data_2C11
# 
_entry.id   2C11 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2C11         
PDBE  EBI-25570    
WWPDB D_1290025570 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2C10 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'THE STRUCTURE OF A TRUNCATED, SOLUBLE VERSION OF SEMICARBAZIDE-SENSITIVE AMINE OXIDASE' 
# 
_pdbx_database_status.entry_id                        2C11 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-09 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jakobsson, E.'  1 ? 
'Kleywegt, G.J.' 2 ? 
# 
_citation.id                        primary 
_citation.title                     'Structure of human semicarbazide-sensitive amine oxidase/vascular adhesion protein-1.' 
_citation.journal_abbrev            'Acta Crystallogr. D Biol. Crystallogr.' 
_citation.journal_volume            61 
_citation.page_first                1550 
_citation.page_last                 1562 
_citation.year                      2005 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16239734 
_citation.pdbx_database_id_DOI      10.1107/S0907444905028805 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jakobsson, E.'  1 ? 
primary 'Nilsson, J.'    2 ? 
primary 'Ogg, D.'        3 ? 
primary 'Kleywegt, G.J.' 4 ? 
# 
_cell.entry_id           2C11 
_cell.length_a           127.402 
_cell.length_b           127.402 
_cell.length_c           219.361 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2C11 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'MEMBRANE COPPER AMINE OXIDASE' 81775.734 4  1.4.3.6 ? 'EXTRA-CELLULAR DOMAINS, RESIDUES 29-763' ? 
2  branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2  ?       
? ?                                         ? 
3  branched    man 'alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose' 367.349   1  ?       ? ? ? 
4  branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   2  
?       ? ?                                         ? 
5  branched    man 
;alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
894.823   2  ?       ? ?                                         ? 
6  branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   1  
?       ? ?                                         ? 
7  non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   10 ?       ? ?                                         ? 
8  non-polymer syn 'CALCIUM ION' 40.078    8  ?       ? ?                                         ? 
9  non-polymer syn 'COPPER (II) ION' 63.546    30 ?       ? ?                                         ? 
10 non-polymer syn 'CHLORIDE ION' 35.453    4  ?       ? ?                                         ? 
11 water       nat water 18.015    59 ?       ? ?                                         ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SEMICARBAZIDE-SENSITIVE AMINE OXIDASE, VASCULAR ADHESION PROTEIN 1, VAP-1, HPAO' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAA
ALAHLDRGSPPPAREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNREL
PQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQG
RYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSWSLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPR
IFDVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDA
FCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLN(PAQ)DYVWDTVFHPSGAIEIRFYATGYISSAFLFGAT
GKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATP
RYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFI
NNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQ
AAACAPDLPAFSHGGFSHN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAA
ALAHLDRGSPPPAREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNREL
PQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQG
RYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSWSLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPR
IFDVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDA
FCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGKYG
NQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLY
LASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNET
IAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAAC
APDLPAFSHGGFSHN
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLY n 
1 3   ASP n 
1 4   GLY n 
1 5   GLY n 
1 6   GLU n 
1 7   PRO n 
1 8   SER n 
1 9   GLN n 
1 10  LEU n 
1 11  PRO n 
1 12  HIS n 
1 13  CYS n 
1 14  PRO n 
1 15  SER n 
1 16  VAL n 
1 17  SER n 
1 18  PRO n 
1 19  SER n 
1 20  ALA n 
1 21  GLN n 
1 22  PRO n 
1 23  TRP n 
1 24  THR n 
1 25  HIS n 
1 26  PRO n 
1 27  GLY n 
1 28  GLN n 
1 29  SER n 
1 30  GLN n 
1 31  LEU n 
1 32  PHE n 
1 33  ALA n 
1 34  ASP n 
1 35  LEU n 
1 36  SER n 
1 37  ARG n 
1 38  GLU n 
1 39  GLU n 
1 40  LEU n 
1 41  THR n 
1 42  ALA n 
1 43  VAL n 
1 44  MET n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  THR n 
1 49  GLN n 
1 50  ARG n 
1 51  LEU n 
1 52  GLY n 
1 53  PRO n 
1 54  GLY n 
1 55  LEU n 
1 56  VAL n 
1 57  ASP n 
1 58  ALA n 
1 59  ALA n 
1 60  GLN n 
1 61  ALA n 
1 62  ARG n 
1 63  PRO n 
1 64  SER n 
1 65  ASP n 
1 66  ASN n 
1 67  CYS n 
1 68  VAL n 
1 69  PHE n 
1 70  SER n 
1 71  VAL n 
1 72  GLU n 
1 73  LEU n 
1 74  GLN n 
1 75  LEU n 
1 76  PRO n 
1 77  PRO n 
1 78  LYS n 
1 79  ALA n 
1 80  ALA n 
1 81  ALA n 
1 82  LEU n 
1 83  ALA n 
1 84  HIS n 
1 85  LEU n 
1 86  ASP n 
1 87  ARG n 
1 88  GLY n 
1 89  SER n 
1 90  PRO n 
1 91  PRO n 
1 92  PRO n 
1 93  ALA n 
1 94  ARG n 
1 95  GLU n 
1 96  ALA n 
1 97  LEU n 
1 98  ALA n 
1 99  ILE n 
1 100 VAL n 
1 101 PHE n 
1 102 PHE n 
1 103 GLY n 
1 104 ARG n 
1 105 GLN n 
1 106 PRO n 
1 107 GLN n 
1 108 PRO n 
1 109 ASN n 
1 110 VAL n 
1 111 SER n 
1 112 GLU n 
1 113 LEU n 
1 114 VAL n 
1 115 VAL n 
1 116 GLY n 
1 117 PRO n 
1 118 LEU n 
1 119 PRO n 
1 120 HIS n 
1 121 PRO n 
1 122 SER n 
1 123 TYR n 
1 124 MET n 
1 125 ARG n 
1 126 ASP n 
1 127 VAL n 
1 128 THR n 
1 129 VAL n 
1 130 GLU n 
1 131 ARG n 
1 132 HIS n 
1 133 GLY n 
1 134 GLY n 
1 135 PRO n 
1 136 LEU n 
1 137 PRO n 
1 138 TYR n 
1 139 HIS n 
1 140 ARG n 
1 141 ARG n 
1 142 PRO n 
1 143 VAL n 
1 144 LEU n 
1 145 PHE n 
1 146 GLN n 
1 147 GLU n 
1 148 TYR n 
1 149 LEU n 
1 150 ASP n 
1 151 ILE n 
1 152 ASP n 
1 153 GLN n 
1 154 MET n 
1 155 ILE n 
1 156 PHE n 
1 157 ASN n 
1 158 ARG n 
1 159 GLU n 
1 160 LEU n 
1 161 PRO n 
1 162 GLN n 
1 163 ALA n 
1 164 SER n 
1 165 GLY n 
1 166 LEU n 
1 167 LEU n 
1 168 HIS n 
1 169 HIS n 
1 170 CYS n 
1 171 CYS n 
1 172 PHE n 
1 173 TYR n 
1 174 LYS n 
1 175 HIS n 
1 176 ARG n 
1 177 GLY n 
1 178 ARG n 
1 179 ASN n 
1 180 LEU n 
1 181 VAL n 
1 182 THR n 
1 183 MET n 
1 184 THR n 
1 185 THR n 
1 186 ALA n 
1 187 PRO n 
1 188 ARG n 
1 189 GLY n 
1 190 LEU n 
1 191 GLN n 
1 192 SER n 
1 193 GLY n 
1 194 ASP n 
1 195 ARG n 
1 196 ALA n 
1 197 THR n 
1 198 TRP n 
1 199 PHE n 
1 200 GLY n 
1 201 LEU n 
1 202 TYR n 
1 203 TYR n 
1 204 ASN n 
1 205 ILE n 
1 206 SER n 
1 207 GLY n 
1 208 ALA n 
1 209 GLY n 
1 210 PHE n 
1 211 PHE n 
1 212 LEU n 
1 213 HIS n 
1 214 HIS n 
1 215 VAL n 
1 216 GLY n 
1 217 LEU n 
1 218 GLU n 
1 219 LEU n 
1 220 LEU n 
1 221 VAL n 
1 222 ASN n 
1 223 HIS n 
1 224 LYS n 
1 225 ALA n 
1 226 LEU n 
1 227 ASP n 
1 228 PRO n 
1 229 ALA n 
1 230 ARG n 
1 231 TRP n 
1 232 THR n 
1 233 ILE n 
1 234 GLN n 
1 235 LYS n 
1 236 VAL n 
1 237 PHE n 
1 238 TYR n 
1 239 GLN n 
1 240 GLY n 
1 241 ARG n 
1 242 TYR n 
1 243 TYR n 
1 244 ASP n 
1 245 SER n 
1 246 LEU n 
1 247 ALA n 
1 248 GLN n 
1 249 LEU n 
1 250 GLU n 
1 251 ALA n 
1 252 GLN n 
1 253 PHE n 
1 254 GLU n 
1 255 ALA n 
1 256 GLY n 
1 257 LEU n 
1 258 VAL n 
1 259 ASN n 
1 260 VAL n 
1 261 VAL n 
1 262 LEU n 
1 263 ILE n 
1 264 PRO n 
1 265 ASP n 
1 266 ASN n 
1 267 GLY n 
1 268 THR n 
1 269 GLY n 
1 270 GLY n 
1 271 SER n 
1 272 TRP n 
1 273 SER n 
1 274 LEU n 
1 275 LYS n 
1 276 SER n 
1 277 PRO n 
1 278 VAL n 
1 279 PRO n 
1 280 PRO n 
1 281 GLY n 
1 282 PRO n 
1 283 ALA n 
1 284 PRO n 
1 285 PRO n 
1 286 LEU n 
1 287 GLN n 
1 288 PHE n 
1 289 TYR n 
1 290 PRO n 
1 291 GLN n 
1 292 GLY n 
1 293 PRO n 
1 294 ARG n 
1 295 PHE n 
1 296 SER n 
1 297 VAL n 
1 298 GLN n 
1 299 GLY n 
1 300 SER n 
1 301 ARG n 
1 302 VAL n 
1 303 ALA n 
1 304 SER n 
1 305 SER n 
1 306 LEU n 
1 307 TRP n 
1 308 THR n 
1 309 PHE n 
1 310 SER n 
1 311 PHE n 
1 312 GLY n 
1 313 LEU n 
1 314 GLY n 
1 315 ALA n 
1 316 PHE n 
1 317 SER n 
1 318 GLY n 
1 319 PRO n 
1 320 ARG n 
1 321 ILE n 
1 322 PHE n 
1 323 ASP n 
1 324 VAL n 
1 325 ARG n 
1 326 PHE n 
1 327 GLN n 
1 328 GLY n 
1 329 GLU n 
1 330 ARG n 
1 331 LEU n 
1 332 VAL n 
1 333 TYR n 
1 334 GLU n 
1 335 ILE n 
1 336 SER n 
1 337 LEU n 
1 338 GLN n 
1 339 GLU n 
1 340 ALA n 
1 341 LEU n 
1 342 ALA n 
1 343 ILE n 
1 344 TYR n 
1 345 GLY n 
1 346 GLY n 
1 347 ASN n 
1 348 SER n 
1 349 PRO n 
1 350 ALA n 
1 351 ALA n 
1 352 MET n 
1 353 THR n 
1 354 THR n 
1 355 ARG n 
1 356 TYR n 
1 357 VAL n 
1 358 ASP n 
1 359 GLY n 
1 360 GLY n 
1 361 PHE n 
1 362 GLY n 
1 363 MET n 
1 364 GLY n 
1 365 LYS n 
1 366 TYR n 
1 367 THR n 
1 368 THR n 
1 369 PRO n 
1 370 LEU n 
1 371 THR n 
1 372 ARG n 
1 373 GLY n 
1 374 VAL n 
1 375 ASP n 
1 376 CYS n 
1 377 PRO n 
1 378 TYR n 
1 379 LEU n 
1 380 ALA n 
1 381 THR n 
1 382 TYR n 
1 383 VAL n 
1 384 ASP n 
1 385 TRP n 
1 386 HIS n 
1 387 PHE n 
1 388 LEU n 
1 389 LEU n 
1 390 GLU n 
1 391 SER n 
1 392 GLN n 
1 393 ALA n 
1 394 PRO n 
1 395 LYS n 
1 396 THR n 
1 397 ILE n 
1 398 ARG n 
1 399 ASP n 
1 400 ALA n 
1 401 PHE n 
1 402 CYS n 
1 403 VAL n 
1 404 PHE n 
1 405 GLU n 
1 406 GLN n 
1 407 ASN n 
1 408 GLN n 
1 409 GLY n 
1 410 LEU n 
1 411 PRO n 
1 412 LEU n 
1 413 ARG n 
1 414 ARG n 
1 415 HIS n 
1 416 HIS n 
1 417 SER n 
1 418 ASP n 
1 419 LEU n 
1 420 TYR n 
1 421 SER n 
1 422 HIS n 
1 423 TYR n 
1 424 PHE n 
1 425 GLY n 
1 426 GLY n 
1 427 LEU n 
1 428 ALA n 
1 429 GLU n 
1 430 THR n 
1 431 VAL n 
1 432 LEU n 
1 433 VAL n 
1 434 VAL n 
1 435 ARG n 
1 436 SER n 
1 437 MET n 
1 438 SER n 
1 439 THR n 
1 440 LEU n 
1 441 LEU n 
1 442 ASN n 
1 443 PAQ n 
1 444 ASP n 
1 445 TYR n 
1 446 VAL n 
1 447 TRP n 
1 448 ASP n 
1 449 THR n 
1 450 VAL n 
1 451 PHE n 
1 452 HIS n 
1 453 PRO n 
1 454 SER n 
1 455 GLY n 
1 456 ALA n 
1 457 ILE n 
1 458 GLU n 
1 459 ILE n 
1 460 ARG n 
1 461 PHE n 
1 462 TYR n 
1 463 ALA n 
1 464 THR n 
1 465 GLY n 
1 466 TYR n 
1 467 ILE n 
1 468 SER n 
1 469 SER n 
1 470 ALA n 
1 471 PHE n 
1 472 LEU n 
1 473 PHE n 
1 474 GLY n 
1 475 ALA n 
1 476 THR n 
1 477 GLY n 
1 478 LYS n 
1 479 TYR n 
1 480 GLY n 
1 481 ASN n 
1 482 GLN n 
1 483 VAL n 
1 484 SER n 
1 485 GLU n 
1 486 HIS n 
1 487 THR n 
1 488 LEU n 
1 489 GLY n 
1 490 THR n 
1 491 VAL n 
1 492 HIS n 
1 493 THR n 
1 494 HIS n 
1 495 SER n 
1 496 ALA n 
1 497 HIS n 
1 498 PHE n 
1 499 LYS n 
1 500 VAL n 
1 501 ASP n 
1 502 LEU n 
1 503 ASP n 
1 504 VAL n 
1 505 ALA n 
1 506 GLY n 
1 507 LEU n 
1 508 GLU n 
1 509 ASN n 
1 510 TRP n 
1 511 VAL n 
1 512 TRP n 
1 513 ALA n 
1 514 GLU n 
1 515 ASP n 
1 516 MET n 
1 517 VAL n 
1 518 PHE n 
1 519 VAL n 
1 520 PRO n 
1 521 MET n 
1 522 ALA n 
1 523 VAL n 
1 524 PRO n 
1 525 TRP n 
1 526 SER n 
1 527 PRO n 
1 528 GLU n 
1 529 HIS n 
1 530 GLN n 
1 531 LEU n 
1 532 GLN n 
1 533 ARG n 
1 534 LEU n 
1 535 GLN n 
1 536 VAL n 
1 537 THR n 
1 538 ARG n 
1 539 LYS n 
1 540 LEU n 
1 541 LEU n 
1 542 GLU n 
1 543 MET n 
1 544 GLU n 
1 545 GLU n 
1 546 GLN n 
1 547 ALA n 
1 548 ALA n 
1 549 PHE n 
1 550 LEU n 
1 551 VAL n 
1 552 GLY n 
1 553 SER n 
1 554 ALA n 
1 555 THR n 
1 556 PRO n 
1 557 ARG n 
1 558 TYR n 
1 559 LEU n 
1 560 TYR n 
1 561 LEU n 
1 562 ALA n 
1 563 SER n 
1 564 ASN n 
1 565 HIS n 
1 566 SER n 
1 567 ASN n 
1 568 LYS n 
1 569 TRP n 
1 570 GLY n 
1 571 HIS n 
1 572 PRO n 
1 573 ARG n 
1 574 GLY n 
1 575 TYR n 
1 576 ARG n 
1 577 ILE n 
1 578 GLN n 
1 579 MET n 
1 580 LEU n 
1 581 SER n 
1 582 PHE n 
1 583 ALA n 
1 584 GLY n 
1 585 GLU n 
1 586 PRO n 
1 587 LEU n 
1 588 PRO n 
1 589 GLN n 
1 590 ASN n 
1 591 SER n 
1 592 SER n 
1 593 MET n 
1 594 ALA n 
1 595 ARG n 
1 596 GLY n 
1 597 PHE n 
1 598 SER n 
1 599 TRP n 
1 600 GLU n 
1 601 ARG n 
1 602 TYR n 
1 603 GLN n 
1 604 LEU n 
1 605 ALA n 
1 606 VAL n 
1 607 THR n 
1 608 GLN n 
1 609 ARG n 
1 610 LYS n 
1 611 GLU n 
1 612 GLU n 
1 613 GLU n 
1 614 PRO n 
1 615 SER n 
1 616 SER n 
1 617 SER n 
1 618 SER n 
1 619 VAL n 
1 620 PHE n 
1 621 ASN n 
1 622 GLN n 
1 623 ASN n 
1 624 ASP n 
1 625 PRO n 
1 626 TRP n 
1 627 ALA n 
1 628 PRO n 
1 629 THR n 
1 630 VAL n 
1 631 ASP n 
1 632 PHE n 
1 633 SER n 
1 634 ASP n 
1 635 PHE n 
1 636 ILE n 
1 637 ASN n 
1 638 ASN n 
1 639 GLU n 
1 640 THR n 
1 641 ILE n 
1 642 ALA n 
1 643 GLY n 
1 644 LYS n 
1 645 ASP n 
1 646 LEU n 
1 647 VAL n 
1 648 ALA n 
1 649 TRP n 
1 650 VAL n 
1 651 THR n 
1 652 ALA n 
1 653 GLY n 
1 654 PHE n 
1 655 LEU n 
1 656 HIS n 
1 657 ILE n 
1 658 PRO n 
1 659 HIS n 
1 660 ALA n 
1 661 GLU n 
1 662 ASP n 
1 663 ILE n 
1 664 PRO n 
1 665 ASN n 
1 666 THR n 
1 667 VAL n 
1 668 THR n 
1 669 VAL n 
1 670 GLY n 
1 671 ASN n 
1 672 GLY n 
1 673 VAL n 
1 674 GLY n 
1 675 PHE n 
1 676 PHE n 
1 677 LEU n 
1 678 ARG n 
1 679 PRO n 
1 680 TYR n 
1 681 ASN n 
1 682 PHE n 
1 683 PHE n 
1 684 ASP n 
1 685 GLU n 
1 686 ASP n 
1 687 PRO n 
1 688 SER n 
1 689 PHE n 
1 690 TYR n 
1 691 SER n 
1 692 ALA n 
1 693 ASP n 
1 694 SER n 
1 695 ILE n 
1 696 TYR n 
1 697 PHE n 
1 698 ARG n 
1 699 GLY n 
1 700 ASP n 
1 701 GLN n 
1 702 ASP n 
1 703 ALA n 
1 704 GLY n 
1 705 ALA n 
1 706 CYS n 
1 707 GLU n 
1 708 VAL n 
1 709 ASN n 
1 710 PRO n 
1 711 LEU n 
1 712 ALA n 
1 713 CYS n 
1 714 LEU n 
1 715 PRO n 
1 716 GLN n 
1 717 ALA n 
1 718 ALA n 
1 719 ALA n 
1 720 CYS n 
1 721 ALA n 
1 722 PRO n 
1 723 ASP n 
1 724 LEU n 
1 725 PRO n 
1 726 ALA n 
1 727 PHE n 
1 728 SER n 
1 729 HIS n 
1 730 GLY n 
1 731 GLY n 
1 732 PHE n 
1 733 SER n 
1 734 HIS n 
1 735 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AOC3_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q16853 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2C11 A 1 ? 735 ? Q16853 29 ? 763 ? 29 763 
2 1 2C11 B 1 ? 735 ? Q16853 29 ? 763 ? 29 763 
3 1 2C11 C 1 ? 735 ? Q16853 29 ? 763 ? 29 763 
4 1 2C11 D 1 ? 735 ? Q16853 29 ? 763 ? 29 763 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                        ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                                   ? 'C6 H12 O6'      180.156 
CA  non-polymer                   . 'CALCIUM ION'                                          ? 'Ca 2'           40.078  
CL  non-polymer                   . 'CHLORIDE ION'                                         ? 'Cl -1'          35.453  
CU  non-polymer                   . 'COPPER (II) ION'                                      ? 'Cu 2'           63.546  
CYS 'L-peptide linking'           y CYSTEINE                                               ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                   ? 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                                  ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                                 ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                                  ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                                             ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose               ? 'C8 H15 N O6'    221.208 
PAQ 'L-peptide linking'           n '2-OXY-4-HYDROXY-5-(2-HYDRAZINOPYRIDINE)PHENYLALANINE' ? 'C14 H16 N4 O4'  304.301 
PHE 'L-peptide linking'           y PHENYLALANINE                                          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2C11 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.90 
_exptl_crystal.density_percent_sol   57.27 
_exptl_crystal.description           'THE DATA IS TWINNED AND THE ESTIMATED TWINNING FRACTION IS 0.28.' 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            288 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;THE PROTEIN WAS CRYSTALLISED IN 0.1 M KBR, 0.1 M ACETATE PH5, 38 % PEG1000 AT 288 K. THE CRYSTALS WERE SOAKED FOR FIVE DAYS IN 40 % PEG1000, 0.1 M ACETATE PH 5, 80 MM KBR, 5 MM CUCL2, 8 MM 2-HYDRAZINOPYRIDINE.
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100.0 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2004-05-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.934 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             0.934 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2C11 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             83.300 
_reflns.d_resolution_high            2.900 
_reflns.number_obs                   72802 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.6 
_reflns.pdbx_Rmerge_I_obs            0.16000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.4000 
_reflns.B_iso_Wilson_estimate        70 
_reflns.pdbx_redundancy              4.700 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              3.10 
_reflns_shell.percent_possible_all   90.6 
_reflns_shell.Rmerge_I_obs           0.46000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.000 
_reflns_shell.pdbx_redundancy        3.10 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2C11 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     69804 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    90.7 
_refine.ls_R_factor_obs                          0.215 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.215 
_refine.ls_R_factor_R_free                       0.276 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.4 
_refine.ls_number_reflns_R_free                  3370 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               60 
_refine.aniso_B[1][1]                            -18.55 
_refine.aniso_B[2][2]                            -18.55 
_refine.aniso_B[3][3]                            37.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;THE LAST REFINEMENT ROUND WAS DONE AGAINST ALL DATA. THE DATA IS TWINNED AND HAS BEEN REFINED USING THE TWIN-REFINEMENT MODULE AND AN ESTIMATED TWINNING FRACTION OF 0.28.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'TWIN LEAST SQUARES' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'RANDOM, BUT PAIRS OF TWIN RELATED REFLECTIONS ARE IN THE SAME SET' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        21360 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         498 
_refine_hist.number_atoms_solvent             59 
_refine_hist.number_atoms_total               21917 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.03 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  ? 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.470529  0.882376 -0.003873 0.882372  -0.470541 -0.003200 -0.004646 -0.001911 -0.999987 -22.20080  37.01720  15.73120 
2 given ? -0.002399 0.999969 -0.007532 0.999996  0.002389  -0.001343 -0.001325 -0.007535 -0.999971 -63.29480  -64.14380 8.70530  
3 given ? 0.879452  0.475946 -0.006291 -0.475949 0.879472  0.001105  0.006058  0.002023  0.999980  -108.68440 11.84170  6.84210  
# 
_struct.entry_id                  2C11 
_struct.title                     'Crystal structure of the 2-hydrazinopyridine of semicarbazide- sensitive amine oxidase' 
_struct.pdbx_descriptor           'MEMBRANE COPPER AMINE OXIDASE (E.C.1.4.3.6)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2C11 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;OXIDOREDUCTASE, ADHESION PROTEIN-1, 2-HYDROXYPYRIDINE, METAL-BINDING, CELL ADHESION, GLYCOPROTEIN, SIGNAL-ANCHOR, TPQ, TRANSMEMBRANE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 1  ? 
D  N N 1  ? 
E  N N 2  ? 
F  N N 3  ? 
G  N N 4  ? 
H  N N 5  ? 
I  N N 2  ? 
J  N N 6  ? 
K  N N 4  ? 
L  N N 5  ? 
M  N N 7  ? 
N  N N 7  ? 
O  N N 8  ? 
P  N N 9  ? 
Q  N N 8  ? 
R  N N 10 ? 
S  N N 9  ? 
T  N N 9  ? 
U  N N 9  ? 
V  N N 9  ? 
W  N N 9  ? 
X  N N 9  ? 
Y  N N 10 ? 
Z  N N 7  ? 
AA N N 7  ? 
BA N N 7  ? 
CA N N 8  ? 
DA N N 9  ? 
EA N N 8  ? 
FA N N 9  ? 
GA N N 9  ? 
HA N N 9  ? 
IA N N 9  ? 
JA N N 9  ? 
KA N N 9  ? 
LA N N 9  ? 
MA N N 7  ? 
NA N N 7  ? 
OA N N 8  ? 
PA N N 9  ? 
QA N N 8  ? 
RA N N 10 ? 
SA N N 9  ? 
TA N N 9  ? 
UA N N 9  ? 
VA N N 9  ? 
WA N N 9  ? 
XA N N 9  ? 
YA N N 9  ? 
ZA N N 7  ? 
AB N N 7  ? 
BB N N 7  ? 
CB N N 8  ? 
DB N N 9  ? 
EB N N 8  ? 
FB N N 10 ? 
GB N N 9  ? 
HB N N 9  ? 
IB N N 9  ? 
JB N N 9  ? 
KB N N 9  ? 
LB N N 9  ? 
MB N N 11 ? 
NB N N 11 ? 
OB N N 11 ? 
PB N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 36  ? LEU A 51  ? SER A 64  LEU A 79  1 ? 16 
HELX_P HELX_P2  2  PRO A 77  ? ASP A 86  ? PRO A 105 ASP A 114 1 ? 10 
HELX_P HELX_P3  3  VAL A 127 ? GLY A 133 ? VAL A 155 GLY A 161 1 ? 7  
HELX_P HELX_P4  4  TYR A 138 ? ARG A 141 ? TYR A 166 ARG A 169 5 ? 4  
HELX_P HELX_P5  5  LEU A 144 ? ASN A 157 ? LEU A 172 ASN A 185 1 ? 14 
HELX_P HELX_P6  6  GLU A 159 ? GLN A 162 ? GLU A 187 GLN A 190 5 ? 4  
HELX_P HELX_P7  7  ALA A 163 ? CYS A 171 ? ALA A 191 CYS A 199 1 ? 9  
HELX_P HELX_P8  8  SER A 245 ? GLY A 256 ? SER A 273 GLY A 284 1 ? 12 
HELX_P HELX_P9  9  SER A 348 ? THR A 353 ? SER A 376 THR A 381 1 ? 6  
HELX_P HELX_P10 10 VAL A 357 ? PHE A 361 ? VAL A 385 PHE A 389 5 ? 5  
HELX_P HELX_P11 11 MET A 543 ? ALA A 548 ? MET A 571 ALA A 576 1 ? 6  
HELX_P HELX_P12 12 MET A 593 ? GLU A 600 ? MET A 621 GLU A 628 5 ? 8  
HELX_P HELX_P13 13 ASP A 631 ? ILE A 636 ? ASP A 659 ILE A 664 5 ? 6  
HELX_P HELX_P14 14 HIS A 659 ? ILE A 663 ? HIS A 687 ILE A 691 5 ? 5  
HELX_P HELX_P15 15 ASP A 686 ? SER A 691 ? ASP A 714 SER A 719 5 ? 6  
HELX_P HELX_P16 16 SER B 36  ? LEU B 51  ? SER B 64  LEU B 79  1 ? 16 
HELX_P HELX_P17 17 ASP B 57  ? ALA B 61  ? ASP B 85  ALA B 89  5 ? 5  
HELX_P HELX_P18 18 PRO B 77  ? ASP B 86  ? PRO B 105 ASP B 114 1 ? 10 
HELX_P HELX_P19 19 VAL B 127 ? GLY B 133 ? VAL B 155 GLY B 161 1 ? 7  
HELX_P HELX_P20 20 HIS B 139 ? ARG B 141 ? HIS B 167 ARG B 169 5 ? 3  
HELX_P HELX_P21 21 LEU B 144 ? ASN B 157 ? LEU B 172 ASN B 185 1 ? 14 
HELX_P HELX_P22 22 GLU B 159 ? GLN B 162 ? GLU B 187 GLN B 190 5 ? 4  
HELX_P HELX_P23 23 ALA B 163 ? CYS B 171 ? ALA B 191 CYS B 199 1 ? 9  
HELX_P HELX_P24 24 ASP B 227 ? TRP B 231 ? ASP B 255 TRP B 259 5 ? 5  
HELX_P HELX_P25 25 SER B 245 ? GLY B 256 ? SER B 273 GLY B 284 1 ? 12 
HELX_P HELX_P26 26 SER B 348 ? THR B 354 ? SER B 376 THR B 382 1 ? 7  
HELX_P HELX_P27 27 VAL B 357 ? PHE B 361 ? VAL B 385 PHE B 389 5 ? 5  
HELX_P HELX_P28 28 GLU B 544 ? GLN B 546 ? GLU B 572 GLN B 574 5 ? 3  
HELX_P HELX_P29 29 PHE B 597 ? GLU B 600 ? PHE B 625 GLU B 628 5 ? 4  
HELX_P HELX_P30 30 ASP B 631 ? ILE B 636 ? ASP B 659 ILE B 664 5 ? 6  
HELX_P HELX_P31 31 HIS B 659 ? ILE B 663 ? HIS B 687 ILE B 691 5 ? 5  
HELX_P HELX_P32 32 ASP B 686 ? SER B 691 ? ASP B 714 SER B 719 5 ? 6  
HELX_P HELX_P33 33 SER C 36  ? LEU C 51  ? SER C 64  LEU C 79  1 ? 16 
HELX_P HELX_P34 34 PRO C 77  ? ASP C 86  ? PRO C 105 ASP C 114 1 ? 10 
HELX_P HELX_P35 35 VAL C 127 ? GLY C 133 ? VAL C 155 GLY C 161 1 ? 7  
HELX_P HELX_P36 36 HIS C 139 ? ARG C 141 ? HIS C 167 ARG C 169 5 ? 3  
HELX_P HELX_P37 37 LEU C 144 ? ASN C 157 ? LEU C 172 ASN C 185 1 ? 14 
HELX_P HELX_P38 38 GLU C 159 ? GLN C 162 ? GLU C 187 GLN C 190 5 ? 4  
HELX_P HELX_P39 39 ALA C 163 ? CYS C 171 ? ALA C 191 CYS C 199 1 ? 9  
HELX_P HELX_P40 40 SER C 245 ? GLY C 256 ? SER C 273 GLY C 284 1 ? 12 
HELX_P HELX_P41 41 SER C 348 ? THR C 353 ? SER C 376 THR C 381 1 ? 6  
HELX_P HELX_P42 42 VAL C 357 ? PHE C 361 ? VAL C 385 PHE C 389 5 ? 5  
HELX_P HELX_P43 43 MET C 543 ? ALA C 548 ? MET C 571 ALA C 576 1 ? 6  
HELX_P HELX_P44 44 MET C 593 ? GLU C 600 ? MET C 621 GLU C 628 5 ? 8  
HELX_P HELX_P45 45 ASP C 631 ? ILE C 636 ? ASP C 659 ILE C 664 5 ? 6  
HELX_P HELX_P46 46 HIS C 659 ? ILE C 663 ? HIS C 687 ILE C 691 5 ? 5  
HELX_P HELX_P47 47 ASP C 686 ? SER C 691 ? ASP C 714 SER C 719 5 ? 6  
HELX_P HELX_P48 48 SER D 36  ? LEU D 51  ? SER D 64  LEU D 79  1 ? 16 
HELX_P HELX_P49 49 PRO D 77  ? ASP D 86  ? PRO D 105 ASP D 114 1 ? 10 
HELX_P HELX_P50 50 VAL D 127 ? GLY D 133 ? VAL D 155 GLY D 161 1 ? 7  
HELX_P HELX_P51 51 HIS D 139 ? ARG D 141 ? HIS D 167 ARG D 169 5 ? 3  
HELX_P HELX_P52 52 LEU D 144 ? ASN D 157 ? LEU D 172 ASN D 185 1 ? 14 
HELX_P HELX_P53 53 GLU D 159 ? GLN D 162 ? GLU D 187 GLN D 190 5 ? 4  
HELX_P HELX_P54 54 ALA D 163 ? CYS D 171 ? ALA D 191 CYS D 199 1 ? 9  
HELX_P HELX_P55 55 GLY D 209 ? LEU D 212 ? GLY D 237 LEU D 240 5 ? 4  
HELX_P HELX_P56 56 ASP D 227 ? TRP D 231 ? ASP D 255 TRP D 259 5 ? 5  
HELX_P HELX_P57 57 SER D 245 ? GLY D 256 ? SER D 273 GLY D 284 1 ? 12 
HELX_P HELX_P58 58 SER D 348 ? THR D 354 ? SER D 376 THR D 382 1 ? 7  
HELX_P HELX_P59 59 GLY D 359 ? PHE D 361 ? GLY D 387 PHE D 389 5 ? 3  
HELX_P HELX_P60 60 GLU D 544 ? GLN D 546 ? GLU D 572 GLN D 574 5 ? 3  
HELX_P HELX_P61 61 PHE D 597 ? GLU D 600 ? PHE D 625 GLU D 628 5 ? 4  
HELX_P HELX_P62 62 SER D 618 ? GLN D 622 ? SER D 646 GLN D 650 5 ? 5  
HELX_P HELX_P63 63 ASP D 631 ? ILE D 636 ? ASP D 659 ILE D 664 5 ? 6  
HELX_P HELX_P64 64 HIS D 659 ? ILE D 663 ? HIS D 687 ILE D 691 5 ? 5  
HELX_P HELX_P65 65 ASP D 686 ? SER D 691 ? ASP D 714 SER D 719 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A  CYS 170 SG  ? ? ? 1_555 A  CYS 171 SG ? ? A CYS 198  A CYS 199  1_555 ? ? ? ? ? ? ? 2.059 ? ? 
disulf2  disulf ?    ? A  CYS 376 SG  ? ? ? 1_555 A  CYS 402 SG ? ? A CYS 404  A CYS 430  1_555 ? ? ? ? ? ? ? 2.027 ? ? 
disulf3  disulf ?    ? B  CYS 170 SG  ? ? ? 1_555 B  CYS 171 SG ? ? B CYS 198  B CYS 199  1_555 ? ? ? ? ? ? ? 2.056 ? ? 
disulf4  disulf ?    ? B  CYS 376 SG  ? ? ? 1_555 B  CYS 402 SG ? ? B CYS 404  B CYS 430  1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf5  disulf ?    ? C  CYS 170 SG  ? ? ? 1_555 C  CYS 171 SG ? ? C CYS 198  C CYS 199  1_555 ? ? ? ? ? ? ? 2.056 ? ? 
disulf6  disulf ?    ? C  CYS 376 SG  ? ? ? 1_555 C  CYS 402 SG ? ? C CYS 404  C CYS 430  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf7  disulf ?    ? D  CYS 170 SG  ? ? ? 1_555 D  CYS 171 SG ? ? D CYS 198  D CYS 199  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
disulf8  disulf ?    ? D  CYS 376 SG  ? ? ? 1_555 D  CYS 402 SG ? ? D CYS 404  D CYS 430  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
covale1  covale one  ? A  ASN 109 ND2 ? ? ? 1_555 E  NAG .   C1 ? ? A ASN 137  E NAG 1    1_555 ? ? ? ? ? ? ? 1.455 ? 
N-Glycosylation 
covale2  covale one  ? A  ASN 204 ND2 ? ? ? 1_555 M  NAG .   C1 ? ? A ASN 232  A NAG 1734 1_555 ? ? ? ? ? ? ? 1.461 ? 
N-Glycosylation 
covale3  covale one  ? A  ASN 266 ND2 ? ? ? 1_555 N  NAG .   C1 ? ? A ASN 294  A NAG 1735 1_555 ? ? ? ? ? ? ? 1.453 ? 
N-Glycosylation 
covale4  covale both ? A  ASN 442 C   ? ? ? 1_555 A  PAQ 443 N  ? ? A ASN 470  A PAQ 471  1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale5  covale both ? A  PAQ 443 C   ? ? ? 1_555 A  ASP 444 N  ? ? A PAQ 471  A ASP 472  1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale6  covale one  ? A  ASN 564 ND2 ? ? ? 1_555 F  NAG .   C1 ? ? A ASN 592  F NAG 1    1_555 ? ? ? ? ? ? ? 1.464 ? 
