47  ? 230  TYR B CB  1 
ATOM   6955  C  CG  . TYR B  1  202 ? 34.959  34.136  -24.234 1.00 32.39  ? 230  TYR B CG  1 
ATOM   6956  C  CD1 . TYR B  1  202 ? 34.932  35.427  -24.769 1.00 30.50  ? 230  TYR B CD1 1 
ATOM   6957  C  CD2 . TYR B  1  202 ? 35.624  33.942  -23.017 1.00 30.89  ? 230  TYR B CD2 1 
ATOM   6958  C  CE1 . TYR B  1  202 ? 35.565  36.474  -24.135 1.00 30.10  ? 230  TYR B CE1 1 
ATOM   6959  C  CE2 . TYR B  1  202 ? 36.258  34.995  -22.375 1.00 30.36  ? 230  TYR B CE2 1 
ATOM   6960  C  CZ  . TYR B  1  202 ? 36.225  36.254  -22.943 1.00 30.45  ? 230  TYR B CZ  1 
ATOM   6961  O  OH  . TYR B  1  202 ? 36.845  37.304  -22.325 1.00 31.17  ? 230  TYR B OH  1 
ATOM   6962  N  N   . TYR B  1  203 ? 34.117  30.132  -26.294 1.00 33.97  ? 231  TYR B N   1 
ATOM   6963  C  CA  . TYR B  1  203 ? 33.180  29.110  -26.709 1.00 34.62  ? 231  TYR B CA  1 
ATOM   6964  C  C   . TYR B  1  203 ? 31.738  29.502  -26.340 1.00 35.61  ? 231  TYR B C   1 
ATOM   6965  O  O   . TYR B  1  203 ? 31.467  29.881  -25.203 1.00 35.77  ? 231  TYR B O   1 
ATOM   6966  C  CB  . TYR B  1  203 ? 33.562  27.782  -26.067 1.00 34.30  ? 231  TYR B CB  1 
ATOM   6967  C  CG  . TYR B  1  203 ? 34.821  27.139  -26.628 1.00 34.04  ? 231  TYR B CG  1 
ATOM   6968  C  CD1 . TYR B  1  203 ? 34.987  26.966  -28.005 1.00 32.50  ? 231  TYR B CD1 1 
ATOM   6969  C  CD2 . TYR B  1  203 ? 35.834  26.664  -25.773 1.00 34.17  ? 231  TYR B CD2 1 
ATOM   6970  C  CE1 . TYR B  1  203 ? 36.134  26.358  -28.524 1.00 32.63  ? 231  TYR B CE1 1 
ATOM   6971  C  CE2 . TYR B  1  203 ? 36.992  26.053  -26.285 1.00 32.37  ? 231  TYR B CE2 1 
ATOM   6972  C  CZ  . TYR B  1  203 ? 37.126  25.903  -27.661 1.00 33.42  ? 231  TYR B CZ  1 
ATOM   6973  O  OH  . TYR B  1  203 ? 38.247  25.303  -28.189 1.00 33.64  ? 231  TYR B OH  1 
ATOM   6974  N  N   . ASN B  1  204 ? 30.827  29.456  -27.313 1.00 36.91  ? 232  ASN B N   1 
ATOM   6975  C  CA  . ASN B  1  204 ? 29.413  29.731  -27.062 1.00 38.45  ? 232  ASN B CA  1 
ATOM   6976  C  C   . ASN B  1  204 ? 28.828  28.582  -26.230 1.00 38.14  ? 232  ASN B C   1 
ATOM   6977  O  O   . ASN B  1  204 ? 28.331  27.610  -26.775 1.00 38.47  ? 232  ASN B O   1 
ATOM   6978  C  CB  . ASN B  1  204 ? 28.661  29.941  -28.400 1.00 39.24  ? 232  ASN B CB  1 
ATOM   6979  C  CG  . ASN B  1  204 ? 27.144  30.214  -28.226 1.00 42.83  ? 232  ASN B CG  1 
ATOM   6980  O  OD1 . ASN B  1  204 ? 26.670  30.568  -27.145 1.00 42.03  ? 232  ASN B OD1 1 
ATOM   6981  N  ND2 . ASN B  1  204 ? 26.390  30.056  -29.330 1.00 49.78  ? 232  ASN B ND2 1 
ATOM   6982  N  N   . ILE B  1  205 ? 28.910  28.690  -24.908 1.00 37.98  ? 233  ILE B N   1 
ATOM   6983  C  CA  . ILE B  1  205 ? 28.492  27.596  -24.025 1.00 37.73  ? 233  ILE B CA  1 
ATOM   6984  C  C   . ILE B  1  205 ? 26.986  27.526  -23.815 1.00 37.29  ? 233  ILE B C   1 
ATOM   6985  O  O   . ILE B  1  205 ? 26.344  28.524  -23.476 1.00 37.92  ? 233  ILE B O   1 
ATOM   6986  C  CB  . ILE B  1  205 ? 29.230  27.652  -22.663 1.00 38.02  ? 233  ILE B CB  1 
ATOM   6987  C  CG1 . ILE B  1  205 ? 30.717  27.337  -22.860 1.00 38.08  ? 233  ILE B CG1 1 
ATOM   6988  C  CG2 . ILE B  1  205 ? 28.610  26.678  -21.643 1.00 37.60  ? 233  ILE B CG2 1 
ATOM   6989  C  CD1 . ILE B  1  205 ? 30.994  26.068  -23.662 1.00 38.66  ? 233  ILE B CD1 1 
ATOM   6990  N  N   . SER B  1  206 ? 26.439  26.332  -24.008 1.00 36.61  ? 234  SER B N   1 
ATOM   6991  C  CA  . SER B  1  206 ? 24.999  26.070  -23.887 1.00 35.79  ? 234  SER B CA  1 
ATOM   6992  C  C   . SER B  1  206 ? 24.527  26.058  -22.429 1.00 34.82  ? 234  SER B C   1 
ATOM   6993  O  O   . SER B  1  206 ? 24.883  25.157  -21.671 1.00 34.49  ? 234  SER B O   1 
ATOM   6994  C  CB  . SER B  1  206 ? 24.684  24.724  -24.558 1.00 36.08  ? 234  SER B CB  1 
ATOM   6995  O  OG  . SER B  1  206 ? 23.330  24.362  -24.386 1.00 37.15  ? 234  SER B OG  1 
ATOM   6996  N  N   . GLY B  1  207 ? 23.750  27.074  -22.041 1.00 34.19  ? 235  GLY B N   1 
ATOM   6997  C  CA  . GLY B  1  207 ? 23.105  27.131  -20.721 1.00 32.93  ? 235  GLY B CA  1 
ATOM   6998  C  C   . GLY B  1  207 ? 23.950  27.531  -19.509 1.00 32.52  ? 235  GLY B C   1 
ATOM   6999  O  O   . GLY B  1  207 ? 23.536  27.312  -18.364 1.00 32.57  ? 235  GLY B O   1 
ATOM   7000  N  N   . ALA B  1  208 ? 25.123  28.120  -19.744 1.00 31.69  ? 236  ALA B N   1 
ATOM   7001  C  CA  . ALA B  1  208 ? 26.068  28.439  -18.663 1.00 31.25  ? 236  ALA B CA  1 
ATOM   7002  C  C   . ALA B  1  208 ? 27.071  29.490  -19.106 1.00 30.96  ? 236  ALA B C   1 
ATOM   7003  O  O   . ALA B  1  208 ? 27.109  29.847  -20.279 1.00 30.97  ? 236  ALA B O   1 
ATOM   7004  C  CB  . ALA B  1  208 ? 26.788  27.166  -18.159 1.00 31.05  ? 236  ALA B CB  1 
ATOM   7005  N  N   . GLY B  1  209 ? 27.879  29.980  -18.170 1.00 31.01  ? 237  GLY B N   1 
ATOM   7006  C  CA  . GLY B  1  209 ? 28.759  31.135  -18.415 1.00 31.27  ? 237  GLY B CA  1 
ATOM   7007  C  C   . GLY B  1  209 ? 29.849  30.897  -19.445 1.00 31.53  ? 237  GLY B C   1 
ATOM   7008  O  O   . GLY B  1  209 ? 30.691  29.992  -19.278 1.00 31.54  ? 237  GLY B O   1 
ATOM   7009  N  N   . PHE B  1  210 ? 29.844  31.702  -20.510 1.00 31.10  ? 238  PHE B N   1 
ATOM   7010  C  CA  . PHE B  1  210 ? 30.860  31.543  -21.557 1.00 31.14  ? 238  PHE B CA  1 
ATOM   7011  C  C   . PHE B  1  210 ? 32.211  32.114  -21.114 1.00 30.78  ? 238  PHE B C   1 
ATOM   7012  O  O   . PHE B  1  210 ? 33.237  31.817  -21.715 1.00 30.99  ? 238  PHE B O   1 
ATOM   7013  C  CB  . PHE B  1  210 ? 30.402  32.135  -22.908 1.00 31.01  ? 238  PHE B CB  1 
ATOM   7014  C  CG  . PHE B  1  210 ? 30.399  33.633  -22.947 1.00 31.67  ? 238  PHE B CG  1 
ATOM   7015  C  CD1 . PHE B  1  210 ? 31.610  34.352  -22.956 1.00 31.96  ? 238  PHE B CD1 1 
ATOM   7016  C  CD2 . PHE B  1  210 ? 29.195  34.334  -22.980 1.00 30.88  ? 238  PHE B CD2 1 
ATOM   7017  C  CE1 . PHE B  1  210 ? 31.614  35.760  -22.974 1.00 32.79  ? 238  PHE B CE1 1 
ATOM   7018  C  CE2 . PHE B  1  210 ? 29.179  35.729  -22.998 1.00 31.51  ? 238  PHE B CE2 1 
ATOM   7019  C  CZ  . PHE B  1  210 ? 30.393  36.453  -23.000 1.00 32.25  ? 238  PHE B CZ  1 
ATOM   7020  N  N   . PHE B  1  211 ? 32.190  32.905  -20.041 1.00 30.54  ? 239  PHE B N   1 
ATOM   7021  C  CA  . PHE B  1  211 ? 33.342  33.694  -19.569 1.00 30.33  ? 239  PHE B CA  1 
ATOM   7022  C  C   . PHE B  1  211 ? 34.522  32.867  -19.063 1.00 30.95  ? 239  PHE B C   1 
ATOM   7023  O  O   . PHE B  1  211 ? 35.642  33.374  -18.958 1.00 31.37  ? 239  PHE B O   1 
ATOM   7024  C  CB  . PHE B  1  211 ? 32.895  34.657  -18.470 1.00 29.45  ? 239  PHE B CB  1 
ATOM   7025  C  CG  . PHE B  1  211 ? 31.557  35.288  -18.728 1.00 28.03  ? 239  PHE B CG  1 
ATOM   7026  C  CD1 . PHE B  1  211 ? 30.389  34.719  -18.212 1.00 26.89  ? 239  PHE B CD1 1 
ATOM   7027  C  CD2 . PHE B  1  211 ? 31.456  36.433  -19.509 1.00 25.91  ? 239  PHE B CD2 1 
ATOM   7028  C  CE1 . PHE B  1  211 ? 29.136  35.297  -18.459 1.00 26.80  ? 239  PHE B CE1 1 
ATOM   7029  C  CE2 . PHE B  1  211 ? 30.212  37.013  -19.759 1.00 26.60  ? 239  PHE B CE2 1 
ATOM   7030  C  CZ  . PHE B  1  211 ? 29.047  36.438  -19.237 1.00 26.64  ? 239  PHE B CZ  1 
ATOM   7031  N  N   . LEU B  1  212 ? 34.269  31.603  -18.747 1.00 31.29  ? 240  LEU B N   1 
ATOM   7032  C  CA  . LEU B  1  212 ? 35.308  30.714  -18.252 1.00 31.51  ? 240  LEU B CA  1 
ATOM   7033  C  C   . LEU B  1  212 ? 35.956  29.898  -19.376 1.00 31.63  ? 240  LEU B C   1 
ATOM   7034  O  O   . LEU B  1  212 ? 36.700  28.946  -19.126 1.00 31.93  ? 240  LEU B O   1 
ATOM   7035  C  CB  . LEU B  1  212 ? 34.735  29.796  -17.162 1.00 31.63  ? 240  LEU B CB  1 
ATOM   7036  C  CG  . LEU B  1  212 ? 34.086  30.502  -15.958 1.00 32.23  ? 240  LEU B CG  1 
ATOM   7037  C  CD1 . LEU B  1  212 ? 33.331  29.523  -15.051 1.00 30.90  ? 240  LEU B CD1 1 
ATOM   7038  C  CD2 . LEU B  1  212 ? 35.121  31.284  -15.156 1.00 31.56  ? 240  LEU B CD2 1 
ATOM   7039  N  N   . HIS B  1  213 ? 35.687  30.271  -20.620 1.00 31.53  ? 241  HIS B N   1 
ATOM   7040  C  CA  . HIS B  1  213 ? 36.120  29.448  -21.724 1.00 31.38  ? 241  HIS B CA  1 
ATOM   7041  C  C   . HIS B  1  213 ? 36.743  30.294  -22.819 1.00 31.85  ? 241  HIS B C   1 
ATOM   7042  O  O   . HIS B  1  213 ? 36.292  30.312  -23.970 1.00 32.62  ? 241  HIS B O   1 
ATOM   7043  C  CB  . HIS B  1  213 ? 34.951  28.590  -22.218 1.00 31.50  ? 241  HIS B CB  1 
ATOM   7044  C  CG  . HIS B  1  213 ? 34.290  27.807  -21.128 1.00 31.29  ? 241  HIS B CG  1 
ATOM   7045  N  ND1 . HIS B  1  213 ? 34.857  26.678  -20.578 1.00 31.12  ? 241  HIS B ND1 1 
ATOM   7046  C  CD2 . HIS B  1  213 ? 33.135  28.018  -20.450 1.00 31.10  ? 241  HIS B CD2 1 
ATOM   7047  C  CE1 . HIS B  1  213 ? 34.072  26.218  -19.620 1.00 31.26  ? 241  HIS B CE1 1 
ATOM   7048  N  NE2 . HIS B  1  213 ? 33.016  27.009  -19.527 1.00 30.17  ? 241  HIS B NE2 1 
ATOM   7049  N  N   . HIS B  1  214 ? 37.796  31.004  -22.442 1.00 31.73  ? 242  HIS B N   1 
ATOM   7050  C  CA  . HIS B  1  214 ? 38.534  31.848  -23.353 1.00 31.71  ? 242  HIS B CA  1 
ATOM   7051  C  C   . HIS B  1  214 ? 39.373  30.945  -24.259 1.00 31.55  ? 242  HIS B C   1 
ATOM   7052  O  O   . HIS B  1  214 ? 40.132  30.100  -23.767 1.00 31.99  ? 242  HIS B O   1 
ATOM   7053  C  CB  . HIS B  1  214 ? 39.431  32.748  -22.516 1.00 32.00  ? 242  HIS B CB  1 
ATOM   7054  C  CG  . HIS B  1  214 ? 39.834  34.015  -23.190 1.00 33.28  ? 242  HIS B CG  1 
ATOM   7055  N  ND1 . HIS B  1  214 ? 40.644  34.041  -24.303 1.00 34.88  ? 242  HIS B ND1 1 
ATOM   7056  C  CD2 . HIS B  1  214 ? 39.582  35.307  -22.876 1.00 34.66  ? 242  HIS B CD2 1 
ATOM   7057  C  CE1 . HIS B  1  214 ? 40.849  35.294  -24.664 1.00 35.58  ? 242  HIS B CE1 1 
ATOM   7058  N  NE2 . HIS B  1  214 ? 40.216  36.082  -23.813 1.00 35.93  ? 242  HIS B NE2 1 
ATOM   7059  N  N   . VAL B  1  215 ? 39.246  31.106  -25.573 1.00 30.92  ? 243  VAL B N   1 
ATOM   7060  C  CA  . VAL B  1  215 ? 40.005  30.266  -26.493 1.00 30.66  ? 243  VAL B CA  1 
ATOM   7061  C  C   . VAL B  1  215 ? 41.441  30.748  -26.685 1.00 30.71  ? 243  VAL B C   1 
ATOM   7062  O  O   . VAL B  1  215 ? 42.231  30.085  -27.341 1.00 31.04  ? 243  VAL B O   1 
ATOM   7063  C  CB  . VAL B  1  215 ? 39.293  30.069  -27.865 1.00 30.71  ? 243  VAL B CB  1 
ATOM   7064  C  CG1 . VAL B  1  215 ? 37.868  29.567  -27.663 1.00 31.10  ? 243  VAL B CG1 1 
ATOM   7065  C  CG2 . VAL B  1  215 ? 39.284  31.344  -28.694 1.00 30.79  ? 243  VAL B CG2 1 
ATOM   7066  N  N   . GLY B  1  216 ? 41.769  31.914  -26.131 1.00 30.69  ? 244  GLY B N   1 
ATOM   7067  C  CA  . GLY B  1  216 ? 43.127  32.445  -26.177 1.00 29.80  ? 244  GLY B CA  1 
ATOM   7068  C  C   . GLY B  1  216 ? 43.371  33.417  -27.302 1.00 29.63  ? 244  GLY B C   1 
ATOM   7069  O  O   . GLY B  1  216 ? 44.516  33.799  -27.567 1.00 29.60  ? 244  GLY B O   1 
ATOM   7070  N  N   . LEU B  1  217 ? 42.299  33.797  -27.984 1.00 29.51  ? 245  LEU B N   1 
ATOM   7071  C  CA  . LEU B  1  217 ? 42.383  34.763  -29.071 1.00 29.55  ? 245  LEU B CA  1 
ATOM   7072  C  C   . LEU B  1  217 ? 41.690  36.026  -28.652 1.00 30.15  ? 245  LEU B C   1 
ATOM   7073  O  O   . LEU B  1  217 ? 40.558  35.986  -28.143 1.00 30.13  ? 245  LEU B O   1 
ATOM   7074  C  CB  . LEU B  1  217 ? 41.716  34.222  -30.332 1.00 29.53  ? 245  LEU B CB  1 
ATOM   7075  C  CG  . LEU B  1  217 ? 41.842  34.960  -31.670 1.00 29.18  ? 245  LEU B CG  1 
ATOM   7076  C  CD1 . LEU B  1  217 ? 43.263  34.916  -32.221 1.00 28.56  ? 245  LEU B CD1 1 
ATOM   7077  C  CD2 . LEU B  1  217 ? 40.897  34.325  -32.658 1.00 28.79  ? 245  LEU B CD2 1 
ATOM   7078  N  N   . GLU B  1  218 ? 42.386  37.142  -28.856 1.00 30.83  ? 246  GLU B N   1 
ATOM   7079  C  CA  . GLU B  1  218 ? 41.844  38.487  -28.632 1.00 31.51  ? 246  GLU B CA  1 
ATOM   7080  C  C   . GLU B  1  218 ? 42.147  39.364  -29.851 1.00 31.50  ? 246  GLU B C   1 
ATOM   7081  O  O   . GLU B  1  218 ? 43.194  39.217  -30.488 1.00 31.18  ? 246  GLU B O   1 
ATOM   7082  C  CB  . GLU B  1  218 ? 42.414  39.100  -27.343 1.00 31.41  ? 246  GLU B CB  1 
ATOM   7083  C  CG  . GLU B  1  218 ? 42.191  38.189  -26.126 1.00 32.33  ? 246  GLU B CG  1 
ATOM   7084  C  CD  . GLU B  1  218 ? 42.748  38.717  -24.823 1.00 32.85  ? 246  GLU B CD  1 
ATOM   7085  O  OE1 . GLU B  1  218 ? 43.656  39.583  -24.830 1.00 34.52  ? 246  GLU B OE1 1 
ATOM   7086  O  OE2 . GLU B  1  218 ? 42.251  38.263  -23.767 1.00 36.46  ? 246  GLU B OE2 1 
ATOM   7087  N  N   . LEU B  1  219 ? 41.220  40.267  -30.175 1.00 31.60  ? 247  LEU B N   1 
ATOM   7088  C  CA  . LEU B  1  219 ? 41.319  41.074  -31.391 1.00 31.48  ? 247  LEU B CA  1 
ATOM   7089  C  C   . LEU B  1  219 ? 41.115  42.541  -31.086 1.00 31.49  ? 247  LEU B C   1 
ATOM   7090  O  O   . LEU B  1  219 ? 40.088  42.924  -30.525 1.00 31.83  ? 247  LEU B O   1 
ATOM   7091  C  CB  . LEU B  1  219 ? 40.274  40.629  -32.414 1.00 31.17  ? 247  LEU B CB  1 
ATOM   7092  C  CG  . LEU B  1  219 ? 40.305  39.184  -32.908 1.00 31.32  ? 247  LEU B CG  1 
ATOM   7093  C  CD1 . LEU B  1  219 ? 39.057  38.883  -33.724 1.00 30.18  ? 247  LEU B CD1 1 
ATOM   7094  C  CD2 . LEU B  1  219 ? 41.569  38.930  -33.719 1.00 30.37  ? 247  LEU B CD2 1 
ATOM   7095  N  N   . LEU B  1  220 ? 42.100  43.360  -31.441 1.00 31.36  ? 248  LEU B N   1 
ATOM   7096  C  CA  . LEU B  1  220 ? 41.954  44.806  -31.330 1.00 30.82  ? 248  LEU B CA  1 
ATOM   7097  C  C   . LEU B  1  220 ? 41.213  45.307  -32.562 1.00 30.44  ? 248  LEU B C   1 
ATOM   7098  O  O   . LEU B  1  220 ? 41.765  45.302  -33.669 1.00 30.61  ? 248  LEU B O   1 
ATOM   7099  C  CB  . LEU B  1  220 ? 43.317  45.491  -31.180 1.00 30.52  ? 248  LEU B CB  1 
ATOM   7100  C  CG  . LEU B  1  220 ? 43.338  47.004  -30.924 1.00 30.59  ? 248  LEU B CG  1 
ATOM   7101  C  CD1 . LEU B  1  220 ? 42.416  47.407  -29.771 1.00 32.05  ? 248  LEU B CD1 1 
ATOM   7102  C  CD2 . LEU B  1  220 ? 44.760  47.484  -30.650 1.00 30.49  ? 248  LEU B CD2 1 
ATOM   7103  N  N   . VAL B  1  221 ? 39.960  45.708  -32.367 1.00 30.00  ? 249  VAL B N   1 
ATOM   7104  C  CA  . VAL B  1  221 ? 39.132  46.202  -33.464 1.00 30.06  ? 249  VAL B CA  1 
ATOM   7105  C  C   . VAL B  1  221 ? 39.033  47.716  -33.419 1.00 30.64  ? 249  VAL B C   1 
ATOM   7106  O  O   . VAL B  1  221 ? 38.638  48.303  -32.393 1.00 31.18  ? 249  VAL B O   1 
ATOM   7107  C  CB  . VAL B  1  221 ? 37.707  45.622  -33.444 1.00 29.97  ? 249  VAL B CB  1 
ATOM   7108  C  CG1 . VAL B  1  221 ? 36.900  46.195  -34.588 1.00 29.12  ? 249  VAL B CG1 1 
ATOM   7109  C  CG2 . VAL B  1  221 ? 37.730  44.081  -33.499 1.00 28.99  ? 249  VAL B CG2 1 
ATOM   7110  N  N   . ASN B  1  222 ? 39.408  48.349  -34.528 1.00 30.56  ? 250  ASN B N   1 
ATOM   7111  C  CA  . ASN B  1  222 ? 39.235  49.776  -34.661 1.00 30.41  ? 250  ASN B CA  1 
ATOM   7112  C  C   . ASN B  1  222 ? 37.922  50.015  -35.372 1.00 30.24  ? 250  ASN B C   1 
ATOM   7113  O  O   . ASN B  1  222 ? 37.813  49.830  -36.577 1.00 30.38  ? 250  ASN B O   1 
ATOM   7114  C  CB  . ASN B  1  222 ? 40.397  50.416  -35.419 1.00 30.37  ? 250  ASN B CB  1 
ATOM   7115  C  CG  . ASN B  1  222 ? 40.286  51.930  -35.466 1.00 31.50  ? 250  ASN B CG  1 
ATOM   7116  O  OD1 . ASN B  1  222 ? 39.358  52.519  -34.904 1.00 32.83  ? 250  ASN B OD1 1 
ATOM   7117  N  ND2 . ASN B  1  222 ? 41.235  52.572  -36.132 1.00 32.98  ? 250  ASN B ND2 1 
ATOM   7118  N  N   . HIS B  1  223 ? 36.919  50.412  -34.613 1.00 30.38  ? 251  HIS B N   1 
ATOM   7119  C  CA  . HIS B  1  223 ? 35.585  50.601  -35.173 1.00 31.10  ? 251  HIS B CA  1 
ATOM   7120  C  C   . HIS B  1  223 ? 35.153  52.053  -35.072 1.00 31.76  ? 251  HIS B C   1 
ATOM   7121  O  O   . HIS B  1  223 ? 33.966  52.343  -34.916 1.00 31.89  ? 251  HIS B O   1 
ATOM   7122  C  CB  . HIS B  1  223 ? 34.556  49.655  -34.521 1.00 30.59  ? 251  HIS B CB  1 
ATOM   7123  C  CG  . HIS B  1  223 ? 34.563  49.687  -33.025 1.00 30.62  ? 251  HIS B CG  1 
ATOM   7124  N  ND1 . HIS B  1  223 ? 33.500  50.158  -32.287 1.00 30.53  ? 251  HIS B ND1 1 
ATOM   7125  C  CD2 . HIS B  1  223 ? 35.506  49.313  -32.128 1.00 30.57  ? 251  HIS B CD2 1 
ATOM   7126  C  CE1 . HIS B  1  223 ? 33.785  50.070  -31.002 1.00 29.94  ? 251  HIS B CE1 1 
ATOM   7127  N  NE2 . HIS B  1  223 ? 34.997  49.563  -30.878 1.00 30.30  ? 251  HIS B NE2 1 
ATOM   7128  N  N   . LYS B  1  224 ? 36.134  52.950  -35.164 1.00 32.55  ? 252  LYS B N   1 
ATOM   7129  C  CA  . LYS B  1  224 ? 35.898  54.386  -35.153 1.00 33.44  ? 252  LYS B CA  1 
ATOM   7130  C  C   . LYS B  1  224 ? 35.154  54.919  -36.388 1.00 34.12  ? 252  LYS B C   1 
ATOM   7131  O  O   . LYS B  1  224 ? 34.260  55.742  -36.248 1.00 34.67  ? 252  LYS B O   1 
ATOM   7132  C  CB  . LYS B  1  224 ? 37.216  55.147  -34.994 1.00 33.41  ? 252  LYS B CB  1 
ATOM   7133  C  CG  . LYS B  1  224 ? 37.035  56.667  -34.936 1.00 34.01  ? 252  LYS B CG  1 
ATOM   7134  C  CD  . LYS B  1  224 ? 38.371  57.376  -35.051 1.00 37.04  ? 252  LYS B CD  1 
ATOM   7135  C  CE  . LYS B  1  224 ? 38.210  58.898  -35.010 1.00 38.20  ? 252  LYS B CE  1 
ATOM   7136  N  NZ  . LYS B  1  224 ? 37.698  59.374  -33.701 1.00 37.35  ? 252  LYS B NZ  1 
ATOM   7137  N  N   . ALA B  1  225 ? 35.533  54.483  -37.589 1.00 34.57  ? 253  ALA B N   1 
ATOM   7138  C  CA  . ALA B  1  225 ? 34.976  55.064  -38.822 1.00 34.94  ? 253  ALA B CA  1 
ATOM   7139  C  C   . ALA B  1  225 ? 33.451  54.997  -38.850 1.00 35.45  ? 253  ALA B C   1 
ATOM   7140  O  O   . ALA B  1  225 ? 32.847  54.072  -38.302 1.00 35.41  ? 253  ALA B O   1 
ATOM   7141  C  CB  . ALA B  1  225 ? 35.559  54.387  -40.055 1.00 34.80  ? 253  ALA B CB  1 
ATOM   7142  N  N   . LEU B  1  226 ? 32.840  55.986  -39.493 1.00 36.16  ? 254  LEU B N   1 
ATOM   7143  C  CA  . LEU B  1  226 ? 31.391  56.053  -39.624 1.00 36.50  ? 254  LEU B CA  1 
ATOM   7144  C  C   . LEU B  1  226 ? 30.858  55.041  -40.634 1.00 36.96  ? 254  LEU B C   1 
ATOM   7145  O  O   . LEU B  1  226 ? 29.662  54.704  -40.624 1.00 37.00  ? 254  LEU B O   1 
ATOM   7146  C  CB  . LEU B  1  226 ? 30.971  57.467  -40.014 1.00 36.76  ? 254  LEU B CB  1 
ATOM   7147  C  CG  . LEU B  1  226 ? 31.379  58.603  -39.069 1.00 36.86  ? 254  LEU B CG  1 
ATOM   7148  C  CD1 . LEU B  1  226 ? 30.953  59.936  -39.676 1.00 36.63  ? 254  LEU B CD1 1 
ATOM   7149  C  CD2 . LEU B  1  226 ? 30.795  58.411  -37.667 1.00 36.72  ? 254  LEU B CD2 1 
ATOM   7150  N  N   . ASP B  1  227 ? 31.750  54.569  -41.509 1.00 37.40  ? 255  ASP B N   1 
ATOM   7151  C  CA  . ASP B  1  227 ? 31.448  53.477  -42.427 1.00 37.63  ? 255  ASP B CA  1 
ATOM   7152  C  C   . ASP B  1  227 ? 32.134  52.205  -41.916 1.00 37.70  ? 255  ASP B C   1 
ATOM   7153  O  O   . ASP B  1  227 ? 33.363  52.139  -41.881 1.00 37.82  ? 255  ASP B O   1 
ATOM   7154  C  CB  . ASP B  1  227 ? 31.905  53.829  -43.852 1.00 37.65  ? 255  ASP B CB  1 
ATOM   7155  C  CG  . ASP B  1  227 ? 31.658  52.695  -44.862 1.00 38.18  ? 255  ASP B CG  1 
ATOM   7156  O  OD1 . ASP B  1  227 ? 30.881  51.754  -44.582 1.00 38.22  ? 255  ASP B OD1 1 
ATOM   7157  O  OD2 . ASP B  1  227 ? 32.256  52.746  -45.956 1.00 38.91  ? 255  ASP B OD2 1 
ATOM   7158  N  N   . PRO B  1  228 ? 31.338  51.201  -41.499 1.00 37.71  ? 256  PRO B N   1 
ATOM   7159  C  CA  . PRO B  1  228 ? 31.854  49.902  -41.011 1.00 37.76  ? 256  PRO B CA  1 
ATOM   7160  C  C   . PRO B  1  228 ? 32.755  49.151  -42.007 1.00 37.99  ? 256  PRO B C   1 
ATOM   7161  O  O   . PRO B  1  228 ? 33.563  48.311  -41.590 1.00 38.00  ? 256  PRO B O   1 
ATOM   7162  C  CB  . PRO B  1  228 ? 30.579  49.089  -40.730 1.00 37.60  ? 256  PRO B CB  1 
ATOM   7163  C  CG  . PRO B  1  228 ? 29.522  50.129  -40.494 1.00 37.91  ? 256  PRO B CG  1 
ATOM   7164  C  CD  . PRO B  1  228 ? 29.867  51.262  -41.437 1.00 37.50  ? 256  PRO B CD  1 
ATOM   7165  N  N   . ALA B  1  229 ? 32.623  49.447  -43.302 1.00 37.84  ? 257  ALA B N   1 
ATOM   7166  C  CA  . ALA B  1  229 ? 33.495  48.848  -44.314 1.00 37.84  ? 257  ALA B CA  1 
ATOM   7167  C  C   . ALA B  1  229 ? 34.955  49.204  -44.051 1.00 37.93  ? 257  ALA B C   1 
ATOM   7168  O  O   . ALA B  1  229 ? 35.853  48.405  -44.323 1.00 37.98  ? 257  ALA B O   1 
ATOM   7169  C  CB  . ALA B  1  229 ? 33.088  49.292  -45.715 1.00 37.82  ? 257  ALA B CB  1 
ATOM   7170  N  N   . ARG B  1  230 ? 35.185  50.400  -43.513 1.00 37.86  ? 258  ARG B N   1 
ATOM   7171  C  CA  . ARG B  1  230 ? 36.542  50.860  -43.211 1.00 38.11  ? 258  ARG B CA  1 
ATOM   7172  C  C   . ARG B  1  230 ? 37.137  50.294  -41.904 1.00 37.31  ? 258  ARG B C   1 
ATOM   7173  O  O   . ARG B  1  230 ? 38.275  50.622  -41.551 1.00 37.18  ? 258  ARG B O   1 
ATOM   7174  C  CB  . ARG B  1  230 ? 36.591  52.389  -43.171 1.00 38.60  ? 258  ARG B CB  1 
ATOM   7175  C  CG  . ARG B  1  230 ? 35.896  53.069  -44.336 1.00 42.70  ? 258  ARG B CG  1 
ATOM   7176  C  CD  . ARG B  1  230 ? 36.380  54.506  -44.516 1.00 49.31  ? 258  ARG B CD  1 
ATOM   7177  N  NE  . ARG B  1  230 ? 37.244  54.630  -45.696 1.00 54.68  ? 258  ARG B NE  1 
ATOM   7178  C  CZ  . ARG B  1  230 ? 37.904  55.737  -46.051 1.00 56.53  ? 258  ARG B CZ  1 
ATOM   7179  N  NH1 . ARG B  1  230 ? 37.820  56.848  -45.313 1.00 56.91  ? 258  ARG B NH1 1 
ATOM   7180  N  NH2 . ARG B  1  230 ? 38.659  55.729  -47.148 1.00 56.14  ? 258  ARG B NH2 1 
ATOM   7181  N  N   . TRP B  1  231 ? 36.386  49.463  -41.177 1.00 36.08  ? 259  TRP B N   1 
ATOM   7182  C  CA  . TRP B  1  231 ? 36.903  48.948  -39.908 1.00 35.07  ? 259  TRP B CA  1 
ATOM   7183  C  C   . TRP B  1  231 ? 38.011  47.909  -40.086 1.00 34.67  ? 259  TRP B C   1 
ATOM   7184  O  O   . TRP B  1  231 ? 38.004  47.144  -41.053 1.00 34.75  ? 259  TRP B O   1 
ATOM   7185  C  CB  . TRP B  1  231 ? 35.788  48.393  -39.025 1.00 34.43  ? 259  TRP B CB  1 
ATOM   7186  C  CG  . TRP B  1  231 ? 34.797  49.404  -38.568 1.00 32.80  ? 259  TRP B CG  1 
ATOM   7187  C  CD1 . TRP B  1  231 ? 34.902  50.762  -38.645 1.00 32.43  ? 259  TRP B CD1 1 
ATOM   7188  C  CD2 . TRP B  1  231 ? 33.552  49.129  -37.938 1.00 31.11  ? 259  TRP B CD2 1 
ATOM   7189  N  NE1 . TRP B  1  231 ? 33.778  51.353  -38.120 1.00 31.72  ? 259  TRP B NE1 1 
ATOM   7190  C  CE2 . TRP B  1  231 ? 32.931  50.371  -37.679 1.00 31.55  ? 259  TRP B CE2 1 
ATOM   7191  C  CE3 . TRP B  1  231 ? 32.885  47.952  -37.585 1.00 30.81  ? 259  TRP B CE3 1 
ATOM   7192  C  CZ2 . TRP B  1  231 ? 31.685  50.471  -37.056 1.00 31.81  ? 259  TRP B CZ2 1 
ATOM   7193  C  CZ3 . TRP B  1  231 ? 31.642  48.052  -36.975 1.00 32.02  ? 259  TRP B CZ3 1 
ATOM   7194  C  CH2 . TRP B  1  231 ? 31.058  49.306  -36.716 1.00 32.10  ? 259  TRP B CH2 1 
ATOM   7195  N  N   . THR B  1  232 ? 38.949  47.889  -39.138 1.00 34.07  ? 260  THR B N   1 
ATOM   7196  C  CA  . THR B  1  232 ? 40.178  47.094  -39.261 1.00 33.59  ? 260  THR B CA  1 
ATOM   7197  C  C   . THR B  1  232 ? 40.521  46.339  -37.975 1.00 33.36  ? 260  THR B C   1 
ATOM   7198  O  O   . THR B  1  232 ? 39.935  46.580  -36.917 1.00 33.68  ? 260  THR B O   1 
ATOM   7199  C  CB  . THR B  1  232 ? 41.391  47.979  -39.648 1.00 33.34  ? 260  THR B CB  1 
ATOM   7200  O  OG1 . THR B  1  232 ? 41.536  49.020  -38.680 1.00 34.56  ? 260  THR B OG1 1 
ATOM   7201  C  CG2 . THR B  1  232 ? 41.217  48.613  -41.041 1.00 32.57  ? 260  THR B CG2 1 
ATOM   7202  N  N   . ILE B  1  233 ? 41.464  45.412  -38.073 1.00 32.99  ? 261  ILE B N   1 
ATOM   7203  C  CA  . ILE B  1  233 ? 42.039  44.798  -36.903 1.00 32.72  ? 261  ILE B CA  1 
ATOM   7204  C  C   . ILE B  1  233 ? 43.425  45.411  -36.777 1.00 33.13  ? 261  ILE B C   1 
ATOM   7205  O  O   . ILE B  1  233 ? 44.257  45.234  -37.668 1.00 33.11  ? 261  ILE B O   1 
ATOM   7206  C  CB  . ILE B  1  233 ? 42.121  43.255  -37.028 1.00 32.65  ? 261  ILE B CB  1 
ATOM   7207  C  CG1 . ILE B  1  233 ? 40.777  42.661  -37.483 1.00 32.48  ? 261  ILE B CG1 1 
ATOM   7208  C  CG2 . ILE B  1  233 ? 42.588  42.632  -35.718 1.00 31.53  ? 261  ILE B CG2 1 
ATOM   7209  C  CD1 . ILE B  1  233 ? 39.677  42.638  -36.427 1.00 31.97  ? 261  ILE B CD1 1 
ATOM   7210  N  N   . GLN B  1  234 ? 43.656  46.157  -35.696 1.00 33.17  ? 262  GLN B N   1 
ATOM   7211  C  CA  . GLN B  1  234 ? 44.950  46.795  -35.467 1.00 33.61  ? 262  GLN B CA  1 
ATOM   7212  C  C   . GLN B  1  234 ? 45.972  45.799  -34.942 1.00 33.47  ? 262  GLN B C   1 
ATOM   7213  O  O   . GLN B  1  234 ? 47.173  46.031  -35.068 1.00 34.19  ? 262  GLN B O   1 
ATOM   7214  C  CB  . GLN B  1  234 ? 44.846  47.957  -34.465 1.00 33.60  ? 262  GLN B CB  1 
ATOM   7215  C  CG  . GLN B  1  234 ? 44.130  49.188  -34.984 1.00 34.33  ? 262  GLN B CG  1 
ATOM   7216  C  CD  . GLN B  1  234 ? 44.025  50.328  -33.973 1.00 34.58  ? 262  GLN B CD  1 
ATOM   7217  O  OE1 . GLN B  1  234 ? 44.200  50.158  -32.762 1.00 35.60  ? 262  GLN B OE1 1 
ATOM   7218  N  NE2 . GLN B  1  234 ? 43.718  51.506  -34.479 1.00 36.88  ? 262  GLN B NE2 1 
ATOM   7219  N  N   . LYS B  1  235 ? 45.502  44.712  -34.334 1.00 32.80  ? 263  LYS B N   1 
ATOM   7220  C  CA  . LYS B  1  235 ? 46.380  43.778  -33.633 1.00 31.98  ? 263  LYS B CA  1 
ATOM   7221  C  C   . LYS B  1  235 ? 45.667  42.486  -33.246 1.00 31.38  ? 263  LYS B C   1 
ATOM   7222  O  O   . LYS B  1  235 ? 44.453  42.454  -33.035 1.00 30.99  ? 263  LYS B O   1 
ATOM   7223  C  CB  . LYS B  1  235 ? 46.952  44.437  -32.367 1.00 32.36  ? 263  LYS B CB  1 
ATOM   7224  C  CG  . LYS B  1  235 ? 48.359  43.967  -31.966 1.00 32.70  ? 263  LYS B CG  1 
ATOM   7225  C  CD  . LYS B  1  235 ? 49.418  44.477  -32.942 1.00 32.06  ? 263  LYS B CD  1 
ATOM   7226  C  CE  . LYS B  1  235 ? 50.794  44.078  -32.472 1.00 34.66  ? 263  LYS B CE  1 
ATOM   7227  N  NZ  . LYS B  1  235 ? 51.876  44.548  -33.373 1.00 34.27  ? 263  LYS B NZ  1 
ATOM   7228  N  N   . VAL B  1  236 ? 46.452  41.420  -33.133 1.00 31.11  ? 264  VAL B N   1 
ATOM   7229  C  CA  . VAL B  1  236 ? 45.962  40.103  -32.745 1.00 30.14  ? 264  VAL B CA  1 
ATOM   7230  C  C   . VAL B  1  236 ? 46.863  39.554  -31.657 1.00 30.04  ? 264  VAL B C   1 
ATOM   7231  O  O   . VAL B  1  236 ? 48.078  39.741  -31.701 1.00 29.90  ? 264  VAL B O   1 
ATOM   7232  C  CB  . VAL B  1  236 ? 45.947  39.144  -33.953 1.00 30.21  ? 264  VAL B CB  1 
ATOM   7233  C  CG1 . VAL B  1  236 ? 45.444  37.763  -33.560 1.00 29.48  ? 264  VAL B CG1 1 
ATOM   7234  C  CG2 . VAL B  1  236 ? 45.088  39.718  -35.068 1.00 29.56  ? 264  VAL B CG2 1 
ATOM   7235  N  N   . PHE B  1  237 ? 46.252  38.884  -30.683 1.00 29.79  ? 265  PHE B N   1 
ATOM   7236  C  CA  . PHE B  1  237 ? 46.959  38.175  -29.635 1.00 29.40  ? 265  PHE B CA  1 
ATOM   7237  C  C   . PHE B  1  237 ? 46.415  36.745  -29.614 1.00 30.17  ? 265  PHE B C   1 
ATOM   7238  O  O   . PHE B  1  237 ? 45.203  36.544  -29.580 1.00 30.37  ? 265  PHE B O   1 
ATOM   7239  C  CB  . PHE B  1  237 ? 46.690  38.872  -28.305 1.00 29.25  ? 265  PHE B CB  1 
ATOM   7240  C  CG  . PHE B  1  237 ? 47.456  38.311  -27.133 1.00 28.44  ? 265  PHE B CG  1 
ATOM   7241  C  CD1 . PHE B  1  237 ? 48.739  38.762  -26.843 1.00 27.30  ? 265  PHE B CD1 1 
ATOM   7242  C  CD2 . PHE B  1  237 ? 46.869  37.364  -26.287 1.00 29.33  ? 265  PHE B CD2 1 
ATOM   7243  C  CE1 . PHE B  1  237 ? 49.436  38.261  -25.752 1.00 27.31  ? 265  PHE B CE1 1 
ATOM   7244  C  CE2 . PHE B  1  237 ? 47.562  36.847  -25.194 1.00 28.15  ? 265  PHE B CE2 1 
ATOM   7245  C  CZ  . PHE B  1  237 ? 48.847  37.310  -24.925 1.00 27.58  ? 265  PHE B CZ  1 
ATOM   7246  N  N   . TYR B  1  238 ? 47.301  35.754  -29.656 1.00 30.69  ? 266  TYR B N   1 
ATOM   7247  C  CA  . TYR B  1  238 ? 46.879  34.361  -29.592 1.00 31.15  ? 266  TYR B CA  1 
ATOM   7248  C  C   . TYR B  1  238 ? 47.762  33.551  -28.652 1.00 32.09  ? 266  TYR B C   1 
ATOM   7249  O  O   . TYR B  1  238 ? 48.984  33.510  -28.825 1.00 32.54  ? 266  TYR B O   1 
ATOM   7250  C  CB  . TYR B  1  238 ? 46.870  33.699  -30.977 1.00 30.11  ? 266  TYR B CB  1 
ATOM   7251  C  CG  . TYR B  1  238 ? 46.369  32.274  -30.929 1.00 29.55  ? 266  TYR B CG  1 
ATOM   7252  C  CD1 . TYR B  1  238 ? 45.028  32.002  -30.660 1.00 28.96  ? 266  TYR B CD1 1 
ATOM   7253  C  CD2 . TYR B  1  238 ? 47.235  31.192  -31.132 1.00 29.87  ? 266  TYR B CD2 1 
ATOM   7254  C  CE1 . TYR B  1  238 ? 44.550  30.688  -30.603 1.00 29.15  ? 266  TYR B CE1 1 
ATOM   7255  C  CE2 . TYR B  1  238 ? 46.768  29.864  -31.089 1.00 28.29  ? 266  TYR B CE2 1 
ATOM   7256  C  CZ  . TYR B  1  238 ? 45.420  29.629  -30.816 1.00 29.11  ? 266  TYR B CZ  1 
ATOM   7257  O  OH  . TYR B  1  238 ? 44.925  28.354  -30.761 1.00 28.37  ? 266  TYR B OH  1 
ATOM   7258  N  N   . GLN B  1  239 ? 47.134  32.896  -27.672 1.00 32.55  ? 267  GLN B N   1 
ATOM   7259  C  CA  . GLN B  1  239 ? 47.851  32.061  -26.703 1.00 32.82  ? 267  GLN B CA  1 
ATOM   7260  C  C   . GLN B  1  239 ? 49.230  32.622  -26.341 1.00 32.61  ? 267  GLN B C   1 
ATOM   7261  O  O   . GLN B  1  239 ? 50.252  31.967  -26.551 1.00 32.23  ? 267  GLN B O   1 
ATOM   7262  C  CB  . GLN B  1  239 ? 47.979  30.620  -27.224 1.00 32.98  ? 267  GLN B CB  1 
ATOM   7263  C  CG  . GLN B  1  239 ? 46.626  29.961  -27.512 1.00 34.67  ? 267  GLN B CG  1 
ATOM   7264  C  CD  . GLN B  1  239 ? 46.677  28.447  -27.522 1.00 35.73  ? 267  GLN B CD  1 
ATOM   7265  O  OE1 . GLN B  1  239 ? 47.743  27.833  -27.393 1.00 37.67  ? 267  GLN B OE1 1 
ATOM   7266  N  NE2 . GLN B  1  239 ? 45.517  27.834  -27.672 1.00 35.98  ? 267  GLN B NE2 1 
ATOM   7267  N  N   . GLY B  1  240 ? 49.255  33.841  -25.814 1.00 32.60  ? 268  GLY B N   1 
ATOM   7268  C  CA  . GLY B  1  240 ? 50.508  34.432  -25.341 1.00 32.75  ? 268  GLY B CA  1 
ATOM   7269  C  C   . GLY B  1  240 ? 51.285  35.334  -26.297 1.00 32.92  ? 268  GLY B C   1 
ATOM   7270  O  O   . GLY B  1  240 ? 52.107  36.125  -25.843 1.00 32.74  ? 268  GLY B O   1 
ATOM   7271  N  N   . ARG B  1  241 ? 51.021  35.242  -27.603 1.00 33.04  ? 269  ARG B N   1 
ATOM   7272  C  CA  . ARG B  1  241 ? 51.828  35.946  -28.608 1.00 33.21  ? 269  ARG B CA  1 
ATOM   7273  C  C   . ARG B  1  241 ? 51.078  36.986  -29.441 1.00 32.97  ? 269  ARG B C   1 
ATOM   7274  O  O   . ARG B  1  241 ? 49.890  36.832  -29.724 1.00 32.50  ? 269  ARG B O   1 
ATOM   7275  C  CB  . ARG B  1  241 ? 52.510  34.934  -29.526 1.00 33.62  ? 269  ARG B CB  1 
ATOM   7276  C  CG  . ARG B  1  241 ? 53.806  34.380  -28.953 1.00 35.65  ? 269  ARG B CG  1 
ATOM   7277  C  CD  . ARG B  1  241 ? 54.204  33.074  -29.611 1.00 38.00  ? 269  ARG B CD  1 
ATOM   7278  N  NE  . ARG B  1  241 ? 55.239  32.408  -28.821 1.00 40.68  ? 269  ARG B NE  1 
ATOM   7279  C  CZ  . ARG B  1  241 ? 56.504  32.230  -29.205 1.00 40.89  ? 269  ARG B CZ  1 
ATOM   7280  N  NH1 . ARG B  1  241 ? 56.921  32.656  -30.390 1.00 40.69  ? 269  ARG B NH1 1 
ATOM   7281  N  NH2 . ARG B  1  241 ? 57.355  31.611  -28.396 1.00 40.91  ? 269  ARG B NH2 1 
ATOM   7282  N  N   . TYR B  1  242 ? 51.798  38.033  -29.837 1.00 33.11  ? 270  TYR B N   1 
ATOM   7283  C  CA  . TYR B  1  242 ? 51.272  39.084  -30.711 1.00 33.53  ? 270  TYR B CA  1 
ATOM   7284  C  C   . TYR B  1  242 ? 51.481  38.798  -32.197 1.00 33.24  ? 270  TYR B C   1 
ATOM   7285  O  O   . TYR B  1  242 ? 52.524  38.286  -32.610 1.00 33.29  ? 270  TYR B O   1 
ATOM   7286  C  CB  . TYR B  1  242 ? 51.918  40.432  -30.384 1.00 34.30  ? 270  TYR B CB  1 
ATOM   7287  C  CG  . TYR B  1  242 ? 51.515  41.002  -29.051 1.00 35.33  ? 270  TYR B CG  1 
ATOM   7288  C  CD1 . TYR B  1  242 ? 52.264  40.734  -27.904 1.00 35.92  ? 270  TYR B CD1 1 
ATOM   7289  C  CD2 . TYR B  1  242 ? 50.388  41.817  -28.932 1.00 35.19  ? 270  TYR B CD2 1 
ATOM   7290  C  CE1 . TYR B  1  242 ? 51.890  41.254  -26.662 1.00 35.79  ? 270  TYR B CE1 1 
ATOM   7291  C  CE2 . TYR B  1  242 ? 50.007  42.344  -27.701 1.00 35.58  ? 270  TYR B CE2 1 
ATOM   7292  C  CZ  . TYR B  1  242 ? 50.766  42.060  -26.570 1.00 36.44  ? 270  TYR B CZ  1 
ATOM   7293  O  OH  . TYR B  1  242 ? 50.397  42.575  -25.340 1.00 37.56  ? 270  TYR B OH  1 
ATOM   7294  N  N   . TYR B  1  243 ? 50.481  39.160  -32.993 1.00 32.89  ? 271  TYR B N   1 
ATOM   7295  C  CA  . TYR B  1  243 ? 50.506  39.004  -34.441 1.00 32.40  ? 271  TYR B CA  1 
ATOM   7296  C  C   . TYR B  1  243 ? 49.945  40.274  -35.059 1.00 33.07  ? 271  TYR B C   1 
ATOM   7297  O  O   . TYR B  1  243 ? 49.121  40.955  -34.444 1.00 33.58  ? 271  TYR B O   1 
ATOM   7298  C  CB  . TYR B  1  243 ? 49.682  37.778  -34.837 1.00 31.73  ? 271  TYR B CB  1 
ATOM   7299  C  CG  . TYR B  1  243 ? 50.248  36.495  -34.257 1.00 30.84  ? 271  TYR B CG  1 
ATOM   7300  C  CD1 . TYR B  1  243 ? 49.818  36.013  -33.015 1.00 29.08  ? 271  TYR B CD1 1 
ATOM   7301  C  CD2 . TYR B  1  243 ? 51.251  35.784  -34.934 1.00 28.78  ? 271  TYR B CD2 1 
ATOM   7302  C  CE1 . TYR B  1  243 ? 50.361  34.848  -32.475 1.00 29.53  ? 271  TYR B CE1 1 
ATOM   7303  C  CE2 . TYR B  1  243 ? 51.790  34.622  -34.411 1.00 27.74  ? 271  TYR B CE2 1 
ATOM   7304  C  CZ  . TYR B  1  243 ? 51.350  34.159  -33.185 1.00 29.91  ? 271  TYR B CZ  1 
ATOM   7305  O  OH  . TYR B  1  243 ? 51.894  33.006  -32.676 1.00 30.72  ? 271  TYR B OH  1 
ATOM   7306  N  N   . ASP B  1  244 ? 50.397  40.618  -36.258 1.00 33.60  ? 272  ASP B N   1 
ATOM   7307  C  CA  . ASP B  1  244 ? 49.933  41.850  -36.917 1.00 34.00  ? 272  ASP B CA  1 
ATOM   7308  C  C   . ASP B  1  244 ? 48.588  41.638  -37.587 1.00 33.42  ? 272  ASP B C   1 
ATOM   7309  O  O   . ASP B  1  244 ? 47.840  42.596  -37.814 1.00 33.76  ? 272  ASP B O   1 
ATOM   7310  C  CB  . ASP B  1  244 ? 50.955  42.337  -37.953 1.00 34.52  ? 272  ASP B CB  1 
ATOM   7311  C  CG  . ASP B  1  244 ? 52.329  42.580  -37.350 1.00 36.61  ? 272  ASP B CG  1 
ATOM   7312  O  OD1 . ASP B  1  244 ? 52.417  42.783  -36.111 1.00 39.37  ? 272  ASP B OD1 1 
ATOM   7313  O  OD2 . ASP B  1  244 ? 53.320  42.577  -38.113 1.00 38.61  ? 272  ASP B OD2 1 
ATOM   7314  N  N   . SER B  1  245 ? 48.287  40.390  -37.921 1.00 32.37  ? 273  SER B N   1 
ATOM   7315  C  CA  . SER B  1  245 ? 47.025  40.086  -38.575 1.00 32.33  ? 273  SER B CA  1 
ATOM   7316  C  C   . SER B  1  245 ? 46.654  38.622  -38.394 1.00 31.92  ? 273  SER B C   1 
ATOM   7317  O  O   . SER B  1  245 ? 47.473  37.816  -37.940 1.00 32.09  ? 273  SER B O   1 
ATOM   7318  C  CB  . SER B  1  245 ? 47.082  40.444  -40.073 1.00 31.84  ? 273  SER B CB  1 
ATOM   7319  O  OG  . SER B  1  245 ? 47.820  39.483  -40.801 1.00 32.59  ? 273  SER B OG  1 
ATOM   7320  N  N   . LEU B  1  246 ? 45.423  38.280  -38.758 1.00 31.35  ? 274  LEU B N   1 
ATOM   7321  C  CA  . LEU B  1  246 ? 45.010  36.888  -38.757 1.00 31.06  ? 274  LEU B CA  1 
ATOM   7322  C  C   . LEU B  1  246 ? 45.712  36.103  -39.865 1.00 30.76  ? 274  LEU B C   1 
ATOM   7323  O  O   . LEU B  1  246 ? 46.126  34.967  -39.645 1.00 30.65  ? 274  LEU B O   1 
ATOM   7324  C  CB  . LEU B  1  246 ? 43.487  36.769  -38.841 1.00 30.92  ? 274  LEU B CB  1 
ATOM   7325  C  CG  . LEU B  1  246 ? 42.845  37.121  -37.497 1.00 31.47  ? 274  LEU B CG  1 
ATOM   7326  C  CD1 . LEU B  1  246 ? 41.434  37.673  -37.665 1.00 33.05  ? 274  LEU B CD1 1 
ATOM   7327  C  CD2 . LEU B  1  246 ? 42.866  35.943  -36.536 1.00 31.08  ? 274  LEU B CD2 1 
ATOM   7328  N  N   . ALA B  1  247 ? 45.867  36.714  -41.039 1.00 30.27  ? 275  ALA B N   1 
ATOM   7329  C  CA  . ALA B  1  247 ? 46.592  36.072  -42.140 1.00 30.36  ? 275  ALA B CA  1 
ATOM   7330  C  C   . ALA B  1  247 ? 48.009  35.660  -41.720 1.00 30.40  ? 275  ALA B C   1 
ATOM   7331  O  O   . ALA B  1  247 ? 48.451  34.541  -41.998 1.00 30.18  ? 275  ALA B O   1 
ATOM   7332  C  CB  . ALA B  1  247 ? 46.633  36.976  -43.376 1.00 29.72  ? 275  ALA B CB  1 
ATOM   7333  N  N   . GLN B  1  248 ? 48.701  36.575  -41.039 1.00 30.48  ? 276  GLN B N   1 
ATOM   7334  C  CA  . GLN B  1  248 ? 50.057  36.343  -40.564 1.00 30.47  ? 276  GLN B CA  1 
ATOM   7335  C  C   . GLN B  1  248 ? 50.067  35.204  -39.539 1.00 29.49  ? 276  GLN B C   1 
ATOM   7336  O  O   . GLN B  1  248 ? 50.925  34.323  -39.596 1.00 29.41  ? 276  GLN B O   1 
ATOM   7337  C  CB  . GLN B  1  248 ? 50.612  37.634  -39.951 1.00 31.27  ? 276  GLN B CB  1 
ATOM   7338  C  CG  . GLN B  1  248 ? 52.125  37.652  -39.737 1.00 34.81  ? 276  GLN B CG  1 
ATOM   7339  C  CD  . GLN B  1  248 ? 52.512  38.092  -38.323 1.00 39.80  ? 276  GLN B CD  1 
ATOM   7340  O  OE1 . GLN B  1  248 ? 52.046  39.123  -37.814 1.00 42.16  ? 276  GLN B OE1 1 
ATOM   7341  N  NE2 . GLN B  1  248 ? 53.364  37.300  -37.678 1.00 41.43  ? 276  GLN B NE2 1 
ATOM   7342  N  N   . LEU B  1  249 ? 49.111  35.232  -38.611 1.00 28.12  ? 277  LEU B N   1 
ATOM   7343  C  CA  . LEU B  1  249 ? 48.924  34.143  -37.664 1.00 27.53  ? 277  LEU B CA  1 
ATOM   7344  C  C   . LEU B  1  249 ? 48.671  32.822  -38.388 1.00 27.48  ? 277  LEU B C   1 
ATOM   7345  O  O   . LEU B  1  249 ? 49.304  31.824  -38.078 1.00 28.30  ? 277  LEU B O   1 
ATOM   7346  C  CB  . LEU B  1  249 ? 47.781  34.459  -36.678 1.00 27.45  ? 277  LEU B CB  1 
ATOM   7347  C  CG  . LEU B  1  249 ? 47.270  33.414  -35.661 1.00 27.44  ? 277  LEU B CG  1 
ATOM   7348  C  CD1 . LEU B  1  249 ? 48.347  32.812  -34.744 1.00 26.69  ? 277  LEU B CD1 1 
ATOM   7349  C  CD2 . LEU B  1  249 ? 46.142  33.984  -34.819 1.00 27.05  ? 277  LEU B CD2 1 
ATOM   7350  N  N   . GLU B  1  250 ? 47.767  32.829  -39.361 1.00 27.03  ? 278  GLU B N   1 
ATOM   7351  C  CA  . GLU B  1  250 ? 47.442  31.649  -40.142 1.00 26.55  ? 278  GLU B CA  1 
ATOM   7352  C  C   . GLU B  1  250 ? 48.666  31.094  -40.847 1.00 26.52  ? 278  GLU B C   1 
ATOM   7353  O  O   . GLU B  1  250 ? 48.913  29.886  -40.827 1.00 26.38  ? 278  GLU B O   1 
ATOM   7354  C  CB  . GLU B  1  250 ? 46.339  31.964  -41.168 1.00 26.50  ? 278  GLU B CB  1 
ATOM   7355  C  CG  . GLU B  1  250 ? 45.867  30.762  -41.988 1.00 26.21  ? 278  GLU B CG  1 
ATOM   7356  C  CD  . GLU B  1  250 ? 45.381  29.591  -41.127 1.00 29.22  ? 278  GLU B CD  1 
ATOM   7357  O  OE1 . GLU B  1  250 ? 44.926  29.810  -39.970 1.00 29.47  ? 278  GLU B OE1 1 
ATOM   7358  O  OE2 . GLU B  1  250 ? 45.436  28.443  -41.617 1.00 29.41  ? 278  GLU B OE2 1 
ATOM   7359  N  N   . ALA B  1  251 ? 49.434  31.981  -41.467 1.00 26.65  ? 279  ALA B N   1 
ATOM   7360  C  CA  . ALA B  1  251 ? 50.620  31.557  -42.201 1.00 26.92  ? 279  ALA B CA  1 
ATOM   7361  C  C   . ALA B  1  251 ? 51.697  31.012  -41.253 1.00 27.28  ? 279  ALA B C   1 
ATOM   7362  O  O   . ALA B  1  251 ? 52.315  29.998  -41.547 1.00 27.27  ? 279  ALA B O   1 
ATOM   7363  C  CB  . ALA B  1  251 ? 51.146  32.670  -43.081 1.00 26.41  ? 279  ALA B CB  1 
ATOM   7364  N  N   . GLN B  1  252 ? 51.896  31.650  -40.107 1.00 27.87  ? 280  GLN B N   1 
ATOM   7365  C  CA  . GLN B  1  252 ? 52.781  31.075  -39.097 1.00 28.88  ? 280  GLN B CA  1 
ATOM   7366  C  C   . GLN B  1  252 ? 52.315  29.709  -38.554 1.00 28.49  ? 280  GLN B C   1 
ATOM   7367  O  O   . GLN B  1  252 ? 53.144  28.823  -38.318 1.00 28.49  ? 280  GLN B O   1 
ATOM   7368  C  CB  . GLN B  1  252 ? 53.075  32.074  -37.971 1.00 29.25  ? 280  GLN B CB  1 
ATOM   7369  C  CG  . GLN B  1  252 ? 54.422  32.760  -38.175 1.00 32.25  ? 280  GLN B CG  1 
ATOM   7370  C  CD  . GLN B  1  252 ? 54.674  33.912  -37.224 1.00 36.62  ? 280  GLN B CD  1 
ATOM   7371  O  OE1 . GLN B  1  252 ? 54.953  35.026  -37.666 1.00 39.61  ? 280  GLN B OE1 1 
ATOM   7372  N  NE2 . GLN B  1  252 ? 54.604  33.651  -35.911 1.00 37.39  ? 280  GLN B NE2 1 
ATOM   7373  N  N   . PHE B  1  253 ? 51.007  29.527  -38.387 1.00 27.94  ? 281  PHE B N   1 
ATOM   7374  C  CA  . PHE B  1  253 ? 50.485  28.232  -37.952 1.00 27.72  ? 281  PHE B CA  1 
ATOM   7375  C  C   . PHE B  1  253 ? 50.745  27.137  -38.978 1.00 27.95  ? 281  PHE B C   1 
ATOM   7376  O  O   . PHE B  1  253 ? 51.187  26.038  -38.634 1.00 27.99  ? 281  PHE B O   1 
ATOM   7377  C  CB  . PHE B  1  253 ? 48.989  28.300  -37.633 1.00 27.61  ? 281  PHE B CB  1 