N-Glycosylation 
covale7  covale one  ? B  ASN 109 ND2 ? ? ? 1_555 G  NAG .   C1 ? ? B ASN 137  G NAG 1    1_555 ? ? ? ? ? ? ? 1.464 ? 
N-Glycosylation 
covale8  covale one  ? B  ASN 204 ND2 ? ? ? 1_555 Z  NAG .   C1 ? ? B ASN 232  B NAG 1735 1_555 ? ? ? ? ? ? ? 1.442 ? 
N-Glycosylation 
covale9  covale one  ? B  ASN 266 ND2 ? ? ? 1_555 AA NAG .   C1 ? ? B ASN 294  B NAG 1736 1_555 ? ? ? ? ? ? ? 1.456 ? 
N-Glycosylation 
covale10 covale both ? B  ASN 442 C   ? ? ? 1_555 B  PAQ 443 N  ? ? B ASN 470  B PAQ 471  1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale11 covale both ? B  PAQ 443 C   ? ? ? 1_555 B  ASP 444 N  ? ? B PAQ 471  B ASP 472  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale12 covale one  ? B  ASN 564 ND2 ? ? ? 1_555 H  NAG .   C1 ? ? B ASN 592  H NAG 1    1_555 ? ? ? ? ? ? ? 1.446 ? 
N-Glycosylation 
covale13 covale one  ? B  ASN 638 ND2 ? ? ? 1_555 BA NAG .   C1 ? ? B ASN 666  B NAG 1738 1_555 ? ? ? ? ? ? ? 1.451 ? 
N-Glycosylation 
covale14 covale one  ? C  ASN 109 ND2 ? ? ? 1_555 I  NAG .   C1 ? ? C ASN 137  I NAG 1    1_555 ? ? ? ? ? ? ? 1.459 ? 
N-Glycosylation 
covale15 covale one  ? C  ASN 204 ND2 ? ? ? 1_555 MA NAG .   C1 ? ? C ASN 232  C NAG 1735 1_555 ? ? ? ? ? ? ? 1.458 ? 
N-Glycosylation 
covale16 covale one  ? C  ASN 266 ND2 ? ? ? 1_555 NA NAG .   C1 ? ? C ASN 294  C NAG 1736 1_555 ? ? ? ? ? ? ? 1.461 ? 
N-Glycosylation 
covale17 covale both ? C  ASN 442 C   ? ? ? 1_555 C  PAQ 443 N  ? ? C ASN 470  C PAQ 471  1_555 ? ? ? ? ? ? ? 1.335 ? ? 
covale18 covale both ? C  PAQ 443 C   ? ? ? 1_555 C  ASP 444 N  ? ? C PAQ 471  C ASP 472  1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale19 covale one  ? C  ASN 564 ND2 ? ? ? 1_555 J  NAG .   C1 ? ? C ASN 592  J NAG 1    1_555 ? ? ? ? ? ? ? 1.459 ? 
N-Glycosylation 
covale20 covale one  ? D  ASN 109 ND2 ? ? ? 1_555 K  NAG .   C1 ? ? D ASN 137  K NAG 1    1_555 ? ? ? ? ? ? ? 1.455 ? 
N-Glycosylation 
covale21 covale one  ? D  ASN 204 ND2 ? ? ? 1_555 ZA NAG .   C1 ? ? D ASN 232  D NAG 1735 1_555 ? ? ? ? ? ? ? 1.458 ? 
N-Glycosylation 
covale22 covale one  ? D  ASN 266 ND2 ? ? ? 1_555 AB NAG .   C1 ? ? D ASN 294  D NAG 1736 1_555 ? ? ? ? ? ? ? 1.459 ? 
N-Glycosylation 
covale23 covale both ? D  ASN 442 C   ? ? ? 1_555 D  PAQ 443 N  ? ? D ASN 470  D PAQ 471  1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale24 covale both ? D  PAQ 443 C   ? ? ? 1_555 D  ASP 444 N  ? ? D PAQ 471  D ASP 472  1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale25 covale one  ? D  ASN 564 ND2 ? ? ? 1_555 L  NAG .   C1 ? ? D ASN 592  L NAG 1    1_555 ? ? ? ? ? ? ? 1.451 ? 
N-Glycosylation 
covale26 covale one  ? D  ASN 638 ND2 ? ? ? 1_555 BB NAG .   C1 ? ? D ASN 666  D NAG 1738 1_555 ? ? ? ? ? ? ? 1.460 ? 
N-Glycosylation 
covale27 covale both ? E  NAG .   O4  ? ? ? 1_555 E  NAG .   C1 ? ? E NAG 1    E NAG 2    1_555 ? ? ? ? ? ? ? 1.384 ? ? 
covale28 covale one  ? F  NAG .   O6  ? ? ? 1_555 F  FUC .   C1 ? ? F NAG 1    F FUC 2    1_555 ? ? ? ? ? ? ? 1.394 ? ? 
covale29 covale both ? G  NAG .   O4  ? ? ? 1_555 G  NAG .   C1 ? ? G NAG 1    G NAG 2    1_555 ? ? ? ? ? ? ? 1.396 ? ? 
covale30 covale both ? G  NAG .   O4  ? ? ? 1_555 G  BMA .   C1 ? ? G NAG 2    G BMA 3    1_555 ? ? ? ? ? ? ? 1.409 ? ? 
covale31 covale both ? H  NAG .   O4  ? ? ? 1_555 H  NAG .   C1 ? ? H NAG 1    H NAG 2    1_555 ? ? ? ? ? ? ? 1.400 ? ? 
covale32 covale one  ? H  NAG .   O6  ? ? ? 1_555 H  FUC .   C1 ? ? H NAG 1    H FUC 5    1_555 ? ? ? ? ? ? ? 1.394 ? ? 
covale33 covale both ? H  NAG .   O4  ? ? ? 1_555 H  BMA .   C1 ? ? H NAG 2    H BMA 3    1_555 ? ? ? ? ? ? ? 1.386 ? ? 
covale34 covale one  ? H  BMA .   O3  ? ? ? 1_555 H  MAN .   C1 ? ? H BMA 3    H MAN 4    1_555 ? ? ? ? ? ? ? 1.411 ? ? 
covale35 covale both ? I  NAG .   O4  ? ? ? 1_555 I  NAG .   C1 ? ? I NAG 1    I NAG 2    1_555 ? ? ? ? ? ? ? 1.390 ? ? 
covale36 covale both ? J  NAG .   O4  ? ? ? 1_555 J  NAG .   C1 ? ? J NAG 1    J NAG 2    1_555 ? ? ? ? ? ? ? 1.390 ? ? 
covale37 covale one  ? J  NAG .   O6  ? ? ? 1_555 J  FUC .   C1 ? ? J NAG 1    J FUC 3    1_555 ? ? ? ? ? ? ? 1.397 ? ? 
covale38 covale both ? K  NAG .   O4  ? ? ? 1_555 K  NAG .   C1 ? ? K NAG 1    K NAG 2    1_555 ? ? ? ? ? ? ? 1.380 ? ? 
covale39 covale both ? K  NAG .   O4  ? ? ? 1_555 K  BMA .   C1 ? ? K NAG 2    K BMA 3    1_555 ? ? ? ? ? ? ? 1.400 ? ? 
covale40 covale both ? L  NAG .   O4  ? ? ? 1_555 L  NAG .   C1 ? ? L NAG 1    L NAG 2    1_555 ? ? ? ? ? ? ? 1.405 ? ? 
covale41 covale one  ? L  NAG .   O6  ? ? ? 1_555 L  FUC .   C1 ? ? L NAG 1    L FUC 5    1_555 ? ? ? ? ? ? ? 1.395 ? ? 
covale42 covale both ? L  NAG .   O4  ? ? ? 1_555 L  BMA .   C1 ? ? L NAG 2    L BMA 3    1_555 ? ? ? ? ? ? ? 1.391 ? ? 
covale43 covale one  ? L  BMA .   O3  ? ? ? 1_555 L  MAN .   C1 ? ? L BMA 3    L MAN 4    1_555 ? ? ? ? ? ? ? 1.416 ? ? 
metalc1  metalc ?    ? A  HIS 84  NE2 ? ? ? 1_555 S  CU  .   CU ? ? A HIS 112  A CU  1740 1_555 ? ? ? ? ? ? ? 2.292 ? ? 
metalc2  metalc ?    ? A  HIS 132 NE2 ? ? ? 1_555 T  CU  .   CU ? ? A HIS 160  A CU  1741 1_555 ? ? ? ? ? ? ? 2.348 ? ? 
metalc3  metalc ?    ? A  HIS 139 ND1 ? ? ? 1_555 U  CU  .   CU ? ? A HIS 167  A CU  1742 1_555 ? ? ? ? ? ? ? 2.577 ? ? 
metalc4  metalc ?    ? A  HIS 386 NE2 ? ? ? 1_555 V  CU  .   CU ? ? A HIS 414  A CU  1743 1_555 ? ? ? ? ? ? ? 2.375 ? ? 
metalc5  metalc ?    ? A  HIS 416 NE2 ? ? ? 1_555 W  CU  .   CU ? ? A HIS 444  A CU  1744 1_555 ? ? ? ? ? ? ? 2.532 ? ? 
metalc6  metalc ?    ? A  ASP 418 OD1 ? ? ? 1_555 W  CU  .   CU ? ? A ASP 446  A CU  1744 1_555 ? ? ? ? ? ? ? 2.185 ? ? 
metalc7  metalc ?    ? A  HIS 492 NE2 ? ? ? 1_555 P  CU  .   CU ? ? A HIS 520  A CU  1737 1_555 ? ? ? ? ? ? ? 2.194 ? ? 
metalc8  metalc ?    ? A  HIS 494 NE2 ? ? ? 1_555 P  CU  .   CU ? ? A HIS 522  A CU  1737 1_555 ? ? ? ? ? ? ? 2.004 ? ? 
metalc9  metalc ?    ? A  ASP 501 OD1 ? ? ? 1_555 O  CA  .   CA ? ? A ASP 529  A CA  1736 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc10 metalc ?    ? A  LEU 502 O   ? ? ? 1_555 O  CA  .   CA ? ? A LEU 530  A CA  1736 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
metalc11 metalc ?    ? A  ASP 503 OD1 ? ? ? 1_555 O  CA  .   CA ? ? A ASP 531  A CA  1736 1_555 ? ? ? ? ? ? ? 2.528 ? ? 
metalc12 metalc ?    ? A  GLU 544 OE1 ? ? ? 1_555 Q  CA  .   CA ? ? A GLU 572  A CA  1738 1_555 ? ? ? ? ? ? ? 2.235 ? ? 
metalc13 metalc ?    ? A  GLU 544 OE2 ? ? ? 1_555 Q  CA  .   CA ? ? A GLU 572  A CA  1738 1_555 ? ? ? ? ? ? ? 2.705 ? ? 
metalc14 metalc ?    ? A  LYS 610 NZ  ? ? ? 1_555 Q  CA  .   CA ? ? A LYS 638  A CA  1738 1_555 ? ? ? ? ? ? ? 2.761 ? ? 
metalc15 metalc ?    ? A  PHE 635 O   ? ? ? 1_555 Q  CA  .   CA ? ? A PHE 663  A CA  1738 1_555 ? ? ? ? ? ? ? 3.013 ? ? 
metalc16 metalc ?    ? A  ASN 637 OD1 ? ? ? 1_555 Q  CA  .   CA ? ? A ASN 665  A CA  1738 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc17 metalc ?    ? A  GLU 639 OE2 ? ? ? 1_555 Q  CA  .   CA ? ? A GLU 667  A CA  1738 1_555 ? ? ? ? ? ? ? 3.185 ? ? 
metalc18 metalc ?    ? A  ASP 645 OD1 ? ? ? 1_555 O  CA  .   CA ? ? A ASP 673  A CA  1736 1_555 ? ? ? ? ? ? ? 2.193 ? ? 
metalc19 metalc ?    ? A  LEU 646 O   ? ? ? 1_555 O  CA  .   CA ? ? A LEU 674  A CA  1736 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc20 metalc ?    ? A  HIS 656 ND1 ? ? ? 1_555 P  CU  .   CU ? ? A HIS 684  A CU  1737 1_555 ? ? ? ? ? ? ? 2.044 ? ? 
metalc21 metalc ?    ? A  HIS 659 NE2 ? ? ? 1_555 X  CU  .   CU ? ? A HIS 687  A CU  1745 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc22 metalc ?    ? P  CU  .   CU  ? ? ? 1_555 MB HOH .   O  ? ? A CU  1737 A HOH 2018 1_555 ? ? ? ? ? ? ? 2.631 ? ? 
metalc23 metalc ?    ? Q  CA  .   CA  ? ? ? 1_555 MB HOH .   O  ? ? A CA  1738 A HOH 2014 1_555 ? ? ? ? ? ? ? 2.270 ? ? 
metalc24 metalc ?    ? B  HIS 84  NE2 ? ? ? 1_555 FA CU  .   CU ? ? B HIS 112  B CU  1744 1_555 ? ? ? ? ? ? ? 2.483 ? ? 
metalc25 metalc ?    ? B  GLU 112 OE1 ? ? ? 1_555 GA CU  .   CU ? ? B GLU 140  B CU  1745 1_555 ? ? ? ? ? ? ? 2.225 ? ? 
metalc26 metalc ?    ? B  HIS 132 NE2 ? ? ? 1_555 GA CU  .   CU ? ? B HIS 160  B CU  1745 1_555 ? ? ? ? ? ? ? 2.380 ? ? 
metalc27 metalc ?    ? B  HIS 139 ND1 ? ? ? 1_555 HA CU  .   CU ? ? B HIS 167  B CU  1746 1_555 ? ? ? ? ? ? ? 2.698 ? ? 
metalc28 metalc ?    ? B  HIS 386 NE2 ? ? ? 1_555 IA CU  .   CU ? ? B HIS 414  B CU  1747 1_555 ? ? ? ? ? ? ? 2.244 ? ? 
metalc29 metalc ?    ? B  HIS 416 NE2 ? ? ? 1_555 JA CU  .   CU ? ? B HIS 444  B CU  1748 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc30 metalc ?    ? B  ASP 418 OD1 ? ? ? 1_555 JA CU  .   CU ? ? B ASP 446  B CU  1748 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc31 metalc ?    ? B  HIS 486 NE2 ? ? ? 1_555 KA CU  .   CU ? ? B HIS 514  B CU  1749 1_555 ? ? ? ? ? ? ? 2.238 ? ? 
metalc32 metalc ?    ? B  HIS 492 NE2 ? ? ? 1_555 DA CU  .   CU ? ? B HIS 520  B CU  1742 1_555 ? ? ? ? ? ? ? 2.219 ? ? 
metalc33 metalc ?    ? B  HIS 494 NE2 ? ? ? 1_555 DA CU  .   CU ? ? B HIS 522  B CU  1742 1_555 ? ? ? ? ? ? ? 2.001 ? ? 
metalc34 metalc ?    ? B  ASP 501 OD1 ? ? ? 1_555 CA CA  .   CA ? ? B ASP 529  B CA  1741 1_555 ? ? ? ? ? ? ? 2.784 ? ? 
metalc35 metalc ?    ? B  LEU 502 O   ? ? ? 1_555 CA CA  .   CA ? ? B LEU 530  B CA  1741 1_555 ? ? ? ? ? ? ? 2.194 ? ? 
metalc36 metalc ?    ? B  ASP 503 OD1 ? ? ? 1_555 CA CA  .   CA ? ? B ASP 531  B CA  1741 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc37 metalc ?    ? B  GLU 544 OE1 ? ? ? 1_555 EA CA  .   CA ? ? B GLU 572  B CA  1743 1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc38 metalc ?    ? B  GLU 544 OE2 ? ? ? 1_555 EA CA  .   CA ? ? B GLU 572  B CA  1743 1_555 ? ? ? ? ? ? ? 2.689 ? ? 
metalc39 metalc ?    ? B  PHE 635 O   ? ? ? 1_555 EA CA  .   CA ? ? B PHE 663  B CA  1743 1_555 ? ? ? ? ? ? ? 2.469 ? ? 
metalc40 metalc ?    ? B  ASN 637 OD1 ? ? ? 1_555 EA CA  .   CA ? ? B ASN 665  B CA  1743 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc41 metalc ?    ? B  GLU 639 OE1 ? ? ? 1_555 EA CA  .   CA ? ? B GLU 667  B CA  1743 1_555 ? ? ? ? ? ? ? 1.974 ? ? 
metalc42 metalc ?    ? B  ASP 645 OD1 ? ? ? 1_555 CA CA  .   CA ? ? B ASP 673  B CA  1741 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc43 metalc ?    ? B  LEU 646 O   ? ? ? 1_555 CA CA  .   CA ? ? B LEU 674  B CA  1741 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc44 metalc ?    ? B  HIS 656 ND1 ? ? ? 1_555 DA CU  .   CU ? ? B HIS 684  B CU  1742 1_555 ? ? ? ? ? ? ? 1.955 ? ? 
metalc45 metalc ?    ? B  HIS 659 NE2 ? ? ? 1_555 LA CU  .   CU ? ? B HIS 687  B CU  1750 1_555 ? ? ? ? ? ? ? 2.523 ? ? 
metalc46 metalc ?    ? DA CU  .   CU  ? ? ? 1_555 NB HOH .   O  ? ? B CU  1742 B HOH 2019 1_555 ? ? ? ? ? ? ? 2.365 ? ? 
metalc47 metalc ?    ? C  HIS 84  NE2 ? ? ? 1_555 SA CU  .   CU ? ? C HIS 112  C CU  1741 1_555 ? ? ? ? ? ? ? 2.360 ? ? 
metalc48 metalc ?    ? C  GLU 112 OE2 ? ? ? 1_555 TA CU  .   CU ? ? C GLU 140  C CU  1742 1_555 ? ? ? ? ? ? ? 2.440 ? ? 
metalc49 metalc ?    ? C  HIS 132 NE2 ? ? ? 1_555 TA CU  .   CU ? ? C HIS 160  C CU  1742 1_555 ? ? ? ? ? ? ? 2.414 ? ? 
metalc50 metalc ?    ? C  HIS 386 NE2 ? ? ? 1_555 VA CU  .   CU ? ? C HIS 414  C CU  1744 1_555 ? ? ? ? ? ? ? 2.258 ? ? 
metalc51 metalc ?    ? C  HIS 416 NE2 ? ? ? 1_555 WA CU  .   CU ? ? C HIS 444  C CU  1745 1_555 ? ? ? ? ? ? ? 2.546 ? ? 
metalc52 metalc ?    ? C  ASP 418 OD1 ? ? ? 1_555 WA CU  .   CU ? ? C ASP 446  C CU  1745 1_555 ? ? ? ? ? ? ? 2.253 ? ? 
metalc53 metalc ?    ? C  HIS 492 NE2 ? ? ? 1_555 PA CU  .   CU ? ? C HIS 520  C CU  1738 1_555 ? ? ? ? ? ? ? 2.145 ? ? 
metalc54 metalc ?    ? C  HIS 494 NE2 ? ? ? 1_555 PA CU  .   CU ? ? C HIS 522  C CU  1738 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
metalc55 metalc ?    ? C  ASP 501 OD1 ? ? ? 1_555 OA CA  .   CA ? ? C ASP 529  C CA  1737 1_555 ? ? ? ? ? ? ? 2.389 ? ? 
metalc56 metalc ?    ? C  LEU 502 O   ? ? ? 1_555 OA CA  .   CA ? ? C LEU 530  C CA  1737 1_555 ? ? ? ? ? ? ? 2.085 ? ? 
metalc57 metalc ?    ? C  ASP 503 OD1 ? ? ? 1_555 OA CA  .   CA ? ? C ASP 531  C CA  1737 1_555 ? ? ? ? ? ? ? 2.795 ? ? 
metalc58 metalc ?    ? C  GLU 544 OE2 ? ? ? 1_555 QA CA  .   CA ? ? C GLU 572  C CA  1739 1_555 ? ? ? ? ? ? ? 2.705 ? ? 
metalc59 metalc ?    ? C  GLU 544 OE1 ? ? ? 1_555 QA CA  .   CA ? ? C GLU 572  C CA  1739 1_555 ? ? ? ? ? ? ? 2.565 ? ? 
metalc60 metalc ?    ? C  HIS 565 NE2 ? ? ? 1_555 XA CU  .   CU ? ? C HIS 593  C CU  1746 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc61 metalc ?    ? C  LYS 610 NZ  ? ? ? 1_555 QA CA  .   CA ? ? C LYS 638  C CA  1739 1_555 ? ? ? ? ? ? ? 2.498 ? ? 
metalc62 metalc ?    ? C  PHE 635 O   ? ? ? 1_555 QA CA  .   CA ? ? C PHE 663  C CA  1739 1_555 ? ? ? ? ? ? ? 2.871 ? ? 
metalc63 metalc ?    ? C  ASN 637 OD1 ? ? ? 1_555 QA CA  .   CA ? ? C ASN 665  C CA  1739 1_555 ? ? ? ? ? ? ? 2.130 ? ? 
metalc64 metalc ?    ? C  ASP 645 OD1 ? ? ? 1_555 OA CA  .   CA ? ? C ASP 673  C CA  1737 1_555 ? ? ? ? ? ? ? 2.078 ? ? 
metalc65 metalc ?    ? C  LEU 646 O   ? ? ? 1_555 OA CA  .   CA ? ? C LEU 674  C CA  1737 1_555 ? ? ? ? ? ? ? 2.227 ? ? 
metalc66 metalc ?    ? C  HIS 656 ND1 ? ? ? 1_555 PA CU  .   CU ? ? C HIS 684  C CU  1738 1_555 ? ? ? ? ? ? ? 2.234 ? ? 
metalc67 metalc ?    ? C  HIS 659 NE2 ? ? ? 1_555 YA CU  .   CU ? ? C HIS 687  C CU  1747 1_555 ? ? ? ? ? ? ? 2.689 ? ? 
metalc68 metalc ?    ? D  HIS 84  NE2 ? ? ? 1_555 GB CU  .   CU ? ? D HIS 112  D CU  1745 1_555 ? ? ? ? ? ? ? 2.226 ? ? 
metalc69 metalc ?    ? D  GLU 112 OE1 ? ? ? 1_555 HB CU  .   CU ? ? D GLU 140  D CU  1746 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc70 metalc ?    ? D  HIS 386 NE2 ? ? ? 1_555 JB CU  .   CU ? ? D HIS 414  D CU  1748 1_555 ? ? ? ? ? ? ? 2.137 ? ? 
metalc71 metalc ?    ? D  ASP 418 OD1 ? ? ? 1_555 KB CU  .   CU ? ? D ASP 446  D CU  1749 1_555 ? ? ? ? ? ? ? 2.065 ? ? 
metalc72 metalc ?    ? D  HIS 492 NE2 ? ? ? 1_555 DB CU  .   CU ? ? D HIS 520  D CU  1742 1_555 ? ? ? ? ? ? ? 2.217 ? ? 
metalc73 metalc ?    ? D  HIS 494 NE2 ? ? ? 1_555 DB CU  .   CU ? ? D HIS 522  D CU  1742 1_555 ? ? ? ? ? ? ? 2.077 ? ? 
metalc74 metalc ?    ? D  ASP 501 OD1 ? ? ? 1_555 CB CA  .   CA ? ? D ASP 529  D CA  1741 1_555 ? ? ? ? ? ? ? 2.525 ? ? 
metalc75 metalc ?    ? D  LEU 502 O   ? ? ? 1_555 CB CA  .   CA ? ? D LEU 530  D CA  1741 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc76 metalc ?    ? D  ASP 503 OD1 ? ? ? 1_555 CB CA  .   CA ? ? D ASP 531  D CA  1741 1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc77 metalc ?    ? D  GLU 544 OE2 ? ? ? 1_555 EB CA  .   CA ? ? D GLU 572  D CA  1743 1_555 ? ? ? ? ? ? ? 2.454 ? ? 
metalc78 metalc ?    ? D  GLU 544 OE1 ? ? ? 1_555 EB CA  .   CA ? ? D GLU 572  D CA  1743 1_555 ? ? ? ? ? ? ? 2.508 ? ? 
metalc79 metalc ?    ? D  PHE 635 O   ? ? ? 1_555 EB CA  .   CA ? ? D PHE 663  D CA  1743 1_555 ? ? ? ? ? ? ? 2.217 ? ? 
metalc80 metalc ?    ? D  ASN 637 OD1 ? ? ? 1_555 EB CA  .   CA ? ? D ASN 665  D CA  1743 1_555 ? ? ? ? ? ? ? 2.262 ? ? 
metalc81 metalc ?    ? D  GLU 639 OE1 ? ? ? 1_555 EB CA  .   CA ? ? D GLU 667  D CA  1743 1_555 ? ? ? ? ? ? ? 2.217 ? ? 
metalc82 metalc ?    ? D  ASP 645 OD1 ? ? ? 1_555 CB CA  .   CA ? ? D ASP 673  D CA  1741 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc83 metalc ?    ? D  LEU 646 O   ? ? ? 1_555 CB CA  .   CA ? ? D LEU 674  D CA  1741 1_555 ? ? ? ? ? ? ? 2.358 ? ? 
metalc84 metalc ?    ? D  HIS 656 ND1 ? ? ? 1_555 DB CU  .   CU ? ? D HIS 684  D CU  1742 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
metalc85 metalc ?    ? D  HIS 659 NE2 ? ? ? 1_555 LB CU  .   CU ? ? D HIS 687  D CU  1750 1_555 ? ? ? ? ? ? ? 2.584 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LEU 118 A . ? LEU 146 A PRO 119 A ? PRO 147 A 1 0.42  
2  ALA 186 A . ? ALA 214 A PRO 187 A ? PRO 215 A 1 0.16  
3  ILE 663 A . ? ILE 691 A PRO 664 A ? PRO 692 A 1 2.14  
4  GLY 116 B . ? GLY 144 B PRO 117 B ? PRO 145 B 1 -0.52 
5  LEU 118 B . ? LEU 146 B PRO 119 B ? PRO 147 B 1 0.59  
6  ALA 186 B . ? ALA 214 B PRO 187 B ? PRO 215 B 1 0.52  
7  ILE 663 B . ? ILE 691 B PRO 664 B ? PRO 692 B 1 0.13  
8  GLY 116 C . ? GLY 144 C PRO 117 C ? PRO 145 C 1 -2.58 
9  LEU 118 C . ? LEU 146 C PRO 119 C ? PRO 147 C 1 0.13  
10 ALA 186 C . ? ALA 214 C PRO 187 C ? PRO 215 C 1 0.09  
11 ILE 663 C . ? ILE 691 C PRO 664 C ? PRO 692 C 1 1.40  
12 GLY 116 D . ? GLY 144 D PRO 117 D ? PRO 145 D 1 -0.57 
13 LEU 118 D . ? LEU 146 D PRO 119 D ? PRO 147 D 1 0.79  
14 ALA 186 D . ? ALA 214 D PRO 187 D ? PRO 215 D 1 0.46  
15 ILE 663 D . ? ILE 691 D PRO 664 D ? PRO 692 D 1 -0.58 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 14 ? 
AB ? 8  ? 
AC ? 6  ? 
AD ? 8  ? 
AE ? 2  ? 
AF ? 18 ? 
AG ? 16 ? 
AH ? 9  ? 
AI ? 12 ? 
AJ ? 2  ? 
AK ? 17 ? 
AL ? 22 ? 
AM ? 20 ? 
AN ? 17 ? 
AO ? 9  ? 
AP ? 5  ? 
AQ ? 3  ? 
BA ? 2  ? 
BB ? 2  ? 
BC ? 2  ? 
BD ? 6  ? 
BE ? 9  ? 
BF ? 9  ? 
BG ? 2  ? 
BH ? 15 ? 
BI ? 20 ? 
BJ ? 18 ? 
BK ? 2  ? 
BL ? 20 ? 
BM ? 5  ? 
BN ? 3  ? 
CA ? 2  ? 
CB ? 2  ? 
CC ? 6  ? 
CD ? 9  ? 
CE ? 9  ? 
CF ? 2  ? 
CG ? 15 ? 
CH ? 20 ? 
CI ? 20 ? 
CJ ? 2  ? 
CK ? 5  ? 
CL ? 3  ? 
DA ? 2  ? 
DB ? 2  ? 
DC ? 2  ? 
DD ? 6  ? 
DE ? 9  ? 
DF ? 9  ? 
DG ? 2  ? 
DH ? 15 ? 
DI ? 20 ? 
DJ ? 18 ? 
DK ? 2  ? 
DL ? 20 ? 
DM ? 5  ? 
DN ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? parallel      
AA 2  3  ? parallel      
AA 3  4  ? parallel      
AA 4  5  ? anti-parallel 
AA 5  6  ? anti-parallel 
AA 6  7  ? anti-parallel 
AA 7  8  ? anti-parallel 
AA 8  9  ? parallel      
AA 9  10 ? parallel      
AA 10 11 ? parallel      
AA 11 12 ? anti-parallel 
AA 12 13 ? anti-parallel 
AA 13 14 ? anti-parallel 
AB 1  2  ? parallel      
AB 2  3  ? parallel      
AB 3  4  ? parallel      
AB 4  5  ? anti-parallel 
AB 5  6  ? anti-parallel 
AB 6  7  ? anti-parallel 
AB 7  8  ? parallel      
AC 1  2  ? anti-parallel 
AC 2  3  ? anti-parallel 
AC 3  4  ? anti-parallel 
AC 4  5  ? anti-parallel 
AC 5  6  ? anti-parallel 
AD 1  2  ? parallel      
AD 2  3  ? parallel      
AD 3  4  ? parallel      
AD 4  5  ? anti-parallel 
AD 5  6  ? anti-parallel 
AD 6  7  ? anti-parallel 
AD 7  8  ? anti-parallel 
AE 1  2  ? anti-parallel 
AF 1  2  ? parallel      
AF 2  3  ? parallel      
AF 3  4  ? parallel      
AF 4  5  ? anti-parallel 
AF 5  6  ? anti-parallel 
AF 6  7  ? anti-parallel 
AF 7  8  ? anti-parallel 
AF 8  9  ? parallel      
AF 9  10 ? anti-parallel 
AF 10 11 ? parallel      
AF 11 12 ? parallel      
AF 12 13 ? anti-parallel 
AF 13 14 ? anti-parallel 
AF 14 15 ? anti-parallel 
AG 1  2  ? parallel      
AG 2  3  ? parallel      
AG 3  4  ? parallel      
AG 4  5  ? anti-parallel 
AG 5  6  ? anti-parallel 
AG 6  7  ? anti-parallel 
AG 7  8  ? anti-parallel 
AG 8  9  ? parallel      
AG 9  10 ? parallel      
AG 10 11 ? parallel      
AG 11 12 ? anti-parallel 
AG 12 13 ? anti-parallel 
AG 13 14 ? anti-parallel 
AG 14 15 ? parallel      
AG 15 16 ? parallel      
AH 1  2  ? anti-parallel 
AH 2  3  ? anti-parallel 
AH 3  4  ? anti-parallel 
AH 4  5  ? anti-parallel 
AH 5  6  ? anti-parallel 
AH 6  7  ? anti-parallel 
AH 7  8  ? parallel      
AH 8  9  ? parallel      
AI 1  2  ? parallel      
AI 2  3  ? parallel      
AI 3  4  ? parallel      
AI 4  5  ? anti-parallel 
AI 5  6  ? anti-parallel 
AI 6  7  ? anti-parallel 
AI 7  8  ? anti-parallel 
AI 8  9  ? parallel      
AI 9  10 ? anti-parallel 
AI 10 11 ? parallel      
AJ 1  2  ? anti-parallel 
AK 1  2  ? parallel      
AK 2  3  ? parallel      
AK 3  4  ? parallel      
AK 4  5  ? anti-parallel 
AK 5  6  ? anti-parallel 
AK 6  7  ? anti-parallel 
AK 7  8  ? anti-parallel 
AK 8  9  ? parallel      
AK 9  10 ? anti-parallel 
AK 10 11 ? parallel      
AL 1  2  ? parallel      
AL 2  3  ? parallel      
AL 3  4  ? parallel      
AL 4  5  ? anti-parallel 
AL 5  6  ? anti-parallel 
AL 6  7  ? anti-parallel 
AL 7  8  ? anti-parallel 
AL 8  9  ? parallel      
AL 9  10 ? anti-parallel 
AL 10 11 ? parallel      
AL 11 12 ? parallel      
AL 12 13 ? anti-parallel 
AL 13 14 ? anti-parallel 
AL 14 15 ? anti-parallel 
AM 1  2  ? parallel      
AM 2  3  ? parallel      
AM 3  4  ? parallel      
AM 4  5  ? anti-parallel 
AM 5  6  ? anti-parallel 
AM 6  7  ? anti-parallel 
AM 7  8  ? anti-parallel 
AM 8  9  ? parallel      
AM 9  10 ? anti-parallel 
AM 10 11 ? parallel      
AM 11 12 ? parallel      
AM 12 13 ? anti-parallel 
AM 13 14 ? anti-parallel 
AM 14 15 ? anti-parallel 
AM 15 16 ? parallel      
AM 16 17 ? parallel      
AN 1  2  ? parallel      
AN 2  3  ? parallel      
AN 3  4  ? parallel      
AN 4  5  ? anti-parallel 
AN 5  6  ? anti-parallel 
AN 6  7  ? anti-parallel 
AN 7  8  ? anti-parallel 
AN 8  9  ? parallel      
AN 9  10 ? parallel      
AN 10 11 ? parallel      
AN 11 12 ? anti-parallel 
AN 12 13 ? anti-parallel 
AN 13 14 ? anti-parallel 
AN 14 15 ? anti-parallel 
AN 15 16 ? anti-parallel 
AN 16 17 ? anti-parallel 
AO 1  2  ? anti-parallel 
AO 2  3  ? anti-parallel 
AO 3  4  ? anti-parallel 
AO 4  5  ? anti-parallel 
AO 5  6  ? anti-parallel 
AO 6  7  ? anti-parallel 
AO 7  8  ? anti-parallel 
AO 8  9  ? anti-parallel 
AP 1  2  ? anti-parallel 
AP 2  3  ? anti-parallel 
AP 3  4  ? anti-parallel 
AP 4  5  ? anti-parallel 
AQ 1  2  ? anti-parallel 
AQ 2  3  ? anti-parallel 
BA 1  2  ? parallel      
BB 1  2  ? anti-parallel 
BC 1  2  ? anti-parallel 
BD 1  2  ? anti-parallel 
BD 2  3  ? anti-parallel 
BD 3  4  ? anti-parallel 
BD 4  5  ? anti-parallel 
BD 5  6  ? anti-parallel 
BE 1  2  ? anti-parallel 
BE 2  3  ? anti-parallel 
BE 3  4  ? anti-parallel 
BE 4  5  ? anti-parallel 
BE 5  6  ? parallel      
BE 6  7  ? parallel      
BE 7  8  ? parallel      
BE 8  9  ? parallel      
BF 1  2  ? anti-parallel 
BF 2  3  ? anti-parallel 
BF 3  4  ? anti-parallel 
BF 4  5  ? anti-parallel 
BF 5  6  ? parallel      
BF 6  7  ? parallel      
BF 7  8  ? anti-parallel 
BF 8  9  ? anti-parallel 
BG 1  2  ? anti-parallel 
BH 1  2  ? anti-parallel 
BH 2  3  ? anti-parallel 
BH 3  4  ? anti-parallel 
BH 4  5  ? anti-parallel 
BH 5  6  ? parallel      
BH 6  7  ? parallel      
BH 7  8  ? anti-parallel 
BH 8  9  ? anti-parallel 
BH 9  10 ? anti-parallel 
BH 10 11 ? anti-parallel 
BH 11 12 ? anti-parallel 
BH 12 13 ? anti-parallel 
BH 13 14 ? anti-parallel 
BH 14 15 ? anti-parallel 
BI 1  2  ? anti-parallel 
BI 2  3  ? anti-parallel 
BI 3  4  ? anti-parallel 
BI 4  5  ? anti-parallel 
BI 5  6  ? parallel      
BI 6  7  ? parallel      
BI 7  8  ? anti-parallel 
BI 8  9  ? anti-parallel 
BI 9  10 ? anti-parallel 
BI 10 11 ? anti-parallel 
BI 11 12 ? anti-parallel 
BI 12 13 ? anti-parallel 
BI 13 14 ? anti-parallel 
BI 14 15 ? anti-parallel 
BI 15 16 ? anti-parallel 
BI 16 17 ? anti-parallel 
BI 17 18 ? anti-parallel 
BI 18 19 ? anti-parallel 
BI 19 20 ? anti-parallel 
BJ 1  2  ? anti-parallel 
BJ 2  3  ? anti-parallel 
BJ 3  4  ? anti-parallel 
BJ 4  5  ? anti-parallel 
BJ 5  6  ? parallel      
BJ 6  7  ? parallel      
BJ 7  8  ? anti-parallel 
BJ 8  9  ? anti-parallel 
BJ 9  10 ? anti-parallel 
BJ 10 11 ? anti-parallel 
BJ 11 12 ? anti-parallel 
BJ 12 13 ? anti-parallel 
BJ 13 14 ? anti-parallel 
BJ 14 15 ? anti-parallel 
BJ 15 16 ? anti-parallel 
BJ 16 17 ? anti-parallel 
BJ 17 18 ? parallel      
BK 1  2  ? anti-parallel 
BL 1  2  ? anti-parallel 
BL 2  3  ? anti-parallel 
BL 3  4  ? anti-parallel 
BL 4  5  ? anti-parallel 
BL 5  6  ? parallel      
BL 6  7  ? parallel      
BL 7  8  ? anti-parallel 
BL 8  9  ? anti-parallel 
BL 9  10 ? anti-parallel 
BL 10 11 ? anti-parallel 
BL 11 12 ? anti-parallel 
BL 12 13 ? anti-parallel 
BL 13 14 ? anti-parallel 
BL 14 15 ? anti-parallel 
BL 15 16 ? anti-parallel 
BL 16 17 ? anti-parallel 
BL 17 18 ? anti-parallel 
BL 18 19 ? anti-parallel 
BL 19 20 ? anti-parallel 
BM 1  2  ? anti-parallel 
BM 2  3  ? anti-parallel 
BM 3  4  ? anti-parallel 
BM 4  5  ? anti-parallel 
BN 1  2  ? anti-parallel 
BN 2  3  ? anti-parallel 
CA 1  2  ? parallel      
CB 1  2  ? anti-parallel 
CC 1  2  ? anti-parallel 
CC 2  3  ? anti-parallel 
CC 3  4  ? anti-parallel 
CC 4  5  ? parallel      
CC 5  6  ? parallel      
CD 1  2  ? anti-parallel 
CD 2  3  ? anti-parallel 
CD 3  4  ? anti-parallel 
CD 4  5  ? parallel      
CD 5  6  ? parallel      
CD 6  7  ? parallel      
CD 7  8  ? parallel      
CD 8  9  ? parallel      
CE 1  2  ? anti-parallel 
CE 2  3  ? anti-parallel 
CE 3  4  ? anti-parallel 
CE 4  5  ? parallel      
CE 5  6  ? parallel      
CE 6  7  ? parallel      
CE 7  8  ? anti-parallel 
CE 8  9  ? anti-parallel 
CF 1  2  ? parallel      
CG 1  2  ? anti-parallel 
CG 2  3  ? anti-parallel 
CG 3  4  ? anti-parallel 
CG 4  5  ? parallel      
CG 5  6  ? parallel      
CG 6  7  ? parallel      
CG 7  8  ? anti-parallel 
CG 8  9  ? anti-parallel 
CG 9  10 ? anti-parallel 
CG 10 11 ? anti-parallel 
CG 11 12 ? anti-parallel 
CG 12 13 ? anti-parallel 
CG 13 14 ? anti-parallel 
CG 14 15 ? anti-parallel 
CH 1  2  ? anti-parallel 
CH 2  3  ? anti-parallel 
CH 3  4  ? anti-parallel 
CH 4  5  ? parallel      
CH 5  6  ? parallel      
CH 6  7  ? parallel      
CH 7  8  ? anti-parallel 
CH 8  9  ? anti-parallel 
CH 9  10 ? anti-parallel 
CH 10 11 ? anti-parallel 
CH 11 12 ? anti-parallel 
CH 12 13 ? anti-parallel 
CH 13 14 ? anti-parallel 
CH 14 15 ? anti-parallel 
CH 15 16 ? anti-parallel 
CH 16 17 ? anti-parallel 
CH 17 18 ? anti-parallel 
CH 18 19 ? anti-parallel 
CH 19 20 ? parallel      
CI 1  2  ? anti-parallel 
CI 2  3  ? anti-parallel 
CI 3  4  ? anti-parallel 
CI 4  5  ? parallel      
CI 5  6  ? parallel      
CI 6  7  ? parallel      
CI 7  8  ? anti-parallel 
CI 8  9  ? anti-parallel 
CI 9  10 ? anti-parallel 
CI 10 11 ? anti-parallel 
CI 11 12 ? anti-parallel 
CI 12 13 ? anti-parallel 
CI 13 14 ? anti-parallel 
CI 14 15 ? anti-parallel 
CI 15 16 ? anti-parallel 
CI 16 17 ? anti-parallel 
CI 17 18 ? anti-parallel 
CI 18 19 ? anti-parallel 
CI 19 20 ? anti-parallel 
CJ 1  2  ? anti-parallel 
CK 1  2  ? anti-parallel 
CK 2  3  ? anti-parallel 
CK 3  4  ? anti-parallel 
CK 4  5  ? anti-parallel 
CL 1  2  ? anti-parallel 
CL 2  3  ? anti-parallel 
DA 1  2  ? parallel      
DB 1  2  ? anti-parallel 
DC 1  2  ? anti-parallel 
DD 1  2  ? anti-parallel 
DD 2  3  ? anti-parallel 
DD 3  4  ? anti-parallel 
DD 4  5  ? anti-parallel 
DD 5  6  ? anti-parallel 
DE 1  2  ? anti-parallel 
DE 2  3  ? anti-parallel 
DE 3  4  ? anti-parallel 
DE 4  5  ? anti-parallel 
DE 5  6  ? parallel      
DE 6  7  ? parallel      
DE 7  8  ? parallel      
DE 8  9  ? parallel      
DF 1  2  ? anti-parallel 
DF 2  3  ? anti-parallel 
DF 3  4  ? anti-parallel 
DF 4  5  ? anti-parallel 
DF 5  6  ? parallel      
DF 6  7  ? parallel      
DF 7  8  ? anti-parallel 
DF 8  9  ? anti-parallel 
DG 1  2  ? anti-parallel 
DH 1  2  ? anti-parallel 
DH 2  3  ? anti-parallel 
DH 3  4  ? anti-parallel 
DH 4  5  ? anti-parallel 
DH 5  6  ? parallel      
DH 6  7  ? parallel      
DH 7  8  ? anti-parallel 
DH 8  9  ? anti-parallel 
DH 9  10 ? anti-parallel 
DH 10 11 ? anti-parallel 
DH 11 12 ? anti-parallel 
DH 12 13 ? anti-parallel 
DH 13 14 ? anti-parallel 
DH 14 15 ? anti-parallel 
DI 1  2  ? anti-parallel 
DI 2  3  ? anti-parallel 
DI 3  4  ? anti-parallel 
DI 4  5  ? anti-parallel 
DI 5  6  ? parallel      
DI 6  7  ? parallel      
DI 7  8  ? anti-parallel 
DI 8  9  ? anti-parallel 
DI 9  10 ? anti-parallel 
DI 10 11 ? anti-parallel 
DI 11 12 ? anti-parallel 
DI 12 13 ? anti-parallel 
DI 13 14 ? anti-parallel 
DI 14 15 ? anti-parallel 
DI 15 16 ? anti-parallel 
DI 16 17 ? anti-parallel 
DI 17 18 ? anti-parallel 
DI 18 19 ? anti-parallel 
DI 19 20 ? anti-parallel 
DJ 1  2  ? anti-parallel 
DJ 2  3  ? anti-parallel 
DJ 3  4  ? anti-parallel 
DJ 4  5  ? anti-parallel 
DJ 5  6  ? parallel      
DJ 6  7  ? parallel      
DJ 7  8  ? anti-parallel 
DJ 8  9  ? anti-parallel 
DJ 9  10 ? anti-parallel 
DJ 10 11 ? anti-parallel 
DJ 11 12 ? anti-parallel 
DJ 12 13 ? anti-parallel 
DJ 13 14 ? anti-parallel 
DJ 14 15 ? anti-parallel 
DJ 15 16 ? anti-parallel 
DJ 16 17 ? anti-parallel 
DJ 17 18 ? parallel      
DK 1  2  ? anti-parallel 
DL 1  2  ? anti-parallel 
DL 2  3  ? anti-parallel 
DL 3  4  ? anti-parallel 
DL 4  5  ? anti-parallel 
DL 5  6  ? parallel      
DL 6  7  ? parallel      
DL 7  8  ? anti-parallel 
DL 8  9  ? anti-parallel 
DL 9  10 ? anti-parallel 
DL 10 11 ? anti-parallel 
DL 11 12 ? anti-parallel 
DL 12 13 ? anti-parallel 
DL 13 14 ? anti-parallel 
DL 14 15 ? anti-parallel 
DL 15 16 ? anti-parallel 
DL 16 17 ? anti-parallel 
DL 17 18 ? anti-parallel 
DL 18 19 ? anti-parallel 
DL 19 20 ? anti-parallel 
DM 1  2  ? anti-parallel 
DM 2  3  ? anti-parallel 
DM 3  4  ? anti-parallel 
DM 4  5  ? anti-parallel 
DN 1  2  ? anti-parallel 
DN 2  3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  MET A 124 ? ASP A 126 ? MET A 152 ASP A 154 
AA 2  ASN A 109 ? VAL A 115 ? ASN A 137 VAL A 143 
AA 3  GLU A 95  ? PHE A 102 ? GLU A 123 PHE A 130 
AA 4  ASN A 66  ? GLN A 74  ? ASN A 94  GLN A 102 
AA 5  THR A 381 ? LEU A 389 ? THR A 409 LEU A 417 
AA 6  LYS A 395 ? HIS A 416 ? LYS A 423 HIS A 444 
AA 7  TYR A 423 ? LEU A 440 ? TYR A 451 LEU A 468 
AA 8  VAL A 450 ? PHE A 451 ? VAL A 478 PHE A 479 
AA 9  ILE A 457 ? GLY A 465 ? ILE A 485 GLY A 493 
AA 10 VAL A 673 ? TYR A 680 ? VAL A 701 TYR A 708 
AA 11 PRO A 572 ? LEU A 580 ? PRO A 600 LEU A 608 
AA 12 TYR A 558 ? SER A 566 ? TYR A 586 SER A 594 
AA 13 GLU A 508 ? PRO A 520 ? GLU A 536 PRO A 548 
AA 14 GLN A 532 ? LEU A 541 ? GLN A 560 LEU A 569 
AB 1  MET A 124 ? ASP A 126 ? MET A 152 ASP A 154 
AB 2  ASN A 109 ? VAL A 115 ? ASN A 137 VAL A 143 
AB 3  GLU A 95  ? PHE A 102 ? GLU A 123 PHE A 130 
AB 4  ASN A 66  ? GLN A 74  ? ASN A 94  GLN A 102 
AB 5  THR A 381 ? LEU A 389 ? THR A 409 LEU A 417 
AB 6  LYS A 395 ? HIS A 416 ? LYS A 423 HIS A 444 
AB 7  TYR A 423 ? LEU A 440 ? TYR A 451 LEU A 468 
AB 8  ILE A 695 ? ARG A 698 ? ILE A 723 ARG A 726 
AC 1  PHE A 295 ? GLN A 298 ? PHE A 323 GLN A 326 
AC 2  ARG A 301 ? SER A 304 ? ARG A 329 SER A 332 
AC 3  TRP A 307 ? GLY A 314 ? TRP A 335 GLY A 342 
AC 4  GLY A 318 ? PHE A 326 ? GLY A 346 PHE A 354 
AC 5  GLU A 329 ? TYR A 344 ? GLU A 357 TYR A 372 
AC 6  ARG A 355 ? TYR A 356 ? ARG A 383 TYR A 384 
AD 1  MET A 124 ? ASP A 126 ? MET A 152 ASP A 154 
AD 2  ASN A 109 ? VAL A 115 ? ASN A 137 VAL A 143 
AD 3  GLU A 95  ? PHE A 102 ? GLU A 123 PHE A 130 
AD 4  ASN A 66  ? GLN A 74  ? ASN A 94  GLN A 102 
AD 5  THR A 381 ? LEU A 389 ? THR A 409 LEU A 417 
AD 6  LYS A 395 ? HIS A 416 ? LYS A 423 HIS A 444 
AD 7  TYR A 423 ? LEU A 440 ? TYR A 451 LEU A 468 
AD 8  THR A 367 ? THR A 368 ? THR A 395 THR A 396 
AE 1  ARG A 355 ? TYR A 356 ? ARG A 383 TYR A 384 
AE 2  GLU A 329 ? TYR A 344 ? GLU A 357 TYR A 372 
AF 1  MET A 124 ? ASP A 126 ? MET A 152 ASP A 154 
AF 2  ASN A 109 ? VAL A 115 ? ASN A 137 VAL A 143 
AF 3  GLU A 95  ? PHE A 102 ? GLU A 123 PHE A 130 
AF 4  ASN A 66  ? GLN A 74  ? ASN A 94  GLN A 102 
AF 5  THR A 381 ? LEU A 389 ? THR A 409 LEU A 417 
AF 6  LYS A 395 ? HIS A 416 ? LYS A 423 HIS A 444 
AF 7  TYR A 423 ? LEU A 440 ? TYR A 451 LEU A 468 
AF 8  VAL A 450 ? PHE A 451 ? VAL A 478 PHE A 479 
AF 9  ILE A 457 ? GLY A 465 ? ILE A 485 GLY A 493 
AF 10 PAQ A 443 ? TRP A 447 ? PAQ A 471 TRP A 475 
AF 11 VAL A 673 ? TYR A 680 ? VAL A 701 TYR A 708 
AF 12 PRO A 572 ? LEU A 580 ? PRO A 600 LEU A 608 
AF 13 TYR A 558 ? SER A 566 ? TYR A 586 SER A 594 
AF 14 GLU A 508 ? PRO A 520 ? GLU A 536 PRO A 548 
AF 15 GLN A 532 ? LEU A 541 ? GLN A 560 LEU A 569 
AG 1  MET A 124 ? ASP A 126 ? MET A 152 ASP A 154 
AG 2  ASN A 109 ? VAL A 115 ? ASN A 137 VAL A 143 
AG 3  GLU A 95  ? PHE A 102 ? GLU A 123 PHE A 130 
AG 4  ASN A 66  ? GLN A 74  ? ASN A 94  GLN A 102 
AG 5  THR A 381 ? LEU A 389 ? THR A 409 LEU A 417 
AG 6  LYS A 395 ? HIS A 416 ? LYS A 423 HIS A 444 
AG 7  TYR A 423 ? LEU A 440 ? TYR A 451 LEU A 468 
AG 8  VAL A 450 ? PHE A 451 ? VAL A 478 PHE A 479 
AG 9  ILE A 457 ? GLY A 465 ? ILE A 485 GLY A 493 
AG 10 VAL A 673 ? TYR A 680 ? VAL A 701 TYR A 708 
AG 11 PRO A 572 ? LEU A 580 ? PRO A 600 LEU A 608 
AG 12 TYR A 558 ? SER A 566 ? TYR A 586 SER A 594 
AG 13 GLU A 508 ? PRO A 520 ? GLU A 536 PRO A 548 
AG 14 LYS A 644 ? HIS A 656 ? LYS A 672 HIS A 684 
AG 15 TYR A 602 ? GLN A 608 ? TYR A 630 GLN A 636 
AG 16 PHE A 549 ? LEU A 550 ? PHE A 577 LEU A 578 
AH 1  PHE A 295 ? GLN A 298 ? PHE A 323 GLN A 326 
AH 2  ARG A 301 ? SER A 304 ? ARG A 329 SER A 332 
AH 3  TRP A 307 ? GLY A 314 ? TRP A 335 GLY A 342 
AH 4  GLY A 318 ? PHE A 326 ? GLY A 346 PHE A 354 
AH 5  GLU A 329 ? TYR A 344 ? GLU A 357 TYR A 372 
AH 6  HIS A 492 ? LEU A 502 ? HIS A 520 LEU A 530 
AH 7  LYS A 644 ? HIS A 656 ? LYS A 672 HIS A 684 
AH 8  TYR A 602 ? GLN A 608 ? TYR A 630 GLN A 636 
AH 9  PHE A 549 ? LEU A 550 ? PHE A 577 LEU A 578 
AI 1  MET A 124 ? ASP A 126 ? MET A 152 ASP A 154 
AI 2  ASN A 109 ? VAL A 115 ? ASN A 137 VAL A 143 
AI 3  GLU A 95  ? PHE A 102 ? GLU A 123 PHE A 130 
AI 4  ASN A 66  ? GLN A 74  ? ASN A 94  GLN A 102 
AI 5  THR A 381 ? LEU A 389 ? THR A 409 LEU A 417 
AI 6  LYS A 395 ? HIS A 416 ? LYS A 423 HIS A 444 
AI 7  TYR A 423 ? LEU A 440 ? TYR A 451 LEU A 468 
AI 8  VAL A 450 ? PHE A 451 ? VAL A 478 PHE A 479 
AI 9  ILE A 457 ? GLY A 465 ? ILE A 485 GLY A 493 
AI 10 PAQ A 443 ? TRP A 447 ? PAQ A 471 TRP A 475 
AI 11 ILE A 695 ? ARG A 698 ? ILE A 723 ARG A 726 
AJ 1  GLN A 532 ? LEU A 541 ? GLN A 560 LEU A 569 
AJ 2  GLU A 508 ? PRO A 520 ? GLU A 536 PRO A 548 
AK 1  MET A 124 ? ASP A 126 ? MET A 152 ASP A 154 
AK 2  ASN A 109 ? VAL A 115 ? ASN A 137 VAL A 143 
AK 3  GLU A 95  ? PHE A 102 ? GLU A 123 PHE A 130 
AK 4  ASN A 66  ? GLN A 74  ? ASN A 94  GLN A 102 
AK 5  THR A 381 ? LEU A 389 ? THR A 409 LEU A 417 
AK 6  LYS A 395 ? HIS A 416 ? LYS A 423 HIS A 444 
AK 7  TYR A 423 ? LEU A 440 ? TYR A 451 LEU A 468 
AK 8  VAL A 450 ? PHE A 451 ? VAL A 478 PHE A 479 
AK 9  ILE A 457 ? GLY A 465 ? ILE A 485 GLY A 493 
AK 10 PAQ A 443 ? TRP A 447 ? PAQ A 471 TRP A 475 
AK 11 MET A 124 ? ASP A 126 ? MET A 152 ASP A 154 
AL 1  MET A 124 ? ASP A 126 ? MET A 152 ASP A 154 
AL 2  ASN A 109 ? VAL A 115 ? ASN A 137 VAL A 143 
AL 3  GLU A 95  ? PHE A 102 ? GLU A 123 PHE A 130 
AL 4  ASN A 66  ? GLN A 74  ? ASN A 94  GLN A 102 
AL 5  THR A 381 ? LEU A 389 ? THR A 409 LEU A 417 
AL 6  LYS A 395 ? HIS A 416 ? LYS A 423 HIS A 444 
AL 7  TYR A 423 ? LEU A 440 ? TYR A 451 LEU A 468 
AL 8  VAL A 450 ? PHE A 451 ? VAL A 478 PHE A 479 
AL 9  ILE A 457 ? GLY A 465 ? ILE A 485 GLY A 493 
AL 10 PAQ A 443 ? TRP A 447 ? PAQ A 471 TRP A 475 
AL 11 VAL A 673 ? TYR A 680 ? VAL A 701 TYR A 708 
AL 12 PRO A 572 ? LEU A 580 ? PRO A 600 LEU A 608 
AL 13 TYR A 558 ? SER A 566 ? TYR A 586 SER A 594 
AL 14 GLU A 508 ? PRO A 520 ? GLU A 536 PRO A 548 
AL 15 GLN A 532 ? LEU A 541 ? GLN A 560 LEU A 569 
AM 1  MET A 124 ? ASP A 126 ? MET A 152 ASP A 154 
AM 2  ASN A 109 ? VAL A 115 ? ASN A 137 VAL A 143 
AM 3  GLU A 95  ? PHE A 102 ? GLU A 123 PHE A 130 
AM 4  ASN A 66  ? GLN A 74  ? ASN A 94  GLN A 102 
AM 5  THR A 381 ? LEU A 389 ? THR A 409 LEU A 417 
AM 6  LYS A 395 ? HIS A 416 ? LYS A 423 HIS A 444 
AM 7  TYR A 423 ? LEU A 440 ? TYR A 451 LEU A 468 
AM 8  VAL A 450 ? PHE A 451 ? VAL A 478 PHE A 479 
AM 9  ILE A 457 ? GLY A 465 ? ILE A 485 GLY A 493 
AM 10 PAQ A 443 ? TRP A 447 ? PAQ A 471 TRP A 475 
AM 11 VAL A 673 ? TYR A 680 ? VAL A 701 TYR A 708 
AM 12 PRO A 572 ? LEU A 580 ? PRO A 600 LEU A 608 
AM 13 TYR A 558 ? SER A 566 ? TYR A 586 SER A 594 
AM 14 GLU A 508 ? PRO A 520 ? GLU A 536 PRO A 548 
AM 15 LYS A 644 ? HIS A 656 ? LYS A 672 HIS A 684 
AM 16 TYR A 602 ? GLN A 608 ? TYR A 630 GLN A 636 
AM 17 PHE A 549 ? LEU A 550 ? PHE A 577 LEU A 578 
AN 1  MET A 124 ? ASP A 126 ? MET A 152 ASP A 154 
AN 2  ASN A 109 ? VAL A 115 ? ASN A 137 VAL A 143 
AN 3  GLU A 95  ? PHE A 102 ? GLU A 123 PHE A 130 
AN 4  ASN A 66  ? GLN A 74  ? ASN A 94  GLN A 102 
AN 5  THR A 381 ? LEU A 389 ? THR A 409 LEU A 417 
AN 6  LYS A 395 ? HIS A 416 ? LYS A 423 HIS A 444 
AN 7  TYR A 423 ? LEU A 440 ? TYR A 451 LEU A 468 
AN 8  VAL A 450 ? PHE A 451 ? VAL A 478 PHE A 479 
AN 9  ILE A 457 ? GLY A 465 ? ILE A 485 GLY A 493 
AN 10 VAL A 673 ? TYR A 680 ? VAL A 701 TYR A 708 
AN 11 PRO A 572 ? LEU A 580 ? PRO A 600 LEU A 608 
AN 12 TYR A 558 ? SER A 566 ? TYR A 586 SER A 594 
AN 13 GLU A 508 ? PRO A 520 ? GLU A 536 PRO A 548 
AN 14 LYS A 644 ? HIS A 656 ? LYS A 672 HIS A 684 
AN 15 HIS A 492 ? LEU A 502 ? HIS A 520 LEU A 530 
AN 16 GLU A 329 ? TYR A 344 ? GLU A 357 TYR A 372 
AN 17 ARG A 355 ? TYR A 356 ? ARG A 383 TYR A 384 
AO 1  PHE A 295 ? GLN A 298 ? PHE A 323 GLN A 326 
AO 2  ARG A 301 ? SER A 304 ? ARG A 329 SER A 332 
AO 3  TRP A 307 ? GLY A 314 ? TRP A 335 GLY A 342 
AO 4  GLY A 318 ? PHE A 326 ? GLY A 346 PHE A 354 
AO 5  GLU A 329 ? TYR A 344 ? GLU A 357 TYR A 372 
AO 6  HIS A 492 ? LEU A 502 ? HIS A 520 LEU A 530 
AO 7  LYS A 644 ? HIS A 656 ? LYS A 672 HIS A 684 
AO 8  GLU A 508 ? PRO A 520 ? GLU A 536 PRO A 548 
AO 9  GLN A 532 ? LEU A 541 ? GLN A 560 LEU A 569 
AP 1  LEU A 180 ? MET A 183 ? LEU A 208 MET A 211 
AP 2  THR A 197 ? TYR A 203 ? THR A 225 TYR A 231 
AP 3  HIS A 214 ? ASN A 222 ? HIS A 242 ASN A 250 
AP 4  THR A 232 ? TYR A 238 ? THR A 260 TYR A 266 
AP 5  ARG A 241 ? TYR A 243 ? ARG A 269 TYR A 271 
AQ 1  SER A 469 ? PHE A 471 ? SER A 497 PHE A 499 
AQ 2  THR A 487 ? THR A 490 ? THR A 515 THR A 518 
AQ 3  GLY A 480 ? SER A 484 ? GLY A 508 SER A 512 
BA 1  LEU B 55  ? VAL B 56  ? LEU B 83  VAL B 84  
BA 2  ASN B 66  ? GLN B 74  ? ASN B 94  GLN B 102 
BB 1  TYR B 123 ? ASP B 126 ? TYR B 151 ASP B 154 
BB 2  ASN B 109 ? GLY B 116 ? ASN B 137 GLY B 144 
BC 1  LEU B 136 ? PRO B 137 ? LEU B 164 PRO B 165 
BC 2  ASN B 109 ? GLY B 116 ? ASN B 137 GLY B 144 
BD 1  PHE B 295 ? GLN B 298 ? PHE B 323 GLN B 326 
BD 2  ARG B 301 ? SER B 304 ? ARG B 329 SER B 332 
BD 3  TRP B 307 ? LEU B 313 ? TRP B 335 LEU B 341 
BD 4  PRO B 319 ? PHE B 326 ? PRO B 347 PHE B 354 
BD 5  GLU B 329 ? TYR B 344 ? GLU B 357 TYR B 372 
BD 6  ARG B 355 ? TYR B 356 ? ARG B 383 TYR B 384 
BE 1  PHE B 295 ? GLN B 298 ? PHE B 323 GLN B 326 
BE 2  ARG B 301 ? SER B 304 ? ARG B 329 SER B 332 
BE 3  TRP B 307 ? LEU B 313 ? TRP B 335 LEU B 341 
BE 4  PRO B 319 ? PHE B 326 ? PRO B 347 PHE B 354 
BE 5  GLU B 329 ? TYR B 344 ? GLU B 357 TYR B 372 
BE 6  HIS B 492 ? LEU B 502 ? HIS B 520 LEU B 530 
BE 7  ALA B 642 ? HIS B 656 ? ALA B 670 HIS B 684 
BE 8  TYR B 602 ? GLN B 608 ? TYR B 630 GLN B 636 
BE 9  ALA B 548 ? LEU B 550 ? ALA B 576 LEU B 578 
BF 1  PHE B 295 ? GLN B 298 ? PHE B 323 GLN B 326 
BF 2  ARG B 301 ? SER B 304 ? ARG B 329 SER B 332 
BF 3  TRP B 307 ? LEU B 313 ? TRP B 335 LEU B 341 
BF 4  PRO B 319 ? PHE B 326 ? PRO B 347 PHE B 354 
BF 5  GLU B 329 ? TYR B 344 ? GLU B 357 TYR B 372 
BF 6  HIS B 492 ? LEU B 502 ? HIS B 520 LEU B 530 
BF 7  ALA B 642 ? HIS B 656 ? ALA B 670 HIS B 684 
BF 8  GLU B 508 ? VAL B 523 ? GLU B 536 VAL B 551 
BF 9  SER B 526 ? LEU B 541 ? SER B 554 LEU B 569 
BG 1  ARG B 355 ? TYR B 356 ? ARG B 383 TYR B 384 
BG 2  GLU B 329 ? TYR B 344 ? GLU B 357 TYR B 372 
BH 1  PHE B 295 ? GLN B 298 ? PHE B 323 GLN B 326 
BH 2  ARG B 301 ? SER B 304 ? ARG B 329 SER B 332 
BH 3  TRP B 307 ? LEU B 313 ? TRP B 335 LEU B 341 
BH 4  PRO B 319 ? PHE B 326 ? PRO B 347 PHE B 354 
BH 5  GLU B 329 ? TYR B 344 ? GLU B 357 TYR B 372 
BH 6  HIS B 492 ? LEU B 502 ? HIS B 520 LEU B 530 
BH 7  ALA B 642 ? HIS B 656 ? ALA B 670 HIS B 684 
BH 8  GLU B 508 ? VAL B 523 ? GLU B 536 VAL B 551 
BH 9  TYR B 558 ? ASN B 567 ? TYR B 586 ASN B 595 
BH 10 HIS B 571 ? LEU B 580 ? HIS B 599 LEU B 608 
BH 11 GLY B 672 ? TYR B 680 ? GLY B 700 TYR B 708 
BH 12 ILE B 457 ? GLY B 465 ? ILE B 485 GLY B 493 
BH 13 PAQ B 443 ? PHE B 451 ? PAQ B 471 PHE B 479 
BH 14 TYR B 423 ? LEU B 440 ? TYR B 451 LEU B 468 
BH 15 ILE B 695 ? PHE B 697 ? ILE B 723 PHE B 725 
BI 1  PHE B 295 ? GLN B 298 ? PHE B 323 GLN B 326 
BI 2  ARG B 301 ? SER B 304 ? ARG B 329 SER B 332 
BI 3  TRP B 307 ? LEU B 313 ? TRP B 335 LEU B 341 
BI 4  PRO B 319 ? PHE B 326 ? PRO B 347 PHE B 354 
BI 5  GLU B 329 ? TYR B 344 ? GLU B 357 TYR B 372 
BI 6  HIS B 492 ? LEU B 502 ? HIS B 520 LEU B 530 
BI 7  ALA B 642 ? HIS B 656 ? ALA B 670 HIS B 684 
BI 8  GLU B 508 ? VAL B 523 ? GLU B 536 VAL B 551 
BI 9  TYR B 558 ? ASN B 567 ? TYR B 586 ASN B 595 
BI 10 HIS B 571 ? LEU B 580 ? HIS B 599 LEU B 608 
BI 11 GLY B 672 ? TYR B 680 ? GLY B 700 TYR B 708 
BI 12 ILE B 457 ? GLY B 465 ? ILE B 485 GLY B 493 
BI 13 PAQ B 443 ? PHE B 451 ? PAQ B 471 PHE B 479 
BI 14 TYR B 423 ? LEU B 440 ? TYR B 451 LEU B 468 
BI 15 LYS B 395 ? SER B 417 ? LYS B 423 SER B 445 
BI 16 THR B 381 ? LEU B 389 ? THR B 409 LEU B 417 
BI 17 ASN B 66  ? GLN B 74  ? ASN B 94  GLN B 102 
BI 18 GLU B 95  ? PHE B 102 ? GLU B 123 PHE B 130 
BI 19 ASN B 109 ? GLY B 116 ? ASN B 137 GLY B 144 
BI 20 TYR B 123 ? ASP B 126 ? TYR B 151 ASP B 154 
BJ 1  PHE B 295 ? GLN B 298 ? PHE B 323 GLN B 326 
BJ 2  ARG B 301 ? SER B 304 ? ARG B 329 SER B 332 
BJ 3  TRP B 307 ? LEU B 313 ? TRP B 335 LEU B 341 
BJ 4  PRO B 319 ? PHE B 326 ? PRO B 347 PHE B 354 
BJ 5  GLU B 329 ? TYR B 344 ? GLU B 357 TYR B 372 
BJ 6  HIS B 492 ? LEU B 502 ? HIS B 520 LEU B 530 
BJ 7  ALA B 642 ? HIS B 656 ? ALA B 670 HIS B 684 
BJ 8  GLU B 508 ? VAL B 523 ? GLU B 536 VAL B 551 
BJ 9  TYR B 558 ? ASN B 567 ? TYR B 586 ASN B 595 
BJ 10 HIS B 571 ? LEU B 580 ? HIS B 599 LEU B 608 
BJ 11 GLY B 672 ? TYR B 680 ? GLY B 700 TYR B 708 
BJ 12 ILE B 457 ? GLY B 465 ? ILE B 485 GLY B 493 
BJ 13 PAQ B 443 ? PHE B 451 ? PAQ B 471 PHE B 479 
BJ 14 TYR B 423 ? LEU B 440 ? TYR B 451 LEU B 468 
BJ 15 LYS B 395 ? SER B 417 ? LYS B 423 SER B 445 