ATOM   7378  C  CG  . PHE B  1  253 ? 48.323  26.946  -37.545 1.00 27.10  ? 281  PHE B CG  1 
ATOM   7379  C  CD1 . PHE B  1  253 ? 48.503  26.133  -36.419 1.00 26.07  ? 281  PHE B CD1 1 
ATOM   7380  C  CD2 . PHE B  1  253 ? 47.509  26.483  -38.594 1.00 25.84  ? 281  PHE B CD2 1 
ATOM   7381  C  CE1 . PHE B  1  253 ? 47.895  24.883  -36.344 1.00 25.93  ? 281  PHE B CE1 1 
ATOM   7382  C  CE2 . PHE B  1  253 ? 46.896  25.233  -38.528 1.00 24.96  ? 281  PHE B CE2 1 
ATOM   7383  C  CZ  . PHE B  1  253 ? 47.091  24.428  -37.411 1.00 25.74  ? 281  PHE B CZ  1 
ATOM   7384  N  N   . GLU B  1  254 ? 50.458  27.436  -40.239 1.00 28.11  ? 282  GLU B N   1 
ATOM   7385  C  CA  . GLU B  1  254 ? 50.662  26.471  -41.304 1.00 28.23  ? 282  GLU B CA  1 
ATOM   7386  C  C   . GLU B  1  254 ? 52.140  26.155  -41.535 1.00 28.12  ? 282  GLU B C   1 
ATOM   7387  O  O   . GLU B  1  254 ? 52.475  25.050  -41.960 1.00 28.13  ? 282  GLU B O   1 
ATOM   7388  C  CB  . GLU B  1  254 ? 50.019  26.961  -42.598 1.00 28.22  ? 282  GLU B CB  1 
ATOM   7389  C  CG  . GLU B  1  254 ? 48.504  26.767  -42.661 1.00 28.88  ? 282  GLU B CG  1 
ATOM   7390  C  CD  . GLU B  1  254 ? 47.896  27.392  -43.914 1.00 29.69  ? 282  GLU B CD  1 
ATOM   7391  O  OE1 . GLU B  1  254 ? 48.430  27.168  -45.033 1.00 32.51  ? 282  GLU B OE1 1 
ATOM   7392  O  OE2 . GLU B  1  254 ? 46.884  28.112  -43.791 1.00 31.28  ? 282  GLU B OE2 1 
ATOM   7393  N  N   . ALA B  1  255 ? 53.023  27.119  -41.269 1.00 27.92  ? 283  ALA B N   1 
ATOM   7394  C  CA  . ALA B  1  255 ? 54.455  26.903  -41.465 1.00 27.75  ? 283  ALA B CA  1 
ATOM   7395  C  C   . ALA B  1  255 ? 55.058  26.044  -40.351 1.00 27.92  ? 283  ALA B C   1 
ATOM   7396  O  O   . ALA B  1  255 ? 56.205  25.628  -40.447 1.00 28.00  ? 283  ALA B O   1 
ATOM   7397  C  CB  . ALA B  1  255 ? 55.195  28.222  -41.598 1.00 27.27  ? 283  ALA B CB  1 
ATOM   7398  N  N   . GLY B  1  256 ? 54.282  25.788  -39.300 1.00 28.10  ? 284  GLY B N   1 
ATOM   7399  C  CA  . GLY B  1  256 ? 54.701  24.901  -38.209 1.00 28.47  ? 284  GLY B CA  1 
ATOM   7400  C  C   . GLY B  1  256 ? 55.214  25.588  -36.948 1.00 28.83  ? 284  GLY B C   1 
ATOM   7401  O  O   . GLY B  1  256 ? 55.808  24.943  -36.079 1.00 28.31  ? 284  GLY B O   1 
ATOM   7402  N  N   . LEU B  1  257 ? 54.977  26.891  -36.832 1.00 29.24  ? 285  LEU B N   1 
ATOM   7403  C  CA  . LEU B  1  257 ? 55.620  27.671  -35.790 1.00 29.90  ? 285  LEU B CA  1 
ATOM   7404  C  C   . LEU B  1  257 ? 54.666  28.163  -34.707 1.00 30.57  ? 285  LEU B C   1 
ATOM   7405  O  O   . LEU B  1  257 ? 54.945  29.130  -34.011 1.00 31.22  ? 285  LEU B O   1 
ATOM   7406  C  CB  . LEU B  1  257 ? 56.360  28.853  -36.410 1.00 29.73  ? 285  LEU B CB  1 
ATOM   7407  C  CG  . LEU B  1  257 ? 57.202  29.654  -35.410 1.00 29.98  ? 285  LEU B CG  1 
ATOM   7408  C  CD1 . LEU B  1  257 ? 58.630  29.116  -35.360 1.00 27.75  ? 285  LEU B CD1 1 
ATOM   7409  C  CD2 . LEU B  1  257 ? 57.136  31.172  -35.709 1.00 29.91  ? 285  LEU B CD2 1 
ATOM   7410  N  N   . VAL B  1  258 ? 53.517  27.533  -34.568 1.00 31.31  ? 286  VAL B N   1 
ATOM   7411  C  CA  . VAL B  1  258 ? 52.618  27.944  -33.506 1.00 31.81  ? 286  VAL B CA  1 
ATOM   7412  C  C   . VAL B  1  258 ? 52.199  26.680  -32.800 1.00 32.39  ? 286  VAL B C   1 
ATOM   7413  O  O   . VAL B  1  258 ? 51.495  25.853  -33.379 1.00 32.41  ? 286  VAL B O   1 
ATOM   7414  C  CB  . VAL B  1  258 ? 51.401  28.738  -34.038 1.00 31.77  ? 286  VAL B CB  1 
ATOM   7415  C  CG1 . VAL B  1  258 ? 50.501  29.170  -32.888 1.00 31.79  ? 286  VAL B CG1 1 
ATOM   7416  C  CG2 . VAL B  1  258 ? 51.858  29.950  -34.824 1.00 31.38  ? 286  VAL B CG2 1 
ATOM   7417  N  N   . ASN B  1  259 ? 52.669  26.498  -31.571 1.00 33.16  ? 287  ASN B N   1 
ATOM   7418  C  CA  . ASN B  1  259 ? 52.304  25.296  -30.836 1.00 33.98  ? 287  ASN B CA  1 
ATOM   7419  C  C   . ASN B  1  259 ? 50.995  25.555  -30.117 1.00 33.38  ? 287  ASN B C   1 
ATOM   7420  O  O   . ASN B  1  259 ? 50.972  26.223  -29.105 1.00 33.68  ? 287  ASN B O   1 
ATOM   7421  C  CB  . ASN B  1  259 ? 53.419  24.822  -29.882 1.00 34.59  ? 287  ASN B CB  1 
ATOM   7422  C  CG  . ASN B  1  259 ? 54.791  24.770  -30.561 1.00 36.41  ? 287  ASN B CG  1 
ATOM   7423  O  OD1 . ASN B  1  259 ? 55.106  23.844  -31.328 1.00 37.49  ? 287  ASN B OD1 1 
ATOM   7424  N  ND2 . ASN B  1  259 ? 55.612  25.781  -30.286 1.00 38.67  ? 287  ASN B ND2 1 
ATOM   7425  N  N   . VAL B  1  260 ? 49.917  25.026  -30.688 1.00 33.02  ? 288  VAL B N   1 
ATOM   7426  C  CA  . VAL B  1  260 ? 48.558  25.187  -30.201 1.00 32.79  ? 288  VAL B CA  1 
ATOM   7427  C  C   . VAL B  1  260 ? 48.264  24.369  -28.936 1.00 33.09  ? 288  VAL B C   1 
ATOM   7428  O  O   . VAL B  1  260 ? 48.377  23.141  -28.932 1.00 32.87  ? 288  VAL B O   1 
ATOM   7429  C  CB  . VAL B  1  260 ? 47.550  24.770  -31.289 1.00 32.47  ? 288  VAL B CB  1 
ATOM   7430  C  CG1 . VAL B  1  260 ? 46.136  24.955  -30.801 1.00 32.23  ? 288  VAL B CG1 1 
ATOM   7431  C  CG2 . VAL B  1  260 ? 47.765  25.569  -32.534 1.00 32.59  ? 288  VAL B CG2 1 
ATOM   7432  N  N   . VAL B  1  261 ? 47.882  25.056  -27.864 1.00 33.47  ? 289  VAL B N   1 
ATOM   7433  C  CA  . VAL B  1  261 ? 47.314  24.376  -26.712 1.00 33.83  ? 289  VAL B CA  1 
ATOM   7434  C  C   . VAL B  1  261 ? 45.848  24.092  -27.035 1.00 34.32  ? 289  VAL B C   1 
ATOM   7435  O  O   . VAL B  1  261 ? 45.108  25.003  -27.419 1.00 33.98  ? 289  VAL B O   1 
ATOM   7436  C  CB  . VAL B  1  261 ? 47.407  25.220  -25.423 1.00 33.65  ? 289  VAL B CB  1 
ATOM   7437  C  CG1 . VAL B  1  261 ? 46.830  24.433  -24.243 1.00 33.29  ? 289  VAL B CG1 1 
ATOM   7438  C  CG2 . VAL B  1  261 ? 48.849  25.644  -25.145 1.00 32.86  ? 289  VAL B CG2 1 
ATOM   7439  N  N   . LEU B  1  262 ? 45.430  22.839  -26.873 1.00 34.95  ? 290  LEU B N   1 
ATOM   7440  C  CA  . LEU B  1  262 ? 44.043  22.456  -27.166 1.00 35.70  ? 290  LEU B CA  1 
ATOM   7441  C  C   . LEU B  1  262 ? 43.080  22.711  -25.990 1.00 36.04  ? 290  LEU B C   1 
ATOM   7442  O  O   . LEU B  1  262 ? 43.062  21.960  -25.007 1.00 36.21  ? 290  LEU B O   1 
ATOM   7443  C  CB  . LEU B  1  262 ? 43.986  20.990  -27.623 1.00 35.90  ? 290  LEU B CB  1 
ATOM   7444  C  CG  . LEU B  1  262 ? 44.764  20.589  -28.889 1.00 36.28  ? 290  LEU B CG  1 
ATOM   7445  C  CD1 . LEU B  1  262 ? 44.837  19.059  -29.031 1.00 36.53  ? 290  LEU B CD1 1 
ATOM   7446  C  CD2 . LEU B  1  262 ? 44.138  21.207  -30.140 1.00 36.56  ? 290  LEU B CD2 1 
ATOM   7447  N  N   . ILE B  1  263 ? 42.291  23.779  -26.091 1.00 36.37  ? 291  ILE B N   1 
ATOM   7448  C  CA  . ILE B  1  263 ? 41.261  24.093  -25.095 1.00 36.62  ? 291  ILE B CA  1 
ATOM   7449  C  C   . ILE B  1  263 ? 39.958  23.391  -25.480 1.00 37.39  ? 291  ILE B C   1 
ATOM   7450  O  O   . ILE B  1  263 ? 39.446  23.630  -26.576 1.00 37.20  ? 291  ILE B O   1 
ATOM   7451  C  CB  . ILE B  1  263 ? 41.021  25.624  -24.982 1.00 36.40  ? 291  ILE B CB  1 
ATOM   7452  C  CG1 . ILE B  1  263 ? 42.291  26.328  -24.533 1.00 35.64  ? 291  ILE B CG1 1 
ATOM   7453  C  CG2 . ILE B  1  263 ? 39.916  25.934  -23.992 1.00 35.30  ? 291  ILE B CG2 1 
ATOM   7454  C  CD1 . ILE B  1  263 ? 42.617  27.523  -25.361 1.00 36.11  ? 291  ILE B CD1 1 
ATOM   7455  N  N   . PRO B  1  264 ? 39.420  22.529  -24.589 1.00 38.20  ? 292  PRO B N   1 
ATOM   7456  C  CA  . PRO B  1  264 ? 38.192  21.787  -24.880 1.00 39.13  ? 292  PRO B CA  1 
ATOM   7457  C  C   . PRO B  1  264 ? 36.952  22.679  -24.795 1.00 39.87  ? 292  PRO B C   1 
ATOM   7458  O  O   . PRO B  1  264 ? 36.935  23.640  -24.018 1.00 39.48  ? 292  PRO B O   1 
ATOM   7459  C  CB  . PRO B  1  264 ? 38.141  20.700  -23.781 1.00 39.12  ? 292  PRO B CB  1 
ATOM   7460  C  CG  . PRO B  1  264 ? 39.412  20.813  -23.014 1.00 39.09  ? 292  PRO B CG  1 
ATOM   7461  C  CD  . PRO B  1  264 ? 39.924  22.215  -23.243 1.00 38.70  ? 292  PRO B CD  1 
ATOM   7462  N  N   . ASP B  1  265 ? 35.930  22.350  -25.587 1.00 40.75  ? 293  ASP B N   1 
ATOM   7463  C  CA  . ASP B  1  265 ? 34.709  23.156  -25.661 1.00 41.75  ? 293  ASP B CA  1 
ATOM   7464  C  C   . ASP B  1  265 ? 33.507  22.543  -24.927 1.00 42.22  ? 293  ASP B C   1 
ATOM   7465  O  O   . ASP B  1  265 ? 32.397  23.072  -25.002 1.00 42.40  ? 293  ASP B O   1 
ATOM   7466  C  CB  . ASP B  1  265 ? 34.348  23.431  -27.120 1.00 41.74  ? 293  ASP B CB  1 
ATOM   7467  C  CG  . ASP B  1  265 ? 33.841  22.193  -27.844 1.00 43.14  ? 293  ASP B CG  1 
ATOM   7468  O  OD1 . ASP B  1  265 ? 34.108  21.056  -27.382 1.00 43.73  ? 293  ASP B OD1 1 
ATOM   7469  O  OD2 . ASP B  1  265 ? 33.181  22.360  -28.892 1.00 45.01  ? 293  ASP B OD2 1 
ATOM   7470  N  N   . ASN B  1  266 ? 33.735  21.437  -24.225 1.00 42.81  ? 294  ASN B N   1 
ATOM   7471  C  CA  . ASN B  1  266 ? 32.688  20.777  -23.462 1.00 43.88  ? 294  ASN B CA  1 
ATOM   7472  C  C   . ASN B  1  266 ? 33.251  20.161  -22.191 1.00 43.35  ? 294  ASN B C   1 
ATOM   7473  O  O   . ASN B  1  266 ? 34.450  19.881  -22.114 1.00 43.49  ? 294  ASN B O   1 
ATOM   7474  C  CB  . ASN B  1  266 ? 32.003  19.692  -24.307 1.00 44.81  ? 294  ASN B CB  1 
ATOM   7475  C  CG  . ASN B  1  266 ? 30.529  19.488  -23.928 1.00 48.89  ? 294  ASN B CG  1 
ATOM   7476  O  OD1 . ASN B  1  266 ? 30.027  20.097  -22.963 1.00 48.67  ? 294  ASN B OD1 1 
ATOM   7477  N  ND2 . ASN B  1  266 ? 29.826  18.641  -24.710 1.00 54.69  ? 294  ASN B ND2 1 
ATOM   7478  N  N   . GLY B  1  267 ? 32.389  19.942  -21.199 1.00 42.63  ? 295  GLY B N   1 
ATOM   7479  C  CA  . GLY B  1  267 ? 32.801  19.268  -19.972 1.00 41.81  ? 295  GLY B CA  1 
ATOM   7480  C  C   . GLY B  1  267 ? 31.700  19.209  -18.936 1.00 41.62  ? 295  GLY B C   1 
ATOM   7481  O  O   . GLY B  1  267 ? 30.542  19.536  -19.223 1.00 41.67  ? 295  GLY B O   1 
ATOM   7482  N  N   . THR B  1  268 ? 32.049  18.793  -17.722 1.00 41.03  ? 296  THR B N   1 
ATOM   7483  C  CA  . THR B  1  268 ? 31.069  18.789  -16.639 1.00 40.53  ? 296  THR B CA  1 
ATOM   7484  C  C   . THR B  1  268 ? 31.639  19.398  -15.371 1.00 39.94  ? 296  THR B C   1 
ATOM   7485  O  O   . THR B  1  268 ? 32.853  19.591  -15.250 1.00 39.71  ? 296  THR B O   1 
ATOM   7486  C  CB  . THR B  1  268 ? 30.551  17.380  -16.329 1.00 40.63  ? 296  THR B CB  1 
ATOM   7487  O  OG1 . THR B  1  268 ? 31.668  16.510  -16.138 1.00 40.85  ? 296  THR B OG1 1 
ATOM   7488  C  CG2 . THR B  1  268 ? 29.666  16.853  -17.470 1.00 40.73  ? 296  THR B CG2 1 
ATOM   7489  N  N   . GLY B  1  269 ? 30.744  19.694  -14.430 1.00 39.07  ? 297  GLY B N   1 
ATOM   7490  C  CA  . GLY B  1  269 ? 31.118  20.348  -13.189 1.00 38.19  ? 297  GLY B CA  1 
ATOM   7491  C  C   . GLY B  1  269 ? 30.854  21.843  -13.223 1.00 37.67  ? 297  GLY B C   1 
ATOM   7492  O  O   . GLY B  1  269 ? 30.263  22.364  -14.179 1.00 37.18  ? 297  GLY B O   1 
ATOM   7493  N  N   . GLY B  1  270 ? 31.314  22.524  -12.172 1.00 37.13  ? 298  GLY B N   1 
ATOM   7494  C  CA  . GLY B  1  270 ? 31.076  23.943  -11.970 1.00 36.32  ? 298  GLY B CA  1 
ATOM   7495  C  C   . GLY B  1  270 ? 31.710  24.873  -12.991 1.00 36.18  ? 298  GLY B C   1 
ATOM   7496  O  O   . GLY B  1  270 ? 31.313  26.032  -13.097 1.00 36.63  ? 298  GLY B O   1 
ATOM   7497  N  N   . SER B  1  271 ? 32.688  24.404  -13.756 1.00 35.44  ? 299  SER B N   1 
ATOM   7498  C  CA  . SER B  1  271 ? 33.284  25.310  -14.741 1.00 35.12  ? 299  SER B CA  1 
ATOM   7499  C  C   . SER B  1  271 ? 32.571  25.239  -16.086 1.00 34.70  ? 299  SER B C   1 
ATOM   7500  O  O   . SER B  1  271 ? 32.866  26.018  -16.991 1.00 34.64  ? 299  SER B O   1 
ATOM   7501  C  CB  . SER B  1  271 ? 34.815  25.143  -14.867 1.00 35.06  ? 299  SER B CB  1 
ATOM   7502  O  OG  . SER B  1  271 ? 35.167  23.868  -15.343 1.00 35.49  ? 299  SER B OG  1 
ATOM   7503  N  N   . TRP B  1  272 ? 31.612  24.318  -16.190 1.00 34.22  ? 300  TRP B N   1 
ATOM   7504  C  CA  . TRP B  1  272 ? 30.840  24.119  -17.415 1.00 33.72  ? 300  TRP B CA  1 
ATOM   7505  C  C   . TRP B  1  272 ? 29.365  24.338  -17.210 1.00 33.98  ? 300  TRP B C   1 
ATOM   7506  O  O   . TRP B  1  272 ? 28.644  24.590  -18.169 1.00 34.63  ? 300  TRP B O   1 
ATOM   7507  C  CB  . TRP B  1  272 ? 31.057  22.710  -17.970 1.00 32.90  ? 300  TRP B CB  1 
ATOM   7508  C  CG  . TRP B  1  272 ? 32.469  22.503  -18.310 1.00 32.23  ? 300  TRP B CG  1 
ATOM   7509  C  CD1 . TRP B  1  272 ? 33.432  21.962  -17.511 1.00 30.37  ? 300  TRP B CD1 1 
ATOM   7510  C  CD2 . TRP B  1  272 ? 33.117  22.893  -19.523 1.00 31.31  ? 300  TRP B CD2 1 
ATOM   7511  N  NE1 . TRP B  1  272 ? 34.634  21.963  -18.162 1.00 30.40  ? 300  TRP B NE1 1 
ATOM   7512  C  CE2 . TRP B  1  272 ? 34.475  22.525  -19.401 1.00 31.29  ? 300  TRP B CE2 1 
ATOM   7513  C  CE3 . TRP B  1  272 ? 32.676  23.498  -20.712 1.00 30.76  ? 300  TRP B CE3 1 
ATOM   7514  C  CZ2 . TRP B  1  272 ? 35.411  22.755  -20.419 1.00 31.38  ? 300  TRP B CZ2 1 
ATOM   7515  C  CZ3 . TRP B  1  272 ? 33.597  23.726  -21.724 1.00 30.69  ? 300  TRP B CZ3 1 
ATOM   7516  C  CH2 . TRP B  1  272 ? 34.955  23.361  -21.567 1.00 31.73  ? 300  TRP B CH2 1 
ATOM   7517  N  N   . SER B  1  273 ? 28.916  24.233  -15.967 1.00 34.16  ? 301  SER B N   1 
ATOM   7518  C  CA  . SER B  1  273 ? 27.490  24.161  -15.688 1.00 34.39  ? 301  SER B CA  1 
ATOM   7519  C  C   . SER B  1  273 ? 27.112  24.975  -14.471 1.00 34.44  ? 301  SER B C   1 
ATOM   7520  O  O   . SER B  1  273 ? 27.974  25.361  -13.687 1.00 34.07  ? 301  SER B O   1 
ATOM   7521  C  CB  . SER B  1  273 ? 27.073  22.698  -15.487 1.00 34.31  ? 301  SER B CB  1 
ATOM   7522  O  OG  . SER B  1  273 ? 25.673  22.593  -15.311 1.00 35.04  ? 301  SER B OG  1 
ATOM   7523  N  N   . LEU B  1  274 ? 25.813  25.234  -14.338 1.00 34.83  ? 302  LEU B N   1 
ATOM   7524  C  CA  . LEU B  1  274 ? 25.241  25.818  -13.135 1.00 35.29  ? 302  LEU B CA  1 
ATOM   7525  C  C   . LEU B  1  274 ? 24.248  24.855  -12.466 1.00 35.97  ? 302  LEU B C   1 
ATOM   7526  O  O   . LEU B  1  274 ? 23.789  25.089  -11.346 1.00 35.65  ? 302  LEU B O   1 
ATOM   7527  C  CB  . LEU B  1  274 ? 24.551  27.137  -13.461 1.00 35.09  ? 302  LEU B CB  1 
ATOM   7528  C  CG  . LEU B  1  274 ? 25.373  28.414  -13.450 1.00 34.67  ? 302  LEU B CG  1 
ATOM   7529  C  CD1 . LEU B  1  274 ? 24.451  29.576  -13.759 1.00 35.71  ? 302  LEU B CD1 1 
ATOM   7530  C  CD2 . LEU B  1  274 ? 26.063  28.641  -12.118 1.00 33.35  ? 302  LEU B CD2 1 
ATOM   7531  N  N   . LYS B  1  275 ? 23.921  23.768  -13.153 1.00 37.04  ? 303  LYS B N   1 
ATOM   7532  C  CA  . LYS B  1  275 ? 23.000  22.786  -12.585 1.00 38.08  ? 303  LYS B CA  1 
ATOM   7533  C  C   . LYS B  1  275 ? 23.660  21.884  -11.544 1.00 38.14  ? 303  LYS B C   1 
ATOM   7534  O  O   . LYS B  1  275 ? 24.593  21.129  -11.842 1.00 38.07  ? 303  LYS B O   1 
ATOM   7535  C  CB  . LYS B  1  275 ? 22.295  21.951  -13.663 1.00 38.16  ? 303  LYS B CB  1 
ATOM   7536  C  CG  . LYS B  1  275 ? 20.999  21.366  -13.136 1.00 39.55  ? 303  LYS B CG  1 
ATOM   7537  C  CD  . LYS B  1  275 ? 20.109  20.830  -14.232 1.00 43.03  ? 303  LYS B CD  1 
ATOM   7538  C  CE  . LYS B  1  275 ? 18.666  20.767  -13.744 1.00 44.69  ? 303  LYS B CE  1 
ATOM   7539  N  NZ  . LYS B  1  275 ? 17.776  20.340  -14.855 1.00 46.61  ? 303  LYS B NZ  1 
ATOM   7540  N  N   . SER B  1  276 ? 23.154  21.984  -10.321 1.00 38.58  ? 304  SER B N   1 
ATOM   7541  C  CA  . SER B  1  276 ? 23.568  21.121  -9.234  1.00 39.03  ? 304  SER B CA  1 
ATOM   7542  C  C   . SER B  1  276 ? 23.182  19.680  -9.540  1.00 39.33  ? 304  SER B C   1 
ATOM   7543  O  O   . SER B  1  276 ? 22.052  19.421  -9.966  1.00 39.29  ? 304  SER B O   1 
ATOM   7544  C  CB  . SER B  1  276 ? 22.908  21.560  -7.929  1.00 38.99  ? 304  SER B CB  1 
ATOM   7545  O  OG  . SER B  1  276 ? 23.150  20.609  -6.907  1.00 39.02  ? 304  SER B OG  1 
ATOM   7546  N  N   . PRO B  1  277 ? 24.117  18.740  -9.329  1.00 39.72  ? 305  PRO B N   1 
ATOM   7547  C  CA  . PRO B  1  277 ? 23.752  17.341  -9.545  1.00 40.15  ? 305  PRO B CA  1 
ATOM   7548  C  C   . PRO B  1  277 ? 23.035  16.755  -8.331  1.00 40.46  ? 305  PRO B C   1 
ATOM   7549  O  O   . PRO B  1  277 ? 22.503  15.644  -8.407  1.00 40.75  ? 305  PRO B O   1 
ATOM   7550  C  CB  . PRO B  1  277 ? 25.110  16.641  -9.774  1.00 40.12  ? 305  PRO B CB  1 
ATOM   7551  C  CG  . PRO B  1  277 ? 26.189  17.698  -9.550  1.00 40.03  ? 305  PRO B CG  1 
ATOM   7552  C  CD  . PRO B  1  277 ? 25.525  18.887  -8.913  1.00 39.74  ? 305  PRO B CD  1 
ATOM   7553  N  N   . VAL B  1  278 ? 23.014  17.496  -7.224  1.00 40.47  ? 306  VAL B N   1 
ATOM   7554  C  CA  . VAL B  1  278 ? 22.412  16.999  -5.989  1.00 40.58  ? 306  VAL B CA  1 
ATOM   7555  C  C   . VAL B  1  278 ? 20.914  17.334  -5.920  1.00 40.45  ? 306  VAL B C   1 
ATOM   7556  O  O   . VAL B  1  278 ? 20.535  18.513  -5.921  1.00 40.78  ? 306  VAL B O   1 
ATOM   7557  C  CB  . VAL B  1  278 ? 23.182  17.484  -4.732  1.00 40.58  ? 306  VAL B CB  1 
ATOM   7558  C  CG1 . VAL B  1  278 ? 22.490  17.025  -3.439  1.00 40.60  ? 306  VAL B CG1 1 
ATOM   7559  C  CG2 . VAL B  1  278 ? 24.621  16.975  -4.768  1.00 41.11  ? 306  VAL B CG2 1 
ATOM   7560  N  N   . PRO B  1  279 ? 20.058  16.295  -5.862  1.00 39.97  ? 307  PRO B N   1 
ATOM   7561  C  CA  . PRO B  1  279 ? 18.611  16.526  -5.830  1.00 39.68  ? 307  PRO B CA  1 
ATOM   7562  C  C   . PRO B  1  279 ? 18.202  17.368  -4.616  1.00 39.14  ? 307  PRO B C   1 
ATOM   7563  O  O   . PRO B  1  279 ? 18.852  17.281  -3.573  1.00 39.05  ? 307  PRO B O   1 
ATOM   7564  C  CB  . PRO B  1  279 ? 18.020  15.105  -5.733  1.00 39.60  ? 307  PRO B CB  1 
ATOM   7565  C  CG  . PRO B  1  279 ? 19.139  14.245  -5.223  1.00 39.96  ? 307  PRO B CG  1 
ATOM   7566  C  CD  . PRO B  1  279 ? 20.389  14.860  -5.811  1.00 40.07  ? 307  PRO B CD  1 
ATOM   7567  N  N   . PRO B  1  280 ? 17.132  18.180  -4.745  1.00 38.78  ? 308  PRO B N   1 
ATOM   7568  C  CA  . PRO B  1  280 ? 16.722  18.971  -3.584  1.00 38.30  ? 308  PRO B CA  1 
ATOM   7569  C  C   . PRO B  1  280 ? 16.382  18.056  -2.421  1.00 37.80  ? 308  PRO B C   1 
ATOM   7570  O  O   . PRO B  1  280 ? 15.990  16.908  -2.644  1.00 38.08  ? 308  PRO B O   1 
ATOM   7571  C  CB  . PRO B  1  280 ? 15.470  19.711  -4.070  1.00 38.32  ? 308  PRO B CB  1 
ATOM   7572  C  CG  . PRO B  1  280 ? 15.044  19.005  -5.317  1.00 38.44  ? 308  PRO B CG  1 
ATOM   7573  C  CD  . PRO B  1  280 ? 16.260  18.406  -5.915  1.00 38.65  ? 308  PRO B CD  1 
ATOM   7574  N  N   . GLY B  1  281 ? 16.574  18.548  -1.201  1.00 36.88  ? 309  GLY B N   1 
ATOM   7575  C  CA  . GLY B  1  281 ? 16.159  17.832  -0.003  1.00 35.81  ? 309  GLY B CA  1 
ATOM   7576  C  C   . GLY B  1  281 ? 15.108  18.621  0.763   1.00 35.27  ? 309  GLY B C   1 
ATOM   7577  O  O   . GLY B  1  281 ? 14.271  19.290  0.161   1.00 35.29  ? 309  GLY B O   1 
ATOM   7578  N  N   . PRO B  1  282 ? 15.153  18.567  2.102   1.00 34.60  ? 310  PRO B N   1 
ATOM   7579  C  CA  . PRO B  1  282 ? 14.182  19.306  2.889   1.00 34.35  ? 310  PRO B CA  1 
ATOM   7580  C  C   . PRO B  1  282 ? 14.222  20.826  2.618   1.00 34.12  ? 310  PRO B C   1 
ATOM   7581  O  O   . PRO B  1  282 ? 15.301  21.394  2.417   1.00 34.20  ? 310  PRO B O   1 
ATOM   7582  C  CB  . PRO B  1  282 ? 14.567  18.963  4.340   1.00 34.40  ? 310  PRO B CB  1 
ATOM   7583  C  CG  . PRO B  1  282 ? 15.951  18.456  4.277   1.00 34.22  ? 310  PRO B CG  1 
ATOM   7584  C  CD  . PRO B  1  282 ? 16.101  17.815  2.946   1.00 34.61  ? 310  PRO B CD  1 
ATOM   7585  N  N   . ALA B  1  283 ? 13.047  21.460  2.616   1.00 33.51  ? 311  ALA B N   1 
ATOM   7586  C  CA  . ALA B  1  283 ? 12.900  22.852  2.185   1.00 33.19  ? 311  ALA B CA  1 
ATOM   7587  C  C   . ALA B  1  283 ? 13.614  23.860  3.089   1.00 33.16  ? 311  ALA B C   1 
ATOM   7588  O  O   . ALA B  1  283 ? 13.534  23.776  4.314   1.00 33.16  ? 311  ALA B O   1 
ATOM   7589  C  CB  . ALA B  1  283 ? 11.429  23.213  2.056   1.00 32.89  ? 311  ALA B CB  1 
ATOM   7590  N  N   . PRO B  1  284 ? 14.311  24.833  2.482   1.00 33.08  ? 312  PRO B N   1 
ATOM   7591  C  CA  . PRO B  1  284 ? 14.981  25.875  3.281   1.00 32.98  ? 312  PRO B CA  1 
ATOM   7592  C  C   . PRO B  1  284 ? 13.976  26.700  4.077   1.00 32.94  ? 312  PRO B C   1 
ATOM   7593  O  O   . PRO B  1  284 ? 12.817  26.742  3.700   1.00 32.88  ? 312  PRO B O   1 
ATOM   7594  C  CB  . PRO B  1  284 ? 15.693  26.731  2.236   1.00 32.50  ? 312  PRO B CB  1 
ATOM   7595  C  CG  . PRO B  1  284 ? 15.088  26.354  0.915   1.00 33.07  ? 312  PRO B CG  1 
ATOM   7596  C  CD  . PRO B  1  284 ? 14.533  24.986  1.034   1.00 32.89  ? 312  PRO B CD  1 
ATOM   7597  N  N   . PRO B  1  285 ? 14.403  27.323  5.194   1.00 33.13  ? 313  PRO B N   1 
ATOM   7598  C  CA  . PRO B  1  285 ? 13.440  28.118  5.946   1.00 33.47  ? 313  PRO B CA  1 
ATOM   7599  C  C   . PRO B  1  285 ? 12.785  29.198  5.089   1.00 33.61  ? 313  PRO B C   1 
ATOM   7600  O  O   . PRO B  1  285 ? 13.405  29.725  4.166   1.00 33.51  ? 313  PRO B O   1 
ATOM   7601  C  CB  . PRO B  1  285 ? 14.276  28.749  7.071   1.00 33.29  ? 313  PRO B CB  1 
ATOM   7602  C  CG  . PRO B  1  285 ? 15.674  28.523  6.719   1.00 33.13  ? 313  PRO B CG  1 
ATOM   7603  C  CD  . PRO B  1  285 ? 15.731  27.327  5.833   1.00 33.32  ? 313  PRO B CD  1 
ATOM   7604  N  N   . LEU B  1  286 ? 11.533  29.498  5.410   1.00 33.78  ? 314  LEU B N   1 
ATOM   7605  C  CA  . LEU B  1  286 ? 10.741  30.466  4.676   1.00 33.93  ? 314  LEU B CA  1 
ATOM   7606  C  C   . LEU B  1  286 ? 10.188  31.546  5.609   1.00 33.98  ? 314  LEU B C   1 
ATOM   7607  O  O   . LEU B  1  286 ? 9.778   31.247  6.739   1.00 33.66  ? 314  LEU B O   1 
ATOM   7608  C  CB  . LEU B  1  286 ? 9.585   29.744  3.981   1.00 34.09  ? 314  LEU B CB  1 
ATOM   7609  C  CG  . LEU B  1  286 ? 8.650   30.636  3.167   1.00 34.60  ? 314  LEU B CG  1 
ATOM   7610  C  CD1 . LEU B  1  286 ? 9.303   31.009  1.831   1.00 34.62  ? 314  LEU B CD1 1 
ATOM   7611  C  CD2 . LEU B  1  286 ? 7.304   29.950  2.962   1.00 36.07  ? 314  LEU B CD2 1 
ATOM   7612  N  N   . GLN B  1  287 ? 10.176  32.792  5.133   1.00 34.19  ? 315  GLN B N   1 
ATOM   7613  C  CA  . GLN B  1  287 ? 9.558   33.888  5.883   1.00 34.64  ? 315  GLN B CA  1 
ATOM   7614  C  C   . GLN B  1  287 ? 8.179   34.255  5.373   1.00 34.47  ? 315  GLN B C   1 
ATOM   7615  O  O   . GLN B  1  287 ? 7.931   34.221  4.178   1.00 34.32  ? 315  GLN B O   1 
ATOM   7616  C  CB  . GLN B  1  287 ? 10.463  35.119  5.925   1.00 34.48  ? 315  GLN B CB  1 
ATOM   7617  C  CG  . GLN B  1  287 ? 11.283  35.151  7.203   1.00 36.12  ? 315  GLN B CG  1 
ATOM   7618  C  CD  . GLN B  1  287 ? 11.907  36.501  7.534   1.00 37.62  ? 315  GLN B CD  1 
ATOM   7619  O  OE1 . GLN B  1  287 ? 11.344  37.565  7.247   1.00 38.03  ? 315  GLN B OE1 1 
ATOM   7620  N  NE2 . GLN B  1  287 ? 13.077  36.457  8.169   1.00 38.19  ? 315  GLN B NE2 1 
ATOM   7621  N  N   . PHE B  1  288 ? 7.278   34.595  6.288   1.00 34.84  ? 316  PHE B N   1 
ATOM   7622  C  CA  . PHE B  1  288 ? 5.930   35.005  5.893   1.00 35.59  ? 316  PHE B CA  1 
ATOM   7623  C  C   . PHE B  1  288 ? 5.328   36.032  6.854   1.00 36.02  ? 316  PHE B C   1 
ATOM   7624  O  O   . PHE B  1  288 ? 5.786   36.172  7.985   1.00 36.12  ? 316  PHE B O   1 
ATOM   7625  C  CB  . PHE B  1  288 ? 5.004   33.779  5.699   1.00 35.50  ? 316  PHE B CB  1 
ATOM   7626  C  CG  . PHE B  1  288 ? 4.465   33.201  6.983   1.00 36.18  ? 316  PHE B CG  1 
ATOM   7627  C  CD1 . PHE B  1  288 ? 3.109   33.315  7.296   1.00 37.15  ? 316  PHE B CD1 1 
ATOM   7628  C  CD2 . PHE B  1  288 ? 5.301   32.541  7.877   1.00 36.14  ? 316  PHE B CD2 1 
ATOM   7629  C  CE1 . PHE B  1  288 ? 2.597   32.782  8.483   1.00 37.40  ? 316  PHE B CE1 1 
ATOM   7630  C  CE2 . PHE B  1  288 ? 4.798   32.015  9.069   1.00 36.74  ? 316  PHE B CE2 1 
ATOM   7631  C  CZ  . PHE B  1  288 ? 3.447   32.134  9.371   1.00 36.39  ? 316  PHE B CZ  1 
ATOM   7632  N  N   . TYR B  1  289 ? 4.309   36.748  6.377   1.00 36.77  ? 317  TYR B N   1 
ATOM   7633  C  CA  . TYR B  1  289 ? 3.623   37.787  7.132   1.00 36.98  ? 317  TYR B CA  1 
ATOM   7634  C  C   . TYR B  1  289 ? 2.310   37.231  7.675   1.00 37.26  ? 317  TYR B C   1 
ATOM   7635  O  O   . TYR B  1  289 ? 1.319   37.175  6.946   1.00 37.04  ? 317  TYR B O   1 
ATOM   7636  C  CB  . TYR B  1  289 ? 3.334   38.994  6.235   1.00 37.44  ? 317  TYR B CB  1 
ATOM   7637  C  CG  . TYR B  1  289 ? 4.519   39.520  5.426   1.00 38.14  ? 317  TYR B CG  1 
ATOM   7638  C  CD1 . TYR B  1  289 ? 5.693   39.957  6.053   1.00 38.40  ? 317  TYR B CD1 1 
ATOM   7639  C  CD2 . TYR B  1  289 ? 4.451   39.602  4.040   1.00 37.83  ? 317  TYR B CD2 1 
ATOM   7640  C  CE1 . TYR B  1  289 ? 6.775   40.432  5.319   1.00 38.77  ? 317  TYR B CE1 1 
ATOM   7641  C  CE2 . TYR B  1  289 ? 5.525   40.083  3.292   1.00 39.16  ? 317  TYR B CE2 1 
ATOM   7642  C  CZ  . TYR B  1  289 ? 6.684   40.504  3.935   1.00 39.56  ? 317  TYR B CZ  1 
ATOM   7643  O  OH  . TYR B  1  289 ? 7.745   40.996  3.193   1.00 39.07  ? 317  TYR B OH  1 
ATOM   7644  N  N   . PRO B  1  290 ? 2.281   36.869  8.976   1.00 37.47  ? 318  PRO B N   1 
ATOM   7645  C  CA  . PRO B  1  290 ? 1.158   36.123  9.552   1.00 37.45  ? 318  PRO B CA  1 
ATOM   7646  C  C   . PRO B  1  290 ? -0.154  36.904  9.518   1.00 37.75  ? 318  PRO B C   1 
ATOM   7647  O  O   . PRO B  1  290 ? -1.229  36.295  9.533   1.00 38.07  ? 318  PRO B O   1 
ATOM   7648  C  CB  . PRO B  1  290 ? 1.595   35.884  11.001  1.00 37.44  ? 318  PRO B CB  1 
ATOM   7649  C  CG  . PRO B  1  290 ? 3.061   36.179  11.032  1.00 37.13  ? 318  PRO B CG  1 
ATOM   7650  C  CD  . PRO B  1  290 ? 3.293   37.202  9.995   1.00 37.19  ? 318  PRO B CD  1 
ATOM   7651  N  N   . GLN B  1  291 ? -0.072  38.233  9.470   1.00 37.88  ? 319  GLN B N   1 
ATOM   7652  C  CA  . GLN B  1  291 ? -1.268  39.070  9.326   1.00 38.03  ? 319  GLN B CA  1 
ATOM   7653  C  C   . GLN B  1  291 ? -1.228  39.960  8.078   1.00 37.85  ? 319  GLN B C   1 
ATOM   7654  O  O   . GLN B  1  291 ? -1.840  41.019  8.046   1.00 38.36  ? 319  GLN B O   1 
ATOM   7655  C  CB  . GLN B  1  291 ? -1.517  39.891  10.599  1.00 37.77  ? 319  GLN B CB  1 
ATOM   7656  C  CG  . GLN B  1  291 ? -2.002  39.035  11.760  1.00 38.56  ? 319  GLN B CG  1 
ATOM   7657  C  CD  . GLN B  1  291 ? -2.145  39.784  13.074  1.00 38.78  ? 319  GLN B CD  1 
ATOM   7658  O  OE1 . GLN B  1  291 ? -1.405  40.726  13.357  1.00 40.85  ? 319  GLN B OE1 1 
ATOM   7659  N  NE2 . GLN B  1  291 ? -3.083  39.339  13.906  1.00 39.80  ? 319  GLN B NE2 1 
ATOM   7660  N  N   . GLY B  1  292 ? -0.520  39.522  7.045   1.00 37.70  ? 320  GLY B N   1 
ATOM   7661  C  CA  . GLY B  1  292 ? -0.375  40.327  5.830   1.00 37.44  ? 320  GLY B CA  1 
ATOM   7662  C  C   . GLY B  1  292 ? 0.824   41.258  5.885   1.00 37.28  ? 320  GLY B C   1 
ATOM   7663  O  O   . GLY B  1  292 ? 1.392   41.487  6.960   1.00 37.18  ? 320  GLY B O   1 
ATOM   7664  N  N   . PRO B  1  293 ? 1.237   41.792  4.721   1.00 37.23  ? 321  PRO B N   1 
ATOM   7665  C  CA  . PRO B  1  293 ? 2.371   42.716  4.694   1.00 36.83  ? 321  PRO B CA  1 
ATOM   7666  C  C   . PRO B  1  293 ? 2.088   44.006  5.470   1.00 36.47  ? 321  PRO B C   1 
ATOM   7667  O  O   . PRO B  1  293 ? 0.947   44.473  5.502   1.00 35.97  ? 321  PRO B O   1 
ATOM   7668  C  CB  . PRO B  1  293 ? 2.566   42.995  3.192   1.00 36.83  ? 321  PRO B CB  1 
ATOM   7669  C  CG  . PRO B  1  293 ? 1.881   41.867  2.491   1.00 36.90  ? 321  PRO B CG  1 
ATOM   7670  C  CD  . PRO B  1  293 ? 0.699   41.555  3.368   1.00 37.43  ? 321  PRO B CD  1 
ATOM   7671  N  N   . ARG B  1  294 ? 3.130   44.558  6.094   1.00 36.25  ? 322  ARG B N   1 
ATOM   7672  C  CA  . ARG B  1  294 ? 3.020   45.772  6.914   1.00 36.00  ? 322  ARG B CA  1 
ATOM   7673  C  C   . ARG B  1  294 ? 3.424   47.069  6.170   1.00 35.49  ? 322  ARG B C   1 
ATOM   7674  O  O   . ARG B  1  294 ? 3.676   48.110  6.800   1.00 35.23  ? 322  ARG B O   1 
ATOM   7675  C  CB  . ARG B  1  294 ? 3.858   45.602  8.188   1.00 36.19  ? 322  ARG B CB  1 
ATOM   7676  C  CG  . ARG B  1  294 ? 3.153   44.821  9.280   1.00 36.81  ? 322  ARG B CG  1 
ATOM   7677  C  CD  . ARG B  1  294 ? 4.059   43.804  9.979   1.00 36.39  ? 322  ARG B CD  1 
ATOM   7678  N  NE  . ARG B  1  294 ? 5.395   44.303  10.305  1.00 34.81  ? 322  ARG B NE  1 
ATOM   7679  C  CZ  . ARG B  1  294 ? 5.859   44.495  11.537  1.00 34.14  ? 322  ARG B CZ  1 
ATOM   7680  N  NH1 . ARG B  1  294 ? 5.106   44.256  12.599  1.00 32.28  ? 322  ARG B NH1 1 
ATOM   7681  N  NH2 . ARG B  1  294 ? 7.092   44.937  11.703  1.00 34.93  ? 322  ARG B NH2 1 
ATOM   7682  N  N   . PHE B  1  295 ? 3.475   46.998  4.841   1.00 34.74  ? 323  PHE B N   1 
ATOM   7683  C  CA  . PHE B  1  295 ? 3.842   48.135  4.008   1.00 34.56  ? 323  PHE B CA  1 
ATOM   7684  C  C   . PHE B  1  295 ? 3.080   48.087  2.681   1.00 34.86  ? 323  PHE B C   1 
ATOM   7685  O  O   . PHE B  1  295 ? 2.662   47.016  2.244   1.00 34.30  ? 323  PHE B O   1 
ATOM   7686  C  CB  . PHE B  1  295 ? 5.352   48.123  3.726   1.00 34.37  ? 323  PHE B CB  1 
ATOM   7687  C  CG  . PHE B  1  295 ? 5.787   46.990  2.837   1.00 33.72  ? 323  PHE B CG  1 
ATOM   7688  C  CD1 . PHE B  1  295 ? 5.830   47.153  1.448   1.00 33.08  ? 323  PHE B CD1 1 
ATOM   7689  C  CD2 . PHE B  1  295 ? 6.117   45.744  3.384   1.00 33.53  ? 323  PHE B CD2 1 
ATOM   7690  C  CE1 . PHE B  1  295 ? 6.204   46.079  0.611   1.00 34.21  ? 323  PHE B CE1 1 
ATOM   7691  C  CE2 . PHE B  1  295 ? 6.495   44.664  2.565   1.00 33.98  ? 323  PHE B CE2 1 
ATOM   7692  C  CZ  . PHE B  1  295 ? 6.543   44.833  1.172   1.00 33.91  ? 323  PHE B CZ  1 
ATOM   7693  N  N   . SER B  1  296 ? 2.937   49.250  2.039   1.00 35.39  ? 324  SER B N   1 
ATOM   7694  C  CA  . SER B  1  296 ? 2.332   49.355  0.716   1.00 36.15  ? 324  SER B CA  1 
ATOM   7695  C  C   . SER B  1  296 ? 3.289   49.940  -0.314  1.00 36.80  ? 324  SER B C   1 
ATOM   7696  O  O   . SER B  1  296 ? 4.178   50.738  0.015   1.00 36.88  ? 324  SER B O   1 
ATOM   7697  C  CB  . SER B  1  296 ? 1.063   50.206  0.760   1.00 36.27  ? 324  SER B CB  1 
ATOM   7698  O  OG  . SER B  1  296 ? 1.368   51.575  0.986   1.00 37.21  ? 324  SER B OG  1 
ATOM   7699  N  N   . VAL B  1  297 ? 3.089   49.529  -1.563  1.00 37.47  ? 325  VAL B N   1 
ATOM   7700  C  CA  . VAL B  1  297 ? 3.791   50.074  -2.710  1.00 38.30  ? 325  VAL B CA  1 
ATOM   7701  C  C   . VAL B  1  297 ? 2.725   50.571  -3.662  1.00 39.18  ? 325  VAL B C   1 
ATOM   7702  O  O   . VAL B  1  297 ? 1.890   49.804  -4.125  1.00 39.65  ? 325  VAL B O   1 
ATOM   7703  C  CB  . VAL B  1  297 ? 4.631   48.996  -3.426  1.00 38.29  ? 325  VAL B CB  1 
ATOM   7704  C  CG1 . VAL B  1  297 ? 5.341   49.584  -4.641  1.00 38.14  ? 325  VAL B CG1 1 
ATOM   7705  C  CG2 . VAL B  1  297 ? 5.638   48.379  -2.471  1.00 38.57  ? 325  VAL B CG2 1 
ATOM   7706  N  N   . GLN B  1  298 ? 2.737   51.862  -3.949  1.00 40.17  ? 326  GLN B N   1 
ATOM   7707  C  CA  . GLN B  1  298 ? 1.726   52.444  -4.814  1.00 41.12  ? 326  GLN B CA  1 
ATOM   7708  C  C   . GLN B  1  298 ? 2.426   53.367  -5.791  1.00 40.80  ? 326  GLN B C   1 
ATOM   7709  O  O   . GLN B  1  298 ? 2.876   54.448  -5.409  1.00 41.14  ? 326  GLN B O   1 
ATOM   7710  C  CB  . GLN B  1  298 ? 0.700   53.205  -3.977  1.00 40.92  ? 326  GLN B CB  1 
ATOM   7711  C  CG  . GLN B  1  298 ? -0.528  53.681  -4.753  1.00 42.67  ? 326  GLN B CG  1 
ATOM   7712  C  CD  . GLN B  1  298 ? -1.559  54.336  -3.848  1.00 43.26  ? 326  GLN B CD  1 
ATOM   7713  O  OE1 . GLN B  1  298 ? -1.345  54.485  -2.633  1.00 45.54  ? 326  GLN B OE1 1 
ATOM   7714  N  NE2 . GLN B  1  298 ? -2.691  54.735  -4.433  1.00 46.19  ? 326  GLN B NE2 1 
ATOM   7715  N  N   . GLY B  1  299 ? 2.528   52.932  -7.047  1.00 40.60  ? 327  GLY B N   1 
ATOM   7716  C  CA  . GLY B  1  299 ? 3.329   53.639  -8.044  1.00 40.32  ? 327  GLY B CA  1 
ATOM   7717  C  C   . GLY B  1  299 ? 4.802   53.451  -7.733  1.00 40.19  ? 327  GLY B C   1 
ATOM   7718  O  O   . GLY B  1  299 ? 5.311   52.331  -7.772  1.00 40.23  ? 327  GLY B O   1 
ATOM   7719  N  N   . SER B  1  300 ? 5.481   54.538  -7.394  1.00 39.92  ? 328  SER B N   1 
ATOM   7720  C  CA  . SER B  1  300 ? 6.881   54.455  -6.987  1.00 40.08  ? 328  SER B CA  1 
ATOM   7721  C  C   . SER B  1  300 ? 7.094   54.807  -5.517  1.00 39.95  ? 328  SER B C   1 
ATOM   7722  O  O   . SER B  1  300 ? 8.220   55.042  -5.090  1.00 40.03  ? 328  SER B O   1 
ATOM   7723  C  CB  . SER B  1  300 ? 7.755   55.353  -7.869  1.00 40.14  ? 328  SER B CB  1 
ATOM   7724  O  OG  . SER B  1  300 ? 7.853   54.832  -9.180  1.00 40.46  ? 328  SER B OG  1 
ATOM   7725  N  N   . ARG B  1  301 ? 6.016   54.850  -4.747  1.00 40.10  ? 329  ARG B N   1 
ATOM   7726  C  CA  . ARG B  1  301 ? 6.119   55.221  -3.339  1.00 40.24  ? 329  ARG B CA  1 
ATOM   7727  C  C   . ARG B  1  301 ? 5.914   54.034  -2.409  1.00 39.48  ? 329  ARG B C   1 
ATOM   7728  O  O   . ARG B  1  301 ? 5.022   53.207  -2.620  1.00 39.39  ? 329  ARG B O   1 
ATOM   7729  C  CB  . ARG B  1  301 ? 5.159   56.363  -2.994  1.00 40.46  ? 329  ARG B CB  1 
ATOM   7730  C  CG  . ARG B  1  301 ? 5.511   57.693  -3.678  1.00 44.09  ? 329  ARG B CG  1 
ATOM   7731  C  CD  . ARG B  1  301 ? 5.059   58.924  -2.863  1.00 48.57  ? 329  ARG B CD  1 
ATOM   7732  N  NE  . ARG B  1  301 ? 5.854   59.089  -1.637  1.00 52.60  ? 329  ARG B NE  1 
ATOM   7733  C  CZ  . ARG B  1  301 ? 6.860   59.956  -1.488  1.00 54.41  ? 329  ARG B CZ  1 
ATOM   7734  N  NH1 . ARG B  1  301 ? 7.213   60.766  -2.485  1.00 54.67  ? 329  ARG B NH1 1 
ATOM   7735  N  NH2 . ARG B  1  301 ? 7.512   60.024  -0.329  1.00 54.80  ? 329  ARG B NH2 1 
ATOM   7736  N  N   . VAL B  1  302 ? 6.760   53.955  -1.388  1.00 38.68  ? 330  VAL B N   1 
ATOM   7737  C  CA  . VAL B  1  302 ? 6.653   52.918  -0.370  1.00 37.93  ? 330  VAL B CA  1 
ATOM   7738  C  C   . VAL B  1  302 ? 6.259   53.563  0.940   1.00 37.46  ? 330  VAL B C   1 
ATOM   7739  O  O   . VAL B  1  302 ? 6.790   54.608  1.314   1.00 37.61  ? 330  VAL B O   1 
ATOM   7740  C  CB  . VAL B  1  302 ? 7.986   52.176  -0.168  1.00 37.93  ? 330  VAL B CB  1 
ATOM   7741  C  CG1 . VAL B  1  302 ? 7.860   51.126  0.923   1.00 37.63  ? 330  VAL B CG1 1 
ATOM   7742  C  CG2 . VAL B  1  302 ? 8.445   51.538  -1.466  1.00 37.49  ? 330  VAL B CG2 1 
ATOM   7743  N  N   . ALA B  1  303 ? 5.332   52.930  1.643   1.00 36.70  ? 331  ALA B N   1 
ATOM   7744  C  CA  . ALA B  1  303 ? 4.901   53.429  2.939   1.00 35.81  ? 331  ALA B CA  1 
ATOM   7745  C  C   . ALA B  1  303 ? 4.727   52.274  3.914   1.00 35.31  ? 331  ALA B C   1 
ATOM   7746  O  O   . ALA B  1  303 ? 4.072   51.276  3.599   1.00 34.96  ? 331  ALA B O   1 
ATOM   7747  C  CB  . ALA B  1  303 ? 3.605   54.246  2.806   1.00 35.56  ? 331  ALA B CB  1 
ATOM   7748  N  N   . SER B  1  304 ? 5.353   52.409  5.080   1.00 34.71  ? 332  SER B N   1 
ATOM   7749  C  CA  . SER B  1  304 ? 5.133   51.513  6.199   1.00 34.72  ? 332  SER B CA  1 
ATOM   7750  C  C   . SER B  1  304 ? 4.745   52.404  7.362   1.00 34.90  ? 332  SER B C   1 
ATOM   7751  O  O   . SER B  1  304 ? 4.645   53.621  7.196   1.00 35.73  ? 332  SER B O   1 
ATOM   7752  C  CB  . SER B  1  304 ? 6.402   50.723  6.519   1.00 34.60  ? 332  SER B CB  1 
ATOM   7753  O  OG  . SER B  1  304 ? 7.399   51.559  7.070   1.00 35.09  ? 332  SER B OG  1 
ATOM   7754  N  N   . SER B  1  305 ? 4.536   51.834  8.543   1.00 34.49  ? 333  SER B N   1 
ATOM   7755  C  CA  . SER B  1  305 ? 4.230   52.676  9.701   1.00 33.90  ? 333  SER B CA  1 
ATOM   7756  C  C   . SER B  1  305 ? 5.391   53.631  10.043  1.00 33.21  ? 333  SER B C   1 
ATOM   7757  O  O   . SER B  1  305 ? 5.166   54.659  10.671  1.00 33.34  ? 333  SER B O   1 
ATOM   7758  C  CB  . SER B  1  305 ? 3.889   51.818  10.917  1.00 33.96  ? 333  SER B CB  1 
ATOM   7759  O  OG  . SER B  1  305 ? 5.024   51.060  11.306  1.00 33.96  ? 333  SER B OG  1 
ATOM   7760  N  N   . LEU B  1  306 ? 6.616   53.290  9.636   1.00 32.04  ? 334  LEU B N   1 
ATOM   7761  C  CA  . LEU B  1  306 ? 7.795   54.096  9.989   1.00 31.01  ? 334  LEU B CA  1 
ATOM   7762  C  C   . LEU B  1  306 ? 8.426   54.873  8.833   1.00 30.20  ? 334  LEU B C   1 
ATOM   7763  O  O   . LEU B  1  306 ? 9.021   55.921  9.044   1.00 29.80  ? 334  LEU B O   1 
ATOM   7764  C  CB  . LEU B  1  306 ? 8.882   53.232  10.632  1.00 30.64  ? 334  LEU B CB  1 
ATOM   7765  C  CG  . LEU B  1  306 ? 8.687   52.533  11.978  1.00 31.12  ? 334  LEU B CG  1 
ATOM   7766  C  CD1 . LEU B  1  306 ? 9.986   51.828  12.338  1.00 30.67  ? 334  LEU B CD1 1 
ATOM   7767  C  CD2 . LEU B  1  306 ? 8.246   53.460  13.117  1.00 29.08  ? 334  LEU B CD2 1 
ATOM   7768  N  N   . TRP B  1  307 ? 8.312   54.354  7.618   1.00 29.51  ? 335  TRP B N   1 
ATOM   7769  C  CA  . TRP B  1  307 ? 9.091   54.891  6.510   1.00 28.75  ? 335  TRP B CA  1 
ATOM   7770  C  C   . TRP B  1  307 ? 8.264   55.279  5.289   1.00 28.89  ? 335  TRP B C   1 
ATOM   7771  O  O   . TRP B  1  307 ? 7.286   54.606  4.930   1.00 29.38  ? 335  TRP B O   1 
ATOM   7772  C  CB  . TRP B  1  307 ? 10.146  53.885  6.079   1.00 27.89  ? 335  TRP B CB  1 
ATOM   7773  C  CG  . TRP B  1  307 ? 11.276  53.690  7.006   1.00 26.94  ? 335  TRP B CG  1 
ATOM   7774  C  CD1 . TRP B  1  307 ? 11.501  52.606  7.801   1.00 26.71  ? 335  TRP B CD1 1 
ATOM   7775  C  CD2 . TRP B  1  307 ? 12.396  54.566  7.197   1.00 27.66  ? 335  TRP B CD2 1 
ATOM   7776  N  NE1 . TRP B  1  307 ? 12.691  52.755  8.491   1.00 25.75  ? 335  TRP B NE1 1 
ATOM   7777  C  CE2 . TRP B  1  307 ? 13.259  53.948  8.135   1.00 25.98  ? 335  TRP B CE2 1 
ATOM   7778  C  CE3 . TRP B  1  307 ? 12.755  55.816  6.673   1.00 26.95  ? 335  TRP B CE3 1 
ATOM   7779  C  CZ2 . TRP B  1  307 ? 14.444  54.544  8.567   1.00 26.30  ? 335  TRP B CZ2 1 
ATOM   7780  C  CZ3 . TRP B  1  307 ? 13.956  56.398  7.100   1.00 26.58  ? 335  TRP B CZ3 1 
ATOM   7781  C  CH2 . TRP B  1  307 ? 14.775  55.764  8.034   1.00 26.16  ? 335  TRP B CH2 1 
ATOM   7782  N  N   . THR B  1  308 ? 8.687   56.361  4.644   1.00 28.51  ? 336  THR B N   1 
ATOM   7783  C  CA  . THR B  1  308 ? 8.074   56.832  3.413   1.00 28.16  ? 336  THR B CA  1 
ATOM   7784  C  C   . THR B  1  308 ? 9.182   57.239  2.477   1.00 27.91  ? 336  THR B C   1 
ATOM   7785  O  O   . THR B  1  308 ? 10.161  57.869  2.893   1.00 28.17  ? 336  THR B O   1 
ATOM   7786  C  CB  . THR B  1  308 ? 7.125   58.014  3.691   1.00 28.34  ? 336  THR B CB  1 
ATOM   7787  O  OG1 . THR B  1  308 ? 5.801   57.508  3.852   1.00 28.69  ? 336  THR B OG1 1 
ATOM   7788  C  CG2 . THR B  1  308 ? 7.114   59.015  2.555   1.00 28.97  ? 336  THR B CG2 1 
ATOM   7789  N  N   . PHE B  1  309 ? 9.050   56.853  1.217   1.00 27.57  ? 337  PHE B N   1 
ATOM   7790  C  CA  . PHE B  1  309 ? 10.037  57.225  0.216   1.00 27.57  ? 337  PHE B CA  1 
ATOM   7791  C  C   . PHE B  1  309 ? 9.548   56.841  -1.160  1.00 28.15  ? 337  PHE B C   1 
ATOM   7792  O  O   . PHE B  1  309 ? 8.530   56.152  -1.307  1.00 28.85  ? 337  PHE B O   1 
ATOM   7793  C  CB  . PHE B  1  309 ? 11.406  56.574  0.501   1.00 27.24  ? 337  PHE B CB  1 
ATOM   7794  C  CG  . PHE B  1  309 ? 11.377  55.080  0.491   1.00 26.18  ? 337  PHE B CG  1 
ATOM   7795  C  CD1 . PHE B  1  309 ? 11.595  54.379  -0.680  1.00 25.89  ? 337  PHE B CD1 1 
ATOM   7796  C  CD2 . PHE B  1  309 ? 11.114  54.372  1.649   1.00 25.94  ? 337  PHE B CD2 1 
ATOM   7797  C  CE1 . PHE B  1  309 ? 11.555  52.988  -0.691  1.00 27.33  ? 337  PHE B CE1 1 
ATOM   7798  C  CE2 . PHE B  1  309 ? 11.076  52.973  1.643   1.00 26.98  ? 337  PHE B CE2 1 
ATOM   7799  C  CZ  . PHE B  1  309 ? 11.309  52.287  0.479   1.00 26.54  ? 337  PHE B CZ  1 
ATOM   7800  N  N   . SER B  1  310 ? 10.314  57.275  -2.151  1.00 28.40  ? 338  SER B N   1 
ATOM   7801  C  CA  . SER B  1  310 ? 10.036  57.102  -3.551  1.00 28.54  ? 338  SER B CA  1 
ATOM   7802  C  C   . SER B  1  310 ? 11.278  56.461  -4.142  1.00 28.32  ? 338  SER B C   1 
ATOM   7803  O  O   . SER B  1  310 ? 12.399  56.914  -3.882  1.00 28.00  ? 338  SER B O   1 
ATOM   7804  C  CB  . SER B  1  310 ? 9.831   58.484  -4.165  1.00 28.81  ? 338  SER B CB  1 
ATOM   7805  O  OG  . SER B  1  310 ? 9.061   58.437  -5.350  1.00 31.72  ? 338  SER B OG  1 
ATOM   7806  N  N   . PHE B  1  311 ? 11.087  55.393  -4.913  1.00 27.98  ? 339  PHE B N   1 
ATOM   7807  C  CA  . PHE B  1  311 ? 12.206  54.667  -5.509  1.00 27.88  ? 339  PHE B CA  1 
ATOM   7808  C  C   . PHE B  1  311 ? 12.126  54.707  -7.043  1.00 28.01  ? 339  PHE B C   1 
ATOM   7809  O  O   . PHE B  1  311 ? 11.116  55.103  -7.609  1.00 28.40  ? 339  PHE B O   1 
ATOM   7810  C  CB  . PHE B  1  311 ? 12.257  53.226  -4.992  1.00 27.41  ? 339  PHE B CB  1 
ATOM   7811  C  CG  . PHE B  1  311 ? 11.080  52.395  -5.422  1.00 27.73  ? 339  PHE B CG  1 
ATOM   7812  C  CD1 . PHE B  1  311 ? 11.151  51.608  -6.570  1.00 27.35  ? 339  PHE B CD1 1 
ATOM   7813  C  CD2 . PHE B  1  311 ? 9.888   52.419  -4.691  1.00 26.14  ? 339  PHE B CD2 1 
ATOM   7814  C  CE1 . PHE B  1  311 ? 10.060  50.857  -6.981  1.00 28.21  ? 339  PHE B CE1 1 
ATOM   7815  C  CE2 . PHE B  1  311 ? 8.801   51.669  -5.084  1.00 25.96  ? 339  PHE B CE2 1 
ATOM   7816  C  CZ  . PHE B  1  311 ? 8.878   50.881  -6.230  1.00 27.35  ? 339  PHE B CZ  1 
ATOM   7817  N  N   . GLY B  1  312 ? 13.200  54.301  -7.702  1.00 28.07  ? 340  GLY B N   1 
ATOM   7818  C  CA  . GLY B  1  312 ? 13.306  54.391  -9.144  1.00 28.25  ? 340  GLY B CA  1 
ATOM   7819  C  C   . GLY B  1  312 ? 14.695  53.995  -9.612  1.00 28.54  ? 340  GLY B C   1 
ATOM   7820  O  O   . GLY B  1  312 ? 15.479  53.419  -8.855  1.00 28.25  ? 340  GLY B O   1 
ATOM   7821  N  N   . LEU B  1  313 ? 15.005  54.323  -10.864 1.00 28.82  ? 341  LEU B N   1 
ATOM   7822  C  CA  . LEU B  1  313 ? 16.138  53.725  -11.534 1.00 29.20  ? 341  LEU B CA  1 
ATOM   7823  C  C   . LEU B  1  313 ? 16.606  54.616  -12.657 1.00 29.38  ? 341  LEU B C   1 
ATOM   7824  O  O   . LEU B  1  313 ? 15.939  54.747  -13.667 1.00 29.61  ? 341  LEU B O   1 
ATOM   7825  C  CB  . LEU B  1  313 ? 15.731  52.352  -12.069 1.00 28.63  ? 341  LEU B CB  1 
ATOM   7826  C  CG  . LEU B  1  313 ? 16.748  51.234  -12.271 1.00 29.74  ? 341  LEU B CG  1 
ATOM   7827  C  CD1 . LEU B  1  313 ? 17.649  51.044  -11.086 1.00 30.81  ? 341  LEU B CD1 1 
ATOM   7828  C  CD2 . LEU B  1  313 ? 16.037  49.921  -12.588 1.00 29.56  ? 341  LEU B CD2 1 
ATOM   7829  N  N   . GLY B  1  314 ? 17.757  55.245  -12.472 1.00 29.94  ? 342  GLY B N   1 
ATOM   7830  C  CA  . GLY B  1  314 ? 18.372  55.994  -13.554 1.00 30.49  ? 342  GLY B CA  1 
ATOM   7831  C  C   . GLY B  1  314 ? 18.846  54.991  -14.587 1.00 30.88  ? 342  GLY B C   1 
ATOM   7832  O  O   . GLY B  1  314 ? 19.407  53.952  -14.224 1.00 31.49  ? 342  GLY B O   1 
ATOM   7833  N  N   . ALA B  1  315 ? 18.609  55.280  -15.866 1.00 30.77  ? 343  ALA B N   1 
ATOM   7834  C  CA  . ALA B  1  315 ? 18.964  54.346  -16.936 1.00 30.70  ? 343  ALA B CA  1 
ATOM   7835  C  C   . ALA B  1  315 ? 20.437  53.980  -16.887 1.00 30.89  ? 343  ALA B C   1 
ATOM   7836  O  O   . ALA B  1  315 ? 20.800  52.839  -17.119 1.00 31.32  ? 343  ALA B O   1 
ATOM   7837  C  CB  . ALA B  1  315 ? 18.602  54.916  -18.297 1.00 30.51  ? 343  ALA B CB  1 
ATOM   7838  N  N   . PHE B  1  316 ? 21.281  54.942  -16.543 1.00 30.92  ? 344  PHE B N   1 
ATOM   7839  C  CA  . PHE B  1  316 ? 22.703  54.728  -16.601 1.00 31.02  ? 344  PHE B CA  1 
ATOM   7840  C  C   . PHE B  1  316 ? 23.334  54.648  -15.231 1.00 31.53  ? 344  PHE B C   1 
ATOM   7841  O  O   . PHE B  1  316 ? 24.254  53.860  -15.003 1.00 31.74  ? 344  PHE B O   1 
ATOM   7842  C  CB  . PHE B  1  316 ? 23.337  55.813  -17.455 1.00 31.06  ? 344  PHE B CB  1 
ATOM   7843  C  CG  . PHE B  1  316 ? 22.747  55.890  -18.822 1.00 31.23  ? 344  PHE B CG  1 
ATOM   7844  C  CD1 . PHE B  1  316 ? 21.956  56.974  -19.192 1.00 31.50  ? 344  PHE B CD1 1 
ATOM   7845  C  CD2 . PHE B  1  316 ? 22.927  54.844  -19.722 1.00 30.66  ? 344  PHE B CD2 1 
ATOM   7846  C  CE1 . PHE B  1  316 ? 21.383  57.035  -20.452 1.00 30.61  ? 344  PHE B CE1 1 
ATOM   7847  C  CE2 . PHE B  1  316 ? 22.357  54.893  -20.985 1.00 31.48  ? 344  PHE B CE2 1 
ATOM   7848  C  CZ  . PHE B  1  316 ? 21.582  55.993  -21.352 1.00 31.50  ? 344  PHE B CZ  1 
ATOM   7849  N  N   . SER B  1  317 ? 22.826  55.450  -14.307 1.00 32.01  ? 345  SER B N   1 
ATOM   7850  C  CA  . SER B  1  317 ? 23.428  55.531  -12.987 1.00 31.97  ? 345  SER B CA  1 
ATOM   7851  C  C   . SER B  1  317 ? 22.766  54.585  -11.979 1.00 31.60  ? 345  SER B C   1 
ATOM   7852  O  O   . SER B  1  317 ? 23.252  54.453  -10.866 1.00 32.09  ? 345  SER B O   1 
ATOM   7853  C  CB  . SER B  1  317 ? 23.388  56.971  -12.488 1.00 31.74  ? 345  SER B CB  1 
ATOM   7854  O  OG  . SER B  1  317 ? 22.050  57.348  -12.245 1.00 33.15  ? 345  SER B OG  1 
ATOM   7855  N  N   . GLY B  1  318 ? 21.667  53.936  -12.354 1.00 31.08  ? 346  GLY B N   1 
ATOM   7856  C  CA  . GLY B  1  318 ? 21.072  52.895  -11.506 1.00 31.11  ? 346  GLY B CA  1 
ATOM   7857  C  C   . GLY B  1  318 ? 20.150  53.297  -10.350 1.00 31.37  ? 346  GLY B C   1 
ATOM   7858  O  O   . GLY B  1  318 ? 19.502  54.351  -10.390 1.00 31.47  ? 346  GLY B O   1 
ATOM   7859  N  N   . PRO B  1  319 ? 20.052  52.426  -9.325  1.00 31.27  ? 347  PRO B N   1 
ATOM   7860  C  CA  . PRO B  1  319 ? 19.072  52.552  -8.233  1.00 31.04  ? 347  PRO B CA  1 
ATOM   7861  C  C   . PRO B  1  319 ? 19.118  53.863  -7.455  1.00 31.01  ? 347  PRO B C   1 
ATOM   7862  O  O   . PRO B  1  319 ? 20.200  54.369  -7.117  1.00 31.06  ? 347  PRO B O   1 
ATOM   7863  C  CB  . PRO B  1  319 ? 19.400  51.352  -7.325  1.00 31.10  ? 347  PRO B CB  1 
ATOM   7864  C  CG  . PRO B  1  319 ? 20.004  50.343  -8.286  1.00 31.14  ? 347  PRO B CG  1 
ATOM   7865  C  CD  . PRO B  1  319 ? 20.858  51.194  -9.186  1.00 31.09  ? 347  PRO B CD  1 
ATOM   7866  N  N   . ARG B  1  320 ? 17.932  54.401  -7.176  1.00 30.30  ? 348  ARG B N   1 
ATOM   7867  C  CA  . ARG B  1  320 ? 17.816  55.662  -6.472  1.00 29.80  ? 348  ARG B CA  1 
ATOM   7868  C  C   . ARG B  1  320 ? 16.547  55.770  -5.634  1.00 30.02  ? 348  ARG B C   1 
ATOM   7869  O  O   . ARG B  1  320 ? 15.506  55.206  -5.962  1.00 29.88  ? 348  ARG B O   1 
ATOM   7870  C  CB  . ARG B  1  320 ? 17.879  56.818  -7.457  1.00 29.68  ? 348  ARG B CB  1 
ATOM   7871  C  CG  . ARG B  1  320 ? 16.759  56.828  -8.451  1.00 28.75  ? 348  ARG B CG  1 
ATOM   7872  C  CD  . ARG B  1  320 ? 17.057  57.795  -9.543  1.00 28.05  ? 348  ARG B CD  1 
ATOM   7873  N  NE  . ARG B  1  320 ? 15.953  57.850  -10.492 1.00 27.16  ? 348  ARG B NE  1 
ATOM   7874  C  CZ  . ARG B  1  320 ? 16.075  58.321  -11.723 1.00 27.24  ? 348  ARG B CZ  1 
ATOM   7875  N  NH1 . ARG B  1  320 ? 17.258  58.775  -12.137 1.00 26.03  ? 348  ARG B NH1 1 
ATOM   7876  N  NH2 . ARG B  1  320 ? 15.022  58.328  -12.537 1.00 26.40  ? 348  ARG B NH2 1 
ATOM   7877  N  N   . ILE B  1  321 ? 16.652  56.514  -4.547  1.00 30.41  ? 349  ILE B N   1 
ATOM   7878  C  CA  . ILE B  1  321 ? 15.529  56.771  -3.676  1.00 30.67  ? 349  ILE B CA  1 
ATOM   7879  C  C   . ILE B  1  321 ? 15.440  58.264  -3.385  1.00 30.57  ? 349  ILE B C   1 
ATOM   7880  O  O   . ILE B  1  321 ? 16.466  58.937  -3.293  1.00 30.54  ? 349  ILE B O   1 
ATOM   7881  C  CB  . ILE B  1  321 ? 15.651  55.940  -2.396  1.00 30.74  ? 349  ILE B CB  1 
ATOM   7882  C  CG1 . ILE B  1  321 ? 15.283  54.489  -2.717  1.00 30.91  ? 349  ILE B CG1 1 
ATOM   7883  C  CG2 . ILE B  1  321 ? 14.724  56.466  -1.331  1.00 31.30  ? 349  ILE B CG2 1 
ATOM   7884  C  CD1 . ILE B  1  321 ? 15.568  53.518  -1.604  1.00 33.41  ? 349  ILE B CD1 1 
ATOM   7885  N  N   . PHE B  1  322 ? 14.213  58.774  -3.270  1.00 30.71  ? 350  PHE B N   1 
ATOM   7886  C  CA  . PHE B  1  322 ? 13.974  60.196  -3.007  1.00 30.51  ? 350  PHE B CA  1 
ATOM   7887  C  C   . PHE B  1  322 ? 13.005  60.423  -1.865  1.00 30.76  ? 350  PHE B C   1 
ATOM   7888  O  O   . PHE B  1  322 ? 12.174  59.553  -1.565  1.00 30.47  ? 350  PHE B O   1 
ATOM   7889  C  CB  . PHE B  1  322 ? 13.402  60.878  -4.246  1.00 30.36  ? 350  PHE B CB  1 
ATOM   7890  C  CG  . PHE B  1  322 ? 14.325  60.887  -5.410  1.00 30.12  ? 350  PHE B CG  1 
ATOM   7891  C  CD1 . PHE B  1  322 ? 14.264  59.881  -6.359  1.00 29.46  ? 350  PHE B CD1 1 
ATOM   7892  C  CD2 . PHE B  1  322 ? 15.250  61.916  -5.568  1.00 29.73  ? 350  PHE B CD2 1 
ATOM   7893  C  CE1 . PHE B  1  322 ? 15.115  59.895  -7.436  1.00 30.68  ? 350  PHE B CE1 1 
ATOM   7894  C  CE2 . PHE B  1  322 ? 16.102  61.945  -6.647  1.00 29.59  ? 350  PHE B CE2 1 
ATOM   7895  C  CZ  . PHE B  1  322 ? 16.050  60.929  -7.578  1.00 31.25  ? 350  PHE B CZ  1 
ATOM   7896  N  N   . ASP B  1  323 ? 13.106  61.603  -1.244  1.00 31.03  ? 351  ASP B N   1 
ATOM   7897  C  CA  . ASP B  1  323 ? 12.105  62.071  -0.271  1.00 31.22  ? 351  ASP B CA  1 
ATOM   7898  C  C   . ASP B  1  323 ? 11.879  61.064  0.861   1.00 31.00  ? 351  ASP B C   1 
ATOM   7899  O  O   . ASP B  1  323 ? 10.751  60.691  1.171   1.00 30.86  ? 351  ASP B O   1 
ATOM   7900  C  CB  . ASP B  1  323 ? 10.799  62.395  -1.000  1.00 31.45  ? 351  ASP B CB  1 
ATOM   7901  C  CG  . ASP B  1  323 ? 9.783   63.112  -0.129  1.00 32.20  ? 351  ASP B CG  1 
ATOM   7902  O  OD1 . ASP B  1  323 ? 8.591   63.006  -0.449  1.00 33.48  ? 351  ASP B OD1 1 
ATOM   7903  O  OD2 . ASP B  1  323 ? 10.153  63.780  0.857   1.00 34.57  ? 351  ASP B OD2 1 
ATOM   7904  N  N   . VAL B  1  324 ? 12.978  60.631  1.469   1.00 31.03  ? 352  VAL B N   1 
ATOM   7905  C  CA  . VAL B  1  324 ? 12.931  59.684  2.577   1.00 31.22  ? 352  VAL B CA  1 
ATOM   7906  C  C   . VAL B  1  324 ? 12.433  60.371  3.850   1.00 31.51  ? 352  VAL B C   1 
ATOM   7907  O  O   . VAL B  1  324 ? 13.124  61.244  4.414   1.00 31.63  ? 352  VAL B O   1 
ATOM   7908  C  CB  . VAL B  1  324 ? 14.316  59.026  2.808   1.00 31.20  ? 352  VAL B CB  1 
ATOM   7909  C  CG1 . VAL B  1  324 ? 14.226  57.891  3.806   1.00 30.25  ? 352  VAL B CG1 1 
ATOM   7910  C  CG2 . VAL B  1  324 ? 14.876  58.513  1.483   1.00 31.19  ? 352  VAL B CG2 1 
ATOM   7911  N  N   . ARG B  1  325 ? 11.234  59.989  4.289   1.00 31.34  ? 353  ARG B N   1 
ATOM   7912  C  CA  . ARG B  1  325 ? 10.697  60.471  5.563   1.00 31.74  ? 353  ARG B CA  1 
ATOM   7913  C  C   . ARG B  1  325 ? 10.600  59.353  6.600   1.00 31.40  ? 353  ARG B C   1 
ATOM   7914  O  O   . ARG B  1  325 ? 10.011  58.296  6.334   1.00 31.49  ? 353  ARG B O   1 
ATOM   7915  C  CB  . ARG B  1  325 ? 9.332   61.140  5.372   1.00 31.64  ? 353  ARG B CB  1 
ATOM   7916  C  CG  . ARG B  1  325 ? 9.336   62.272  4.331   1.00 33.44  ? 353  ARG B CG  1 
ATOM   7917  C  CD  . ARG B  1  325 ? 8.010   63.029  4.232   1.00 33.05  ? 353  ARG B CD  1 
ATOM   7918  N  NE  . ARG B  1  325 ? 7.751   63.421  2.846   1.00 37.25  ? 353  ARG B NE  1 
ATOM   7919  C  CZ  . ARG B  1  325 ? 7.070   64.504  2.467   1.00 38.68  ? 353  ARG B CZ  1 
ATOM   7920  N  NH1 . ARG B  1  325 ? 6.582   65.342  3.375   1.00 38.76  ? 353  ARG B NH1 1 
ATOM   7921  N  NH2 . ARG B  1  325 ? 6.891   64.758  1.168   1.00 36.96  ? 353  ARG B NH2 1 
ATOM   7922  N  N   . PHE B  1  326 ? 11.208  59.584  7.767   1.00 31.14  ? 354  PHE B N   1 
ATOM   7923  C  CA  . PHE B  1  326 ? 11.054  58.712  8.939   1.00 30.71  ? 354  PHE B CA  1 
ATOM   7924  C  C   . PHE B  1  326 ? 10.020  59.303  9.897   1.00 31.32  ? 354  PHE B C   1 
ATOM   7925  O  O   . PHE B  1  326 ? 10.185  60.438  10.389  1.00 31.80  ? 354  PHE B O   1 
ATOM   7926  C  CB  . PHE B  1  326 ? 12.386  58.545  9.672   1.00 29.97  ? 354  PHE B CB  1 
ATOM   7927  C  CG  . PHE B  1  326 ? 12.323  57.606  10.834  1.00 28.33  ? 354  PHE B CG  1 
ATOM   7928  C  CD1 . PHE B  1  326 ? 12.348  56.233  10.632  1.00 27.78  ? 354  PHE B CD1 1 
ATOM   7929  C  CD2 . PHE B  1  326 ? 12.239  58.092  12.139  1.00 27.48  ? 354  PHE B CD2 1 
ATOM   7930  C  CE1 . PHE B  1  326 ? 12.282  55.343  11.719  1.00 28.89  ? 354  PHE B CE1 1 
ATOM   7931  C  CE2 . PHE B  1  326 ? 12.170  57.219  13.236  1.00 27.17  ? 354  PHE B CE2 1 
ATOM   7932  C  CZ  . PHE B  1  326 ? 12.196  55.834  13.022  1.00 28.42  ? 354  PHE B CZ  1 
ATOM   7933  N  N   . GLN B  1  327 ? 8.963   58.536  10.166  1.00 31.27  ? 355  GLN B N   1 
ATOM   7934  C  CA  . GLN B  1  327 ? 7.872   58.989  11.024  1.00 31.88  ? 355  GLN B CA  1 
ATOM   7935  C  C   . GLN B  1  327 ? 7.450   60.407  10.643  1.00 31.60  ? 355  GLN B C   1 
ATOM   7936  O  O   . GLN B  1  327 ? 7.270   61.279  11.504  1.00 31.21  ? 355  GLN B O   1 
ATOM   7937  C  CB  . GLN B  1  327 ? 8.268   58.920  12.502  1.00 31.71  ? 355  GLN B CB  1 
ATOM   7938  C  CG  . GLN B  1  327 ? 8.179   57.516  13.100  1.00 33.53  ? 355  GLN B CG  1 
ATOM   7939  C  CD  . GLN B  1  327 ? 8.635   57.464  14.549  1.00 33.16  ? 355  GLN B CD  1 
ATOM   7940  O  OE1 . GLN B  1  327 ? 9.071   58.477  15.112  1.00 35.37  ? 355  GLN B OE1 1 
ATOM   7941  N  NE2 . GLN B  1  327 ? 8.543   56.282  15.160  1.00 33.36  ? 355  GLN B NE2 1 
ATOM   7942  N  N   . GLY B  1  328 ? 7.318   60.628  9.339   1.00 31.27  ? 356  GLY B N   1 
ATOM   7943  C  CA  . GLY B  1  328 ? 6.810   61.889  8.828   1.00 31.23  ? 356  GLY B CA  1 
ATOM   7944  C  C   . GLY B  1  328 ? 7.851   62.958  8.551   1.00 31.20  ? 356  GLY B C   1 
ATOM   7945  O  O   . GLY B  1  328 ? 7.541   63.936  7.873   1.00 31.26  ? 356  GLY B O   1 
ATOM   7946  N  N   . GLU B  1  329 ? 9.076   62.774  9.050   1.00 30.84  ? 357  GLU B N   1 
ATOM   7947  C  CA  . GLU B  1  329 ? 10.128  63.795  8.926   1.00 31.06  ? 357  GLU B CA  1 
ATOM   7948  C  C   . GLU B  1  329 ? 11.181  63.445  7.857   1.00 30.82  ? 357  GLU B C   1 
ATOM   7949  O  O   . GLU B  1  329 ? 11.867  62.417  7.961   1.00 30.87  ? 357  GLU B O   1 
ATOM   7950  C  CB  . GLU B  1  329 ? 10.790  64.041  10.297  1.00 30.78  ? 357  GLU B CB  1 
ATOM   7951  C  CG  . GLU B  1  329 ? 11.887  65.088  10.295  1.00 30.71  ? 357  GLU B CG  1 
ATOM   7952  C  CD  . GLU B  1  329 ? 12.457  65.379  11.678  1.00 32.18  ? 357  GLU B CD  1 
ATOM   7953  O  OE1 . GLU B  1  329 ? 12.029  64.757  12.679  1.00 33.14  ? 357  GLU B OE1 1 
ATOM   7954  O  OE2 . GLU B  1  329 ? 13.353  66.252  11.768  1.00 36.05  ? 357  GLU B OE2 1 
ATOM   7955  N  N   . ARG B  1  330 ? 11.305  64.298  6.838   1.00 30.71  ? 358  ARG B N   1 
ATOM   7956  C  CA  . ARG B  1  330 ? 12.270  64.074  5.756   1.00 31.05  ? 358  ARG B CA  1 
ATOM   7957  C  C   . ARG B  1  330 ? 13.699  64.065  6.303   1.00 31.27  ? 358  ARG B C   1 
ATOM   7958  O  O   . ARG B  1  330 ? 14.079  64.973  7.037   1.00 31.74  ? 358  ARG B O   1 
ATOM   7959  C  CB  . ARG B  1  330 ? 12.115  65.121  4.652   1.00 30.27  ? 358  ARG B CB  1 
ATOM   7960  C  CG  . ARG B  1  330 ? 13.054  64.938  3.462   1.00 31.22  ? 358  ARG B CG  1 
ATOM   7961  C  CD  . ARG B  1  330 ? 12.506  65.542  2.147   1.00 31.57  ? 358  ARG B CD  1 
ATOM   7962  N  NE  . ARG B  1  330 ? 12.143  66.952  2.307   1.00 33.30  ? 358  ARG B NE  1 
ATOM   7963  C  CZ  . ARG B  1  330 ? 10.901  67.436  2.279   1.00 33.79  ? 358  ARG B CZ  1 
ATOM   7964  N  NH1 . ARG B  1  330 ? 9.858   66.627  2.060   1.00 32.34  ? 358  ARG B NH1 1 
ATOM   7965  N  NH2 . ARG B  1  330 ? 10.709  68.744  2.468   1.00 33.00  ? 358  ARG B NH2 1 
ATOM   7966  N  N   . LEU B  1  331 ? 14.459  63.013  5.987   1.00 31.27  ? 359  LEU B N   1 
ATOM   7967  C  CA  . LEU B  1  331 ? 15.877  62.928  6.360   1.00 31.40  ? 359  LEU B CA  1 
ATOM   7968  C  C   . LEU B  1  331 ? 16.782  63.127  5.144   1.00 31.18  ? 359  LEU B C   1 
ATOM   7969  O  O   . LEU B  1  331 ? 17.866  63.703  5.253   1.00 30.85  ? 359  LEU B O   1 
ATOM   7970  C  CB  . LEU B  1  331 ? 16.214  61.565  6.970   1.00 31.50  ? 359  LEU B CB  1 
ATOM   7971  C  CG  . LEU B  1  331 ? 15.293  60.922  8.002   1.00 33.06  ? 359  LEU B CG  1 
ATOM   7972  C  CD1 . LEU B  1  331 ? 15.660  59.451  8.168   1.00 34.38  ? 359  LEU B CD1 1 
ATOM   7973  C  CD2 . LEU B  1  331 ? 15.363  61.640  9.334   1.00 34.52  ? 359  LEU B CD2 1 
ATOM   7974  N  N   . VAL B  1  332 ? 16.329  62.635  3.993   1.00 30.91  ? 360  VAL B N   1 
ATOM   7975  C  CA  . VAL B  1  332 ? 17.158  62.547  2.804   1.00 31.19  ? 360  VAL B CA  1 
ATOM   7976  C  C   . VAL B  1  332 ? 16.412  63.050  1.569   1.00 31.44  ? 360  VAL B C   1 
ATOM   7977  O  O   . VAL B  1  332 ? 15.309  62.575  1.292   1.00 31.96  ? 360  VAL B O   1 
ATOM   7978  C  CB  . VAL B  1  332 ? 17.553  61.082  2.546   1.00 31.05  ? 360  VAL B CB  1 
ATOM   7979  C  CG1 . VAL B  1  332 ? 18.245  60.961  1.214   1.00 32.21  ? 360  VAL B CG1 1 
ATOM   7980  C  CG2 . VAL B  1  332 ? 18.434  60.539  3.666   1.00 30.11  ? 360  VAL B CG2 1 
ATOM   7981  N  N   . TYR B  1  333 ? 16.990  64.005  0.834   1.00 31.19  ? 361  TYR B N   1 
ATOM   7982  C  CA  . TYR B  1  333 ? 16.405  64.387  -0.452  1.00 31.45  ? 361  TYR B CA  1 
ATOM   7983  C  C   . TYR B  1  333 ? 16.619  63.294  -1.508  1.00 31.62  ? 361  TYR B C   1 
ATOM   7984  O  O   . TYR B  1  333 ? 15.681  62.882  -2.180  1.00 31.70  ? 361  TYR B O   1 
ATOM   7985  C  CB  . TYR B  1  333 ? 16.927  65.739  -0.969  1.00 31.27  ? 361  TYR B CB  1 
ATOM   7986  C  CG  . TYR B  1  333 ? 16.270  66.150  -2.273  1.00 30.96  ? 361  TYR B CG  1 
ATOM   7987  C  CD1 . TYR B  1  333 ? 15.004  66.731  -2.283  1.00 31.58  ? 361  TYR B CD1 1 
ATOM   7988  C  CD2 . TYR B  1  333 ? 16.901  65.930  -3.504  1.00 32.46  ? 361  TYR B CD2 1 
ATOM   7989  C  CE1 . TYR B  1  333 ? 14.378  67.100  -3.479  1.00 30.50  ? 361  TYR B CE1 1 
ATOM   7990  C  CE2 . TYR B  1  333 ? 16.281  66.287  -4.715  1.00 31.69  ? 361  TYR B CE2 1 
ATOM   7991  C  CZ  . TYR B  1  333 ? 15.016  66.874  -4.684  1.00 31.59  ? 361  TYR B CZ  1 
ATOM   7992  O  OH  . TYR B  1  333 ? 14.386  67.233  -5.853  1.00 30.61  ? 361  TYR B OH  1 
ATOM   7993  N  N   . GLU B  1  334 ? 17.861  62.846  -1.651  1.00 31.91  ? 362  GLU B N   1 
ATOM   7994  C  CA  . GLU B  1  334 ? 18.233  61.864  -2.656  1.00 32.00  ? 362  GLU B CA  1 
ATOM   7995  C  C   . GLU B  1  334 ? 19.347  60.970  -2.129  1.00 31.65  ? 362  GLU B C   1 
ATOM   7996  O  O   . GLU B  1  334 ? 20.377  61.473  -1.670  1.00 31.96  ? 362  GLU B O   1 
ATOM   7997  C  CB  . GLU B  1  334 ? 18.716  62.594  -3.906  1.00 31.87  ? 362  GLU B CB  1 
ATOM   7998  C  CG  . GLU B  1  334 ? 19.062  61.701  -5.092  1.00 32.35  ? 362  GLU B CG  1 
ATOM   7999  C  CD  . GLU B  1  334 ? 19.801  62.458  -6.178  1.00 33.41  ? 362  GLU B CD  1 
ATOM   8000  O  OE1 . GLU B  1  334 ? 20.550  61.820  -6.954  1.00 34.96  ? 362  GLU B OE1 1 
ATOM   8001  O  OE2 . GLU B  1  334 ? 19.657  63.702  -6.244  1.00 36.54  ? 362  GLU B OE2 1 
ATOM   8002  N  N   . ILE B  1  335 ? 19.111  59.659  -2.141  1.00 31.09  ? 363  ILE B N   1 
ATOM   8003  C  CA  . ILE B  1  335 ? 20.186  58.655  -2.131  1.00 30.93  ? 363  ILE B CA  1 
ATOM   8004  C  C   . ILE B  1  335 ? 20.141  57.925  -3.486  1.00 30.50  ? 363  ILE B C   1 
ATOM   8005  O  O   . ILE B  1  335 ? 19.089  57.392  -3.878  1.00 29.69  ? 363  ILE B O   1 
ATOM   8006  C  CB  . ILE B  1  335 ? 20.047  57.621  -0.996  1.00 31.10  ? 363  ILE B CB  1 
ATOM   8007  C  CG1 . ILE B  1  335 ? 20.412  58.236  0.343   1.00 32.82  ? 363  ILE B CG1 1 
ATOM   8008  C  CG2 . ILE B  1  335 ? 20.977  56.424  -1.223  1.00 30.95  ? 363  ILE B CG2 1 
ATOM   8009  C  CD1 . ILE B  1  335 ? 19.579  57.667  1.486   1.00 34.05  ? 363  ILE B CD1 1 
ATOM   8010  N  N   . SER B  1  336 ? 21.269  57.921  -4.194  1.00 30.05  ? 364  SER B N   1 
ATOM   8011  C  CA  . SER B  1  336 ? 21.339  57.321  -5.519  1.00 30.51  ? 364  SER B CA  1 
ATOM   8012  C  C   . SER B  1  336 ? 22.692  56.685  -5.822  1.00 30.24  ? 364  SER B C   1 
ATOM   8013  O  O   . SER B  1  336 ? 23.733  57.170  -5.385  1.00 30.09  ? 364  SER B O   1 
ATOM   8014  C  CB  . SER B  1  336 ? 20.982  58.354  -6.602  1.00 30.63  ? 364  SER B CB  1 
ATOM   8015  O  OG  . SER B  1  336 ? 21.915  59.425  -6.649  1.00 31.68  ? 364  SER B OG  1 
ATOM   8016  N  N   . LEU B  1  337 ? 22.663  55.585  -6.569  1.00 30.35  ? 365  LEU B N   1 
ATOM   8017  C  CA  . LEU B  1  337 ? 23.882  55.050  -7.164  1.00 29.85  ? 365  LEU B CA  1 
ATOM   8018  C  C   . LEU B  1  337 ? 24.333  56.030  -8.248  1.00 30.05  ? 365  LEU B C   1 
ATOM   8019  O  O   . LEU B  1  337 ? 23.508  56.603  -8.967  1.00 29.82  ? 365  LEU B O   1 
ATOM   8020  C  CB  . LEU B  1  337 ? 23.675  53.648  -7.740  1.00 29.66  ? 365  LEU B CB  1 
ATOM   8021  C  CG  . LEU B  1  337 ? 24.935  53.008  -8.373  1.00 29.87  ? 365  LEU B CG  1 
ATOM   8022  C  CD1 . LEU B  1  337 ? 26.070  52.864  -7.376  1.00 29.46  ? 365  LEU B CD1 1 
ATOM   8023  C  CD2 . LEU B  1  337 ? 24.629  51.677  -9.027  1.00 28.89  ? 365  LEU B CD2 1 
ATOM   8024  N  N   . GLN B  1  338 ? 25.640  56.240  -8.340  1.00 29.81  ? 366  GLN B N   1 
ATOM   8025  C  CA  . GLN B  1  338 ? 26.167  57.222  -9.271  1.00 29.53  ? 366  GLN B CA  1 
ATOM   8026  C  C   . GLN B  1  338 ? 27.030  56.598  -10.348 1.00 29.23  ? 366  GLN B C   1 
ATOM   8027  O  O   . GLN B  1  338 ? 26.942  56.992  -11.494 1.00 29.19  ? 366  GLN B O   1 
ATOM   8028  C  CB  . GLN B  1  338 ? 26.935  58.287  -8.510  1.00 29.69  ? 366  GLN B CB  1 
ATOM   8029  C  CG  . GLN B  1  338 ? 26.015  59.250  -7.798  1.00 30.12  ? 366  GLN B CG  1 
ATOM   8030  C  CD  . GLN B  1  338 ? 25.243  60.083  -8.772  1.00 30.91  ? 366  GLN B CD  1 
ATOM   8031  O  OE1 . GLN B  1  338 ? 25.830  60.670  -9.672  1.00 33.57  ? 366  GLN B OE1 1 
ATOM   8032  N  NE2 . GLN B  1  338 ? 23.922  60.142  -8.614  1.00 30.46  ? 366  GLN B NE2 1 
ATOM   8033  N  N   . GLU B  1  339 ? 27.857  55.626  -9.967  1.00 28.80  ? 367  GLU B N   1 
ATOM   8034  C  CA  . GLU B  1  339 ? 28.749  54.946  -10.890 1.00 28.51  ? 367  GLU B CA  1 
ATOM   8035  C  C   . GLU B  1  339 ? 29.279  53.660  -10.277 1.00 27.79  ? 367  GLU B C   1 
ATOM   8036  O  O   . GLU B  1  339 ? 29.323  53.536  -9.053  1.00 27.56  ? 367  GLU B O   1 
ATOM   8037  C  CB  . GLU B  1  339 ? 29.932  55.854  -11.277 1.00 29.08  ? 367  GLU B CB  1 
ATOM   8038  C  CG  . GLU B  1  339 ? 30.789  55.313  -12.446 1.00 30.12  ? 367  GLU B CG  1 
ATOM   8039  C  CD  . GLU B  1  339 ? 29.935  54.959  -13.656 1.00 32.90  ? 367  GLU B CD  1 
ATOM   8040  O  OE1 . GLU B  1  339 ? 29.663  55.850  -14.496 1.00 34.54  ? 367  GLU B OE1 1 
ATOM   8041  O  OE2 . GLU B  1  339 ? 29.520  53.786  -13.756 1.00 33.37  ? 367  GLU B OE2 1 
ATOM   8042  N  N   . ALA B  1  340 ? 29.671  52.710  -11.126 1.00 27.15  ? 368  ALA B N   1 
ATOM   8043  C  CA  . ALA B  1  340 ? 30.412  51.531  -10.676 1.00 27.02  ? 368  ALA B CA  1 
ATOM   8044  C  C   . ALA B  1  340 ? 31.629  51.280  -11.548 1.00 27.14  ? 368  ALA B C   1 
ATOM   8045  O  O   . ALA B  1  340 ? 31.618  51.585  -12.749 1.00 27.29  ? 368  ALA B O   1 
ATOM   8046  C  CB  . ALA B  1  340 ? 29.535  50.325  -10.614 1.00 26.79  ? 368  ALA B CB  1 
ATOM   8047  N  N   . LEU B  1  341 ? 32.684  50.743  -10.940 1.00 26.97  ? 369  LEU B N   1 
ATOM   8048  C  CA  . LEU B  1  341 ? 33.982  50.644  -11.606 1.00 27.01  ? 369  LEU B CA  1 
ATOM   8049  C  C   . LEU B  1  341 ? 34.701  49.318  -11.326 1.00 27.52  ? 369  LEU B C   1 
ATOM   8050  O  O   . LEU B  1  341 ? 34.812  48.890  -10.184 1.00 27.50  ? 369  LEU B O   1 
ATOM   8051  C  CB  . LEU B  1  341 ? 34.850  51.839  -11.189 1.00 26.87  ? 369  LEU B CB  1 
ATOM   8052  C  CG  . LEU B  1  341 ? 36.316  51.986  -11.617 1.00 27.49  ? 369  LEU B CG  1 
ATOM   8053  C  CD1 . LEU B  1  341 ? 36.480  52.439  -13.085 1.00 25.66  ? 369  LEU B CD1 1 
ATOM   8054  C  CD2 . LEU B  1  341 ? 37.018  52.956  -10.688 1.00 26.26  ? 369  LEU B CD2 1 
ATOM   8055  N  N   . ALA B  1  342 ? 35.177  48.673  -12.386 1.00 28.33  ? 370  ALA B N   1 
ATOM   8056  C  CA  . ALA B  1  342 ? 36.058  47.504  -12.286 1.00 28.93  ? 370  ALA B CA  1 
ATOM   8057  C  C   . ALA B  1  342 ? 37.365  47.764  -13.026 1.00 29.25  ? 370  ALA B C   1 
ATOM   8058  O  O   . ALA B  1  342 ? 37.361  48.042  -14.218 1.00 29.58  ? 370  ALA B O   1 
ATOM   8059  C  CB  . ALA B  1  342 ? 35.377  46.263  -12.847 1.00 28.80  ? 370  ALA B CB  1 
ATOM   8060  N  N   . ILE B  1  343 ? 38.481  47.673  -12.312 1.00 30.12  ? 371  ILE B N   1 
ATOM   8061  C  CA  . ILE B  1  343 ? 39.810  47.845  -12.904 1.00 30.65  ? 371  ILE B CA  1 
ATOM   8062  C  C   . ILE B  1  343 ? 40.551  46.507  -12.896 1.00 31.34  ? 371  ILE B C   1 
ATOM   8063  O  O   . ILE B  1  343 ? 40.678  45.886  -11.847 1.00 31.84  ? 371  ILE B O   1 
ATOM   8064  C  CB  . ILE B  1  343 ? 40.608  48.946  -12.175 1.00 30.43  ? 371  ILE B CB  1 
ATOM   8065  C  CG1 . ILE B  1  343 ? 39.955  50.303  -12.451 1.00 29.73  ? 371  ILE B CG1 1 
ATOM   8066  C  CG2 . ILE B  1  343 ? 42.089  48.964  -12.632 1.00 29.81  ? 371  ILE B CG2 1 
ATOM   8067  C  CD1 . ILE B  1  343 ? 40.387  51.368  -11.513 1.00 29.46  ? 371  ILE B CD1 1 
ATOM   8068  N  N   . TYR B  1  344 ? 41.022  46.071  -14.064 1.00 31.81  ? 372  TYR B N   1 
ATOM   8069  C  CA  . TYR B  1  344 ? 41.617  44.743  -14.210 1.00 32.67  ? 372  TYR B CA  1 
ATOM   8070  C  C   . TYR B  1  344 ? 43.137  44.747  -14.379 1.00 33.01  ? 372  TYR B C   1 
ATOM   8071  O  O   . TYR B  1  344 ? 43.753  45.749  -14.755 1.00 32.71  ? 372  TYR B O   1 
ATOM   8072  C  CB  . TYR B  1  344 ? 40.966  43.972  -15.380 1.00 32.79  ? 372  TYR B CB  1 
ATOM   8073  C  CG  . TYR B  1  344 ? 39.609  43.388  -15.050 1.00 33.25  ? 372  TYR B CG  1 
ATOM   8074  C  CD1 . TYR B  1  344 ? 38.472  44.205  -15.009 1.00 32.64  ? 372  TYR B CD1 1 
ATOM   8075  C  CD2 . TYR B  1  344 ? 39.456  42.025  -14.771 1.00 32.30  ? 372  TYR B CD2 1 
ATOM   8076  C  CE1 . TYR B  1  344 ? 37.220  43.691  -14.707 1.00 32.31  ? 372  TYR B CE1 1 
ATOM   8077  C  CE2 . TYR B  1  344 ? 38.185  41.490  -14.473 1.00 33.38  ? 372  TYR B CE2 1 
ATOM   8078  C  CZ  . TYR B  1  344 ? 37.073  42.337  -14.438 1.00 33.83  ? 372  TYR B CZ  1 
ATOM   8079  O  OH  . TYR B  1  344 ? 35.806  41.856  -14.122 1.00 34.74  ? 372  TYR B OH  1 
ATOM   8080  N  N   . GLY B  1  345 ? 43.725  43.602  -14.071 1.00 33.46  ? 373  GLY B N   1 
ATOM   8081  C  CA  . GLY B  1  345 ? 45.089  43.299  -14.441 1.00 33.91  ? 373  GLY B CA  1 
ATOM   8082  C  C   . GLY B  1  345 ? 45.022  41.993  -15.197 1.00 34.54  ? 373  GLY B C   1 
ATOM   8083  O  O   . GLY B  1  345 ? 44.014  41.291  -15.157 1.00 34.69  ? 373  GLY B O   1 
ATOM   8084  N  N   . GLY B  1  346 ? 46.086  41.658  -15.901 1.00 35.16  ? 374  GLY B N   1 
ATOM   8085  C  CA  . GLY B  1  346 ? 46.101  40.400  -16.621 1.00 35.93  ? 374  GLY B CA  1 
ATOM   8086  C  C   . GLY B  1  346 ? 47.336  40.192  -17.450 1.00 36.19  ? 374  GLY B C   1 
ATOM   8087  O  O   . GLY B  1  346 ? 48.180  41.082  -17.574 1.00 36.06  ? 374  GLY B O   1 
ATOM   8088  N  N   . ASN B  1  347 ? 47.408  39.000  -18.026 1.00 36.92  ? 375  ASN B N   1 
ATOM   8089  C  CA  . ASN B  1  347 ? 48.525  38.562  -18.846 1.00 37.49  ? 375  ASN B CA  1 
ATOM   8090  C  C   . ASN B  1  347 ? 48.301  38.851  -20.330 1.00 37.15  ? 375  ASN B C   1 
ATOM   8091  O  O   . ASN B  1  347 ? 49.235  38.755  -21.130 1.00 37.28  ? 375  ASN B O   1 
ATOM   8092  C  CB  . ASN B  1  347 ? 48.700  37.056  -18.649 1.00 38.13  ? 375  ASN B CB  1 
ATOM   8093  C  CG  . ASN B  1  347 ? 50.148  36.657  -18.512 1.00 41.23  ? 375  ASN B CG  1 
ATOM   8094  O  OD1 . ASN B  1  347 ? 50.477  35.551  -18.047 1.00 43.31  ? 375  ASN B OD1 1 
ATOM   8095  N  ND2 . ASN B  1  347 ? 51.040  37.566  -18.903 1.00 45.09  ? 375  ASN B ND2 1 
ATOM   8096  N  N   . SER B  1  348 ? 47.056  39.187  -20.683 1.00 36.51  ? 376  SER B N   1 
ATOM   8097  C  CA  . SER B  1  348 ? 46.630  39.416  -22.059 1.00 36.34  ? 376  SER B CA  1 
ATOM   8098  C  C   . SER B  1  348 ? 46.148  40.852  -22.255 1.00 36.52  ? 376  SER B C   1 
ATOM   8099  O  O   . SER B  1  348 ? 45.699  41.476  -21.310 1.00 36.90  ? 376  SER B O   1 
ATOM   8100  C  CB  . SER B  1  348 ? 45.488  38.469  -22.404 1.00 36.41  ? 376  SER B CB  1 
ATOM   8101  O  OG  . SER B  1  348 ? 45.890  37.117  -22.328 1.00 36.59  ? 376  SER B OG  1 
ATOM   8102  N  N   . PRO B  1  349 ? 46.227  41.384  -23.485 1.00 36.63  ? 377  PRO B N   1 
ATOM   8103  C  CA  . PRO B  1  349 ? 45.819  42.770  -23.748 1.00 36.77  ? 377  PRO B CA  1 
ATOM   8104  C  C   . PRO B  1  349 ? 44.423  43.163  -23.215 1.00 37.04  ? 377  PRO B C   1 
ATOM   8105  O  O   . PRO B  1  349 ? 44.282  44.238  -22.621 1.00 37.52  ? 377  PRO B O   1 
ATOM   8106  C  CB  . PRO B  1  349 ? 45.859  42.859  -25.276 1.00 36.44  ? 377  PRO B CB  1 
ATOM   8107  C  CG  . PRO B  1  349 ? 46.869  41.868  -25.669 1.00 36.73  ? 377  PRO B CG  1 
ATOM   8108  C  CD  . PRO B  1  349 ? 46.735  40.730  -24.704 1.00 36.58  ? 377  PRO B CD  1 
ATOM   8109  N  N   . ALA B  1  350 ? 43.412  42.317  -23.424 1.00 36.89  ? 378  ALA B N   1 
ATOM   8110  C  CA  . ALA B  1  350 ? 42.054  42.620  -22.973 1.00 36.75  ? 378  ALA B CA  1 
ATOM   8111  C  C   . ALA B  1  350 ? 42.022  43.000  -21.485 1.00 36.86  ? 378  ALA B C   1 
ATOM   8112  O  O   . ALA B  1  350 ? 41.671  44.117  -21.138 1.00 37.06  ? 378  ALA B O   1 
ATOM   8113  C  CB  . ALA B  1  350 ? 41.100  41.444  -23.267 1.00 36.40  ? 378  ALA B CB  1 
ATOM   8114  N  N   . ALA B  1  351 ? 42.431  42.078  -20.620 1.00 37.04  ? 379  ALA B N   1 
ATOM   8115  C  CA  . ALA B  1  351 ? 42.377  42.285  -19.181 1.00 36.96  ? 379  ALA B CA  1 
ATOM   8116  C  C   . ALA B  1  351 ? 43.433  43.270  -18.675 1.00 37.27  ? 379  ALA B C   1 
ATOM   8117  O  O   . ALA B  1  351 ? 43.282  43.849  -17.612 1.00 38.09  ? 379  ALA B O   1 
ATOM   8118  C  CB  . ALA B  1  351 ? 42.513  40.955  -18.462 1.00 36.96  ? 379  ALA B CB  1 
ATOM   8119  N  N   . MET B  1  352 ? 44.501  43.451  -19.432 1.00 36.93  ? 380  MET B N   1 
ATOM   8120  C  CA  . MET B  1  352 ? 45.587  44.364  -19.079 1.00 36.98  ? 380  MET B CA  1 
ATOM   8121  C  C   . MET B  1  352 ? 45.148  45.817  -19.063 1.00 36.04  ? 380  MET B C   1 
ATOM   8122  O  O   . MET B  1  352 ? 45.659  46.612  -18.278 1.00 35.75  ? 380  MET B O   1 
ATOM   8123  C  CB  . MET B  1  352 ? 46.672  44.230  -20.137 1.00 36.92  ? 380  MET B CB  1 
ATOM   8124  C  CG  . MET B  1  352 ? 48.057  44.424  -19.668 1.00 37.33  ? 380  MET B CG  1 
ATOM   8125  S  SD  . MET B  1  352 ? 49.137  44.109  -21.078 1.00 39.39  ? 380  MET B SD  1 
ATOM   8126  C  CE  . MET B  1  352 ? 49.251  42.310  -21.111 1.00 36.10  ? 380  MET B CE  1 
ATOM   8127  N  N   . THR B  1  353 ? 44.224  46.154  -19.963 1.00 35.36  ? 381  THR B N   1 
ATOM   8128  C  CA  . THR B  1  353 ? 43.761  47.526  -20.161 1.00 34.70  ? 381  THR B CA  1 
ATOM   8129  C  C   . THR B  1  353 ? 42.261  47.708  -19.871 1.00 34.27  ? 381  THR B C   1 
ATOM   8130  O  O   . THR B  1  353 ? 41.679  48.740  -20.217 1.00 34.48  ? 381  THR B O   1 
ATOM   8131  C  CB  . THR B  1  353 ? 44.020  47.994  -21.616 1.00 34.89  ? 381  THR B CB  1 
ATOM   8132  O  OG1 . THR B  1  353 ? 43.550  46.994  -22.529 1.00 34.39  ? 381  THR B OG1 1 
ATOM   8133  C  CG2 . THR B  1  353 ? 45.505  48.231  -21.868 1.00 34.95  ? 381  THR B CG2 1 
ATOM   8134  N  N   . THR B  1  354 ? 41.619  46.717  -19.260 1.00 33.33  ? 382  THR B N   1 
ATOM   8135  C  CA  . THR B  1  354 ? 40.193  46.846  -18.977 1.00 32.40  ? 382  THR B CA  1 
ATOM   8136  C  C   . THR B  1  354 ? 39.970  47.728  -17.764 1.00 31.85  ? 382  THR B C   1 
ATOM   8137  O  O   . THR B  1  354 ? 40.543  47.490  -16.701 1.00 31.52  ? 382  THR B O   1 
ATOM   8138  C  CB  . THR B  1  354 ? 39.511  45.483  -18.790 1.00 32.44  ? 382  THR B CB  1 
ATOM   8139  O  OG1 . THR B  1  354 ? 39.492  44.806  -20.042 1.00 32.82  ? 382  THR B OG1 1 
ATOM   8140  C  CG2 . THR B  1  354 ? 38.073  45.641  -18.328 1.00 32.21  ? 382  THR B CG2 1 
ATOM   8141  N  N   . ARG B  1  355 ? 39.172  48.772  -17.966 1.00 31.48  ? 383  ARG B N   1 
ATOM   8142  C  CA  . ARG B  1  355 ? 38.691  49.656  -16.908 1.00 31.57  ? 383  ARG B CA  1 
ATOM   8143  C  C   . ARG B  1  355 ? 37.241  49.972  -17.240 1.00 31.91  ? 383  ARG B C   1 
ATOM   8144  O  O   . ARG B  1  355 ? 36.969  50.872  -18.048 1.00 31.72  ? 383  ARG B O   1 
ATOM   8145  C  CB  . ARG B  1  355 ? 39.496  50.963  -16.827 1.00 31.12  ? 383  ARG B CB  1 
ATOM   8146  C  CG  . ARG B  1  355 ? 40.912  50.839  -16.250 1.00 31.47  ? 383  ARG B CG  1 
ATOM   8147  C  CD  . ARG B  1  355 ? 41.939  50.486  -17.311 1.00 30.70  ? 383  ARG B CD  1 
ATOM   8148  N  NE  . ARG B  1  355 ? 43.293  50.413  -16.775 1.00 32.72  ? 383  ARG B NE  1 
ATOM   8149  C  CZ  . ARG B  1  355 ? 43.848  49.318  -16.245 1.00 32.84  ? 383  ARG B CZ  1 
ATOM   8150  N  NH1 . ARG B  1  355 ? 43.175  48.168  -16.164 1.00 31.78  ? 383  ARG B NH1 1 
ATOM   8151  N  NH2 . ARG B  1  355 ? 45.095  49.377  -15.801 1.00 30.64  ? 383  ARG B NH2 1 
ATOM   8152  N  N   . TYR B  1  356 ? 36.325  49.217  -16.632 1.00 32.00  ? 384  TYR B N   1 
ATOM   8153  C  CA  . TYR B  1  356 ? 34.894  49.361  -16.872 1.00 32.48  ? 384  TYR B CA  1 
ATOM   8154  C  C   . TYR B  1  356 ? 34.328  50.501  -16.041 1.00 32.97  ? 384  TYR B C   1 
ATOM   8155  O  O   . TYR B  1  356 ? 34.476  50.527  -14.820 1.00 33.52  ? 384  TYR B O   1 
ATOM   8156  C  CB  . TYR B  1  356 ? 34.138  48.066  -16.523 1.00 32.67  ? 384  TYR B CB  1 
ATOM   8157  C  CG  . TYR B  1  356 ? 34.231  46.965  -17.557 1.00 32.46  ? 384  TYR B CG  1 
ATOM   8158  C  CD1 . TYR B  1  356 ? 34.679  45.689  -17.210 1.00 33.04  ? 384  TYR B CD1 1 
ATOM   8159  C  CD2 . TYR B  1  356 ? 33.856  47.193  -18.880 1.00 32.93  ? 384  TYR B CD2 1 
ATOM   8160  C  CE1 . TYR B  1  356 ? 34.767  44.664  -18.173 1.00 33.39  ? 384  TYR B CE1 1 
ATOM   8161  C  CE2 . TYR B  1  356 ? 33.939  46.189  -19.847 1.00 32.71  ? 384  TYR B CE2 1 
ATOM   8162  C  CZ  . TYR B  1  356 ? 34.390  44.933  -19.487 1.00 33.38  ? 384  TYR B CZ  1 
ATOM   8163  O  OH  . TYR B  1  356 ? 34.461  43.961  -20.451 1.00 34.19  ? 384  TYR B OH  1 
ATOM   8164  N  N   . VAL B  1  357 ? 33.686  51.446  -16.709 1.00 33.25  ? 385  VAL B N   1 
ATOM   8165  C  CA  . VAL B  1  357 ? 32.926  52.487  -16.048 1.00 33.38  ? 385  VAL B CA  1 
ATOM   8166  C  C   . VAL B  1  357 ? 31.484  52.118  -16.388 1.00 34.01  ? 385  VAL B C   1 
ATOM   8167  O  O   . VAL B  1  357 ? 30.986  52.482  -17.445 1.00 34.23  ? 385  VAL B O   1 
ATOM   8168  C  CB  . VAL B  1  357 ? 33.325  53.874  -16.608 1.00 33.52  ? 385  VAL B CB  1 
ATOM   8169  C  CG1 . VAL B  1  357 ? 32.679  55.000  -15.829 1.00 32.49  ? 385  VAL B CG1 1 
ATOM   8170  C  CG2 . VAL B  1  357 ? 34.858  54.029  -16.620 1.00 32.96  ? 385  VAL B CG2 1 
ATOM   8171  N  N   . ASP B  1  358 ? 30.831  51.358  -15.511 1.00 34.44  ? 386  ASP B N   1 
ATOM   8172  C  CA  . ASP B  1  358 ? 29.590  50.652  -15.871 1.00 35.04  ? 386  ASP B CA  1 
ATOM   8173  C  C   . ASP B  1  358 ? 28.390  51.509  -16.312 1.00 35.00  ? 386  ASP B C   1 
ATOM   8174  O  O   . ASP B  1  358 ? 27.534  51.033  -17.068 1.00 34.97  ? 386  ASP B O   1 
ATOM   8175  C  CB  . ASP B  1  358 ? 29.184  49.651  -14.785 1.00 35.21  ? 386  ASP B CB  1 
ATOM   8176  C  CG  . ASP B  1  358 ? 29.938  48.324  -14.899 1.00 36.97  ? 386  ASP B CG  1 
ATOM   8177  O  OD1 . ASP B  1  358 ? 30.108  47.805  -16.030 1.00 38.07  ? 386  ASP B OD1 1 
ATOM   8178  O  OD2 . ASP B  1  358 ? 30.356  47.789  -13.847 1.00 38.86  ? 386  ASP B OD2 1 
ATOM   8179  N  N   . GLY B  1  359 ? 28.337  52.757  -15.856 1.00 35.02  ? 387  GLY B N   1 
ATOM   8180  C  CA  . GLY B  1  359 ? 27.314  53.710  -16.296 1.00 34.89  ? 387  GLY B CA  1 
ATOM   8181  C  C   . GLY B  1  359 ? 27.332  53.939  -17.796 1.00 34.96  ? 387  GLY B C   1 
ATOM   8182  O  O   . GLY B  1  359 ? 26.298  54.200  -18.389 1.00 35.17  ? 387  GLY B O   1 
ATOM   8183  N  N   . GLY B  1  360 ? 28.508  53.832  -18.412 1.00 35.06  ? 388  GLY B N   1 
ATOM   8184  C  CA  . GLY B  1  360 ? 28.632  53.855  -19.871 1.00 35.06  ? 388  GLY B CA  1 
ATOM   8185  C  C   . GLY B  1  360 ? 27.809  52.793  -20.585 1.00 35.21  ? 388  GLY B C   1 
ATOM   8186  O  O   . GLY B  1  360 ? 27.399  52.986  -21.731 1.00 34.98  ? 388  GLY B O   1 
ATOM   8187  N  N   . PHE B  1  361 ? 27.590  51.663  -19.910 1.00 35.32  ? 389  PHE B N   1 
ATOM   8188  C  CA  . PHE B  1  361 ? 26.669  50.633  -20.369 1.00 35.37  ? 389  PHE B CA  1 
ATOM   8189  C  C   . PHE B  1  361 ? 25.279  50.915  -19.768 1.00 35.58  ? 389  PHE B C   1 
ATOM   8190  O  O   . PHE B  1  361 ? 24.320  51.195  -20.505 1.00 35.15  ? 389  PHE B O   1 
ATOM   8191  C  CB  . PHE B  1  361 ? 27.197  49.238  -20.014 1.00 35.77  ? 389  PHE B CB  1 
ATOM   8192  C  CG  . PHE B  1  361 ? 28.509  48.905  -20.670 1.00 36.11  ? 389  PHE B CG  1 
ATOM   8193  C  CD1 . PHE B  1  361 ? 29.713  49.269  -20.079 1.00 37.65  ? 389  PHE B CD1 1 
ATOM   8194  C  CD2 . PHE B  1  361 ? 28.540  48.239  -21.894 1.00 38.07  ? 389  PHE B CD2 1 
ATOM   8195  C  CE1 . PHE B  1  361 ? 30.933  48.982  -20.691 1.00 38.18  ? 389  PHE B CE1 1 
ATOM   8196  C  CE2 . PHE B  1  361 ? 29.759  47.942  -22.533 1.00 37.72  ? 389  PHE B CE2 1 
ATOM   8197  C  CZ  . PHE B  1  361 ? 30.957  48.312  -21.928 1.00 37.92  ? 389  PHE B CZ  1 
ATOM   8198  N  N   . GLY B  1  362 ? 25.170  50.870  -18.436 1.00 35.52  ? 390  GLY B N   1 
ATOM   8199  C  CA  . GLY B  1  362 ? 24.000  51.440  -17.756 1.00 35.58  ? 390  GLY B CA  1 
ATOM   8200  C  C   . GLY B  1  362 ? 23.327  50.549  -16.737 1.00 35.75  ? 390  GLY B C   1 
ATOM   8201  O  O   . GLY B  1  362 ? 22.756  49.519  -17.096 1.00 35.68  ? 390  GLY B O   1 
ATOM   8202  N  N   . MET B  1  363 ? 23.361  50.962  -15.467 1.00 35.78  ? 391  MET B N   1 
ATOM   8203  C  CA  . MET B  1  363 ? 22.870  50.107  -14.374 1.00 35.73  ? 391  MET B CA  1 
ATOM   8204  C  C   . MET B  1  363 ? 21.373  49.853  -14.420 1.00 35.29  ? 391  MET B C   1 
ATOM   8205  O  O   . MET B  1  363 ? 20.932  48.773  -14.054 1.00 35.15  ? 391  MET B O   1 
ATOM   8206  C  CB  . MET B  1  363 ? 23.309  50.607  -12.992 1.00 36.02  ? 391  MET B CB  1 
ATOM   8207  C  CG  . MET B  1  363 ? 24.708  50.132  -12.569 1.00 36.77  ? 391  MET B CG  1 
ATOM   8208  S  SD  . MET B  1  363 ? 26.029  50.959  -13.501 1.00 41.02  ? 391  MET B SD  1 
ATOM   8209  C  CE  . MET B  1  363 ? 26.327  52.422  -12.506 1.00 38.91  ? 391  MET B CE  1 
ATOM   8210  N  N   . GLY B  1  364 ? 20.599  50.834  -14.877 1.00 35.02  ? 392  GLY B N   1 
ATOM   8211  C  CA  . GLY B  1  364 ? 19.183  50.613  -15.130 1.00 34.76  ? 392  GLY B CA  1 
ATOM   8212  C  C   . GLY B  1  364 ? 19.007  49.747  -16.372 1.00 35.11  ? 392  GLY B C   1 
ATOM   8213  O  O   . GLY B  1  364 ? 18.414  48.661  -16.312 1.00 35.03  ? 392  GLY B O   1 
ATOM   8214  N  N   . LYS B  1  365 ? 19.539  50.239  -17.494 1.00 34.82  ? 393  LYS B N   1 
ATOM   8215  C  CA  . LYS B  1  365 ? 19.543  49.542  -18.774 1.00 34.76  ? 393  LYS B CA  1 
ATOM   8216  C  C   . LYS B  1  365 ? 19.860  48.049  -18.676 1.00 34.77  ? 393  LYS B C   1 
ATOM   8217  O  O   . LYS B  1  365 ? 19.227  47.244  -19.354 1.00 34.77  ? 393  LYS B O   1 
ATOM   8218  C  CB  . LYS B  1  365 ? 20.537  50.217  -19.719 1.00 35.08  ? 393  LYS B CB  1 
ATOM   8219  C  CG  . LYS B  1  365 ? 20.488  49.706  -21.148 1.00 35.12  ? 393  LYS B CG  1 
ATOM   8220  C  CD  . LYS B  1  365 ? 21.096  50.700  -22.100 1.00 35.12  ? 393  LYS B CD  1 
ATOM   8221  C  CE  . LYS B  1  365 ? 21.208  50.111  -23.484 1.00 35.10  ? 393  LYS B CE  1 
ATOM   8222  N  NZ  . LYS B  1  365 ? 21.439  51.195  -24.455 1.00 36.51  ? 393  LYS B NZ  1 
ATOM   8223  N  N   . TYR B  1  366 ? 20.832  47.683  -17.837 1.00 34.73  ? 394  TYR B N   1 