BJ 16 THR B 381 ? LEU B 389 ? THR B 409 LEU B 417 
BJ 17 ASN B 66  ? GLN B 74  ? ASN B 94  GLN B 102 
BJ 18 LEU B 55  ? VAL B 56  ? LEU B 83  VAL B 84  
BK 1  ILE B 695 ? PHE B 697 ? ILE B 723 PHE B 725 
BK 2  TYR B 423 ? LEU B 440 ? TYR B 451 LEU B 468 
BL 1  PHE B 295 ? GLN B 298 ? PHE B 323 GLN B 326 
BL 2  ARG B 301 ? SER B 304 ? ARG B 329 SER B 332 
BL 3  TRP B 307 ? LEU B 313 ? TRP B 335 LEU B 341 
BL 4  PRO B 319 ? PHE B 326 ? PRO B 347 PHE B 354 
BL 5  GLU B 329 ? TYR B 344 ? GLU B 357 TYR B 372 
BL 6  HIS B 492 ? LEU B 502 ? HIS B 520 LEU B 530 
BL 7  ALA B 642 ? HIS B 656 ? ALA B 670 HIS B 684 
BL 8  GLU B 508 ? VAL B 523 ? GLU B 536 VAL B 551 
BL 9  TYR B 558 ? ASN B 567 ? TYR B 586 ASN B 595 
BL 10 HIS B 571 ? LEU B 580 ? HIS B 599 LEU B 608 
BL 11 GLY B 672 ? TYR B 680 ? GLY B 700 TYR B 708 
BL 12 ILE B 457 ? GLY B 465 ? ILE B 485 GLY B 493 
BL 13 PAQ B 443 ? PHE B 451 ? PAQ B 471 PHE B 479 
BL 14 TYR B 423 ? LEU B 440 ? TYR B 451 LEU B 468 
BL 15 LYS B 395 ? SER B 417 ? LYS B 423 SER B 445 
BL 16 THR B 381 ? LEU B 389 ? THR B 409 LEU B 417 
BL 17 ASN B 66  ? GLN B 74  ? ASN B 94  GLN B 102 
BL 18 GLU B 95  ? PHE B 102 ? GLU B 123 PHE B 130 
BL 19 ASN B 109 ? GLY B 116 ? ASN B 137 GLY B 144 
BL 20 LEU B 136 ? PRO B 137 ? LEU B 164 PRO B 165 
BM 1  LEU B 180 ? MET B 183 ? LEU B 208 MET B 211 
BM 2  ALA B 196 ? TYR B 203 ? ALA B 224 TYR B 231 
BM 3  HIS B 214 ? ASN B 222 ? HIS B 242 ASN B 250 
BM 4  THR B 232 ? TYR B 238 ? THR B 260 TYR B 266 
BM 5  ARG B 241 ? TYR B 243 ? ARG B 269 TYR B 271 
BN 1  SER B 469 ? PHE B 471 ? SER B 497 PHE B 499 
BN 2  THR B 487 ? THR B 490 ? THR B 515 THR B 518 
BN 3  GLY B 480 ? SER B 484 ? GLY B 508 SER B 512 
CA 1  TYR C 123 ? ASP C 126 ? TYR C 151 ASP C 154 
CA 2  ASN C 109 ? GLY C 116 ? ASN C 137 GLY C 144 
CB 1  LEU C 136 ? PRO C 137 ? LEU C 164 PRO C 165 
CB 2  ASN C 109 ? GLY C 116 ? ASN C 137 GLY C 144 
CC 1  PHE C 295 ? GLN C 298 ? PHE C 323 GLN C 326 
CC 2  ARG C 301 ? SER C 304 ? ARG C 329 SER C 332 
CC 3  TRP C 307 ? GLY C 314 ? TRP C 335 GLY C 342 
CC 4  GLY C 318 ? PHE C 326 ? GLY C 346 PHE C 354 
CC 5  GLU C 329 ? TYR C 344 ? GLU C 357 TYR C 372 
CC 6  ARG C 355 ? TYR C 356 ? ARG C 383 TYR C 384 
CD 1  PHE C 295 ? GLN C 298 ? PHE C 323 GLN C 326 
CD 2  ARG C 301 ? SER C 304 ? ARG C 329 SER C 332 
CD 3  TRP C 307 ? GLY C 314 ? TRP C 335 GLY C 342 
CD 4  GLY C 318 ? PHE C 326 ? GLY C 346 PHE C 354 
CD 5  GLU C 329 ? TYR C 344 ? GLU C 357 TYR C 372 
CD 6  HIS C 492 ? LEU C 502 ? HIS C 520 LEU C 530 
CD 7  LYS C 644 ? HIS C 656 ? LYS C 672 HIS C 684 
CD 8  TYR C 602 ? GLN C 608 ? TYR C 630 GLN C 636 
CD 9  PHE C 549 ? LEU C 550 ? PHE C 577 LEU C 578 
CE 1  PHE C 295 ? GLN C 298 ? PHE C 323 GLN C 326 
CE 2  ARG C 301 ? SER C 304 ? ARG C 329 SER C 332 
CE 3  TRP C 307 ? GLY C 314 ? TRP C 335 GLY C 342 
CE 4  GLY C 318 ? PHE C 326 ? GLY C 346 PHE C 354 
CE 5  GLU C 329 ? TYR C 344 ? GLU C 357 TYR C 372 
CE 6  HIS C 492 ? LEU C 502 ? HIS C 520 LEU C 530 
CE 7  LYS C 644 ? HIS C 656 ? LYS C 672 HIS C 684 
CE 8  GLU C 508 ? PRO C 520 ? GLU C 536 PRO C 548 
CE 9  GLN C 532 ? LEU C 541 ? GLN C 560 LEU C 569 
CF 1  ARG C 355 ? TYR C 356 ? ARG C 383 TYR C 384 
CF 2  GLU C 329 ? TYR C 344 ? GLU C 357 TYR C 372 
CG 1  PHE C 295 ? GLN C 298 ? PHE C 323 GLN C 326 
CG 2  ARG C 301 ? SER C 304 ? ARG C 329 SER C 332 
CG 3  TRP C 307 ? GLY C 314 ? TRP C 335 GLY C 342 
CG 4  GLY C 318 ? PHE C 326 ? GLY C 346 PHE C 354 
CG 5  GLU C 329 ? TYR C 344 ? GLU C 357 TYR C 372 
CG 6  HIS C 492 ? LEU C 502 ? HIS C 520 LEU C 530 
CG 7  LYS C 644 ? HIS C 656 ? LYS C 672 HIS C 684 
CG 8  GLU C 508 ? PRO C 520 ? GLU C 536 PRO C 548 
CG 9  TYR C 558 ? SER C 566 ? TYR C 586 SER C 594 
CG 10 PRO C 572 ? LEU C 580 ? PRO C 600 LEU C 608 
CG 11 VAL C 673 ? TYR C 680 ? VAL C 701 TYR C 708 
CG 12 ILE C 457 ? GLY C 465 ? ILE C 485 GLY C 493 
CG 13 PAQ C 443 ? PHE C 451 ? PAQ C 471 PHE C 479 
CG 14 TYR C 423 ? LEU C 440 ? TYR C 451 LEU C 468 
CG 15 ILE C 695 ? ARG C 698 ? ILE C 723 ARG C 726 
CH 1  PHE C 295 ? GLN C 298 ? PHE C 323 GLN C 326 
CH 2  ARG C 301 ? SER C 304 ? ARG C 329 SER C 332 
CH 3  TRP C 307 ? GLY C 314 ? TRP C 335 GLY C 342 
CH 4  GLY C 318 ? PHE C 326 ? GLY C 346 PHE C 354 
CH 5  GLU C 329 ? TYR C 344 ? GLU C 357 TYR C 372 
CH 6  HIS C 492 ? LEU C 502 ? HIS C 520 LEU C 530 
CH 7  LYS C 644 ? HIS C 656 ? LYS C 672 HIS C 684 
CH 8  GLU C 508 ? PRO C 520 ? GLU C 536 PRO C 548 
CH 9  TYR C 558 ? SER C 566 ? TYR C 586 SER C 594 
CH 10 PRO C 572 ? LEU C 580 ? PRO C 600 LEU C 608 
CH 11 VAL C 673 ? TYR C 680 ? VAL C 701 TYR C 708 
CH 12 ILE C 457 ? GLY C 465 ? ILE C 485 GLY C 493 
CH 13 PAQ C 443 ? PHE C 451 ? PAQ C 471 PHE C 479 
CH 14 TYR C 423 ? LEU C 440 ? TYR C 451 LEU C 468 
CH 15 LYS C 395 ? HIS C 416 ? LYS C 423 HIS C 444 
CH 16 THR C 381 ? LEU C 389 ? THR C 409 LEU C 417 
CH 17 ASN C 66  ? GLN C 74  ? ASN C 94  GLN C 102 
CH 18 GLU C 95  ? PHE C 102 ? GLU C 123 PHE C 130 
CH 19 ASN C 109 ? GLY C 116 ? ASN C 137 GLY C 144 
CH 20 TYR C 123 ? ASP C 126 ? TYR C 151 ASP C 154 
CI 1  PHE C 295 ? GLN C 298 ? PHE C 323 GLN C 326 
CI 2  ARG C 301 ? SER C 304 ? ARG C 329 SER C 332 
CI 3  TRP C 307 ? GLY C 314 ? TRP C 335 GLY C 342 
CI 4  GLY C 318 ? PHE C 326 ? GLY C 346 PHE C 354 
CI 5  GLU C 329 ? TYR C 344 ? GLU C 357 TYR C 372 
CI 6  HIS C 492 ? LEU C 502 ? HIS C 520 LEU C 530 
CI 7  LYS C 644 ? HIS C 656 ? LYS C 672 HIS C 684 
CI 8  GLU C 508 ? PRO C 520 ? GLU C 536 PRO C 548 
CI 9  TYR C 558 ? SER C 566 ? TYR C 586 SER C 594 
CI 10 PRO C 572 ? LEU C 580 ? PRO C 600 LEU C 608 
CI 11 VAL C 673 ? TYR C 680 ? VAL C 701 TYR C 708 
CI 12 ILE C 457 ? GLY C 465 ? ILE C 485 GLY C 493 
CI 13 PAQ C 443 ? PHE C 451 ? PAQ C 471 PHE C 479 
CI 14 TYR C 423 ? LEU C 440 ? TYR C 451 LEU C 468 
CI 15 LYS C 395 ? HIS C 416 ? LYS C 423 HIS C 444 
CI 16 THR C 381 ? LEU C 389 ? THR C 409 LEU C 417 
CI 17 ASN C 66  ? GLN C 74  ? ASN C 94  GLN C 102 
CI 18 GLU C 95  ? PHE C 102 ? GLU C 123 PHE C 130 
CI 19 ASN C 109 ? GLY C 116 ? ASN C 137 GLY C 144 
CI 20 LEU C 136 ? PRO C 137 ? LEU C 164 PRO C 165 
CJ 1  ILE C 695 ? ARG C 698 ? ILE C 723 ARG C 726 
CJ 2  TYR C 423 ? LEU C 440 ? TYR C 451 LEU C 468 
CK 1  LEU C 180 ? MET C 183 ? LEU C 208 MET C 211 
CK 2  THR C 197 ? TYR C 203 ? THR C 225 TYR C 231 
CK 3  HIS C 214 ? ASN C 222 ? HIS C 242 ASN C 250 
CK 4  THR C 232 ? TYR C 238 ? THR C 260 TYR C 266 
CK 5  ARG C 241 ? TYR C 243 ? ARG C 269 TYR C 271 
CL 1  SER C 469 ? PHE C 471 ? SER C 497 PHE C 499 
CL 2  THR C 487 ? THR C 490 ? THR C 515 THR C 518 
CL 3  GLY C 480 ? SER C 484 ? GLY C 508 SER C 512 
DA 1  LEU D 55  ? VAL D 56  ? LEU D 83  VAL D 84  
DA 2  ASN D 66  ? GLN D 74  ? ASN D 94  GLN D 102 
DB 1  TYR D 123 ? ASP D 126 ? TYR D 151 ASP D 154 
DB 2  ASN D 109 ? GLY D 116 ? ASN D 137 GLY D 144 
DC 1  LEU D 136 ? PRO D 137 ? LEU D 164 PRO D 165 
DC 2  ASN D 109 ? GLY D 116 ? ASN D 137 GLY D 144 
DD 1  PHE D 295 ? GLN D 298 ? PHE D 323 GLN D 326 
DD 2  ARG D 301 ? SER D 304 ? ARG D 329 SER D 332 
DD 3  TRP D 307 ? GLY D 314 ? TRP D 335 GLY D 342 
DD 4  GLY D 318 ? PHE D 326 ? GLY D 346 PHE D 354 
DD 5  GLU D 329 ? TYR D 344 ? GLU D 357 TYR D 372 
DD 6  ARG D 355 ? VAL D 357 ? ARG D 383 VAL D 385 
DE 1  PHE D 295 ? GLN D 298 ? PHE D 323 GLN D 326 
DE 2  ARG D 301 ? SER D 304 ? ARG D 329 SER D 332 
DE 3  TRP D 307 ? GLY D 314 ? TRP D 335 GLY D 342 
DE 4  GLY D 318 ? PHE D 326 ? GLY D 346 PHE D 354 
DE 5  GLU D 329 ? TYR D 344 ? GLU D 357 TYR D 372 
DE 6  HIS D 492 ? LEU D 502 ? HIS D 520 LEU D 530 
DE 7  ALA D 642 ? HIS D 656 ? ALA D 670 HIS D 684 
DE 8  TYR D 602 ? GLN D 608 ? TYR D 630 GLN D 636 
DE 9  ALA D 548 ? LEU D 550 ? ALA D 576 LEU D 578 
DF 1  PHE D 295 ? GLN D 298 ? PHE D 323 GLN D 326 
DF 2  ARG D 301 ? SER D 304 ? ARG D 329 SER D 332 
DF 3  TRP D 307 ? GLY D 314 ? TRP D 335 GLY D 342 
DF 4  GLY D 318 ? PHE D 326 ? GLY D 346 PHE D 354 
DF 5  GLU D 329 ? TYR D 344 ? GLU D 357 TYR D 372 
DF 6  HIS D 492 ? LEU D 502 ? HIS D 520 LEU D 530 
DF 7  ALA D 642 ? HIS D 656 ? ALA D 670 HIS D 684 
DF 8  GLU D 508 ? VAL D 523 ? GLU D 536 VAL D 551 
DF 9  SER D 526 ? LEU D 541 ? SER D 554 LEU D 569 
DG 1  ARG D 355 ? VAL D 357 ? ARG D 383 VAL D 385 
DG 2  GLU D 329 ? TYR D 344 ? GLU D 357 TYR D 372 
DH 1  PHE D 295 ? GLN D 298 ? PHE D 323 GLN D 326 
DH 2  ARG D 301 ? SER D 304 ? ARG D 329 SER D 332 
DH 3  TRP D 307 ? GLY D 314 ? TRP D 335 GLY D 342 
DH 4  GLY D 318 ? PHE D 326 ? GLY D 346 PHE D 354 
DH 5  GLU D 329 ? TYR D 344 ? GLU D 357 TYR D 372 
DH 6  HIS D 492 ? LEU D 502 ? HIS D 520 LEU D 530 
DH 7  ALA D 642 ? HIS D 656 ? ALA D 670 HIS D 684 
DH 8  GLU D 508 ? VAL D 523 ? GLU D 536 VAL D 551 
DH 9  TYR D 558 ? ASN D 567 ? TYR D 586 ASN D 595 
DH 10 HIS D 571 ? MET D 579 ? HIS D 599 MET D 607 
DH 11 VAL D 673 ? TYR D 680 ? VAL D 701 TYR D 708 
DH 12 ILE D 457 ? GLY D 465 ? ILE D 485 GLY D 493 
DH 13 PAQ D 443 ? PHE D 451 ? PAQ D 471 PHE D 479 
DH 14 TYR D 423 ? LEU D 440 ? TYR D 451 LEU D 468 
DH 15 ILE D 695 ? PHE D 697 ? ILE D 723 PHE D 725 
DI 1  PHE D 295 ? GLN D 298 ? PHE D 323 GLN D 326 
DI 2  ARG D 301 ? SER D 304 ? ARG D 329 SER D 332 
DI 3  TRP D 307 ? GLY D 314 ? TRP D 335 GLY D 342 
DI 4  GLY D 318 ? PHE D 326 ? GLY D 346 PHE D 354 
DI 5  GLU D 329 ? TYR D 344 ? GLU D 357 TYR D 372 
DI 6  HIS D 492 ? LEU D 502 ? HIS D 520 LEU D 530 
DI 7  ALA D 642 ? HIS D 656 ? ALA D 670 HIS D 684 
DI 8  GLU D 508 ? VAL D 523 ? GLU D 536 VAL D 551 
DI 9  TYR D 558 ? ASN D 567 ? TYR D 586 ASN D 595 
DI 10 HIS D 571 ? MET D 579 ? HIS D 599 MET D 607 
DI 11 VAL D 673 ? TYR D 680 ? VAL D 701 TYR D 708 
DI 12 ILE D 457 ? GLY D 465 ? ILE D 485 GLY D 493 
DI 13 PAQ D 443 ? PHE D 451 ? PAQ D 471 PHE D 479 
DI 14 TYR D 423 ? LEU D 440 ? TYR D 451 LEU D 468 
DI 15 LYS D 395 ? SER D 417 ? LYS D 423 SER D 445 
DI 16 THR D 381 ? LEU D 389 ? THR D 409 LEU D 417 
DI 17 ASN D 66  ? GLN D 74  ? ASN D 94  GLN D 102 
DI 18 GLU D 95  ? PHE D 102 ? GLU D 123 PHE D 130 
DI 19 ASN D 109 ? GLY D 116 ? ASN D 137 GLY D 144 
DI 20 TYR D 123 ? ASP D 126 ? TYR D 151 ASP D 154 
DJ 1  PHE D 295 ? GLN D 298 ? PHE D 323 GLN D 326 
DJ 2  ARG D 301 ? SER D 304 ? ARG D 329 SER D 332 
DJ 3  TRP D 307 ? GLY D 314 ? TRP D 335 GLY D 342 
DJ 4  GLY D 318 ? PHE D 326 ? GLY D 346 PHE D 354 
DJ 5  GLU D 329 ? TYR D 344 ? GLU D 357 TYR D 372 
DJ 6  HIS D 492 ? LEU D 502 ? HIS D 520 LEU D 530 
DJ 7  ALA D 642 ? HIS D 656 ? ALA D 670 HIS D 684 
DJ 8  GLU D 508 ? VAL D 523 ? GLU D 536 VAL D 551 
DJ 9  TYR D 558 ? ASN D 567 ? TYR D 586 ASN D 595 
DJ 10 HIS D 571 ? MET D 579 ? HIS D 599 MET D 607 
DJ 11 VAL D 673 ? TYR D 680 ? VAL D 701 TYR D 708 
DJ 12 ILE D 457 ? GLY D 465 ? ILE D 485 GLY D 493 
DJ 13 PAQ D 443 ? PHE D 451 ? PAQ D 471 PHE D 479 
DJ 14 TYR D 423 ? LEU D 440 ? TYR D 451 LEU D 468 
DJ 15 LYS D 395 ? SER D 417 ? LYS D 423 SER D 445 
DJ 16 THR D 381 ? LEU D 389 ? THR D 409 LEU D 417 
DJ 17 ASN D 66  ? GLN D 74  ? ASN D 94  GLN D 102 
DJ 18 LEU D 55  ? VAL D 56  ? LEU D 83  VAL D 84  
DK 1  ILE D 695 ? PHE D 697 ? ILE D 723 PHE D 725 
DK 2  TYR D 423 ? LEU D 440 ? TYR D 451 LEU D 468 
DL 1  PHE D 295 ? GLN D 298 ? PHE D 323 GLN D 326 
DL 2  ARG D 301 ? SER D 304 ? ARG D 329 SER D 332 
DL 3  TRP D 307 ? GLY D 314 ? TRP D 335 GLY D 342 
DL 4  GLY D 318 ? PHE D 326 ? GLY D 346 PHE D 354 
DL 5  GLU D 329 ? TYR D 344 ? GLU D 357 TYR D 372 
DL 6  HIS D 492 ? LEU D 502 ? HIS D 520 LEU D 530 
DL 7  ALA D 642 ? HIS D 656 ? ALA D 670 HIS D 684 
DL 8  GLU D 508 ? VAL D 523 ? GLU D 536 VAL D 551 
DL 9  TYR D 558 ? ASN D 567 ? TYR D 586 ASN D 595 
DL 10 HIS D 571 ? MET D 579 ? HIS D 599 MET D 607 
DL 11 VAL D 673 ? TYR D 680 ? VAL D 701 TYR D 708 
DL 12 ILE D 457 ? GLY D 465 ? ILE D 485 GLY D 493 
DL 13 PAQ D 443 ? PHE D 451 ? PAQ D 471 PHE D 479 
DL 14 TYR D 423 ? LEU D 440 ? TYR D 451 LEU D 468 
DL 15 LYS D 395 ? SER D 417 ? LYS D 423 SER D 445 
DL 16 THR D 381 ? LEU D 389 ? THR D 409 LEU D 417 
DL 17 ASN D 66  ? GLN D 74  ? ASN D 94  GLN D 102 
DL 18 GLU D 95  ? PHE D 102 ? GLU D 123 PHE D 130 
DL 19 ASN D 109 ? GLY D 116 ? ASN D 137 GLY D 144 
DL 20 LEU D 136 ? PRO D 137 ? LEU D 164 PRO D 165 
DM 1  LEU D 180 ? MET D 183 ? LEU D 208 MET D 211 
DM 2  ALA D 196 ? TYR D 203 ? ALA D 224 TYR D 231 
DM 3  HIS D 214 ? ASN D 222 ? HIS D 242 ASN D 250 
DM 4  THR D 232 ? TYR D 238 ? THR D 260 TYR D 266 
DM 5  ARG D 241 ? TYR D 243 ? ARG D 269 TYR D 271 
DN 1  SER D 469 ? PHE D 471 ? SER D 497 PHE D 499 
DN 2  THR D 487 ? THR D 490 ? THR D 515 THR D 518 
DN 3  GLY D 480 ? SER D 484 ? GLY D 508 SER D 512 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N ARG A 125 ? N ARG A 153 O VAL A 114 ? O VAL A 142 
AA 2  3  N VAL A 115 ? N VAL A 143 O ALA A 96  ? O ALA A 124 
AA 3  4  N PHE A 101 ? N PHE A 129 O CYS A 67  ? O CYS A 95  
AA 4  5  N VAL A 71  ? N VAL A 99  O LEU A 388 ? O LEU A 416 
AA 5  6  N PHE A 387 ? N PHE A 415 O LYS A 395 ? O LYS A 423 
AA 6  7  N HIS A 415 ? N HIS A 443 O GLY A 425 ? O GLY A 453 
AA 7  8  N LEU A 432 ? N LEU A 460 O PHE A 451 ? O PHE A 479 
AA 8  9  N VAL A 450 ? N VAL A 478 O GLU A 458 ? O GLU A 486 
AA 9  10 N PHE A 461 ? N PHE A 489 O VAL A 673 ? O VAL A 701 
AA 10 11 N TYR A 680 ? N TYR A 708 O GLY A 574 ? O GLY A 602 
AA 11 12 N ILE A 577 ? N ILE A 605 O LEU A 559 ? O LEU A 587 
AA 12 13 N ALA A 562 ? N ALA A 590 O TRP A 510 ? O TRP A 538 
AA 13 14 N VAL A 519 ? N VAL A 547 O ARG A 533 ? O ARG A 561 
AB 1  2  N ARG A 125 ? N ARG A 153 O VAL A 114 ? O VAL A 142 
AB 2  3  N VAL A 115 ? N VAL A 143 O ALA A 96  ? O ALA A 124 
AB 3  4  N PHE A 101 ? N PHE A 129 O CYS A 67  ? O CYS A 95  
AB 4  5  N VAL A 71  ? N VAL A 99  O LEU A 388 ? O LEU A 416 
AB 5  6  N PHE A 387 ? N PHE A 415 O LYS A 395 ? O LYS A 423 
AB 6  7  N HIS A 415 ? N HIS A 443 O GLY A 425 ? O GLY A 453 
AB 7  8  N GLY A 426 ? N GLY A 454 O ILE A 695 ? O ILE A 723 
AC 1  2  N GLN A 298 ? N GLN A 326 O ARG A 301 ? O ARG A 329 
AC 2  3  N SER A 304 ? N SER A 332 O TRP A 307 ? O TRP A 335 
AC 3  4  N GLY A 314 ? N GLY A 342 O GLY A 318 ? O GLY A 346 
AC 4  5  N PHE A 326 ? N PHE A 354 O GLU A 329 ? O GLU A 357 
AC 5  6  N ALA A 342 ? N ALA A 370 O TYR A 356 ? O TYR A 384 
AD 1  2  N ARG A 125 ? N ARG A 153 O VAL A 114 ? O VAL A 142 
AD 2  3  N VAL A 115 ? N VAL A 143 O ALA A 96  ? O ALA A 124 
AD 3  4  N PHE A 101 ? N PHE A 129 O CYS A 67  ? O CYS A 95  
AD 4  5  N VAL A 71  ? N VAL A 99  O LEU A 388 ? O LEU A 416 
AD 5  6  N PHE A 387 ? N PHE A 415 O LYS A 395 ? O LYS A 423 
AD 6  7  N HIS A 415 ? N HIS A 443 O GLY A 425 ? O GLY A 453 
AD 7  8  N MET A 437 ? N MET A 465 O THR A 368 ? O THR A 396 
AE 1  2  N TYR A 356 ? N TYR A 384 O ALA A 342 ? O ALA A 370 
AF 1  2  N ARG A 125 ? N ARG A 153 O VAL A 114 ? O VAL A 142 
AF 2  3  N VAL A 115 ? N VAL A 143 O ALA A 96  ? O ALA A 124 
AF 3  4  N PHE A 101 ? N PHE A 129 O CYS A 67  ? O CYS A 95  
AF 4  5  N VAL A 71  ? N VAL A 99  O LEU A 388 ? O LEU A 416 
AF 5  6  N PHE A 387 ? N PHE A 415 O LYS A 395 ? O LYS A 423 
AF 6  7  N HIS A 415 ? N HIS A 443 O GLY A 425 ? O GLY A 453 
AF 7  8  N LEU A 432 ? N LEU A 460 O PHE A 451 ? O PHE A 479 
AF 8  9  N VAL A 450 ? N VAL A 478 O GLU A 458 ? O GLU A 486 
AF 9  10 N THR A 464 ? N THR A 492 O ASP A 444 ? O ASP A 472 
AF 10 11 N PHE A 461 ? N PHE A 489 O VAL A 673 ? O VAL A 701 
AF 11 12 N TYR A 680 ? N TYR A 708 O GLY A 574 ? O GLY A 602 
AF 12 13 N ILE A 577 ? N ILE A 605 O LEU A 559 ? O LEU A 587 
AF 13 14 N ALA A 562 ? N ALA A 590 O TRP A 510 ? O TRP A 538 
AF 14 15 N VAL A 519 ? N VAL A 547 O ARG A 533 ? O ARG A 561 
AG 1  2  N ARG A 125 ? N ARG A 153 O VAL A 114 ? O VAL A 142 
AG 2  3  N VAL A 115 ? N VAL A 143 O ALA A 96  ? O ALA A 124 
AG 3  4  N PHE A 101 ? N PHE A 129 O CYS A 67  ? O CYS A 95  
AG 4  5  N VAL A 71  ? N VAL A 99  O LEU A 388 ? O LEU A 416 
AG 5  6  N PHE A 387 ? N PHE A 415 O LYS A 395 ? O LYS A 423 
AG 6  7  N HIS A 415 ? N HIS A 443 O GLY A 425 ? O GLY A 453 
AG 7  8  N LEU A 432 ? N LEU A 460 O PHE A 451 ? O PHE A 479 
AG 8  9  N VAL A 450 ? N VAL A 478 O GLU A 458 ? O GLU A 486 
AG 9  10 N PHE A 461 ? N PHE A 489 O VAL A 673 ? O VAL A 701 
AG 10 11 N TYR A 680 ? N TYR A 708 O GLY A 574 ? O GLY A 602 
AG 11 12 N ILE A 577 ? N ILE A 605 O LEU A 559 ? O LEU A 587 
AG 12 13 N ALA A 562 ? N ALA A 590 O TRP A 510 ? O TRP A 538 
AG 13 14 N ASN A 509 ? N ASN A 537 O LYS A 644 ? O LYS A 672 
AG 14 15 N THR A 651 ? N THR A 679 O GLN A 603 ? O GLN A 631 
AG 15 16 N GLN A 603 ? N GLN A 631 O PHE A 549 ? O PHE A 577 
AH 1  2  N GLN A 298 ? N GLN A 326 O ARG A 301 ? O ARG A 329 
AH 2  3  N SER A 304 ? N SER A 332 O TRP A 307 ? O TRP A 335 
AH 3  4  N GLY A 314 ? N GLY A 342 O GLY A 318 ? O GLY A 346 
AH 4  5  N PHE A 326 ? N PHE A 354 O GLU A 329 ? O GLU A 357 
AH 5  6  N ILE A 343 ? N ILE A 371 O THR A 493 ? O THR A 521 
AH 6  7  N VAL A 500 ? N VAL A 528 O ALA A 648 ? O ALA A 676 
AH 7  8  N THR A 651 ? N THR A 679 O GLN A 603 ? O GLN A 631 
AH 8  9  N GLN A 603 ? N GLN A 631 O PHE A 549 ? O PHE A 577 
AI 1  2  N ARG A 125 ? N ARG A 153 O VAL A 114 ? O VAL A 142 
AI 2  3  N VAL A 115 ? N VAL A 143 O ALA A 96  ? O ALA A 124 
AI 3  4  N PHE A 101 ? N PHE A 129 O CYS A 67  ? O CYS A 95  
AI 4  5  N VAL A 71  ? N VAL A 99  O LEU A 388 ? O LEU A 416 
AI 5  6  N PHE A 387 ? N PHE A 415 O LYS A 395 ? O LYS A 423 
AI 6  7  N HIS A 415 ? N HIS A 443 O GLY A 425 ? O GLY A 453 
AI 7  8  N LEU A 432 ? N LEU A 460 O PHE A 451 ? O PHE A 479 
AI 8  9  N VAL A 450 ? N VAL A 478 O GLU A 458 ? O GLU A 486 
AI 9  10 N THR A 464 ? N THR A 492 O ASP A 444 ? O ASP A 472 
AI 10 11 N GLY A 426 ? N GLY A 454 O ILE A 695 ? O ILE A 723 
AJ 1  2  N LEU A 541 ? N LEU A 569 O VAL A 511 ? O VAL A 539 
AK 1  2  N ARG A 125 ? N ARG A 153 O VAL A 114 ? O VAL A 142 
AK 2  3  N VAL A 115 ? N VAL A 143 O ALA A 96  ? O ALA A 124 
AK 3  4  N PHE A 101 ? N PHE A 129 O CYS A 67  ? O CYS A 95  
AK 4  5  N VAL A 71  ? N VAL A 99  O LEU A 388 ? O LEU A 416 
AK 5  6  N PHE A 387 ? N PHE A 415 O LYS A 395 ? O LYS A 423 
AK 6  7  N HIS A 415 ? N HIS A 443 O GLY A 425 ? O GLY A 453 
AK 7  8  N LEU A 432 ? N LEU A 460 O PHE A 451 ? O PHE A 479 
AK 8  9  N VAL A 450 ? N VAL A 478 O GLU A 458 ? O GLU A 486 
AK 9  10 N THR A 464 ? N THR A 492 O ASP A 444 ? O ASP A 472 
AK 10 11 N VAL A 114 ? N VAL A 142 O ARG A 125 ? O ARG A 153 
AL 1  2  N ARG A 125 ? N ARG A 153 O VAL A 114 ? O VAL A 142 
AL 2  3  N VAL A 115 ? N VAL A 143 O ALA A 96  ? O ALA A 124 
AL 3  4  N PHE A 101 ? N PHE A 129 O CYS A 67  ? O CYS A 95  
AL 4  5  N VAL A 71  ? N VAL A 99  O LEU A 388 ? O LEU A 416 
AL 5  6  N PHE A 387 ? N PHE A 415 O LYS A 395 ? O LYS A 423 
AL 6  7  N HIS A 415 ? N HIS A 443 O GLY A 425 ? O GLY A 453 
AL 7  8  N LEU A 432 ? N LEU A 460 O PHE A 451 ? O PHE A 479 
AL 8  9  N VAL A 450 ? N VAL A 478 O GLU A 458 ? O GLU A 486 
AL 9  10 N THR A 464 ? N THR A 492 O ASP A 444 ? O ASP A 472 
AL 10 11 N PHE A 461 ? N PHE A 489 O VAL A 673 ? O VAL A 701 
AL 11 12 N TYR A 680 ? N TYR A 708 O GLY A 574 ? O GLY A 602 
AL 12 13 N ILE A 577 ? N ILE A 605 O LEU A 559 ? O LEU A 587 
AL 13 14 N ALA A 562 ? N ALA A 590 O TRP A 510 ? O TRP A 538 
AL 14 15 N VAL A 519 ? N VAL A 547 O ARG A 533 ? O ARG A 561 
AM 1  2  N ARG A 125 ? N ARG A 153 O VAL A 114 ? O VAL A 142 
AM 2  3  N VAL A 115 ? N VAL A 143 O ALA A 96  ? O ALA A 124 
AM 3  4  N PHE A 101 ? N PHE A 129 O CYS A 67  ? O CYS A 95  
AM 4  5  N VAL A 71  ? N VAL A 99  O LEU A 388 ? O LEU A 416 
AM 5  6  N PHE A 387 ? N PHE A 415 O LYS A 395 ? O LYS A 423 
AM 6  7  N HIS A 415 ? N HIS A 443 O GLY A 425 ? O GLY A 453 
AM 7  8  N LEU A 432 ? N LEU A 460 O PHE A 451 ? O PHE A 479 
AM 8  9  N VAL A 450 ? N VAL A 478 O GLU A 458 ? O GLU A 486 
AM 9  10 N THR A 464 ? N THR A 492 O ASP A 444 ? O ASP A 472 
AM 10 11 N PHE A 461 ? N PHE A 489 O VAL A 673 ? O VAL A 701 
AM 11 12 N TYR A 680 ? N TYR A 708 O GLY A 574 ? O GLY A 602 
AM 12 13 N ILE A 577 ? N ILE A 605 O LEU A 559 ? O LEU A 587 
AM 13 14 N ALA A 562 ? N ALA A 590 O TRP A 510 ? O TRP A 538 
AM 14 15 N ASN A 509 ? N ASN A 537 O LYS A 644 ? O LYS A 672 
AM 15 16 N THR A 651 ? N THR A 679 O GLN A 603 ? O GLN A 631 
AM 16 17 N GLN A 603 ? N GLN A 631 O PHE A 549 ? O PHE A 577 
AN 1  2  N ARG A 125 ? N ARG A 153 O VAL A 114 ? O VAL A 142 
AN 2  3  N VAL A 115 ? N VAL A 143 O ALA A 96  ? O ALA A 124 
AN 3  4  N PHE A 101 ? N PHE A 129 O CYS A 67  ? O CYS A 95  
AN 4  5  N VAL A 71  ? N VAL A 99  O LEU A 388 ? O LEU A 416 
AN 5  6  N PHE A 387 ? N PHE A 415 O LYS A 395 ? O LYS A 423 
AN 6  7  N HIS A 415 ? N HIS A 443 O GLY A 425 ? O GLY A 453 
AN 7  8  N LEU A 432 ? N LEU A 460 O PHE A 451 ? O PHE A 479 
AN 8  9  N VAL A 450 ? N VAL A 478 O GLU A 458 ? O GLU A 486 
AN 9  10 N PHE A 461 ? N PHE A 489 O VAL A 673 ? O VAL A 701 
AN 10 11 N TYR A 680 ? N TYR A 708 O GLY A 574 ? O GLY A 602 
AN 11 12 N ILE A 577 ? N ILE A 605 O LEU A 559 ? O LEU A 587 
AN 12 13 N ALA A 562 ? N ALA A 590 O TRP A 510 ? O TRP A 538 
AN 13 14 N ASN A 509 ? N ASN A 537 O LYS A 644 ? O LYS A 672 
AN 14 15 N HIS A 656 ? N HIS A 684 O HIS A 492 ? O HIS A 520 
AN 15 16 O ASP A 501 ? O ASP A 529 N TYR A 333 ? N TYR A 361 
AN 16 17 N ALA A 342 ? N ALA A 370 O TYR A 356 ? O TYR A 384 
AO 1  2  N GLN A 298 ? N GLN A 326 O ARG A 301 ? O ARG A 329 
AO 2  3  N SER A 304 ? N SER A 332 O TRP A 307 ? O TRP A 335 
AO 3  4  N GLY A 314 ? N GLY A 342 O GLY A 318 ? O GLY A 346 
AO 4  5  N PHE A 326 ? N PHE A 354 O GLU A 329 ? O GLU A 357 
AO 5  6  N ILE A 343 ? N ILE A 371 O THR A 493 ? O THR A 521 
AO 6  7  N VAL A 500 ? N VAL A 528 O ALA A 648 ? O ALA A 676 
AO 7  8  O LYS A 644 ? O LYS A 672 N ASN A 509 ? N ASN A 537 
AO 8  9  N VAL A 519 ? N VAL A 547 O ARG A 533 ? O ARG A 561 
AP 1  2  N MET A 183 ? N MET A 211 O GLY A 200 ? O GLY A 228 
AP 2  3  O LEU A 201 ? O LEU A 229 N VAL A 215 ? N VAL A 243 
AP 3  4  N ASN A 222 ? N ASN A 250 O THR A 232 ? O THR A 260 
AP 4  5  N TYR A 238 ? N TYR A 266 O ARG A 241 ? O ARG A 269 
AQ 1  2  N ALA A 470 ? N ALA A 498 O LEU A 488 ? O LEU A 516 
AQ 2  3  N GLY A 489 ? N GLY A 517 O ASN A 481 ? O ASN A 509 
BA 1  2  N VAL B 56  ? N VAL B 84  O ASN B 66  ? O ASN B 94  
BB 1  2  N ARG B 125 ? N ARG B 153 O VAL B 114 ? O VAL B 142 
BC 1  2  N LEU B 136 ? N LEU B 164 O VAL B 110 ? O VAL B 138 
BD 1  2  N GLN B 298 ? N GLN B 326 O ARG B 301 ? O ARG B 329 
BD 2  3  N SER B 304 ? N SER B 332 O TRP B 307 ? O TRP B 335 
BD 3  4  N GLY B 312 ? N GLY B 340 O ARG B 320 ? O ARG B 348 
BD 4  5  N PHE B 326 ? N PHE B 354 O GLU B 329 ? O GLU B 357 
BD 5  6  N ALA B 342 ? N ALA B 370 O TYR B 356 ? O TYR B 384 
BE 1  2  N GLN B 298 ? N GLN B 326 O ARG B 301 ? O ARG B 329 
BE 2  3  N SER B 304 ? N SER B 332 O TRP B 307 ? O TRP B 335 
BE 3  4  N GLY B 312 ? N GLY B 340 O ARG B 320 ? O ARG B 348 
BE 4  5  N PHE B 326 ? N PHE B 354 O GLU B 329 ? O GLU B 357 
BE 5  6  N ILE B 343 ? N ILE B 371 O THR B 493 ? O THR B 521 
BE 6  7  N VAL B 500 ? N VAL B 528 O ALA B 648 ? O ALA B 676 
BE 7  8  N THR B 651 ? N THR B 679 O GLN B 603 ? O GLN B 631 
BE 8  9  N GLN B 603 ? N GLN B 631 O PHE B 549 ? O PHE B 577 
BF 1  2  N GLN B 298 ? N GLN B 326 O ARG B 301 ? O ARG B 329 
BF 2  3  N SER B 304 ? N SER B 332 O TRP B 307 ? O TRP B 335 
BF 3  4  N GLY B 312 ? N GLY B 340 O ARG B 320 ? O ARG B 348 
BF 4  5  N PHE B 326 ? N PHE B 354 O GLU B 329 ? O GLU B 357 
BF 5  6  N ILE B 343 ? N ILE B 371 O THR B 493 ? O THR B 521 
BF 6  7  N VAL B 500 ? N VAL B 528 O ALA B 648 ? O ALA B 676 
BF 7  8  N GLY B 643 ? N GLY B 671 O ASN B 509 ? O ASN B 537 
BF 8  9  O VAL B 523 ? O VAL B 551 N SER B 526 ? N SER B 554 
BG 1  2  N TYR B 356 ? N TYR B 384 O ALA B 342 ? O ALA B 370 
BH 1  2  N GLN B 298 ? N GLN B 326 O ARG B 301 ? O ARG B 329 
BH 2  3  N SER B 304 ? N SER B 332 O TRP B 307 ? O TRP B 335 
BH 3  4  N GLY B 312 ? N GLY B 340 O ARG B 320 ? O ARG B 348 
BH 4  5  N PHE B 326 ? N PHE B 354 O GLU B 329 ? O GLU B 357 
BH 5  6  N ILE B 343 ? N ILE B 371 O THR B 493 ? O THR B 521 
BH 6  7  N VAL B 500 ? N VAL B 528 O ALA B 648 ? O ALA B 676 
BH 7  8  N GLY B 643 ? N GLY B 671 O ASN B 509 ? O ASN B 537 
BH 8  9  N GLU B 514 ? N GLU B 542 O TYR B 558 ? O TYR B 586 
BH 9  10 N ASN B 567 ? N ASN B 595 O HIS B 571 ? O HIS B 599 
BH 10 11 N LEU B 580 ? N LEU B 608 O GLY B 674 ? O GLY B 702 
BH 11 12 N LEU B 677 ? N LEU B 705 O ILE B 457 ? O ILE B 485 
BH 12 13 N THR B 464 ? N THR B 492 O ASP B 444 ? O ASP B 472 
BH 13 14 N PHE B 451 ? N PHE B 479 O LEU B 432 ? O LEU B 460 
BH 14 15 N GLY B 426 ? N GLY B 454 O ILE B 695 ? O ILE B 723 