ATOM   8224  C  CA  . TYR B  1  366 ? 21.219  46.284  -17.687 1.00 34.69  ? 394  TYR B CA  1 
ATOM   8225  C  C   . TYR B  1  366 ? 20.586  45.606  -16.461 1.00 34.48  ? 394  TYR B C   1 
ATOM   8226  O  O   . TYR B  1  366 ? 21.023  44.541  -16.027 1.00 34.60  ? 394  TYR B O   1 
ATOM   8227  C  CB  . TYR B  1  366 ? 22.753  46.122  -17.771 1.00 35.28  ? 394  TYR B CB  1 
ATOM   8228  C  CG  . TYR B  1  366 ? 23.264  46.328  -19.187 1.00 35.67  ? 394  TYR B CG  1 
ATOM   8229  C  CD1 . TYR B  1  366 ? 23.363  47.612  -19.734 1.00 35.41  ? 394  TYR B CD1 1 
ATOM   8230  C  CD2 . TYR B  1  366 ? 23.608  45.244  -19.988 1.00 36.30  ? 394  TYR B CD2 1 
ATOM   8231  C  CE1 . TYR B  1  366 ? 23.797  47.822  -21.037 1.00 36.21  ? 394  TYR B CE1 1 
ATOM   8232  C  CE2 . TYR B  1  366 ? 24.053  45.434  -21.302 1.00 37.98  ? 394  TYR B CE2 1 
ATOM   8233  C  CZ  . TYR B  1  366 ? 24.137  46.735  -21.827 1.00 38.02  ? 394  TYR B CZ  1 
ATOM   8234  O  OH  . TYR B  1  366 ? 24.570  46.944  -23.132 1.00 37.17  ? 394  TYR B OH  1 
ATOM   8235  N  N   . THR B  1  367 ? 19.528  46.216  -15.935 1.00 34.10  ? 395  THR B N   1 
ATOM   8236  C  CA  . THR B  1  367 ? 18.764  45.644  -14.826 1.00 34.01  ? 395  THR B CA  1 
ATOM   8237  C  C   . THR B  1  367 ? 17.997  44.395  -15.265 1.00 34.28  ? 395  THR B C   1 
ATOM   8238  O  O   . THR B  1  367 ? 17.426  44.339  -16.365 1.00 34.21  ? 395  THR B O   1 
ATOM   8239  C  CB  . THR B  1  367 ? 17.847  46.721  -14.150 1.00 34.06  ? 395  THR B CB  1 
ATOM   8240  O  OG1 . THR B  1  367 ? 18.515  47.248  -13.001 1.00 33.55  ? 395  THR B OG1 1 
ATOM   8241  C  CG2 . THR B  1  367 ? 16.523  46.161  -13.704 1.00 33.39  ? 395  THR B CG2 1 
ATOM   8242  N  N   . THR B  1  368 ? 17.999  43.382  -14.409 1.00 34.18  ? 396  THR B N   1 
ATOM   8243  C  CA  . THR B  1  368 ? 17.433  42.109  -14.801 1.00 34.53  ? 396  THR B CA  1 
ATOM   8244  C  C   . THR B  1  368 ? 16.271  41.694  -13.907 1.00 34.20  ? 396  THR B C   1 
ATOM   8245  O  O   . THR B  1  368 ? 16.152  42.174  -12.785 1.00 34.34  ? 396  THR B O   1 
ATOM   8246  C  CB  . THR B  1  368 ? 18.507  41.008  -14.832 1.00 34.65  ? 396  THR B CB  1 
ATOM   8247  O  OG1 . THR B  1  368 ? 19.191  40.972  -13.578 1.00 36.84  ? 396  THR B OG1 1 
ATOM   8248  C  CG2 . THR B  1  368 ? 19.506  41.291  -15.919 1.00 34.76  ? 396  THR B CG2 1 
ATOM   8249  N  N   . PRO B  1  369 ? 15.395  40.807  -14.418 1.00 33.90  ? 397  PRO B N   1 
ATOM   8250  C  CA  . PRO B  1  369 ? 14.309  40.286  -13.602 1.00 33.58  ? 397  PRO B CA  1 
ATOM   8251  C  C   . PRO B  1  369 ? 14.822  39.604  -12.348 1.00 33.30  ? 397  PRO B C   1 
ATOM   8252  O  O   . PRO B  1  369 ? 15.882  38.982  -12.362 1.00 33.49  ? 397  PRO B O   1 
ATOM   8253  C  CB  . PRO B  1  369 ? 13.632  39.262  -14.527 1.00 33.43  ? 397  PRO B CB  1 
ATOM   8254  C  CG  . PRO B  1  369 ? 13.936  39.746  -15.886 1.00 34.08  ? 397  PRO B CG  1 
ATOM   8255  C  CD  . PRO B  1  369 ? 15.345  40.272  -15.791 1.00 33.65  ? 397  PRO B CD  1 
ATOM   8256  N  N   . LEU B  1  370 ? 14.074  39.747  -11.266 1.00 32.85  ? 398  LEU B N   1 
ATOM   8257  C  CA  . LEU B  1  370 ? 14.441  39.148  -10.005 1.00 32.60  ? 398  LEU B CA  1 
ATOM   8258  C  C   . LEU B  1  370 ? 13.724  37.829  -9.910  1.00 32.67  ? 398  LEU B C   1 
ATOM   8259  O  O   . LEU B  1  370 ? 12.512  37.782  -10.046 1.00 33.17  ? 398  LEU B O   1 
ATOM   8260  C  CB  . LEU B  1  370 ? 14.025  40.059  -8.851  1.00 32.03  ? 398  LEU B CB  1 
ATOM   8261  C  CG  . LEU B  1  370 ? 14.781  41.378  -8.753  1.00 31.29  ? 398  LEU B CG  1 
ATOM   8262  C  CD1 . LEU B  1  370 ? 14.051  42.350  -7.861  1.00 30.22  ? 398  LEU B CD1 1 
ATOM   8263  C  CD2 . LEU B  1  370 ? 16.228  41.158  -8.266  1.00 30.68  ? 398  LEU B CD2 1 
ATOM   8264  N  N   . THR B  1  371 ? 14.468  36.755  -9.685  1.00 32.76  ? 399  THR B N   1 
ATOM   8265  C  CA  . THR B  1  371 ? 13.854  35.442  -9.525  1.00 33.14  ? 399  THR B CA  1 
ATOM   8266  C  C   . THR B  1  371 ? 13.198  35.306  -8.139  1.00 33.79  ? 399  THR B C   1 
ATOM   8267  O  O   . THR B  1  371 ? 13.874  35.364  -7.113  1.00 33.84  ? 399  THR B O   1 
ATOM   8268  C  CB  . THR B  1  371 ? 14.868  34.325  -9.785  1.00 32.72  ? 399  THR B CB  1 
ATOM   8269  O  OG1 . THR B  1  371 ? 15.365  34.451  -11.122 1.00 32.82  ? 399  THR B OG1 1 
ATOM   8270  C  CG2 . THR B  1  371 ? 14.226  32.977  -9.630  1.00 32.12  ? 399  THR B CG2 1 
ATOM   8271  N  N   . ARG B  1  372 ? 11.876  35.149  -8.119  1.00 34.55  ? 400  ARG B N   1 
ATOM   8272  C  CA  . ARG B  1  372 ? 11.122  35.107  -6.862  1.00 35.83  ? 400  ARG B CA  1 
ATOM   8273  C  C   . ARG B  1  372 ? 11.623  33.937  -6.011  1.00 35.05  ? 400  ARG B C   1 
ATOM   8274  O  O   . ARG B  1  372 ? 11.646  32.809  -6.474  1.00 34.79  ? 400  ARG B O   1 
ATOM   8275  C  CB  . ARG B  1  372 ? 9.610   35.016  -7.144  1.00 35.67  ? 400  ARG B CB  1 
ATOM   8276  C  CG  . ARG B  1  372 ? 8.730   35.043  -5.908  1.00 37.82  ? 400  ARG B CG  1 
ATOM   8277  C  CD  . ARG B  1  372 ? 7.268   34.752  -6.238  1.00 38.68  ? 400  ARG B CD  1 
ATOM   8278  N  NE  . ARG B  1  372 ? 6.416   35.949  -6.235  1.00 44.62  ? 400  ARG B NE  1 
ATOM   8279  C  CZ  . ARG B  1  372 ? 6.155   36.697  -7.314  1.00 47.01  ? 400  ARG B CZ  1 
ATOM   8280  N  NH1 . ARG B  1  372 ? 6.695   36.395  -8.504  1.00 47.58  ? 400  ARG B NH1 1 
ATOM   8281  N  NH2 . ARG B  1  372 ? 5.361   37.761  -7.204  1.00 45.94  ? 400  ARG B NH2 1 
ATOM   8282  N  N   . GLY B  1  373 ? 12.089  34.222  -4.797  1.00 35.04  ? 401  GLY B N   1 
ATOM   8283  C  CA  . GLY B  1  373 ? 12.601  33.164  -3.903  1.00 34.74  ? 401  GLY B CA  1 
ATOM   8284  C  C   . GLY B  1  373 ? 14.095  32.851  -3.947  1.00 34.34  ? 401  GLY B C   1 
ATOM   8285  O  O   . GLY B  1  373 ? 14.607  32.109  -3.105  1.00 34.19  ? 401  GLY B O   1 
ATOM   8286  N  N   . VAL B  1  374 ? 14.793  33.396  -4.939  1.00 33.92  ? 402  VAL B N   1 
ATOM   8287  C  CA  . VAL B  1  374 ? 16.243  33.296  -5.008  1.00 33.13  ? 402  VAL B CA  1 
ATOM   8288  C  C   . VAL B  1  374 ? 16.835  34.691  -4.828  1.00 33.16  ? 402  VAL B C   1 
ATOM   8289  O  O   . VAL B  1  374 ? 17.644  34.921  -3.926  1.00 33.43  ? 402  VAL B O   1 
ATOM   8290  C  CB  . VAL B  1  374 ? 16.712  32.711  -6.355  1.00 33.06  ? 402  VAL B CB  1 
ATOM   8291  C  CG1 . VAL B  1  374 ? 18.239  32.729  -6.446  1.00 32.51  ? 402  VAL B CG1 1 
ATOM   8292  C  CG2 . VAL B  1  374 ? 16.165  31.314  -6.563  1.00 31.35  ? 402  VAL B CG2 1 
ATOM   8293  N  N   . ASP B  1  375 ? 16.415  35.618  -5.685  1.00 32.78  ? 403  ASP B N   1 
ATOM   8294  C  CA  . ASP B  1  375 ? 16.915  36.995  -5.665  1.00 32.85  ? 403  ASP B CA  1 
ATOM   8295  C  C   . ASP B  1  375 ? 16.368  37.818  -4.482  1.00 32.62  ? 403  ASP B C   1 
ATOM   8296  O  O   . ASP B  1  375 ? 17.069  38.659  -3.908  1.00 32.67  ? 403  ASP B O   1 
ATOM   8297  C  CB  . ASP B  1  375 ? 16.628  37.661  -7.014  1.00 32.53  ? 403  ASP B CB  1 
ATOM   8298  C  CG  . ASP B  1  375 ? 17.517  37.119  -8.134  1.00 33.77  ? 403  ASP B CG  1 
ATOM   8299  O  OD1 . ASP B  1  375 ? 18.694  36.804  -7.845  1.00 32.32  ? 403  ASP B OD1 1 
ATOM   8300  O  OD2 . ASP B  1  375 ? 17.052  37.020  -9.304  1.00 34.28  ? 403  ASP B OD2 1 
ATOM   8301  N  N   . CYS B  1  376 ? 15.108  37.575  -4.141  1.00 32.50  ? 404  CYS B N   1 
ATOM   8302  C  CA  . CYS B  1  376 ? 14.490  38.124  -2.938  1.00 32.74  ? 404  CYS B CA  1 
ATOM   8303  C  C   . CYS B  1  376 ? 13.641  37.026  -2.294  1.00 32.81  ? 404  CYS B C   1 
ATOM   8304  O  O   . CYS B  1  376 ? 13.386  35.984  -2.919  1.00 32.41  ? 404  CYS B O   1 
ATOM   8305  C  CB  . CYS B  1  376 ? 13.597  39.326  -3.263  1.00 32.48  ? 404  CYS B CB  1 
ATOM   8306  S  SG  . CYS B  1  376 ? 14.261  40.477  -4.469  1.00 32.93  ? 404  CYS B SG  1 
ATOM   8307  N  N   . PRO B  1  377 ? 13.193  37.258  -1.048  1.00 33.05  ? 405  PRO B N   1 
ATOM   8308  C  CA  . PRO B  1  377 ? 12.302  36.320  -0.386  1.00 33.23  ? 405  PRO B CA  1 
ATOM   8309  C  C   . PRO B  1  377 ? 11.068  36.104  -1.230  1.00 33.40  ? 405  PRO B C   1 
ATOM   8310  O  O   . PRO B  1  377 ? 10.653  36.996  -1.969  1.00 33.01  ? 405  PRO B O   1 
ATOM   8311  C  CB  . PRO B  1  377 ? 11.933  37.044  0.916   1.00 33.51  ? 405  PRO B CB  1 
ATOM   8312  C  CG  . PRO B  1  377 ? 13.092  37.937  1.181   1.00 33.43  ? 405  PRO B CG  1 
ATOM   8313  C  CD  . PRO B  1  377 ? 13.506  38.413  -0.185  1.00 33.14  ? 405  PRO B CD  1 
ATOM   8314  N  N   . TYR B  1  378 ? 10.493  34.917  -1.130  1.00 33.95  ? 406  TYR B N   1 
ATOM   8315  C  CA  . TYR B  1  378 ? 9.369   34.576  -1.976  1.00 34.86  ? 406  TYR B CA  1 
ATOM   8316  C  C   . TYR B  1  378 ? 8.198   35.569  -1.858  1.00 34.85  ? 406  TYR B C   1 
ATOM   8317  O  O   . TYR B  1  378 ? 7.538   35.883  -2.859  1.00 35.04  ? 406  TYR B O   1 
ATOM   8318  C  CB  . TYR B  1  378 ? 8.902   33.153  -1.680  1.00 35.59  ? 406  TYR B CB  1 
ATOM   8319  C  CG  . TYR B  1  378 ? 8.130   32.544  -2.816  1.00 36.79  ? 406  TYR B CG  1 
ATOM   8320  C  CD1 . TYR B  1  378 ? 8.729   31.623  -3.670  1.00 37.97  ? 406  TYR B CD1 1 
ATOM   8321  C  CD2 . TYR B  1  378 ? 6.800   32.908  -3.057  1.00 37.53  ? 406  TYR B CD2 1 
ATOM   8322  C  CE1 . TYR B  1  378 ? 8.011   31.060  -4.729  1.00 38.86  ? 406  TYR B CE1 1 
ATOM   8323  C  CE2 . TYR B  1  378 ? 6.076   32.358  -4.104  1.00 38.07  ? 406  TYR B CE2 1 
ATOM   8324  C  CZ  . TYR B  1  378 ? 6.686   31.430  -4.937  1.00 38.53  ? 406  TYR B CZ  1 
ATOM   8325  O  OH  . TYR B  1  378 ? 5.973   30.883  -5.983  1.00 38.46  ? 406  TYR B OH  1 
ATOM   8326  N  N   . LEU B  1  379 ? 7.954   36.064  -0.646  1.00 34.56  ? 407  LEU B N   1 
ATOM   8327  C  CA  . LEU B  1  379 ? 6.779   36.893  -0.383  1.00 34.64  ? 407  LEU B CA  1 
ATOM   8328  C  C   . LEU B  1  379 ? 7.033   38.402  -0.459  1.00 34.42  ? 407  LEU B C   1 
ATOM   8329  O  O   . LEU B  1  379 ? 6.312   39.187  0.162   1.00 34.74  ? 407  LEU B O   1 
ATOM   8330  C  CB  . LEU B  1  379 ? 6.138   36.504  0.957   1.00 34.53  ? 407  LEU B CB  1 
ATOM   8331  C  CG  . LEU B  1  379 ? 5.460   35.122  0.940   1.00 36.01  ? 407  LEU B CG  1 
ATOM   8332  C  CD1 . LEU B  1  379 ? 4.994   34.698  2.325   1.00 36.88  ? 407  LEU B CD1 1 
ATOM   8333  C  CD2 . LEU B  1  379 ? 4.291   35.068  -0.041  1.00 36.37  ? 407  LEU B CD2 1 
ATOM   8334  N  N   . ALA B  1  380 ? 8.059   38.798  -1.212  1.00 33.72  ? 408  ALA B N   1 
ATOM   8335  C  CA  . ALA B  1  380 ? 8.334   40.204  -1.485  1.00 33.05  ? 408  ALA B CA  1 
ATOM   8336  C  C   . ALA B  1  380 ? 7.331   40.781  -2.503  1.00 33.06  ? 408  ALA B C   1 
ATOM   8337  O  O   . ALA B  1  380 ? 6.714   40.045  -3.276  1.00 32.85  ? 408  ALA B O   1 
ATOM   8338  C  CB  . ALA B  1  380 ? 9.738   40.354  -1.993  1.00 32.55  ? 408  ALA B CB  1 
ATOM   8339  N  N   . THR B  1  381 ? 7.175   42.099  -2.500  1.00 32.70  ? 409  THR B N   1 
ATOM   8340  C  CA  . THR B  1  381 ? 6.368   42.762  -3.508  1.00 32.30  ? 409  THR B CA  1 
ATOM   8341  C  C   . THR B  1  381 ? 7.305   43.109  -4.656  1.00 32.62  ? 409  THR B C   1 
ATOM   8342  O  O   . THR B  1  381 ? 8.344   43.742  -4.444  1.00 32.92  ? 409  THR B O   1 
ATOM   8343  C  CB  . THR B  1  381 ? 5.684   44.023  -2.953  1.00 32.31  ? 409  THR B CB  1 
ATOM   8344  O  OG1 . THR B  1  381 ? 4.975   43.685  -1.756  1.00 31.48  ? 409  THR B OG1 1 
ATOM   8345  C  CG2 . THR B  1  381 ? 4.692   44.593  -3.954  1.00 32.35  ? 409  THR B CG2 1 
ATOM   8346  N  N   . TYR B  1  382 ? 6.945   42.659  -5.860  1.00 32.29  ? 410  TYR B N   1 
ATOM   8347  C  CA  . TYR B  1  382 ? 7.779   42.792  -7.045  1.00 31.77  ? 410  TYR B CA  1 
ATOM   8348  C  C   . TYR B  1  382 ? 7.238   43.867  -7.978  1.00 32.01  ? 410  TYR B C   1 
ATOM   8349  O  O   . TYR B  1  382 ? 6.073   43.821  -8.358  1.00 32.21  ? 410  TYR B O   1 
ATOM   8350  C  CB  . TYR B  1  382 ? 7.882   41.438  -7.756  1.00 31.54  ? 410  TYR B CB  1 
ATOM   8351  C  CG  . TYR B  1  382 ? 8.674   40.422  -6.956  1.00 31.29  ? 410  TYR B CG  1 
ATOM   8352  C  CD1 . TYR B  1  382 ? 8.039   39.528  -6.082  1.00 31.58  ? 410  TYR B CD1 1 
ATOM   8353  C  CD2 . TYR B  1  382 ? 10.069  40.382  -7.042  1.00 30.76  ? 410  TYR B CD2 1 
ATOM   8354  C  CE1 . TYR B  1  382 ? 8.787   38.596  -5.328  1.00 31.90  ? 410  TYR B CE1 1 
ATOM   8355  C  CE2 . TYR B  1  382 ? 10.821  39.468  -6.300  1.00 30.56  ? 410  TYR B CE2 1 
ATOM   8356  C  CZ  . TYR B  1  382 ? 10.187  38.579  -5.449  1.00 31.40  ? 410  TYR B CZ  1 
ATOM   8357  O  OH  . TYR B  1  382 ? 10.963  37.695  -4.729  1.00 30.73  ? 410  TYR B OH  1 
ATOM   8358  N  N   . VAL B  1  383 ? 8.074   44.846  -8.329  1.00 32.21  ? 411  VAL B N   1 
ATOM   8359  C  CA  . VAL B  1  383 ? 7.647   45.942  -9.213  1.00 32.46  ? 411  VAL B CA  1 
ATOM   8360  C  C   . VAL B  1  383 ? 8.357   45.927  -10.569 1.00 32.86  ? 411  VAL B C   1 
ATOM   8361  O  O   . VAL B  1  383 ? 9.564   45.715  -10.642 1.00 33.05  ? 411  VAL B O   1 
ATOM   8362  C  CB  . VAL B  1  383 ? 7.808   47.351  -8.547  1.00 32.57  ? 411  VAL B CB  1 
ATOM   8363  C  CG1 . VAL B  1  383 ? 7.146   48.435  -9.402  1.00 31.43  ? 411  VAL B CG1 1 
ATOM   8364  C  CG2 . VAL B  1  383 ? 7.234   47.366  -7.133  1.00 31.73  ? 411  VAL B CG2 1 
ATOM   8365  N  N   . ASP B  1  384 ? 7.592   46.170  -11.628 1.00 33.73  ? 412  ASP B N   1 
ATOM   8366  C  CA  . ASP B  1  384 ? 8.107   46.302  -13.000 1.00 34.68  ? 412  ASP B CA  1 
ATOM   8367  C  C   . ASP B  1  384 ? 8.854   47.626  -13.264 1.00 34.86  ? 412  ASP B C   1 
ATOM   8368  O  O   . ASP B  1  384 ? 8.595   48.633  -12.600 1.00 35.09  ? 412  ASP B O   1 
ATOM   8369  C  CB  . ASP B  1  384 ? 6.946   46.167  -13.983 1.00 34.69  ? 412  ASP B CB  1 
ATOM   8370  C  CG  . ASP B  1  384 ? 6.347   44.765  -13.999 1.00 36.93  ? 412  ASP B CG  1 
ATOM   8371  O  OD1 . ASP B  1  384 ? 6.917   43.859  -13.349 1.00 40.07  ? 412  ASP B OD1 1 
ATOM   8372  O  OD2 . ASP B  1  384 ? 5.309   44.560  -14.675 1.00 38.46  ? 412  ASP B OD2 1 
ATOM   8373  N  N   . TRP B  1  385 ? 9.781   47.619  -14.224 1.00 35.10  ? 413  TRP B N   1 
ATOM   8374  C  CA  . TRP B  1  385 ? 10.461  48.855  -14.661 1.00 35.33  ? 413  TRP B CA  1 
ATOM   8375  C  C   . TRP B  1  385 ? 10.285  49.080  -16.143 1.00 35.85  ? 413  TRP B C   1 
ATOM   8376  O  O   . TRP B  1  385 ? 10.442  48.151  -16.935 1.00 36.06  ? 413  TRP B O   1 
ATOM   8377  C  CB  . TRP B  1  385 ? 11.956  48.823  -14.361 1.00 34.63  ? 413  TRP B CB  1 
ATOM   8378  C  CG  . TRP B  1  385 ? 12.656  50.136  -14.584 1.00 34.25  ? 413  TRP B CG  1 
ATOM   8379  C  CD1 . TRP B  1  385 ? 12.368  51.330  -13.983 1.00 33.64  ? 413  TRP B CD1 1 
ATOM   8380  C  CD2 . TRP B  1  385 ? 13.790  50.383  -15.432 1.00 34.60  ? 413  TRP B CD2 1 
ATOM   8381  N  NE1 . TRP B  1  385 ? 13.237  52.304  -14.409 1.00 33.34  ? 413  TRP B NE1 1 
ATOM   8382  C  CE2 . TRP B  1  385 ? 14.124  51.754  -15.296 1.00 34.49  ? 413  TRP B CE2 1 
ATOM   8383  C  CE3 . TRP B  1  385 ? 14.546  49.587  -16.308 1.00 34.57  ? 413  TRP B CE3 1 
ATOM   8384  C  CZ2 . TRP B  1  385 ? 15.190  52.345  -15.997 1.00 34.48  ? 413  TRP B CZ2 1 
ATOM   8385  C  CZ3 . TRP B  1  385 ? 15.605  50.177  -17.013 1.00 33.66  ? 413  TRP B CZ3 1 
ATOM   8386  C  CH2 . TRP B  1  385 ? 15.916  51.543  -16.846 1.00 33.82  ? 413  TRP B CH2 1 
ATOM   8387  N  N   . HIS B  1  386 ? 9.984   50.327  -16.506 1.00 36.51  ? 414  HIS B N   1 
ATOM   8388  C  CA  . HIS B  1  386 ? 9.745   50.718  -17.904 1.00 36.54  ? 414  HIS B CA  1 
ATOM   8389  C  C   . HIS B  1  386 ? 10.858  51.629  -18.415 1.00 36.69  ? 414  HIS B C   1 
ATOM   8390  O  O   . HIS B  1  386 ? 11.410  52.445  -17.662 1.00 36.59  ? 414  HIS B O   1 
ATOM   8391  C  CB  . HIS B  1  386 ? 8.380   51.396  -18.056 1.00 36.32  ? 414  HIS B CB  1 
ATOM   8392  C  CG  . HIS B  1  386 ? 7.270   50.682  -17.346 1.00 36.24  ? 414  HIS B CG  1 
ATOM   8393  N  ND1 . HIS B  1  386 ? 6.601   49.606  -17.894 1.00 37.04  ? 414  HIS B ND1 1 
ATOM   8394  C  CD2 . HIS B  1  386 ? 6.712   50.890  -16.130 1.00 36.02  ? 414  HIS B CD2 1 
ATOM   8395  C  CE1 . HIS B  1  386 ? 5.679   49.183  -17.047 1.00 36.26  ? 414  HIS B CE1 1 
ATOM   8396  N  NE2 . HIS B  1  386 ? 5.724   49.947  -15.969 1.00 36.00  ? 414  HIS B NE2 1 
ATOM   8397  N  N   . PHE B  1  387 ? 11.192  51.470  -19.694 1.00 37.03  ? 415  PHE B N   1 
ATOM   8398  C  CA  . PHE B  1  387 ? 12.318  52.169  -20.302 1.00 37.17  ? 415  PHE B CA  1 
ATOM   8399  C  C   . PHE B  1  387 ? 12.168  52.321  -21.807 1.00 37.29  ? 415  PHE B C   1 
ATOM   8400  O  O   . PHE B  1  387 ? 11.469  51.540  -22.470 1.00 37.28  ? 415  PHE B O   1 
ATOM   8401  C  CB  . PHE B  1  387 ? 13.623  51.430  -20.005 1.00 37.51  ? 415  PHE B CB  1 
ATOM   8402  C  CG  . PHE B  1  387 ? 13.723  50.077  -20.657 1.00 38.54  ? 415  PHE B CG  1 
ATOM   8403  C  CD1 . PHE B  1  387 ? 14.356  49.927  -21.893 1.00 39.74  ? 415  PHE B CD1 1 
ATOM   8404  C  CD2 . PHE B  1  387 ? 13.190  48.948  -20.035 1.00 39.78  ? 415  PHE B CD2 1 
ATOM   8405  C  CE1 . PHE B  1  387 ? 14.460  48.673  -22.499 1.00 40.38  ? 415  PHE B CE1 1 
ATOM   8406  C  CE2 . PHE B  1  387 ? 13.279  47.687  -20.633 1.00 39.92  ? 415  PHE B CE2 1 
ATOM   8407  C  CZ  . PHE B  1  387 ? 13.922  47.547  -21.865 1.00 39.98  ? 415  PHE B CZ  1 
ATOM   8408  N  N   . LEU B  1  388 ? 12.869  53.318  -22.333 1.00 37.17  ? 416  LEU B N   1 
ATOM   8409  C  CA  . LEU B  1  388 ? 12.949  53.563  -23.759 1.00 36.47  ? 416  LEU B CA  1 
ATOM   8410  C  C   . LEU B  1  388 ? 14.414  53.776  -24.078 1.00 36.32  ? 416  LEU B C   1 
ATOM   8411  O  O   . LEU B  1  388 ? 14.936  54.887  -24.020 1.00 35.72  ? 416  LEU B O   1 
ATOM   8412  C  CB  . LEU B  1  388 ? 12.106  54.777  -24.141 1.00 36.41  ? 416  LEU B CB  1 
ATOM   8413  C  CG  . LEU B  1  388 ? 11.972  55.175  -25.609 1.00 36.38  ? 416  LEU B CG  1 
ATOM   8414  C  CD1 . LEU B  1  388 ? 11.609  53.992  -26.453 1.00 36.59  ? 416  LEU B CD1 1 
ATOM   8415  C  CD2 . LEU B  1  388 ? 10.913  56.256  -25.738 1.00 36.44  ? 416  LEU B CD2 1 
ATOM   8416  N  N   . LEU B  1  389 ? 15.073  52.670  -24.397 1.00 36.82  ? 417  LEU B N   1 
ATOM   8417  C  CA  . LEU B  1  389 ? 16.508  52.639  -24.607 1.00 36.97  ? 417  LEU B CA  1 
ATOM   8418  C  C   . LEU B  1  389 ? 16.814  51.876  -25.879 1.00 37.29  ? 417  LEU B C   1 
ATOM   8419  O  O   . LEU B  1  389 ? 16.437  50.711  -26.025 1.00 37.54  ? 417  LEU B O   1 
ATOM   8420  C  CB  . LEU B  1  389 ? 17.196  51.987  -23.408 1.00 36.77  ? 417  LEU B CB  1 
ATOM   8421  C  CG  . LEU B  1  389 ? 16.874  52.590  -22.032 1.00 36.97  ? 417  LEU B CG  1 
ATOM   8422  C  CD1 . LEU B  1  389 ? 17.224  51.614  -20.910 1.00 36.59  ? 417  LEU B CD1 1 
ATOM   8423  C  CD2 . LEU B  1  389 ? 17.557  53.947  -21.823 1.00 35.18  ? 417  LEU B CD2 1 
ATOM   8424  N  N   . GLU B  1  390 ? 17.488  52.549  -26.808 1.00 37.89  ? 418  GLU B N   1 
ATOM   8425  C  CA  . GLU B  1  390 ? 17.861  51.966  -28.106 1.00 38.26  ? 418  GLU B CA  1 
ATOM   8426  C  C   . GLU B  1  390 ? 16.699  51.354  -28.872 1.00 37.91  ? 418  GLU B C   1 
ATOM   8427  O  O   . GLU B  1  390 ? 16.873  50.364  -29.562 1.00 38.55  ? 418  GLU B O   1 
ATOM   8428  C  CB  . GLU B  1  390 ? 18.992  50.937  -27.959 1.00 38.37  ? 418  GLU B CB  1 
ATOM   8429  C  CG  . GLU B  1  390 ? 20.352  51.550  -27.726 1.00 39.59  ? 418  GLU B CG  1 
ATOM   8430  C  CD  . GLU B  1  390 ? 21.479  50.554  -27.891 1.00 40.94  ? 418  GLU B CD  1 
ATOM   8431  O  OE1 . GLU B  1  390 ? 21.804  50.190  -29.043 1.00 41.58  ? 418  GLU B OE1 1 
ATOM   8432  O  OE2 . GLU B  1  390 ? 22.053  50.150  -26.864 1.00 41.71  ? 418  GLU B OE2 1 
ATOM   8433  N  N   . SER B  1  391 ? 15.517  51.936  -28.751 1.00 37.92  ? 419  SER B N   1 
ATOM   8434  C  CA  . SER B  1  391 ? 14.356  51.474  -29.505 1.00 37.93  ? 419  SER B CA  1 
ATOM   8435  C  C   . SER B  1  391 ? 13.458  52.662  -29.805 1.00 38.06  ? 419  SER B C   1 
ATOM   8436  O  O   . SER B  1  391 ? 13.864  53.805  -29.593 1.00 37.97  ? 419  SER B O   1 
ATOM   8437  C  CB  . SER B  1  391 ? 13.602  50.383  -28.742 1.00 37.80  ? 419  SER B CB  1 
ATOM   8438  O  OG  . SER B  1  391 ? 13.054  50.899  -27.542 1.00 38.07  ? 419  SER B OG  1 
ATOM   8439  N  N   . GLN B  1  392 ? 12.253  52.395  -30.309 1.00 38.36  ? 420  GLN B N   1 
ATOM   8440  C  CA  . GLN B  1  392 ? 11.295  53.457  -30.630 1.00 38.72  ? 420  GLN B CA  1 
ATOM   8441  C  C   . GLN B  1  392 ? 9.974   53.282  -29.885 1.00 38.62  ? 420  GLN B C   1 
ATOM   8442  O  O   . GLN B  1  392 ? 9.053   54.100  -30.008 1.00 38.59  ? 420  GLN B O   1 
ATOM   8443  C  CB  . GLN B  1  392 ? 11.063  53.540  -32.146 1.00 38.87  ? 420  GLN B CB  1 
ATOM   8444  C  CG  . GLN B  1  392 ? 12.264  54.080  -32.903 1.00 39.75  ? 420  GLN B CG  1 
ATOM   8445  C  CD  . GLN B  1  392 ? 11.886  54.742  -34.212 1.00 40.56  ? 420  GLN B CD  1 
ATOM   8446  O  OE1 . GLN B  1  392 ? 12.013  55.962  -34.357 1.00 40.80  ? 420  GLN B OE1 1 
ATOM   8447  N  NE2 . GLN B  1  392 ? 11.425  53.944  -35.179 1.00 39.63  ? 420  GLN B NE2 1 
ATOM   8448  N  N   . ALA B  1  393 ? 9.888   52.201  -29.124 1.00 38.48  ? 421  ALA B N   1 
ATOM   8449  C  CA  . ALA B  1  393 ? 8.725   51.926  -28.314 1.00 38.48  ? 421  ALA B CA  1 
ATOM   8450  C  C   . ALA B  1  393 ? 9.204   51.473  -26.939 1.00 38.59  ? 421  ALA B C   1 
ATOM   8451  O  O   . ALA B  1  393 ? 10.183  50.730  -26.832 1.00 38.10  ? 421  ALA B O   1 
ATOM   8452  C  CB  . ALA B  1  393 ? 7.846   50.868  -28.974 1.00 38.35  ? 421  ALA B CB  1 
ATOM   8453  N  N   . PRO B  1  394 ? 8.509   51.918  -25.880 1.00 38.90  ? 422  PRO B N   1 
ATOM   8454  C  CA  . PRO B  1  394 ? 8.938   51.596  -24.519 1.00 38.94  ? 422  PRO B CA  1 
ATOM   8455  C  C   . PRO B  1  394 ? 8.819   50.095  -24.234 1.00 39.11  ? 422  PRO B C   1 
ATOM   8456  O  O   . PRO B  1  394 ? 7.983   49.409  -24.824 1.00 38.86  ? 422  PRO B O   1 
ATOM   8457  C  CB  . PRO B  1  394 ? 7.967   52.401  -23.639 1.00 38.70  ? 422  PRO B CB  1 
ATOM   8458  C  CG  . PRO B  1  394 ? 6.751   52.614  -24.499 1.00 38.92  ? 422  PRO B CG  1 
ATOM   8459  C  CD  . PRO B  1  394 ? 7.262   52.715  -25.907 1.00 38.86  ? 422  PRO B CD  1 
ATOM   8460  N  N   . LYS B  1  395 ? 9.672   49.597  -23.347 1.00 39.52  ? 423  LYS B N   1 
ATOM   8461  C  CA  . LYS B  1  395 ? 9.659   48.193  -22.982 1.00 40.00  ? 423  LYS B CA  1 
ATOM   8462  C  C   . LYS B  1  395 ? 9.569   48.064  -21.472 1.00 39.70  ? 423  LYS B C   1 
ATOM   8463  O  O   . LYS B  1  395 ? 9.499   49.063  -20.741 1.00 39.80  ? 423  LYS B O   1 
ATOM   8464  C  CB  . LYS B  1  395 ? 10.918  47.478  -23.482 1.00 39.97  ? 423  LYS B CB  1 
ATOM   8465  C  CG  . LYS B  1  395 ? 10.955  47.106  -24.957 1.00 40.92  ? 423  LYS B CG  1 
ATOM   8466  C  CD  . LYS B  1  395 ? 12.365  46.584  -25.317 1.00 41.99  ? 423  LYS B CD  1 
ATOM   8467  C  CE  . LYS B  1  395 ? 12.494  46.163  -26.797 1.00 45.98  ? 423  LYS B CE  1 
ATOM   8468  N  NZ  . LYS B  1  395 ? 12.642  47.334  -27.726 1.00 46.84  ? 423  LYS B NZ  1 
ATOM   8469  N  N   . THR B  1  396 ? 9.595   46.818  -21.014 1.00 39.33  ? 424  THR B N   1 
ATOM   8470  C  CA  . THR B  1  396 ? 9.421   46.501  -19.616 1.00 38.70  ? 424  THR B CA  1 
ATOM   8471  C  C   . THR B  1  396 ? 10.481  45.509  -19.157 1.00 38.30  ? 424  THR B C   1 
ATOM   8472  O  O   . THR B  1  396 ? 10.789  44.539  -19.853 1.00 37.95  ? 424  THR B O   1 
ATOM   8473  C  CB  . THR B  1  396 ? 8.006   45.908  -19.377 1.00 38.88  ? 424  THR B CB  1 
ATOM   8474  O  OG1 . THR B  1  396 ? 7.014   46.911  -19.638 1.00 39.00  ? 424  THR B OG1 1 
ATOM   8475  C  CG2 . THR B  1  396 ? 7.840   45.393  -17.945 1.00 38.58  ? 424  THR B CG2 1 
ATOM   8476  N  N   . ILE B  1  397 ? 11.050  45.770  -17.989 1.00 37.95  ? 425  ILE B N   1 
ATOM   8477  C  CA  . ILE B  1  397 ? 11.707  44.715  -17.242 1.00 37.95  ? 425  ILE B CA  1 
ATOM   8478  C  C   . ILE B  1  397 ? 10.765  44.287  -16.116 1.00 38.07  ? 425  ILE B C   1 
ATOM   8479  O  O   . ILE B  1  397 ? 10.419  45.087  -15.224 1.00 37.74  ? 425  ILE B O   1 
ATOM   8480  C  CB  . ILE B  1  397 ? 13.087  45.137  -16.708 1.00 38.02  ? 425  ILE B CB  1 
ATOM   8481  C  CG1 . ILE B  1  397 ? 14.042  45.365  -17.879 1.00 38.38  ? 425  ILE B CG1 1 
ATOM   8482  C  CG2 . ILE B  1  397 ? 13.660  44.040  -15.825 1.00 37.20  ? 425  ILE B CG2 1 
ATOM   8483  C  CD1 . ILE B  1  397 ? 15.078  46.410  -17.599 1.00 41.44  ? 425  ILE B CD1 1 
ATOM   8484  N  N   . ARG B  1  398 ? 10.322  43.033  -16.186 1.00 38.06  ? 426  ARG B N   1 
ATOM   8485  C  CA  . ARG B  1  398 ? 9.412   42.497  -15.184 1.00 38.25  ? 426  ARG B CA  1 
ATOM   8486  C  C   . ARG B  1  398 ? 10.147  42.151  -13.908 1.00 37.18  ? 426  ARG B C   1 
ATOM   8487  O  O   . ARG B  1  398 ? 11.256  41.607  -13.946 1.00 36.96  ? 426  ARG B O   1 
ATOM   8488  C  CB  . ARG B  1  398 ? 8.660   41.287  -15.716 1.00 38.86  ? 426  ARG B CB  1 
ATOM   8489  C  CG  . ARG B  1  398 ? 7.380   41.659  -16.443 1.00 42.24  ? 426  ARG B CG  1 
ATOM   8490  C  CD  . ARG B  1  398 ? 6.922   40.552  -17.377 1.00 47.83  ? 426  ARG B CD  1 
ATOM   8491  N  NE  . ARG B  1  398 ? 6.932   39.249  -16.713 1.00 53.18  ? 426  ARG B NE  1 
ATOM   8492  C  CZ  . ARG B  1  398 ? 5.860   38.651  -16.197 1.00 55.84  ? 426  ARG B CZ  1 
ATOM   8493  N  NH1 . ARG B  1  398 ? 4.660   39.229  -16.271 1.00 56.09  ? 426  ARG B NH1 1 
ATOM   8494  N  NH2 . ARG B  1  398 ? 5.993   37.465  -15.611 1.00 56.85  ? 426  ARG B NH2 1 
ATOM   8495  N  N   . ASP B  1  399 ? 9.522   42.501  -12.784 1.00 36.06  ? 427  ASP B N   1 
ATOM   8496  C  CA  . ASP B  1  399 ? 10.082  42.279  -11.443 1.00 34.85  ? 427  ASP B CA  1 
ATOM   8497  C  C   . ASP B  1  399 ? 11.473  42.842  -11.276 1.00 33.97  ? 427  ASP B C   1 
ATOM   8498  O  O   . ASP B  1  399 ? 12.363  42.148  -10.797 1.00 33.72  ? 427  ASP B O   1 
ATOM   8499  C  CB  . ASP B  1  399 ? 10.106  40.792  -11.111 1.00 34.84  ? 427  ASP B CB  1 
ATOM   8500  C  CG  . ASP B  1  399 ? 8.779   40.155  -11.286 1.00 34.37  ? 427  ASP B CG  1 
ATOM   8501  O  OD1 . ASP B  1  399 ? 8.769   39.017  -11.751 1.00 35.28  ? 427  ASP B OD1 1 
ATOM   8502  O  OD2 . ASP B  1  399 ? 7.752   40.790  -10.972 1.00 34.34  ? 427  ASP B OD2 1 
ATOM   8503  N  N   . ALA B  1  400 ? 11.650  44.103  -11.663 1.00 33.30  ? 428  ALA B N   1 
ATOM   8504  C  CA  . ALA B  1  400 ? 12.962  44.731  -11.628 1.00 32.72  ? 428  ALA B CA  1 
ATOM   8505  C  C   . ALA B  1  400 ? 13.320  45.172  -10.220 1.00 32.42  ? 428  ALA B C   1 
ATOM   8506  O  O   . ALA B  1  400 ? 14.503  45.262  -9.885  1.00 33.30  ? 428  ALA B O   1 
ATOM   8507  C  CB  . ALA B  1  400 ? 13.021  45.888  -12.588 1.00 32.43  ? 428  ALA B CB  1 
ATOM   8508  N  N   . PHE B  1  401 ? 12.299  45.463  -9.413  1.00 31.87  ? 429  PHE B N   1 
ATOM   8509  C  CA  . PHE B  1  401 ? 12.473  45.831  -8.003  1.00 31.23  ? 429  PHE B CA  1 
ATOM   8510  C  C   . PHE B  1  401 ? 11.793  44.825  -7.109  1.00 31.08  ? 429  PHE B C   1 
ATOM   8511  O  O   . PHE B  1  401 ? 10.806  44.185  -7.501  1.00 31.04  ? 429  PHE B O   1 
ATOM   8512  C  CB  . PHE B  1  401 ? 11.836  47.190  -7.698  1.00 31.31  ? 429  PHE B CB  1 
ATOM   8513  C  CG  . PHE B  1  401 ? 12.296  48.302  -8.587  1.00 30.41  ? 429  PHE B CG  1 
ATOM   8514  C  CD1 . PHE B  1  401 ? 11.553  48.655  -9.710  1.00 29.85  ? 429  PHE B CD1 1 
ATOM   8515  C  CD2 . PHE B  1  401 ? 13.463  49.012  -8.289  1.00 28.16  ? 429  PHE B CD2 1 
ATOM   8516  C  CE1 . PHE B  1  401 ? 11.978  49.692  -10.546 1.00 30.00  ? 429  PHE B CE1 1 
ATOM   8517  C  CE2 . PHE B  1  401 ? 13.897  50.046  -9.096  1.00 27.58  ? 429  PHE B CE2 1 
ATOM   8518  C  CZ  . PHE B  1  401 ? 13.156  50.394  -10.232 1.00 30.63  ? 429  PHE B CZ  1 
ATOM   8519  N  N   . CYS B  1  402 ? 12.302  44.702  -5.890  1.00 31.08  ? 430  CYS B N   1 
ATOM   8520  C  CA  . CYS B  1  402 ? 11.579  43.983  -4.848  1.00 30.96  ? 430  CYS B CA  1 
ATOM   8521  C  C   . CYS B  1  402 ? 11.646  44.732  -3.521  1.00 30.93  ? 430  CYS B C   1 
ATOM   8522  O  O   . CYS B  1  402 ? 12.691  45.283  -3.161  1.00 30.59  ? 430  CYS B O   1 
ATOM   8523  C  CB  . CYS B  1  402 ? 12.050  42.533  -4.714  1.00 30.89  ? 430  CYS B CB  1 
ATOM   8524  S  SG  . CYS B  1  402 ? 13.596  42.300  -3.851  1.00 31.69  ? 430  CYS B SG  1 
ATOM   8525  N  N   . VAL B  1  403 ? 10.497  44.773  -2.845  1.00 30.93  ? 431  VAL B N   1 
ATOM   8526  C  CA  . VAL B  1  403 ? 10.320  45.440  -1.569  1.00 31.45  ? 431  VAL B CA  1 
ATOM   8527  C  C   . VAL B  1  403 ? 9.736   44.446  -0.571  1.00 31.87  ? 431  VAL B C   1 
ATOM   8528  O  O   . VAL B  1  403 ? 8.729   43.786  -0.862  1.00 32.14  ? 431  VAL B O   1 
ATOM   8529  C  CB  . VAL B  1  403 ? 9.369   46.650  -1.683  1.00 31.50  ? 431  VAL B CB  1 
ATOM   8530  C  CG1 . VAL B  1  403 ? 9.305   47.398  -0.362  1.00 30.34  ? 431  VAL B CG1 1 
ATOM   8531  C  CG2 . VAL B  1  403 ? 9.828   47.584  -2.802  1.00 31.56  ? 431  VAL B CG2 1 
ATOM   8532  N  N   . PHE B  1  404 ? 10.374  44.337  0.595   1.00 31.91  ? 432  PHE B N   1 
ATOM   8533  C  CA  . PHE B  1  404 ? 9.971   43.354  1.589   1.00 32.01  ? 432  PHE B CA  1 
ATOM   8534  C  C   . PHE B  1  404 ? 10.430  43.672  2.995   1.00 32.43  ? 432  PHE B C   1 
ATOM   8535  O  O   . PHE B  1  404 ? 11.452  44.334  3.193   1.00 32.25  ? 432  PHE B O   1 
ATOM   8536  C  CB  . PHE B  1  404 ? 10.467  41.951  1.203   1.00 31.63  ? 432  PHE B CB  1 
ATOM   8537  C  CG  . PHE B  1  404 ? 11.966  41.832  1.072   1.00 31.28  ? 432  PHE B CG  1 
ATOM   8538  C  CD1 . PHE B  1  404 ? 12.737  41.367  2.138   1.00 31.84  ? 432  PHE B CD1 1 
ATOM   8539  C  CD2 . PHE B  1  404 ? 12.609  42.153  -0.125  1.00 30.62  ? 432  PHE B CD2 1 
ATOM   8540  C  CE1 . PHE B  1  404 ? 14.130  41.239  2.019   1.00 31.37  ? 432  PHE B CE1 1 
ATOM   8541  C  CE2 . PHE B  1  404 ? 13.999  42.032  -0.255  1.00 29.16  ? 432  PHE B CE2 1 
ATOM   8542  C  CZ  . PHE B  1  404 ? 14.758  41.569  0.811   1.00 30.29  ? 432  PHE B CZ  1 
ATOM   8543  N  N   . GLU B  1  405 ? 9.664   43.187  3.969   1.00 33.02  ? 433  GLU B N   1 
ATOM   8544  C  CA  . GLU B  1  405 ? 10.124  43.154  5.354   1.00 33.50  ? 433  GLU B CA  1 
ATOM   8545  C  C   . GLU B  1  405 ? 10.878  41.856  5.636   1.00 33.48  ? 433  GLU B C   1 
ATOM   8546  O  O   . GLU B  1  405 ? 10.425  40.778  5.290   1.00 33.59  ? 433  GLU B O   1 
ATOM   8547  C  CB  . GLU B  1  405 ? 8.957   43.320  6.316   1.00 33.38  ? 433  GLU B CB  1 
ATOM   8548  C  CG  . GLU B  1  405 ? 8.669   44.758  6.684   1.00 34.59  ? 433  GLU B CG  1 
ATOM   8549  C  CD  . GLU B  1  405 ? 7.822   44.882  7.942   1.00 35.86  ? 433  GLU B CD  1 
ATOM   8550  O  OE1 . GLU B  1  405 ? 6.771   44.224  8.001   1.00 37.43  ? 433  GLU B OE1 1 
ATOM   8551  O  OE2 . GLU B  1  405 ? 8.199   45.631  8.871   1.00 36.40  ? 433  GLU B OE2 1 
ATOM   8552  N  N   . GLN B  1  406 ? 12.041  41.973  6.253   1.00 33.95  ? 434  GLN B N   1 
ATOM   8553  C  CA  . GLN B  1  406 ? 12.836  40.812  6.636   1.00 34.45  ? 434  GLN B CA  1 
ATOM   8554  C  C   . GLN B  1  406 ? 13.055  40.814  8.161   1.00 34.75  ? 434  GLN B C   1 
ATOM   8555  O  O   . GLN B  1  406 ? 13.578  41.786  8.717   1.00 35.14  ? 434  GLN B O   1 
ATOM   8556  C  CB  . GLN B  1  406 ? 14.164  40.849  5.882   1.00 34.47  ? 434  GLN B CB  1 
ATOM   8557  C  CG  . GLN B  1  406 ? 15.180  39.776  6.251   1.00 36.01  ? 434  GLN B CG  1 
ATOM   8558  C  CD  . GLN B  1  406 ? 14.932  38.420  5.598   1.00 37.16  ? 434  GLN B CD  1 
ATOM   8559  O  OE1 . GLN B  1  406 ? 13.914  38.195  4.929   1.00 39.01  ? 434  GLN B OE1 1 
ATOM   8560  N  NE2 . GLN B  1  406 ? 15.862  37.499  5.808   1.00 36.45  ? 434  GLN B NE2 1 
ATOM   8561  N  N   . ASN B  1  407 ? 12.623  39.757  8.846   1.00 34.71  ? 435  ASN B N   1 
ATOM   8562  C  CA  . ASN B  1  407 ? 13.049  39.555  10.231  1.00 34.96  ? 435  ASN B CA  1 
ATOM   8563  C  C   . ASN B  1  407 ? 14.505  39.094  10.263  1.00 35.09  ? 435  ASN B C   1 
ATOM   8564  O  O   . ASN B  1  407 ? 14.842  38.034  9.733   1.00 34.68  ? 435  ASN B O   1 
ATOM   8565  C  CB  . ASN B  1  407 ? 12.164  38.547  10.957  1.00 34.91  ? 435  ASN B CB  1 
ATOM   8566  C  CG  . ASN B  1  407 ? 12.408  38.533  12.463  1.00 35.43  ? 435  ASN B CG  1 
ATOM   8567  O  OD1 . ASN B  1  407 ? 13.542  38.338  12.934  1.00 34.31  ? 435  ASN B OD1 1 
ATOM   8568  N  ND2 . ASN B  1  407 ? 11.340  38.750  13.228  1.00 33.64  ? 435  ASN B ND2 1 
ATOM   8569  N  N   . GLN B  1  408 ? 15.361  39.896  10.888  1.00 35.54  ? 436  GLN B N   1 
ATOM   8570  C  CA  . GLN B  1  408 ? 16.809  39.642  10.884  1.00 35.98  ? 436  GLN B CA  1 
ATOM   8571  C  C   . GLN B  1  408 ? 17.256  38.416  11.682  1.00 35.87  ? 436  GLN B C   1 
ATOM   8572  O  O   . GLN B  1  408 ? 18.336  37.890  11.441  1.00 36.09  ? 436  GLN B O   1 
ATOM   8573  C  CB  . GLN B  1  408 ? 17.563  40.874  11.359  1.00 35.84  ? 436  GLN B CB  1 
ATOM   8574  C  CG  . GLN B  1  408 ? 17.301  42.112  10.514  1.00 37.36  ? 436  GLN B CG  1 
ATOM   8575  C  CD  . GLN B  1  408 ? 17.949  42.031  9.133   1.00 39.83  ? 436  GLN B CD  1 
ATOM   8576  O  OE1 . GLN B  1  408 ? 17.561  41.208  8.290   1.00 40.35  ? 436  GLN B OE1 1 
ATOM   8577  N  NE2 . GLN B  1  408 ? 18.943  42.885  8.900   1.00 38.90  ? 436  GLN B NE2 1 
ATOM   8578  N  N   . GLY B  1  409 ? 16.418  37.960  12.612  1.00 35.79  ? 437  GLY B N   1 
ATOM   8579  C  CA  . GLY B  1  409 ? 16.752  36.833  13.486  1.00 35.51  ? 437  GLY B CA  1 
ATOM   8580  C  C   . GLY B  1  409 ? 17.784  37.260  14.512  1.00 35.38  ? 437  GLY B C   1 
ATOM   8581  O  O   . GLY B  1  409 ? 18.676  36.492  14.890  1.00 35.84  ? 437  GLY B O   1 
ATOM   8582  N  N   . LEU B  1  410 ? 17.645  38.500  14.966  1.00 34.69  ? 438  LEU B N   1 
ATOM   8583  C  CA  . LEU B  1  410 ? 18.631  39.146  15.796  1.00 33.98  ? 438  LEU B CA  1 
ATOM   8584  C  C   . LEU B  1  410 ? 17.938  40.315  16.494  1.00 33.55  ? 438  LEU B C   1 
ATOM   8585  O  O   . LEU B  1  410 ? 17.145  41.036  15.876  1.00 33.70  ? 438  LEU B O   1 
ATOM   8586  C  CB  . LEU B  1  410 ? 19.768  39.638  14.904  1.00 33.89  ? 438  LEU B CB  1 
ATOM   8587  C  CG  . LEU B  1  410 ? 20.800  40.601  15.482  1.00 34.93  ? 438  LEU B CG  1 
ATOM   8588  C  CD1 . LEU B  1  410 ? 21.962  39.842  16.111  1.00 34.83  ? 438  LEU B CD1 1 
ATOM   8589  C  CD2 . LEU B  1  410 ? 21.284  41.504  14.375  1.00 36.33  ? 438  LEU B CD2 1 
ATOM   8590  N  N   . PRO B  1  411 ? 18.218  40.518  17.787  1.00 32.90  ? 439  PRO B N   1 
ATOM   8591  C  CA  . PRO B  1  411 ? 17.513  41.618  18.428  1.00 32.38  ? 439  PRO B CA  1 
ATOM   8592  C  C   . PRO B  1  411 ? 18.034  42.982  17.963  1.00 32.06  ? 439  PRO B C   1 
ATOM   8593  O  O   . PRO B  1  411 ? 19.203  43.101  17.574  1.00 32.29  ? 439  PRO B O   1 
ATOM   8594  C  CB  . PRO B  1  411 ? 17.814  41.402  19.907  1.00 32.08  ? 439  PRO B CB  1 
ATOM   8595  C  CG  . PRO B  1  411 ? 19.129  40.692  19.921  1.00 32.06  ? 439  PRO B CG  1 
ATOM   8596  C  CD  . PRO B  1  411 ? 19.129  39.817  18.711  1.00 32.85  ? 439  PRO B CD  1 
ATOM   8597  N  N   . LEU B  1  412 ? 17.155  43.981  17.992  1.00 31.30  ? 440  LEU B N   1 
ATOM   8598  C  CA  . LEU B  1  412 ? 17.515  45.374  17.782  1.00 30.47  ? 440  LEU B CA  1 
ATOM   8599  C  C   . LEU B  1  412 ? 18.137  45.922  19.046  1.00 30.37  ? 440  LEU B C   1 
ATOM   8600  O  O   . LEU B  1  412 ? 19.130  46.658  19.001  1.00 30.98  ? 440  LEU B O   1 
ATOM   8601  C  CB  . LEU B  1  412 ? 16.267  46.202  17.461  1.00 30.50  ? 440  LEU B CB  1 
ATOM   8602  C  CG  . LEU B  1  412 ? 16.467  47.707  17.220  1.00 30.37  ? 440  LEU B CG  1 
ATOM   8603  C  CD1 . LEU B  1  412 ? 17.349  47.939  16.017  1.00 30.08  ? 440  LEU B CD1 1 
ATOM   8604  C  CD2 . LEU B  1  412 ? 15.148  48.413  17.023  1.00 30.07  ? 440  LEU B CD2 1 
ATOM   8605  N  N   . ARG B  1  413 ? 17.509  45.580  20.168  1.00 29.96  ? 441  ARG B N   1 
ATOM   8606  C  CA  . ARG B  1  413 ? 17.883  46.017  21.519  1.00 29.13  ? 441  ARG B CA  1 
ATOM   8607  C  C   . ARG B  1  413 ? 17.453  44.914  22.476  1.00 29.75  ? 441  ARG B C   1 
ATOM   8608  O  O   . ARG B  1  413 ? 16.483  44.191  22.220  1.00 29.50  ? 441  ARG B O   1 
ATOM   8609  C  CB  . ARG B  1  413 ? 17.201  47.339  21.909  1.00 28.74  ? 441  ARG B CB  1 
ATOM   8610  C  CG  . ARG B  1  413 ? 15.861  47.617  21.223  1.00 28.84  ? 441  ARG B CG  1 
ATOM   8611  C  CD  . ARG B  1  413 ? 15.142  48.853  21.743  1.00 27.41  ? 441  ARG B CD  1 
ATOM   8612  N  NE  . ARG B  1  413 ? 14.558  48.490  22.998  1.00 27.68  ? 441  ARG B NE  1 
ATOM   8613  C  CZ  . ARG B  1  413 ? 13.260  48.432  23.264  1.00 27.32  ? 441  ARG B CZ  1 
ATOM   8614  N  NH1 . ARG B  1  413 ? 12.350  48.783  22.368  1.00 24.82  ? 441  ARG B NH1 1 
ATOM   8615  N  NH2 . ARG B  1  413 ? 12.887  48.046  24.474  1.00 25.83  ? 441  ARG B NH2 1 
ATOM   8616  N  N   . ARG B  1  414 ? 18.154  44.793  23.595  1.00 30.06  ? 442  ARG B N   1 
ATOM   8617  C  CA  . ARG B  1  414 ? 17.918  43.673  24.473  1.00 30.14  ? 442  ARG B CA  1 
ATOM   8618  C  C   . ARG B  1  414 ? 18.486  43.963  25.845  1.00 30.13  ? 442  ARG B C   1 
ATOM   8619  O  O   . ARG B  1  414 ? 19.576  44.496  25.953  1.00 29.90  ? 442  ARG B O   1 
ATOM   8620  C  CB  . ARG B  1  414 ? 18.615  42.461  23.861  1.00 30.68  ? 442  ARG B CB  1 
ATOM   8621  C  CG  . ARG B  1  414 ? 18.291  41.160  24.487  1.00 30.93  ? 442  ARG B CG  1 
ATOM   8622  C  CD  . ARG B  1  414 ? 19.420  40.688  25.353  1.00 30.41  ? 442  ARG B CD  1 
ATOM   8623  N  NE  . ARG B  1  414 ? 19.055  39.378  25.859  1.00 31.55  ? 442  ARG B NE  1 
ATOM   8624  C  CZ  . ARG B  1  414 ? 19.555  38.830  26.954  1.00 31.89  ? 442  ARG B CZ  1 
ATOM   8625  N  NH1 . ARG B  1  414 ? 20.450  39.493  27.683  1.00 32.03  ? 442  ARG B NH1 1 
ATOM   8626  N  NH2 . ARG B  1  414 ? 19.145  37.624  27.321  1.00 30.66  ? 442  ARG B NH2 1 
ATOM   8627  N  N   . HIS B  1  415 ? 17.739  43.629  26.895  1.00 30.31  ? 443  HIS B N   1 
ATOM   8628  C  CA  . HIS B  1  415 ? 18.287  43.657  28.246  1.00 30.34  ? 443  HIS B CA  1 
ATOM   8629  C  C   . HIS B  1  415 ? 17.574  42.669  29.135  1.00 30.45  ? 443  HIS B C   1 
ATOM   8630  O  O   . HIS B  1  415 ? 16.361  42.741  29.329  1.00 30.24  ? 443  HIS B O   1 
ATOM   8631  C  CB  . HIS B  1  415 ? 18.252  45.056  28.876  1.00 29.89  ? 443  HIS B CB  1 
ATOM   8632  C  CG  . HIS B  1  415 ? 19.036  45.155  30.151  1.00 31.11  ? 443  HIS B CG  1 
ATOM   8633  N  ND1 . HIS B  1  415 ? 20.405  44.979  30.203  1.00 32.27  ? 443  HIS B ND1 1 
ATOM   8634  C  CD2 . HIS B  1  415 ? 18.645  45.406  31.425  1.00 32.02  ? 443  HIS B CD2 1 
ATOM   8635  C  CE1 . HIS B  1  415 ? 20.824  45.118  31.449  1.00 31.73  ? 443  HIS B CE1 1 
ATOM   8636  N  NE2 . HIS B  1  415 ? 19.776  45.375  32.213  1.00 32.48  ? 443  HIS B NE2 1 
ATOM   8637  N  N   . HIS B  1  416 ? 18.343  41.737  29.672  1.00 30.56  ? 444  HIS B N   1 
ATOM   8638  C  CA  . HIS B  1  416 ? 17.824  40.829  30.658  1.00 30.93  ? 444  HIS B CA  1 
ATOM   8639  C  C   . HIS B  1  416 ? 18.439  41.260  31.970  1.00 31.61  ? 444  HIS B C   1 
ATOM   8640  O  O   . HIS B  1  416 ? 19.661  41.326  32.088  1.00 31.93  ? 444  HIS B O   1 
ATOM   8641  C  CB  . HIS B  1  416 ? 18.232  39.406  30.321  1.00 30.84  ? 444  HIS B CB  1 
ATOM   8642  C  CG  . HIS B  1  416 ? 17.786  38.411  31.334  1.00 30.79  ? 444  HIS B CG  1 
ATOM   8643  N  ND1 . HIS B  1  416 ? 16.631  37.675  31.189  1.00 31.06  ? 444  HIS B ND1 1 
ATOM   8644  C  CD2 . HIS B  1  416 ? 18.318  38.056  32.526  1.00 29.81  ? 444  HIS B CD2 1 
ATOM   8645  C  CE1 . HIS B  1  416 ? 16.477  36.900  32.245  1.00 31.49  ? 444  HIS B CE1 1 
ATOM   8646  N  NE2 . HIS B  1  416 ? 17.489  37.110  33.069  1.00 30.78  ? 444  HIS B NE2 1 
ATOM   8647  N  N   . SER B  1  417 ? 17.601  41.556  32.955  1.00 32.12  ? 445  SER B N   1 
ATOM   8648  C  CA  . SER B  1  417 ? 18.090  42.050  34.234  1.00 32.74  ? 445  SER B CA  1 
ATOM   8649  C  C   . SER B  1  417 ? 17.851  41.064  35.354  1.00 33.49  ? 445  SER B C   1 
ATOM   8650  O  O   . SER B  1  417 ? 16.708  40.758  35.689  1.00 33.72  ? 445  SER B O   1 
ATOM   8651  C  CB  . SER B  1  417 ? 17.428  43.386  34.575  1.00 32.75  ? 445  SER B CB  1 
ATOM   8652  O  OG  . SER B  1  417 ? 17.835  43.860  35.842  1.00 31.31  ? 445  SER B OG  1 
ATOM   8653  N  N   . ASP B  1  418 ? 18.940  40.575  35.938  1.00 34.41  ? 446  ASP B N   1 
ATOM   8654  C  CA  . ASP B  1  418 ? 18.860  39.752  37.139  1.00 35.11  ? 446  ASP B CA  1 
ATOM   8655  C  C   . ASP B  1  418 ? 19.249  40.559  38.381  1.00 35.44  ? 446  ASP B C   1 
ATOM   8656  O  O   . ASP B  1  418 ? 19.173  40.057  39.499  1.00 35.34  ? 446  ASP B O   1 
ATOM   8657  C  CB  . ASP B  1  418 ? 19.787  38.542  37.009  1.00 35.43  ? 446  ASP B CB  1 
ATOM   8658  C  CG  . ASP B  1  418 ? 19.300  37.523  35.982  1.00 36.30  ? 446  ASP B CG  1 
ATOM   8659  O  OD1 . ASP B  1  418 ? 18.105  37.133  36.016  1.00 37.88  ? 446  ASP B OD1 1 
ATOM   8660  O  OD2 . ASP B  1  418 ? 20.130  37.088  35.154  1.00 36.94  ? 446  ASP B OD2 1 
ATOM   8661  N  N   . LEU B  1  419 ? 19.665  41.809  38.176  1.00 35.99  ? 447  LEU B N   1 
ATOM   8662  C  CA  . LEU B  1  419 ? 20.296  42.614  39.223  1.00 36.06  ? 447  LEU B CA  1 
ATOM   8663  C  C   . LEU B  1  419 ? 19.351  43.644  39.849  1.00 36.20  ? 447  LEU B C   1 
ATOM   8664  O  O   . LEU B  1  419 ? 19.014  44.655  39.226  1.00 36.04  ? 447  LEU B O   1 
ATOM   8665  C  CB  . LEU B  1  419 ? 21.550  43.285  38.646  1.00 36.17  ? 447  LEU B CB  1 
ATOM   8666  C  CG  . LEU B  1  419 ? 22.535  44.102  39.487  1.00 36.27  ? 447  LEU B CG  1 
ATOM   8667  C  CD1 . LEU B  1  419 ? 23.224  43.262  40.561  1.00 36.61  ? 447  LEU B CD1 1 
ATOM   8668  C  CD2 . LEU B  1  419 ? 23.562  44.732  38.554  1.00 36.03  ? 447  LEU B CD2 1 
ATOM   8669  N  N   . TYR B  1  420 ? 18.939  43.356  41.087  1.00 36.57  ? 448  TYR B N   1 
ATOM   8670  C  CA  . TYR B  1  420 ? 18.063  44.201  41.933  1.00 36.72  ? 448  TYR B CA  1 
ATOM   8671  C  C   . TYR B  1  420 ? 16.590  44.211  41.529  1.00 37.02  ? 448  TYR B C   1 
ATOM   8672  O  O   . TYR B  1  420 ? 15.707  44.306  42.386  1.00 37.38  ? 448  TYR B O   1 
ATOM   8673  C  CB  . TYR B  1  420 ? 18.552  45.648  42.032  1.00 36.61  ? 448  TYR B CB  1 
ATOM   8674  C  CG  . TYR B  1  420 ? 19.980  45.823  42.462  1.00 36.64  ? 448  TYR B CG  1 
ATOM   8675  C  CD1 . TYR B  1  420 ? 20.862  46.589  41.700  1.00 36.15  ? 448  TYR B CD1 1 
ATOM   8676  C  CD2 . TYR B  1  420 ? 20.453  45.236  43.634  1.00 36.50  ? 448  TYR B CD2 1 
ATOM   8677  C  CE1 . TYR B  1  420 ? 22.186  46.762  42.092  1.00 36.29  ? 448  TYR B CE1 1 
ATOM   8678  C  CE2 . TYR B  1  420 ? 21.777  45.402  44.034  1.00 36.70  ? 448  TYR B CE2 1 
ATOM   8679  C  CZ  . TYR B  1  420 ? 22.632  46.170  43.260  1.00 36.73  ? 448  TYR B CZ  1 
ATOM   8680  O  OH  . TYR B  1  420 ? 23.933  46.335  43.657  1.00 36.82  ? 448  TYR B OH  1 
ATOM   8681  N  N   . SER B  1  421 ? 16.339  44.136  40.227  1.00 36.88  ? 449  SER B N   1 
ATOM   8682  C  CA  . SER B  1  421 ? 14.994  44.190  39.669  1.00 36.72  ? 449  SER B CA  1 
ATOM   8683  C  C   . SER B  1  421 ? 14.941  43.226  38.468  1.00 36.38  ? 449  SER B C   1 
ATOM   8684  O  O   . SER B  1  421 ? 15.649  43.414  37.481  1.00 36.42  ? 449  SER B O   1 
ATOM   8685  C  CB  . SER B  1  421 ? 14.663  45.639  39.259  1.00 36.69  ? 449  SER B CB  1 
ATOM   8686  O  OG  . SER B  1  421 ? 13.265  45.847  39.100  1.00 37.44  ? 449  SER B OG  1 
ATOM   8687  N  N   . HIS B  1  422 ? 14.135  42.172  38.582  1.00 36.14  ? 450  HIS B N   1 
ATOM   8688  C  CA  . HIS B  1  422 ? 14.011  41.162  37.530  1.00 35.75  ? 450  HIS B CA  1 
ATOM   8689  C  C   . HIS B  1  422 ? 13.005  41.563  36.444  1.00 34.71  ? 450  HIS B C   1 
ATOM   8690  O  O   . HIS B  1  422 ? 11.787  41.609  36.693  1.00 34.35  ? 450  HIS B O   1 
ATOM   8691  C  CB  . HIS B  1  422 ? 13.628  39.804  38.119  1.00 36.35  ? 450  HIS B CB  1 
ATOM   8692  C  CG  . HIS B  1  422 ? 14.509  39.356  39.242  1.00 39.12  ? 450  HIS B CG  1 
ATOM   8693  N  ND1 . HIS B  1  422 ? 15.882  39.472  39.208  1.00 41.42  ? 450  HIS B ND1 1 
ATOM   8694  C  CD2 . HIS B  1  422 ? 14.209  38.780  40.433  1.00 42.29  ? 450  HIS B CD2 1 
ATOM   8695  C  CE1 . HIS B  1  422 ? 16.391  38.997  40.332  1.00 42.68  ? 450  HIS B CE1 1 
ATOM   8696  N  NE2 . HIS B  1  422 ? 15.397  38.569  41.092  1.00 43.48  ? 450  HIS B NE2 1 
ATOM   8697  N  N   . TYR B  1  423 ? 13.532  41.851  35.252  1.00 33.09  ? 451  TYR B N   1 
ATOM   8698  C  CA  . TYR B  1  423 ? 12.728  42.229  34.085  1.00 31.98  ? 451  TYR B CA  1 
ATOM   8699  C  C   . TYR B  1  423 ? 13.515  41.963  32.799  1.00 31.39  ? 451  TYR B C   1 
ATOM   8700  O  O   . TYR B  1  423 ? 14.750  41.939  32.809  1.00 30.89  ? 451  TYR B O   1 
ATOM   8701  C  CB  . TYR B  1  423 ? 12.337  43.714  34.142  1.00 31.44  ? 451  TYR B CB  1 
ATOM   8702  C  CG  . TYR B  1  423 ? 13.536  44.645  34.095  1.00 31.12  ? 451  TYR B CG  1 
ATOM   8703  C  CD1 . TYR B  1  423 ? 14.037  45.102  32.878  1.00 30.69  ? 451  TYR B CD1 1 
ATOM   8704  C  CD2 . TYR B  1  423 ? 14.184  45.042  35.260  1.00 29.73  ? 451  TYR B CD2 1 
ATOM   8705  C  CE1 . TYR B  1  423 ? 15.146  45.935  32.827  1.00 30.45  ? 451  TYR B CE1 1 
ATOM   8706  C  CE2 . TYR B  1  423 ? 15.287  45.868  35.219  1.00 29.67  ? 451  TYR B CE2 1 
ATOM   8707  C  CZ  . TYR B  1  423 ? 15.764  46.312  34.003  1.00 30.50  ? 451  TYR B CZ  1 
ATOM   8708  O  OH  . TYR B  1  423 ? 16.860  47.138  33.949  1.00 30.61  ? 451  TYR B OH  1 
ATOM   8709  N  N   . PHE B  1  424 ? 12.790  41.758  31.704  1.00 30.91  ? 452  PHE B N   1 
ATOM   8710  C  CA  . PHE B  1  424 ? 13.384  41.662  30.366  1.00 30.55  ? 452  PHE B CA  1 
ATOM   8711  C  C   . PHE B  1  424 ? 12.721  42.689  29.478  1.00 30.54  ? 452  PHE B C   1 
ATOM   8712  O  O   . PHE B  1  424 ? 11.520  42.903  29.571  1.00 31.27  ? 452  PHE B O   1 
ATOM   8713  C  CB  . PHE B  1  424 ? 13.193  40.266  29.755  1.00 29.99  ? 452  PHE B CB  1 
ATOM   8714  C  CG  . PHE B  1  424 ? 13.673  40.155  28.329  1.00 29.81  ? 452  PHE B CG  1 
ATOM   8715  C  CD1 . PHE B  1  424 ? 14.991  39.808  28.048  1.00 29.61  ? 452  PHE B CD1 1 
ATOM   8716  C  CD2 . PHE B  1  424 ? 12.810  40.407  27.264  1.00 30.44  ? 452  PHE B CD2 1 
ATOM   8717  C  CE1 . PHE B  1  424 ? 15.454  39.726  26.737  1.00 29.78  ? 452  PHE B CE1 1 
ATOM   8718  C  CE2 . PHE B  1  424 ? 13.257  40.323  25.937  1.00 30.52  ? 452  PHE B CE2 1 
ATOM   8719  C  CZ  . PHE B  1  424 ? 14.583  39.982  25.675  1.00 30.25  ? 452  PHE B CZ  1 
ATOM   8720  N  N   . GLY B  1  425 ? 13.498  43.315  28.612  1.00 30.33  ? 453  GLY B N   1 
ATOM   8721  C  CA  . GLY B  1  425 ? 12.960  44.233  27.625  1.00 30.41  ? 453  GLY B CA  1 
ATOM   8722  C  C   . GLY B  1  425 ? 13.766  44.166  26.346  1.00 30.59  ? 453  GLY B C   1 
ATOM   8723  O  O   . GLY B  1  425 ? 14.996  44.344  26.362  1.00 31.02  ? 453  GLY B O   1 
ATOM   8724  N  N   . GLY B  1  426 ? 13.084  43.919  25.233  1.00 30.57  ? 454  GLY B N   1 
ATOM   8725  C  CA  . GLY B  1  426 ? 13.756  43.826  23.951  1.00 30.70  ? 454  GLY B CA  1 
ATOM   8726  C  C   . GLY B  1  426 ? 12.832  43.937  22.762  1.00 31.05  ? 454  GLY B C   1 
ATOM   8727  O  O   . GLY B  1  426 ? 11.603  44.023  22.900  1.00 30.57  ? 454  GLY B O   1 
ATOM   8728  N  N   . LEU B  1  427 ? 13.446  43.932  21.584  1.00 31.24  ? 455  LEU B N   1 
ATOM   8729  C  CA  . LEU B  1  427 ? 12.730  43.999  20.322  1.00 31.47  ? 455  LEU B CA  1 
ATOM   8730  C  C   . LEU B  1  427 ? 13.524  43.232  19.268  1.00 31.08  ? 455  LEU B C   1 
ATOM   8731  O  O   . LEU B  1  427 ? 14.737  43.397  19.156  1.00 30.53  ? 455  LEU B O   1 
ATOM   8732  C  CB  . LEU B  1  427 ? 12.550  45.466  19.913  1.00 31.63  ? 455  LEU B CB  1 
ATOM   8733  C  CG  . LEU B  1  427 ? 12.058  45.811  18.504  1.00 32.64  ? 455  LEU B CG  1 
ATOM   8734  C  CD1 . LEU B  1  427 ? 10.681  45.237  18.231  1.00 33.43  ? 455  LEU B CD1 1 
ATOM   8735  C  CD2 . LEU B  1  427 ? 12.045  47.308  18.322  1.00 32.25  ? 455  LEU B CD2 1 
ATOM   8736  N  N   . ALA B  1  428 ? 12.848  42.364  18.523  1.00 31.13  ? 456  ALA B N   1 
ATOM   8737  C  CA  . ALA B  1  428 ? 13.501  41.682  17.415  1.00 31.30  ? 456  ALA B CA  1 
ATOM   8738  C  C   . ALA B  1  428 ? 13.547  42.647  16.254  1.00 31.38  ? 456  ALA B C   1 
ATOM   8739  O  O   . ALA B  1  428 ? 12.590  43.385  16.043  1.00 32.06  ? 456  ALA B O   1 
ATOM   8740  C  CB  . ALA B  1  428 ? 12.749  40.415  17.039  1.00 31.12  ? 456  ALA B CB  1 
ATOM   8741  N  N   . GLU B  1  429 ? 14.652  42.672  15.514  1.00 31.73  ? 457  GLU B N   1 
ATOM   8742  C  CA  . GLU B  1  429 ? 14.779  43.624  14.404  1.00 31.80  ? 457  GLU B CA  1 
ATOM   8743  C  C   . GLU B  1  429 ? 14.143  43.143  13.114  1.00 31.88  ? 457  GLU B C   1 
ATOM   8744  O  O   . GLU B  1  429 ? 14.458  42.053  12.609  1.00 32.15  ? 457  GLU B O   1 
ATOM   8745  C  CB  . GLU B  1  429 ? 16.223  44.022  14.118  1.00 31.65  ? 457  GLU B CB  1 
ATOM   8746  C  CG  . GLU B  1  429 ? 16.276  45.102  13.034  1.00 32.16  ? 457  GLU B CG  1 
ATOM   8747  C  CD  . GLU B  1  429 ? 17.664  45.636  12.723  1.00 32.49  ? 457  GLU B CD  1 
ATOM   8748  O  OE1 . GLU B  1  429 ? 18.668  44.891  12.862  1.00 32.67  ? 457  GLU B OE1 1 
ATOM   8749  O  OE2 . GLU B  1  429 ? 17.730  46.817  12.311  1.00 31.62  ? 457  GLU B OE2 1 
ATOM   8750  N  N   . THR B  1  430 ? 13.244  43.970  12.593  1.00 31.67  ? 458  THR B N   1 
ATOM   8751  C  CA  . THR B  1  430 ? 12.682  43.772  11.267  1.00 31.51  ? 458  THR B CA  1 
ATOM   8752  C  C   . THR B  1  430 ? 13.050  44.984  10.428  1.00 31.39  ? 458  THR B C   1 
ATOM   8753  O  O   . THR B  1  430 ? 12.870  46.128  10.866  1.00 31.63  ? 458  THR B O   1 
ATOM   8754  C  CB  . THR B  1  430 ? 11.147  43.572  11.309  1.00 31.59  ? 458  THR B CB  1 
ATOM   8755  O  OG1 . THR B  1  430 ? 10.847  42.347  11.990  1.00 31.85  ? 458  THR B OG1 1 
ATOM   8756  C  CG2 . THR B  1  430 ? 10.574  43.482  9.902   1.00 31.53  ? 458  THR B CG2 1 
ATOM   8757  N  N   . VAL B  1  431 ? 13.587  44.725  9.236   1.00 30.91  ? 459  VAL B N   1 
ATOM   8758  C  CA  . VAL B  1  431 ? 13.989  45.774  8.320   1.00 30.63  ? 459  VAL B CA  1 
ATOM   8759  C  C   . VAL B  1  431 ? 13.144  45.732  7.067   1.00 30.66  ? 459  VAL B C   1 
ATOM   8760  O  O   . VAL B  1  431 ? 12.638  44.675  6.681   1.00 31.29  ? 459  VAL B O   1 
ATOM   8761  C  CB  . VAL B  1  431 ? 15.486  45.661  7.891   1.00 30.73  ? 459  VAL B CB  1 
ATOM   8762  C  CG1 . VAL B  1  431 ? 16.419  45.790  9.088   1.00 30.13  ? 459  VAL B CG1 1 
ATOM   8763  C  CG2 . VAL B  1  431 ? 15.748  44.377  7.114   1.00 30.63  ? 459  VAL B CG2 1 
ATOM   8764  N  N   . LEU B  1  432 ? 13.021  46.884  6.421   1.00 30.12  ? 460  LEU B N   1 
ATOM   8765  C  CA  . LEU B  1  432 ? 12.352  46.998  5.151   1.00 29.70  ? 460  LEU B CA  1 
ATOM   8766  C  C   . LEU B  1  432 ? 13.422  47.245  4.088   1.00 29.77  ? 460  LEU B C   1 
ATOM   8767  O  O   . LEU B  1  432 ? 14.303  48.098  4.267   1.00 30.03  ? 460  LEU B O   1 
ATOM   8768  C  CB  . LEU B  1  432 ? 11.370  48.151  5.226   1.00 29.56  ? 460  LEU B CB  1 
ATOM   8769  C  CG  . LEU B  1  432 ? 10.712  48.684  3.963   1.00 30.23  ? 460  LEU B CG  1 
ATOM   8770  C  CD1 . LEU B  1  432 ? 9.557   47.808  3.547   1.00 30.07  ? 460  LEU B CD1 1 
ATOM   8771  C  CD2 . LEU B  1  432 ? 10.239  50.104  4.233   1.00 31.04  ? 460  LEU B CD2 1 
ATOM   8772  N  N   . VAL B  1  433 ? 13.338  46.497  2.991   1.00 29.39  ? 461  VAL B N   1 
ATOM   8773  C  CA  . VAL B  1  433 ? 14.393  46.443  1.984   1.00 29.47  ? 461  VAL B CA  1 
ATOM   8774  C  C   . VAL B  1  433 ? 13.882  46.717  0.575   1.00 29.79  ? 461  VAL B C   1 
ATOM   8775  O  O   . VAL B  1  433 ? 12.758  46.307  0.206   1.00 30.02  ? 461  VAL B O   1 
ATOM   8776  C  CB  . VAL B  1  433 ? 15.080  45.064  1.971   1.00 29.51  ? 461  VAL B CB  1 
ATOM   8777  C  CG1 . VAL B  1  433 ? 16.122  45.003  0.869   1.00 30.04  ? 461  VAL B CG1 1 
ATOM   8778  C  CG2 . VAL B  1  433 ? 15.734  44.764  3.320   1.00 29.28  ? 461  VAL B CG2 1 
ATOM   8779  N  N   . VAL B  1  434 ? 14.717  47.406  -0.203  1.00 29.67  ? 462  VAL B N   1 
ATOM   8780  C  CA  . VAL B  1  434 ? 14.459  47.707  -1.619  1.00 29.62  ? 462  VAL B CA  1 
ATOM   8781  C  C   . VAL B  1  434 ? 15.683  47.312  -2.408  1.00 30.02  ? 462  VAL B C   1 
ATOM   8782  O  O   . VAL B  1  434 ? 16.788  47.819  -2.177  1.00 30.32  ? 462  VAL B O   1 
ATOM   8783  C  CB  . VAL B  1  434 ? 14.235  49.207  -1.878  1.00 29.76  ? 462  VAL B CB  1 
ATOM   8784  C  CG1 . VAL B  1  434 ? 13.922  49.467  -3.370  1.00 28.52  ? 462  VAL B CG1 1 
ATOM   8785  C  CG2 . VAL B  1  434 ? 13.158  49.750  -0.958  1.00 29.00  ? 462  VAL B CG2 1 
ATOM   8786  N  N   . ARG B  1  435 ? 15.474  46.405  -3.347  1.00 30.29  ? 463  ARG B N   1 
ATOM   8787  C  CA  . ARG B  1  435 ? 16.559  45.768  -4.046  1.00 30.27  ? 463  ARG B CA  1 
ATOM   8788  C  C   . ARG B  1  435 ? 16.304  45.777  -5.548  1.00 31.00  ? 463  ARG B C   1 
ATOM   8789  O  O   . ARG B  1  435 ? 15.169  45.605  -5.996  1.00 31.46  ? 463  ARG B O   1 
ATOM   8790  C  CB  . ARG B  1  435 ? 16.672  44.334  -3.539  1.00 29.87  ? 463  ARG B CB  1 
ATOM   8791  C  CG  . ARG B  1  435 ? 17.611  43.449  -4.325  1.00 28.78  ? 463  ARG B CG  1 
ATOM   8792  C  CD  . ARG B  1  435 ? 17.758  42.120  -3.649  1.00 26.17  ? 463  ARG B CD  1 
ATOM   8793  N  NE  . ARG B  1  435 ? 18.227  42.278  -2.283  1.00 24.39  ? 463  ARG B NE  1 
ATOM   8794  C  CZ  . ARG B  1  435 ? 18.041  41.382  -1.323  1.00 25.00  ? 463  ARG B CZ  1 
ATOM   8795  N  NH1 . ARG B  1  435 ? 17.391  40.248  -1.575  1.00 25.32  ? 463  ARG B NH1 1 
ATOM   8796  N  NH2 . ARG B  1  435 ? 18.512  41.615  -0.112  1.00 24.82  ? 463  ARG B NH2 1 
ATOM   8797  N  N   . SER B  1  436 ? 17.356  46.011  -6.321  1.00 31.53  ? 464  SER B N   1 
ATOM   8798  C  CA  . SER B  1  436 ? 17.356  45.642  -7.737  1.00 32.40  ? 464  SER B CA  1 
ATOM   8799  C  C   . SER B  1  436 ? 18.729  45.071  -8.101  1.00 32.35  ? 464  SER B C   1 
ATOM   8800  O  O   . SER B  1  436 ? 19.664  45.173  -7.310  1.00 32.06  ? 464  SER B O   1 
ATOM   8801  C  CB  . SER B  1  436 ? 16.941  46.797  -8.650  1.00 32.19  ? 464  SER B CB  1 
ATOM   8802  O  OG  . SER B  1  436 ? 17.704  47.957  -8.388  1.00 34.09  ? 464  SER B OG  1 
ATOM   8803  N  N   . MET B  1  437 ? 18.827  44.438  -9.271  1.00 32.69  ? 465  MET B N   1 
ATOM   8804  C  CA  . MET B  1  437 ? 20.078  43.817  -9.702  1.00 33.23  ? 465  MET B CA  1 
ATOM   8805  C  C   . MET B  1  437 ? 20.450  44.166  -11.141 1.00 33.25  ? 465  MET B C   1 
ATOM   8806  O  O   . MET B  1  437 ? 19.628  44.039  -12.052 1.00 33.70  ? 465  MET B O   1 
ATOM   8807  C  CB  . MET B  1  437 ? 20.028  42.302  -9.503  1.00 33.12  ? 465  MET B CB  1 
ATOM   8808  C  CG  . MET B  1  437 ? 19.953  41.879  -8.042  1.00 32.90  ? 465  MET B CG  1 
ATOM   8809  S  SD  . MET B  1  437 ? 19.769  40.100  -7.902  1.00 33.95  ? 465  MET B SD  1 
ATOM   8810  C  CE  . MET B  1  437 ? 19.427  39.878  -6.147  1.00 34.43  ? 465  MET B CE  1 
ATOM   8811  N  N   . SER B  1  438 ? 21.683  44.625  -11.325 1.00 33.16  ? 466  SER B N   1 
ATOM   8812  C  CA  . SER B  1  438 ? 22.226  44.891  -12.639 1.00 33.43  ? 466  SER B CA  1 
ATOM   8813  C  C   . SER B  1  438 ? 23.162  43.749  -13.012 1.00 34.12  ? 466  SER B C   1 
ATOM   8814  O  O   . SER B  1  438 ? 24.110  43.445  -12.277 1.00 34.08  ? 466  SER B O   1 
ATOM   8815  C  CB  . SER B  1  438 ? 23.028  46.195  -12.641 1.00 33.37  ? 466  SER B CB  1 
ATOM   8816  O  OG  . SER B  1  438 ? 22.288  47.292  -12.146 1.00 33.32  ? 466  SER B OG  1 
ATOM   8817  N  N   . THR B  1  439 ? 22.902  43.122  -14.157 1.00 34.59  ? 467  THR B N   1 
ATOM   8818  C  CA  . THR B  1  439 ? 23.801  42.123  -14.709 1.00 34.73  ? 467  THR B CA  1 
ATOM   8819  C  C   . THR B  1  439 ? 24.468  42.742  -15.920 1.00 35.12  ? 467  THR B C   1 
ATOM   8820  O  O   . THR B  1  439 ? 23.843  42.890  -16.975 1.00 35.09  ? 467  THR B O   1 
ATOM   8821  C  CB  . THR B  1  439 ? 23.045  40.838  -15.107 1.00 34.97  ? 467  THR B CB  1 
ATOM   8822  O  OG1 . THR B  1  439 ? 22.427  40.275  -13.940 1.00 35.97  ? 467  THR B OG1 1 
ATOM   8823  C  CG2 . THR B  1  439 ? 23.985  39.807  -15.735 1.00 33.52  ? 467  THR B CG2 1 
ATOM   8824  N  N   . LEU B  1  440 ? 25.732  43.128  -15.755 1.00 35.24  ? 468  LEU B N   1 
ATOM   8825  C  CA  . LEU B  1  440 ? 26.511  43.684  -16.860 1.00 35.47  ? 468  LEU B CA  1 
ATOM   8826  C  C   . LEU B  1  440 ? 27.576  42.706  -17.339 1.00 35.72  ? 468  LEU B C   1 
ATOM   8827  O  O   . LEU B  1  440 ? 28.596  42.500  -16.661 1.00 35.98  ? 468  LEU B O   1 
ATOM   8828  C  CB  . LEU B  1  440 ? 27.166  44.997  -16.455 1.00 35.19  ? 468  LEU B CB  1 
ATOM   8829  C  CG  . LEU B  1  440 ? 26.282  46.213  -16.215 1.00 35.81  ? 468  LEU B CG  1 
ATOM   8830  C  CD1 . LEU B  1  440 ? 26.338  46.617  -14.755 1.00 37.16  ? 468  LEU B CD1 1 
ATOM   8831  C  CD2 . LEU B  1  440 ? 26.792  47.337  -17.072 1.00 36.30  ? 468  LEU B CD2 1 
ATOM   8832  N  N   . LEU B  1  441 ? 27.349  42.115  -18.510 1.00 35.88  ? 469  LEU B N   1 
ATOM   8833  C  CA  . LEU B  1  441 ? 28.245  41.076  -19.035 1.00 36.29  ? 469  LEU B CA  1 
ATOM   8834  C  C   . LEU B  1  441 ? 28.302  39.915  -18.020 1.00 36.76  ? 469  LEU B C   1 
ATOM   8835  O  O   . LEU B  1  441 ? 27.264  39.324  -17.715 1.00 36.83  ? 469  LEU B O   1 
ATOM   8836  C  CB  . LEU B  1  441 ? 29.641  41.653  -19.352 1.00 36.02  ? 469  LEU B CB  1 
ATOM   8837  C  CG  . LEU B  1  441 ? 29.760  42.778  -20.395 1.00 35.72  ? 469  LEU B CG  1 
ATOM   8838  C  CD1 . LEU B  1  441 ? 30.837  43.778  -20.013 1.00 36.90  ? 469  LEU B CD1 1 
ATOM   8839  C  CD2 . LEU B  1  441 ? 30.003  42.279  -21.800 1.00 34.89  ? 469  LEU B CD2 1 
ATOM   8840  N  N   . ASN B  1  442 ? 29.485  39.633  -17.462 1.00 37.37  ? 470  ASN B N   1 
ATOM   8841  C  CA  . ASN B  1  442 ? 29.680  38.522  -16.507 1.00 37.72  ? 470  ASN B CA  1 
ATOM   8842  C  C   . ASN B  1  442 ? 29.107  38.680  -15.088 1.00 38.60  ? 470  ASN B C   1 
ATOM   8843  O  O   . ASN B  1  442 ? 28.582  37.727  -14.516 1.00 38.94  ? 470  ASN B O   1 
ATOM   8844  C  CB  . ASN B  1  442 ? 31.154  38.131  -16.419 1.00 37.20  ? 470  ASN B CB  1 
ATOM   8845  C  CG  . ASN B  1  442 ? 32.052  39.293  -16.010 1.00 37.01  ? 470  ASN B CG  1 
ATOM   8846  O  OD1 . ASN B  1  442 ? 32.190  40.273  -16.733 1.00 36.24  ? 470  ASN B OD1 1 
ATOM   8847  N  ND2 . ASN B  1  442 ? 32.681  39.171  -14.850 1.00 36.61  ? 470  ASN B ND2 1 
HETATM 8848  N  N   . TPQ B  1  443 ? 29.198  39.864  -14.502 1.00 39.65  ? 471  TPQ B N   1 
HETATM 8849  C  CA  . TPQ B  1  443 ? 28.791  39.969  -13.112 1.00 40.86  ? 471  TPQ B CA  1 
HETATM 8850  C  CB  . TPQ B  1  443 ? 29.770  40.705  -12.201 1.00 43.32  ? 471  TPQ B CB  1 
HETATM 8851  C  C   . TPQ B  1  443 ? 27.435  40.547  -12.885 1.00 39.92  ? 471  TPQ B C   1 
HETATM 8852  O  O   . TPQ B  1  443 ? 26.849  41.253  -13.738 1.00 39.65  ? 471  TPQ B O   1 
HETATM 8853  C  C1  . TPQ B  1  443 ? 30.371  41.929  -12.836 1.00 45.54  ? 471  TPQ B C1  1 
HETATM 8854  C  C2  . TPQ B  1  443 ? 31.797  42.199  -12.551 1.00 47.75  ? 471  TPQ B C2  1 
HETATM 8855  O  O2  . TPQ B  1  443 ? 32.443  41.325  -11.734 1.00 49.22  ? 471  TPQ B O2  1 
HETATM 8856  C  C3  . TPQ B  1  443 ? 32.442  43.308  -13.100 1.00 48.25  ? 471  TPQ B C3  1 
HETATM 8857  C  C4  . TPQ B  1  443 ? 31.713  44.167  -13.923 1.00 47.79  ? 471  TPQ B C4  1 
HETATM 8858  O  O4  . TPQ B  1  443 ? 32.281  45.277  -14.481 1.00 47.11  ? 471  TPQ B O4  1 
HETATM 8859  C  C5  . TPQ B  1  443 ? 30.273  43.879  -14.205 1.00 49.53  ? 471  TPQ B C5  1 
HETATM 8860  O  O5  . TPQ B  1  443 ? 29.566  44.723  -15.018 1.00 50.17  ? 471  TPQ B O5  1 
HETATM 8861  C  C6  . TPQ B  1  443 ? 29.636  42.773  -13.652 1.00 47.24  ? 471  TPQ B C6  1 
ATOM   8862  N  N   . ASP B  1  444 ? 26.935  40.236  -11.698 1.00 38.75  ? 472  ASP B N   1 
ATOM   8863  C  CA  . ASP B  1  444 ? 25.654  40.680  -11.232 1.00 37.46  ? 472  ASP B CA  1 
ATOM   8864  C  C   . ASP B  1  444 ? 25.869  41.506  -9.982  1.00 36.94  ? 472  ASP B C   1 
ATOM   8865  O  O   . ASP B  1  444 ? 26.322  41.008  -8.942  1.00 36.32  ? 472  ASP B O   1 
ATOM   8866  C  CB  . ASP B  1  444 ? 24.750  39.482  -10.948 1.00 37.09  ? 472  ASP B CB  1 
ATOM   8867  C  CG  . ASP B  1  444 ? 24.562  38.600  -12.160 1.00 36.74  ? 472  ASP B CG  1 
ATOM   8868  O  OD1 . ASP B  1  444 ? 25.571  38.049  -12.653 1.00 37.48  ? 472  ASP B OD1 1 
ATOM   8869  O  OD2 . ASP B  1  444 ? 23.409  38.440  -12.616 1.00 35.11  ? 472  ASP B OD2 1 
ATOM   8870  N  N   . TYR B  1  445 ? 25.563  42.788  -10.112 1.00 36.74  ? 473  TYR B N   1 
ATOM   8871  C  CA  . TYR B  1  445 ? 25.534  43.693  -8.984  1.00 36.66  ? 473  TYR B CA  1 
ATOM   8872  C  C   . TYR B  1  445 ? 24.186  43.615  -8.272  1.00 35.81  ? 473  TYR B C   1 
ATOM   8873  O  O   . TYR B  1  445 ? 23.140  43.684  -8.926  1.00 35.30  ? 473  TYR B O   1 
ATOM   8874  C  CB  . TYR B  1  445 ? 25.741  45.114  -9.463  1.00 37.41  ? 473  TYR B CB  1 
ATOM   8875  C  CG  . TYR B  1  445 ? 27.126  45.440  -9.936  1.00 39.09  ? 473  TYR B CG  1 
ATOM   8876  C  CD1 . TYR B  1  445 ? 27.352  45.860  -11.251 1.00 40.30  ? 473  TYR B CD1 1 
ATOM   8877  C  CD2 . TYR B  1  445 ? 28.211  45.383  -9.066  1.00 41.70  ? 473  TYR B CD2 1 
ATOM   8878  C  CE1 . TYR B  1  445 ? 28.630  46.204  -11.689 1.00 41.25  ? 473  TYR B CE1 1 
ATOM   8879  C  CE2 . TYR B  1  445 ? 29.507  45.710  -9.497  1.00 42.03  ? 473  TYR B CE2 1 
ATOM   8880  C  CZ  . TYR B  1  445 ? 29.708  46.121  -10.810 1.00 41.14  ? 473  TYR B CZ  1 
ATOM   8881  O  OH  . TYR B  1  445 ? 30.986  46.442  -11.234 1.00 41.28  ? 473  TYR B OH  1 
ATOM   8882  N  N   . VAL B  1  446 ? 24.228  43.474  -6.942  1.00 34.97  ? 474  VAL B N   1 
ATOM   8883  C  CA  . VAL B  1  446 ? 23.039  43.564  -6.087  1.00 34.60  ? 474  VAL B CA  1 
ATOM   8884  C  C   . VAL B  1  446 ? 23.050  44.897  -5.322  1.00 34.24  ? 474  VAL B C   1 
ATOM   8885  O  O   . VAL B  1  446 ? 23.984  45.174  -4.568  1.00 33.88  ? 474  VAL B O   1 
ATOM   8886  C  CB  . VAL B  1  446 ? 22.939  42.397  -5.041  1.00 34.91  ? 474  VAL B CB  1 
ATOM   8887  C  CG1 . VAL B  1  446 ? 21.581  42.427  -4.333  1.00 34.23  ? 474  VAL B CG1 1 
ATOM   8888  C  CG2 . VAL B  1  446 ? 23.181  41.013  -5.684  1.00 34.69  ? 474  VAL B CG2 1 
ATOM   8889  N  N   . TRP B  1  447 ? 22.013  45.710  -5.508  1.00 33.40  ? 475  TRP B N   1 
ATOM   8890  C  CA  . TRP B  1  447 ? 21.920  46.996  -4.820  1.00 32.95  ? 475  TRP B CA  1 
ATOM   8891  C  C   . TRP B  1  447 ? 20.815  46.976  -3.780  1.00 32.80  ? 475  TRP B C   1 
ATOM   8892  O  O   . TRP B  1  447 ? 19.652  46.789  -4.111  1.00 32.94  ? 475  TRP B O   1 
ATOM   8893  C  CB  . TRP B  1  447 ? 21.673  48.131  -5.810  1.00 32.89  ? 475  TRP B CB  1 
ATOM   8894  C  CG  . TRP B  1  447 ? 22.505  48.024  -7.060  1.00 33.64  ? 475  TRP B CG  1 
ATOM   8895  C  CD1 . TRP B  1  447 ? 22.088  47.562  -8.282  1.00 33.40  ? 475  TRP B CD1 1 
ATOM   8896  C  CD2 . TRP B  1  447 ? 23.889  48.370  -7.214  1.00 33.15  ? 475  TRP B CD2 1 
ATOM   8897  N  NE1 . TRP B  1  447 ? 23.115  47.618  -9.183  1.00 33.99  ? 475  TRP B NE1 1 
ATOM   8898  C  CE2 . TRP B  1  447 ? 24.237  48.099  -8.558  1.00 34.03  ? 475  TRP B CE2 1 
ATOM   8899  C  CE3 . TRP B  1  447 ? 24.869  48.881  -6.348  1.00 33.12  ? 475  TRP B CE3 1 
ATOM   8900  C  CZ2 . TRP B  1  447 ? 25.532  48.316  -9.064  1.00 33.22  ? 475  TRP B CZ2 1 
ATOM   8901  C  CZ3 . TRP B  1  447 ? 26.160  49.097  -6.846  1.00 32.90  ? 475  TRP B CZ3 1 
ATOM   8902  C  CH2 . TRP B  1  447 ? 26.475  48.813  -8.196  1.00 33.86  ? 475  TRP B CH2 1 
ATOM   8903  N  N   . ASP B  1  448 ? 21.188  47.164  -2.524  1.00 32.55  ? 476  ASP B N   1 
ATOM   8904  C  CA  . ASP B  1  448 ? 20.235  47.189  -1.438  1.00 32.77  ? 476  ASP B CA  1 
ATOM   8905  C  C   . ASP B  1  448 ? 20.179  48.541  -0.767  1.00 32.33  ? 476  ASP B C   1 
ATOM   8906  O  O   . ASP B  1  448 ? 21.218  49.160  -0.484  1.00 32.20  ? 476  ASP B O   1 
ATOM   8907  C  CB  . ASP B  1  448 ? 20.588  46.136  -0.379  1.00 33.25  ? 476  ASP B CB  1 
ATOM   8908  C  CG  . ASP B  1  448 ? 20.182  44.725  -0.790  1.00 35.62  ? 476  ASP B CG  1 
ATOM   8909  O  OD1 . ASP B  1  448 ? 19.683  44.540  -1.928  1.00 37.93  ? 476  ASP B OD1 1 
ATOM   8910  O  OD2 . ASP B  1  448 ? 20.372  43.793  0.029   1.00 37.54  ? 476  ASP B OD2 1 
ATOM   8911  N  N   . THR B  1  449 ? 18.958  48.994  -0.511  1.00 31.81  ? 477  THR B N   1 
ATOM   8912  C  CA  . THR B  1  449 ? 18.749  49.996  0.510   1.00 31.46  ? 477  THR B CA  1 
ATOM   8913  C  C   . THR B  1  449 ? 17.898  49.385  1.620   1.00 31.24  ? 477  THR B C   1 
ATOM   8914  O  O   . THR B  1  449 ? 16.846  48.798  1.363   1.00 31.30  ? 477  THR B O   1 
ATOM   8915  C  CB  . THR B  1  449 ? 18.146  51.272  -0.052  1.00 31.50  ? 477  THR B CB  1 
ATOM   8916  O  OG1 . THR B  1  449 ? 18.989  51.749  -1.103  1.00 31.87  ? 477  THR B OG1 1 
ATOM   8917  C  CG2 . THR B  1  449 ? 18.076  52.338  1.033   1.00 31.20  ? 477  THR B CG2 1 
ATOM   8918  N  N   . VAL B  1  450 ? 18.387  49.500  2.848   1.00 30.83  ? 478  VAL B N   1 
ATOM   8919  C  CA  . VAL B  1  450 ? 17.784  48.836  3.992   1.00 30.52  ? 478  VAL B CA  1 
ATOM   8920  C  C   . VAL B  1  450 ? 17.308  49.897  4.976   1.00 30.56  ? 478  VAL B C   1 
ATOM   8921  O  O   . VAL B  1  450 ? 18.080  50.781  5.362   1.00 31.44  ? 478  VAL B O   1 
ATOM   8922  C  CB  . VAL B  1  450 ? 18.796  47.879  4.677   1.00 30.43  ? 478  VAL B CB  1 
ATOM   8923  C  CG1 . VAL B  1  450 ? 18.153  47.168  5.860   1.00 29.93  ? 478  VAL B CG1 1 
ATOM   8924  C  CG2 . VAL B  1  450 ? 19.321  46.861  3.679   1.00 29.06  ? 478  VAL B CG2 1 
ATOM   8925  N  N   . PHE B  1  451 ? 16.042  49.819  5.370   1.00 29.73  ? 479  PHE B N   1 
ATOM   8926  C  CA  . PHE B  1  451 ? 15.480  50.804  6.281   1.00 28.99  ? 479  PHE B CA  1 
ATOM   8927  C  C   . PHE B  1  451 ? 15.291  50.214  7.683   1.00 28.67  ? 479  PHE B C   1 
ATOM   8928  O  O   . PHE B  1  451 ? 14.489  49.300  7.893   1.00 28.23  ? 479  PHE B O   1 
ATOM   8929  C  CB  . PHE B  1  451 ? 14.184  51.399  5.699   1.00 28.86  ? 479  PHE B CB  1 
ATOM   8930  C  CG  . PHE B  1  451 ? 14.397  52.152  4.406   1.00 29.15  ? 479  PHE B CG  1 
ATOM   8931  C  CD1 . PHE B  1  451 ? 14.315  51.500  3.175   1.00 30.36  ? 479  PHE B CD1 1 
ATOM   8932  C  CD2 . PHE B  1  451 ? 14.706  53.508  4.412   1.00 28.08  ? 479  PHE B CD2 1 
ATOM   8933  C  CE1 . PHE B  1  451 ? 14.529  52.200  1.974   1.00 29.50  ? 479  PHE B CE1 1 
ATOM   8934  C  CE2 . PHE B  1  451 ? 14.916  54.199  3.222   1.00 27.31  ? 479  PHE B CE2 1 
ATOM   8935  C  CZ  . PHE B  1  451 ? 14.821  53.551  2.007   1.00 27.58  ? 479  PHE B CZ  1 
ATOM   8936  N  N   . HIS B  1  452 ? 16.062  50.728  8.635   1.00 28.55  ? 480  HIS B N   1 
ATOM   8937  C  CA  . HIS B  1  452 ? 16.070  50.193  9.995   1.00 28.54  ? 480  HIS B CA  1 
ATOM   8938  C  C   . HIS B  1  452 ? 15.059  50.913  10.910  1.00 28.34  ? 480  HIS B C   1 
ATOM   8939  O  O   . HIS B  1  452 ? 14.829  52.110  10.748  1.00 27.98  ? 480  HIS B O   1 
ATOM   8940  C  CB  . HIS B  1  452 ? 17.483  50.259  10.567  1.00 28.39  ? 480  HIS B CB  1 
ATOM   8941  C  CG  . HIS B  1  452 ? 18.446  49.297  9.933   1.00 29.82  ? 480  HIS B CG  1 
ATOM   8942  N  ND1 . HIS B  1  452 ? 18.781  48.090  10.509  1.00 30.38  ? 480  HIS B ND1 1 
ATOM   8943  C  CD2 . HIS B  1  452 ? 19.163  49.373  8.786   1.00 30.88  ? 480  HIS B CD2 1 
ATOM   8944  C  CE1 . HIS B  1  452 ? 19.649  47.457  9.739   1.00 29.47  ? 480  HIS B CE1 1 
ATOM   8945  N  NE2 . HIS B  1  452 ? 19.896  48.212  8.685   1.00 29.72  ? 480  HIS B NE2 1 
ATOM   8946  N  N   . PRO B  1  453 ? 14.460  50.184  11.884  1.00 28.30  ? 481  PRO B N   1 
ATOM   8947  C  CA  . PRO B  1  453 ? 13.496  50.819  12.799  1.00 28.06  ? 481  PRO B CA  1 
ATOM   8948  C  C   . PRO B  1  453 ? 14.129  51.779  13.822  1.00 27.75  ? 481  PRO B C   1 
ATOM   8949  O  O   . PRO B  1  453 ? 13.407  52.522  14.489  1.00 27.83  ? 481  PRO B O   1 
ATOM   8950  C  CB  . PRO B  1  453 ? 12.801  49.641  13.504  1.00 27.19  ? 481  PRO B CB  1 
ATOM   8951  C  CG  . PRO B  1  453 ? 13.577  48.433  13.191  1.00 28.10  ? 481  PRO B CG  1 
ATOM   8952  C  CD  . PRO B  1  453 ? 14.679  48.760  12.207  1.00 28.83  ? 481  PRO B CD  1 
ATOM   8953  N  N   . SER B  1  454 ? 15.456  51.778  13.938  1.00 27.70  ? 482  SER B N   1 
ATOM   8954  C  CA  . SER B  1  454 ? 16.148  52.756  14.787  1.00 27.06  ? 482  SER B CA  1 
ATOM   8955  C  C   . SER B  1  454 ? 16.178  54.091  14.077  1.00 27.32  ? 482  SER B C   1 
ATOM   8956  O  O   . SER B  1  454 ? 16.533  55.107  14.655  1.00 27.07  ? 482  SER B O   1 
ATOM   8957  C  CB  . SER B  1  454 ? 17.579  52.325  15.016  1.00 27.05  ? 482  SER B CB  1 
ATOM   8958  O  OG  . SER B  1  454 ? 18.264  52.306  13.778  1.00 26.23  ? 482  SER B OG  1 
ATOM   8959  N  N   . GLY B  1  455 ? 15.832  54.069  12.793  1.00 27.79  ? 483  GLY B N   1 
ATOM   8960  C  CA  . GLY B  1  455 ? 15.873  55.271  11.973  1.00 27.61  ? 483  GLY B CA  1 
ATOM   8961  C  C   . GLY B  1  455 ? 17.143  55.319  11.147  1.00 27.22  ? 483  GLY B C   1 
ATOM   8962  O  O   . GLY B  1  455 ? 17.422  56.323  10.489  1.00 27.10  ? 483  GLY B O   1 
ATOM   8963  N  N   . ALA B  1  456 ? 17.915  54.240  11.198  1.00 27.04  ? 484  ALA B N   1 
ATOM   8964  C  CA  . ALA B  1  456 ? 19.115  54.115  10.380  1.00 27.51  ? 484  ALA B CA  1 
ATOM   8965  C  C   . ALA B  1  456 ? 18.766  53.693  8.954   1.00 27.92  ? 484  ALA B C   1 
ATOM   8966  O  O   . ALA B  1  456 ? 17.835  52.921  8.744   1.00 28.13  ? 484  ALA B O   1 
ATOM   8967  C  CB  . ALA B  1  456 ? 20.094  53.121  11.008  1.00 27.40  ? 484  ALA B CB  1 
ATOM   8968  N  N   . ILE B  1  457 ? 19.511  54.222  7.986   1.00 28.77  ? 485  ILE B N   1 
ATOM   8969  C  CA  . ILE B  1  457 ? 19.433  53.814  6.581   1.00 29.47  ? 485  ILE B CA  1 
ATOM   8970  C  C   . ILE B  1  457 ? 20.753  53.140  6.204   1.00 30.74  ? 485  ILE B C   1 
ATOM   8971  O  O   . ILE B  1  457 ? 21.826  53.660  6.512   1.00 31.36  ? 485  ILE B O   1 
ATOM   8972  C  CB  . ILE B  1  457 ? 19.210  55.040  5.669   1.00 29.20  ? 485  ILE B CB  1 
ATOM   8973  C  CG1 . ILE B  1  457 ? 17.919  55.779  6.061   1.00 29.30  ? 485  ILE B CG1 1 
ATOM   8974  C  CG2 . ILE B  1  457 ? 19.196  54.634  4.212   1.00 28.91  ? 485  ILE B CG2 1 
ATOM   8975  C  CD1 . ILE B  1  457 ? 17.704  57.110  5.335   1.00 28.75  ? 485  ILE B CD1 1 
ATOM   8976  N  N   . GLU B  1  458 ? 20.683  51.987  5.550   1.00 31.87  ? 486  GLU B N   1 
ATOM   8977  C  CA  . GLU B  1  458 ? 21.886  51.240  5.181   1.00 33.38  ? 486  GLU B CA  1 
ATOM   8978  C  C   . GLU B  1  458 ? 21.915  50.953  3.689   1.00 33.91  ? 486  GLU B C   1 
ATOM   8979  O  O   . GLU B  1  458 ? 20.953  50.426  3.144   1.00 33.79  ? 486  GLU B O   1 
ATOM   8980  C  CB  . GLU B  1  458 ? 21.947  49.920  5.959   1.00 33.43  ? 486  GLU B CB  1 
ATOM   8981  C  CG  . GLU B  1  458 ? 23.103  48.987  5.572   1.00 34.39  ? 486  GLU B CG  1 
ATOM   8982  C  CD  . GLU B  1  458 ? 22.942  47.572  6.123   1.00 34.84  ? 486  GLU B CD  1 
ATOM   8983  O  OE1 . GLU B  1  458 ? 21.959  47.302  6.845   1.00 37.40  ? 486  GLU B OE1 1 
ATOM   8984  O  OE2 . GLU B  1  458 ? 23.814  46.725  5.853   1.00 37.24  ? 486  GLU B OE2 1 
ATOM   8985  N  N   . ILE B  1  459 ? 23.021  51.304  3.035   1.00 35.16  ? 487  ILE B N   1 
ATOM   8986  C  CA  . ILE B  1  459 ? 23.232  50.970  1.624   1.00 36.01  ? 487  ILE B CA  1 
ATOM   8987  C  C   . ILE B  1  459 ? 24.313  49.909  1.479   1.00 36.18  ? 487  ILE B C   1 
ATOM   8988  O  O   . ILE B  1  459 ? 25.410  50.049  2.005   1.00 36.05  ? 487  ILE B O   1 
ATOM   8989  C  CB  . ILE B  1  459 ? 23.598  52.207  0.763   1.00 36.22  ? 487  ILE B CB  1 
ATOM   8990  C  CG1 . ILE B  1  459 ? 22.357  53.037  0.450   1.00 37.05  ? 487  ILE B CG1 1 
ATOM   8991  C  CG2 . ILE B  1  459 ? 24.170  51.779  -0.573  1.00 36.47  ? 487  ILE B CG2 1 
ATOM   8992  C  CD1 . ILE B  1  459 ? 22.070  54.111  1.467   1.00 38.82  ? 487  ILE B CD1 1 
ATOM   8993  N  N   . ARG B  1  460 ? 24.001  48.835  0.769   1.00 36.99  ? 488  ARG B N   1 
ATOM   8994  C  CA  . ARG B  1  460 ? 25.020  47.821  0.491   1.00 37.77  ? 488  ARG B CA  1 
ATOM   8995  C  C   . ARG B  1  460 ? 24.978  47.401  -0.952  1.00 37.53  ? 488  ARG B C   1 
ATOM   8996  O  O   . ARG B  1  460 ? 23.920  47.429  -1.572  1.00 37.40  ? 488  ARG B O   1 
ATOM   8997  C  CB  . ARG B  1  460 ? 24.850  46.600  1.394   1.00 37.87  ? 488  ARG B CB  1 
ATOM   8998  C  CG  . ARG B  1  460 ? 25.564  46.739  2.705   1.00 41.05  ? 488  ARG B CG  1 
ATOM   8999  C  CD  . ARG B  1  460 ? 25.601  45.426  3.432   1.00 45.66  ? 488  ARG B CD  1 
ATOM   9000  N  NE  . ARG B  1  460 ? 26.094  45.548  4.805   1.00 49.07  ? 488  ARG B NE  1 
ATOM   9001  C  CZ  . ARG B  1  460 ? 27.376  45.704  5.141   1.00 52.14  ? 488  ARG B CZ  1 
ATOM   9002  N  NH1 . ARG B  1  460 ? 28.308  45.797  4.203   1.00 52.61  ? 488  ARG B NH1 1 
ATOM   9003  N  NH2 . ARG B  1  460 ? 27.729  45.780  6.425   1.00 53.76  ? 488  ARG B NH2 1 
ATOM   9004  N  N   . PHE B  1  461 ? 26.137  47.030  -1.484  1.00 37.74  ? 489  PHE B N   1 
ATOM   9005  C  CA  . PHE B  1  461 ? 26.187  46.331  -2.756  1.00 38.13  ? 489  PHE B CA  1 
ATOM   9006  C  C   . PHE B  1  461 ? 27.087  45.103  -2.749  1.00 38.00  ? 489  PHE B C   1 
ATOM   9007  O  O   . PHE B  1  461 ? 28.056  45.032  -1.988  1.00 38.18  ? 489  PHE B O   1 
ATOM   9008  C  CB  . PHE B  1  461 ? 26.484  47.282  -3.918  1.00 38.77  ? 489  PHE B CB  1 
ATOM   9009  C  CG  . PHE B  1  461 ? 27.944  47.483  -4.223  1.00 39.87  ? 489  PHE B CG  1 
ATOM   9010  C  CD1 . PHE B  1  461 ? 28.567  46.734  -5.223  1.00 41.79  ? 489  PHE B CD1 1 
ATOM   9011  C  CD2 . PHE B  1  461 ? 28.677  48.475  -3.576  1.00 40.94  ? 489  PHE B CD2 1 
ATOM   9012  C  CE1 . PHE B  1  461 ? 29.921  46.935  -5.541  1.00 41.67  ? 489  PHE B CE1 1 
ATOM   9013  C  CE2 . PHE B  1  461 ? 30.025  48.691  -3.883  1.00 40.76  ? 489  PHE B CE2 1 
ATOM   9014  C  CZ  . PHE B  1  461 ? 30.647  47.916  -4.873  1.00 41.10  ? 489  PHE B CZ  1 
ATOM   9015  N  N   . TYR B  1  462 ? 26.727  44.145  -3.603  1.00 37.80  ? 490  TYR B N   1 
ATOM   9016  C  CA  . TYR B  1  462 ? 27.367  42.840  -3.726  1.00 37.23  ? 490  TYR B CA  1 
ATOM   9017  C  C   . TYR B  1  462 ? 27.660  42.585  -5.181  1.00 37.23  ? 490  TYR B C   1 
ATOM   9018  O  O   . TYR B  1  462 ? 26.826  42.871  -6.045  1.00 37.23  ? 490  TYR B O   1 
ATOM   9019  C  CB  . TYR B  1  462 ? 26.415  41.736  -3.276  1.00 37.37  ? 490  TYR B CB  1 
ATOM   9020  C  CG  . TYR B  1  462 ? 25.939  41.836  -1.850  1.00 37.00  ? 490  TYR B CG  1 
ATOM   9021  C  CD1 . TYR B  1  462 ? 24.834  42.624  -1.516  1.00 35.05  ? 490  TYR B CD1 1 
ATOM   9022  C  CD2 . TYR B  1  462 ? 26.583  41.126  -0.836  1.00 36.33  ? 490  TYR B CD2 1 
ATOM   9023  C  CE1 . TYR B  1  462 ? 24.394  42.719  -0.207  1.00 35.24  ? 490  TYR B CE1 1 
ATOM   9024  C  CE2 . TYR B  1  462 ? 26.145  41.201  0.474   1.00 36.33  ? 490  TYR B CE2 1 
ATOM   9025  C  CZ  . TYR B  1  462 ? 25.053  42.005  0.782   1.00 37.24  ? 490  TYR B CZ  1 
ATOM   9026  O  OH  . TYR B  1  462 ? 24.632  42.092  2.089   1.00 39.01  ? 490  TYR B OH  1 
ATOM   9027  N  N   . ALA B  1  463 ? 28.834  42.026  -5.458  1.00 37.16  ? 491  ALA B N   1 
ATOM   9028  C  CA  . ALA B  1  463 ? 29.197  41.663  -6.824  1.00 36.64  ? 491  ALA B CA  1 
ATOM   9029  C  C   . ALA B  1  463 ? 29.221  40.148  -6.935  1.00 36.47  ? 491  ALA B C   1 
ATOM   9030  O  O   . ALA B  1  463 ? 30.179  39.516  -6.499  1.00 37.23  ? 491  ALA B O   1 
ATOM   9031  C  CB  . ALA B  1  463 ? 30.538  42.249  -7.188  1.00 36.63  ? 491  ALA B CB  1 
ATOM   9032  N  N   . THR B  1  464 ? 28.156  39.560  -7.476  1.00 35.47  ? 492  THR B N   1 
ATOM   9033  C  CA  . THR B  1  464 ? 28.103  38.107  -7.667  1.00 34.25  ? 492  THR B CA  1 
ATOM   9034  C  C   . THR B  1  464 ? 28.113  37.764  -9.172  1.00 33.90  ? 492  THR B C   1 
ATOM   9035  O  O   . THR B  1  464 ? 28.507  38.597  -9.998  1.00 33.62  ? 492  THR B O   1 
ATOM   9036  C  CB  . THR B  1  464 ? 26.932  37.464  -6.861  1.00 34.44  ? 492  THR B CB  1 
ATOM   9037  O  OG1 . THR B  1  464 ? 26.969  36.039  -6.987  1.00 34.61  ? 492  THR B OG1 1 
ATOM   9038  C  CG2 . THR B  1  464 ? 25.544  37.992  -7.291  1.00 33.52  ? 492  THR B CG2 1 
ATOM   9039  N  N   . GLY B  1  465 ? 27.693  36.560  -9.541  1.00 33.29  ? 493  GLY B N   1 
ATOM   9040  C  CA  . GLY B  1  465 ? 27.790  36.132  -10.947 1.00 32.87  ? 493  GLY B CA  1 
ATOM   9041  C  C   . GLY B  1  465 ? 29.166  35.613  -11.327 1.00 32.17  ? 493  GLY B C   1 
ATOM   9042  O  O   . GLY B  1  465 ? 29.925  35.170  -10.469 1.00 32.10  ? 493  GLY B O   1 
ATOM   9043  N  N   . TYR B  1  466 ? 29.492  35.694  -12.615 1.00 32.03  ? 494  TYR B N   1 
ATOM   9044  C  CA  . TYR B  1  466 ? 30.741  35.145  -13.143 1.00 32.12  ? 494  TYR B CA  1 
ATOM   9045  C  C   . TYR B  1  466 ? 31.890  36.125  -13.120 1.00 32.37  ? 494  TYR B C   1 
ATOM   9046  O  O   . TYR B  1  466 ? 31.686  37.338  -13.246 1.00 32.16  ? 494  TYR B O   1 
ATOM   9047  C  CB  . TYR B  1  466 ? 30.553  34.706  -14.586 1.00 31.96  ? 494  TYR B CB  1 
ATOM   9048  C  CG  . TYR B  1  466 ? 29.794  33.430  -14.761 1.00 32.02  ? 494  TYR B CG  1 
ATOM   9049  C  CD1 . TYR B  1  466 ? 28.417  33.438  -15.005 1.00 31.25  ? 494  TYR B CD1 1 
ATOM   9050  C  CD2 . TYR B  1  466 ? 30.451  32.206  -14.703 1.00 32.48  ? 494  TYR B CD2 1 
ATOM   9051  C  CE1 . TYR B  1  466 ? 27.719  32.248  -15.174 1.00 31.53  ? 494  TYR B CE1 1 
ATOM   9052  C  CE2 . TYR B  1  466 ? 29.764  31.010  -14.874 1.00 31.74  ? 494  TYR B CE2 1 
ATOM   9053  C  CZ  . TYR B  1  466 ? 28.408  31.043  -15.106 1.00 31.82  ? 494  TYR B CZ  1 
ATOM   9054  O  OH  . TYR B  1  466 ? 27.755  29.856  -15.279 1.00 33.14  ? 494  TYR B OH  1 
ATOM   9055  N  N   . ILE B  1  467 ? 33.102  35.588  -12.987 1.00 32.75  ? 495  ILE B N   1 
ATOM   9056  C  CA  . ILE B  1  467 ? 34.321  36.372  -13.211 1.00 33.00  ? 495  ILE B CA  1 
ATOM   9057  C  C   . ILE B  1  467 ? 34.648  36.431  -14.700 1.00 33.75  ? 495  ILE B C   1 
ATOM   9058  O  O   . ILE B  1  467 ? 34.169  35.605  -15.478 1.00 33.51  ? 495  ILE B O   1 
ATOM   9059  C  CB  . ILE B  1  467 ? 35.542  35.788  -12.469 1.00 32.58  ? 495  ILE B CB  1 
ATOM   9060  C  CG1 . ILE B  1  467 ? 35.790  34.334  -12.881 1.00 32.40  ? 495  ILE B CG1 1 
ATOM   9061  C  CG2 . ILE B  1  467 ? 35.347  35.896  -10.963 1.00 32.68  ? 495  ILE B CG2 1 
ATOM   9062  C  CD1 . ILE B  1  467 ? 37.166  33.809  -12.495 1.00 31.04  ? 495  ILE B CD1 1 
ATOM   9063  N  N   . SER B  1  468 ? 35.443  37.430  -15.089 1.00 34.60  ? 496  SER B N   1 
ATOM   9064  C  CA  . SER B  1  468 ? 36.142  37.403  -16.357 1.00 35.32  ? 496  SER B CA  1 
ATOM   9065  C  C   . SER B  1  468 ? 37.372  36.550  -16.138 1.00 35.33  ? 496  SER B C   1 
ATOM   9066  O  O   . SER B  1  468 ? 38.006  36.636  -15.073 1.00 35.78  ? 496  SER B O   1 
ATOM   9067  C  CB  . SER B  1  468 ? 36.602  38.792  -16.745 1.00 35.20  ? 496  SER B CB  1 
ATOM   9068  O  OG  . SER B  1  468 ? 35.493  39.583  -17.067 1.00 38.71  ? 496  SER B OG  1 