BI 1  2  N GLN B 298 ? N GLN B 326 O ARG B 301 ? O ARG B 329 
BI 2  3  N SER B 304 ? N SER B 332 O TRP B 307 ? O TRP B 335 
BI 3  4  N GLY B 312 ? N GLY B 340 O ARG B 320 ? O ARG B 348 
BI 4  5  N PHE B 326 ? N PHE B 354 O GLU B 329 ? O GLU B 357 
BI 5  6  N ILE B 343 ? N ILE B 371 O THR B 493 ? O THR B 521 
BI 6  7  N VAL B 500 ? N VAL B 528 O ALA B 648 ? O ALA B 676 
BI 7  8  N GLY B 643 ? N GLY B 671 O ASN B 509 ? O ASN B 537 
BI 8  9  N GLU B 514 ? N GLU B 542 O TYR B 558 ? O TYR B 586 
BI 9  10 N ASN B 567 ? N ASN B 595 O HIS B 571 ? O HIS B 599 
BI 10 11 N LEU B 580 ? N LEU B 608 O GLY B 674 ? O GLY B 702 
BI 11 12 N LEU B 677 ? N LEU B 705 O ILE B 457 ? O ILE B 485 
BI 12 13 N THR B 464 ? N THR B 492 O ASP B 444 ? O ASP B 472 
BI 13 14 N PHE B 451 ? N PHE B 479 O LEU B 432 ? O LEU B 460 
BI 14 15 N MET B 437 ? N MET B 465 O ALA B 400 ? O ALA B 428 
BI 15 16 N VAL B 403 ? N VAL B 431 O THR B 381 ? O THR B 409 
BI 16 17 N LEU B 388 ? N LEU B 416 O VAL B 71  ? O VAL B 99  
BI 17 18 N GLN B 74  ? N GLN B 102 O GLU B 95  ? O GLU B 123 
BI 18 19 N PHE B 102 ? N PHE B 130 O ASN B 109 ? O ASN B 137 
BI 19 20 N GLY B 116 ? N GLY B 144 O TYR B 123 ? O TYR B 151 
BJ 1  2  N GLN B 298 ? N GLN B 326 O ARG B 301 ? O ARG B 329 
BJ 2  3  N SER B 304 ? N SER B 332 O TRP B 307 ? O TRP B 335 
BJ 3  4  N GLY B 312 ? N GLY B 340 O ARG B 320 ? O ARG B 348 
BJ 4  5  N PHE B 326 ? N PHE B 354 O GLU B 329 ? O GLU B 357 
BJ 5  6  N ILE B 343 ? N ILE B 371 O THR B 493 ? O THR B 521 
BJ 6  7  N VAL B 500 ? N VAL B 528 O ALA B 648 ? O ALA B 676 
BJ 7  8  N GLY B 643 ? N GLY B 671 O ASN B 509 ? O ASN B 537 
BJ 8  9  N GLU B 514 ? N GLU B 542 O TYR B 558 ? O TYR B 586 
BJ 9  10 N ASN B 567 ? N ASN B 595 O HIS B 571 ? O HIS B 599 
BJ 10 11 N LEU B 580 ? N LEU B 608 O GLY B 674 ? O GLY B 702 
BJ 11 12 N LEU B 677 ? N LEU B 705 O ILE B 457 ? O ILE B 485 
BJ 12 13 N THR B 464 ? N THR B 492 O ASP B 444 ? O ASP B 472 
BJ 13 14 N PHE B 451 ? N PHE B 479 O LEU B 432 ? O LEU B 460 
BJ 14 15 N MET B 437 ? N MET B 465 O ALA B 400 ? O ALA B 428 
BJ 15 16 N VAL B 403 ? N VAL B 431 O THR B 381 ? O THR B 409 
BJ 16 17 N LEU B 388 ? N LEU B 416 O VAL B 71  ? O VAL B 99  
BJ 17 18 N VAL B 68  ? N VAL B 96  O VAL B 56  ? O VAL B 84  
BK 1  2  N PHE B 697 ? N PHE B 725 O PHE B 424 ? O PHE B 452 
BL 1  2  N GLN B 298 ? N GLN B 326 O ARG B 301 ? O ARG B 329 
BL 2  3  N SER B 304 ? N SER B 332 O TRP B 307 ? O TRP B 335 
BL 3  4  N GLY B 312 ? N GLY B 340 O ARG B 320 ? O ARG B 348 
BL 4  5  N PHE B 326 ? N PHE B 354 O GLU B 329 ? O GLU B 357 
BL 5  6  N ILE B 343 ? N ILE B 371 O THR B 493 ? O THR B 521 
BL 6  7  N VAL B 500 ? N VAL B 528 O ALA B 648 ? O ALA B 676 
BL 7  8  N GLY B 643 ? N GLY B 671 O ASN B 509 ? O ASN B 537 
BL 8  9  N GLU B 514 ? N GLU B 542 O TYR B 558 ? O TYR B 586 
BL 9  10 N ASN B 567 ? N ASN B 595 O HIS B 571 ? O HIS B 599 
BL 10 11 N LEU B 580 ? N LEU B 608 O GLY B 674 ? O GLY B 702 
BL 11 12 N LEU B 677 ? N LEU B 705 O ILE B 457 ? O ILE B 485 
BL 12 13 N THR B 464 ? N THR B 492 O ASP B 444 ? O ASP B 472 
BL 13 14 N PHE B 451 ? N PHE B 479 O LEU B 432 ? O LEU B 460 
BL 14 15 N MET B 437 ? N MET B 465 O ALA B 400 ? O ALA B 428 
BL 15 16 N VAL B 403 ? N VAL B 431 O THR B 381 ? O THR B 409 
BL 16 17 N LEU B 388 ? N LEU B 416 O VAL B 71  ? O VAL B 99  
BL 17 18 N GLN B 74  ? N GLN B 102 O GLU B 95  ? O GLU B 123 
BL 18 19 N PHE B 102 ? N PHE B 130 O ASN B 109 ? O ASN B 137 
BL 19 20 N VAL B 110 ? N VAL B 138 O LEU B 136 ? O LEU B 164 
BM 1  2  N MET B 183 ? N MET B 211 O GLY B 200 ? O GLY B 228 
BM 2  3  O LEU B 201 ? O LEU B 229 N VAL B 215 ? N VAL B 243 
BM 3  4  N ASN B 222 ? N ASN B 250 O THR B 232 ? O THR B 260 
BM 4  5  N TYR B 238 ? N TYR B 266 O ARG B 241 ? O ARG B 269 
BN 1  2  N ALA B 470 ? N ALA B 498 O LEU B 488 ? O LEU B 516 
BN 2  3  N GLY B 489 ? N GLY B 517 O ASN B 481 ? O ASN B 509 
CA 1  2  N ARG C 125 ? N ARG C 153 O VAL C 114 ? O VAL C 142 
CB 1  2  N LEU C 136 ? N LEU C 164 O VAL C 110 ? O VAL C 138 
CC 1  2  N GLN C 298 ? N GLN C 326 O ARG C 301 ? O ARG C 329 
CC 2  3  N SER C 304 ? N SER C 332 O TRP C 307 ? O TRP C 335 
CC 3  4  N GLY C 314 ? N GLY C 342 O GLY C 318 ? O GLY C 346 
CC 4  5  N PHE C 326 ? N PHE C 354 O GLU C 329 ? O GLU C 357 
CC 5  6  N ALA C 342 ? N ALA C 370 O TYR C 356 ? O TYR C 384 
CD 1  2  N GLN C 298 ? N GLN C 326 O ARG C 301 ? O ARG C 329 
CD 2  3  N SER C 304 ? N SER C 332 O TRP C 307 ? O TRP C 335 
CD 3  4  N GLY C 314 ? N GLY C 342 O GLY C 318 ? O GLY C 346 
CD 4  5  N PHE C 326 ? N PHE C 354 O GLU C 329 ? O GLU C 357 
CD 5  6  N ILE C 343 ? N ILE C 371 O THR C 493 ? O THR C 521 
CD 6  7  N VAL C 500 ? N VAL C 528 O ALA C 648 ? O ALA C 676 
CD 7  8  N THR C 651 ? N THR C 679 O GLN C 603 ? O GLN C 631 
CD 8  9  N GLN C 603 ? N GLN C 631 O PHE C 549 ? O PHE C 577 
CE 1  2  N GLN C 298 ? N GLN C 326 O ARG C 301 ? O ARG C 329 
CE 2  3  N SER C 304 ? N SER C 332 O TRP C 307 ? O TRP C 335 
CE 3  4  N GLY C 314 ? N GLY C 342 O GLY C 318 ? O GLY C 346 
CE 4  5  N PHE C 326 ? N PHE C 354 O GLU C 329 ? O GLU C 357 
CE 5  6  N ILE C 343 ? N ILE C 371 O THR C 493 ? O THR C 521 
CE 6  7  N VAL C 500 ? N VAL C 528 O ALA C 648 ? O ALA C 676 
CE 7  8  O LYS C 644 ? O LYS C 672 N ASN C 509 ? N ASN C 537 
CE 8  9  N VAL C 519 ? N VAL C 547 O ARG C 533 ? O ARG C 561 
CF 1  2  N TYR C 356 ? N TYR C 384 O ALA C 342 ? O ALA C 370 
CG 1  2  N GLN C 298 ? N GLN C 326 O ARG C 301 ? O ARG C 329 
CG 2  3  N SER C 304 ? N SER C 332 O TRP C 307 ? O TRP C 335 
CG 3  4  N GLY C 314 ? N GLY C 342 O GLY C 318 ? O GLY C 346 
CG 4  5  N PHE C 326 ? N PHE C 354 O GLU C 329 ? O GLU C 357 
CG 5  6  N ILE C 343 ? N ILE C 371 O THR C 493 ? O THR C 521 
CG 6  7  N VAL C 500 ? N VAL C 528 O ALA C 648 ? O ALA C 676 
CG 7  8  O LYS C 644 ? O LYS C 672 N ASN C 509 ? N ASN C 537 
CG 8  9  N GLU C 514 ? N GLU C 542 O TYR C 558 ? O TYR C 586 
CG 9  10 N SER C 563 ? N SER C 591 O ARG C 573 ? O ARG C 601 
CG 10 11 N LEU C 580 ? N LEU C 608 O GLY C 674 ? O GLY C 702 
CG 11 12 N LEU C 677 ? N LEU C 705 O ILE C 457 ? O ILE C 485 
CG 12 13 N THR C 464 ? N THR C 492 O ASP C 444 ? O ASP C 472 
CG 13 14 N PHE C 451 ? N PHE C 479 O LEU C 432 ? O LEU C 460 
CG 14 15 N GLY C 426 ? N GLY C 454 O ILE C 695 ? O ILE C 723 
CH 1  2  N GLN C 298 ? N GLN C 326 O ARG C 301 ? O ARG C 329 
CH 2  3  N SER C 304 ? N SER C 332 O TRP C 307 ? O TRP C 335 
CH 3  4  N GLY C 314 ? N GLY C 342 O GLY C 318 ? O GLY C 346 
CH 4  5  N PHE C 326 ? N PHE C 354 O GLU C 329 ? O GLU C 357 
CH 5  6  N ILE C 343 ? N ILE C 371 O THR C 493 ? O THR C 521 
CH 6  7  N VAL C 500 ? N VAL C 528 O ALA C 648 ? O ALA C 676 
CH 7  8  O LYS C 644 ? O LYS C 672 N ASN C 509 ? N ASN C 537 
CH 8  9  N GLU C 514 ? N GLU C 542 O TYR C 558 ? O TYR C 586 
CH 9  10 N SER C 563 ? N SER C 591 O ARG C 573 ? O ARG C 601 
CH 10 11 N LEU C 580 ? N LEU C 608 O GLY C 674 ? O GLY C 702 
CH 11 12 N LEU C 677 ? N LEU C 705 O ILE C 457 ? O ILE C 485 
CH 12 13 N THR C 464 ? N THR C 492 O ASP C 444 ? O ASP C 472 
CH 13 14 N PHE C 451 ? N PHE C 479 O LEU C 432 ? O LEU C 460 
CH 14 15 N MET C 437 ? N MET C 465 O ALA C 400 ? O ALA C 428 
CH 15 16 N VAL C 403 ? N VAL C 431 O THR C 381 ? O THR C 409 
CH 16 17 N LEU C 388 ? N LEU C 416 O VAL C 71  ? O VAL C 99  
CH 17 18 N GLN C 74  ? N GLN C 102 O GLU C 95  ? O GLU C 123 
CH 18 19 N PHE C 102 ? N PHE C 130 O ASN C 109 ? O ASN C 137 
CH 19 20 N GLY C 116 ? N GLY C 144 O TYR C 123 ? O TYR C 151 
CI 1  2  N GLN C 298 ? N GLN C 326 O ARG C 301 ? O ARG C 329 
CI 2  3  N SER C 304 ? N SER C 332 O TRP C 307 ? O TRP C 335 
CI 3  4  N GLY C 314 ? N GLY C 342 O GLY C 318 ? O GLY C 346 
CI 4  5  N PHE C 326 ? N PHE C 354 O GLU C 329 ? O GLU C 357 
CI 5  6  N ILE C 343 ? N ILE C 371 O THR C 493 ? O THR C 521 
CI 6  7  N VAL C 500 ? N VAL C 528 O ALA C 648 ? O ALA C 676 
CI 7  8  O LYS C 644 ? O LYS C 672 N ASN C 509 ? N ASN C 537 
CI 8  9  N GLU C 514 ? N GLU C 542 O TYR C 558 ? O TYR C 586 
CI 9  10 N SER C 563 ? N SER C 591 O ARG C 573 ? O ARG C 601 
CI 10 11 N LEU C 580 ? N LEU C 608 O GLY C 674 ? O GLY C 702 
CI 11 12 N LEU C 677 ? N LEU C 705 O ILE C 457 ? O ILE C 485 
CI 12 13 N THR C 464 ? N THR C 492 O ASP C 444 ? O ASP C 472 
CI 13 14 N PHE C 451 ? N PHE C 479 O LEU C 432 ? O LEU C 460 
CI 14 15 N MET C 437 ? N MET C 465 O ALA C 400 ? O ALA C 428 
CI 15 16 N VAL C 403 ? N VAL C 431 O THR C 381 ? O THR C 409 
CI 16 17 N LEU C 388 ? N LEU C 416 O VAL C 71  ? O VAL C 99  
CI 17 18 N GLN C 74  ? N GLN C 102 O GLU C 95  ? O GLU C 123 
CI 18 19 N PHE C 102 ? N PHE C 130 O ASN C 109 ? O ASN C 137 
CI 19 20 N VAL C 110 ? N VAL C 138 O LEU C 136 ? O LEU C 164 
CJ 1  2  N PHE C 697 ? N PHE C 725 O PHE C 424 ? O PHE C 452 
CK 1  2  N MET C 183 ? N MET C 211 O GLY C 200 ? O GLY C 228 
CK 2  3  O LEU C 201 ? O LEU C 229 N VAL C 215 ? N VAL C 243 
CK 3  4  N ASN C 222 ? N ASN C 250 O THR C 232 ? O THR C 260 
CK 4  5  N TYR C 238 ? N TYR C 266 O ARG C 241 ? O ARG C 269 
CL 1  2  N ALA C 470 ? N ALA C 498 O LEU C 488 ? O LEU C 516 
CL 2  3  N GLY C 489 ? N GLY C 517 O ASN C 481 ? O ASN C 509 
DA 1  2  N VAL D 56  ? N VAL D 84  O ASN D 66  ? O ASN D 94  
DB 1  2  N ARG D 125 ? N ARG D 153 O VAL D 114 ? O VAL D 142 
DC 1  2  N LEU D 136 ? N LEU D 164 O VAL D 110 ? O VAL D 138 
DD 1  2  N GLN D 298 ? N GLN D 326 O ARG D 301 ? O ARG D 329 
DD 2  3  N SER D 304 ? N SER D 332 O TRP D 307 ? O TRP D 335 
DD 3  4  N GLY D 314 ? N GLY D 342 O GLY D 318 ? O GLY D 346 
DD 4  5  N PHE D 326 ? N PHE D 354 O GLU D 329 ? O GLU D 357 
DD 5  6  N ALA D 342 ? N ALA D 370 O TYR D 356 ? O TYR D 384 
DE 1  2  N GLN D 298 ? N GLN D 326 O ARG D 301 ? O ARG D 329 
DE 2  3  N SER D 304 ? N SER D 332 O TRP D 307 ? O TRP D 335 
DE 3  4  N GLY D 314 ? N GLY D 342 O GLY D 318 ? O GLY D 346 
DE 4  5  N PHE D 326 ? N PHE D 354 O GLU D 329 ? O GLU D 357 
DE 5  6  N ILE D 343 ? N ILE D 371 O THR D 493 ? O THR D 521 
DE 6  7  N VAL D 500 ? N VAL D 528 O ALA D 648 ? O ALA D 676 
DE 7  8  N THR D 651 ? N THR D 679 O GLN D 603 ? O GLN D 631 
DE 8  9  N GLN D 603 ? N GLN D 631 O PHE D 549 ? O PHE D 577 
DF 1  2  N GLN D 298 ? N GLN D 326 O ARG D 301 ? O ARG D 329 
DF 2  3  N SER D 304 ? N SER D 332 O TRP D 307 ? O TRP D 335 
DF 3  4  N GLY D 314 ? N GLY D 342 O GLY D 318 ? O GLY D 346 
DF 4  5  N PHE D 326 ? N PHE D 354 O GLU D 329 ? O GLU D 357 
DF 5  6  N ILE D 343 ? N ILE D 371 O THR D 493 ? O THR D 521 
DF 6  7  N VAL D 500 ? N VAL D 528 O ALA D 648 ? O ALA D 676 
DF 7  8  N GLY D 643 ? N GLY D 671 O ASN D 509 ? O ASN D 537 
DF 8  9  O VAL D 523 ? O VAL D 551 N SER D 526 ? N SER D 554 
DG 1  2  N TYR D 356 ? N TYR D 384 O ALA D 342 ? O ALA D 370 
DH 1  2  N GLN D 298 ? N GLN D 326 O ARG D 301 ? O ARG D 329 
DH 2  3  N SER D 304 ? N SER D 332 O TRP D 307 ? O TRP D 335 
DH 3  4  N GLY D 314 ? N GLY D 342 O GLY D 318 ? O GLY D 346 
DH 4  5  N PHE D 326 ? N PHE D 354 O GLU D 329 ? O GLU D 357 
DH 5  6  N ILE D 343 ? N ILE D 371 O THR D 493 ? O THR D 521 
DH 6  7  N VAL D 500 ? N VAL D 528 O ALA D 648 ? O ALA D 676 
DH 7  8  N GLY D 643 ? N GLY D 671 O ASN D 509 ? O ASN D 537 
DH 8  9  N GLU D 514 ? N GLU D 542 O TYR D 558 ? O TYR D 586 
DH 9  10 N ASN D 567 ? N ASN D 595 O HIS D 571 ? O HIS D 599 
DH 10 11 N GLN D 578 ? N GLN D 606 O PHE D 676 ? O PHE D 704 
DH 11 12 N LEU D 677 ? N LEU D 705 O ILE D 457 ? O ILE D 485 
DH 12 13 N THR D 464 ? N THR D 492 O ASP D 444 ? O ASP D 472 
DH 13 14 N PHE D 451 ? N PHE D 479 O LEU D 432 ? O LEU D 460 
DH 14 15 N GLY D 426 ? N GLY D 454 O ILE D 695 ? O ILE D 723 
DI 1  2  N GLN D 298 ? N GLN D 326 O ARG D 301 ? O ARG D 329 
DI 2  3  N SER D 304 ? N SER D 332 O TRP D 307 ? O TRP D 335 
DI 3  4  N GLY D 314 ? N GLY D 342 O GLY D 318 ? O GLY D 346 
DI 4  5  N PHE D 326 ? N PHE D 354 O GLU D 329 ? O GLU D 357 
DI 5  6  N ILE D 343 ? N ILE D 371 O THR D 493 ? O THR D 521 
DI 6  7  N VAL D 500 ? N VAL D 528 O ALA D 648 ? O ALA D 676 
DI 7  8  N GLY D 643 ? N GLY D 671 O ASN D 509 ? O ASN D 537 
DI 8  9  N GLU D 514 ? N GLU D 542 O TYR D 558 ? O TYR D 586 
DI 9  10 N ASN D 567 ? N ASN D 595 O HIS D 571 ? O HIS D 599 
DI 10 11 N GLN D 578 ? N GLN D 606 O PHE D 676 ? O PHE D 704 
DI 11 12 N LEU D 677 ? N LEU D 705 O ILE D 457 ? O ILE D 485 
DI 12 13 N THR D 464 ? N THR D 492 O ASP D 444 ? O ASP D 472 
DI 13 14 N PHE D 451 ? N PHE D 479 O LEU D 432 ? O LEU D 460 
DI 14 15 N MET D 437 ? N MET D 465 O ALA D 400 ? O ALA D 428 
DI 15 16 N VAL D 403 ? N VAL D 431 O THR D 381 ? O THR D 409 
DI 16 17 N LEU D 388 ? N LEU D 416 O VAL D 71  ? O VAL D 99  
DI 17 18 N GLN D 74  ? N GLN D 102 O GLU D 95  ? O GLU D 123 
DI 18 19 N PHE D 102 ? N PHE D 130 O ASN D 109 ? O ASN D 137 
DI 19 20 N GLY D 116 ? N GLY D 144 O TYR D 123 ? O TYR D 151 
DJ 1  2  N GLN D 298 ? N GLN D 326 O ARG D 301 ? O ARG D 329 
DJ 2  3  N SER D 304 ? N SER D 332 O TRP D 307 ? O TRP D 335 
DJ 3  4  N GLY D 314 ? N GLY D 342 O GLY D 318 ? O GLY D 346 
DJ 4  5  N PHE D 326 ? N PHE D 354 O GLU D 329 ? O GLU D 357 
DJ 5  6  N ILE D 343 ? N ILE D 371 O THR D 493 ? O THR D 521 
DJ 6  7  N VAL D 500 ? N VAL D 528 O ALA D 648 ? O ALA D 676 
DJ 7  8  N GLY D 643 ? N GLY D 671 O ASN D 509 ? O ASN D 537 
DJ 8  9  N GLU D 514 ? N GLU D 542 O TYR D 558 ? O TYR D 586 
DJ 9  10 N ASN D 567 ? N ASN D 595 O HIS D 571 ? O HIS D 599 
DJ 10 11 N GLN D 578 ? N GLN D 606 O PHE D 676 ? O PHE D 704 
DJ 11 12 N LEU D 677 ? N LEU D 705 O ILE D 457 ? O ILE D 485 
DJ 12 13 N THR D 464 ? N THR D 492 O ASP D 444 ? O ASP D 472 
DJ 13 14 N PHE D 451 ? N PHE D 479 O LEU D 432 ? O LEU D 460 
DJ 14 15 N MET D 437 ? N MET D 465 O ALA D 400 ? O ALA D 428 
DJ 15 16 N VAL D 403 ? N VAL D 431 O THR D 381 ? O THR D 409 
DJ 16 17 N LEU D 388 ? N LEU D 416 O VAL D 71  ? O VAL D 99  
DJ 17 18 N VAL D 68  ? N VAL D 96  O VAL D 56  ? O VAL D 84  
DK 1  2  N PHE D 697 ? N PHE D 725 O PHE D 424 ? O PHE D 452 
DL 1  2  N GLN D 298 ? N GLN D 326 O ARG D 301 ? O ARG D 329 
DL 2  3  N SER D 304 ? N SER D 332 O TRP D 307 ? O TRP D 335 
DL 3  4  N GLY D 314 ? N GLY D 342 O GLY D 318 ? O GLY D 346 
DL 4  5  N PHE D 326 ? N PHE D 354 O GLU D 329 ? O GLU D 357 
DL 5  6  N ILE D 343 ? N ILE D 371 O THR D 493 ? O THR D 521 
DL 6  7  N VAL D 500 ? N VAL D 528 O ALA D 648 ? O ALA D 676 
DL 7  8  N GLY D 643 ? N GLY D 671 O ASN D 509 ? O ASN D 537 
DL 8  9  N GLU D 514 ? N GLU D 542 O TYR D 558 ? O TYR D 586 
DL 9  10 N ASN D 567 ? N ASN D 595 O HIS D 571 ? O HIS D 599 
DL 10 11 N GLN D 578 ? N GLN D 606 O PHE D 676 ? O PHE D 704 
DL 11 12 N LEU D 677 ? N LEU D 705 O ILE D 457 ? O ILE D 485 
DL 12 13 N THR D 464 ? N THR D 492 O ASP D 444 ? O ASP D 472 
DL 13 14 N PHE D 451 ? N PHE D 479 O LEU D 432 ? O LEU D 460 
DL 14 15 N MET D 437 ? N MET D 465 O ALA D 400 ? O ALA D 428 
DL 15 16 N VAL D 403 ? N VAL D 431 O THR D 381 ? O THR D 409 
DL 16 17 N LEU D 388 ? N LEU D 416 O VAL D 71  ? O VAL D 99  
DL 17 18 N GLN D 74  ? N GLN D 102 O GLU D 95  ? O GLU D 123 
DL 18 19 N PHE D 102 ? N PHE D 130 O ASN D 109 ? O ASN D 137 
DL 19 20 N VAL D 110 ? N VAL D 138 O LEU D 136 ? O LEU D 164 
DM 1  2  N MET D 183 ? N MET D 211 O GLY D 200 ? O GLY D 228 
DM 2  3  O LEU D 201 ? O LEU D 229 N VAL D 215 ? N VAL D 243 
DM 3  4  N ASN D 222 ? N ASN D 250 O THR D 232 ? O THR D 260 
DM 4  5  N TYR D 238 ? N TYR D 266 O ARG D 241 ? O ARG D 269 
DN 1  2  N ALA D 470 ? N ALA D 498 O LEU D 488 ? O LEU D 516 
DN 2  3  N GLY D 489 ? N GLY D 517 O ASN D 481 ? O ASN D 509 
# 
_database_PDB_matrix.entry_id          2C11 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2C11 
_atom_sites.fract_transf_matrix[1][1]   0.007849 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007849 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004559 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
CU 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . GLN A  1  30  ? 31.414  11.381  22.745  1.00 80.47 ? 58   GLN A N   1 
ATOM   2     C  CA  . GLN A  1  30  ? 31.333  12.794  23.225  1.00 79.90 ? 58   GLN A CA  1 
ATOM   3     C  C   . GLN A  1  30  ? 32.342  13.124  24.311  1.00 79.81 ? 58   GLN A C   1 
ATOM   4     O  O   . GLN A  1  30  ? 32.030  13.195  25.501  1.00 79.22 ? 58   GLN A O   1 
ATOM   5     C  CB  . GLN A  1  30  ? 29.922  13.111  23.701  1.00 79.67 ? 58   GLN A CB  1 
ATOM   6     C  CG  . GLN A  1  30  ? 29.029  13.544  22.561  1.00 80.47 ? 58   GLN A CG  1 
ATOM   7     C  CD  . GLN A  1  30  ? 27.767  14.227  23.025  1.00 80.90 ? 58   GLN A CD  1 
ATOM   8     O  OE1 . GLN A  1  30  ? 27.809  15.162  23.825  1.00 80.22 ? 58   GLN A OE1 1 
ATOM   9     N  NE2 . GLN A  1  30  ? 26.628  13.767  22.520  1.00 81.41 ? 58   GLN A NE2 1 
ATOM   10    N  N   . LEU A  1  31  ? 33.561  13.356  23.847  1.00 80.07 ? 59   LEU A N   1 
ATOM   11    C  CA  . LEU A  1  31  ? 34.720  13.663  24.667  1.00 78.77 ? 59   LEU A CA  1 
ATOM   12    C  C   . LEU A  1  31  ? 34.930  15.182  24.842  1.00 77.50 ? 59   LEU A C   1 
ATOM   13    O  O   . LEU A  1  31  ? 35.798  15.625  25.598  1.00 75.92 ? 59   LEU A O   1 
ATOM   14    C  CB  . LEU A  1  31  ? 35.892  12.960  23.980  1.00 78.36 ? 59   LEU A CB  1 
ATOM   15    C  CG  . LEU A  1  31  ? 37.346  13.350  23.812  1.00 78.18 ? 59   LEU A CG  1 
ATOM   16    C  CD1 . LEU A  1  31  ? 38.206  12.695  24.881  1.00 78.06 ? 59   LEU A CD1 1 
ATOM   17    C  CD2 . LEU A  1  31  ? 37.769  12.849  22.437  1.00 78.49 ? 59   LEU A CD2 1 
ATOM   18    N  N   . PHE A  1  32  ? 34.117  15.972  24.144  1.00 77.08 ? 60   PHE A N   1 
ATOM   19    C  CA  . PHE A  1  32  ? 34.195  17.426  24.245  1.00 76.66 ? 60   PHE A CA  1 
ATOM   20    C  C   . PHE A  1  32  ? 32.980  17.955  24.982  1.00 76.41 ? 60   PHE A C   1 
ATOM   21    O  O   . PHE A  1  32  ? 32.962  19.105  25.413  1.00 75.85 ? 60   PHE A O   1 
ATOM   22    C  CB  . PHE A  1  32  ? 34.265  18.086  22.859  1.00 76.97 ? 60   PHE A CB  1 
ATOM   23    C  CG  . PHE A  1  32  ? 35.551  17.830  22.134  1.00 76.53 ? 60   PHE A CG  1 
ATOM   24    C  CD1 . PHE A  1  32  ? 35.634  16.833  21.166  1.00 75.94 ? 60   PHE A CD1 1 
ATOM   25    C  CD2 . PHE A  1  32  ? 36.697  18.550  22.460  1.00 76.23 ? 60   PHE A CD2 1 
ATOM   26    C  CE1 . PHE A  1  32  ? 36.846  16.554  20.535  1.00 75.57 ? 60   PHE A CE1 1 
ATOM   27    C  CE2 . PHE A  1  32  ? 37.915  18.280  21.837  1.00 75.63 ? 60   PHE A CE2 1 
ATOM   28    C  CZ  . PHE A  1  32  ? 37.989  17.279  20.874  1.00 75.46 ? 60   PHE A CZ  1 
ATOM   29    N  N   . ALA A  1  33  ? 31.968  17.099  25.117  1.00 76.40 ? 61   ALA A N   1 
ATOM   30    C  CA  . ALA A  1  33  ? 30.729  17.450  25.799  1.00 75.48 ? 61   ALA A CA  1 
ATOM   31    C  C   . ALA A  1  33  ? 30.961  17.938  27.228  1.00 75.07 ? 61   ALA A C   1 
ATOM   32    O  O   . ALA A  1  33  ? 31.795  17.398  27.953  1.00 74.55 ? 61   ALA A O   1 
ATOM   33    C  CB  . ALA A  1  33  ? 29.790  16.258  25.807  1.00 75.19 ? 61   ALA A CB  1 
ATOM   34    N  N   . ASP A  1  34  ? 30.213  18.964  27.625  1.00 75.66 ? 62   ASP A N   1 
ATOM   35    C  CA  . ASP A  1  34  ? 30.322  19.541  28.964  1.00 75.58 ? 62   ASP A CA  1 
ATOM   36    C  C   . ASP A  1  34  ? 29.913  18.518  30.030  1.00 75.33 ? 62   ASP A C   1 
ATOM   37    O  O   . ASP A  1  34  ? 29.117  17.622  29.749  1.00 76.14 ? 62   ASP A O   1 
ATOM   38    C  CB  . ASP A  1  34  ? 29.418  20.775  29.066  1.00 75.37 ? 62   ASP A CB  1 
ATOM   39    C  CG  . ASP A  1  34  ? 29.831  21.889  28.120  1.00 74.93 ? 62   ASP A CG  1 
ATOM   40    O  OD1 . ASP A  1  34  ? 28.937  22.637  27.665  1.00 75.17 ? 62   ASP A OD1 1 
ATOM   41    O  OD2 . ASP A  1  34  ? 31.040  22.024  27.841  1.00 74.12 ? 62   ASP A OD2 1 
ATOM   42    N  N   . LEU A  1  35  ? 30.454  18.650  31.244  1.00 75.24 ? 63   LEU A N   1 
ATOM   43    C  CA  . LEU A  1  35  ? 30.120  17.737  32.344  1.00 74.91 ? 63   LEU A CA  1 
ATOM   44    C  C   . LEU A  1  35  ? 28.663  17.925  32.810  1.00 75.31 ? 63   LEU A C   1 
ATOM   45    O  O   . LEU A  1  35  ? 28.131  19.039  32.809  1.00 74.15 ? 63   LEU A O   1 
ATOM   46    C  CB  . LEU A  1  35  ? 31.076  17.953  33.523  1.00 72.90 ? 63   LEU A CB  1 
ATOM   47    C  CG  . LEU A  1  35  ? 32.553  17.634  33.290  1.00 72.54 ? 63   LEU A CG  1 
ATOM   48    C  CD1 . LEU A  1  35  ? 33.359  17.920  34.540  1.00 72.07 ? 63   LEU A CD1 1 
ATOM   49    C  CD2 . LEU A  1  35  ? 32.685  16.184  32.904  1.00 73.31 ? 63   LEU A CD2 1 
ATOM   50    N  N   . SER A  1  36  ? 28.021  16.827  33.201  1.00 75.46 ? 64   SER A N   1 
ATOM   51    C  CA  . SER A  1  36  ? 26.634  16.871  33.653  1.00 74.94 ? 64   SER A CA  1 
ATOM   52    C  C   . SER A  1  36  ? 26.503  16.522  35.126  1.00 74.88 ? 64   SER A C   1 
ATOM   53    O  O   . SER A  1  36  ? 27.384  15.903  35.720  1.00 75.04 ? 64   SER A O   1 
ATOM   54    C  CB  . SER A  1  36  ? 25.780  15.887  32.865  1.00 74.86 ? 64   SER A CB  1 
ATOM   55    O  OG  . SER A  1  36  ? 25.970  14.577  33.377  1.00 75.25 ? 64   SER A OG  1 
ATOM   56    N  N   . ARG A  1  37  ? 25.369  16.911  35.692  1.00 75.26 ? 65   ARG A N   1 
ATOM   57    C  CA  . ARG A  1  37  ? 25.041  16.670  37.089  1.00 75.77 ? 65   ARG A CA  1 
ATOM   58    C  C   . ARG A  1  37  ? 25.879  15.561  37.722  1.00 75.43 ? 65   ARG A C   1 
ATOM   59    O  O   . ARG A  1  37  ? 26.818  15.822  38.473  1.00 74.61 ? 65   ARG A O   1 
ATOM   60    C  CB  . ARG A  1  37  ? 23.557  16.322  37.181  1.00 75.76 ? 65   ARG A CB  1 
ATOM   61    C  CG  . ARG A  1  37  ? 22.770  16.939  36.053  1.00 77.01 ? 65   ARG A CG  1 
ATOM   62    C  CD  . ARG A  1  37  ? 21.300  16.646  36.137  1.00 79.05 ? 65   ARG A CD  1 
ATOM   63    N  NE  . ARG A  1  37  ? 20.594  17.302  35.036  1.00 82.26 ? 65   ARG A NE  1 
ATOM   64    C  CZ  . ARG A  1  37  ? 19.268  17.412  34.939  1.00 83.85 ? 65   ARG A CZ  1 
ATOM   65    N  NH1 . ARG A  1  37  ? 18.484  16.902  35.887  1.00 84.61 ? 65   ARG A NH1 1 
ATOM   66    N  NH2 . ARG A  1  37  ? 18.722  18.045  33.901  1.00 83.05 ? 65   ARG A NH2 1 
ATOM   67    N  N   . GLU A  1  38  ? 25.535  14.322  37.400  1.00 76.11 ? 66   GLU A N   1 
ATOM   68    C  CA  . GLU A  1  38  ? 26.225  13.160  37.939  1.00 76.22 ? 66   GLU A CA  1 
ATOM   69    C  C   . GLU A  1  38  ? 27.720  13.376  38.062  1.00 75.54 ? 66   GLU A C   1 
ATOM   70    O  O   . GLU A  1  38  ? 28.295  13.216  39.143  1.00 74.92 ? 66   GLU A O   1 
ATOM   71    C  CB  . GLU A  1  38  ? 25.967  11.940  37.059  1.00 76.72 ? 66   GLU A CB  1 
ATOM   72    C  CG  . GLU A  1  38  ? 24.493  11.526  36.928  1.00 77.66 ? 66   GLU A CG  1 
ATOM   73    C  CD  . GLU A  1  38  ? 23.664  12.482  36.069  1.00 78.58 ? 66   GLU A CD  1 
ATOM   74    O  OE1 . GLU A  1  38  ? 24.179  12.958  35.029  1.00 78.90 ? 66   GLU A OE1 1 
ATOM   75    O  OE2 . GLU A  1  38  ? 22.489  12.742  36.425  1.00 78.63 ? 66   GLU A OE2 1 
ATOM   76    N  N   . GLU A  1  39  ? 28.337  13.744  36.944  1.00 75.99 ? 67   GLU A N   1 
ATOM   77    C  CA  . GLU A  1  39  ? 29.777  13.973  36.880  1.00 76.48 ? 67   GLU A CA  1 
ATOM   78    C  C   . GLU A  1  39  ? 30.266  15.054  37.825  1.00 76.28 ? 67   GLU A C   1 
ATOM   79    O  O   . GLU A  1  39  ? 31.277  14.881  38.504  1.00 76.82 ? 67   GLU A O   1 
ATOM   80    C  CB  . GLU A  1  39  ? 30.188  14.364  35.474  1.00 76.02 ? 67   GLU A CB  1 
ATOM   81    C  CG  . GLU A  1  39  ? 29.624  13.503  34.403  1.00 75.21 ? 67   GLU A CG  1 
ATOM   82    C  CD  . GLU A  1  39  ? 30.493  13.549  33.189  1.00 75.33 ? 67   GLU A CD  1 
ATOM   83    O  OE1 . GLU A  1  39  ? 31.612  13.001  33.268  1.00 75.75 ? 67   GLU A OE1 1 
ATOM   84    O  OE2 . GLU A  1  39  ? 30.076  14.146  32.176  1.00 74.98 ? 67   GLU A OE2 1 
ATOM   85    N  N   . LEU A  1  40  ? 29.568  16.183  37.834  1.00 75.16 ? 68   LEU A N   1 
ATOM   86    C  CA  . LEU A  1  40  ? 29.927  17.289  38.703  1.00 75.05 ? 68   LEU A CA  1 
ATOM   87    C  C   . LEU A  1  40  ? 29.753  16.818  40.139  1.00 75.53 ? 68   LEU A C   1 
ATOM   88    O  O   . LEU A  1  40  ? 30.618  17.014  40.988  1.00 74.87 ? 68   LEU A O   1 
ATOM   89    C  CB  . LEU A  1  40  ? 29.019  18.480  38.417  1.00 75.61 ? 68   LEU A CB  1 
ATOM   90    C  CG  . LEU A  1  40  ? 29.296  19.201  37.101  1.00 74.47 ? 68   LEU A CG  1 
ATOM   91    C  CD1 . LEU A  1  40  ? 28.084  19.996  36.681  1.00 73.32 ? 68   LEU A CD1 1 
ATOM   92    C  CD2 . LEU A  1  40  ? 30.521  20.092  37.275  1.00 74.88 ? 68   LEU A CD2 1 