ATOM   9069  N  N   . SER B  1  469 ? 37.703  35.731  -17.132 1.00 34.81  ? 497  SER B N   1 
ATOM   9070  C  CA  . SER B  1  469 ? 38.926  34.958  -17.107 1.00 34.49  ? 497  SER B CA  1 
ATOM   9071  C  C   . SER B  1  469 ? 39.605  35.107  -18.448 1.00 34.54  ? 497  SER B C   1 
ATOM   9072  O  O   . SER B  1  469 ? 39.010  35.580  -19.420 1.00 34.64  ? 497  SER B O   1 
ATOM   9073  C  CB  . SER B  1  469 ? 38.630  33.490  -16.837 1.00 34.54  ? 497  SER B CB  1 
ATOM   9074  O  OG  . SER B  1  469 ? 37.791  32.970  -17.852 1.00 33.77  ? 497  SER B OG  1 
ATOM   9075  N  N   . ALA B  1  470 ? 40.865  34.713  -18.490 1.00 34.49  ? 498  ALA B N   1 
ATOM   9076  C  CA  . ALA B  1  470 ? 41.634  34.726  -19.724 1.00 34.35  ? 498  ALA B CA  1 
ATOM   9077  C  C   . ALA B  1  470 ? 42.346  33.380  -19.854 1.00 34.31  ? 498  ALA B C   1 
ATOM   9078  O  O   . ALA B  1  470 ? 42.412  32.604  -18.881 1.00 33.77  ? 498  ALA B O   1 
ATOM   9079  C  CB  . ALA B  1  470 ? 42.626  35.881  -19.722 1.00 33.85  ? 498  ALA B CB  1 
ATOM   9080  N  N   . PHE B  1  471 ? 42.846  33.103  -21.060 1.00 34.44  ? 499  PHE B N   1 
ATOM   9081  C  CA  . PHE B  1  471 ? 43.568  31.876  -21.331 1.00 34.48  ? 499  PHE B CA  1 
ATOM   9082  C  C   . PHE B  1  471 ? 44.853  31.885  -20.534 1.00 35.08  ? 499  PHE B C   1 
ATOM   9083  O  O   . PHE B  1  471 ? 45.617  32.842  -20.590 1.00 35.02  ? 499  PHE B O   1 
ATOM   9084  C  CB  . PHE B  1  471 ? 43.860  31.713  -22.831 1.00 34.19  ? 499  PHE B CB  1 
ATOM   9085  C  CG  . PHE B  1  471 ? 44.800  30.576  -23.141 1.00 33.48  ? 499  PHE B CG  1 
ATOM   9086  C  CD1 . PHE B  1  471 ? 44.392  29.251  -22.987 1.00 32.96  ? 499  PHE B CD1 1 
ATOM   9087  C  CD2 . PHE B  1  471 ? 46.104  30.824  -23.546 1.00 32.65  ? 499  PHE B CD2 1 
ATOM   9088  C  CE1 . PHE B  1  471 ? 45.278  28.188  -23.240 1.00 33.45  ? 499  PHE B CE1 1 
ATOM   9089  C  CE2 . PHE B  1  471 ? 46.989  29.766  -23.807 1.00 33.18  ? 499  PHE B CE2 1 
ATOM   9090  C  CZ  . PHE B  1  471 ? 46.572  28.450  -23.656 1.00 32.74  ? 499  PHE B CZ  1 
ATOM   9091  N  N   . LEU B  1  472 ? 45.079  30.810  -19.793 1.00 36.17  ? 500  LEU B N   1 
ATOM   9092  C  CA  . LEU B  1  472 ? 46.269  30.675  -18.974 1.00 37.31  ? 500  LEU B CA  1 
ATOM   9093  C  C   . LEU B  1  472 ? 47.460  30.276  -19.828 1.00 38.35  ? 500  LEU B C   1 
ATOM   9094  O  O   . LEU B  1  472 ? 47.415  29.299  -20.576 1.00 38.61  ? 500  LEU B O   1 
ATOM   9095  C  CB  . LEU B  1  472 ? 46.044  29.661  -17.841 1.00 37.27  ? 500  LEU B CB  1 
ATOM   9096  C  CG  . LEU B  1  472 ? 47.166  29.454  -16.812 1.00 37.28  ? 500  LEU B CG  1 
ATOM   9097  C  CD1 . LEU B  1  472 ? 47.246  30.611  -15.803 1.00 35.65  ? 500  LEU B CD1 1 
ATOM   9098  C  CD2 . LEU B  1  472 ? 46.994  28.112  -16.098 1.00 36.79  ? 500  LEU B CD2 1 
ATOM   9099  N  N   . PHE B  1  473 ? 48.514  31.069  -19.717 1.00 39.81  ? 501  PHE B N   1 
ATOM   9100  C  CA  . PHE B  1  473 ? 49.792  30.798  -20.348 1.00 41.41  ? 501  PHE B CA  1 
ATOM   9101  C  C   . PHE B  1  473 ? 50.842  31.470  -19.465 1.00 42.97  ? 501  PHE B C   1 
ATOM   9102  O  O   . PHE B  1  473 ? 50.562  32.499  -18.828 1.00 42.83  ? 501  PHE B O   1 
ATOM   9103  C  CB  . PHE B  1  473 ? 49.841  31.384  -21.769 1.00 40.72  ? 501  PHE B CB  1 
ATOM   9104  C  CG  . PHE B  1  473 ? 50.095  32.872  -21.805 1.00 40.04  ? 501  PHE B CG  1 
ATOM   9105  C  CD1 . PHE B  1  473 ? 51.406  33.370  -21.908 1.00 38.66  ? 501  PHE B CD1 1 
ATOM   9106  C  CD2 . PHE B  1  473 ? 49.030  33.780  -21.720 1.00 38.82  ? 501  PHE B CD2 1 
ATOM   9107  C  CE1 . PHE B  1  473 ? 51.655  34.750  -21.927 1.00 38.70  ? 501  PHE B CE1 1 
ATOM   9108  C  CE2 . PHE B  1  473 ? 49.258  35.164  -21.741 1.00 38.48  ? 501  PHE B CE2 1 
ATOM   9109  C  CZ  . PHE B  1  473 ? 50.579  35.653  -21.845 1.00 39.25  ? 501  PHE B CZ  1 
ATOM   9110  N  N   . GLY B  1  474 ? 52.044  30.897  -19.433 1.00 44.45  ? 502  GLY B N   1 
ATOM   9111  C  CA  . GLY B  1  474 ? 53.184  31.560  -18.801 1.00 46.30  ? 502  GLY B CA  1 
ATOM   9112  C  C   . GLY B  1  474 ? 53.210  31.582  -17.281 1.00 47.60  ? 502  GLY B C   1 
ATOM   9113  O  O   . GLY B  1  474 ? 52.540  30.781  -16.619 1.00 47.47  ? 502  GLY B O   1 
ATOM   9114  N  N   . ALA B  1  475 ? 53.983  32.532  -16.746 1.00 48.76  ? 503  ALA B N   1 
ATOM   9115  C  CA  . ALA B  1  475 ? 54.330  32.584  -15.326 1.00 50.01  ? 503  ALA B CA  1 
ATOM   9116  C  C   . ALA B  1  475 ? 53.199  33.127  -14.456 1.00 50.79  ? 503  ALA B C   1 
ATOM   9117  O  O   . ALA B  1  475 ? 52.917  34.337  -14.447 1.00 51.42  ? 503  ALA B O   1 
ATOM   9118  C  CB  . ALA B  1  475 ? 55.617  33.402  -15.119 1.00 50.07  ? 503  ALA B CB  1 
ATOM   9119  N  N   . THR B  1  476 ? 52.562  32.223  -13.714 1.00 51.13  ? 504  THR B N   1 
ATOM   9120  C  CA  . THR B  1  476 ? 51.429  32.577  -12.848 1.00 50.81  ? 504  THR B CA  1 
ATOM   9121  C  C   . THR B  1  476 ? 51.927  33.178  -11.524 1.00 50.07  ? 504  THR B C   1 
ATOM   9122  O  O   . THR B  1  476 ? 52.908  32.700  -10.941 1.00 50.34  ? 504  THR B O   1 
ATOM   9123  C  CB  . THR B  1  476 ? 50.530  31.330  -12.584 1.00 51.06  ? 504  THR B CB  1 
ATOM   9124  O  OG1 . THR B  1  476 ? 50.284  30.659  -13.826 1.00 51.51  ? 504  THR B OG1 1 
ATOM   9125  C  CG2 . THR B  1  476 ? 49.197  31.717  -11.941 1.00 50.65  ? 504  THR B CG2 1 
ATOM   9126  N  N   . GLY B  1  477 ? 51.257  34.229  -11.058 1.00 48.83  ? 505  GLY B N   1 
ATOM   9127  C  CA  . GLY B  1  477 ? 51.578  34.791  -9.764  1.00 46.86  ? 505  GLY B CA  1 
ATOM   9128  C  C   . GLY B  1  477 ? 51.318  36.268  -9.624  1.00 45.62  ? 505  GLY B C   1 
ATOM   9129  O  O   . GLY B  1  477 ? 51.048  36.748  -8.516  1.00 46.43  ? 505  GLY B O   1 
ATOM   9130  N  N   . LYS B  1  478 ? 51.391  37.002  -10.726 1.00 43.56  ? 506  LYS B N   1 
ATOM   9131  C  CA  . LYS B  1  478 ? 51.268  38.452  -10.644 1.00 41.88  ? 506  LYS B CA  1 
ATOM   9132  C  C   . LYS B  1  478 ? 49.911  38.968  -11.111 1.00 40.03  ? 506  LYS B C   1 
ATOM   9133  O  O   . LYS B  1  478 ? 49.642  40.164  -10.989 1.00 39.65  ? 506  LYS B O   1 
ATOM   9134  C  CB  . LYS B  1  478 ? 52.398  39.144  -11.415 1.00 41.79  ? 506  LYS B CB  1 
ATOM   9135  C  CG  . LYS B  1  478 ? 53.784  38.553  -11.160 1.00 43.05  ? 506  LYS B CG  1 
ATOM   9136  C  CD  . LYS B  1  478 ? 54.852  39.151  -12.086 1.00 43.47  ? 506  LYS B CD  1 
ATOM   9137  C  CE  . LYS B  1  478 ? 55.631  40.284  -11.404 1.00 45.62  ? 506  LYS B CE  1 
ATOM   9138  N  NZ  . LYS B  1  478 ? 56.669  39.761  -10.456 1.00 45.75  ? 506  LYS B NZ  1 
ATOM   9139  N  N   . TYR B  1  479 ? 49.053  38.083  -11.620 1.00 37.94  ? 507  TYR B N   1 
ATOM   9140  C  CA  . TYR B  1  479 ? 47.836  38.538  -12.305 1.00 36.64  ? 507  TYR B CA  1 
ATOM   9141  C  C   . TYR B  1  479 ? 46.546  37.807  -11.942 1.00 35.90  ? 507  TYR B C   1 
ATOM   9142  O  O   . TYR B  1  479 ? 45.539  37.971  -12.624 1.00 36.11  ? 507  TYR B O   1 
ATOM   9143  C  CB  . TYR B  1  479 ? 48.039  38.577  -13.840 1.00 36.04  ? 507  TYR B CB  1 
ATOM   9144  C  CG  . TYR B  1  479 ? 49.261  39.366  -14.254 1.00 35.37  ? 507  TYR B CG  1 
ATOM   9145  C  CD1 . TYR B  1  479 ? 49.301  40.752  -14.106 1.00 33.65  ? 507  TYR B CD1 1 
ATOM   9146  C  CD2 . TYR B  1  479 ? 50.396  38.723  -14.758 1.00 35.03  ? 507  TYR B CD2 1 
ATOM   9147  C  CE1 . TYR B  1  479 ? 50.425  41.477  -14.455 1.00 33.81  ? 507  TYR B CE1 1 
ATOM   9148  C  CE2 . TYR B  1  479 ? 51.530  39.446  -15.118 1.00 34.42  ? 507  TYR B CE2 1 
ATOM   9149  C  CZ  . TYR B  1  479 ? 51.537  40.827  -14.961 1.00 35.34  ? 507  TYR B CZ  1 
ATOM   9150  O  OH  . TYR B  1  479 ? 52.657  41.567  -15.305 1.00 35.69  ? 507  TYR B OH  1 
ATOM   9151  N  N   . GLY B  1  480 ? 46.568  37.038  -10.857 1.00 35.18  ? 508  GLY B N   1 
ATOM   9152  C  CA  . GLY B  1  480 ? 45.441  36.194  -10.458 1.00 34.04  ? 508  GLY B CA  1 
ATOM   9153  C  C   . GLY B  1  480 ? 45.872  34.741  -10.315 1.00 33.98  ? 508  GLY B C   1 
ATOM   9154  O  O   . GLY B  1  480 ? 47.046  34.406  -10.529 1.00 34.23  ? 508  GLY B O   1 
ATOM   9155  N  N   . ASN B  1  481 ? 44.927  33.879  -9.951  1.00 33.26  ? 509  ASN B N   1 
ATOM   9156  C  CA  . ASN B  1  481 ? 45.186  32.455  -9.775  1.00 32.73  ? 509  ASN B CA  1 
ATOM   9157  C  C   . ASN B  1  481 ? 44.501  31.645  -10.862 1.00 32.55  ? 509  ASN B C   1 
ATOM   9158  O  O   . ASN B  1  481 ? 43.452  32.054  -11.382 1.00 31.58  ? 509  ASN B O   1 
ATOM   9159  C  CB  . ASN B  1  481 ? 44.647  31.960  -8.425  1.00 32.82  ? 509  ASN B CB  1 
ATOM   9160  C  CG  . ASN B  1  481 ? 45.247  32.686  -7.239  1.00 33.04  ? 509  ASN B CG  1 
ATOM   9161  O  OD1 . ASN B  1  481 ? 46.453  32.616  -6.998  1.00 33.66  ? 509  ASN B OD1 1 
ATOM   9162  N  ND2 . ASN B  1  481 ? 44.400  33.363  -6.472  1.00 32.64  ? 509  ASN B ND2 1 
ATOM   9163  N  N   . GLN B  1  482 ? 45.086  30.488  -11.183 1.00 32.37  ? 510  GLN B N   1 
ATOM   9164  C  CA  . GLN B  1  482 ? 44.393  29.497  -11.994 1.00 32.67  ? 510  GLN B CA  1 
ATOM   9165  C  C   . GLN B  1  482 ? 43.157  29.016  -11.232 1.00 32.82  ? 510  GLN B C   1 
ATOM   9166  O  O   . GLN B  1  482 ? 43.240  28.604  -10.074 1.00 32.26  ? 510  GLN B O   1 
ATOM   9167  C  CB  . GLN B  1  482 ? 45.301  28.318  -12.389 1.00 32.52  ? 510  GLN B CB  1 
ATOM   9168  C  CG  . GLN B  1  482 ? 44.545  27.230  -13.164 1.00 32.22  ? 510  GLN B CG  1 
ATOM   9169  C  CD  . GLN B  1  482 ? 45.430  26.179  -13.814 1.00 32.36  ? 510  GLN B CD  1 
ATOM   9170  O  OE1 . GLN B  1  482 ? 46.586  25.987  -13.435 1.00 33.06  ? 510  GLN B OE1 1 
ATOM   9171  N  NE2 . GLN B  1  482 ? 44.883  25.491  -14.810 1.00 31.71  ? 510  GLN B NE2 1 
ATOM   9172  N  N   . VAL B  1  483 ? 42.014  29.099  -11.899 1.00 33.37  ? 511  VAL B N   1 
ATOM   9173  C  CA  . VAL B  1  483 ? 40.724  28.790  -11.286 1.00 34.14  ? 511  VAL B CA  1 
ATOM   9174  C  C   . VAL B  1  483 ? 40.048  27.592  -11.940 1.00 34.83  ? 511  VAL B C   1 
ATOM   9175  O  O   . VAL B  1  483 ? 39.097  27.048  -11.393 1.00 35.12  ? 511  VAL B O   1 
ATOM   9176  C  CB  . VAL B  1  483 ? 39.758  30.022  -11.297 1.00 33.84  ? 511  VAL B CB  1 
ATOM   9177  C  CG1 . VAL B  1  483 ? 40.226  31.086  -10.325 1.00 33.06  ? 511  VAL B CG1 1 
ATOM   9178  C  CG2 . VAL B  1  483 ? 39.634  30.606  -12.690 1.00 33.36  ? 511  VAL B CG2 1 
ATOM   9179  N  N   . SER B  1  484 ? 40.526  27.210  -13.122 1.00 35.76  ? 512  SER B N   1 
ATOM   9180  C  CA  . SER B  1  484 ? 40.093  25.985  -13.807 1.00 36.84  ? 512  SER B CA  1 
ATOM   9181  C  C   . SER B  1  484 ? 40.993  25.653  -14.993 1.00 37.11  ? 512  SER B C   1 
ATOM   9182  O  O   . SER B  1  484 ? 41.971  26.363  -15.261 1.00 37.61  ? 512  SER B O   1 
ATOM   9183  C  CB  . SER B  1  484 ? 38.622  26.052  -14.246 1.00 36.82  ? 512  SER B CB  1 
ATOM   9184  O  OG  . SER B  1  484 ? 38.387  27.190  -15.050 1.00 38.34  ? 512  SER B OG  1 
ATOM   9185  N  N   . GLU B  1  485 ? 40.658  24.572  -15.692 1.00 37.49  ? 513  GLU B N   1 
ATOM   9186  C  CA  . GLU B  1  485 ? 41.447  24.079  -16.820 1.00 37.98  ? 513  GLU B CA  1 
ATOM   9187  C  C   . GLU B  1  485 ? 41.815  25.220  -17.765 1.00 37.26  ? 513  GLU B C   1 
ATOM   9188  O  O   . GLU B  1  485 ? 40.929  25.879  -18.306 1.00 37.11  ? 513  GLU B O   1 
ATOM   9189  C  CB  . GLU B  1  485 ? 40.678  22.976  -17.568 1.00 38.34  ? 513  GLU B CB  1 
ATOM   9190  C  CG  . GLU B  1  485 ? 40.537  21.652  -16.795 1.00 42.39  ? 513  GLU B CG  1 
ATOM   9191  C  CD  . GLU B  1  485 ? 41.824  20.795  -16.792 1.00 48.80  ? 513  GLU B CD  1 
ATOM   9192  O  OE1 . GLU B  1  485 ? 42.709  21.034  -17.664 1.00 50.88  ? 513  GLU B OE1 1 
ATOM   9193  O  OE2 . GLU B  1  485 ? 41.946  19.874  -15.926 1.00 49.73  ? 513  GLU B OE2 1 
ATOM   9194  N  N   . HIS B  1  486 ? 43.119  25.466  -17.925 1.00 36.61  ? 514  HIS B N   1 
ATOM   9195  C  CA  . HIS B  1  486 ? 43.639  26.475  -18.873 1.00 36.28  ? 514  HIS B CA  1 
ATOM   9196  C  C   . HIS B  1  486 ? 43.174  27.910  -18.626 1.00 35.58  ? 514  HIS B C   1 
ATOM   9197  O  O   . HIS B  1  486 ? 43.326  28.760  -19.509 1.00 35.37  ? 514  HIS B O   1 
ATOM   9198  C  CB  . HIS B  1  486 ? 43.280  26.118  -20.325 1.00 36.38  ? 514  HIS B CB  1 
ATOM   9199  C  CG  . HIS B  1  486 ? 43.754  24.770  -20.753 1.00 37.64  ? 514  HIS B CG  1 
ATOM   9200  N  ND1 . HIS B  1  486 ? 42.888  23.755  -21.097 1.00 39.97  ? 514  HIS B ND1 1 
ATOM   9201  C  CD2 . HIS B  1  486 ? 45.002  24.262  -20.880 1.00 38.54  ? 514  HIS B CD2 1 
ATOM   9202  C  CE1 . HIS B  1  486 ? 43.581  22.680  -21.429 1.00 39.39  ? 514  HIS B CE1 1 
ATOM   9203  N  NE2 . HIS B  1  486 ? 44.866  22.961  -21.304 1.00 39.95  ? 514  HIS B NE2 1 
ATOM   9204  N  N   . THR B  1  487 ? 42.589  28.185  -17.457 1.00 34.92  ? 515  THR B N   1 
ATOM   9205  C  CA  . THR B  1  487 ? 42.055  29.540  -17.196 1.00 33.97  ? 515  THR B CA  1 
ATOM   9206  C  C   . THR B  1  487 ? 42.549  30.294  -15.940 1.00 32.80  ? 515  THR B C   1 
ATOM   9207  O  O   . THR B  1  487 ? 42.643  29.743  -14.844 1.00 32.75  ? 515  THR B O   1 
ATOM   9208  C  CB  . THR B  1  487 ? 40.518  29.642  -17.367 1.00 33.86  ? 515  THR B CB  1 
ATOM   9209  O  OG1 . THR B  1  487 ? 39.960  30.350  -16.254 1.00 35.38  ? 515  THR B OG1 1 
ATOM   9210  C  CG2 . THR B  1  487 ? 39.876  28.293  -17.477 1.00 33.32  ? 515  THR B CG2 1 
ATOM   9211  N  N   . LEU B  1  488 ? 42.886  31.557  -16.161 1.00 31.47  ? 516  LEU B N   1 
ATOM   9212  C  CA  . LEU B  1  488 ? 43.374  32.454  -15.139 1.00 30.34  ? 516  LEU B CA  1 
ATOM   9213  C  C   . LEU B  1  488 ? 42.264  33.424  -14.754 1.00 29.99  ? 516  LEU B C   1 
ATOM   9214  O  O   . LEU B  1  488 ? 41.730  34.126  -15.620 1.00 29.58  ? 516  LEU B O   1 
ATOM   9215  C  CB  . LEU B  1  488 ? 44.550  33.242  -15.691 1.00 30.16  ? 516  LEU B CB  1 
ATOM   9216  C  CG  . LEU B  1  488 ? 44.979  34.491  -14.928 1.00 29.85  ? 516  LEU B CG  1 
ATOM   9217  C  CD1 . LEU B  1  488 ? 45.868  34.117  -13.740 1.00 29.77  ? 516  LEU B CD1 1 
ATOM   9218  C  CD2 . LEU B  1  488 ? 45.684  35.436  -15.866 1.00 27.50  ? 516  LEU B CD2 1 
ATOM   9219  N  N   . GLY B  1  489 ? 41.908  33.436  -13.466 1.00 29.59  ? 517  GLY B N   1 
ATOM   9220  C  CA  . GLY B  1  489 ? 40.938  34.379  -12.917 1.00 29.71  ? 517  GLY B CA  1 
ATOM   9221  C  C   . GLY B  1  489 ? 41.703  35.664  -12.709 1.00 30.17  ? 517  GLY B C   1 
ATOM   9222  O  O   . GLY B  1  489 ? 42.639  35.722  -11.898 1.00 30.77  ? 517  GLY B O   1 
ATOM   9223  N  N   . THR B  1  490 ? 41.340  36.688  -13.466 1.00 29.70  ? 518  THR B N   1 
ATOM   9224  C  CA  . THR B  1  490 ? 42.130  37.905  -13.501 1.00 29.30  ? 518  THR B CA  1 
ATOM   9225  C  C   . THR B  1  490 ? 41.868  38.798  -12.282 1.00 29.33  ? 518  THR B C   1 
ATOM   9226  O  O   . THR B  1  490 ? 40.709  39.027  -11.898 1.00 29.33  ? 518  THR B O   1 
ATOM   9227  C  CB  . THR B  1  490 ? 41.893  38.683  -14.817 1.00 29.36  ? 518  THR B CB  1 
ATOM   9228  O  OG1 . THR B  1  490 ? 40.483  38.867  -15.022 1.00 29.77  ? 518  THR B OG1 1 
ATOM   9229  C  CG2 . THR B  1  490 ? 42.495  37.926  -16.007 1.00 28.12  ? 518  THR B CG2 1 
ATOM   9230  N  N   . VAL B  1  491 ? 42.954  39.293  -11.687 1.00 28.58  ? 519  VAL B N   1 
ATOM   9231  C  CA  . VAL B  1  491 ? 42.893  40.237  -10.577 1.00 28.08  ? 519  VAL B CA  1 
ATOM   9232  C  C   . VAL B  1  491 ? 42.157  41.522  -10.998 1.00 28.45  ? 519  VAL B C   1 
ATOM   9233  O  O   . VAL B  1  491 ? 42.302  41.978  -12.126 1.00 28.85  ? 519  VAL B O   1 
ATOM   9234  C  CB  . VAL B  1  491 ? 44.322  40.557  -10.036 1.00 27.78  ? 519  VAL B CB  1 
ATOM   9235  C  CG1 . VAL B  1  491 ? 45.159  41.352  -11.055 1.00 26.34  ? 519  VAL B CG1 1 
ATOM   9236  C  CG2 . VAL B  1  491 ? 44.257  41.286  -8.722  1.00 26.25  ? 519  VAL B CG2 1 
ATOM   9237  N  N   . HIS B  1  492 ? 41.367  42.097  -10.097 1.00 28.66  ? 520  HIS B N   1 
ATOM   9238  C  CA  . HIS B  1  492 ? 40.674  43.360  -10.377 1.00 28.83  ? 520  HIS B CA  1 
ATOM   9239  C  C   . HIS B  1  492 ? 40.157  43.995  -9.096  1.00 28.77  ? 520  HIS B C   1 
ATOM   9240  O  O   . HIS B  1  492 ? 40.122  43.344  -8.049  1.00 28.55  ? 520  HIS B O   1 
ATOM   9241  C  CB  . HIS B  1  492 ? 39.495  43.130  -11.329 1.00 29.03  ? 520  HIS B CB  1 
ATOM   9242  C  CG  . HIS B  1  492 ? 38.514  42.122  -10.822 1.00 29.47  ? 520  HIS B CG  1 
ATOM   9243  N  ND1 . HIS B  1  492 ? 38.703  40.766  -10.973 1.00 29.66  ? 520  HIS B ND1 1 
ATOM   9244  C  CD2 . HIS B  1  492 ? 37.355  42.269  -10.138 1.00 29.82  ? 520  HIS B CD2 1 
ATOM   9245  C  CE1 . HIS B  1  492 ? 37.692  40.120  -10.415 1.00 31.40  ? 520  HIS B CE1 1 
ATOM   9246  N  NE2 . HIS B  1  492 ? 36.859  41.008  -9.903  1.00 31.42  ? 520  HIS B NE2 1 
ATOM   9247  N  N   . THR B  1  493 ? 39.751  45.262  -9.181  1.00 28.91  ? 521  THR B N   1 
ATOM   9248  C  CA  . THR B  1  493 ? 39.056  45.918  -8.068  1.00 29.33  ? 521  THR B CA  1 
ATOM   9249  C  C   . THR B  1  493 ? 37.614  46.247  -8.437  1.00 29.47  ? 521  THR B C   1 
ATOM   9250  O  O   . THR B  1  493 ? 37.317  46.564  -9.593  1.00 29.59  ? 521  THR B O   1 
ATOM   9251  C  CB  . THR B  1  493 ? 39.752  47.222  -7.625  1.00 29.24  ? 521  THR B CB  1 
ATOM   9252  O  OG1 . THR B  1  493 ? 39.679  48.182  -8.683  1.00 30.67  ? 521  THR B OG1 1 
ATOM   9253  C  CG2 . THR B  1  493 ? 41.205  46.975  -7.274  1.00 28.60  ? 521  THR B CG2 1 
ATOM   9254  N  N   . HIS B  1  494 ? 36.723  46.169  -7.451  1.00 29.78  ? 522  HIS B N   1 
ATOM   9255  C  CA  . HIS B  1  494 ? 35.366  46.705  -7.574  1.00 29.85  ? 522  HIS B CA  1 
ATOM   9256  C  C   . HIS B  1  494 ? 35.242  47.994  -6.762  1.00 29.97  ? 522  HIS B C   1 
ATOM   9257  O  O   . HIS B  1  494 ? 35.741  48.074  -5.622  1.00 30.20  ? 522  HIS B O   1 
ATOM   9258  C  CB  . HIS B  1  494 ? 34.342  45.696  -7.062  1.00 30.22  ? 522  HIS B CB  1 
ATOM   9259  C  CG  . HIS B  1  494 ? 34.254  44.443  -7.876  1.00 32.17  ? 522  HIS B CG  1 
ATOM   9260  N  ND1 . HIS B  1  494 ? 33.567  44.376  -9.073  1.00 34.40  ? 522  HIS B ND1 1 
ATOM   9261  C  CD2 . HIS B  1  494 ? 34.756  43.202  -7.659  1.00 33.31  ? 522  HIS B CD2 1 
ATOM   9262  C  CE1 . HIS B  1  494 ? 33.657  43.150  -9.558  1.00 34.88  ? 522  HIS B CE1 1 
ATOM   9263  N  NE2 . HIS B  1  494 ? 34.366  42.416  -8.716  1.00 34.78  ? 522  HIS B NE2 1 
ATOM   9264  N  N   . SER B  1  495 ? 34.591  49.001  -7.349  1.00 30.02  ? 523  SER B N   1 
ATOM   9265  C  CA  . SER B  1  495 ? 34.236  50.258  -6.649  1.00 29.74  ? 523  SER B CA  1 
ATOM   9266  C  C   . SER B  1  495 ? 32.894  50.763  -7.120  1.00 29.25  ? 523  SER B C   1 
ATOM   9267  O  O   . SER B  1  495 ? 32.505  50.532  -8.277  1.00 29.51  ? 523  SER B O   1 
ATOM   9268  C  CB  . SER B  1  495 ? 35.256  51.363  -6.910  1.00 29.87  ? 523  SER B CB  1 
ATOM   9269  O  OG  . SER B  1  495 ? 36.570  50.915  -6.660  1.00 31.32  ? 523  SER B OG  1 
ATOM   9270  N  N   . ALA B  1  496 ? 32.200  51.464  -6.233  1.00 28.48  ? 524  ALA B N   1 
ATOM   9271  C  CA  . ALA B  1  496 ? 30.934  52.116  -6.561  1.00 28.40  ? 524  ALA B CA  1 
ATOM   9272  C  C   . ALA B  1  496 ? 30.856  53.448  -5.832  1.00 28.61  ? 524  ALA B C   1 
ATOM   9273  O  O   . ALA B  1  496 ? 31.446  53.618  -4.757  1.00 28.56  ? 524  ALA B O   1 
ATOM   9274  C  CB  . ALA B  1  496 ? 29.748  51.238  -6.190  1.00 27.83  ? 524  ALA B CB  1 
ATOM   9275  N  N   . HIS B  1  497 ? 30.120  54.391  -6.408  1.00 28.67  ? 525  HIS B N   1 
ATOM   9276  C  CA  . HIS B  1  497 ? 30.041  55.723  -5.848  1.00 28.91  ? 525  HIS B CA  1 
ATOM   9277  C  C   . HIS B  1  497 ? 28.582  56.043  -5.617  1.00 29.41  ? 525  HIS B C   1 
ATOM   9278  O  O   . HIS B  1  497 ? 27.763  55.879  -6.536  1.00 29.77  ? 525  HIS B O   1 
ATOM   9279  C  CB  . HIS B  1  497 ? 30.679  56.726  -6.818  1.00 28.61  ? 525  HIS B CB  1 
ATOM   9280  C  CG  . HIS B  1  497 ? 31.045  58.040  -6.196  1.00 28.98  ? 525  HIS B CG  1 
ATOM   9281  N  ND1 . HIS B  1  497 ? 30.681  59.250  -6.747  1.00 29.56  ? 525  HIS B ND1 1 
ATOM   9282  C  CD2 . HIS B  1  497 ? 31.747  58.337  -5.075  1.00 29.27  ? 525  HIS B CD2 1 
ATOM   9283  C  CE1 . HIS B  1  497 ? 31.139  60.234  -5.992  1.00 29.11  ? 525  HIS B CE1 1 
ATOM   9284  N  NE2 . HIS B  1  497 ? 31.791  59.708  -4.972  1.00 28.50  ? 525  HIS B NE2 1 
ATOM   9285  N  N   . PHE B  1  498 ? 28.252  56.506  -4.407  1.00 29.58  ? 526  PHE B N   1 
ATOM   9286  C  CA  . PHE B  1  498 ? 26.867  56.911  -4.087  1.00 29.59  ? 526  PHE B CA  1 
ATOM   9287  C  C   . PHE B  1  498 ? 26.742  58.396  -3.779  1.00 29.71  ? 526  PHE B C   1 
ATOM   9288  O  O   . PHE B  1  498 ? 27.624  58.973  -3.172  1.00 30.40  ? 526  PHE B O   1 
ATOM   9289  C  CB  . PHE B  1  498 ? 26.311  56.122  -2.906  1.00 29.12  ? 526  PHE B CB  1 
ATOM   9290  C  CG  . PHE B  1  498 ? 26.268  54.652  -3.126  1.00 29.56  ? 526  PHE B CG  1 
ATOM   9291  C  CD1 . PHE B  1  498 ? 27.391  53.866  -2.887  1.00 30.76  ? 526  PHE B CD1 1 
ATOM   9292  C  CD2 . PHE B  1  498 ? 25.103  54.039  -3.562  1.00 30.41  ? 526  PHE B CD2 1 
ATOM   9293  C  CE1 . PHE B  1  498 ? 27.345  52.491  -3.099  1.00 30.93  ? 526  PHE B CE1 1 
ATOM   9294  C  CE2 . PHE B  1  498 ? 25.047  52.655  -3.774  1.00 29.50  ? 526  PHE B CE2 1 
ATOM   9295  C  CZ  . PHE B  1  498 ? 26.161  51.887  -3.545  1.00 29.74  ? 526  PHE B CZ  1 
ATOM   9296  N  N   . LYS B  1  499 ? 25.629  58.993  -4.198  1.00 29.93  ? 527  LYS B N   1 
ATOM   9297  C  CA  . LYS B  1  499 ? 25.251  60.351  -3.834  1.00 29.70  ? 527  LYS B CA  1 
ATOM   9298  C  C   . LYS B  1  499 ? 24.261  60.298  -2.674  1.00 29.82  ? 527  LYS B C   1 
ATOM   9299  O  O   . LYS B  1  499 ? 23.192  59.708  -2.780  1.00 30.13  ? 527  LYS B O   1 
ATOM   9300  C  CB  . LYS B  1  499 ? 24.620  61.050  -5.038  1.00 29.77  ? 527  LYS B CB  1 
ATOM   9301  C  CG  . LYS B  1  499 ? 24.196  62.497  -4.826  1.00 28.81  ? 527  LYS B CG  1 
ATOM   9302  C  CD  . LYS B  1  499 ? 23.662  63.064  -6.134  1.00 29.29  ? 527  LYS B CD  1 
ATOM   9303  C  CE  . LYS B  1  499 ? 23.220  64.504  -5.982  1.00 31.46  ? 527  LYS B CE  1 
ATOM   9304  N  NZ  . LYS B  1  499 ? 22.351  64.959  -7.114  1.00 32.09  ? 527  LYS B NZ  1 
ATOM   9305  N  N   . VAL B  1  500 ? 24.633  60.918  -1.564  1.00 29.81  ? 528  VAL B N   1 
ATOM   9306  C  CA  . VAL B  1  500 ? 23.841  60.901  -0.353  1.00 29.47  ? 528  VAL B CA  1 
ATOM   9307  C  C   . VAL B  1  500 ? 23.536  62.343  0.002   1.00 29.76  ? 528  VAL B C   1 
ATOM   9308  O  O   . VAL B  1  500 ? 24.342  63.008  0.659   1.00 29.97  ? 528  VAL B O   1 
ATOM   9309  C  CB  . VAL B  1  500 ? 24.603  60.232  0.816   1.00 29.37  ? 528  VAL B CB  1 
ATOM   9310  C  CG1 . VAL B  1  500 ? 23.701  60.089  2.024   1.00 29.38  ? 528  VAL B CG1 1 
ATOM   9311  C  CG2 . VAL B  1  500 ? 25.134  58.864  0.416   1.00 28.25  ? 528  VAL B CG2 1 
ATOM   9312  N  N   . ASP B  1  501 ? 22.379  62.825  -0.453  1.00 29.92  ? 529  ASP B N   1 
ATOM   9313  C  CA  . ASP B  1  501 ? 21.954  64.193  -0.196  1.00 29.73  ? 529  ASP B CA  1 
ATOM   9314  C  C   . ASP B  1  501 ? 21.047  64.219  1.025   1.00 29.73  ? 529  ASP B C   1 
ATOM   9315  O  O   . ASP B  1  501 ? 19.813  64.309  0.930   1.00 29.77  ? 529  ASP B O   1 
ATOM   9316  C  CB  . ASP B  1  501 ? 21.299  64.827  -1.433  1.00 29.73  ? 529  ASP B CB  1 
ATOM   9317  C  CG  . ASP B  1  501 ? 20.779  66.255  -1.176  1.00 30.64  ? 529  ASP B CG  1 
ATOM   9318  O  OD1 . ASP B  1  501 ? 21.175  66.897  -0.178  1.00 32.41  ? 529  ASP B OD1 1 
ATOM   9319  O  OD2 . ASP B  1  501 ? 19.957  66.741  -1.974  1.00 31.04  ? 529  ASP B OD2 1 
ATOM   9320  N  N   . LEU B  1  502 ? 21.694  64.122  2.181   1.00 29.73  ? 530  LEU B N   1 
ATOM   9321  C  CA  . LEU B  1  502 ? 21.047  64.294  3.474   1.00 29.31  ? 530  LEU B CA  1 
ATOM   9322  C  C   . LEU B  1  502 ? 20.631  65.749  3.652   1.00 29.44  ? 530  LEU B C   1 
ATOM   9323  O  O   . LEU B  1  502 ? 21.385  66.651  3.292   1.00 29.47  ? 530  LEU B O   1 
ATOM   9324  C  CB  . LEU B  1  502 ? 22.024  63.915  4.580   1.00 29.11  ? 530  LEU B CB  1 
ATOM   9325  C  CG  . LEU B  1  502 ? 22.238  62.433  4.838   1.00 28.46  ? 530  LEU B CG  1 
ATOM   9326  C  CD1 . LEU B  1  502 ? 23.520  62.218  5.587   1.00 28.01  ? 530  LEU B CD1 1 
ATOM   9327  C  CD2 . LEU B  1  502 ? 21.069  61.928  5.659   1.00 30.68  ? 530  LEU B CD2 1 
ATOM   9328  N  N   . ASP B  1  503 ? 19.421  65.964  4.171   1.00 29.45  ? 531  ASP B N   1 
ATOM   9329  C  CA  . ASP B  1  503 ? 18.942  67.281  4.591   1.00 29.88  ? 531  ASP B CA  1 
ATOM   9330  C  C   . ASP B  1  503 ? 18.540  67.176  6.055   1.00 30.17  ? 531  ASP B C   1 
ATOM   9331  O  O   . ASP B  1  503 ? 17.341  67.093  6.386   1.00 30.32  ? 531  ASP B O   1 
ATOM   9332  C  CB  . ASP B  1  503 ? 17.730  67.724  3.764   1.00 29.68  ? 531  ASP B CB  1 
ATOM   9333  C  CG  . ASP B  1  503 ? 18.061  67.964  2.308   1.00 30.60  ? 531  ASP B CG  1 
ATOM   9334  O  OD1 . ASP B  1  503 ? 19.252  67.858  1.912   1.00 30.90  ? 531  ASP B OD1 1 
ATOM   9335  O  OD2 . ASP B  1  503 ? 17.112  68.263  1.550   1.00 31.67  ? 531  ASP B OD2 1 
ATOM   9336  N  N   . VAL B  1  504 ? 19.540  67.165  6.930   1.00 30.33  ? 532  VAL B N   1 
ATOM   9337  C  CA  . VAL B  1  504 ? 19.303  66.877  8.346   1.00 30.34  ? 532  VAL B CA  1 
ATOM   9338  C  C   . VAL B  1  504 ? 18.571  68.043  9.004   1.00 30.48  ? 532  VAL B C   1 
ATOM   9339  O  O   . VAL B  1  504 ? 19.121  69.130  9.151   1.00 30.26  ? 532  VAL B O   1 
ATOM   9340  C  CB  . VAL B  1  504 ? 20.606  66.498  9.096   1.00 30.29  ? 532  VAL B CB  1 
ATOM   9341  C  CG1 . VAL B  1  504 ? 20.295  66.043  10.521  1.00 30.42  ? 532  VAL B CG1 1 
ATOM   9342  C  CG2 . VAL B  1  504 ? 21.353  65.410  8.352   1.00 29.62  ? 532  VAL B CG2 1 
ATOM   9343  N  N   . ALA B  1  505 ? 17.306  67.794  9.353   1.00 30.88  ? 533  ALA B N   1 
ATOM   9344  C  CA  . ALA B  1  505 ? 16.391  68.788  9.915   1.00 30.81  ? 533  ALA B CA  1 
ATOM   9345  C  C   . ALA B  1  505 ? 16.461  70.108  9.170   1.00 31.08  ? 533  ALA B C   1 
ATOM   9346  O  O   . ALA B  1  505 ? 16.492  71.162  9.788   1.00 31.56  ? 533  ALA B O   1 
ATOM   9347  C  CB  . ALA B  1  505 ? 16.662  68.998  11.400  1.00 30.54  ? 533  ALA B CB  1 
ATOM   9348  N  N   . GLY B  1  506 ? 16.496  70.044  7.845   1.00 31.34  ? 534  GLY B N   1 
ATOM   9349  C  CA  . GLY B  1  506 ? 16.517  71.246  7.009   1.00 31.45  ? 534  GLY B CA  1 
ATOM   9350  C  C   . GLY B  1  506 ? 17.594  71.145  5.952   1.00 31.68  ? 534  GLY B C   1 
ATOM   9351  O  O   . GLY B  1  506 ? 18.424  70.231  5.982   1.00 32.46  ? 534  GLY B O   1 
ATOM   9352  N  N   . LEU B  1  507 ? 17.594  72.079  5.015   1.00 31.42  ? 535  LEU B N   1 
ATOM   9353  C  CA  . LEU B  1  507 ? 18.617  72.091  3.985   1.00 31.32  ? 535  LEU B CA  1 
ATOM   9354  C  C   . LEU B  1  507 ? 19.961  72.351  4.622   1.00 30.99  ? 535  LEU B C   1 
ATOM   9355  O  O   . LEU B  1  507 ? 20.952  71.681  4.292   1.00 31.05  ? 535  LEU B O   1 
ATOM   9356  C  CB  . LEU B  1  507 ? 18.354  73.182  2.935   1.00 31.62  ? 535  LEU B CB  1 
ATOM   9357  C  CG  . LEU B  1  507 ? 17.140  73.057  2.011   1.00 32.36  ? 535  LEU B CG  1 
ATOM   9358  C  CD1 . LEU B  1  507 ? 17.104  74.201  0.961   1.00 31.27  ? 535  LEU B CD1 1 
ATOM   9359  C  CD2 . LEU B  1  507 ? 17.149  71.698  1.354   1.00 31.82  ? 535  LEU B CD2 1 
ATOM   9360  N  N   . GLU B  1  508 ? 19.983  73.326  5.529   1.00 30.15  ? 536  GLU B N   1 
ATOM   9361  C  CA  . GLU B  1  508 ? 21.236  73.878  6.018   1.00 29.88  ? 536  GLU B CA  1 
ATOM   9362  C  C   . GLU B  1  508 ? 21.918  72.991  7.027   1.00 28.81  ? 536  GLU B C   1 
ATOM   9363  O  O   . GLU B  1  508 ? 21.392  72.742  8.116   1.00 28.21  ? 536  GLU B O   1 
ATOM   9364  C  CB  . GLU B  1  508 ? 21.047  75.287  6.566   1.00 30.56  ? 536  GLU B CB  1 
ATOM   9365  C  CG  . GLU B  1  508 ? 21.064  76.346  5.474   1.00 33.69  ? 536  GLU B CG  1 
ATOM   9366  C  CD  . GLU B  1  508 ? 19.675  76.656  4.947   1.00 39.41  ? 536  GLU B CD  1 
ATOM   9367  O  OE1 . GLU B  1  508 ? 18.750  76.816  5.793   1.00 41.32  ? 536  GLU B OE1 1 
ATOM   9368  O  OE2 . GLU B  1  508 ? 19.512  76.750  3.697   1.00 40.87  ? 536  GLU B OE2 1 
ATOM   9369  N  N   . ASN B  1  509 ? 23.097  72.514  6.637   1.00 27.62  ? 537  ASN B N   1 
ATOM   9370  C  CA  . ASN B  1  509 ? 23.836  71.538  7.416   1.00 26.70  ? 537  ASN B CA  1 
ATOM   9371  C  C   . ASN B  1  509 ? 25.290  71.926  7.636   1.00 26.44  ? 537  ASN B C   1 
ATOM   9372  O  O   . ASN B  1  509 ? 25.858  72.722  6.882   1.00 26.44  ? 537  ASN B O   1 
ATOM   9373  C  CB  . ASN B  1  509 ? 23.755  70.164  6.749   1.00 26.18  ? 537  ASN B CB  1 
ATOM   9374  C  CG  . ASN B  1  509 ? 22.396  69.498  6.935   1.00 26.27  ? 537  ASN B CG  1 
ATOM   9375  O  OD1 . ASN B  1  509 ? 22.054  68.550  6.218   1.00 26.71  ? 537  ASN B OD1 1 
ATOM   9376  N  ND2 . ASN B  1  509 ? 21.622  69.976  7.908   1.00 23.61  ? 537  ASN B ND2 1 
ATOM   9377  N  N   . TRP B  1  510 ? 25.875  71.377  8.694   1.00 25.85  ? 538  TRP B N   1 
ATOM   9378  C  CA  . TRP B  1  510 ? 27.311  71.483  8.938   1.00 25.40  ? 538  TRP B CA  1 
ATOM   9379  C  C   . TRP B  1  510 ? 27.897  70.075  9.014   1.00 25.48  ? 538  TRP B C   1 
ATOM   9380  O  O   . TRP B  1  510 ? 27.153  69.078  9.021   1.00 25.39  ? 538  TRP B O   1 
ATOM   9381  C  CB  . TRP B  1  510 ? 27.578  72.204  10.247  1.00 24.58  ? 538  TRP B CB  1 
ATOM   9382  C  CG  . TRP B  1  510 ? 27.324  73.665  10.230  1.00 24.08  ? 538  TRP B CG  1 
ATOM   9383  C  CD1 . TRP B  1  510 ? 28.271  74.657  10.264  1.00 23.78  ? 538  TRP B CD1 1 
ATOM   9384  C  CD2 . TRP B  1  510 ? 26.047  74.328  10.205  1.00 23.17  ? 538  TRP B CD2 1 
ATOM   9385  N  NE1 . TRP B  1  510 ? 27.662  75.894  10.252  1.00 23.18  ? 538  TRP B NE1 1 
ATOM   9386  C  CE2 . TRP B  1  510 ? 26.301  75.724  10.226  1.00 22.54  ? 538  TRP B CE2 1 
ATOM   9387  C  CE3 . TRP B  1  510 ? 24.714  73.882  10.164  1.00 23.19  ? 538  TRP B CE3 1 
ATOM   9388  C  CZ2 . TRP B  1  510 ? 25.273  76.676  10.197  1.00 22.63  ? 538  TRP B CZ2 1 
ATOM   9389  C  CZ3 . TRP B  1  510 ? 23.690  74.828  10.138  1.00 22.97  ? 538  TRP B CZ3 1 
ATOM   9390  C  CH2 . TRP B  1  510 ? 23.978  76.213  10.149  1.00 23.42  ? 538  TRP B CH2 1 
ATOM   9391  N  N   . VAL B  1  511 ? 29.221  69.987  9.087   1.00 25.43  ? 539  VAL B N   1 
ATOM   9392  C  CA  . VAL B  1  511 ? 29.881  68.690  9.187   1.00 25.32  ? 539  VAL B CA  1 
ATOM   9393  C  C   . VAL B  1  511 ? 30.763  68.659  10.423  1.00 25.64  ? 539  VAL B C   1 
ATOM   9394  O  O   . VAL B  1  511 ? 31.644  69.522  10.595  1.00 25.37  ? 539  VAL B O   1 
ATOM   9395  C  CB  . VAL B  1  511 ? 30.720  68.380  7.953   1.00 25.54  ? 539  VAL B CB  1 
ATOM   9396  C  CG1 . VAL B  1  511 ? 31.519  67.086  8.161   1.00 25.90  ? 539  VAL B CG1 1 
ATOM   9397  C  CG2 . VAL B  1  511 ? 29.838  68.272  6.720   1.00 24.53  ? 539  VAL B CG2 1 
ATOM   9398  N  N   . TRP B  1  512 ? 30.509  67.675  11.286  1.00 25.55  ? 540  TRP B N   1 
ATOM   9399  C  CA  . TRP B  1  512 ? 31.277  67.509  12.509  1.00 25.72  ? 540  TRP B CA  1 
ATOM   9400  C  C   . TRP B  1  512 ? 32.208  66.291  12.471  1.00 26.05  ? 540  TRP B C   1 
ATOM   9401  O  O   . TRP B  1  512 ? 31.870  65.246  11.911  1.00 26.16  ? 540  TRP B O   1 
ATOM   9402  C  CB  . TRP B  1  512 ? 30.339  67.405  13.703  1.00 25.27  ? 540  TRP B CB  1 
ATOM   9403  C  CG  . TRP B  1  512 ? 29.650  68.653  14.021  1.00 25.66  ? 540  TRP B CG  1 
ATOM   9404  C  CD1 . TRP B  1  512 ? 28.373  69.005  13.668  1.00 26.22  ? 540  TRP B CD1 1 
ATOM   9405  C  CD2 . TRP B  1  512 ? 30.177  69.757  14.763  1.00 25.52  ? 540  TRP B CD2 1 
ATOM   9406  N  NE1 . TRP B  1  512 ? 28.079  70.265  14.137  1.00 25.25  ? 540  TRP B NE1 1 
ATOM   9407  C  CE2 . TRP B  1  512 ? 29.172  70.748  14.812  1.00 25.84  ? 540  TRP B CE2 1 
ATOM   9408  C  CE3 . TRP B  1  512 ? 31.404  70.013  15.373  1.00 24.13  ? 540  TRP B CE3 1 
ATOM   9409  C  CZ2 . TRP B  1  512 ? 29.355  71.963  15.467  1.00 25.47  ? 540  TRP B CZ2 1 
ATOM   9410  C  CZ3 . TRP B  1  512 ? 31.585  71.218  16.016  1.00 25.27  ? 540  TRP B CZ3 1 
ATOM   9411  C  CH2 . TRP B  1  512 ? 30.565  72.176  16.064  1.00 25.48  ? 540  TRP B CH2 1 
ATOM   9412  N  N   . ALA B  1  513 ? 33.374  66.428  13.084  1.00 26.61  ? 541  ALA B N   1 
ATOM   9413  C  CA  . ALA B  1  513 ? 34.299  65.304  13.222  1.00 27.54  ? 541  ALA B CA  1 
ATOM   9414  C  C   . ALA B  1  513 ? 34.555  65.021  14.700  1.00 28.57  ? 541  ALA B C   1 
ATOM   9415  O  O   . ALA B  1  513 ? 35.230  65.802  15.406  1.00 29.39  ? 541  ALA B O   1 
ATOM   9416  C  CB  . ALA B  1  513 ? 35.610  65.589  12.498  1.00 26.63  ? 541  ALA B CB  1 
ATOM   9417  N  N   . GLU B  1  514 ? 34.023  63.908  15.180  1.00 29.28  ? 542  GLU B N   1 
ATOM   9418  C  CA  . GLU B  1  514 ? 34.299  63.513  16.543  1.00 29.98  ? 542  GLU B CA  1 
ATOM   9419  C  C   . GLU B  1  514 ? 35.162  62.270  16.589  1.00 30.25  ? 542  GLU B C   1 
ATOM   9420  O  O   . GLU B  1  514 ? 35.013  61.370  15.760  1.00 30.45  ? 542  GLU B O   1 
ATOM   9421  C  CB  . GLU B  1  514 ? 33.005  63.347  17.314  1.00 30.28  ? 542  GLU B CB  1 
ATOM   9422  C  CG  . GLU B  1  514 ? 32.338  64.683  17.632  1.00 31.20  ? 542  GLU B CG  1 
ATOM   9423  C  CD  . GLU B  1  514 ? 31.100  64.498  18.467  1.00 32.45  ? 542  GLU B CD  1 
ATOM   9424  O  OE1 . GLU B  1  514 ? 30.992  63.420  19.086  1.00 33.40  ? 542  GLU B OE1 1 
ATOM   9425  O  OE2 . GLU B  1  514 ? 30.242  65.408  18.506  1.00 31.98  ? 542  GLU B OE2 1 
ATOM   9426  N  N   . ASP B  1  515 ? 36.098  62.253  17.535  1.00 30.70  ? 543  ASP B N   1 
ATOM   9427  C  CA  . ASP B  1  515 ? 37.016  61.125  17.717  1.00 30.83  ? 543  ASP B CA  1 
ATOM   9428  C  C   . ASP B  1  515 ? 37.455  61.068  19.173  1.00 30.86  ? 543  ASP B C   1 
ATOM   9429  O  O   . ASP B  1  515 ? 36.864  61.725  20.020  1.00 30.91  ? 543  ASP B O   1 
ATOM   9430  C  CB  . ASP B  1  515 ? 38.229  61.195  16.761  1.00 30.71  ? 543  ASP B CB  1 
ATOM   9431  C  CG  . ASP B  1  515 ? 38.676  59.786  16.248  1.00 31.84  ? 543  ASP B CG  1 
ATOM   9432  O  OD1 . ASP B  1  515 ? 38.812  58.855  17.078  1.00 32.19  ? 543  ASP B OD1 1 
ATOM   9433  O  OD2 . ASP B  1  515 ? 38.891  59.609  15.022  1.00 29.96  ? 543  ASP B OD2 1 
ATOM   9434  N  N   . MET B  1  516 ? 38.486  60.280  19.458  1.00 30.85  ? 544  MET B N   1 
ATOM   9435  C  CA  . MET B  1  516 ? 38.936  60.072  20.823  1.00 30.84  ? 544  MET B CA  1 
ATOM   9436  C  C   . MET B  1  516 ? 40.400  60.437  20.975  1.00 30.47  ? 544  MET B C   1 
ATOM   9437  O  O   . MET B  1  516 ? 41.141  60.547  19.984  1.00 29.87  ? 544  MET B O   1 
ATOM   9438  C  CB  . MET B  1  516 ? 38.727  58.617  21.223  1.00 30.50  ? 544  MET B CB  1 
ATOM   9439  C  CG  . MET B  1  516 ? 39.564  57.659  20.414  1.00 30.47  ? 544  MET B CG  1 
ATOM   9440  S  SD  . MET B  1  516 ? 39.241  55.933  20.752  1.00 32.74  ? 544  MET B SD  1 
ATOM   9441  C  CE  . MET B  1  516 ? 40.031  55.735  22.351  1.00 30.54  ? 544  MET B CE  1 
ATOM   9442  N  N   . VAL B  1  517 ? 40.805  60.615  22.229  1.00 30.48  ? 545  VAL B N   1 
ATOM   9443  C  CA  . VAL B  1  517 ? 42.201  60.852  22.579  1.00 30.39  ? 545  VAL B CA  1 
ATOM   9444  C  C   . VAL B  1  517 ? 42.445  60.509  24.048  1.00 30.44  ? 545  VAL B C   1 
ATOM   9445  O  O   . VAL B  1  517 ? 41.511  60.510  24.868  1.00 30.02  ? 545  VAL B O   1 
ATOM   9446  C  CB  . VAL B  1  517 ? 42.653  62.299  22.243  1.00 30.25  ? 545  VAL B CB  1 
ATOM   9447  C  CG1 . VAL B  1  517 ? 42.166  63.292  23.299  1.00 29.89  ? 545  VAL B CG1 1 
ATOM   9448  C  CG2 . VAL B  1  517 ? 44.175  62.369  22.059  1.00 30.26  ? 545  VAL B CG2 1 
ATOM   9449  N  N   . PHE B  1  518 ? 43.701  60.186  24.354  1.00 30.77  ? 546  PHE B N   1 
ATOM   9450  C  CA  . PHE B  1  518 ? 44.127  59.915  25.715  1.00 31.49  ? 546  PHE B CA  1 
ATOM   9451  C  C   . PHE B  1  518 ? 45.096  61.003  26.176  1.00 32.20  ? 546  PHE B C   1 
ATOM   9452  O  O   . PHE B  1  518 ? 46.097  61.284  25.509  1.00 31.78  ? 546  PHE B O   1 
ATOM   9453  C  CB  . PHE B  1  518 ? 44.781  58.532  25.820  1.00 31.18  ? 546  PHE B CB  1 
ATOM   9454  C  CG  . PHE B  1  518 ? 43.801  57.388  25.828  1.00 31.81  ? 546  PHE B CG  1 
ATOM   9455  C  CD1 . PHE B  1  518 ? 43.631  56.594  24.709  1.00 31.35  ? 546  PHE B CD1 1 
ATOM   9456  C  CD2 . PHE B  1  518 ? 43.050  57.097  26.965  1.00 32.63  ? 546  PHE B CD2 1 
ATOM   9457  C  CE1 . PHE B  1  518 ? 42.736  55.535  24.721  1.00 31.72  ? 546  PHE B CE1 1 
ATOM   9458  C  CE2 . PHE B  1  518 ? 42.150  56.036  26.979  1.00 31.40  ? 546  PHE B CE2 1 
ATOM   9459  C  CZ  . PHE B  1  518 ? 42.001  55.254  25.853  1.00 31.38  ? 546  PHE B CZ  1 
ATOM   9460  N  N   . VAL B  1  519 ? 44.786  61.616  27.316  1.00 33.07  ? 547  VAL B N   1 
ATOM   9461  C  CA  . VAL B  1  519 ? 45.642  62.644  27.882  1.00 34.28  ? 547  VAL B CA  1 
ATOM   9462  C  C   . VAL B  1  519 ? 46.135  62.190  29.247  1.00 35.07  ? 547  VAL B C   1 
ATOM   9463  O  O   . VAL B  1  519 ? 45.340  62.084  30.175  1.00 35.04  ? 547  VAL B O   1 
ATOM   9464  C  CB  . VAL B  1  519 ? 44.897  63.977  28.034  1.00 34.19  ? 547  VAL B CB  1 
ATOM   9465  C  CG1 . VAL B  1  519 ? 45.857  65.065  28.466  1.00 34.74  ? 547  VAL B CG1 1 
ATOM   9466  C  CG2 . VAL B  1  519 ? 44.231  64.370  26.721  1.00 34.61  ? 547  VAL B CG2 1 
ATOM   9467  N  N   . PRO B  1  520 ? 47.448  61.901  29.367  1.00 36.13  ? 548  PRO B N   1 
ATOM   9468  C  CA  . PRO B  1  520 ? 48.036  61.567  30.674  1.00 36.64  ? 548  PRO B CA  1 
ATOM   9469  C  C   . PRO B  1  520 ? 47.930  62.732  31.631  1.00 37.36  ? 548  PRO B C   1 
ATOM   9470  O  O   . PRO B  1  520 ? 48.350  63.839  31.311  1.00 37.66  ? 548  PRO B O   1 
ATOM   9471  C  CB  . PRO B  1  520 ? 49.514  61.281  30.357  1.00 36.41  ? 548  PRO B CB  1 
ATOM   9472  C  CG  . PRO B  1  520 ? 49.763  61.903  29.000  1.00 36.98  ? 548  PRO B CG  1 
ATOM   9473  C  CD  . PRO B  1  520 ? 48.443  61.849  28.274  1.00 36.39  ? 548  PRO B CD  1 
ATOM   9474  N  N   . MET B  1  521 ? 47.336  62.488  32.788  1.00 38.25  ? 549  MET B N   1 
ATOM   9475  C  CA  . MET B  1  521 ? 47.297  63.490  33.840  1.00 39.19  ? 549  MET B CA  1 
ATOM   9476  C  C   . MET B  1  521 ? 47.315  62.828  35.204  1.00 38.87  ? 549  MET B C   1 
ATOM   9477  O  O   . MET B  1  521 ? 47.139  61.610  35.305  1.00 39.61  ? 549  MET B O   1 
ATOM   9478  C  CB  . MET B  1  521 ? 46.108  64.446  33.681  1.00 39.15  ? 549  MET B CB  1 
ATOM   9479  C  CG  . MET B  1  521 ? 44.757  63.807  33.545  1.00 40.38  ? 549  MET B CG  1 
ATOM   9480  S  SD  . MET B  1  521 ? 43.435  65.010  33.290  1.00 41.19  ? 549  MET B SD  1 
ATOM   9481  C  CE  . MET B  1  521 ? 43.882  65.715  31.708  1.00 38.80  ? 549  MET B CE  1 
ATOM   9482  N  N   . ALA B  1  522 ? 47.562  63.620  36.245  1.00 38.43  ? 550  ALA B N   1 
ATOM   9483  C  CA  . ALA B  1  522 ? 47.633  63.104  37.608  1.00 37.37  ? 550  ALA B CA  1 
ATOM   9484  C  C   . ALA B  1  522 ? 46.249  62.746  38.129  1.00 36.75  ? 550  ALA B C   1 
ATOM   9485  O  O   . ALA B  1  522 ? 45.285  63.462  37.877  1.00 36.19  ? 550  ALA B O   1 
ATOM   9486  C  CB  . ALA B  1  522 ? 48.310  64.120  38.530  1.00 37.45  ? 550  ALA B CB  1 
ATOM   9487  N  N   . VAL B  1  523 ? 46.183  61.632  38.858  1.00 36.44  ? 551  VAL B N   1 
ATOM   9488  C  CA  . VAL B  1  523 ? 44.969  61.139  39.508  1.00 35.72  ? 551  VAL B CA  1 
ATOM   9489  C  C   . VAL B  1  523 ? 44.589  62.097  40.641  1.00 36.03  ? 551  VAL B C   1 
ATOM   9490  O  O   . VAL B  1  523 ? 45.283  62.143  41.646  1.00 35.80  ? 551  VAL B O   1 
ATOM   9491  C  CB  . VAL B  1  523 ? 45.197  59.725  40.110  1.00 35.41  ? 551  VAL B CB  1 