ATOM   93    N  N   . THR A  1  41  ? 28.621  16.184  40.400  1.00 75.55 ? 69   THR A N   1 
ATOM   94    C  CA  . THR A  1  41  ? 28.350  15.669  41.721  1.00 75.00 ? 69   THR A CA  1 
ATOM   95    C  C   . THR A  1  41  ? 29.507  14.771  42.105  1.00 75.10 ? 69   THR A C   1 
ATOM   96    O  O   . THR A  1  41  ? 30.142  14.962  43.136  1.00 75.10 ? 69   THR A O   1 
ATOM   97    C  CB  . THR A  1  41  ? 27.089  14.837  41.718  1.00 75.53 ? 69   THR A CB  1 
ATOM   98    O  OG1 . THR A  1  41  ? 25.995  15.636  41.253  1.00 75.00 ? 69   THR A OG1 1 
ATOM   99    C  CG2 . THR A  1  41  ? 26.801  14.334  43.112  1.00 76.58 ? 69   THR A CG2 1 
ATOM   100   N  N   . ALA A  1  42  ? 29.771  13.788  41.257  1.00 75.06 ? 70   ALA A N   1 
ATOM   101   C  CA  . ALA A  1  42  ? 30.852  12.852  41.488  1.00 74.82 ? 70   ALA A CA  1 
ATOM   102   C  C   . ALA A  1  42  ? 32.141  13.552  41.896  1.00 74.64 ? 70   ALA A C   1 
ATOM   103   O  O   . ALA A  1  42  ? 32.821  13.109  42.808  1.00 76.15 ? 70   ALA A O   1 
ATOM   104   C  CB  . ALA A  1  42  ? 31.082  12.023  40.244  1.00 75.30 ? 70   ALA A CB  1 
ATOM   105   N  N   . VAL A  1  43  ? 32.478  14.646  41.225  1.00 75.71 ? 71   VAL A N   1 
ATOM   106   C  CA  . VAL A  1  43  ? 33.705  15.388  41.531  1.00 76.66 ? 71   VAL A CA  1 
ATOM   107   C  C   . VAL A  1  43  ? 33.610  16.121  42.864  1.00 77.08 ? 71   VAL A C   1 
ATOM   108   O  O   . VAL A  1  43  ? 34.552  16.139  43.655  1.00 76.17 ? 71   VAL A O   1 
ATOM   109   C  CB  . VAL A  1  43  ? 34.011  16.433  40.444  1.00 75.60 ? 71   VAL A CB  1 
ATOM   110   C  CG1 . VAL A  1  43  ? 35.352  17.069  40.703  1.00 74.98 ? 71   VAL A CG1 1 
ATOM   111   C  CG2 . VAL A  1  43  ? 33.986  15.785  39.084  1.00 76.34 ? 71   VAL A CG2 1 
ATOM   112   N  N   . MET A  1  44  ? 32.467  16.748  43.094  1.00 78.46 ? 72   MET A N   1 
ATOM   113   C  CA  . MET A  1  44  ? 32.241  17.476  44.329  1.00 78.37 ? 72   MET A CA  1 
ATOM   114   C  C   . MET A  1  44  ? 32.298  16.466  45.458  1.00 78.80 ? 72   MET A C   1 
ATOM   115   O  O   . MET A  1  44  ? 33.107  16.594  46.366  1.00 79.02 ? 72   MET A O   1 
ATOM   116   C  CB  . MET A  1  44  ? 30.872  18.160  44.291  1.00 78.82 ? 72   MET A CB  1 
ATOM   117   C  CG  . MET A  1  44  ? 30.517  18.918  45.557  1.00 79.27 ? 72   MET A CG  1 
ATOM   118   S  SD  . MET A  1  44  ? 31.840  20.020  46.060  1.00 79.45 ? 72   MET A SD  1 
ATOM   119   C  CE  . MET A  1  44  ? 31.612  21.373  44.910  1.00 79.07 ? 72   MET A CE  1 
ATOM   120   N  N   . ARG A  1  45  ? 31.434  15.458  45.389  1.00 79.81 ? 73   ARG A N   1 
ATOM   121   C  CA  . ARG A  1  45  ? 31.398  14.407  46.398  1.00 80.36 ? 73   ARG A CA  1 
ATOM   122   C  C   . ARG A  1  45  ? 32.828  13.992  46.708  1.00 80.29 ? 73   ARG A C   1 
ATOM   123   O  O   . ARG A  1  45  ? 33.212  13.857  47.872  1.00 80.55 ? 73   ARG A O   1 
ATOM   124   C  CB  . ARG A  1  45  ? 30.619  13.196  45.873  1.00 80.29 ? 73   ARG A CB  1 
ATOM   125   C  CG  . ARG A  1  45  ? 30.810  11.918  46.689  1.00 80.89 ? 73   ARG A CG  1 
ATOM   126   C  CD  . ARG A  1  45  ? 30.307  10.689  45.931  1.00 81.96 ? 73   ARG A CD  1 
ATOM   127   N  NE  . ARG A  1  45  ? 28.863  10.729  45.684  1.00 83.73 ? 73   ARG A NE  1 
ATOM   128   C  CZ  . ARG A  1  45  ? 28.289  10.583  44.487  1.00 84.09 ? 73   ARG A CZ  1 
ATOM   129   N  NH1 . ARG A  1  45  ? 29.029  10.387  43.394  1.00 83.08 ? 73   ARG A NH1 1 
ATOM   130   N  NH2 . ARG A  1  45  ? 26.965  10.631  44.383  1.00 84.02 ? 73   ARG A NH2 1 
ATOM   131   N  N   . PHE A  1  46  ? 33.613  13.809  45.651  1.00 80.10 ? 74   PHE A N   1 
ATOM   132   C  CA  . PHE A  1  46  ? 35.006  13.403  45.779  1.00 80.82 ? 74   PHE A CA  1 
ATOM   133   C  C   . PHE A  1  46  ? 35.893  14.482  46.379  1.00 79.84 ? 74   PHE A C   1 
ATOM   134   O  O   . PHE A  1  46  ? 36.867  14.180  47.058  1.00 79.37 ? 74   PHE A O   1 
ATOM   135   C  CB  . PHE A  1  46  ? 35.581  13.010  44.419  1.00 81.26 ? 74   PHE A CB  1 
ATOM   136   C  CG  . PHE A  1  46  ? 37.035  12.656  44.473  1.00 81.93 ? 74   PHE A CG  1 
ATOM   137   C  CD1 . PHE A  1  46  ? 37.446  11.420  44.970  1.00 82.14 ? 74   PHE A CD1 1 
ATOM   138   C  CD2 . PHE A  1  46  ? 38.002  13.582  44.094  1.00 81.73 ? 74   PHE A CD2 1 
ATOM   139   C  CE1 . PHE A  1  46  ? 38.805  11.110  45.093  1.00 81.81 ? 74   PHE A CE1 1 
ATOM   140   C  CE2 . PHE A  1  46  ? 39.365  13.284  44.213  1.00 82.16 ? 74   PHE A CE2 1 
ATOM   141   C  CZ  . PHE A  1  46  ? 39.767  12.043  44.716  1.00 81.62 ? 74   PHE A CZ  1 
ATOM   142   N  N   . LEU A  1  47  ? 35.564  15.737  46.108  1.00 80.77 ? 75   LEU A N   1 
ATOM   143   C  CA  . LEU A  1  47  ? 36.338  16.859  46.626  1.00 81.99 ? 75   LEU A CA  1 
ATOM   144   C  C   . LEU A  1  47  ? 36.160  17.071  48.129  1.00 81.35 ? 75   LEU A C   1 
ATOM   145   O  O   . LEU A  1  47  ? 37.138  17.221  48.860  1.00 80.46 ? 75   LEU A O   1 
ATOM   146   C  CB  . LEU A  1  47  ? 35.954  18.143  45.891  1.00 81.51 ? 75   LEU A CB  1 
ATOM   147   C  CG  . LEU A  1  47  ? 36.500  18.350  44.487  1.00 80.35 ? 75   LEU A CG  1 
ATOM   148   C  CD1 . LEU A  1  47  ? 35.857  19.583  43.892  1.00 81.08 ? 75   LEU A CD1 1 
ATOM   149   C  CD2 . LEU A  1  47  ? 38.012  18.497  44.541  1.00 79.84 ? 75   LEU A CD2 1 
ATOM   150   N  N   . THR A  1  48  ? 34.911  17.098  48.585  1.00 81.86 ? 76   THR A N   1 
ATOM   151   C  CA  . THR A  1  48  ? 34.633  17.301  50.001  1.00 82.88 ? 76   THR A CA  1 
ATOM   152   C  C   . THR A  1  48  ? 35.223  16.157  50.812  1.00 82.66 ? 76   THR A C   1 
ATOM   153   O  O   . THR A  1  48  ? 35.425  16.287  52.020  1.00 82.65 ? 76   THR A O   1 
ATOM   154   C  CB  . THR A  1  48  ? 33.109  17.399  50.289  1.00 82.61 ? 76   THR A CB  1 
ATOM   155   O  OG1 . THR A  1  48  ? 32.435  16.275  49.705  1.00 83.61 ? 76   THR A OG1 1 
ATOM   156   C  CG2 . THR A  1  48  ? 32.532  18.704  49.731  1.00 81.65 ? 76   THR A CG2 1 
ATOM   157   N  N   . GLN A  1  49  ? 35.505  15.043  50.138  1.00 83.12 ? 77   GLN A N   1 
ATOM   158   C  CA  . GLN A  1  49  ? 36.092  13.869  50.784  1.00 83.97 ? 77   GLN A CA  1 
ATOM   159   C  C   . GLN A  1  49  ? 37.608  13.969  50.941  1.00 84.46 ? 77   GLN A C   1 
ATOM   160   O  O   . GLN A  1  49  ? 38.131  13.882  52.050  1.00 85.33 ? 77   GLN A O   1 
ATOM   161   C  CB  . GLN A  1  49  ? 35.769  12.601  49.999  1.00 83.79 ? 77   GLN A CB  1 
ATOM   162   C  CG  . GLN A  1  49  ? 34.336  12.144  50.119  1.00 85.07 ? 77   GLN A CG  1 
ATOM   163   C  CD  . GLN A  1  49  ? 34.169  10.695  49.694  1.00 86.21 ? 77   GLN A CD  1 
ATOM   164   O  OE1 . GLN A  1  49  ? 34.418  10.340  48.533  1.00 85.73 ? 77   GLN A OE1 1 
ATOM   165   N  NE2 . GLN A  1  49  ? 33.753  9.843   50.638  1.00 86.30 ? 77   GLN A NE2 1 
ATOM   166   N  N   . ARG A  1  50  ? 38.309  14.142  49.826  1.00 84.09 ? 78   ARG A N   1 
ATOM   167   C  CA  . ARG A  1  50  ? 39.762  14.251  49.839  1.00 84.37 ? 78   ARG A CA  1 
ATOM   168   C  C   . ARG A  1  50  ? 40.261  15.615  50.316  1.00 85.30 ? 78   ARG A C   1 
ATOM   169   O  O   . ARG A  1  50  ? 41.413  15.746  50.733  1.00 85.74 ? 78   ARG A O   1 
ATOM   170   C  CB  . ARG A  1  50  ? 40.319  13.964  48.441  1.00 85.62 ? 78   ARG A CB  1 
ATOM   171   C  CG  . ARG A  1  50  ? 40.336  12.491  48.058  1.00 86.71 ? 78   ARG A CG  1 
ATOM   172   C  CD  . ARG A  1  50  ? 41.654  11.809  48.439  1.00 88.23 ? 78   ARG A CD  1 
ATOM   173   N  NE  . ARG A  1  50  ? 42.789  12.318  47.662  1.00 89.56 ? 78   ARG A NE  1 
ATOM   174   C  CZ  . ARG A  1  50  ? 43.591  13.316  48.039  1.00 90.12 ? 78   ARG A CZ  1 
ATOM   175   N  NH1 . ARG A  1  50  ? 43.404  13.936  49.200  1.00 89.65 ? 78   ARG A NH1 1 
ATOM   176   N  NH2 . ARG A  1  50  ? 44.585  13.703  47.246  1.00 89.92 ? 78   ARG A NH2 1 
ATOM   177   N  N   . LEU A  1  51  ? 39.409  16.633  50.246  1.00 85.42 ? 79   LEU A N   1 
ATOM   178   C  CA  . LEU A  1  51  ? 39.805  17.970  50.688  1.00 85.44 ? 79   LEU A CA  1 
ATOM   179   C  C   . LEU A  1  51  ? 39.754  18.130  52.200  1.00 86.09 ? 79   LEU A C   1 
ATOM   180   O  O   . LEU A  1  51  ? 40.403  19.017  52.758  1.00 85.55 ? 79   LEU A O   1 
ATOM   181   C  CB  . LEU A  1  51  ? 38.930  19.029  50.028  1.00 85.76 ? 79   LEU A CB  1 
ATOM   182   C  CG  . LEU A  1  51  ? 39.476  19.486  48.677  1.00 85.93 ? 79   LEU A CG  1 
ATOM   183   C  CD1 . LEU A  1  51  ? 38.423  20.269  47.925  1.00 86.17 ? 79   LEU A CD1 1 
ATOM   184   C  CD2 . LEU A  1  51  ? 40.732  20.319  48.912  1.00 85.75 ? 79   LEU A CD2 1 
ATOM   185   N  N   . GLY A  1  52  ? 38.968  17.276  52.854  1.00 86.35 ? 80   GLY A N   1 
ATOM   186   C  CA  . GLY A  1  52  ? 38.865  17.309  54.300  1.00 85.23 ? 80   GLY A CA  1 
ATOM   187   C  C   . GLY A  1  52  ? 37.767  18.170  54.889  1.00 85.11 ? 80   GLY A C   1 
ATOM   188   O  O   . GLY A  1  52  ? 36.839  18.586  54.186  1.00 85.15 ? 80   GLY A O   1 
ATOM   189   N  N   . PRO A  1  53  ? 37.861  18.448  56.198  1.00 84.84 ? 81   PRO A N   1 
ATOM   190   C  CA  . PRO A  1  53  ? 36.928  19.252  56.999  1.00 84.92 ? 81   PRO A CA  1 
ATOM   191   C  C   . PRO A  1  53  ? 36.710  20.715  56.589  1.00 84.24 ? 81   PRO A C   1 
ATOM   192   O  O   . PRO A  1  53  ? 35.624  21.064  56.129  1.00 84.02 ? 81   PRO A O   1 
ATOM   193   C  CB  . PRO A  1  53  ? 37.481  19.109  58.423  1.00 85.41 ? 81   PRO A CB  1 
ATOM   194   C  CG  . PRO A  1  53  ? 38.939  18.803  58.218  1.00 84.79 ? 81   PRO A CG  1 
ATOM   195   C  CD  . PRO A  1  53  ? 38.909  17.862  57.055  1.00 84.86 ? 81   PRO A CD  1 
ATOM   196   N  N   . GLY A  1  54  ? 37.727  21.563  56.758  1.00 84.07 ? 82   GLY A N   1 
ATOM   197   C  CA  . GLY A  1  54  ? 37.592  22.973  56.411  1.00 83.92 ? 82   GLY A CA  1 
ATOM   198   C  C   . GLY A  1  54  ? 37.222  23.282  54.966  1.00 83.67 ? 82   GLY A C   1 
ATOM   199   O  O   . GLY A  1  54  ? 38.066  23.735  54.188  1.00 83.77 ? 82   GLY A O   1 
ATOM   200   N  N   . LEU A  1  55  ? 35.957  23.067  54.609  1.00 82.37 ? 83   LEU A N   1 
ATOM   201   C  CA  . LEU A  1  55  ? 35.497  23.293  53.243  1.00 81.31 ? 83   LEU A CA  1 
ATOM   202   C  C   . LEU A  1  55  ? 34.051  23.771  53.220  1.00 81.28 ? 83   LEU A C   1 
ATOM   203   O  O   . LEU A  1  55  ? 33.132  22.965  53.051  1.00 81.32 ? 83   LEU A O   1 
ATOM   204   C  CB  . LEU A  1  55  ? 35.604  21.986  52.457  1.00 81.64 ? 83   LEU A CB  1 
ATOM   205   C  CG  . LEU A  1  55  ? 35.314  21.999  50.960  1.00 80.91 ? 83   LEU A CG  1 
ATOM   206   C  CD1 . LEU A  1  55  ? 36.506  22.558  50.217  1.00 80.05 ? 83   LEU A CD1 1 
ATOM   207   C  CD2 . LEU A  1  55  ? 35.034  20.589  50.504  1.00 80.89 ? 83   LEU A CD2 1 
ATOM   208   N  N   . VAL A  1  56  ? 33.844  25.075  53.372  1.00 80.57 ? 84   VAL A N   1 
ATOM   209   C  CA  . VAL A  1  56  ? 32.489  25.615  53.377  1.00 80.30 ? 84   VAL A CA  1 
ATOM   210   C  C   . VAL A  1  56  ? 31.875  25.728  51.986  1.00 80.28 ? 84   VAL A C   1 
ATOM   211   O  O   . VAL A  1  56  ? 32.576  25.663  50.969  1.00 79.45 ? 84   VAL A O   1 
ATOM   212   C  CB  . VAL A  1  56  ? 32.445  27.002  54.013  1.00 80.10 ? 84   VAL A CB  1 
ATOM   213   C  CG1 . VAL A  1  56  ? 31.012  27.321  54.448  1.00 79.91 ? 84   VAL A CG1 1 
ATOM   214   C  CG2 . VAL A  1  56  ? 33.420  27.068  55.173  1.00 79.45 ? 84   VAL A CG2 1 
ATOM   215   N  N   . ASP A  1  57  ? 30.555  25.884  51.945  1.00 79.45 ? 85   ASP A N   1 
ATOM   216   C  CA  . ASP A  1  57  ? 29.867  26.021  50.673  1.00 78.11 ? 85   ASP A CA  1 
ATOM   217   C  C   . ASP A  1  57  ? 30.202  27.403  50.167  1.00 77.74 ? 85   ASP A C   1 
ATOM   218   O  O   . ASP A  1  57  ? 29.711  28.393  50.709  1.00 78.08 ? 85   ASP A O   1 
ATOM   219   C  CB  . ASP A  1  57  ? 28.356  25.903  50.848  1.00 78.12 ? 85   ASP A CB  1 
ATOM   220   C  CG  . ASP A  1  57  ? 27.615  26.036  49.536  1.00 77.71 ? 85   ASP A CG  1 
ATOM   221   O  OD1 . ASP A  1  57  ? 27.829  27.048  48.846  1.00 77.78 ? 85   ASP A OD1 1 
ATOM   222   O  OD2 . ASP A  1  57  ? 26.824  25.136  49.187  1.00 77.54 ? 85   ASP A OD2 1 
ATOM   223   N  N   . ALA A  1  58  ? 31.041  27.464  49.135  1.00 77.93 ? 86   ALA A N   1 
ATOM   224   C  CA  . ALA A  1  58  ? 31.476  28.730  48.539  1.00 77.28 ? 86   ALA A CA  1 
ATOM   225   C  C   . ALA A  1  58  ? 30.362  29.782  48.415  1.00 77.87 ? 86   ALA A C   1 
ATOM   226   O  O   . ALA A  1  58  ? 30.643  30.986  48.317  1.00 77.53 ? 86   ALA A O   1 
ATOM   227   C  CB  . ALA A  1  58  ? 32.103  28.466  47.171  1.00 76.36 ? 86   ALA A CB  1 
ATOM   228   N  N   . ALA A  1  59  ? 29.108  29.328  48.426  1.00 76.68 ? 87   ALA A N   1 
ATOM   229   C  CA  . ALA A  1  59  ? 27.958  30.219  48.319  1.00 74.92 ? 87   ALA A CA  1 
ATOM   230   C  C   . ALA A  1  59  ? 27.898  31.207  49.473  1.00 75.45 ? 87   ALA A C   1 
ATOM   231   O  O   . ALA A  1  59  ? 27.453  32.339  49.306  1.00 75.84 ? 87   ALA A O   1 
ATOM   232   C  CB  . ALA A  1  59  ? 26.685  29.417  48.279  1.00 75.10 ? 87   ALA A CB  1 
ATOM   233   N  N   . GLN A  1  60  ? 28.346  30.772  50.643  1.00 75.07 ? 88   GLN A N   1 
ATOM   234   C  CA  . GLN A  1  60  ? 28.336  31.617  51.822  1.00 74.34 ? 88   GLN A CA  1 
ATOM   235   C  C   . GLN A  1  60  ? 29.760  31.807  52.291  1.00 73.54 ? 88   GLN A C   1 
ATOM   236   O  O   . GLN A  1  60  ? 30.070  32.764  52.990  1.00 74.30 ? 88   GLN A O   1 
ATOM   237   C  CB  . GLN A  1  60  ? 27.530  30.948  52.920  1.00 75.35 ? 88   GLN A CB  1 
ATOM   238   C  CG  . GLN A  1  60  ? 26.470  30.006  52.399  1.00 76.35 ? 88   GLN A CG  1 
ATOM   239   C  CD  . GLN A  1  60  ? 26.174  28.886  53.380  1.00 77.89 ? 88   GLN A CD  1 
ATOM   240   O  OE1 . GLN A  1  60  ? 27.087  28.179  53.838  1.00 78.19 ? 88   GLN A OE1 1 
ATOM   241   N  NE2 . GLN A  1  60  ? 24.896  28.710  53.709  1.00 77.75 ? 88   GLN A NE2 1 
ATOM   242   N  N   . ALA A  1  61  ? 30.619  30.873  51.904  1.00 73.58 ? 89   ALA A N   1 
ATOM   243   C  CA  . ALA A  1  61  ? 32.024  30.916  52.269  1.00 73.46 ? 89   ALA A CA  1 
ATOM   244   C  C   . ALA A  1  61  ? 32.508  32.335  52.524  1.00 73.11 ? 89   ALA A C   1 
ATOM   245   O  O   . ALA A  1  61  ? 32.204  33.276  51.786  1.00 72.59 ? 89   ALA A O   1 
ATOM   246   C  CB  . ALA A  1  61  ? 32.862  30.269  51.186  1.00 73.99 ? 89   ALA A CB  1 
ATOM   247   N  N   . ARG A  1  62  ? 33.273  32.468  53.591  1.00 72.91 ? 90   ARG A N   1 
ATOM   248   C  CA  . ARG A  1  62  ? 33.802  33.749  53.993  1.00 72.29 ? 90   ARG A CA  1 
ATOM   249   C  C   . ARG A  1  62  ? 35.260  33.866  53.560  1.00 72.66 ? 90   ARG A C   1 
ATOM   250   O  O   . ARG A  1  62  ? 35.973  32.867  53.469  1.00 72.58 ? 90   ARG A O   1 
ATOM   251   C  CB  . ARG A  1  62  ? 33.698  33.872  55.509  1.00 73.72 ? 90   ARG A CB  1 
ATOM   252   C  CG  . ARG A  1  62  ? 33.809  35.276  56.026  1.00 75.13 ? 90   ARG A CG  1 
ATOM   253   C  CD  . ARG A  1  62  ? 34.149  35.288  57.500  1.00 77.08 ? 90   ARG A CD  1 
ATOM   254   N  NE  . ARG A  1  62  ? 34.129  36.650  58.029  1.00 79.63 ? 90   ARG A NE  1 
ATOM   255   C  CZ  . ARG A  1  62  ? 34.464  36.988  59.274  1.00 80.73 ? 90   ARG A CZ  1 
ATOM   256   N  NH1 . ARG A  1  62  ? 34.860  36.055  60.141  1.00 80.76 ? 90   ARG A NH1 1 
ATOM   257   N  NH2 . ARG A  1  62  ? 34.382  38.262  59.661  1.00 81.05 ? 90   ARG A NH2 1 
ATOM   258   N  N   . PRO A  1  63  ? 35.722  35.097  53.294  1.00 73.14 ? 91   PRO A N   1 
ATOM   259   C  CA  . PRO A  1  63  ? 37.098  35.354  52.871  1.00 72.36 ? 91   PRO A CA  1 
ATOM   260   C  C   . PRO A  1  63  ? 38.125  34.351  53.357  1.00 71.13 ? 91   PRO A C   1 
ATOM   261   O  O   . PRO A  1  63  ? 38.779  33.700  52.552  1.00 71.29 ? 91   PRO A O   1 
ATOM   262   C  CB  . PRO A  1  63  ? 37.346  36.759  53.394  1.00 72.11 ? 91   PRO A CB  1 
ATOM   263   C  CG  . PRO A  1  63  ? 36.038  37.425  53.053  1.00 72.80 ? 91   PRO A CG  1 
ATOM   264   C  CD  . PRO A  1  63  ? 34.979  36.367  53.418  1.00 73.43 ? 91   PRO A CD  1 
ATOM   265   N  N   . SER A  1  64  ? 38.258  34.206  54.669  1.00 70.81 ? 92   SER A N   1 
ATOM   266   C  CA  . SER A  1  64  ? 39.249  33.279  55.183  1.00 71.02 ? 92   SER A CA  1 
ATOM   267   C  C   . SER A  1  64  ? 38.746  31.838  55.316  1.00 70.62 ? 92   SER A C   1 
ATOM   268   O  O   . SER A  1  64  ? 39.033  31.146  56.295  1.00 70.58 ? 92   SER A O   1 
ATOM   269   C  CB  . SER A  1  64  ? 39.795  33.787  56.519  1.00 71.45 ? 92   SER A CB  1 
ATOM   270   O  OG  . SER A  1  64  ? 41.112  33.294  56.736  1.00 71.04 ? 92   SER A OG  1 
ATOM   271   N  N   . ASP A  1  65  ? 38.007  31.385  54.312  1.00 69.53 ? 93   ASP A N   1 
ATOM   272   C  CA  . ASP A  1  65  ? 37.483  30.030  54.299  1.00 68.81 ? 93   ASP A CA  1 
ATOM   273   C  C   . ASP A  1  65  ? 38.118  29.246  53.174  1.00 68.92 ? 93   ASP A C   1 
ATOM   274   O  O   . ASP A  1  65  ? 38.865  29.786  52.365  1.00 68.84 ? 93   ASP A O   1 
ATOM   275   C  CB  . ASP A  1  65  ? 35.973  30.039  54.068  1.00 69.38 ? 93   ASP A CB  1 
ATOM   276   C  CG  . ASP A  1  65  ? 35.182  29.981  55.353  1.00 70.48 ? 93   ASP A CG  1 
ATOM   277   O  OD1 . ASP A  1  65  ? 33.940  30.072  55.278  1.00 70.64 ? 93   ASP A OD1 1 
ATOM   278   O  OD2 . ASP A  1  65  ? 35.793  29.838  56.436  1.00 71.56 ? 93   ASP A OD2 1 
ATOM   279   N  N   . ASN A  1  66  ? 37.813  27.959  53.135  1.00 68.74 ? 94   ASN A N   1 
ATOM   280   C  CA  . ASN A  1  66  ? 38.294  27.096  52.076  1.00 68.14 ? 94   ASN A CA  1 
ATOM   281   C  C   . ASN A  1  66  ? 37.004  26.702  51.396  1.00 68.14 ? 94   ASN A C   1 
ATOM   282   O  O   . ASN A  1  66  ? 36.047  26.321  52.077  1.00 68.46 ? 94   ASN A O   1 
ATOM   283   C  CB  . ASN A  1  66  ? 38.971  25.845  52.634  1.00 66.98 ? 94   ASN A CB  1 
ATOM   284   C  CG  . ASN A  1  66  ? 40.289  26.141  53.294  1.00 66.57 ? 94   ASN A CG  1 
ATOM   285   O  OD1 . ASN A  1  66  ? 40.671  27.293  53.448  1.00 66.66 ? 94   ASN A OD1 1 
ATOM   286   N  ND2 . ASN A  1  66  ? 40.992  25.096  53.697  1.00 67.21 ? 94   ASN A ND2 1 
ATOM   287   N  N   . CYS A  1  67  ? 36.959  26.825  50.070  1.00 68.21 ? 95   CYS A N   1 
ATOM   288   C  CA  . CYS A  1  67  ? 35.765  26.451  49.308  1.00 69.16 ? 95   CYS A CA  1 
ATOM   289   C  C   . CYS A  1  67  ? 36.066  26.156  47.844  1.00 68.01 ? 95   CYS A C   1 
ATOM   290   O  O   . CYS A  1  67  ? 37.066  26.621  47.297  1.00 68.43 ? 95   CYS A O   1 
ATOM   291   C  CB  . CYS A  1  67  ? 34.686  27.545  49.400  1.00 68.64 ? 95   CYS A CB  1 
ATOM   292   S  SG  . CYS A  1  67  ? 35.128  29.151  48.689  1.00 69.21 ? 95   CYS A SG  1 
ATOM   293   N  N   . VAL A  1  68  ? 35.196  25.364  47.225  1.00 67.30 ? 96   VAL A N   1 
ATOM   294   C  CA  . VAL A  1  68  ? 35.332  25.003  45.820  1.00 67.73 ? 96   VAL A CA  1 
ATOM   295   C  C   . VAL A  1  68  ? 34.579  26.055  44.993  1.00 68.19 ? 96   VAL A C   1 
ATOM   296   O  O   . VAL A  1  68  ? 33.339  26.080  44.954  1.00 68.26 ? 96   VAL A O   1 
ATOM   297   C  CB  . VAL A  1  68  ? 34.766  23.577  45.573  1.00 67.44 ? 96   VAL A CB  1 
ATOM   298   C  CG1 . VAL A  1  68  ? 34.722  23.254  44.089  1.00 67.05 ? 96   VAL A CG1 1 
ATOM   299   C  CG2 . VAL A  1  68  ? 35.637  22.567  46.292  1.00 67.11 ? 96   VAL A CG2 1 
ATOM   300   N  N   . PHE A  1  69  ? 35.348  26.931  44.348  1.00 67.55 ? 97   PHE A N   1 
ATOM   301   C  CA  . PHE A  1  69  ? 34.797  28.019  43.544  1.00 66.96 ? 97   PHE A CA  1 
ATOM   302   C  C   . PHE A  1  69  ? 34.134  27.522  42.270  1.00 66.09 ? 97   PHE A C   1 
ATOM   303   O  O   . PHE A  1  69  ? 33.139  28.090  41.809  1.00 65.72 ? 97   PHE A O   1 
ATOM   304   C  CB  . PHE A  1  69  ? 35.910  29.034  43.203  1.00 66.07 ? 97   PHE A CB  1 
ATOM   305   C  CG  . PHE A  1  69  ? 35.430  30.242  42.429  1.00 66.45 ? 97   PHE A CG  1 
ATOM   306   C  CD1 . PHE A  1  69  ? 34.382  31.030  42.910  1.00 66.21 ? 97   PHE A CD1 1 
ATOM   307   C  CD2 . PHE A  1  69  ? 36.025  30.592  41.219  1.00 65.69 ? 97   PHE A CD2 1 
ATOM   308   C  CE1 . PHE A  1  69  ? 33.934  32.145  42.198  1.00 65.76 ? 97   PHE A CE1 1 
ATOM   309   C  CE2 . PHE A  1  69  ? 35.582  31.708  40.500  1.00 65.52 ? 97   PHE A CE2 1 
ATOM   310   C  CZ  . PHE A  1  69  ? 34.535  32.484  40.991  1.00 65.49 ? 97   PHE A CZ  1 
ATOM   311   N  N   . SER A  1  70  ? 34.670  26.449  41.707  1.00 65.42 ? 98   SER A N   1 
ATOM   312   C  CA  . SER A  1  70  ? 34.111  25.951  40.476  1.00 65.03 ? 98   SER A CA  1 
ATOM   313   C  C   . SER A  1  70  ? 34.697  24.631  40.051  1.00 64.72 ? 98   SER A C   1 
ATOM   314   O  O   . SER A  1  70  ? 35.889  24.388  40.216  1.00 64.14 ? 98   SER A O   1 
ATOM   315   C  CB  . SER A  1  70  ? 34.363  26.971  39.386  1.00 66.02 ? 98   SER A CB  1 
ATOM   316   O  OG  . SER A  1  70  ? 35.749  27.261  39.335  1.00 66.63 ? 98   SER A OG  1 
ATOM   317   N  N   . VAL A  1  71  ? 33.836  23.799  39.481  1.00 65.26 ? 99   VAL A N   1 
ATOM   318   C  CA  . VAL A  1  71  ? 34.205  22.484  38.977  1.00 66.64 ? 99   VAL A CA  1 
ATOM   319   C  C   . VAL A  1  71  ? 33.775  22.413  37.519  1.00 66.35 ? 99   VAL A C   1 
ATOM   320   O  O   . VAL A  1  71  ? 32.587  22.291  37.229  1.00 66.62 ? 99   VAL A O   1 
ATOM   321   C  CB  . VAL A  1  71  ? 33.483  21.372  39.753  1.00 66.29 ? 99   VAL A CB  1 
ATOM   322   C  CG1 . VAL A  1  71  ? 33.702  20.027  39.072  1.00 65.91 ? 99   VAL A CG1 1 
ATOM   323   C  CG2 . VAL A  1  71  ? 33.982  21.347  41.182  1.00 65.47 ? 99   VAL A CG2 1 
ATOM   324   N  N   . GLU A  1  72  ? 34.739  22.489  36.605  1.00 67.01 ? 100  GLU A N   1 
ATOM   325   C  CA  . GLU A  1  72  ? 34.435  22.449  35.173  1.00 67.68 ? 100  GLU A CA  1 
ATOM   326   C  C   . GLU A  1  72  ? 35.159  21.312  34.433  1.00 68.36 ? 100  GLU A C   1 
ATOM   327   O  O   . GLU A  1  72  ? 35.942  20.561  35.031  1.00 68.66 ? 100  GLU A O   1 
ATOM   328   C  CB  . GLU A  1  72  ? 34.804  23.791  34.519  1.00 67.99 ? 100  GLU A CB  1 
ATOM   329   C  CG  . GLU A  1  72  ? 33.929  24.168  33.311  1.00 69.16 ? 100  GLU A CG  1 
ATOM   330   C  CD  . GLU A  1  72  ? 34.519  25.285  32.450  1.00 69.73 ? 100  GLU A CD  1 
ATOM   331   O  OE1 . GLU A  1  72  ? 34.975  26.314  33.011  1.00 67.53 ? 100  GLU A OE1 1 
ATOM   332   O  OE2 . GLU A  1  72  ? 34.512  25.125  31.201  1.00 70.68 ? 100  GLU A OE2 1 
ATOM   333   N  N   . LEU A  1  73  ? 34.884  21.192  33.134  1.00 67.21 ? 101  LEU A N   1 
ATOM   334   C  CA  . LEU A  1  73  ? 35.511  20.169  32.313  1.00 67.40 ? 101  LEU A CA  1 
ATOM   335   C  C   . LEU A  1  73  ? 36.902  20.605  31.882  1.00 68.62 ? 101  LEU A C   1 
ATOM   336   O  O   . LEU A  1  73  ? 37.069  21.667  31.276  1.00 67.76 ? 101  LEU A O   1 
ATOM   337   C  CB  . LEU A  1  73  ? 34.679  19.883  31.059  1.00 66.98 ? 101  LEU A CB  1 
ATOM   338   C  CG  . LEU A  1  73  ? 35.441  19.146  29.947  1.00 66.81 ? 101  LEU A CG  1 
ATOM   339   C  CD1 . LEU A  1  73  ? 35.924  17.797  30.443  1.00 66.74 ? 101  LEU A CD1 1 
ATOM   340   C  CD2 . LEU A  1  73  ? 34.549  18.971  28.745  1.00 67.17 ? 101  LEU A CD2 1 
ATOM   341   N  N   . GLN A  1  74  ? 37.895  19.783  32.214  1.00 68.28 ? 102  GLN A N   1 
ATOM   342   C  CA  . GLN A  1  74  ? 39.274  20.040  31.830  1.00 66.59 ? 102  GLN A CA  1 
ATOM   343   C  C   . GLN A  1  74  ? 39.395  19.462  30.443  1.00 67.56 ? 102  GLN A C   1 
ATOM   344   O  O   . GLN A  1  74  ? 39.299  18.248  30.274  1.00 68.81 ? 102  GLN A O   1 
ATOM   345   C  CB  . GLN A  1  74  ? 40.232  19.303  32.746  1.00 66.40 ? 102  GLN A CB  1 
ATOM   346   C  CG  . GLN A  1  74  ? 41.650  19.236  32.217  1.00 65.26 ? 102  GLN A CG  1 
ATOM   347   C  CD  . GLN A  1  74  ? 42.263  20.604  31.990  1.00 63.77 ? 102  GLN A CD  1 
ATOM   348   O  OE1 . GLN A  1  74  ? 42.192  21.477  32.843  1.00 62.84 ? 102  GLN A OE1 1 
ATOM   349   N  NE2 . GLN A  1  74  ? 42.878  20.788  30.839  1.00 64.13 ? 102  GLN A NE2 1 
ATOM   350   N  N   . LEU A  1  75  ? 39.598  20.330  29.455  1.00 68.32 ? 103  LEU A N   1 
ATOM   351   C  CA  . LEU A  1  75  ? 39.722  19.918  28.056  1.00 68.45 ? 103  LEU A CA  1 
ATOM   352   C  C   . LEU A  1  75  ? 40.886  18.967  27.768  1.00 68.34 ? 103  LEU A C   1 
ATOM   353   O  O   . LEU A  1  75  ? 42.037  19.241  28.117  1.00 67.81 ? 103  LEU A O   1 
ATOM   354   C  CB  . LEU A  1  75  ? 39.810  21.154  27.170  1.00 67.83 ? 103  LEU A CB  1 
ATOM   355   C  CG  . LEU A  1  75  ? 38.454  21.849  27.095  1.00 67.40 ? 103  LEU A CG  1 
ATOM   356   C  CD1 . LEU A  1  75  ? 38.642  23.250  26.603  1.00 67.58 ? 103  LEU A CD1 1 
ATOM   357   C  CD2 . LEU A  1  75  ? 37.510  21.063  26.196  1.00 67.39 ? 103  LEU A CD2 1 
ATOM   358   N  N   . PRO A  1  76  ? 40.592  17.845  27.088  1.00 68.09 ? 104  PRO A N   1 
ATOM   359   C  CA  . PRO A  1  76  ? 41.555  16.808  26.727  1.00 68.13 ? 104  PRO A CA  1 
ATOM   360   C  C   . PRO A  1  76  ? 42.707  17.265  25.849  1.00 69.28 ? 104  PRO A C   1 
ATOM   361   O  O   . PRO A  1  76  ? 42.569  18.180  25.027  1.00 69.23 ? 104  PRO A O   1 
ATOM   362   C  CB  . PRO A  1  76  ? 40.687  15.787  26.017  1.00 67.46 ? 104  PRO A CB  1 
ATOM   363   C  CG  . PRO A  1  76  ? 39.762  16.665  25.263  1.00 67.35 ? 104  PRO A CG  1 
ATOM   364   C  CD  . PRO A  1  76  ? 39.344  17.655  26.326  1.00 68.16 ? 104  PRO A CD  1 
ATOM   365   N  N   . PRO A  1  77  ? 43.868  16.622  26.012  1.00 68.99 ? 105  PRO A N   1 
ATOM   366   C  CA  . PRO A  1  77  ? 45.050  16.961  25.216  1.00 68.85 ? 105  PRO A CA  1 
ATOM   367   C  C   . PRO A  1  77  ? 44.667  16.692  23.765  1.00 69.17 ? 105  PRO A C   1 
ATOM   368   O  O   . PRO A  1  77  ? 44.169  15.612  23.443  1.00 69.60 ? 105  PRO A O   1 
ATOM   369   C  CB  . PRO A  1  77  ? 46.093  15.978  25.728  1.00 69.91 ? 105  PRO A CB  1 
ATOM   370   C  CG  . PRO A  1  77  ? 45.242  14.759  26.088  1.00 69.38 ? 105  PRO A CG  1 
ATOM   371   C  CD  . PRO A  1  77  ? 44.089  15.401  26.809  1.00 68.15 ? 105  PRO A CD  1 
ATOM   372   N  N   . LYS A  1  78  ? 44.882  17.662  22.887  1.00 69.45 ? 106  LYS A N   1 
ATOM   373   C  CA  . LYS A  1  78  ? 44.507  17.478  21.489  1.00 69.60 ? 106  LYS A CA  1 
ATOM   374   C  C   . LYS A  1  78  ? 45.031  16.167  20.898  1.00 69.69 ? 106  LYS A C   1 
ATOM   375   O  O   . LYS A  1  78  ? 44.256  15.358  20.382  1.00 68.52 ? 106  LYS A O   1 
ATOM   376   C  CB  . LYS A  1  78  ? 44.996  18.668  20.654  1.00 69.60 ? 106  LYS A CB  1 
ATOM   377   C  CG  . LYS A  1  78  ? 44.487  18.698  19.208  1.00 69.36 ? 106  LYS A CG  1 
ATOM   378   C  CD  . LYS A  1  78  ? 44.951  19.955  18.453  1.00 67.90 ? 106  LYS A CD  1 
ATOM   379   C  CE  . LYS A  1  78  ? 44.512  19.927  16.996  1.00 66.88 ? 106  LYS A CE  1 
ATOM   380   N  NZ  . LYS A  1  78  ? 44.937  21.141  16.253  1.00 66.41 ? 106  LYS A NZ  1 
ATOM   381   N  N   . ALA A  1  79  ? 46.342  15.957  20.994  1.00 69.72 ? 107  ALA A N   1 
ATOM   382   C  CA  . ALA A  1  79  ? 46.986  14.763  20.454  1.00 69.83 ? 107  ALA A CA  1 
ATOM   383   C  C   . ALA A  1  79  ? 46.204  13.458  20.638  1.00 70.35 ? 107  ALA A C   1 
ATOM   384   O  O   . ALA A  1  79  ? 45.890  12.765  19.664  1.00 69.80 ? 107  ALA A O   1 
ATOM   385   C  CB  . ALA A  1  79  ? 48.364  14.626  21.054  1.00 69.44 ? 107  ALA A CB  1 
ATOM   386   N  N   . ALA A  1  80  ? 45.904  13.129  21.891  1.00 70.42 ? 108  ALA A N   1 
ATOM   387   C  CA  . ALA A  1  80  ? 45.175  11.907  22.236  1.00 70.84 ? 108  ALA A CA  1 
ATOM   388   C  C   . ALA A  1  80  ? 43.718  11.991  21.816  1.00 70.26 ? 108  ALA A C   1 
ATOM   389   O  O   . ALA A  1  80  ? 43.084  10.981  21.495  1.00 69.28 ? 108  ALA A O   1 
ATOM   390   C  CB  . ALA A  1  80  ? 45.267  11.662  23.738  1.00 71.49 ? 108  ALA A CB  1 
ATOM   391   N  N   . ALA A  1  81  ? 43.194  13.209  21.847  1.00 70.90 ? 109  ALA A N   1 
ATOM   392   C  CA  . ALA A  1  81  ? 41.820  13.459  21.468  1.00 70.90 ? 109  ALA A CA  1 
ATOM   393   C  C   . ALA A  1  81  ? 41.685  13.059  20.019  1.00 71.01 ? 109  ALA A C   1 
ATOM   394   O  O   . ALA A  1  81  ? 40.785  12.313  19.659  1.00 72.05 ? 109  ALA A O   1 
ATOM   395   C  CB  . ALA A  1  81  ? 41.490  14.922  21.641  1.00 71.36 ? 109  ALA A CB  1 
ATOM   396   N  N   . LEU A  1  82  ? 42.589  13.560  19.188  1.00 71.62 ? 110  LEU A N   1 
ATOM   397   C  CA  . LEU A  1  82  ? 42.572  13.228  17.772  1.00 72.14 ? 110  LEU A CA  1 
ATOM   398   C  C   . LEU A  1  82  ? 42.978  11.764  17.625  1.00 72.95 ? 110  LEU A C   1 
ATOM   399   O  O   . LEU A  1  82  ? 42.398  11.020  16.834  1.00 71.06 ? 110  LEU A O   1 
ATOM   400   C  CB  . LEU A  1  82  ? 43.547  14.124  17.012  1.00 71.31 ? 110  LEU A CB  1 
ATOM   401   C  CG  . LEU A  1  82  ? 43.256  15.620  17.110  1.00 71.09 ? 110  LEU A CG  1 
ATOM   402   C  CD1 . LEU A  1  82  ? 44.291  16.428  16.326  1.00 71.14 ? 110  LEU A CD1 1 
ATOM   403   C  CD2 . LEU A  1  82  ? 41.864  15.873  16.581  1.00 71.16 ? 110  LEU A CD2 1 
ATOM   404   N  N   . ALA A  1  83  ? 43.977  11.357  18.404  1.00 74.00 ? 111  ALA A N   1 
ATOM   405   C  CA  . ALA A  1  83  ? 44.449  9.978   18.375  1.00 74.50 ? 111  ALA A CA  1 
ATOM   406   C  C   . ALA A  1  83  ? 43.246  9.031   18.413  1.00 74.33 ? 111  ALA A C   1 
ATOM   407   O  O   . ALA A  1  83  ? 43.076  8.169   17.548  1.00 73.46 ? 111  ALA A O   1 
ATOM   408   C  CB  . ALA A  1  83  ? 45.372  9.718   19.566  1.00 73.75 ? 111  ALA A CB  1 
ATOM   409   N  N   . HIS A  1  84  ? 42.401  9.205   19.418  1.00 74.65 ? 112  HIS A N   1 
ATOM   410   C  CA  . HIS A  1  84  ? 41.226  8.370   19.539  1.00 75.14 ? 112  HIS A CA  1 
ATOM   411   C  C   . HIS A  1  84  ? 40.165  8.698   18.501  1.00 75.89 ? 112  HIS A C   1 
ATOM   412   O  O   . HIS A  1  84  ? 39.831  7.881   17.646  1.00 76.50 ? 112  HIS A O   1 
ATOM   413   C  CB  . HIS A  1  84  ? 40.603  8.533   20.915  1.00 76.97 ? 112  HIS A CB  1 
ATOM   414   C  CG  . HIS A  1  84  ? 39.218  7.969   21.007  1.00 79.11 ? 112  HIS A CG  1 
ATOM   415   N  ND1 . HIS A  1  84  ? 38.956  6.618   20.911  1.00 79.12 ? 112  HIS A ND1 1 
ATOM   416   C  CD2 . HIS A  1  84  ? 38.016  8.578   21.127  1.00 78.68 ? 112  HIS A CD2 1 
ATOM   417   C  CE1 . HIS A  1  84  ? 37.653  6.418   20.967  1.00 79.57 ? 112  HIS A CE1 1 
ATOM   418   N  NE2 . HIS A  1  84  ? 37.060  7.591   21.096  1.00 79.98 ? 112  HIS A NE2 1 
ATOM   419   N  N   . LEU A  1  85  ? 39.633  9.909   18.612  1.00 77.28 ? 113  LEU A N   1 
ATOM   420   C  CA  . LEU A  1  85  ? 38.568  10.423  17.754  1.00 78.12 ? 113  LEU A CA  1 
ATOM   421   C  C   . LEU A  1  85  ? 38.501  9.900   16.320  1.00 78.25 ? 113  LEU A C   1 
ATOM   422   O  O   . LEU A  1  85  ? 37.494  9.321   15.906  1.00 78.71 ? 113  LEU A O   1 
ATOM   423   C  CB  . LEU A  1  85  ? 38.627  11.954  17.729  1.00 77.56 ? 113  LEU A CB  1 
ATOM   424   C  CG  . LEU A  1  85  ? 37.359  12.643  17.238  1.00 76.76 ? 113  LEU A CG  1 
ATOM   425   C  CD1 . LEU A  1  85  ? 36.220  12.289  18.166  1.00 76.75 ? 113  LEU A CD1 1 
ATOM   426   C  CD2 . LEU A  1  85  ? 37.568  14.137  17.198  1.00 76.80 ? 113  LEU A CD2 1 
ATOM   427   N  N   . ASP A  1  86  ? 39.572  10.108  15.563  1.00 79.21 ? 114  ASP A N   1 
ATOM   428   C  CA  . ASP A  1  86  ? 39.607  9.674   14.171  1.00 78.96 ? 114  ASP A CA  1 
ATOM   429   C  C   . ASP A  1  86  ? 40.551  8.500   13.857  1.00 79.13 ? 114  ASP A C   1 
ATOM   430   O  O   . ASP A  1  86  ? 41.027  8.367   12.730  1.00 79.10 ? 114  ASP A O   1 
ATOM   431   C  CB  . ASP A  1  86  ? 39.939  10.871  13.256  1.00 78.96 ? 114  ASP A CB  1 
ATOM   432   C  CG  . ASP A  1  86  ? 41.240  11.580  13.644  1.00 78.31 ? 114  ASP A CG  1 
ATOM   433   O  OD1 . ASP A  1  86  ? 41.823  12.287  12.798  1.00 76.51 ? 114  ASP A OD1 1 
ATOM   434   O  OD2 . ASP A  1  86  ? 41.682  11.443  14.798  1.00 78.44 ? 114  ASP A OD2 1 
ATOM   435   N  N   . ARG A  1  87  ? 40.819  7.645   14.840  1.00 80.14 ? 115  ARG A N   1 
ATOM   436   C  CA  . ARG A  1  87  ? 41.688  6.490   14.607  1.00 80.23 ? 115  ARG A CA  1 
ATOM   437   C  C   . ARG A  1  87  ? 41.186  5.224   15.268  1.00 79.85 ? 115  ARG A C   1 
ATOM   438   O  O   . ARG A  1  87  ? 40.926  4.217   14.600  1.00 79.32 ? 115  ARG A O   1 
ATOM   439   C  CB  . ARG A  1  87  ? 43.097  6.763   15.098  1.00 78.96 ? 115  ARG A CB  1 
ATOM   440   C  CG  . ARG A  1  87  ? 43.909  7.569   14.146  1.00 78.49 ? 115  ARG A CG  1 
ATOM   441   C  CD  . ARG A  1  87  ? 45.327  7.529   14.601  1.00 79.48 ? 115  ARG A CD  1 
ATOM   442   N  NE  . ARG A  1  87  ? 46.228  8.167   13.656  1.00 80.80 ? 115  ARG A NE  1 
ATOM   443   C  CZ  . ARG A  1  87  ? 47.554  8.146   13.765  1.00 81.96 ? 115  ARG A CZ  1 
ATOM   444   N  NH1 . ARG A  1  87  ? 48.131  7.519   14.783  1.00 81.67 ? 115  ARG A NH1 1 
ATOM   445   N  NH2 . ARG A  1  87  ? 48.307  8.749   12.853  1.00 83.42 ? 115  ARG A NH2 1 
ATOM   446   N  N   . GLY A  1  88  ? 41.067  5.282   16.588  1.00 79.29 ? 116  GLY A N   1 
ATOM   447   C  CA  . GLY A  1  88  ? 40.592  4.137   17.332  1.00 79.04 ? 116  GLY A CA  1 
ATOM   448   C  C   . GLY A  1  88  ? 41.264  4.083   18.679  1.00 78.49 ? 116  GLY A C   1 
ATOM   449   O  O   . GLY A  1  88  ? 40.757  3.433   19.592  1.00 78.58 ? 116  GLY A O   1 
ATOM   450   N  N   . SER A  1  89  ? 42.404  4.769   18.797  1.00 78.57 ? 117  SER A N   1 
ATOM   451   C  CA  . SER A  1  89  ? 43.169  4.812   20.045  1.00 78.71 ? 117  SER A CA  1 
ATOM   452   C  C   . SER A  1  89  ? 42.229  5.035   21.234  1.00 78.99 ? 117  SER A C   1 
ATOM   453   O  O   . SER A  1  89  ? 41.116  5.535   21.063  1.00 79.21 ? 117  SER A O   1 
ATOM   454   C  CB  . SER A  1  89  ? 44.224  5.927   19.990  1.00 78.51 ? 117  SER A CB  1 
ATOM   455   O  OG  . SER A  1  89  ? 45.268  5.619   19.076  1.00 77.38 ? 117  SER A OG  1 
ATOM   456   N  N   . PRO A  1  90  ? 42.660  4.658   22.457  1.00 79.87 ? 118  PRO A N   1 
ATOM   457   C  CA  . PRO A  1  90  ? 41.809  4.836   23.648  1.00 79.57 ? 118  PRO A CA  1 
ATOM   458   C  C   . PRO A  1  90  ? 41.527  6.301   24.009  1.00 78.92 ? 118  PRO A C   1 
ATOM   459   O  O   . PRO A  1  90  ? 42.457  7.106   24.114  1.00 79.18 ? 118  PRO A O   1 
ATOM   460   C  CB  . PRO A  1  90  ? 42.590  4.098   24.748  1.00 79.07 ? 118  PRO A CB  1 
ATOM   461   C  CG  . PRO A  1  90  ? 44.032  4.266   24.319  1.00 78.47 ? 118  PRO A CG  1 
ATOM   462   C  CD  . PRO A  1  90  ? 43.954  4.034   22.815  1.00 79.40 ? 118  PRO A CD  1 
ATOM   463   N  N   . PRO A  1  91  ? 40.240  6.666   24.201  1.00 78.28 ? 119  PRO A N   1 
ATOM   464   C  CA  . PRO A  1  91  ? 39.921  8.063   24.551  1.00 77.24 ? 119  PRO A CA  1 
ATOM   465   C  C   . PRO A  1  91  ? 40.697  8.528   25.794  1.00 77.12 ? 119  PRO A C   1 
ATOM   466   O  O   . PRO A  1  91  ? 40.954  7.723   26.695  1.00 77.58 ? 119  PRO A O   1 
ATOM   467   C  CB  . PRO A  1  91  ? 38.399  8.034   24.762  1.00 76.90 ? 119  PRO A CB  1 
ATOM   468   C  CG  . PRO A  1  91  ? 38.109  6.578   25.094  1.00 77.78 ? 119  PRO A CG  1 
ATOM   469   C  CD  . PRO A  1  91  ? 39.024  5.832   24.162  1.00 77.01 ? 119  PRO A CD  1 
ATOM   470   N  N   . PRO A  1  92  ? 41.113  9.818   25.845  1.00 77.12 ? 120  PRO A N   1 
ATOM   471   C  CA  . PRO A  1  92  ? 41.860  10.300  27.022  1.00 76.98 ? 120  PRO A CA  1 
ATOM   472   C  C   . PRO A  1  92  ? 41.042  10.489  28.321  1.00 75.90 ? 120  PRO A C   1 
ATOM   473   O  O   . PRO A  1  92  ? 39.822  10.687  28.297  1.00 74.71 ? 120  PRO A O   1 
ATOM   474   C  CB  . PRO A  1  92  ? 42.519  11.594  26.516  1.00 75.84 ? 120  PRO A CB  1 
ATOM   475   C  CG  . PRO A  1  92  ? 41.595  12.067  25.462  1.00 75.64 ? 120  PRO A CG  1 
ATOM   476   C  CD  . PRO A  1  92  ? 41.191  10.795  24.744  1.00 76.21 ? 120  PRO A CD  1 
ATOM   477   N  N   . ALA A  1  93  ? 41.736  10.413  29.454  1.00 75.52 ? 121  ALA A N   1 
ATOM   478   C  CA  . ALA A  1  93  ? 41.108  10.532  30.767  1.00 75.25 ? 121  ALA A CA  1 
ATOM   479   C  C   . ALA A  1  93  ? 40.127  11.697  30.892  1.00 74.27 ? 121  ALA A C   1 
ATOM   480   O  O   . ALA A  1  93  ? 40.529  12.867  30.877  1.00 74.14 ? 121  ALA A O   1 
ATOM   481   C  CB  . ALA A  1  93  ? 42.191  10.635  31.852  1.00 74.84 ? 121  ALA A CB  1 
ATOM   482   N  N   . ARG A  1  94  ? 38.840  11.365  31.017  1.00 73.49 ? 122  ARG A N   1 
ATOM   483   C  CA  . ARG A  1  94  ? 37.795  12.378  31.170  1.00 72.90 ? 122  ARG A CA  1 
ATOM   484   C  C   . ARG A  1  94  ? 38.108  13.126  32.458  1.00 71.82 ? 122  ARG A C   1 
ATOM   485   O  O   . ARG A  1  94  ? 37.986  12.571  33.545  1.00 72.39 ? 122  ARG A O   1 
ATOM   486   C  CB  . ARG A  1  94  ? 36.404  11.724  31.277  1.00 72.47 ? 122  ARG A CB  1 
ATOM   487   C  CG  . ARG A  1  94  ? 35.227  12.712  31.237  1.00 71.36 ? 122  ARG A CG  1 
ATOM   488   C  CD  . ARG A  1  94  ? 35.062  13.303  29.844  1.00 71.90 ? 122  ARG A CD  1 
ATOM   489   N  NE  . ARG A  1  94  ? 34.283  14.542  29.832  1.00 72.48 ? 122  ARG A NE  1 
ATOM   490   C  CZ  . ARG A  1  94  ? 32.954  14.613  29.816  1.00 71.43 ? 122  ARG A CZ  1 
ATOM   491   N  NH1 . ARG A  1  94  ? 32.222  13.505  29.807  1.00 71.47 ? 122  ARG A NH1 1 
ATOM   492   N  NH2 . ARG A  1  94  ? 32.358  15.800  29.803  1.00 70.39 ? 122  ARG A NH2 1 
ATOM   493   N  N   . GLU A  1  95  ? 38.518  14.381  32.342  1.00 70.93 ? 123  GLU A N   1 
ATOM   494   C  CA  . GLU A  1  95  ? 38.849  15.150  33.526  1.00 69.47 ? 123  GLU A CA  1 
ATOM   495   C  C   . GLU A  1  95  ? 37.956  16.357  33.771  1.00 69.30 ? 123  GLU A C   1 
ATOM   496   O  O   . GLU A  1  95  ? 37.065  16.674  32.982  1.00 69.70 ? 123  GLU A O   1 
ATOM   497   C  CB  . GLU A  1  95  ? 40.311  15.587  33.458  1.00 69.78 ? 123  GLU A CB  1 
ATOM   498   C  CG  . GLU A  1  95  ? 41.296  14.448  33.663  1.00 68.73 ? 123  GLU A CG  1 
ATOM   499   C  CD  . GLU A  1  95  ? 42.737  14.907  33.594  1.00 68.63 ? 123  GLU A CD  1 
ATOM   500   O  OE1 . GLU A  1  95  ? 43.601  14.221  34.173  1.00 67.99 ? 123  GLU A OE1 1 
ATOM   501   O  OE2 . GLU A  1  95  ? 43.011  15.945  32.953  1.00 68.73 ? 123  GLU A OE2 1 
ATOM   502   N  N   . ALA A  1  96  ? 38.199  17.015  34.896  1.00 68.63 ? 124  ALA A N   1 
ATOM   503   C  CA  . ALA A  1  96  ? 37.453  18.195  35.273  1.00 67.60 ? 124  ALA A CA  1 
ATOM   504   C  C   . ALA A  1  96  ? 38.399  19.037  36.090  1.00 66.92 ? 124  ALA A C   1 
ATOM   505   O  O   . ALA A  1  96  ? 39.105  18.530  36.954  1.00 67.34 ? 124  ALA A O   1 
ATOM   506   C  CB  . ALA A  1  96  ? 36.242  17.816  36.095  1.00 67.76 ? 124  ALA A CB  1 
ATOM   507   N  N   . LEU A  1  97  ? 38.443  20.323  35.795  1.00 66.50 ? 125  LEU A N   1 
ATOM   508   C  CA  . LEU A  1  97  ? 39.317  21.200  36.539  1.00 67.36 ? 125  LEU A CA  1 
ATOM   509   C  C   . LEU A  1  97  ? 38.487  21.935  37.588  1.00 67.55 ? 125  LEU A C   1 
ATOM   510   O  O   . LEU A  1  97  ? 37.481  22.571  37.274  1.00 67.00 ? 125  LEU A O   1 
ATOM   511   C  CB  . LEU A  1  97  ? 40.006  22.194  35.598  1.00 66.64 ? 125  LEU A CB  1 
ATOM   512   C  CG  . LEU A  1  97  ? 41.032  23.129  36.253  1.00 66.89 ? 125  LEU A CG  1 
ATOM   513   C  CD1 . LEU A  1  97  ? 42.158  22.320  36.872  1.00 66.83 ? 125  LEU A CD1 1 
ATOM   514   C  CD2 . LEU A  1  97  ? 41.584  24.086  35.220  1.00 67.92 ? 125  LEU A CD2 1 
ATOM   515   N  N   . ALA A  1  98  ? 38.905  21.823  38.842  1.00 66.84 ? 126  ALA A N   1 
ATOM   516   C  CA  . ALA A  1  98  ? 38.206  22.476  39.930  1.00 66.08 ? 126  ALA A CA  1 
ATOM   517   C  C   . ALA A  1  98  ? 39.114  23.530  40.531  1.00 66.55 ? 126  ALA A C   1 
ATOM   518   O  O   . ALA A  1  98  ? 40.318  23.301  40.689  1.00 65.34 ? 126  ALA A O   1 
ATOM   519   C  CB  . ALA A  1  98  ? 37.817  21.457  40.983  1.00 65.78 ? 126  ALA A CB  1 
ATOM   520   N  N   . ILE A  1  99  ? 38.532  24.689  40.844  1.00 67.75 ? 127  ILE A N   1 
ATOM   521   C  CA  . ILE A  1  99  ? 39.276  25.796  41.452  1.00 68.17 ? 127  ILE A CA  1 
ATOM   522   C  C   . ILE A  1  99  ? 38.836  26.010  42.891  1.00 68.12 ? 127  ILE A C   1 
ATOM   523   O  O   . ILE A  1  99  ? 37.647  26.181  43.177  1.00 67.60 ? 127  ILE A O   1 
ATOM   524   C  CB  . ILE A  1  99  ? 39.064  27.129  40.723  1.00 67.86 ? 127  ILE A CB  1 
ATOM   525   C  CG1 . ILE A  1  99  ? 39.357  26.961  39.233  1.00 67.94 ? 127  ILE A CG1 1 
ATOM   526   C  CG2 . ILE A  1  99  ? 39.975  28.197  41.348  1.00 66.71 ? 127  ILE A CG2 1 
ATOM   527   C  CD1 . ILE A  1  99  ? 39.055  28.189  38.409  1.00 68.04 ? 127  ILE A CD1 1 
ATOM   528   N  N   . VAL A  1  100 ? 39.807  26.016  43.794  1.00 68.51 ? 128  VAL A N   1 
ATOM   529   C  CA  . VAL A  1  100 ? 39.519  26.188  45.201  1.00 67.48 ? 128  VAL A CA  1 
ATOM   530   C  C   . VAL A  1  100 ? 40.228  27.393  45.753  1.00 66.92 ? 128  VAL A C   1 
ATOM   531   O  O   . VAL A  1  100 ? 41.389  27.637  45.440  1.00 67.27 ? 128  VAL A O   1 
ATOM   532   C  CB  . VAL A  1  100 ? 39.956  24.949  46.014  1.00 67.09 ? 128  VAL A CB  1 
ATOM   533   C  CG1 . VAL A  1  100 ? 39.790  25.208  47.499  1.00 66.75 ? 128  VAL A CG1 1 
ATOM   534   C  CG2 . VAL A  1  100 ? 39.132  23.750  45.603  1.00 67.24 ? 128  VAL A CG2 1 
ATOM   535   N  N   . PHE A  1  101 ? 39.506  28.157  46.559  1.00 66.70 ? 129  PHE A N   1 
ATOM   536   C  CA  . PHE A  1  101 ? 40.073  29.318  47.205  1.00 66.77 ? 129  PHE A CA  1 
ATOM   537   C  C   . PHE A  1  101 ? 40.493  28.807  48.565  1.00 67.50 ? 129  PHE A C   1 
ATOM   538   O  O   . PHE A  1  101 ? 39.650  28.411  49.367  1.00 68.00 ? 129  PHE A O   1 
ATOM   539   C  CB  . PHE A  1  101 ? 39.031  30.418  47.423  1.00 67.89 ? 129  PHE A CB  1 
ATOM   540   C  CG  . PHE A  1  101 ? 38.533  31.072  46.163  1.00 68.67 ? 129  PHE A CG  1 
ATOM   541   C  CD1 . PHE A  1  101 ? 37.618  32.125  46.241  1.00 67.69 ? 129  PHE A CD1 1 
ATOM   542   C  CD2 . PHE A  1  101 ? 38.947  30.636  44.910  1.00 67.69 ? 129  PHE A CD2 1 
ATOM   543   C  CE1 . PHE A  1  101 ? 37.120  32.732  45.095  1.00 67.02 ? 129  PHE A CE1 1 
ATOM   544   C  CE2 . PHE A  1  101 ? 38.452  31.238  43.758  1.00 68.16 ? 129  PHE A CE2 1 
ATOM   545   C  CZ  . PHE A  1  101 ? 37.534  32.291  43.854  1.00 67.20 ? 129  PHE A CZ  1 
ATOM   546   N  N   . PHE A  1  102 ? 41.790  28.778  48.819  1.00 67.45 ? 130  PHE A N   1 
ATOM   547   C  CA  . PHE A  1  102 ? 42.269  28.344  50.118  1.00 68.37 ? 130  PHE A CA  1 
ATOM   548   C  C   . PHE A  1  102 ? 42.488  29.630  50.914  1.00 69.97 ? 130  PHE A C   1 
ATOM   549   O  O   . PHE A  1  102 ? 43.471  30.344  50.692  1.00 70.44 ? 130  PHE A O   1 
ATOM   550   C  CB  . PHE A  1  102 ? 43.588  27.572  49.989  1.00 67.82 ? 130  PHE A CB  1 
ATOM   551   C  CG  . PHE A  1  102 ? 43.431  26.166  49.484  1.00 66.92 ? 130  PHE A CG  1 
ATOM   552   C  CD1 . PHE A  1  102 ? 44.311  25.657  48.535  1.00 67.09 ? 130  PHE A CD1 1 
ATOM   553   C  CD2 . PHE A  1  102 ? 42.421  25.347  49.966  1.00 66.79 ? 130  PHE A CD2 1 
ATOM   554   C  CE1 . PHE A  1  102 ? 44.184  24.356  48.078  1.00 66.37 ? 130  PHE A CE1 1 
ATOM   555   C  CE2 . PHE A  1  102 ? 42.289  24.041  49.511  1.00 66.89 ? 130  PHE A CE2 1 
ATOM   556   C  CZ  . PHE A  1  102 ? 43.170  23.546  48.567  1.00 66.25 ? 130  PHE A CZ  1 
ATOM   557   N  N   . GLY A  1  103 ? 41.557  29.940  51.815  1.00 70.17 ? 131  GLY A N   1 
ATOM   558   C  CA  . GLY A  1  103 ? 41.684  31.139  52.630  1.00 70.65 ? 131  GLY A CA  1 
ATOM   559   C  C   . GLY A  1  103 ? 42.021  30.797  54.071  1.00 71.69 ? 131  GLY A C   1 
ATOM   560   O  O   . GLY A  1  103 ? 42.721  31.552  54.756  1.00 71.24 ? 131  GLY A O   1 
ATOM   561   N  N   . ARG A  1  104 ? 41.514  29.647  54.517  1.00 72.12 ? 132  ARG A N   1 
ATOM   562   C  CA  . ARG A  1  104 ? 41.735  29.154  55.868  1.00 72.16 ? 132  ARG A CA  1 
ATOM   563   C  C   . ARG A  1  104 ? 43.112  28.525  55.965  1.00 71.67 ? 132  ARG A C   1 
ATOM   564   O  O   . ARG A  1  104 ? 43.244  27.308  56.073  1.00 71.81 ? 132  ARG A O   1 
ATOM   565   C  CB  . ARG A  1  104 ? 40.690  28.103  56.231  1.00 73.17 ? 132  ARG A CB  1 
ATOM   566   C  CG  . ARG A  1  104 ? 40.627  27.771  57.712  1.00 74.24 ? 132  ARG A CG  1 
ATOM   567   C  CD  . ARG A  1  104 ? 39.930  26.429  57.962  1.00 76.57 ? 132  ARG A CD  1 
ATOM   568   N  NE  . ARG A  1  104 ? 38.812  26.166  57.052  1.00 79.26 ? 132  ARG A NE  1 
ATOM   569   C  CZ  . ARG A  1  104 ? 37.779  26.987  56.850  1.00 80.44 ? 132  ARG A CZ  1 
ATOM   570   N  NH1 . ARG A  1  104 ? 37.708  28.149  57.501  1.00 80.43 ? 132  ARG A NH1 1 
ATOM   571   N  NH2 . ARG A  1  104 ? 36.821  26.650  55.986  1.00 79.97 ? 132  ARG A NH2 1 
ATOM   572   N  N   . GLN A  1  105 ? 44.134  29.362  55.896  1.00 71.26 ? 133  GLN A N   1 
ATOM   573   C  CA  . GLN A  1  105 ? 45.501  28.900  56.015  1.00 71.96 ? 133  GLN A CA  1 
ATOM   574   C  C   . GLN A  1  105 ? 46.403  30.124  56.132  1.00 72.42 ? 133  GLN A C   1 
ATOM   575   O  O   . GLN A  1  105 ? 45.999  31.228  55.765  1.00 71.47 ? 133  GLN A O   1 
ATOM   576   C  CB  . GLN A  1  105 ? 45.889  27.995  54.819  1.00 72.79 ? 133  GLN A CB  1 
ATOM   577   C  CG  . GLN A  1  105 ? 45.946  28.626  53.414  1.00 73.27 ? 133  GLN A CG  1 
ATOM   578   C  CD  . GLN A  1  105 ? 46.318  27.607  52.315  1.00 72.52 ? 133  GLN A CD  1 
ATOM   579   O  OE1 . GLN A  1  105 ? 45.615  26.619  52.101  1.00 72.50 ? 133  GLN A OE1 1 
ATOM   580   N  NE2 . GLN A  1  105 ? 47.422  27.854  51.624  1.00 71.51 ? 133  GLN A NE2 1 
ATOM   581   N  N   . PRO A  1  106 ? 47.625  29.948  56.676  1.00 73.53 ? 134  PRO A N   1 
ATOM   582   C  CA  . PRO A  1  106 ? 48.627  31.009  56.873  1.00 73.60 ? 134  PRO A CA  1 
ATOM   583   C  C   . PRO A  1  106 ? 49.033  31.696  55.568  1.00 74.06 ? 134  PRO A C   1 
ATOM   584   O  O   . PRO A  1  106 ? 49.162  32.922  55.515  1.00 73.40 ? 134  PRO A O   1 
ATOM   585   C  CB  . PRO A  1  106 ? 49.789  30.263  57.517  1.00 73.73 ? 134  PRO A CB  1 
ATOM   586   C  CG  . PRO A  1  106 ? 49.684  28.901  56.879  1.00 73.49 ? 134  PRO A CG  1 
ATOM   587   C  CD  . PRO A  1  106 ? 48.204  28.632  57.002  1.00 73.42 ? 134  PRO A CD  1 
ATOM   588   N  N   . GLN A  1  107 ? 49.253  30.893  54.528  1.00 74.49 ? 135  GLN A N   1 
ATOM   589   C  CA  . GLN A  1  107 ? 49.601  31.410  53.204  1.00 74.36 ? 135  GLN A CA  1 
ATOM   590   C  C   . GLN A  1  107 ? 48.418  31.041  52.296  1.00 74.18 ? 135  GLN A C   1 
ATOM   591   O  O   . GLN A  1  107 ? 48.373  29.940  51.739  1.00 73.66 ? 135  GLN A O   1 
ATOM   592   C  CB  . GLN A  1  107 ? 50.882  30.748  52.676  1.00 74.96 ? 135  GLN A CB  1 
ATOM   593   C  CG  . GLN A  1  107 ? 52.129  30.932  53.557  1.00 75.87 ? 135  GLN A CG  1 
ATOM   594   C  CD  . GLN A  1  107 ? 52.816  32.291  53.378  1.00 76.43 ? 135  GLN A CD  1 
ATOM   595   O  OE1 . GLN A  1  107 ? 52.205  33.345  53.584  1.00 76.74 ? 135  GLN A OE1 1 
ATOM   596   N  NE2 . GLN A  1  107 ? 54.101  32.267  53.003  1.00 76.14 ? 135  GLN A NE2 1 
ATOM   597   N  N   . PRO A  1  108 ? 47.426  31.947  52.161  1.00 74.18 ? 136  PRO A N   1 
ATOM   598   C  CA  . PRO A  1  108 ? 46.258  31.676  51.316  1.00 73.64 ? 136  PRO A CA  1 
ATOM   599   C  C   . PRO A  1  108 ? 46.538  31.801  49.818  1.00 72.54 ? 136  PRO A C   1 
ATOM   600   O  O   . PRO A  1  108 ? 47.077  32.803  49.336  1.00 71.42 ? 136  PRO A O   1 
ATOM   601   C  CB  . PRO A  1  108 ? 45.230  32.688  51.819  1.00 73.11 ? 136  PRO A CB  1 
ATOM   602   C  CG  . PRO A  1  108 ? 46.076  33.855  52.170  1.00 73.73 ? 136  PRO A CG  1 
ATOM   603   C  CD  . PRO A  1  108 ? 47.251  33.214  52.897  1.00 73.81 ? 136  PRO A CD  1 
ATOM   604   N  N   . ASN A  1  109 ? 46.162  30.750  49.101  1.00 71.88 ? 137  ASN A N   1 
ATOM   605   C  CA  . ASN A  1  109 ? 46.347  30.668  47.667  1.00 71.61 ? 137  ASN A CA  1 
ATOM   606   C  C   . ASN A  1  109 ? 45.059  30.128  47.062  1.00 71.36 ? 137  ASN A C   1 
ATOM   607   O  O   . ASN A  1  109 ? 44.241  29.538  47.759  1.00 71.31 ? 137  ASN A O   1 
ATOM   608   C  CB  . ASN A  1  109 ? 47.516  29.709  47.344  1.00 72.43 ? 137  ASN A CB  1 
ATOM   609   C  CG  . ASN A  1  109 ? 47.148  28.222  47.516  1.00 72.76 ? 137  ASN A CG  1 
ATOM   610   O  OD1 . ASN A  1  109 ? 46.217  27.732  46.870  1.00 71.72 ? 137  ASN A OD1 1 
ATOM   611   N  ND2 . ASN A  1  109 ? 47.879  27.496  48.362  1.00 74.33 ? 137  ASN A ND2 1 
ATOM   612   N  N   . VAL A  1  110 ? 44.858  30.366  45.775  1.00 71.20 ? 138  VAL A N   1 