ATOM   9492  C  CG1 . VAL B  1  523 ? 43.922  59.191  40.741  1.00 34.82  ? 551  VAL B CG1 1 
ATOM   9493  C  CG2 . VAL B  1  523 ? 45.725  58.757  39.066  1.00 34.51  ? 551  VAL B CG2 1 
ATOM   9494  N  N   . PRO B  1  524 ? 43.479  62.853  40.488  1.00 36.45  ? 552  PRO B N   1 
ATOM   9495  C  CA  . PRO B  1  524 ? 43.137  63.929  41.426  1.00 36.56  ? 552  PRO B CA  1 
ATOM   9496  C  C   . PRO B  1  524 ? 43.245  63.546  42.894  1.00 36.72  ? 552  PRO B C   1 
ATOM   9497  O  O   . PRO B  1  524 ? 43.879  64.273  43.660  1.00 36.81  ? 552  PRO B O   1 
ATOM   9498  C  CB  . PRO B  1  524 ? 41.695  64.269  41.052  1.00 36.68  ? 552  PRO B CB  1 
ATOM   9499  C  CG  . PRO B  1  524 ? 41.673  64.026  39.564  1.00 37.14  ? 552  PRO B CG  1 
ATOM   9500  C  CD  . PRO B  1  524 ? 42.481  62.755  39.404  1.00 36.51  ? 552  PRO B CD  1 
ATOM   9501  N  N   . TRP B  1  525 ? 42.667  62.403  43.269  1.00 36.73  ? 553  TRP B N   1 
ATOM   9502  C  CA  . TRP B  1  525 ? 42.636  61.958  44.671  1.00 36.38  ? 553  TRP B CA  1 
ATOM   9503  C  C   . TRP B  1  525 ? 43.913  61.225  45.099  1.00 36.79  ? 553  TRP B C   1 
ATOM   9504  O  O   . TRP B  1  525 ? 44.037  60.804  46.252  1.00 36.72  ? 553  TRP B O   1 
ATOM   9505  C  CB  . TRP B  1  525 ? 41.401  61.078  44.935  1.00 35.86  ? 553  TRP B CB  1 
ATOM   9506  C  CG  . TRP B  1  525 ? 41.373  59.811  44.114  1.00 35.25  ? 553  TRP B CG  1 
ATOM   9507  C  CD1 . TRP B  1  525 ? 41.842  58.577  44.486  1.00 34.27  ? 553  TRP B CD1 1 
ATOM   9508  C  CD2 . TRP B  1  525 ? 40.869  59.662  42.778  1.00 34.29  ? 553  TRP B CD2 1 
ATOM   9509  N  NE1 . TRP B  1  525 ? 41.654  57.675  43.465  1.00 34.48  ? 553  TRP B NE1 1 
ATOM   9510  C  CE2 . TRP B  1  525 ? 41.056  58.311  42.409  1.00 33.89  ? 553  TRP B CE2 1 
ATOM   9511  C  CE3 . TRP B  1  525 ? 40.269  60.537  41.862  1.00 34.51  ? 553  TRP B CE3 1 
ATOM   9512  C  CZ2 . TRP B  1  525 ? 40.670  57.817  41.165  1.00 35.00  ? 553  TRP B CZ2 1 
ATOM   9513  C  CZ3 . TRP B  1  525 ? 39.883  60.045  40.618  1.00 34.28  ? 553  TRP B CZ3 1 
ATOM   9514  C  CH2 . TRP B  1  525 ? 40.086  58.700  40.281  1.00 34.70  ? 553  TRP B CH2 1 
ATOM   9515  N  N   . SER B  1  526 ? 44.855  61.067  44.171  1.00 37.41  ? 554  SER B N   1 
ATOM   9516  C  CA  . SER B  1  526 ? 46.123  60.382  44.453  1.00 37.85  ? 554  SER B CA  1 
ATOM   9517  C  C   . SER B  1  526 ? 47.190  60.837  43.449  1.00 38.22  ? 554  SER B C   1 
ATOM   9518  O  O   . SER B  1  526 ? 47.559  60.085  42.537  1.00 38.22  ? 554  SER B O   1 
ATOM   9519  C  CB  . SER B  1  526 ? 45.923  58.867  44.405  1.00 37.90  ? 554  SER B CB  1 
ATOM   9520  O  OG  . SER B  1  526 ? 47.073  58.178  44.837  1.00 37.70  ? 554  SER B OG  1 
ATOM   9521  N  N   . PRO B  1  527 ? 47.688  62.081  43.618  1.00 38.65  ? 555  PRO B N   1 
ATOM   9522  C  CA  . PRO B  1  527 ? 48.520  62.809  42.655  1.00 38.54  ? 555  PRO B CA  1 
ATOM   9523  C  C   . PRO B  1  527 ? 49.845  62.158  42.258  1.00 38.64  ? 555  PRO B C   1 
ATOM   9524  O  O   . PRO B  1  527 ? 50.386  62.511  41.214  1.00 38.51  ? 555  PRO B O   1 
ATOM   9525  C  CB  . PRO B  1  527 ? 48.785  64.140  43.366  1.00 38.87  ? 555  PRO B CB  1 
ATOM   9526  C  CG  . PRO B  1  527 ? 47.664  64.292  44.326  1.00 38.74  ? 555  PRO B CG  1 
ATOM   9527  C  CD  . PRO B  1  527 ? 47.441  62.898  44.824  1.00 38.79  ? 555  PRO B CD  1 
ATOM   9528  N  N   . GLU B  1  528 ? 50.375  61.236  43.063  1.00 38.83  ? 556  GLU B N   1 
ATOM   9529  C  CA  . GLU B  1  528 ? 51.644  60.579  42.701  1.00 39.20  ? 556  GLU B CA  1 
ATOM   9530  C  C   . GLU B  1  528 ? 51.446  59.429  41.718  1.00 38.69  ? 556  GLU B C   1 
ATOM   9531  O  O   . GLU B  1  528 ? 52.403  58.733  41.365  1.00 38.69  ? 556  GLU B O   1 
ATOM   9532  C  CB  . GLU B  1  528 ? 52.468  60.131  43.928  1.00 39.78  ? 556  GLU B CB  1 
ATOM   9533  C  CG  . GLU B  1  528 ? 51.895  58.943  44.704  1.00 41.82  ? 556  GLU B CG  1 
ATOM   9534  C  CD  . GLU B  1  528 ? 50.982  59.383  45.835  1.00 44.25  ? 556  GLU B CD  1 
ATOM   9535  O  OE1 . GLU B  1  528 ? 51.496  59.593  46.958  1.00 44.88  ? 556  GLU B OE1 1 
ATOM   9536  O  OE2 . GLU B  1  528 ? 49.756  59.519  45.599  1.00 44.58  ? 556  GLU B OE2 1 
ATOM   9537  N  N   . HIS B  1  529 ? 50.204  59.248  41.278  1.00 38.12  ? 557  HIS B N   1 
ATOM   9538  C  CA  . HIS B  1  529 ? 49.861  58.233  40.294  1.00 37.57  ? 557  HIS B CA  1 
ATOM   9539  C  C   . HIS B  1  529 ? 49.388  58.885  39.002  1.00 37.31  ? 557  HIS B C   1 
ATOM   9540  O  O   . HIS B  1  529 ? 48.753  59.950  39.026  1.00 37.10  ? 557  HIS B O   1 
ATOM   9541  C  CB  . HIS B  1  529 ? 48.763  57.310  40.837  1.00 37.68  ? 557  HIS B CB  1 
ATOM   9542  C  CG  . HIS B  1  529 ? 49.239  56.355  41.878  1.00 37.58  ? 557  HIS B CG  1 
ATOM   9543  N  ND1 . HIS B  1  529 ? 49.107  56.603  43.228  1.00 38.55  ? 557  HIS B ND1 1 
ATOM   9544  C  CD2 . HIS B  1  529 ? 49.863  55.159  41.771  1.00 37.25  ? 557  HIS B CD2 1 
ATOM   9545  C  CE1 . HIS B  1  529 ? 49.623  55.595  43.910  1.00 38.25  ? 557  HIS B CE1 1 
ATOM   9546  N  NE2 . HIS B  1  529 ? 50.094  54.708  43.049  1.00 37.82  ? 557  HIS B NE2 1 
ATOM   9547  N  N   . GLN B  1  530 ? 49.689  58.224  37.885  1.00 36.80  ? 558  GLN B N   1 
ATOM   9548  C  CA  . GLN B  1  530 ? 49.238  58.647  36.564  1.00 36.64  ? 558  GLN B CA  1 
ATOM   9549  C  C   . GLN B  1  530 ? 48.004  57.861  36.120  1.00 36.09  ? 558  GLN B C   1 
ATOM   9550  O  O   . GLN B  1  530 ? 47.887  56.673  36.397  1.00 36.01  ? 558  GLN B O   1 
ATOM   9551  C  CB  . GLN B  1  530 ? 50.351  58.445  35.518  1.00 36.62  ? 558  GLN B CB  1 
ATOM   9552  C  CG  . GLN B  1  530 ? 51.538  59.396  35.619  1.00 37.93  ? 558  GLN B CG  1 
ATOM   9553  C  CD  . GLN B  1  530 ? 51.247  60.809  35.094  1.00 39.69  ? 558  GLN B CD  1 
ATOM   9554  O  OE1 . GLN B  1  530 ? 51.241  61.784  35.860  1.00 40.52  ? 558  GLN B OE1 1 
ATOM   9555  N  NE2 . GLN B  1  530 ? 51.011  60.922  33.787  1.00 39.12  ? 558  GLN B NE2 1 
ATOM   9556  N  N   . LEU B  1  531 ? 47.087  58.536  35.433  1.00 35.56  ? 559  LEU B N   1 
ATOM   9557  C  CA  . LEU B  1  531 ? 46.079  57.852  34.623  1.00 35.12  ? 559  LEU B CA  1 
ATOM   9558  C  C   . LEU B  1  531 ? 46.050  58.402  33.187  1.00 34.91  ? 559  LEU B C   1 
ATOM   9559  O  O   . LEU B  1  531 ? 46.479  59.544  32.941  1.00 35.01  ? 559  LEU B O   1 
ATOM   9560  C  CB  . LEU B  1  531 ? 44.698  57.953  35.258  1.00 35.01  ? 559  LEU B CB  1 
ATOM   9561  C  CG  . LEU B  1  531 ? 44.080  59.310  35.570  1.00 35.86  ? 559  LEU B CG  1 
ATOM   9562  C  CD1 . LEU B  1  531 ? 43.520  59.992  34.330  1.00 36.71  ? 559  LEU B CD1 1 
ATOM   9563  C  CD2 . LEU B  1  531 ? 42.972  59.077  36.574  1.00 37.02  ? 559  LEU B CD2 1 
ATOM   9564  N  N   . GLN B  1  532 ? 45.546  57.596  32.250  1.00 34.00  ? 560  GLN B N   1 
ATOM   9565  C  CA  . GLN B  1  532 ? 45.334  58.053  30.891  1.00 32.99  ? 560  GLN B CA  1 
ATOM   9566  C  C   . GLN B  1  532 ? 43.886  58.483  30.765  1.00 32.80  ? 560  GLN B C   1 
ATOM   9567  O  O   . GLN B  1  532 ? 42.985  57.660  30.779  1.00 32.87  ? 560  GLN B O   1 
ATOM   9568  C  CB  . GLN B  1  532 ? 45.650  56.943  29.906  1.00 32.70  ? 560  GLN B CB  1 
ATOM   9569  C  CG  . GLN B  1  532 ? 46.964  56.250  30.174  1.00 32.59  ? 560  GLN B CG  1 
ATOM   9570  C  CD  . GLN B  1  532 ? 48.181  57.167  30.066  1.00 33.60  ? 560  GLN B CD  1 
ATOM   9571  O  OE1 . GLN B  1  532 ? 48.374  57.863  29.064  1.00 31.63  ? 560  GLN B OE1 1 
ATOM   9572  N  NE2 . GLN B  1  532 ? 49.027  57.142  31.098  1.00 32.83  ? 560  GLN B NE2 1 
ATOM   9573  N  N   . ARG B  1  533 ? 43.666  59.786  30.663  1.00 32.60  ? 561  ARG B N   1 
ATOM   9574  C  CA  . ARG B  1  533 ? 42.313  60.341  30.643  1.00 32.43  ? 561  ARG B CA  1 
ATOM   9575  C  C   . ARG B  1  533 ? 41.708  60.258  29.252  1.00 32.18  ? 561  ARG B C   1 
ATOM   9576  O  O   . ARG B  1  533 ? 42.166  60.933  28.328  1.00 32.72  ? 561  ARG B O   1 
ATOM   9577  C  CB  . ARG B  1  533 ? 42.344  61.806  31.104  1.00 32.56  ? 561  ARG B CB  1 
ATOM   9578  C  CG  . ARG B  1  533 ? 40.991  62.404  31.425  1.00 31.40  ? 561  ARG B CG  1 
ATOM   9579  C  CD  . ARG B  1  533 ? 40.479  61.862  32.723  1.00 29.28  ? 561  ARG B CD  1 
ATOM   9580  N  NE  . ARG B  1  533 ? 39.195  62.457  33.056  1.00 29.32  ? 561  ARG B NE  1 
ATOM   9581  C  CZ  . ARG B  1  533 ? 39.047  63.636  33.652  1.00 28.63  ? 561  ARG B CZ  1 
ATOM   9582  N  NH1 . ARG B  1  533 ? 40.107  64.347  33.979  1.00 29.42  ? 561  ARG B NH1 1 
ATOM   9583  N  NH2 . ARG B  1  533 ? 37.839  64.102  33.921  1.00 28.84  ? 561  ARG B NH2 1 
ATOM   9584  N  N   . LEU B  1  534 ? 40.677  59.440  29.095  1.00 31.66  ? 562  LEU B N   1 
ATOM   9585  C  CA  . LEU B  1  534 ? 40.001  59.338  27.800  1.00 31.38  ? 562  LEU B CA  1 
ATOM   9586  C  C   . LEU B  1  534 ? 39.104  60.554  27.570  1.00 31.06  ? 562  LEU B C   1 
ATOM   9587  O  O   . LEU B  1  534 ? 38.325  60.923  28.439  1.00 31.07  ? 562  LEU B O   1 
ATOM   9588  C  CB  . LEU B  1  534 ? 39.206  58.032  27.706  1.00 31.10  ? 562  LEU B CB  1 
ATOM   9589  C  CG  . LEU B  1  534 ? 38.373  57.750  26.456  1.00 30.99  ? 562  LEU B CG  1 
ATOM   9590  C  CD1 . LEU B  1  534 ? 39.244  57.721  25.212  1.00 29.97  ? 562  LEU B CD1 1 
ATOM   9591  C  CD2 . LEU B  1  534 ? 37.627  56.435  26.620  1.00 31.31  ? 562  LEU B CD2 1 
ATOM   9592  N  N   . GLN B  1  535 ? 39.232  61.172  26.401  1.00 31.21  ? 563  GLN B N   1 
ATOM   9593  C  CA  . GLN B  1  535 ? 38.477  62.390  26.048  1.00 31.19  ? 563  GLN B CA  1 
ATOM   9594  C  C   . GLN B  1  535 ? 37.978  62.345  24.614  1.00 30.94  ? 563  GLN B C   1 
ATOM   9595  O  O   . GLN B  1  535 ? 38.596  61.720  23.749  1.00 31.22  ? 563  GLN B O   1 
ATOM   9596  C  CB  . GLN B  1  535 ? 39.354  63.643  26.199  1.00 30.98  ? 563  GLN B CB  1 
ATOM   9597  C  CG  . GLN B  1  535 ? 39.476  64.167  27.611  1.00 31.50  ? 563  GLN B CG  1 
ATOM   9598  C  CD  . GLN B  1  535 ? 40.468  65.329  27.740  1.00 31.61  ? 563  GLN B CD  1 
ATOM   9599  O  OE1 . GLN B  1  535 ? 40.950  65.872  26.740  1.00 32.16  ? 563  GLN B OE1 1 
ATOM   9600  N  NE2 . GLN B  1  535 ? 40.773  65.711  28.980  1.00 30.56  ? 563  GLN B NE2 1 
ATOM   9601  N  N   . VAL B  1  536 ? 36.873  63.038  24.365  1.00 30.81  ? 564  VAL B N   1 
ATOM   9602  C  CA  . VAL B  1  536 ? 36.324  63.214  23.020  1.00 30.34  ? 564  VAL B CA  1 
ATOM   9603  C  C   . VAL B  1  536 ? 36.907  64.478  22.377  1.00 30.35  ? 564  VAL B C   1 
ATOM   9604  O  O   . VAL B  1  536 ? 36.979  65.523  23.019  1.00 30.63  ? 564  VAL B O   1 
ATOM   9605  C  CB  . VAL B  1  536 ? 34.793  63.346  23.085  1.00 30.43  ? 564  VAL B CB  1 
ATOM   9606  C  CG1 . VAL B  1  536 ? 34.207  63.657  21.714  1.00 29.86  ? 564  VAL B CG1 1 
ATOM   9607  C  CG2 . VAL B  1  536 ? 34.173  62.072  23.671  1.00 30.25  ? 564  VAL B CG2 1 
ATOM   9608  N  N   . THR B  1  537 ? 37.350  64.365  21.125  1.00 30.12  ? 565  THR B N   1 
ATOM   9609  C  CA  . THR B  1  537 ? 37.775  65.516  20.333  1.00 29.37  ? 565  THR B CA  1 
ATOM   9610  C  C   . THR B  1  537 ? 36.646  65.836  19.389  1.00 29.47  ? 565  THR B C   1 
ATOM   9611  O  O   . THR B  1  537 ? 35.925  64.926  18.934  1.00 29.01  ? 565  THR B O   1 
ATOM   9612  C  CB  . THR B  1  537 ? 39.037  65.236  19.473  1.00 29.42  ? 565  THR B CB  1 
ATOM   9613  O  OG1 . THR B  1  537 ? 38.782  64.145  18.584  1.00 29.06  ? 565  THR B OG1 1 
ATOM   9614  C  CG2 . THR B  1  537 ? 40.254  64.921  20.343  1.00 29.42  ? 565  THR B CG2 1 
ATOM   9615  N  N   . ARG B  1  538 ? 36.502  67.125  19.092  1.00 29.34  ? 566  ARG B N   1 
ATOM   9616  C  CA  . ARG B  1  538 ? 35.434  67.615  18.250  1.00 30.18  ? 566  ARG B CA  1 
ATOM   9617  C  C   . ARG B  1  538 ? 35.979  68.717  17.384  1.00 30.74  ? 566  ARG B C   1 
ATOM   9618  O  O   . ARG B  1  538 ? 36.580  69.664  17.874  1.00 30.69  ? 566  ARG B O   1 
ATOM   9619  C  CB  . ARG B  1  538 ? 34.260  68.127  19.088  1.00 29.66  ? 566  ARG B CB  1 
ATOM   9620  C  CG  . ARG B  1  538 ? 33.083  68.639  18.261  1.00 29.75  ? 566  ARG B CG  1 
ATOM   9621  C  CD  . ARG B  1  538 ? 31.874  69.005  19.133  1.00 31.27  ? 566  ARG B CD  1 
ATOM   9622  N  NE  . ARG B  1  538 ? 31.305  67.827  19.802  1.00 35.62  ? 566  ARG B NE  1 
ATOM   9623  C  CZ  . ARG B  1  538 ? 31.512  67.484  21.079  1.00 35.53  ? 566  ARG B CZ  1 
ATOM   9624  N  NH1 . ARG B  1  538 ? 32.279  68.230  21.863  1.00 35.08  ? 566  ARG B NH1 1 
ATOM   9625  N  NH2 . ARG B  1  538 ? 30.950  66.378  21.570  1.00 35.52  ? 566  ARG B NH2 1 
ATOM   9626  N  N   . LYS B  1  539 ? 35.769  68.588  16.083  1.00 31.67  ? 567  LYS B N   1 
ATOM   9627  C  CA  . LYS B  1  539 ? 36.270  69.564  15.136  1.00 32.43  ? 567  LYS B CA  1 
ATOM   9628  C  C   . LYS B  1  539 ? 35.161  69.764  14.146  1.00 32.19  ? 567  LYS B C   1 
ATOM   9629  O  O   . LYS B  1  539 ? 34.587  68.782  13.634  1.00 31.83  ? 567  LYS B O   1 
ATOM   9630  C  CB  . LYS B  1  539 ? 37.503  69.015  14.422  1.00 32.74  ? 567  LYS B CB  1 
ATOM   9631  C  CG  . LYS B  1  539 ? 38.402  70.064  13.750  1.00 34.47  ? 567  LYS B CG  1 
ATOM   9632  C  CD  . LYS B  1  539 ? 39.300  69.383  12.684  1.00 34.33  ? 567  LYS B CD  1 
ATOM   9633  C  CE  . LYS B  1  539 ? 40.093  70.387  11.814  1.00 35.90  ? 567  LYS B CE  1 
ATOM   9634  N  NZ  . LYS B  1  539 ? 40.443  69.804  10.434  1.00 35.96  ? 567  LYS B NZ  1 
ATOM   9635  N  N   . LEU B  1  540 ? 34.833  71.033  13.915  1.00 31.86  ? 568  LEU B N   1 
ATOM   9636  C  CA  . LEU B  1  540 ? 33.956  71.427  12.819  1.00 31.98  ? 568  LEU B CA  1 
ATOM   9637  C  C   . LEU B  1  540 ? 34.761  71.469  11.519  1.00 32.22  ? 568  LEU B C   1 
ATOM   9638  O  O   . LEU B  1  540 ? 35.750  72.174  11.428  1.00 32.62  ? 568  LEU B O   1 
ATOM   9639  C  CB  . LEU B  1  540 ? 33.341  72.814  13.098  1.00 31.83  ? 568  LEU B CB  1 
ATOM   9640  C  CG  . LEU B  1  540 ? 32.457  73.494  12.039  1.00 31.30  ? 568  LEU B CG  1 
ATOM   9641  C  CD1 . LEU B  1  540 ? 31.186  72.694  11.773  1.00 29.74  ? 568  LEU B CD1 1 
ATOM   9642  C  CD2 . LEU B  1  540 ? 32.105  74.923  12.449  1.00 31.30  ? 568  LEU B CD2 1 
ATOM   9643  N  N   . LEU B  1  541 ? 34.331  70.715  10.518  1.00 32.76  ? 569  LEU B N   1 
ATOM   9644  C  CA  . LEU B  1  541 ? 34.967  70.732  9.205   1.00 33.07  ? 569  LEU B CA  1 
ATOM   9645  C  C   . LEU B  1  541 ? 34.323  71.808  8.348   1.00 33.67  ? 569  LEU B C   1 
ATOM   9646  O  O   . LEU B  1  541 ? 33.188  71.646  7.920   1.00 34.01  ? 569  LEU B O   1 
ATOM   9647  C  CB  . LEU B  1  541 ? 34.834  69.354  8.557   1.00 32.60  ? 569  LEU B CB  1 
ATOM   9648  C  CG  . LEU B  1  541 ? 35.392  68.206  9.416   1.00 32.80  ? 569  LEU B CG  1 
ATOM   9649  C  CD1 . LEU B  1  541 ? 35.210  66.851  8.729   1.00 32.15  ? 569  LEU B CD1 1 
ATOM   9650  C  CD2 . LEU B  1  541 ? 36.881  68.425  9.801   1.00 30.85  ? 569  LEU B CD2 1 
ATOM   9651  N  N   . GLU B  1  542 ? 35.047  72.902  8.094   1.00 34.51  ? 570  GLU B N   1 
ATOM   9652  C  CA  . GLU B  1  542 ? 34.445  74.121  7.504   1.00 35.62  ? 570  GLU B CA  1 
ATOM   9653  C  C   . GLU B  1  542 ? 34.483  74.235  5.976   1.00 36.01  ? 570  GLU B C   1 
ATOM   9654  O  O   . GLU B  1  542 ? 33.506  74.670  5.369   1.00 36.41  ? 570  GLU B O   1 
ATOM   9655  C  CB  . GLU B  1  542 ? 35.017  75.399  8.150   1.00 35.15  ? 570  GLU B CB  1 
ATOM   9656  C  CG  . GLU B  1  542 ? 34.831  75.454  9.669   1.00 36.09  ? 570  GLU B CG  1 
ATOM   9657  C  CD  . GLU B  1  542 ? 35.219  76.785  10.298  1.00 36.51  ? 570  GLU B CD  1 
ATOM   9658  O  OE1 . GLU B  1  542 ? 35.070  77.841  9.643   1.00 39.61  ? 570  GLU B OE1 1 
ATOM   9659  O  OE2 . GLU B  1  542 ? 35.650  76.780  11.467  1.00 36.92  ? 570  GLU B OE2 1 
ATOM   9660  N  N   . MET B  1  543 ? 35.607  73.873  5.365   1.00 36.60  ? 571  MET B N   1 
ATOM   9661  C  CA  . MET B  1  543 ? 35.764  73.909  3.903   1.00 36.80  ? 571  MET B CA  1 
ATOM   9662  C  C   . MET B  1  543 ? 35.714  72.485  3.323   1.00 35.86  ? 571  MET B C   1 
ATOM   9663  O  O   . MET B  1  543 ? 36.094  71.529  3.994   1.00 35.44  ? 571  MET B O   1 
ATOM   9664  C  CB  . MET B  1  543 ? 37.094  74.581  3.520   1.00 37.60  ? 571  MET B CB  1 
ATOM   9665  C  CG  . MET B  1  543 ? 37.383  75.882  4.256   1.00 39.73  ? 571  MET B CG  1 
ATOM   9666  S  SD  . MET B  1  543 ? 36.359  77.276  3.727   1.00 43.97  ? 571  MET B SD  1 
ATOM   9667  C  CE  . MET B  1  543 ? 36.158  78.132  5.304   1.00 40.74  ? 571  MET B CE  1 
ATOM   9668  N  N   . GLU B  1  544 ? 35.271  72.361  2.073   1.00 35.17  ? 572  GLU B N   1 
ATOM   9669  C  CA  . GLU B  1  544 ? 35.145  71.053  1.405   1.00 34.86  ? 572  GLU B CA  1 
ATOM   9670  C  C   . GLU B  1  544 ? 36.397  70.175  1.480   1.00 34.73  ? 572  GLU B C   1 
ATOM   9671  O  O   . GLU B  1  544 ? 36.284  68.963  1.689   1.00 34.60  ? 572  GLU B O   1 
ATOM   9672  C  CB  . GLU B  1  544 ? 34.726  71.216  -0.061  1.00 34.41  ? 572  GLU B CB  1 
ATOM   9673  C  CG  . GLU B  1  544 ? 33.249  71.468  -0.259  1.00 35.11  ? 572  GLU B CG  1 
ATOM   9674  C  CD  . GLU B  1  544 ? 32.886  71.949  -1.653  1.00 35.12  ? 572  GLU B CD  1 
ATOM   9675  O  OE1 . GLU B  1  544 ? 31.686  71.972  -1.978  1.00 35.49  ? 572  GLU B OE1 1 
ATOM   9676  O  OE2 . GLU B  1  544 ? 33.786  72.301  -2.440  1.00 36.82  ? 572  GLU B OE2 1 
ATOM   9677  N  N   . GLU B  1  545 ? 37.573  70.773  1.293   1.00 34.70  ? 573  GLU B N   1 
ATOM   9678  C  CA  . GLU B  1  545 ? 38.824  70.019  1.329   1.00 35.33  ? 573  GLU B CA  1 
ATOM   9679  C  C   . GLU B  1  545 ? 39.012  69.263  2.643   1.00 35.10  ? 573  GLU B C   1 
ATOM   9680  O  O   . GLU B  1  545 ? 39.590  68.169  2.648   1.00 34.88  ? 573  GLU B O   1 
ATOM   9681  C  CB  . GLU B  1  545 ? 40.037  70.924  1.075   1.00 35.90  ? 573  GLU B CB  1 
ATOM   9682  C  CG  . GLU B  1  545 ? 40.359  71.169  -0.412  1.00 37.56  ? 573  GLU B CG  1 
ATOM   9683  C  CD  . GLU B  1  545 ? 39.412  72.178  -1.061  1.00 41.13  ? 573  GLU B CD  1 
ATOM   9684  O  OE1 . GLU B  1  545 ? 39.400  72.243  -2.315  1.00 40.65  ? 573  GLU B OE1 1 
ATOM   9685  O  OE2 . GLU B  1  545 ? 38.677  72.899  -0.318  1.00 42.54  ? 573  GLU B OE2 1 
ATOM   9686  N  N   . GLN B  1  546 ? 38.500  69.841  3.732   1.00 34.77  ? 574  GLN B N   1 
ATOM   9687  C  CA  . GLN B  1  546 ? 38.619  69.270  5.069   1.00 34.94  ? 574  GLN B CA  1 
ATOM   9688  C  C   . GLN B  1  546 ? 37.741  68.044  5.207   1.00 34.72  ? 574  GLN B C   1 
ATOM   9689  O  O   . GLN B  1  546 ? 37.968  67.211  6.083   1.00 34.77  ? 574  GLN B O   1 
ATOM   9690  C  CB  . GLN B  1  546 ? 38.231  70.290  6.149   1.00 34.98  ? 574  GLN B CB  1 
ATOM   9691  C  CG  . GLN B  1  546 ? 39.311  71.298  6.543   1.00 34.65  ? 574  GLN B CG  1 
ATOM   9692  C  CD  . GLN B  1  546 ? 38.756  72.359  7.500   1.00 35.79  ? 574  GLN B CD  1 
ATOM   9693  O  OE1 . GLN B  1  546 ? 38.117  73.316  7.072   1.00 37.09  ? 574  GLN B OE1 1 
ATOM   9694  N  NE2 . GLN B  1  546 ? 38.980  72.177  8.804   1.00 36.30  ? 574  GLN B NE2 1 
ATOM   9695  N  N   . ALA B  1  547 ? 36.733  67.950  4.346   1.00 34.48  ? 575  ALA B N   1 
ATOM   9696  C  CA  . ALA B  1  547 ? 35.796  66.832  4.360   1.00 34.26  ? 575  ALA B CA  1 
ATOM   9697  C  C   . ALA B  1  547 ? 35.987  65.897  3.167   1.00 34.20  ? 575  ALA B C   1 
ATOM   9698  O  O   . ALA B  1  547 ? 35.115  65.071  2.874   1.00 34.22  ? 575  ALA B O   1 
ATOM   9699  C  CB  . ALA B  1  547 ? 34.364  67.346  4.403   1.00 34.36  ? 575  ALA B CB  1 
ATOM   9700  N  N   . ALA B  1  548 ? 37.117  66.028  2.477   1.00 33.94  ? 576  ALA B N   1 
ATOM   9701  C  CA  . ALA B  1  548 ? 37.474  65.090  1.410   1.00 34.19  ? 576  ALA B CA  1 
ATOM   9702  C  C   . ALA B  1  548 ? 38.478  64.067  1.929   1.00 34.12  ? 576  ALA B C   1 
ATOM   9703  O  O   . ALA B  1  548 ? 39.600  64.422  2.262   1.00 34.13  ? 576  ALA B O   1 
ATOM   9704  C  CB  . ALA B  1  548 ? 38.051  65.836  0.216   1.00 34.16  ? 576  ALA B CB  1 
ATOM   9705  N  N   . PHE B  1  549 ? 38.079  62.805  2.009   1.00 34.35  ? 577  PHE B N   1 
ATOM   9706  C  CA  . PHE B  1  549 ? 38.956  61.794  2.594   1.00 35.06  ? 577  PHE B CA  1 
ATOM   9707  C  C   . PHE B  1  549 ? 39.432  60.770  1.577   1.00 36.01  ? 577  PHE B C   1 
ATOM   9708  O  O   . PHE B  1  549 ? 38.632  60.007  1.002   1.00 36.02  ? 577  PHE B O   1 
ATOM   9709  C  CB  . PHE B  1  549 ? 38.304  61.132  3.807   1.00 34.77  ? 577  PHE B CB  1 
ATOM   9710  C  CG  . PHE B  1  549 ? 38.003  62.099  4.932   1.00 34.30  ? 577  PHE B CG  1 
ATOM   9711  C  CD1 . PHE B  1  549 ? 36.731  62.659  5.063   1.00 33.08  ? 577  PHE B CD1 1 
ATOM   9712  C  CD2 . PHE B  1  549 ? 38.998  62.462  5.844   1.00 32.57  ? 577  PHE B CD2 1 
ATOM   9713  C  CE1 . PHE B  1  549 ? 36.451  63.548  6.087   1.00 33.33  ? 577  PHE B CE1 1 
ATOM   9714  C  CE2 . PHE B  1  549 ? 38.732  63.358  6.877   1.00 32.92  ? 577  PHE B CE2 1 
ATOM   9715  C  CZ  . PHE B  1  549 ? 37.456  63.906  7.001   1.00 33.19  ? 577  PHE B CZ  1 
ATOM   9716  N  N   . LEU B  1  550 ? 40.745  60.778  1.353   1.00 36.62  ? 578  LEU B N   1 
ATOM   9717  C  CA  . LEU B  1  550 ? 41.359  59.922  0.357   1.00 37.71  ? 578  LEU B CA  1 
ATOM   9718  C  C   . LEU B  1  550 ? 41.343  58.467  0.796   1.00 38.39  ? 578  LEU B C   1 
ATOM   9719  O  O   . LEU B  1  550 ? 41.327  58.164  2.001   1.00 38.57  ? 578  LEU B O   1 
ATOM   9720  C  CB  . LEU B  1  550 ? 42.793  60.369  0.045   1.00 37.50  ? 578  LEU B CB  1 
ATOM   9721  C  CG  . LEU B  1  550 ? 42.949  61.654  -0.771  1.00 38.14  ? 578  LEU B CG  1 
ATOM   9722  C  CD1 . LEU B  1  550 ? 44.422  62.109  -0.804  1.00 37.82  ? 578  LEU B CD1 1 
ATOM   9723  C  CD2 . LEU B  1  550 ? 42.384  61.491  -2.180  1.00 35.89  ? 578  LEU B CD2 1 
ATOM   9724  N  N   . VAL B  1  551 ? 41.327  57.576  -0.190  1.00 38.74  ? 579  VAL B N   1 
ATOM   9725  C  CA  . VAL B  1  551 ? 41.470  56.165  0.067   1.00 39.70  ? 579  VAL B CA  1 
ATOM   9726  C  C   . VAL B  1  551 ? 42.808  55.940  0.765   1.00 40.09  ? 579  VAL B C   1 
ATOM   9727  O  O   . VAL B  1  551 ? 43.825  56.510  0.374   1.00 39.94  ? 579  VAL B O   1 
ATOM   9728  C  CB  . VAL B  1  551 ? 41.387  55.337  -1.247  1.00 40.07  ? 579  VAL B CB  1 
ATOM   9729  C  CG1 . VAL B  1  551 ? 41.800  53.879  -1.010  1.00 39.92  ? 579  VAL B CG1 1 
ATOM   9730  C  CG2 . VAL B  1  551 ? 39.975  55.396  -1.835  1.00 40.27  ? 579  VAL B CG2 1 
ATOM   9731  N  N   . GLY B  1  552 ? 42.784  55.130  1.821   1.00 40.83  ? 580  GLY B N   1 
ATOM   9732  C  CA  . GLY B  1  552 ? 43.998  54.696  2.495   1.00 41.35  ? 580  GLY B CA  1 
ATOM   9733  C  C   . GLY B  1  552 ? 44.372  55.556  3.679   1.00 41.85  ? 580  GLY B C   1 
ATOM   9734  O  O   . GLY B  1  552 ? 45.332  55.239  4.396   1.00 42.28  ? 580  GLY B O   1 
ATOM   9735  N  N   . SER B  1  553 ? 43.627  56.641  3.889   1.00 41.69  ? 581  SER B N   1 
ATOM   9736  C  CA  . SER B  1  553 ? 43.914  57.558  4.987   1.00 41.67  ? 581  SER B CA  1 
ATOM   9737  C  C   . SER B  1  553 ? 42.902  57.382  6.126   1.00 41.58  ? 581  SER B C   1 
ATOM   9738  O  O   . SER B  1  553 ? 41.856  56.745  5.948   1.00 41.58  ? 581  SER B O   1 
ATOM   9739  C  CB  . SER B  1  553 ? 43.955  59.006  4.489   1.00 41.87  ? 581  SER B CB  1 
ATOM   9740  O  OG  . SER B  1  553 ? 42.654  59.555  4.419   1.00 42.84  ? 581  SER B OG  1 
ATOM   9741  N  N   . ALA B  1  554 ? 43.229  57.923  7.301   1.00 41.12  ? 582  ALA B N   1 
ATOM   9742  C  CA  . ALA B  1  554 ? 42.361  57.798  8.472   1.00 40.51  ? 582  ALA B CA  1 
ATOM   9743  C  C   . ALA B  1  554 ? 41.190  58.772  8.383   1.00 39.85  ? 582  ALA B C   1 
ATOM   9744  O  O   . ALA B  1  554 ? 41.374  59.939  8.027   1.00 39.51  ? 582  ALA B O   1 
ATOM   9745  C  CB  . ALA B  1  554 ? 43.157  58.045  9.764   1.00 40.61  ? 582  ALA B CB  1 
ATOM   9746  N  N   . THR B  1  555 ? 39.991  58.292  8.698   1.00 38.85  ? 583  THR B N   1 
ATOM   9747  C  CA  . THR B  1  555 ? 38.842  59.188  8.818   1.00 38.16  ? 583  THR B CA  1 
ATOM   9748  C  C   . THR B  1  555 ? 38.333  59.262  10.265  1.00 37.38  ? 583  THR B C   1 
ATOM   9749  O  O   . THR B  1  555 ? 38.459  58.297  11.033  1.00 37.36  ? 583  THR B O   1 
ATOM   9750  C  CB  . THR B  1  555 ? 37.692  58.833  7.820   1.00 38.60  ? 583  THR B CB  1 
ATOM   9751  O  OG1 . THR B  1  555 ? 36.929  57.710  8.295   1.00 38.61  ? 583  THR B OG1 1 
ATOM   9752  C  CG2 . THR B  1  555 ? 38.253  58.550  6.424   1.00 38.18  ? 583  THR B CG2 1 
ATOM   9753  N  N   . PRO B  1  556 ? 37.765  60.413  10.655  1.00 36.30  ? 584  PRO B N   1 
ATOM   9754  C  CA  . PRO B  1  556 ? 37.353  60.494  12.052  1.00 35.41  ? 584  PRO B CA  1 
ATOM   9755  C  C   . PRO B  1  556 ? 36.291  59.435  12.375  1.00 34.72  ? 584  PRO B C   1 
ATOM   9756  O  O   . PRO B  1  556 ? 35.393  59.182  11.566  1.00 34.75  ? 584  PRO B O   1 
ATOM   9757  C  CB  . PRO B  1  556 ? 36.804  61.917  12.192  1.00 35.27  ? 584  PRO B CB  1 
ATOM   9758  C  CG  . PRO B  1  556 ? 36.677  62.461  10.840  1.00 35.51  ? 584  PRO B CG  1 
ATOM   9759  C  CD  . PRO B  1  556 ? 37.469  61.638  9.893   1.00 36.34  ? 584  PRO B CD  1 
ATOM   9760  N  N   . ARG B  1  557 ? 36.415  58.815  13.547  1.00 33.67  ? 585  ARG B N   1 
ATOM   9761  C  CA  . ARG B  1  557 ? 35.562  57.690  13.928  1.00 32.17  ? 585  ARG B CA  1 
ATOM   9762  C  C   . ARG B  1  557 ? 34.080  58.024  13.951  1.00 32.08  ? 585  ARG B C   1 
ATOM   9763  O  O   . ARG B  1  557 ? 33.243  57.150  13.676  1.00 32.03  ? 585  ARG B O   1 
ATOM   9764  C  CB  . ARG B  1  557 ? 36.012  57.096  15.258  1.00 32.13  ? 585  ARG B CB  1 
ATOM   9765  C  CG  . ARG B  1  557 ? 37.313  56.305  15.154  1.00 30.93  ? 585  ARG B CG  1 
ATOM   9766  C  CD  . ARG B  1  557 ? 37.749  55.763  16.519  1.00 30.58  ? 585  ARG B CD  1 
ATOM   9767  N  NE  . ARG B  1  557 ? 38.921  54.908  16.408  1.00 26.67  ? 585  ARG B NE  1 
ATOM   9768  C  CZ  . ARG B  1  557 ? 40.186  55.325  16.465  1.00 25.51  ? 585  ARG B CZ  1 
ATOM   9769  N  NH1 . ARG B  1  557 ? 40.471  56.610  16.646  1.00 25.07  ? 585  ARG B NH1 1 
ATOM   9770  N  NH2 . ARG B  1  557 ? 41.173  54.445  16.330  1.00 22.23  ? 585  ARG B NH2 1 
ATOM   9771  N  N   . TYR B  1  558 ? 33.759  59.278  14.291  1.00 31.52  ? 586  TYR B N   1 
ATOM   9772  C  CA  . TYR B  1  558 ? 32.392  59.800  14.169  1.00 31.01  ? 586  TYR B CA  1 
ATOM   9773  C  C   . TYR B  1  558 ? 32.362  60.977  13.217  1.00 30.94  ? 586  TYR B C   1 
ATOM   9774  O  O   . TYR B  1  558 ? 32.786  62.072  13.572  1.00 31.28  ? 586  TYR B O   1 
ATOM   9775  C  CB  . TYR B  1  558 ? 31.826  60.249  15.519  1.00 30.48  ? 586  TYR B CB  1 
ATOM   9776  C  CG  . TYR B  1  558 ? 31.301  59.141  16.397  1.00 30.27  ? 586  TYR B CG  1 
ATOM   9777  C  CD1 . TYR B  1  558 ? 32.177  58.258  17.027  1.00 30.79  ? 586  TYR B CD1 1 
ATOM   9778  C  CD2 . TYR B  1  558 ? 29.941  58.982  16.619  1.00 28.27  ? 586  TYR B CD2 1 
ATOM   9779  C  CE1 . TYR B  1  558 ? 31.709  57.245  17.855  1.00 29.57  ? 586  TYR B CE1 1 
ATOM   9780  C  CE2 . TYR B  1  558 ? 29.470  57.968  17.442  1.00 29.72  ? 586  TYR B CE2 1 
ATOM   9781  C  CZ  . TYR B  1  558 ? 30.369  57.105  18.065  1.00 29.28  ? 586  TYR B CZ  1 
ATOM   9782  O  OH  . TYR B  1  558 ? 29.936  56.085  18.885  1.00 28.93  ? 586  TYR B OH  1 
ATOM   9783  N  N   . LEU B  1  559 ? 31.864  60.745  12.009  1.00 30.77  ? 587  LEU B N   1 
ATOM   9784  C  CA  . LEU B  1  559 ? 31.688  61.803  11.035  1.00 30.44  ? 587  LEU B CA  1 
ATOM   9785  C  C   . LEU B  1  559 ? 30.207  61.968  10.751  1.00 30.12  ? 587  LEU B C   1 
ATOM   9786  O  O   . LEU B  1  559 ? 29.528  61.006  10.388  1.00 30.33  ? 587  LEU B O   1 
ATOM   9787  C  CB  . LEU B  1  559 ? 32.444  61.495  9.747   1.00 30.46  ? 587  LEU B CB  1 
ATOM   9788  C  CG  . LEU B  1  559 ? 32.480  62.790  8.931   1.00 31.71  ? 587  LEU B CG  1 
ATOM   9789  C  CD1 . LEU B  1  559 ? 33.877  63.268  8.690   1.00 30.18  ? 587  LEU B CD1 1 
ATOM   9790  C  CD2 . LEU B  1  559 ? 31.675  62.690  7.650   1.00 33.26  ? 587  LEU B CD2 1 
ATOM   9791  N  N   . TYR B  1  560 ? 29.695  63.178  10.944  1.00 29.36  ? 588  TYR B N   1 
ATOM   9792  C  CA  . TYR B  1  560 ? 28.268  63.388  10.787  1.00 29.09  ? 588  TYR B CA  1 
ATOM   9793  C  C   . TYR B  1  560 ? 27.919  64.758  10.258  1.00 29.00  ? 588  TYR B C   1 
ATOM   9794  O  O   . TYR B  1  560 ? 28.631  65.732  10.524  1.00 28.64  ? 588  TYR B O   1 
ATOM   9795  C  CB  . TYR B  1  560 ? 27.493  63.082  12.088  1.00 28.99  ? 588  TYR B CB  1 
ATOM   9796  C  CG  . TYR B  1  560 ? 27.793  63.957  13.286  1.00 28.63  ? 588  TYR B CG  1 
ATOM   9797  C  CD1 . TYR B  1  560 ? 26.946  65.003  13.631  1.00 28.31  ? 588  TYR B CD1 1 
ATOM   9798  C  CD2 . TYR B  1  560 ? 28.910  63.716  14.097  1.00 28.87  ? 588  TYR B CD2 1 
ATOM   9799  C  CE1 . TYR B  1  560 ? 27.205  65.804  14.741  1.00 29.00  ? 588  TYR B CE1 1 
ATOM   9800  C  CE2 . TYR B  1  560 ? 29.189  64.515  15.211  1.00 27.97  ? 588  TYR B CE2 1 
ATOM   9801  C  CZ  . TYR B  1  560 ? 28.323  65.552  15.532  1.00 29.47  ? 588  TYR B CZ  1 
ATOM   9802  O  OH  . TYR B  1  560 ? 28.572  66.349  16.634  1.00 29.59  ? 588  TYR B OH  1 
ATOM   9803  N  N   . LEU B  1  561 ? 26.833  64.804  9.485   1.00 29.21  ? 589  LEU B N   1 
ATOM   9804  C  CA  . LEU B  1  561 ? 26.247  66.057  9.060   1.00 29.94  ? 589  LEU B CA  1 
ATOM   9805  C  C   . LEU B  1  561 ? 25.133  66.425  10.021  1.00 30.49  ? 589  LEU B C   1 
ATOM   9806  O  O   . LEU B  1  561 ? 24.262  65.602  10.358  1.00 30.78  ? 589  LEU B O   1 
ATOM   9807  C  CB  . LEU B  1  561 ? 25.697  66.018  7.635   1.00 29.75  ? 589  LEU B CB  1 
ATOM   9808  C  CG  . LEU B  1  561 ? 26.316  65.309  6.431   1.00 30.25  ? 589  LEU B CG  1 
ATOM   9809  C  CD1 . LEU B  1  561 ? 25.826  65.996  5.169   1.00 29.02  ? 589  LEU B CD1 1 
ATOM   9810  C  CD2 . LEU B  1  561 ? 27.820  65.202  6.451   1.00 29.16  ? 589  LEU B CD2 1 
ATOM   9811  N  N   . ALA B  1  562 ? 25.165  67.676  10.453  1.00 30.82  ? 590  ALA B N   1 
ATOM   9812  C  CA  . ALA B  1  562 ? 24.268  68.113  11.491  1.00 31.26  ? 590  ALA B CA  1 
ATOM   9813  C  C   . ALA B  1  562 ? 23.474  69.327  11.086  1.00 31.46  ? 590  ALA B C   1 
ATOM   9814  O  O   . ALA B  1  562 ? 23.921  70.162  10.301  1.00 31.52  ? 590  ALA B O   1 
ATOM   9815  C  CB  . ALA B  1  562 ? 25.034  68.399  12.760  1.00 31.23  ? 590  ALA B CB  1 
ATOM   9816  N  N   . SER B  1  563 ? 22.282  69.404  11.644  1.00 31.52  ? 591  SER B N   1 
ATOM   9817  C  CA  . SER B  1  563 ? 21.558  70.631  11.648  1.00 31.95  ? 591  SER B CA  1 
ATOM   9818  C  C   . SER B  1  563 ? 22.181  71.596  12.632  1.00 32.65  ? 591  SER B C   1 
ATOM   9819  O  O   . SER B  1  563 ? 23.023  71.265  13.489  1.00 32.73  ? 591  SER B O   1 
ATOM   9820  C  CB  . SER B  1  563 ? 20.086  70.422  12.013  1.00 31.92  ? 591  SER B CB  1 
ATOM   9821  O  OG  . SER B  1  563 ? 19.421  71.666  12.142  1.00 31.29  ? 591  SER B OG  1 
ATOM   9822  N  N   . ASN B  1  564 ? 21.730  72.816  12.452  1.00 33.19  ? 592  ASN B N   1 
ATOM   9823  C  CA  . ASN B  1  564 ? 22.003  73.942  13.279  1.00 33.66  ? 592  ASN B CA  1 
ATOM   9824  C  C   . ASN B  1  564 ? 21.261  73.788  14.616  1.00 33.19  ? 592  ASN B C   1 
ATOM   9825  O  O   . ASN B  1  564 ? 21.760  74.163  15.679  1.00 32.81  ? 592  ASN B O   1 
ATOM   9826  C  CB  . ASN B  1  564 ? 21.423  75.098  12.484  1.00 34.09  ? 592  ASN B CB  1 
ATOM   9827  C  CG  . ASN B  1  564 ? 21.741  76.384  13.058  1.00 36.00  ? 592  ASN B CG  1 
ATOM   9828  O  OD1 . ASN B  1  564 ? 22.842  76.592  13.555  1.00 38.62  ? 592  ASN B OD1 1 
ATOM   9829  N  ND2 . ASN B  1  564 ? 20.763  77.276  13.038  1.00 39.69  ? 592  ASN B ND2 1 
ATOM   9830  N  N   . HIS B  1  565 ? 20.054  73.234  14.536  1.00 33.02  ? 593  HIS B N   1 
ATOM   9831  C  CA  . HIS B  1  565 ? 19.163  73.075  15.676  1.00 32.98  ? 593  HIS B CA  1 
ATOM   9832  C  C   . HIS B  1  565 ? 19.537  71.882  16.538  1.00 32.49  ? 593  HIS B C   1 
ATOM   9833  O  O   . HIS B  1  565 ? 20.107  70.905  16.049  1.00 32.11  ? 593  HIS B O   1 
ATOM   9834  C  CB  . HIS B  1  565 ? 17.727  72.943  15.179  1.00 33.32  ? 593  HIS B CB  1 
ATOM   9835  C  CG  . HIS B  1  565 ? 17.236  74.159  14.455  1.00 36.45  ? 593  HIS B CG  1 
ATOM   9836  N  ND1 . HIS B  1  565 ? 17.535  74.411  13.132  1.00 39.12  ? 593  HIS B ND1 1 
ATOM   9837  C  CD2 . HIS B  1  565 ? 16.483  75.204  14.875  1.00 37.99  ? 593  HIS B CD2 1 
ATOM   9838  C  CE1 . HIS B  1  565 ? 16.980  75.551  12.763  1.00 38.13  ? 593  HIS B CE1 1 
ATOM   9839  N  NE2 . HIS B  1  565 ? 16.333  76.050  13.802  1.00 39.27  ? 593  HIS B NE2 1 
ATOM   9840  N  N   . SER B  1  566 ? 19.206  71.970  17.821  1.00 32.03  ? 594  SER B N   1 
ATOM   9841  C  CA  . SER B  1  566 ? 19.545  70.934  18.787  1.00 31.86  ? 594  SER B CA  1 
ATOM   9842  C  C   . SER B  1  566 ? 18.372  70.024  19.134  1.00 31.40  ? 594  SER B C   1 
ATOM   9843  O  O   . SER B  1  566 ? 17.206  70.359  18.880  1.00 30.81  ? 594  SER B O   1 
ATOM   9844  C  CB  . SER B  1  566 ? 20.094  71.570  20.069  1.00 31.97  ? 594  SER B CB  1 
ATOM   9845  O  OG  . SER B  1  566 ? 21.470  71.886  19.909  1.00 33.80  ? 594  SER B OG  1 
ATOM   9846  N  N   . ASN B  1  567 ? 18.699  68.869  19.713  1.00 31.02  ? 595  ASN B N   1 
ATOM   9847  C  CA  . ASN B  1  567 ? 17.702  68.029  20.349  1.00 30.67  ? 595  ASN B CA  1 
ATOM   9848  C  C   . ASN B  1  567 ? 17.405  68.531  21.760  1.00 30.88  ? 595  ASN B C   1 
ATOM   9849  O  O   . ASN B  1  567 ? 18.029  69.485  22.229  1.00 30.80  ? 595  ASN B O   1 
ATOM   9850  C  CB  . ASN B  1  567 ? 18.129  66.556  20.340  1.00 30.35  ? 595  ASN B CB  1 
ATOM   9851  C  CG  . ASN B  1  567 ? 19.356  66.261  21.222  1.00 30.31  ? 595  ASN B CG  1 
ATOM   9852  O  OD1 . ASN B  1  567 ? 19.989  67.156  21.801  1.00 28.46  ? 595  ASN B OD1 1 
ATOM   9853  N  ND2 . ASN B  1  567 ? 19.697  64.978  21.309  1.00 29.01  ? 595  ASN B ND2 1 
ATOM   9854  N  N   . LYS B  1  568 ? 16.447  67.893  22.427  1.00 31.39  ? 596  LYS B N   1 
ATOM   9855  C  CA  . LYS B  1  568 ? 16.069  68.233  23.804  1.00 31.80  ? 596  LYS B CA  1 
ATOM   9856  C  C   . LYS B  1  568 ? 17.289  68.450  24.713  1.00 31.31  ? 596  LYS B C   1 
ATOM   9857  O  O   . LYS B  1  568 ? 17.238  69.249  25.638  1.00 31.07  ? 596  LYS B O   1 
ATOM   9858  C  CB  . LYS B  1  568 ? 15.187  67.117  24.371  1.00 31.65  ? 596  LYS B CB  1 
ATOM   9859  C  CG  . LYS B  1  568 ? 14.431  67.437  25.654  1.00 32.80  ? 596  LYS B CG  1 
ATOM   9860  C  CD  . LYS B  1  568 ? 13.513  66.265  26.048  1.00 33.35  ? 596  LYS B CD  1 
ATOM   9861  C  CE  . LYS B  1  568 ? 12.336  66.697  26.951  1.00 36.25  ? 596  LYS B CE  1 
ATOM   9862  N  NZ  . LYS B  1  568 ? 11.248  67.347  26.133  1.00 38.06  ? 596  LYS B NZ  1 
ATOM   9863  N  N   . TRP B  1  569 ? 18.380  67.739  24.438  1.00 31.09  ? 597  TRP B N   1 
ATOM   9864  C  CA  . TRP B  1  569 ? 19.557  67.730  25.323  1.00 30.84  ? 597  TRP B CA  1 
ATOM   9865  C  C   . TRP B  1  569 ? 20.679  68.701  24.915  1.00 30.60  ? 597  TRP B C   1 
ATOM   9866  O  O   . TRP B  1  569 ? 21.771  68.676  25.480  1.00 30.41  ? 597  TRP B O   1 
ATOM   9867  C  CB  . TRP B  1  569 ? 20.073  66.285  25.487  1.00 31.14  ? 597  TRP B CB  1 
ATOM   9868  C  CG  . TRP B  1  569 ? 18.940  65.306  25.763  1.00 31.17  ? 597  TRP B CG  1 
ATOM   9869  C  CD1 . TRP B  1  569 ? 18.550  64.261  24.975  1.00 31.64  ? 597  TRP B CD1 1 
ATOM   9870  C  CD2 . TRP B  1  569 ? 18.032  65.326  26.878  1.00 31.09  ? 597  TRP B CD2 1 
ATOM   9871  N  NE1 . TRP B  1  569 ? 17.471  63.617  25.536  1.00 31.91  ? 597  TRP B NE1 1 
ATOM   9872  C  CE2 . TRP B  1  569 ? 17.129  64.252  26.701  1.00 31.61  ? 597  TRP B CE2 1 
ATOM   9873  C  CE3 . TRP B  1  569 ? 17.895  66.146  28.006  1.00 30.17  ? 597  TRP B CE3 1 
ATOM   9874  C  CZ2 . TRP B  1  569 ? 16.101  63.973  27.612  1.00 31.92  ? 597  TRP B CZ2 1 
ATOM   9875  C  CZ3 . TRP B  1  569 ? 16.879  65.872  28.910  1.00 31.62  ? 597  TRP B CZ3 1 
ATOM   9876  C  CH2 . TRP B  1  569 ? 15.988  64.792  28.707  1.00 31.55  ? 597  TRP B CH2 1 
ATOM   9877  N  N   . GLY B  1  570 ? 20.396  69.562  23.942  1.00 30.51  ? 598  GLY B N   1 
ATOM   9878  C  CA  . GLY B  1  570 ? 21.282  70.680  23.600  1.00 30.36  ? 598  GLY B CA  1 
ATOM   9879  C  C   . GLY B  1  570 ? 22.414  70.373  22.642  1.00 30.37  ? 598  GLY B C   1 
ATOM   9880  O  O   . GLY B  1  570 ? 23.385  71.103  22.589  1.00 30.65  ? 598  GLY B O   1 
ATOM   9881  N  N   . HIS B  1  571 ? 22.286  69.285  21.889  1.00 30.07  ? 599  HIS B N   1 
ATOM   9882  C  CA  . HIS B  1  571 ? 23.287  68.876  20.930  1.00 29.32  ? 599  HIS B CA  1 
ATOM   9883  C  C   . HIS B  1  571 ? 22.726  68.989  19.509  1.00 29.36  ? 599  HIS B C   1 
ATOM   9884  O  O   . HIS B  1  571 ? 21.553  68.678  19.273  1.00 29.24  ? 599  HIS B O   1 
ATOM   9885  C  CB  . HIS B  1  571 ? 23.710  67.437  21.213  1.00 29.06  ? 599  HIS B CB  1 
ATOM   9886  C  CG  . HIS B  1  571 ? 24.412  67.257  22.525  1.00 29.68  ? 599  HIS B CG  1 
ATOM   9887  N  ND1 . HIS B  1  571 ? 25.752  67.543  22.700  1.00 29.91  ? 599  HIS B ND1 1 
ATOM   9888  C  CD2 . HIS B  1  571 ? 23.967  66.799  23.721  1.00 29.78  ? 599  HIS B CD2 1 
ATOM   9889  C  CE1 . HIS B  1  571 ? 26.096  67.285  23.949  1.00 29.93  ? 599  HIS B CE1 1 
ATOM   9890  N  NE2 . HIS B  1  571 ? 25.031  66.833  24.591  1.00 30.03  ? 599  HIS B NE2 1 
ATOM   9891  N  N   . PRO B  1  572 ? 23.558  69.435  18.549  1.00 29.38  ? 600  PRO B N   1 
ATOM   9892  C  CA  . PRO B  1  572 ? 23.094  69.570  17.164  1.00 29.12  ? 600  PRO B CA  1 
ATOM   9893  C  C   . PRO B  1  572 ? 22.535  68.250  16.679  1.00 28.85  ? 600  PRO B C   1 
ATOM   9894  O  O   . PRO B  1  572 ? 23.135  67.221  16.930  1.00 28.82  ? 600  PRO B O   1 
ATOM   9895  C  CB  . PRO B  1  572 ? 24.378  69.902  16.400  1.00 29.20  ? 600  PRO B CB  1 
ATOM   9896  C  CG  . PRO B  1  572 ? 25.255  70.563  17.429  1.00 29.37  ? 600  PRO B CG  1 
ATOM   9897  C  CD  . PRO B  1  572 ? 24.972  69.836  18.701  1.00 29.08  ? 600  PRO B CD  1 
ATOM   9898  N  N   . ARG B  1  573 ? 21.386  68.270  16.012  1.00 29.20  ? 601  ARG B N   1 
ATOM   9899  C  CA  . ARG B  1  573 ? 20.795  67.025  15.540  1.00 29.27  ? 601  ARG B CA  1 
ATOM   9900  C  C   . ARG B  1  573 ? 21.497  66.508  14.297  1.00 29.38  ? 601  ARG B C   1 
ATOM   9901  O  O   . ARG B  1  573 ? 21.643  67.221  13.300  1.00 29.61  ? 601  ARG B O   1 
ATOM   9902  C  CB  . ARG B  1  573 ? 19.260  67.066  15.398  1.00 29.38  ? 601  ARG B CB  1 
ATOM   9903  C  CG  . ARG B  1  573 ? 18.584  68.402  15.586  1.00 30.07  ? 601  ARG B CG  1 
ATOM   9904  C  CD  . ARG B  1  573 ? 17.054  68.296  15.833  1.00 28.34  ? 601  ARG B CD  1 
ATOM   9905  N  NE  . ARG B  1  573 ? 16.447  67.004  15.489  1.00 25.86  ? 601  ARG B NE  1 
ATOM   9906  C  CZ  . ARG B  1  573 ? 15.414  66.820  14.659  1.00 26.08  ? 601  ARG B CZ  1 
ATOM   9907  N  NH1 . ARG B  1  573 ? 14.847  67.844  14.036  1.00 24.26  ? 601  ARG B NH1 1 
ATOM   9908  N  NH2 . ARG B  1  573 ? 14.939  65.590  14.451  1.00 25.24  ? 601  ARG B NH2 1 
ATOM   9909  N  N   . GLY B  1  574 ? 21.958  65.266  14.377  1.00 29.17  ? 602  GLY B N   1 
ATOM   9910  C  CA  . GLY B  1  574 ? 22.880  64.757  13.376  1.00 29.27  ? 602  GLY B CA  1 
ATOM   9911  C  C   . GLY B  1  574 ? 22.551  63.400  12.804  1.00 29.19  ? 602  GLY B C   1 
ATOM   9912  O  O   . GLY B  1  574 ? 21.804  62.608  13.394  1.00 28.74  ? 602  GLY B O   1 
ATOM   9913  N  N   . TYR B  1  575 ? 23.099  63.160  11.618  1.00 29.56  ? 603  TYR B N   1 
ATOM   9914  C  CA  . TYR B  1  575 ? 23.146  61.827  11.035  1.00 29.84  ? 603  TYR B CA  1 
ATOM   9915  C  C   . TYR B  1  575 ? 24.580  61.482  10.673  1.00 30.12  ? 603  TYR B C   1 
ATOM   9916  O  O   . TYR B  1  575 ? 25.244  62.200  9.920   1.00 29.58  ? 603  TYR B O   1 
ATOM   9917  C  CB  . TYR B  1  575 ? 22.203  61.716  9.839   1.00 29.94  ? 603  TYR B CB  1 
ATOM   9918  C  CG  . TYR B  1  575 ? 20.941  60.984  10.189  1.00 29.52  ? 603  TYR B CG  1 
ATOM   9919  C  CD1 . TYR B  1  575 ? 19.887  61.636  10.832  1.00 29.36  ? 603  TYR B CD1 1 
ATOM   9920  C  CD2 . TYR B  1  575 ? 20.808  59.630  9.906   1.00 28.89  ? 603  TYR B CD2 1 
ATOM   9921  C  CE1 . TYR B  1  575 ? 18.721  60.950  11.176  1.00 29.74  ? 603  TYR B CE1 1 
ATOM   9922  C  CE2 . TYR B  1  575 ? 19.651  58.938  10.248  1.00 29.90  ? 603  TYR B CE2 1 
ATOM   9923  C  CZ  . TYR B  1  575 ? 18.618  59.601  10.879  1.00 29.30  ? 603  TYR B CZ  1 
ATOM   9924  O  OH  . TYR B  1  575 ? 17.499  58.905  11.221  1.00 29.78  ? 603  TYR B OH  1 
ATOM   9925  N  N   . ARG B  1  576 ? 25.054  60.401  11.275  1.00 30.89  ? 604  ARG B N   1 
ATOM   9926  C  CA  . ARG B  1  576 ? 26.411  59.899  11.096  1.00 31.82  ? 604  ARG B CA  1 
ATOM   9927  C  C   . ARG B  1  576 ? 26.531  59.097  9.809   1.00 32.47  ? 604  ARG B C   1 
ATOM   9928  O  O   . ARG B  1  576 ? 25.637  58.305  9.471   1.00 32.54  ? 604  ARG B O   1 
ATOM   9929  C  CB  . ARG B  1  576 ? 26.743  59.005  12.275  1.00 31.81  ? 604  ARG B CB  1 
ATOM   9930  C  CG  . ARG B  1  576 ? 28.174  58.520  12.366  1.00 32.92  ? 604  ARG B CG  1 
ATOM   9931  C  CD  . ARG B  1  576 ? 28.268  57.699  13.606  1.00 33.46  ? 604  ARG B CD  1 
ATOM   9932  N  NE  . ARG B  1  576 ? 29.476  56.892  13.686  1.00 35.10  ? 604  ARG B NE  1 
ATOM   9933  C  CZ  . ARG B  1  576 ? 29.583  55.816  14.463  1.00 34.33  ? 604  ARG B CZ  1 
ATOM   9934  N  NH1 . ARG B  1  576 ? 28.559  55.420  15.205  1.00 32.73  ? 604  ARG B NH1 1 
ATOM   9935  N  NH2 . ARG B  1  576 ? 30.712  55.136  14.498  1.00 35.27  ? 604  ARG B NH2 1 
ATOM   9936  N  N   . ILE B  1  577 ? 27.620  59.310  9.080   1.00 33.28  ? 605  ILE B N   1 
ATOM   9937  C  CA  . ILE B  1  577 ? 27.946  58.450  7.945   1.00 34.36  ? 605  ILE B CA  1 
ATOM   9938  C  C   . ILE B  1  577 ? 29.021  57.498  8.404   1.00 35.71  ? 605  ILE B C   1 
ATOM   9939  O  O   . ILE B  1  577 ? 30.110  57.924  8.767   1.00 35.69  ? 605  ILE B O   1 
ATOM   9940  C  CB  . ILE B  1  577 ? 28.443  59.239  6.719   1.00 33.91  ? 605  ILE B CB  1 
ATOM   9941  C  CG1 . ILE B  1  577 ? 27.386  60.260  6.299   1.00 34.41  ? 605  ILE B CG1 1 
ATOM   9942  C  CG2 . ILE B  1  577 ? 28.768  58.283  5.575   1.00 32.19  ? 605  ILE B CG2 1 
ATOM   9943  C  CD1 . ILE B  1  577 ? 27.837  61.256  5.266   1.00 34.97  ? 605  ILE B CD1 1 
ATOM   9944  N  N   . GLN B  1  578 ? 28.713  56.210  8.405   1.00 37.92  ? 606  GLN B N   1 
ATOM   9945  C  CA  . GLN B  1  578 ? 29.681  55.200  8.824   1.00 40.32  ? 606  GLN B CA  1 
ATOM   9946  C  C   . GLN B  1  578 ? 29.967  54.211  7.702   1.00 41.42  ? 606  GLN B C   1 
ATOM   9947  O  O   . GLN B  1  578 ? 29.064  53.558  7.188   1.00 41.51  ? 606  GLN B O   1 
ATOM   9948  C  CB  . GLN B  1  578 ? 29.151  54.474  10.045  1.00 40.70  ? 606  GLN B CB  1 
ATOM   9949  C  CG  . GLN B  1  578 ? 30.034  53.372  10.570  1.00 43.71  ? 606  GLN B CG  1 
ATOM   9950  C  CD  . GLN B  1  578 ? 29.239  52.363  11.358  1.00 47.73  ? 606  GLN B CD  1 
ATOM   9951  O  OE1 . GLN B  1  578 ? 28.675  52.677  12.414  1.00 50.25  ? 606  GLN B OE1 1 
ATOM   9952  N  NE2 . GLN B  1  578 ? 29.167  51.142  10.842  1.00 49.13  ? 606  GLN B NE2 1 
ATOM   9953  N  N   . MET B  1  579 ? 31.234  54.082  7.340   1.00 43.31  ? 607  MET B N   1 
ATOM   9954  C  CA  . MET B  1  579 ? 31.601  53.317  6.149   1.00 45.35  ? 607  MET B CA  1 
ATOM   9955  C  C   . MET B  1  579 ? 32.050  51.874  6.399   1.00 46.36  ? 607  MET B C   1 
ATOM   9956  O  O   . MET B  1  579 ? 32.738  51.570  7.383   1.00 46.37  ? 607  MET B O   1 
ATOM   9957  C  CB  . MET B  1  579 ? 32.638  54.088  5.328   1.00 45.21  ? 607  MET B CB  1 
ATOM   9958  C  CG  . MET B  1  579 ? 32.120  55.448  4.858   1.00 45.25  ? 607  MET B CG  1 
ATOM   9959  S  SD  . MET B  1  579 ? 33.340  56.414  3.965   1.00 46.52  ? 607  MET B SD  1 
ATOM   9960  C  CE  . MET B  1  579 ? 34.526  56.840  5.260   1.00 45.19  ? 607  MET B CE  1 
ATOM   9961  N  N   . LEU B  1  580 ? 31.611  50.993  5.499   1.00 47.99  ? 608  LEU B N   1 
ATOM   9962  C  CA  . LEU B  1  580 ? 32.026  49.584  5.456   1.00 49.55  ? 608  LEU B CA  1 
ATOM   9963  C  C   . LEU B  1  580 ? 32.622  49.336  4.073   1.00 49.95  ? 608  LEU B C   1 
ATOM   9964  O  O   . LEU B  1  580 ? 31.901  49.038  3.114   1.00 49.92  ? 608  LEU B O   1 
ATOM   9965  C  CB  . LEU B  1  580 ? 30.836  48.647  5.678   1.00 49.89  ? 608  LEU B CB  1 
ATOM   9966  C  CG  . LEU B  1  580 ? 29.867  49.033  6.798   1.00 51.54  ? 608  LEU B CG  1 
ATOM   9967  C  CD1 . LEU B  1  580 ? 28.442  49.001  6.276   1.00 52.42  ? 608  LEU B CD1 1 
ATOM   9968  C  CD2 . LEU B  1  580 ? 30.053  48.167  8.058   1.00 52.89  ? 608  LEU B CD2 1 
ATOM   9969  N  N   . SER B  1  581 ? 33.941  49.488  3.985   1.00 50.72  ? 609  SER B N   1 
ATOM   9970  C  CA  . SER B  1  581 ? 34.654  49.430  2.718   1.00 51.38  ? 609  SER B CA  1 
ATOM   9971  C  C   . SER B  1  581 ? 36.097  48.995  2.950   1.00 51.90  ? 609  SER B C   1 
ATOM   9972  O  O   . SER B  1  581 ? 36.724  49.419  3.921   1.00 52.24  ? 609  SER B O   1 
ATOM   9973  C  CB  . SER B  1  581 ? 34.604  50.799  2.024   1.00 51.03  ? 609  SER B CB  1 
ATOM   9974  O  OG  . SER B  1  581 ? 34.938  50.695  0.654   1.00 50.73  ? 609  SER B OG  1 
ATOM   9975  N  N   . PHE B  1  582 ? 36.597  48.133  2.063   1.00 52.52  ? 610  PHE B N   1 
ATOM   9976  C  CA  . PHE B  1  582 ? 37.997  47.683  2.071   1.00 53.00  ? 610  PHE B CA  1 
ATOM   9977  C  C   . PHE B  1  582 ? 38.655  48.144  0.773   1.00 52.50  ? 610  PHE B C   1 
ATOM   9978  O  O   . PHE B  1  582 ? 39.308  47.359  0.070   1.00 52.82  ? 610  PHE B O   1 
ATOM   9979  C  CB  . PHE B  1  582 ? 38.082  46.150  2.182   1.00 53.82  ? 610  PHE B CB  1 
ATOM   9980  C  CG  . PHE B  1  582 ? 37.123  45.554  3.173   1.00 55.56  ? 610  PHE B CG  1 
ATOM   9981  C  CD1 . PHE B  1  582 ? 35.872  45.088  2.753   1.00 57.44  ? 610  PHE B CD1 1 
ATOM   9982  C  CD2 . PHE B  1  582 ? 37.467  45.460  4.529   1.00 57.57  ? 610  PHE B CD2 1 
ATOM   9983  C  CE1 . PHE B  1  582 ? 34.962  44.533  3.672   1.00 58.60  ? 610  PHE B CE1 1 
ATOM   9984  C  CE2 . PHE B  1  582 ? 36.580  44.911  5.463   1.00 57.75  ? 610  PHE B CE2 1 
ATOM   9985  C  CZ  . PHE B  1  582 ? 35.320  44.446  5.033   1.00 58.09  ? 610  PHE B CZ  1 
ATOM   9986  N  N   . ALA B  1  583 ? 38.481  49.424  0.463   1.00 51.74  ? 611  ALA B N   1 
ATOM   9987  C  CA  . ALA B  1  583 ? 38.774  49.953  -0.863  1.00 51.10  ? 611  ALA B CA  1 
ATOM   9988  C  C   . ALA B  1  583 ? 40.078  49.455  -1.482  1.00 50.61  ? 611  ALA B C   1 
ATOM   9989  O  O   . ALA B  1  583 ? 41.128  49.410  -0.826  1.00 50.40  ? 611  ALA B O   1 
ATOM   9990  C  CB  . ALA B  1  583 ? 38.743  51.465  -0.837  1.00 51.59  ? 611  ALA B CB  1 
ATOM   9991  N  N   . GLY B  1  584 ? 39.999  49.082  -2.755  1.00 50.01  ? 612  GLY B N   1 
ATOM   9992  C  CA  . GLY B  1  584 ? 41.193  48.817  -3.543  1.00 49.07  ? 612  GLY B CA  1 
ATOM   9993  C  C   . GLY B  1  584 ? 41.982  50.100  -3.704  1.00 48.71  ? 612  GLY B C   1 
ATOM   9994  O  O   . GLY B  1  584 ? 41.423  51.200  -3.688  1.00 48.35  ? 612  GLY B O   1 
ATOM   9995  N  N   . GLU B  1  585 ? 43.295  49.962  -3.827  1.00 48.61  ? 613  GLU B N   1 
ATOM   9996  C  CA  . GLU B  1  585 ? 44.143  51.075  -4.218  1.00 48.81  ? 613  GLU B CA  1 
ATOM   9997  C  C   . GLU B  1  585 ? 43.579  51.655  -5.528  1.00 48.26  ? 613  GLU B C   1 
ATOM   9998  O  O   . GLU B  1  585 ? 43.257  50.907  -6.459  1.00 47.91  ? 613  GLU B O   1 
ATOM   9999  C  CB  . GLU B  1  585 ? 45.564  50.568  -4.412  1.00 48.74  ? 613  GLU B CB  1 
ATOM   10000 C  CG  . GLU B  1  585 ? 46.679  51.562  -4.180  1.00 49.52  ? 613  GLU B CG  1 
ATOM   10001 C  CD  . GLU B  1  585 ? 48.040  50.971  -4.583  1.00 50.24  ? 613  GLU B CD  1 
ATOM   10002 O  OE1 . GLU B  1  585 ? 48.505  49.992  -3.938  1.00 51.69  ? 613  GLU B OE1 1 
ATOM   10003 O  OE2 . GLU B  1  585 ? 48.640  51.480  -5.559  1.00 51.02  ? 613  GLU B OE2 1 
ATOM   10004 N  N   . PRO B  1  586 ? 43.404  52.986  -5.589  1.00 47.96  ? 614  PRO B N   1 
ATOM   10005 C  CA  . PRO B  1  586 ? 42.852  53.582  -6.804  1.00 47.67  ? 614  PRO B CA  1 
ATOM   10006 C  C   . PRO B  1  586 ? 43.883  53.664  -7.924  1.00 47.43  ? 614  PRO B C   1 
ATOM   10007 O  O   . PRO B  1  586 ? 45.091  53.713  -7.657  1.00 47.51  ? 614  PRO B O   1 
ATOM   10008 C  CB  . PRO B  1  586 ? 42.463  54.986  -6.350  1.00 47.51  ? 614  PRO B CB  1 
ATOM   10009 C  CG  . PRO B  1  586 ? 43.419  55.292  -5.255  1.00 47.83  ? 614  PRO B CG  1 
ATOM   10010 C  CD  . PRO B  1  586 ? 43.696  53.999  -4.557  1.00 47.84  ? 614  PRO B CD  1 
ATOM   10011 N  N   . LEU B  1  587 ? 43.413  53.680  -9.166  1.00 47.06  ? 615  LEU B N   1 
ATOM   10012 C  CA  . LEU B  1  587 ? 44.305  53.852  -10.303 1.00 47.07  ? 615  LEU B CA  1 
ATOM   10013 C  C   . LEU B  1  587 ? 45.183  55.087  -10.070 1.00 46.98  ? 615  LEU B C   1 
ATOM   10014 O  O   . LEU B  1  587 ? 44.662  56.159  -9.782  1.00 46.69  ? 615  LEU B O   1 
ATOM   10015 C  CB  . LEU B  1  587 ? 43.500  53.974  -11.601 1.00 47.01  ? 615  LEU B CB  1 
ATOM   10016 C  CG  . LEU B  1  587 ? 44.205  53.745  -12.939 1.00 46.43  ? 615  LEU B CG  1 
ATOM   10017 C  CD1 . LEU B  1  587 ? 44.475  52.270  -13.199 1.00 44.73  ? 615  LEU B CD1 1 
ATOM   10018 C  CD2 . LEU B  1  587 ? 43.346  54.316  -14.043 1.00 46.58  ? 615  LEU B CD2 1 
ATOM   10019 N  N   . PRO B  1  588 ? 46.523  54.931  -10.172 1.00 47.23  ? 616  PRO B N   1 
ATOM   10020 C  CA  . PRO B  1  588 ? 47.458  56.024  -9.875  1.00 47.25  ? 616  PRO B CA  1 
ATOM   10021 C  C   . PRO B  1  588 ? 47.126  57.268  -10.679 1.00 47.58  ? 616  PRO B C   1 
ATOM   10022 O  O   . PRO B  1  588 ? 46.691  57.161  -11.825 1.00 47.79  ? 616  PRO B O   1 
ATOM   10023 C  CB  . PRO B  1  588 ? 48.805  55.464  -10.328 1.00 47.01  ? 616  PRO B CB  1 
ATOM   10024 C  CG  . PRO B  1  588 ? 48.662  54.009  -10.221 1.00 47.16  ? 616  PRO B CG  1 
ATOM   10025 C  CD  . PRO B  1  588 ? 47.238  53.713  -10.598 1.00 47.16  ? 616  PRO B CD  1 
ATOM   10026 N  N   . GLN B  1  589 ? 47.334  58.436  -10.081 1.00 48.02  ? 617  GLN B N   1 
ATOM   10027 C  CA  . GLN B  1  589 ? 46.993  59.712  -10.718 1.00 48.28  ? 617  GLN B CA  1 
ATOM   10028 C  C   . GLN B  1  589 ? 47.688  60.011  -12.054 1.00 48.03  ? 617  GLN B C   1 
ATOM   10029 O  O   . GLN B  1  589 ? 47.111  60.696  -12.906 1.00 47.92  ? 617  GLN B O   1 
ATOM   10030 C  CB  . GLN B  1  589 ? 47.231  60.859  -9.754  1.00 48.61  ? 617  GLN B CB  1 
ATOM   10031 C  CG  . GLN B  1  589 ? 46.035  61.173  -8.904  1.00 49.93  ? 617  GLN B CG  1 
ATOM   10032 C  CD  . GLN B  1  589 ? 46.250  62.426  -8.108  1.00 52.36  ? 617  GLN B CD  1 
ATOM   10033 O  OE1 . GLN B  1  589 ? 47.050  62.448  -7.165  1.00 53.17  ? 617  GLN B OE1 1 
ATOM   10034 N  NE2 . GLN B  1  589 ? 45.555  63.495  -8.491  1.00 53.25  ? 617  GLN B NE2 1 
ATOM   10035 N  N   . ASN B  1  590 ? 48.908  59.504  -12.235 1.00 47.45  ? 618  ASN B N   1 
ATOM   10036 C  CA  . ASN B  1  590 ? 49.647  59.724  -13.483 1.00 47.14  ? 618  ASN B CA  1 
ATOM   10037 C  C   . ASN B  1  590 ? 48.991  59.172  -14.762 1.00 46.12  ? 618  ASN B C   1 
ATOM   10038 O  O   . ASN B  1  590 ? 49.274  59.665  -15.858 1.00 46.11  ? 618  ASN B O   1 
ATOM   10039 C  CB  . ASN B  1  590 ? 51.102  59.244  -13.363 1.00 47.52  ? 618  ASN B CB  1 
ATOM   10040 C  CG  . ASN B  1  590 ? 51.976  60.234  -12.624 1.00 49.81  ? 618  ASN B CG  1 
ATOM   10041 O  OD1 . ASN B  1  590 ? 53.090  59.903  -12.192 1.00 52.09  ? 618  ASN B OD1 1 
ATOM   10042 N  ND2 . ASN B  1  590 ? 51.475  61.467  -12.465 1.00 51.74  ? 618  ASN B ND2 1 
ATOM   10043 N  N   . SER B  1  591 ? 48.147  58.146  -14.617 1.00 44.59  ? 619  SER B N   1 
ATOM   10044 C  CA  . SER B  1  591 ? 47.349  57.614  -15.719 1.00 43.02  ? 619  SER B CA  1 
ATOM   10045 C  C   . SER B  1  591 ? 46.553  58.736  -16.350 1.00 42.15  ? 619  SER B C   1 
ATOM   10046 O  O   . SER B  1  591 ? 45.906  59.512  -15.645 1.00 42.01  ? 619  SER B O   1 
ATOM   10047 C  CB  . SER B  1  591 ? 46.375  56.559  -15.203 1.00 43.25  ? 619  SER B CB  1 
ATOM   10048 O  OG  . SER B  1  591 ? 45.452  56.166  -16.211 1.00 43.41  ? 619  SER B OG  1 
ATOM   10049 N  N   . SER B  1  592 ? 46.596  58.834  -17.673 1.00 40.97  ? 620  SER B N   1 
ATOM   10050 C  CA  . SER B  1  592 ? 45.859  59.890  -18.362 1.00 40.05  ? 620  SER B CA  1 
ATOM   10051 C  C   . SER B  1  592 ? 44.331  59.669  -18.309 1.00 39.57  ? 620  SER B C   1 
ATOM   10052 O  O   . SER B  1  592 ? 43.558  60.588  -18.604 1.00 39.65  ? 620  SER B O   1 
ATOM   10053 C  CB  . SER B  1  592 ? 46.361  60.079  -19.805 1.00 39.78  ? 620  SER B CB  1 
ATOM   10054 O  OG  . SER B  1  592 ? 46.169  58.904  -20.578 1.00 39.05  ? 620  SER B OG  1 
ATOM   10055 N  N   . MET B  1  593 ? 43.898  58.471  -17.914 1.00 38.53  ? 621  MET B N   1 
ATOM   10056 C  CA  . MET B  1  593 ? 42.468  58.184  -17.833 1.00 38.09  ? 621  MET B CA  1 
ATOM   10057 C  C   . MET B  1  593 ? 41.873  58.276  -16.429 1.00 37.47  ? 621  MET B C   1 
ATOM   10058 O  O   . MET B  1  593 ? 40.662  58.121  -16.266 1.00 37.78  ? 621  MET B O   1 
ATOM   10059 C  CB  . MET B  1  593 ? 42.136  56.822  -18.450 1.00 38.00  ? 621  MET B CB  1 
ATOM   10060 C  CG  . MET B  1  593 ? 42.451  55.623  -17.571 1.00 37.58  ? 621  MET B CG  1 
ATOM   10061 S  SD  . MET B  1  593 ? 41.719  54.126  -18.254 1.00 39.08  ? 621  MET B SD  1 
ATOM   10062 C  CE  . MET B  1  593 ? 42.865  53.755  -19.583 1.00 38.85  ? 621  MET B CE  1 
ATOM   10063 N  N   . ALA B  1  594 ? 42.704  58.541  -15.427 1.00 36.84  ? 622  ALA B N   1 
ATOM   10064 C  CA  . ALA B  1  594 ? 42.243  58.553  -14.024 1.00 36.97  ? 622  ALA B CA  1 
ATOM   10065 C  C   . ALA B  1  594 ? 41.084  59.525  -13.751 1.00 36.87  ? 622  ALA B C   1 
ATOM   10066 O  O   . ALA B  1  594 ? 40.154  59.204  -13.019 1.00 36.96  ? 622  ALA B O   1 
ATOM   10067 C  CB  . ALA B  1  594 ? 43.406  58.824  -13.077 1.00 36.42  ? 622  ALA B CB  1 
ATOM   10068 N  N   . ARG B  1  595 ? 41.148  60.694  -14.380 1.00 36.98  ? 623  ARG B N   1 
ATOM   10069 C  CA  . ARG B  1  595 ? 40.175  61.762  -14.208 1.00 37.29  ? 623  ARG B CA  1 
ATOM   10070 C  C   . ARG B  1  595 ? 38.778  61.358  -14.686 1.00 36.42  ? 623  ARG B C   1 
ATOM   10071 O  O   . ARG B  1  595 ? 37.799  62.033  -14.380 1.00 36.34  ? 623  ARG B O   1 
ATOM   10072 C  CB  . ARG B  1  595 ? 40.640  63.024  -14.949 1.00 37.76  ? 623  ARG B CB  1 
ATOM   10073 C  CG  . ARG B  1  595 ? 42.121  63.399  -14.716 1.00 41.99  ? 623  ARG B CG  1 
ATOM   10074 C  CD  . ARG B  1  595 ? 42.356  64.140  -13.383 1.00 47.83  ? 623  ARG B CD  1 
ATOM   10075 N  NE  . ARG B  1  595 ? 42.378  65.601  -13.550 1.00 51.96  ? 623  ARG B NE  1 
ATOM   10076 C  CZ  . ARG B  1  595 ? 42.000  66.486  -12.619 1.00 54.07  ? 623  ARG B CZ  1 
ATOM   10077 N  NH1 . ARG B  1  595 ? 41.545  66.076  -11.433 1.00 53.91  ? 623  ARG B NH1 1 
ATOM   10078 N  NH2 . ARG B  1  595 ? 42.061  67.792  -12.886 1.00 54.96  ? 623  ARG B NH2 1 
ATOM   10079 N  N   . GLY B  1  596 ? 38.694  60.262  -15.435 1.00 35.47  ? 624  GLY B N   1 
ATOM   10080 C  CA  . GLY B  1  596 ? 37.412  59.748  -15.892 1.00 34.64  ? 624  GLY B CA  1 
ATOM   10081 C  C   . GLY B  1  596 ? 36.627  59.032  -14.813 1.00 34.07  ? 624  GLY B C   1 
ATOM   10082 O  O   . GLY B  1  596 ? 35.502  58.652  -15.023 1.00 33.88  ? 624  GLY B O   1 
ATOM   10083 N  N   . PHE B  1  597 ? 37.234  58.847  -13.649 1.00 34.19  ? 625  PHE B N   1 
ATOM   10084 C  CA  . PHE B  1  597 ? 36.549  58.288  -12.493 1.00 34.30  ? 625  PHE B CA  1 
ATOM   10085 C  C   . PHE B  1  597 ? 37.326  58.664  -11.230 1.00 34.98  ? 625  PHE B C   1 
ATOM   10086 O  O   . PHE B  1  597 ? 37.690  57.803  -10.406 1.00 35.24  ? 625  PHE B O   1 
ATOM   10087 C  CB  . PHE B  1  597 ? 36.355  56.757  -12.625 1.00 33.47  ? 625  PHE B CB  1 
ATOM   10088 C  CG  . PHE B  1  597 ? 37.476  56.050  -13.348 1.00 32.45  ? 625  PHE B CG  1 
ATOM   10089 C  CD1 . PHE B  1  597 ? 38.607  55.606  -12.656 1.00 31.32  ? 625  PHE B CD1 1 
ATOM   10090 C  CD2 . PHE B  1  597 ? 37.408  55.828  -14.729 1.00 31.22  ? 625  PHE B CD2 1 
ATOM   10091 C  CE1 . PHE B  1  597 ? 39.649  54.945  -13.331 1.00 30.54  ? 625  PHE B CE1 1 
ATOM   10092 C  CE2 . PHE B  1  597 ? 38.454  55.177  -15.413 1.00 29.37  ? 625  PHE B CE2 1 
ATOM   10093 C  CZ  . PHE B  1  597 ? 39.568  54.730  -14.714 1.00 30.17  ? 625  PHE B CZ  1 
ATOM   10094 N  N   . SER B  1  598 ? 37.588  59.959  -11.083 1.00 35.46  ? 626  SER B N   1 
ATOM   10095 C  CA  . SER B  1  598 ? 38.440  60.436  -9.990  1.00 36.25  ? 626  SER B CA  1 
ATOM   10096 C  C   . SER B  1  598 ? 37.768  60.333  -8.607  1.00 36.21  ? 626  SER B C   1 
ATOM   10097 O  O   . SER B  1  598 ? 38.440  60.499  -7.563  1.00 35.71  ? 626  SER B O   1 
ATOM   10098 C  CB  . SER B  1  598 ? 38.919  61.856  -10.264 1.00 36.18  ? 626  SER B CB  1 
ATOM   10099 O  OG  . SER B  1  598 ? 37.800  62.711  -10.376 1.00 39.19  ? 626  SER B OG  1 
ATOM   10100 N  N   . TRP B  1  599 ? 36.463  60.028  -8.607  1.00 36.18  ? 627  TRP B N   1 
ATOM   10101 C  CA  . TRP B  1  599 ? 35.732  59.735  -7.368  1.00 36.24  ? 627  TRP B CA  1 
ATOM   10102 C  C   . TRP B  1  599 ? 36.307  58.535  -6.638  1.00 36.37  ? 627  TRP B C   1 
ATOM   10103 O  O   . TRP B  1  599 ? 36.070  58.346  -5.446  1.00 36.32  ? 627  TRP B O   1 
ATOM   10104 C  CB  . TRP B  1  599 ? 34.239  59.508  -7.623  1.00 36.27  ? 627  TRP B CB  1 
ATOM   10105 C  CG  . TRP B  1  599 ? 33.915  58.442  -8.621  1.00 36.20  ? 627  TRP B CG  1 
ATOM   10106 C  CD1 . TRP B  1  599 ? 33.599  58.623  -9.948  1.00 35.33  ? 627  TRP B CD1 1 
ATOM   10107 C  CD2 . TRP B  1  599 ? 33.854  57.029  -8.384  1.00 36.23  ? 627  TRP B CD2 1 
ATOM   10108 N  NE1 . TRP B  1  599 ? 33.351  57.409  -10.547 1.00 34.90  ? 627  TRP B NE1 1 
ATOM   10109 C  CE2 . TRP B  1  599 ? 33.501  56.413  -9.616  1.00 35.70  ? 627  TRP B CE2 1 
ATOM   10110 C  CE3 . TRP B  1  599 ? 34.063  56.221  -7.257  1.00 35.75  ? 627  TRP B CE3 1 
ATOM   10111 C  CZ2 . TRP B  1  599 ? 33.354  55.028  -9.748  1.00 36.25  ? 627  TRP B CZ2 1 
ATOM   10112 C  CZ3 . TRP B  1  599 ? 33.909  54.835  -7.389  1.00 36.11  ? 627  TRP B CZ3 1 
ATOM   10113 C  CH2 . TRP B  1  599 ? 33.558  54.255  -8.628  1.00 36.36  ? 627  TRP B CH2 1 
ATOM   10114 N  N   . GLU B  1  600 ? 37.076  57.735  -7.364  1.00 36.90  ? 628  GLU B N   1 
ATOM   10115 C  CA  . GLU B  1  600 ? 37.653  56.507  -6.836  1.00 37.18  ? 628  GLU B CA  1 
ATOM   10116 C  C   . GLU B  1  600 ? 38.747  56.771  -5.827  1.00 36.97  ? 628  GLU B C   1 
ATOM   10117 O  O   . GLU B  1  600 ? 39.035  55.921  -4.995  1.00 37.03  ? 628  GLU B O   1 
ATOM   10118 C  CB  . GLU B  1  600 ? 38.210  55.663  -7.972  1.00 37.23  ? 628  GLU B CB  1 
ATOM   10119 C  CG  . GLU B  1  600 ? 38.466  54.244  -7.579  1.00 39.01  ? 628  GLU B CG  1 
ATOM   10120 C  CD  . GLU B  1  600 ? 39.541  53.583  -8.421  1.00 42.00  ? 628  GLU B CD  1 
ATOM   10121 O  OE1 . GLU B  1  600 ? 40.259  54.289  -9.183  1.00 42.18  ? 628  GLU B OE1 1 
ATOM   10122 O  OE2 . GLU B  1  600 ? 39.657  52.341  -8.310  1.00 43.21  ? 628  GLU B OE2 1 
ATOM   10123 N  N   . ARG B  1  601 ? 39.368  57.940  -5.914  1.00 37.17  ? 629  ARG B N   1 
ATOM   10124 C  CA  . ARG B  1  601 ? 40.446  58.299  -5.001  1.00 37.81  ? 629  ARG B CA  1 
ATOM   10125 C  C   . ARG B  1  601 ? 39.919  58.586  -3.594  1.00 37.52  ? 629  ARG B C   1 
ATOM   10126 O  O   . ARG B  1  601 ? 40.679  58.521  -2.630  1.00 38.00  ? 629  ARG B O   1 
ATOM   10127 C  CB  . ARG B  1  601 ? 41.198  59.532  -5.505  1.00 37.88  ? 629  ARG B CB  1 
ATOM   10128 C  CG  . ARG B  1  601 ? 41.817  59.405  -6.880  1.00 39.01  ? 629  ARG B CG  1 
ATOM   10129 C  CD  . ARG B  1  601 ? 42.371  60.742  -7.380  1.00 39.14  ? 629  ARG B CD  1 
ATOM   10130 N  NE  . ARG B  1  601 ? 43.307  61.363  -6.435  1.00 42.59  ? 629  ARG B NE  1 
ATOM   10131 C  CZ  . ARG B  1  601 ? 43.185  62.603  -5.946  1.00 43.54  ? 629  ARG B CZ  1 
ATOM   10132 N  NH1 . ARG B  1  601 ? 44.096  63.073  -5.097  1.00 42.32  ? 629  ARG B NH1 1 
ATOM   10133 N  NH2 . ARG B  1  601 ? 42.164  63.381  -6.313  1.00 43.40  ? 629  ARG B NH2 1 
ATOM   10134 N  N   . TYR B  1  602 ? 38.626  58.899  -3.483  1.00 37.03  ? 630  TYR B N   1 
ATOM   10135 C  CA  . TYR B  1  602 ? 38.018  59.327  -2.213  1.00 36.58  ? 630  TYR B CA  1 
ATOM   10136 C  C   . TYR B  1  602 ? 37.190  58.239  -1.517  1.00 36.22  ? 630  TYR B C   1 
ATOM   10137 O  O   . TYR B  1  602 ? 36.396  57.570  -2.166  1.00 36.85  ? 630  TYR B O   1 
ATOM   10138 C  CB  . TYR B  1  602 ? 37.129  60.551  -2.449  1.00 36.16  ? 630  TYR B CB  1 
ATOM   10139 C  CG  . TYR B  1  602 ? 37.871  61.733  -3.013  1.00 35.81  ? 630  TYR B CG  1 
ATOM   10140 C  CD1 . TYR B  1  602 ? 37.841  62.019  -4.379  1.00 35.11  ? 630  TYR B CD1 1 
ATOM   10141 C  CD2 . TYR B  1  602 ? 38.611  62.562  -2.183  1.00 35.08  ? 630  TYR B CD2 1 
ATOM   10142 C  CE1 . TYR B  1  602 ? 38.537  63.105  -4.897  1.00 34.44  ? 630  TYR B CE1 1 
ATOM   10143 C  CE2 . TYR B  1  602 ? 39.308  63.647  -2.688  1.00 35.43  ? 630  TYR B CE2 1 
ATOM   10144 C  CZ  . TYR B  1  602 ? 39.268  63.913  -4.038  1.00 35.41  ? 630  TYR B CZ  1 
ATOM   10145 O  OH  . TYR B  1  602 ? 39.962  65.002  -4.513  1.00 36.46  ? 630  TYR B OH  1 
ATOM   10146 N  N   . GLN B  1  603 ? 37.357  58.068  -0.205  1.00 35.28  ? 631  GLN B N   1 
ATOM   10147 C  CA  . GLN B  1  603 ? 36.424  57.244  0.560   1.00 34.34  ? 631  GLN B CA  1 
ATOM   10148 C  C   . GLN B  1  603 ? 35.129  58.026  0.704   1.00 33.94  ? 631  GLN B C   1 
ATOM   10149 O  O   . GLN B  1  603 ? 34.034  57.470  0.623   1.00 33.95  ? 631  GLN B O   1 
ATOM   10150 C  CB  . GLN B  1  603 ? 36.939  56.993  1.965   1.00 34.41  ? 631  GLN B CB  1 
ATOM   10151 C  CG  . GLN B  1  603 ? 38.171  56.144  2.100   1.00 34.65  ? 631  GLN B CG  1 
ATOM   10152 C  CD  . GLN B  1  603 ? 38.610  56.048  3.557   1.00 33.91  ? 631  GLN B CD  1 
ATOM   10153 O  OE1 . GLN B  1  603 ? 37.948  55.406  4.373   1.00 33.12  ? 631  GLN B OE1 1 
ATOM   10154 N  NE2 . GLN B  1  603 ? 39.717  56.711  3.888   1.00 33.33  ? 631  GLN B NE2 1 
ATOM   10155 N  N   . LEU B  1  604 ? 35.280  59.328  0.927   1.00 33.25  ? 632  LEU B N   1 
ATOM   10156 C  CA  . LEU B  1  604 ? 34.187  60.211  1.279   1.00 32.66  ? 632  LEU B CA  1 
ATOM   10157 C  C   . LEU B  1  604 ? 34.488  61.635  0.864   1.00 32.35  ? 632  LEU B C   1 
ATOM   10158 O  O   . LEU B  1  604 ? 35.620  62.094  0.983   1.00 32.42  ? 632  LEU B O   1 
ATOM   10159 C  CB  . LEU B  1  604 ? 33.989  60.179  2.793   1.00 32.80  ? 632  LEU B CB  1 
ATOM   10160 C  CG  . LEU B  1  604 ? 33.003  61.141  3.467   1.00 32.38  ? 632  LEU B CG  1 
ATOM   10161 C  CD1 . LEU B  1  604 ? 31.573  60.921  2.979   1.00 31.76  ? 632  LEU B CD1 1 
ATOM   10162 C  CD2 . LEU B  1  604 ? 33.099  60.927  4.958   1.00 32.84  ? 632  LEU B CD2 1 
ATOM   10163 N  N   . ALA B  1  605 ? 33.468  62.340  0.386   1.00 32.13  ? 633  ALA B N   1 
ATOM   10164 C  CA  . ALA B  1  605 ? 33.582  63.781  0.171   1.00 31.94  ? 633  ALA B CA  1 
ATOM   10165 C  C   . ALA B  1  605 ? 32.259  64.450  0.478   1.00 31.69  ? 633  ALA B C   1 
ATOM   10166 O  O   . ALA B  1  605 ? 31.198  63.932  0.144   1.00 31.93  ? 633  ALA B O   1 
ATOM   10167 C  CB  . ALA B  1  605 ? 34.028  64.093  -1.269  1.00 31.70  ? 633  ALA B CB  1 
ATOM   10168 N  N   . VAL B  1  606 ? 32.316  65.605  1.121   1.00 31.91  ? 634  VAL B N   1 
ATOM   10169 C  CA  . VAL B  1  606 ? 31.099  66.378  1.396   1.00 31.35  ? 634  VAL B CA  1 
ATOM   10170 C  C   . VAL B  1  606 ? 31.187  67.708  0.647   1.00 31.70  ? 634  VAL B C   1 
ATOM   10171 O  O   . VAL B  1  606 ? 32.077  68.523  0.893   1.00 31.55  ? 634  VAL B O   1 
ATOM   10172 C  CB  . VAL B  1  606 ? 30.857  66.580  2.911   1.00 30.90  ? 634  VAL B CB  1 
ATOM   10173 C  CG1 . VAL B  1  606 ? 29.468  67.107  3.152   1.00 30.12  ? 634  VAL B CG1 1 
ATOM   10174 C  CG2 . VAL B  1  606 ? 31.018  65.263  3.657   1.00 29.79  ? 634  VAL B CG2 1 
ATOM   10175 N  N   . THR B  1  607 ? 30.283  67.902  -0.303  1.00 31.79  ? 635  THR B N   1 
ATOM   10176 C  CA  . THR B  1  607 ? 30.276  69.127  -1.079  1.00 32.38  ? 635  THR B CA  1 
ATOM   10177 C  C   . THR B  1  607 ? 28.986  69.886  -0.856  1.00 32.98  ? 635  THR B C   1 
ATOM   10178 O  O   . THR B  1  607 ? 28.008  69.332  -0.325  1.00 33.00  ? 635  THR B O   1 
ATOM   10179 C  CB  . THR B  1  607 ? 30.444  68.860  -2.610  1.00 32.63  ? 635  THR B CB  1 
ATOM   10180 O  OG1 . THR B  1  607 ? 29.324  68.094  -3.114  1.00 32.31  ? 635  THR B OG1 1 
ATOM   10181 C  CG2 . THR B  1  607 ? 31.769  68.134  -2.892  1.00 31.63  ? 635  THR B CG2 1 
ATOM   10182 N  N   . GLN B  1  608 ? 29.002  71.159  -1.255  1.00 33.47  ? 636  GLN B N   1 
ATOM   10183 C  CA  . GLN B  1  608 ? 27.786  71.923  -1.472  1.00 34.03  ? 636  GLN B CA  1 
ATOM   10184 C  C   . GLN B  1  608 ? 27.021  71.266  -2.609  1.00 34.40  ? 636  GLN B C   1 
ATOM   10185 O  O   . GLN B  1  608 ? 27.572  71.073  -3.697  1.00 34.39  ? 636  GLN B O   1 
ATOM   10186 C  CB  . GLN B  1  608 ? 28.125  73.353  -1.882  1.00 33.87  ? 636  GLN B CB  1 
ATOM   10187 C  CG  . GLN B  1  608 ? 28.900  74.150  -0.848  1.00 34.34  ? 636  GLN B CG  1 
ATOM   10188 C  CD  . GLN B  1  608 ? 28.890  75.654  -1.120  1.00 34.55  ? 636  GLN B CD  1 
ATOM   10189 O  OE1 . GLN B  1  608 ? 28.245  76.127  -2.057  1.00 34.73  ? 636  GLN B OE1 1 
ATOM   10190 N  NE2 . GLN B  1  608 ? 29.607  76.410  -0.292  1.00 35.41  ? 636  GLN B NE2 1 
ATOM   10191 N  N   . ARG B  1  609 ? 25.770  70.895  -2.344  1.00 35.16  ? 637  ARG B N   1 
ATOM   10192 C  CA  . ARG B  1  609 ? 24.852  70.411  -3.380  1.00 35.70  ? 637  ARG B CA  1 
ATOM   10193 C  C   . ARG B  1  609 ? 24.572  71.555  -4.354  1.00 36.10  ? 637  ARG B C   1 
ATOM   10194 O  O   . ARG B  1  609 ? 24.253  72.669  -3.948  1.00 36.23  ? 637  ARG B O   1 
ATOM   10195 C  CB  . ARG B  1  609 ? 23.563  69.842  -2.747  1.00 36.01  ? 637  ARG B CB  1 
ATOM   10196 C  CG  . ARG B  1  609 ? 22.223  70.015  -3.516  1.00 35.95  ? 637  ARG B CG  1 
ATOM   10197 C  CD  . ARG B  1  609 ? 22.024  68.891  -4.459  1.00 36.64  ? 637  ARG B CD  1 
ATOM   10198 N  NE  . ARG B  1  609 ? 20.654  68.622  -4.912  1.00 37.88  ? 637  ARG B NE  1 
ATOM   10199 C  CZ  . ARG B  1  609 ? 20.006  69.278  -5.872  1.00 38.11  ? 637  ARG B CZ  1 
ATOM   10200 N  NH1 . ARG B  1  609 ? 20.537  70.337  -6.465  1.00 39.38  ? 637  ARG B NH1 1 
ATOM   10201 N  NH2 . ARG B  1  609 ? 18.793  68.888  -6.220  1.00 38.70  ? 637  ARG B NH2 1 
ATOM   10202 N  N   . LYS B  1  610 ? 24.741  71.262  -5.638  1.00 36.48  ? 638  LYS B N   1 
ATOM   10203 C  CA  . LYS B  1  610 ? 24.575  72.229  -6.707  1.00 36.52  ? 638  LYS B CA  1 
ATOM   10204 C  C   . LYS B  1  610 ? 23.741  71.614  -7.814  1.00 36.66  ? 638  LYS B C   1 
ATOM   10205 O  O   . LYS B  1  610 ? 23.958  70.468  -8.233  1.00 36.38  ? 638  LYS B O   1 
ATOM   10206 C  CB  . LYS B  1  610 ? 25.931  72.672  -7.263  1.00 36.54  ? 638  LYS B CB  1 
ATOM   10207 C  CG  . LYS B  1  610 ? 26.763  73.488  -6.291  1.00 37.17  ? 638  LYS B CG  1 
ATOM   10208 C  CD  . LYS B  1  610 ? 27.977  74.100  -6.964  1.00 37.22  ? 638  LYS B CD  1 
ATOM   10209 C  CE  . LYS B  1  610 ? 28.695  75.042  -5.993  1.00 37.59  ? 638  LYS B CE  1 
ATOM   10210 N  NZ  . LYS B  1  610 ? 30.023  75.497  -6.491  1.00 35.08  ? 638  LYS B NZ  1 
ATOM   10211 N  N   . GLU B  1  611 ? 22.772  72.387  -8.280  1.00 36.95  ? 639  GLU B N   1 
ATOM   10212 C  CA  . GLU B  1  611 ? 21.949  71.993  -9.411  1.00 37.22  ? 639  GLU B CA  1 
ATOM   10213 C  C   . GLU B  1  611 ? 22.819  71.547  -10.611 1.00 36.96  ? 639  GLU B C   1 
ATOM   10214 O  O   . GLU B  1  611 ? 22.457  70.597  -11.306 1.00 36.90  ? 639  GLU B O   1 
ATOM   10215 C  CB  . GLU B  1  611 ? 20.993  73.145  -9.771  1.00 37.49  ? 639  GLU B CB  1 
ATOM   10216 C  CG  . GLU B  1  611 ? 19.714  72.738  -10.491 1.00 39.07  ? 639  GLU B CG  1 
ATOM   10217 C  CD  . GLU B  1  611 ? 18.889  71.690  -9.734  1.00 40.76  ? 639  GLU B CD  1 
ATOM   10218 O  OE1 . GLU B  1  611 ? 18.523  71.918  -8.550  1.00 37.36  ? 639  GLU B OE1 1 
ATOM   10219 O  OE2 . GLU B  1  611 ? 18.605  70.632  -10.355 1.00 41.69  ? 639  GLU B OE2 1 
ATOM   10220 N  N   . GLU B  1  612 ? 23.980  72.188  -10.800 1.00 36.74  ? 640  GLU B N   1 
ATOM   10221 C  CA  . GLU B  1  612 ? 24.877  71.941  -11.947 1.00 36.87  ? 640  GLU B CA  1 
ATOM   10222 C  C   . GLU B  1  612 ? 25.898  70.830  -11.677 1.00 36.63  ? 640  GLU B C   1 
ATOM   10223 O  O   . GLU B  1  612 ? 26.789  70.578  -12.496 1.00 36.64  ? 640  GLU B O   1 
ATOM   10224 C  CB  . GLU B  1  612 ? 25.628  73.217  -12.363 1.00 37.04  ? 640  GLU B CB  1 
ATOM   10225 C  CG  . GLU B  1  612 ? 24.880  74.535  -12.130 1.00 39.59  ? 640  GLU B CG  1 
ATOM   10226 C  CD  . GLU B  1  612 ? 24.896  74.993  -10.652 1.00 41.51  ? 640  GLU B CD  1 
ATOM   10227 O  OE1 . GLU B  1  612 ? 25.816  75.743  -10.253 1.00 43.03  ? 640  GLU B OE1 1 
ATOM   10228 O  OE2 . GLU B  1  612 ? 23.983  74.617  -9.891  1.00 40.87  ? 640  GLU B OE2 1 
ATOM   10229 N  N   . GLU B  1  613 ? 25.779  70.174  -10.525 1.00 36.02  ? 641  GLU B N   1 
ATOM   10230 C  CA  . GLU B  1  613 ? 26.576  68.980  -10.228 1.00 35.22  ? 641  GLU B CA  1 
ATOM   10231 C  C   . GLU B  1  613 ? 25.654  67.823  -9.854  1.00 34.50  ? 641  GLU B C   1 
ATOM   10232 O  O   . GLU B  1  613 ? 25.695  67.347  -8.718  1.00 34.53  ? 641  GLU B O   1 
ATOM   10233 C  CB  . GLU B  1  613 ? 27.579  69.264  -9.098  1.00 35.26  ? 641  GLU B CB  1 
ATOM   10234 C  CG  . GLU B  1  613 ? 28.678  70.272  -9.475  1.00 35.72  ? 641  GLU B CG  1 
ATOM   10235 C  CD  . GLU B  1  613 ? 29.480  70.792  -8.281  1.00 35.42  ? 641  GLU B CD  1 
ATOM   10236 O  OE1 . GLU B  1  613 ? 29.259  70.338  -7.137  1.00 34.50  ? 641  GLU B OE1 1 
ATOM   10237 O  OE2 . GLU B  1  613 ? 30.343  71.665  -8.500  1.00 35.98  ? 641  GLU B OE2 1 
ATOM   10238 N  N   . PRO B  1  614 ? 24.804  67.370  -10.799 1.00 33.95  ? 642  PRO B N   1 
ATOM   10239 C  CA  . PRO B  1  614 ? 23.827  66.327  -10.439 1.00 33.46  ? 642  PRO B CA  1 
ATOM   10240 C  C   . PRO B  1  614 ? 24.421  64.924  -10.293 1.00 33.20  ? 642  PRO B C   1 
ATOM   10241 O  O   . PRO B  1  614 ? 23.858  64.098  -9.575  1.00 33.62  ? 642  PRO B O   1 
ATOM   10242 C  CB  . PRO B  1  614 ? 22.842  66.358  -11.606 1.00 33.25  ? 642  PRO B CB  1 
ATOM   10243 C  CG  . PRO B  1  614 ? 23.669  66.825  -12.780 1.00 33.18  ? 642  PRO B CG  1 
ATOM   10244 C  CD  . PRO B  1  614 ? 24.681  67.780  -12.216 1.00 33.72  ? 642  PRO B CD  1 
ATOM   10245 N  N   . SER B  1  615 ? 25.527  64.648  -10.976 1.00 32.54  ? 643  SER B N   1 
ATOM   10246 C  CA  . SER B  1  615 ? 26.134  63.320  -10.934 1.00 32.39  ? 643  SER B CA  1 
ATOM   10247 C  C   . SER B  1  615 ? 27.633  63.410  -10.860 1.00 31.86  ? 643  SER B C   1 
ATOM   10248 O  O   . SER B  1  615 ? 28.243  64.294  -11.457 1.00 31.99  ? 643  SER B O   1 
ATOM   10249 C  CB  . SER B  1  615 ? 25.800  62.500  -12.184 1.00 32.32  ? 643  SER B CB  1 
ATOM   10250 O  OG  . SER B  1  615 ? 24.494  62.748  -12.650 1.00 33.93  ? 643  SER B OG  1 
ATOM   10251 N  N   . SER B  1  616 ? 28.218  62.459  -10.155 1.00 31.13  ? 644  SER B N   1 
ATOM   10252 C  CA  . SER B  1  616 ? 29.653  62.309  -10.113 1.00 30.87  ? 644  SER B CA  1 
ATOM   10253 C  C   . SER B  1  616 ? 30.229  61.652  -11.375 1.00 30.87  ? 644  SER B C   1 
ATOM   10254 O  O   . SER B  1  616 ? 31.432  61.640  -11.565 1.00 31.29  ? 644  SER B O   1 
ATOM   10255 C  CB  . SER B  1  616 ? 30.011  61.473  -8.895  1.00 30.94  ? 644  SER B CB  1 
ATOM   10256 O  OG  . SER B  1  616 ? 29.300  60.238  -8.907  1.00 29.62  ? 644  SER B OG  1 
ATOM   10257 N  N   . SER B  1  617 ? 29.380  61.086  -12.227 1.00 31.17  ? 645  SER B N   1 
ATOM   10258 C  CA  . SER B  1  617 ? 29.846  60.411  -13.439 1.00 31.14  ? 645  SER B CA  1 
ATOM   10259 C  C   . SER B  1  617 ? 28.987  60.786  -14.627 1.00 30.99  ? 645  SER B C   1 
ATOM   10260 O  O   . SER B  1  617 ? 28.097  61.635  -14.513 1.00 31.33  ? 645  SER B O   1 
ATOM   10261 C  CB  . SER B  1  617 ? 29.827  58.892  -13.246 1.00 31.43  ? 645  SER B CB  1 
ATOM   10262 O  OG  . SER B  1  617 ? 30.620  58.229  -14.236 1.00 32.54  ? 645  SER B OG  1 
ATOM   10263 N  N   . SER B  1  618 ? 29.264  60.157  -15.770 1.00 30.96  ? 646  SER B N   1 
ATOM   10264 C  CA  . SER B  1  618 ? 28.457  60.313  -16.982 1.00 30.75  ? 646  SER B CA  1 
ATOM   10265 C  C   . SER B  1  618 ? 28.526  59.080  -17.880 1.00 30.85  ? 646  SER B C   1 
ATOM   10266 O  O   . SER B  1  618 ? 29.585  58.456  -18.022 1.00 31.26  ? 646  SER B O   1 
ATOM   10267 C  CB  . SER B  1  618 ? 28.898  61.532  -17.789 1.00 30.68  ? 646  SER B CB  1 
ATOM   10268 O  OG  . SER B  1  618 ? 28.236  61.546  -19.044 1.00 31.26  ? 646  SER B OG  1 
ATOM   10269 N  N   . VAL B  1  619 ? 27.397  58.759  -18.507 1.00 30.65  ? 647  VAL B N   1 
ATOM   10270 C  CA  . VAL B  1  619 ? 27.309  57.684  -19.488 1.00 30.11  ? 647  VAL B CA  1 
ATOM   10271 C  C   . VAL B  1  619 ? 28.403  57.825  -20.547 1.00 29.93  ? 647  VAL B C   1 
ATOM   10272 O  O   . VAL B  1  619 ? 28.784  56.835  -21.192 1.00 29.65  ? 647  VAL B O   1 
ATOM   10273 C  CB  . VAL B  1  619 ? 25.909  57.660  -20.153 1.00 30.36  ? 647  VAL B CB  1 
ATOM   10274 C  CG1 . VAL B  1  619 ? 25.647  58.962  -20.928 1.00 30.24  ? 647  VAL B CG1 1 
ATOM   10275 C  CG2 . VAL B  1  619 ? 25.744  56.439  -21.056 1.00 30.24  ? 647  VAL B CG2 1 
ATOM   10276 N  N   . PHE B  1  620 ? 28.924  59.051  -20.685 1.00 29.74  ? 648  PHE B N   1 
ATOM   10277 C  CA  . PHE B  1  620 ? 29.889  59.401  -21.737 1.00 29.49  ? 648  PHE B CA  1 
ATOM   10278 C  C   . PHE B  1  620 ? 31.353  59.218  -21.356 1.00 29.69  ? 648  PHE B C   1 
ATOM   10279 O  O   . PHE B  1  620 ? 32.226  59.252  -22.245 1.00 29.65  ? 648  PHE B O   1 
ATOM   10280 C  CB  . PHE B  1  620 ? 29.658  60.832  -22.247 1.00 29.27  ? 648  PHE B CB  1 
ATOM   10281 C  CG  . PHE B  1  620 ? 28.302  61.047  -22.859 1.00 28.56  ? 648  PHE B CG  1 
ATOM   10282 C  CD1 . PHE B  1  620 ? 27.416  61.958  -22.302 1.00 27.03  ? 648  PHE B CD1 1 
ATOM   10283 C  CD2 . PHE B  1  620 ? 27.901  60.315  -23.979 1.00 28.19  ? 648  PHE B CD2 1 
ATOM   10284 C  CE1 . PHE B  1  620 ? 26.149  62.137  -22.850 1.00 27.44  ? 648  PHE B CE1 1 
ATOM   10285 C  CE2 . PHE B  1  620 ? 26.626  60.494  -24.536 1.00 28.01  ? 648  PHE B CE2 1 
ATOM   10286 C  CZ  . PHE B  1  620 ? 25.753  61.412  -23.972 1.00 26.36  ? 648  PHE B CZ  1 
ATOM   10287 N  N   . ASN B  1  621 ? 31.617  59.032  -20.057 1.00 29.44  ? 649  ASN B N   1 
ATOM   10288 C  CA  . ASN B  1  621 ? 32.983  58.822  -19.546 1.00 29.66  ? 649  ASN B CA  1 
ATOM   10289 C  C   . ASN B  1  621 ? 33.675  57.530  -19.995 1.00 30.17  ? 649  ASN B C   1 
ATOM   10290 O  O   . ASN B  1  621 ? 34.891  57.518  -20.200 1.00 30.39  ? 649  ASN B O   1 
ATOM   10291 C  CB  . ASN B  1  621 ? 33.020  58.896  -18.010 1.00 29.47  ? 649  ASN B CB  1 
ATOM   10292 C  CG  . ASN B  1  621 ? 33.091  60.325  -17.486 1.00 27.73  ? 649  ASN B CG  1 
ATOM   10293 O  OD1 . ASN B  1  621 ? 32.641  61.262  -18.134 1.00 27.12  ? 649  ASN B OD1 1 
ATOM   10294 N  ND2 . ASN B  1  621 ? 33.650  60.486  -16.299 1.00 24.90  ? 649  ASN B ND2 1 
ATOM   10295 N  N   . GLN B  1  622 ? 32.911  56.448  -20.134 1.00 30.44  ? 650  GLN B N   1 
ATOM   10296 C  CA  . GLN B  1  622 ? 33.470  55.142  -20.489 1.00 30.82  ? 650  GLN B CA  1 
ATOM   10297 C  C   . GLN B  1  622 ? 34.320  55.158  -21.760 1.00 30.92  ? 650  GLN B C   1 
ATOM   10298 O  O   . GLN B  1  622 ? 35.456  54.686  -21.750 1.00 31.63  ? 650  GLN B O   1 
ATOM   10299 C  CB  . GLN B  1  622 ? 32.360  54.082  -20.587 1.00 31.32  ? 650  GLN B CB  1 
ATOM   10300 C  CG  . GLN B  1  622 ? 32.786  52.704  -21.098 1.00 31.39  ? 650  GLN B CG  1 
ATOM   10301 C  CD  . GLN B  1  622 ? 33.623  51.953  -20.092 1.00 34.69  ? 650  GLN B CD  1 
ATOM   10302 O  OE1 . GLN B  1  622 ? 33.159  50.967  -19.502 1.00 34.82  ? 650  GLN B OE1 1 
ATOM   10303 N  NE2 . GLN B  1  622 ? 34.874  52.410  -19.882 1.00 33.03  ? 650  GLN B NE2 1 
ATOM   10304 N  N   . ASN B  1  623 ? 33.782  55.716  -22.838 1.00 30.86  ? 651  ASN B N   1 
ATOM   10305 C  CA  . ASN B  1  623 ? 34.455  55.696  -24.127 1.00 30.99  ? 651  ASN B CA  1 
ATOM   10306 C  C   . ASN B  1  623 ? 35.401  56.870  -24.355 1.00 31.16  ? 651  ASN B C   1 
ATOM   10307 O  O   . ASN B  1  623 ? 36.013  56.987  -25.418 1.00 31.03  ? 651  ASN B O   1 
ATOM   10308 C  CB  . ASN B  1  623 ? 33.432  55.563  -25.253 1.00 31.07  ? 651  ASN B CB  1 
ATOM   10309 C  CG  . ASN B  1  623 ? 32.803  54.182  -25.295 1.00 32.47  ? 651  ASN B CG  1 
ATOM   10310 O  OD1 . ASN B  1  623 ? 33.304  53.245  -24.662 1.00 33.66  ? 651  ASN B OD1 1 
ATOM   10311 N  ND2 . ASN B  1  623 ? 31.703  54.044  -26.034 1.00 33.51  ? 651  ASN B ND2 1 
ATOM   10312 N  N   . ASP B  1  624 ? 35.518  57.741  -23.354 1.00 31.34  ? 652  ASP B N   1 
ATOM   10313 C  CA  . ASP B  1  624 ? 36.519  58.801  -23.368 1.00 31.65  ? 652  ASP B CA  1 
ATOM   10314 C  C   . ASP B  1  624 ? 36.853  59.291  -21.955 1.00 31.67  ? 652  ASP B C   1 
ATOM   10315 O  O   . ASP B  1  624 ? 36.459  60.398  -21.566 1.00 31.88  ? 652  ASP B O   1 
ATOM   10316 C  CB  . ASP B  1  624 ? 36.080  59.963  -24.263 1.00 31.76  ? 652  ASP B CB  1 
ATOM   10317 C  CG  . ASP B  1  624 ? 37.214  60.939  -24.560 1.00 32.79  ? 652  ASP B CG  1 
ATOM   10318 O  OD1 . ASP B  1  624 ? 38.296  60.823  -23.947 1.00 34.44  ? 652  ASP B OD1 1 
ATOM   10319 O  OD2 . ASP B  1  624 ? 37.020  61.829  -25.410 1.00 35.35  ? 652  ASP B OD2 1 
ATOM   10320 N  N   . PRO B  1  625 ? 37.563  58.457  -21.169 1.00 31.74  ? 653  PRO B N   1 
ATOM   10321 C  CA  . PRO B  1  625 ? 37.927  58.913  -19.831 1.00 31.67  ? 653  PRO B CA  1 
ATOM   10322 C  C   . PRO B  1  625 ? 39.074  59.940  -19.884 1.00 32.21  ? 653  PRO B C   1 
ATOM   10323 O  O   . PRO B  1  625 ? 39.299  60.685  -18.915 1.00 32.06  ? 653  PRO B O   1 
ATOM   10324 C  CB  . PRO B  1  625 ? 38.353  57.622  -19.138 1.00 31.60  ? 653  PRO B CB  1 
ATOM   10325 C  CG  . PRO B  1  625 ? 38.855  56.747  -20.252 1.00 31.05  ? 653  PRO B CG  1 
ATOM   10326 C  CD  . PRO B  1  625 ? 38.021  57.073  -21.432 1.00 31.48  ? 653  PRO B CD  1 
ATOM   10327 N  N   . TRP B  1  626 ? 39.768  59.987  -21.022 1.00 32.30  ? 654  TRP B N   1 
ATOM   10328 C  CA  . TRP B  1  626 ? 40.905  60.893  -21.209 1.00 32.74  ? 654  TRP B CA  1 
ATOM   10329 C  C   . TRP B  1  626 ? 40.443  62.347  -21.242 1.00 32.69  ? 654  TRP B C   1 
ATOM   10330 O  O   . TRP B  1  626 ? 41.211  63.249  -20.910 1.00 32.93  ? 654  TRP B O   1 
ATOM   10331 C  CB  . TRP B  1  626 ? 41.703  60.525  -22.472 1.00 32.45  ? 654  TRP B CB  1 
ATOM   10332 C  CG  . TRP B  1  626 ? 42.157  59.085  -22.464 1.00 32.95  ? 654  TRP B CG  1 
ATOM   10333 C  CD1 . TRP B  1  626 ? 43.250  58.568  -21.812 1.00 33.08  ? 654  TRP B CD1 1 
ATOM   10334 C  CD2 . TRP B  1  626 ? 41.513  57.969  -23.109 1.00 32.89  ? 654  TRP B CD2 1 
ATOM   10335 N  NE1 . TRP B  1  626 ? 43.333  57.198  -22.026 1.00 33.14  ? 654  TRP B NE1 1 
ATOM   10336 C  CE2 . TRP B  1  626 ? 42.281  56.809  -22.815 1.00 32.48  ? 654  TRP B CE2 1 
ATOM   10337 C  CE3 . TRP B  1  626 ? 40.370  57.836  -23.909 1.00 32.64  ? 654  TRP B CE3 1 
ATOM   10338 C