ATOM   613   C  CA  . VAL A  1  110 ? 43.704  29.809  45.095  1.00 70.90 ? 138  VAL A CA  1 
ATOM   614   C  C   . VAL A  1  110 ? 44.367  28.844  44.112  1.00 71.06 ? 138  VAL A C   1 
ATOM   615   O  O   . VAL A  1  110 ? 45.296  29.209  43.392  1.00 70.72 ? 138  VAL A O   1 
ATOM   616   C  CB  . VAL A  1  110 ? 42.821  30.906  44.403  1.00 70.87 ? 138  VAL A CB  1 
ATOM   617   C  CG1 . VAL A  1  110 ? 43.626  32.164  44.141  1.00 71.12 ? 138  VAL A CG1 1 
ATOM   618   C  CG2 . VAL A  1  110 ? 42.211  30.355  43.128  1.00 70.18 ? 138  VAL A CG2 1 
ATOM   619   N  N   . SER A  1  111 ? 43.927  27.593  44.121  1.00 71.43 ? 139  SER A N   1 
ATOM   620   C  CA  . SER A  1  111 ? 44.547  26.599  43.268  1.00 71.26 ? 139  SER A CA  1 
ATOM   621   C  C   . SER A  1  111 ? 43.643  25.859  42.295  1.00 71.56 ? 139  SER A C   1 
ATOM   622   O  O   . SER A  1  111 ? 42.450  25.685  42.529  1.00 71.43 ? 139  SER A O   1 
ATOM   623   C  CB  . SER A  1  111 ? 45.284  25.584  44.142  1.00 71.45 ? 139  SER A CB  1 
ATOM   624   O  OG  . SER A  1  111 ? 46.282  26.216  44.922  1.00 71.42 ? 139  SER A OG  1 
ATOM   625   N  N   . GLU A  1  112 ? 44.256  25.428  41.196  1.00 72.28 ? 140  GLU A N   1 
ATOM   626   C  CA  . GLU A  1  112 ? 43.596  24.673  40.139  1.00 71.39 ? 140  GLU A CA  1 
ATOM   627   C  C   . GLU A  1  112 ? 43.942  23.207  40.327  1.00 70.89 ? 140  GLU A C   1 
ATOM   628   O  O   . GLU A  1  112 ? 45.110  22.821  40.298  1.00 69.72 ? 140  GLU A O   1 
ATOM   629   C  CB  . GLU A  1  112 ? 44.100  25.120  38.771  1.00 72.57 ? 140  GLU A CB  1 
ATOM   630   C  CG  . GLU A  1  112 ? 43.489  26.413  38.241  1.00 73.57 ? 140  GLU A CG  1 
ATOM   631   C  CD  . GLU A  1  112 ? 44.180  26.900  36.969  1.00 73.45 ? 140  GLU A CD  1 
ATOM   632   O  OE1 . GLU A  1  112 ? 45.249  27.537  37.095  1.00 72.12 ? 140  GLU A OE1 1 
ATOM   633   O  OE2 . GLU A  1  112 ? 43.668  26.630  35.851  1.00 73.36 ? 140  GLU A OE2 1 
ATOM   634   N  N   . LEU A  1  113 ? 42.921  22.387  40.506  1.00 70.92 ? 141  LEU A N   1 
ATOM   635   C  CA  . LEU A  1  113 ? 43.154  20.978  40.715  1.00 71.18 ? 141  LEU A CA  1 
ATOM   636   C  C   . LEU A  1  113 ? 42.432  20.175  39.671  1.00 71.70 ? 141  LEU A C   1 
ATOM   637   O  O   . LEU A  1  113 ? 41.238  20.362  39.453  1.00 71.18 ? 141  LEU A O   1 
ATOM   638   C  CB  . LEU A  1  113 ? 42.653  20.586  42.091  1.00 71.78 ? 141  LEU A CB  1 
ATOM   639   C  CG  . LEU A  1  113 ? 43.078  21.566  43.184  1.00 71.62 ? 141  LEU A CG  1 
ATOM   640   C  CD1 . LEU A  1  113 ? 42.351  21.239  44.473  1.00 71.16 ? 141  LEU A CD1 1 
ATOM   641   C  CD2 . LEU A  1  113 ? 44.584  21.510  43.362  1.00 70.74 ? 141  LEU A CD2 1 
ATOM   642   N  N   . VAL A  1  114 ? 43.161  19.280  39.019  1.00 72.38 ? 142  VAL A N   1 
ATOM   643   C  CA  . VAL A  1  114 ? 42.558  18.441  38.002  1.00 72.81 ? 142  VAL A CA  1 
ATOM   644   C  C   . VAL A  1  114 ? 42.145  17.146  38.675  1.00 73.82 ? 142  VAL A C   1 
ATOM   645   O  O   . VAL A  1  114 ? 42.991  16.411  39.196  1.00 73.36 ? 142  VAL A O   1 
ATOM   646   C  CB  . VAL A  1  114 ? 43.540  18.129  36.886  1.00 72.95 ? 142  VAL A CB  1 
ATOM   647   C  CG1 . VAL A  1  114 ? 42.793  17.515  35.713  1.00 73.30 ? 142  VAL A CG1 1 
ATOM   648   C  CG2 . VAL A  1  114 ? 44.267  19.390  36.476  1.00 72.94 ? 142  VAL A CG2 1 
ATOM   649   N  N   . VAL A  1  115 ? 40.840  16.884  38.661  1.00 74.62 ? 143  VAL A N   1 
ATOM   650   C  CA  . VAL A  1  115 ? 40.261  15.699  39.289  1.00 75.31 ? 143  VAL A CA  1 
ATOM   651   C  C   . VAL A  1  115 ? 40.324  14.454  38.406  1.00 75.36 ? 143  VAL A C   1 
ATOM   652   O  O   . VAL A  1  115 ? 40.376  14.561  37.180  1.00 75.42 ? 143  VAL A O   1 
ATOM   653   C  CB  . VAL A  1  115 ? 38.794  15.981  39.714  1.00 75.54 ? 143  VAL A CB  1 
ATOM   654   C  CG1 . VAL A  1  115 ? 38.135  14.720  40.283  1.00 74.92 ? 143  VAL A CG1 1 
ATOM   655   C  CG2 . VAL A  1  115 ? 38.778  17.096  40.753  1.00 74.89 ? 143  VAL A CG2 1 
ATOM   656   N  N   . GLY A  1  116 ? 40.311  13.289  39.064  1.00 75.77 ? 144  GLY A N   1 
ATOM   657   C  CA  . GLY A  1  116 ? 40.406  11.974  38.426  1.00 77.24 ? 144  GLY A CA  1 
ATOM   658   C  C   . GLY A  1  116 ? 39.417  11.509  37.370  1.00 77.50 ? 144  GLY A C   1 
ATOM   659   O  O   . GLY A  1  116 ? 38.402  12.142  37.170  1.00 78.50 ? 144  GLY A O   1 
ATOM   660   N  N   . PRO A  1  117 ? 39.657  10.344  36.731  1.00 77.08 ? 145  PRO A N   1 
ATOM   661   C  CA  . PRO A  1  117 ? 38.810  9.784   35.673  1.00 77.74 ? 145  PRO A CA  1 
ATOM   662   C  C   . PRO A  1  117 ? 37.323  9.639   35.914  1.00 78.32 ? 145  PRO A C   1 
ATOM   663   O  O   . PRO A  1  117 ? 36.876  8.673   36.534  1.00 77.74 ? 145  PRO A O   1 
ATOM   664   C  CB  . PRO A  1  117 ? 39.441  8.410   35.411  1.00 77.59 ? 145  PRO A CB  1 
ATOM   665   C  CG  . PRO A  1  117 ? 40.752  8.448   36.094  1.00 77.75 ? 145  PRO A CG  1 
ATOM   666   C  CD  . PRO A  1  117 ? 40.500  9.291   37.296  1.00 77.83 ? 145  PRO A CD  1 
ATOM   667   N  N   . LEU A  1  118 ? 36.546  10.592  35.404  1.00 78.81 ? 146  LEU A N   1 
ATOM   668   C  CA  . LEU A  1  118 ? 35.102  10.506  35.539  1.00 80.04 ? 146  LEU A CA  1 
ATOM   669   C  C   . LEU A  1  118 ? 34.669  9.285   34.722  1.00 80.52 ? 146  LEU A C   1 
ATOM   670   O  O   . LEU A  1  118 ? 35.405  8.822   33.849  1.00 80.10 ? 146  LEU A O   1 
ATOM   671   C  CB  . LEU A  1  118 ? 34.436  11.779  34.999  1.00 79.44 ? 146  LEU A CB  1 
ATOM   672   C  CG  . LEU A  1  118 ? 34.638  13.036  35.846  1.00 79.03 ? 146  LEU A CG  1 
ATOM   673   C  CD1 . LEU A  1  118 ? 35.750  13.889  35.265  1.00 78.94 ? 146  LEU A CD1 1 
ATOM   674   C  CD2 . LEU A  1  118 ? 33.334  13.810  35.892  1.00 79.66 ? 146  LEU A CD2 1 
ATOM   675   N  N   . PRO A  1  119 ? 33.468  8.747   34.988  1.00 80.92 ? 147  PRO A N   1 
ATOM   676   C  CA  . PRO A  1  119 ? 32.474  9.183   35.979  1.00 82.10 ? 147  PRO A CA  1 
ATOM   677   C  C   . PRO A  1  119 ? 32.804  8.921   37.464  1.00 82.92 ? 147  PRO A C   1 
ATOM   678   O  O   . PRO A  1  119 ? 32.194  9.526   38.359  1.00 83.16 ? 147  PRO A O   1 
ATOM   679   C  CB  . PRO A  1  119 ? 31.206  8.448   35.535  1.00 81.67 ? 147  PRO A CB  1 
ATOM   680   C  CG  . PRO A  1  119 ? 31.422  8.253   34.056  1.00 81.69 ? 147  PRO A CG  1 
ATOM   681   C  CD  . PRO A  1  119 ? 32.854  7.814   34.031  1.00 81.22 ? 147  PRO A CD  1 
ATOM   682   N  N   . HIS A  1  120 ? 33.750  8.020   37.729  1.00 83.64 ? 148  HIS A N   1 
ATOM   683   C  CA  . HIS A  1  120 ? 34.136  7.711   39.111  1.00 84.04 ? 148  HIS A CA  1 
ATOM   684   C  C   . HIS A  1  120 ? 35.556  8.242   39.390  1.00 84.29 ? 148  HIS A C   1 
ATOM   685   O  O   . HIS A  1  120 ? 36.543  7.522   39.201  1.00 83.67 ? 148  HIS A O   1 
ATOM   686   C  CB  . HIS A  1  120 ? 34.067  6.189   39.366  1.00 83.57 ? 148  HIS A CB  1 
ATOM   687   C  CG  . HIS A  1  120 ? 32.693  5.598   39.195  1.00 85.14 ? 148  HIS A CG  1 
ATOM   688   N  ND1 . HIS A  1  120 ? 32.310  4.905   38.064  1.00 85.34 ? 148  HIS A ND1 1 
ATOM   689   C  CD2 . HIS A  1  120 ? 31.611  5.604   40.012  1.00 84.99 ? 148  HIS A CD2 1 
ATOM   690   C  CE1 . HIS A  1  120 ? 31.055  4.507   38.193  1.00 84.87 ? 148  HIS A CE1 1 
ATOM   691   N  NE2 . HIS A  1  120 ? 30.607  4.918   39.366  1.00 85.09 ? 148  HIS A NE2 1 
ATOM   692   N  N   . PRO A  1  121 ? 35.669  9.514   39.845  1.00 84.31 ? 149  PRO A N   1 
ATOM   693   C  CA  . PRO A  1  121 ? 36.947  10.176  40.154  1.00 83.26 ? 149  PRO A CA  1 
ATOM   694   C  C   . PRO A  1  121 ? 37.907  9.310   40.962  1.00 82.73 ? 149  PRO A C   1 
ATOM   695   O  O   . PRO A  1  121 ? 37.477  8.504   41.784  1.00 83.49 ? 149  PRO A O   1 
ATOM   696   C  CB  . PRO A  1  121 ? 36.510  11.429  40.911  1.00 83.65 ? 149  PRO A CB  1 
ATOM   697   C  CG  . PRO A  1  121 ? 35.213  11.764  40.264  1.00 83.47 ? 149  PRO A CG  1 
ATOM   698   C  CD  . PRO A  1  121 ? 34.540  10.403  40.185  1.00 83.49 ? 149  PRO A CD  1 
ATOM   699   N  N   . SER A  1  122 ? 39.205  9.490   40.731  1.00 82.38 ? 150  SER A N   1 
ATOM   700   C  CA  . SER A  1  122 ? 40.216  8.703   41.426  1.00 82.76 ? 150  SER A CA  1 
ATOM   701   C  C   . SER A  1  122 ? 41.376  9.530   41.961  1.00 82.53 ? 150  SER A C   1 
ATOM   702   O  O   . SER A  1  122 ? 41.784  9.356   43.103  1.00 82.66 ? 150  SER A O   1 
ATOM   703   C  CB  . SER A  1  122 ? 40.755  7.611   40.492  1.00 82.87 ? 150  SER A CB  1 
ATOM   704   O  OG  . SER A  1  122 ? 41.793  6.864   41.101  1.00 82.91 ? 150  SER A OG  1 
ATOM   705   N  N   . TYR A  1  123 ? 41.905  10.436  41.146  1.00 83.51 ? 151  TYR A N   1 
ATOM   706   C  CA  . TYR A  1  123 ? 43.041  11.250  41.573  1.00 83.57 ? 151  TYR A CA  1 
ATOM   707   C  C   . TYR A  1  123 ? 42.791  12.749  41.632  1.00 83.11 ? 151  TYR A C   1 
ATOM   708   O  O   . TYR A  1  123 ? 41.680  13.226  41.397  1.00 82.25 ? 151  TYR A O   1 
ATOM   709   C  CB  . TYR A  1  123 ? 44.250  10.974  40.671  1.00 84.05 ? 151  TYR A CB  1 
ATOM   710   C  CG  . TYR A  1  123 ? 43.997  11.206  39.192  1.00 83.79 ? 151  TYR A CG  1 
ATOM   711   C  CD1 . TYR A  1  123 ? 44.178  12.464  38.615  1.00 83.49 ? 151  TYR A CD1 1 
ATOM   712   C  CD2 . TYR A  1  123 ? 43.554  10.167  38.375  1.00 83.47 ? 151  TYR A CD2 1 
ATOM   713   C  CE1 . TYR A  1  123 ? 43.920  12.677  37.260  1.00 84.04 ? 151  TYR A CE1 1 
ATOM   714   C  CE2 . TYR A  1  123 ? 43.295  10.369  37.026  1.00 83.52 ? 151  TYR A CE2 1 
ATOM   715   C  CZ  . TYR A  1  123 ? 43.473  11.621  36.472  1.00 84.05 ? 151  TYR A CZ  1 
ATOM   716   O  OH  . TYR A  1  123 ? 43.178  11.813  35.135  1.00 84.16 ? 151  TYR A OH  1 
ATOM   717   N  N   . MET A  1  124 ? 43.853  13.484  41.943  1.00 83.85 ? 152  MET A N   1 
ATOM   718   C  CA  . MET A  1  124 ? 43.791  14.934  42.060  1.00 83.93 ? 152  MET A CA  1 
ATOM   719   C  C   . MET A  1  124 ? 45.209  15.508  42.008  1.00 83.51 ? 152  MET A C   1 
ATOM   720   O  O   . MET A  1  124 ? 46.100  15.043  42.719  1.00 83.21 ? 152  MET A O   1 
ATOM   721   C  CB  . MET A  1  124 ? 43.112  15.292  43.390  1.00 84.08 ? 152  MET A CB  1 
ATOM   722   C  CG  . MET A  1  124 ? 43.157  16.764  43.784  1.00 84.62 ? 152  MET A CG  1 
ATOM   723   S  SD  . MET A  1  124 ? 42.601  17.054  45.502  1.00 84.90 ? 152  MET A SD  1 
ATOM   724   C  CE  . MET A  1  124 ? 44.178  17.079  46.403  1.00 83.34 ? 152  MET A CE  1 
ATOM   725   N  N   . ARG A  1  125 ? 45.429  16.505  41.157  1.00 83.45 ? 153  ARG A N   1 
ATOM   726   C  CA  . ARG A  1  125 ? 46.752  17.112  41.069  1.00 83.76 ? 153  ARG A CA  1 
ATOM   727   C  C   . ARG A  1  125 ? 46.648  18.634  41.065  1.00 83.46 ? 153  ARG A C   1 
ATOM   728   O  O   . ARG A  1  125 ? 45.764  19.208  40.414  1.00 82.44 ? 153  ARG A O   1 
ATOM   729   C  CB  . ARG A  1  125 ? 47.481  16.650  39.801  1.00 84.71 ? 153  ARG A CB  1 
ATOM   730   C  CG  . ARG A  1  125 ? 48.963  17.053  39.746  1.00 85.19 ? 153  ARG A CG  1 
ATOM   731   C  CD  . ARG A  1  125 ? 49.492  17.215  38.307  1.00 85.88 ? 153  ARG A CD  1 
ATOM   732   N  NE  . ARG A  1  125 ? 49.216  16.063  37.440  1.00 88.69 ? 153  ARG A NE  1 
ATOM   733   C  CZ  . ARG A  1  125 ? 48.119  15.919  36.692  1.00 89.57 ? 153  ARG A CZ  1 
ATOM   734   N  NH1 . ARG A  1  125 ? 47.184  16.860  36.696  1.00 89.36 ? 153  ARG A NH1 1 
ATOM   735   N  NH2 . ARG A  1  125 ? 47.948  14.827  35.944  1.00 89.70 ? 153  ARG A NH2 1 
ATOM   736   N  N   . ASP A  1  126 ? 47.547  19.280  41.806  1.00 82.12 ? 154  ASP A N   1 
ATOM   737   C  CA  . ASP A  1  126 ? 47.562  20.731  41.858  1.00 82.18 ? 154  ASP A CA  1 
ATOM   738   C  C   . ASP A  1  126 ? 48.385  21.225  40.681  1.00 82.48 ? 154  ASP A C   1 
ATOM   739   O  O   . ASP A  1  126 ? 49.621  21.202  40.698  1.00 81.83 ? 154  ASP A O   1 
ATOM   740   C  CB  . ASP A  1  126 ? 48.170  21.239  43.162  1.00 82.63 ? 154  ASP A CB  1 
ATOM   741   C  CG  . ASP A  1  126 ? 48.038  22.749  43.312  1.00 83.36 ? 154  ASP A CG  1 
ATOM   742   O  OD1 . ASP A  1  126 ? 46.897  23.256  43.266  1.00 82.96 ? 154  ASP A OD1 1 
ATOM   743   O  OD2 . ASP A  1  126 ? 49.069  23.433  43.476  1.00 83.41 ? 154  ASP A OD2 1 
ATOM   744   N  N   . VAL A  1  127 ? 47.677  21.670  39.652  1.00 83.03 ? 155  VAL A N   1 
ATOM   745   C  CA  . VAL A  1  127 ? 48.313  22.154  38.443  1.00 82.18 ? 155  VAL A CA  1 
ATOM   746   C  C   . VAL A  1  127 ? 48.644  23.648  38.479  1.00 82.31 ? 155  VAL A C   1 
ATOM   747   O  O   . VAL A  1  127 ? 49.214  24.173  37.528  1.00 83.16 ? 155  VAL A O   1 
ATOM   748   C  CB  . VAL A  1  127 ? 47.421  21.856  37.218  1.00 80.61 ? 155  VAL A CB  1 
ATOM   749   C  CG1 . VAL A  1  127 ? 47.237  20.362  37.066  1.00 80.78 ? 155  VAL A CG1 1 
ATOM   750   C  CG2 . VAL A  1  127 ? 46.078  22.513  37.386  1.00 80.70 ? 155  VAL A CG2 1 
ATOM   751   N  N   . THR A  1  128 ? 48.310  24.330  39.572  1.00 81.08 ? 156  THR A N   1 
ATOM   752   C  CA  . THR A  1  128 ? 48.573  25.765  39.676  1.00 80.37 ? 156  THR A CA  1 
ATOM   753   C  C   . THR A  1  128 ? 49.991  26.171  39.247  1.00 80.84 ? 156  THR A C   1 
ATOM   754   O  O   . THR A  1  128 ? 50.166  27.016  38.365  1.00 79.87 ? 156  THR A O   1 
ATOM   755   C  CB  . THR A  1  128 ? 48.318  26.250  41.099  1.00 80.55 ? 156  THR A CB  1 
ATOM   756   O  OG1 . THR A  1  128 ? 47.030  25.791  41.518  1.00 81.49 ? 156  THR A OG1 1 
ATOM   757   C  CG2 . THR A  1  128 ? 48.340  27.774  41.160  1.00 80.83 ? 156  THR A CG2 1 
ATOM   758   N  N   . VAL A  1  129 ? 50.999  25.572  39.874  1.00 81.23 ? 157  VAL A N   1 
ATOM   759   C  CA  . VAL A  1  129 ? 52.390  25.866  39.537  1.00 80.21 ? 157  VAL A CA  1 
ATOM   760   C  C   . VAL A  1  129 ? 52.673  25.303  38.163  1.00 79.25 ? 157  VAL A C   1 
ATOM   761   O  O   . VAL A  1  129 ? 53.197  25.980  37.292  1.00 78.61 ? 157  VAL A O   1 
ATOM   762   C  CB  . VAL A  1  129 ? 53.361  25.198  40.518  1.00 80.09 ? 157  VAL A CB  1 
ATOM   763   C  CG1 . VAL A  1  129 ? 53.396  25.967  41.822  1.00 79.66 ? 157  VAL A CG1 1 
ATOM   764   C  CG2 . VAL A  1  129 ? 52.933  23.749  40.754  1.00 80.21 ? 157  VAL A CG2 1 
ATOM   765   N  N   . GLU A  1  130 ? 52.336  24.036  37.991  1.00 79.53 ? 158  GLU A N   1 
ATOM   766   C  CA  . GLU A  1  130 ? 52.541  23.377  36.724  1.00 79.25 ? 158  GLU A CA  1 
ATOM   767   C  C   . GLU A  1  130 ? 52.019  24.327  35.654  1.00 79.45 ? 158  GLU A C   1 
ATOM   768   O  O   . GLU A  1  130 ? 52.785  24.914  34.890  1.00 79.91 ? 158  GLU A O   1 
ATOM   769   C  CB  . GLU A  1  130 ? 51.754  22.072  36.705  1.00 79.37 ? 158  GLU A CB  1 
ATOM   770   C  CG  . GLU A  1  130 ? 51.985  21.202  35.490  1.00 80.66 ? 158  GLU A CG  1 
ATOM   771   C  CD  . GLU A  1  130 ? 51.112  19.944  35.500  1.00 82.55 ? 158  GLU A CD  1 
ATOM   772   O  OE1 . GLU A  1  130 ? 51.121  19.208  36.519  1.00 83.08 ? 158  GLU A OE1 1 
ATOM   773   O  OE2 . GLU A  1  130 ? 50.418  19.687  34.488  1.00 82.11 ? 158  GLU A OE2 1 
ATOM   774   N  N   . ARG A  1  131 ? 50.703  24.501  35.657  1.00 79.37 ? 159  ARG A N   1 
ATOM   775   C  CA  . ARG A  1  131 ? 49.968  25.339  34.714  1.00 78.43 ? 159  ARG A CA  1 
ATOM   776   C  C   . ARG A  1  131 ? 50.358  26.808  34.599  1.00 78.25 ? 159  ARG A C   1 
ATOM   777   O  O   . ARG A  1  131 ? 50.865  27.240  33.572  1.00 78.51 ? 159  ARG A O   1 
ATOM   778   C  CB  . ARG A  1  131 ? 48.489  25.245  35.040  1.00 77.21 ? 159  ARG A CB  1 
ATOM   779   C  CG  . ARG A  1  131 ? 47.605  26.117  34.201  1.00 77.82 ? 159  ARG A CG  1 
ATOM   780   C  CD  . ARG A  1  131 ? 46.229  25.503  34.155  1.00 77.52 ? 159  ARG A CD  1 
ATOM   781   N  NE  . ARG A  1  131 ? 46.326  24.072  33.855  1.00 77.39 ? 159  ARG A NE  1 
ATOM   782   C  CZ  . ARG A  1  131 ? 45.277  23.276  33.662  1.00 77.13 ? 159  ARG A CZ  1 
ATOM   783   N  NH1 . ARG A  1  131 ? 44.046  23.778  33.736  1.00 76.36 ? 159  ARG A NH1 1 
ATOM   784   N  NH2 . ARG A  1  131 ? 45.456  21.982  33.401  1.00 75.59 ? 159  ARG A NH2 1 
ATOM   785   N  N   . HIS A  1  132 ? 50.090  27.593  35.630  1.00 78.70 ? 160  HIS A N   1 
ATOM   786   C  CA  . HIS A  1  132 ? 50.429  29.007  35.563  1.00 79.35 ? 160  HIS A CA  1 
ATOM   787   C  C   . HIS A  1  132 ? 51.833  29.279  36.050  1.00 79.78 ? 160  HIS A C   1 
ATOM   788   O  O   . HIS A  1  132 ? 52.309  30.414  35.950  1.00 80.00 ? 160  HIS A O   1 
ATOM   789   C  CB  . HIS A  1  132 ? 49.458  29.833  36.394  1.00 79.22 ? 160  HIS A CB  1 
ATOM   790   C  CG  . HIS A  1  132 ? 48.060  29.809  35.874  1.00 78.61 ? 160  HIS A CG  1 
ATOM   791   N  ND1 . HIS A  1  132 ? 47.568  30.766  35.015  1.00 78.48 ? 160  HIS A ND1 1 
ATOM   792   C  CD2 . HIS A  1  132 ? 47.051  28.937  36.086  1.00 77.49 ? 160  HIS A CD2 1 
ATOM   793   C  CE1 . HIS A  1  132 ? 46.311  30.486  34.728  1.00 78.48 ? 160  HIS A CE1 1 
ATOM   794   N  NE2 . HIS A  1  132 ? 45.973  29.382  35.367  1.00 77.19 ? 160  HIS A NE2 1 
ATOM   795   N  N   . GLY A  1  133 ? 52.489  28.250  36.589  1.00 79.63 ? 161  GLY A N   1 
ATOM   796   C  CA  . GLY A  1  133 ? 53.848  28.416  37.092  1.00 78.99 ? 161  GLY A CA  1 
ATOM   797   C  C   . GLY A  1  133 ? 53.906  29.392  38.249  1.00 79.60 ? 161  GLY A C   1 
ATOM   798   O  O   . GLY A  1  133 ? 54.024  30.603  38.051  1.00 79.98 ? 161  GLY A O   1 
ATOM   799   N  N   . GLY A  1  134 ? 53.830  28.867  39.467  1.00 79.78 ? 162  GLY A N   1 
ATOM   800   C  CA  . GLY A  1  134 ? 53.850  29.723  40.638  1.00 78.66 ? 162  GLY A CA  1 
ATOM   801   C  C   . GLY A  1  134 ? 52.552  29.574  41.416  1.00 78.40 ? 162  GLY A C   1 
ATOM   802   O  O   . GLY A  1  134 ? 51.666  28.817  40.995  1.00 78.94 ? 162  GLY A O   1 
ATOM   803   N  N   . PRO A  1  135 ? 52.411  30.276  42.562  1.00 78.02 ? 163  PRO A N   1 
ATOM   804   C  CA  . PRO A  1  135 ? 51.211  30.210  43.403  1.00 77.43 ? 163  PRO A CA  1 
ATOM   805   C  C   . PRO A  1  135 ? 50.215  31.310  43.030  1.00 76.78 ? 163  PRO A C   1 
ATOM   806   O  O   . PRO A  1  135 ? 50.624  32.395  42.617  1.00 77.57 ? 163  PRO A O   1 
ATOM   807   C  CB  . PRO A  1  135 ? 51.781  30.404  44.798  1.00 77.29 ? 163  PRO A CB  1 
ATOM   808   C  CG  . PRO A  1  135 ? 52.797  31.497  44.550  1.00 77.50 ? 163  PRO A CG  1 
ATOM   809   C  CD  . PRO A  1  135 ? 53.466  31.074  43.227  1.00 77.98 ? 163  PRO A CD  1 
ATOM   810   N  N   . LEU A  1  136 ? 48.920  31.057  43.186  1.00 74.63 ? 164  LEU A N   1 
ATOM   811   C  CA  . LEU A  1  136 ? 47.971  32.097  42.831  1.00 74.57 ? 164  LEU A CA  1 
ATOM   812   C  C   . LEU A  1  136 ? 47.625  32.995  44.017  1.00 73.77 ? 164  LEU A C   1 
ATOM   813   O  O   . LEU A  1  136 ? 46.969  32.557  44.956  1.00 74.66 ? 164  LEU A O   1 
ATOM   814   C  CB  . LEU A  1  136 ? 46.703  31.473  42.226  1.00 75.59 ? 164  LEU A CB  1 
ATOM   815   C  CG  . LEU A  1  136 ? 46.730  31.090  40.732  1.00 74.98 ? 164  LEU A CG  1 
ATOM   816   C  CD1 . LEU A  1  136 ? 45.710  30.011  40.453  1.00 74.57 ? 164  LEU A CD1 1 
ATOM   817   C  CD2 . LEU A  1  136 ? 46.457  32.309  39.868  1.00 74.34 ? 164  LEU A CD2 1 
ATOM   818   N  N   . PRO A  1  137 ? 48.096  34.260  44.000  1.00 74.15 ? 165  PRO A N   1 
ATOM   819   C  CA  . PRO A  1  137 ? 47.825  35.219  45.075  1.00 74.43 ? 165  PRO A CA  1 
ATOM   820   C  C   . PRO A  1  137 ? 46.334  35.287  45.323  1.00 73.80 ? 165  PRO A C   1 
ATOM   821   O  O   . PRO A  1  137 ? 45.542  35.415  44.395  1.00 74.36 ? 165  PRO A O   1 
ATOM   822   C  CB  . PRO A  1  137 ? 48.379  36.524  44.518  1.00 73.93 ? 165  PRO A CB  1 
ATOM   823   C  CG  . PRO A  1  137 ? 49.574  36.059  43.773  1.00 74.20 ? 165  PRO A CG  1 
ATOM   824   C  CD  . PRO A  1  137 ? 49.033  34.843  43.022  1.00 74.23 ? 165  PRO A CD  1 
ATOM   825   N  N   . TYR A  1  138 ? 45.951  35.210  46.584  1.00 73.82 ? 166  TYR A N   1 
ATOM   826   C  CA  . TYR A  1  138 ? 44.544  35.212  46.911  1.00 74.41 ? 166  TYR A CA  1 
ATOM   827   C  C   . TYR A  1  138 ? 43.718  36.371  46.344  1.00 74.51 ? 166  TYR A C   1 
ATOM   828   O  O   . TYR A  1  138 ? 42.606  36.159  45.862  1.00 74.01 ? 166  TYR A O   1 
ATOM   829   C  CB  . TYR A  1  138 ? 44.377  35.142  48.421  1.00 73.91 ? 166  TYR A CB  1 
ATOM   830   C  CG  . TYR A  1  138 ? 43.114  34.436  48.817  1.00 73.54 ? 166  TYR A CG  1 
ATOM   831   C  CD1 . TYR A  1  138 ? 42.839  33.151  48.355  1.00 73.34 ? 166  TYR A CD1 1 
ATOM   832   C  CD2 . TYR A  1  138 ? 42.184  35.052  49.639  1.00 73.59 ? 166  TYR A CD2 1 
ATOM   833   C  CE1 . TYR A  1  138 ? 41.668  32.506  48.703  1.00 73.31 ? 166  TYR A CE1 1 
ATOM   834   C  CE2 . TYR A  1  138 ? 41.012  34.416  49.993  1.00 73.48 ? 166  TYR A CE2 1 
ATOM   835   C  CZ  . TYR A  1  138 ? 40.757  33.150  49.526  1.00 73.18 ? 166  TYR A CZ  1 
ATOM   836   O  OH  . TYR A  1  138 ? 39.578  32.547  49.889  1.00 74.12 ? 166  TYR A OH  1 
ATOM   837   N  N   . HIS A  1  139 ? 44.266  37.583  46.384  1.00 74.64 ? 167  HIS A N   1 
ATOM   838   C  CA  . HIS A  1  139 ? 43.556  38.769  45.901  1.00 74.77 ? 167  HIS A CA  1 
ATOM   839   C  C   . HIS A  1  139 ? 43.173  38.733  44.429  1.00 73.83 ? 167  HIS A C   1 
ATOM   840   O  O   . HIS A  1  139 ? 42.584  39.690  43.924  1.00 73.12 ? 167  HIS A O   1 
ATOM   841   C  CB  . HIS A  1  139 ? 44.387  40.016  46.125  1.00 75.69 ? 167  HIS A CB  1 
ATOM   842   C  CG  . HIS A  1  139 ? 45.511  40.149  45.160  1.00 77.71 ? 167  HIS A CG  1 
ATOM   843   N  ND1 . HIS A  1  139 ? 46.492  39.190  45.029  1.00 77.17 ? 167  HIS A ND1 1 
ATOM   844   C  CD2 . HIS A  1  139 ? 45.803  41.115  44.261  1.00 78.93 ? 167  HIS A CD2 1 
ATOM   845   C  CE1 . HIS A  1  139 ? 47.347  39.566  44.097  1.00 79.23 ? 167  HIS A CE1 1 
ATOM   846   N  NE2 . HIS A  1  139 ? 46.951  40.730  43.614  1.00 80.42 ? 167  HIS A NE2 1 
ATOM   847   N  N   . ARG A  1  140 ? 43.531  37.658  43.733  1.00 72.79 ? 168  ARG A N   1 
ATOM   848   C  CA  . ARG A  1  140 ? 43.175  37.531  42.321  1.00 72.05 ? 168  ARG A CA  1 
ATOM   849   C  C   . ARG A  1  140 ? 41.837  36.822  42.205  1.00 71.11 ? 168  ARG A C   1 
ATOM   850   O  O   . ARG A  1  140 ? 41.159  36.922  41.182  1.00 70.46 ? 168  ARG A O   1 
ATOM   851   C  CB  . ARG A  1  140 ? 44.218  36.721  41.559  1.00 71.11 ? 168  ARG A CB  1 
ATOM   852   C  CG  . ARG A  1  140 ? 45.571  37.341  41.525  1.00 70.79 ? 168  ARG A CG  1 
ATOM   853   C  CD  . ARG A  1  140 ? 46.456  36.596  40.552  1.00 70.78 ? 168  ARG A CD  1 
ATOM   854   N  NE  . ARG A  1  140 ? 47.804  37.157  40.532  1.00 70.81 ? 168  ARG A NE  1 
ATOM   855   C  CZ  . ARG A  1  140 ? 48.787  36.725  39.749  1.00 69.64 ? 168  ARG A CZ  1 
ATOM   856   N  NH1 . ARG A  1  140 ? 48.579  35.719  38.909  1.00 69.61 ? 168  ARG A NH1 1 
ATOM   857   N  NH2 . ARG A  1  140 ? 49.979  37.302  39.810  1.00 68.52 ? 168  ARG A NH2 1 
ATOM   858   N  N   . ARG A  1  141 ? 41.477  36.096  43.260  1.00 70.39 ? 169  ARG A N   1 
ATOM   859   C  CA  . ARG A  1  141 ? 40.225  35.357  43.289  1.00 69.79 ? 169  ARG A CA  1 
ATOM   860   C  C   . ARG A  1  141 ? 39.061  36.325  43.062  1.00 70.11 ? 169  ARG A C   1 
ATOM   861   O  O   . ARG A  1  141 ? 38.979  37.380  43.700  1.00 69.73 ? 169  ARG A O   1 
ATOM   862   C  CB  . ARG A  1  141 ? 40.062  34.650  44.639  1.00 68.92 ? 169  ARG A CB  1 
ATOM   863   C  CG  . ARG A  1  141 ? 39.677  35.591  45.756  1.00 69.11 ? 169  ARG A CG  1 
ATOM   864   C  CD  . ARG A  1  141 ? 39.563  34.895  47.085  1.00 68.99 ? 169  ARG A CD  1 
ATOM   865   N  NE  . ARG A  1  141 ? 39.015  35.785  48.103  1.00 69.20 ? 169  ARG A NE  1 
ATOM   866   C  CZ  . ARG A  1  141 ? 39.499  36.993  48.384  1.00 70.12 ? 169  ARG A CZ  1 
ATOM   867   N  NH1 . ARG A  1  141 ? 40.548  37.465  47.720  1.00 69.32 ? 169  ARG A NH1 1 
ATOM   868   N  NH2 . ARG A  1  141 ? 38.937  37.730  49.335  1.00 69.95 ? 169  ARG A NH2 1 
ATOM   869   N  N   . PRO A  1  142 ? 38.150  35.984  42.136  1.00 68.69 ? 170  PRO A N   1 
ATOM   870   C  CA  . PRO A  1  142 ? 36.994  36.829  41.833  1.00 67.40 ? 170  PRO A CA  1 
ATOM   871   C  C   . PRO A  1  142 ? 36.246  37.110  43.118  1.00 67.38 ? 170  PRO A C   1 
ATOM   872   O  O   . PRO A  1  142 ? 36.486  36.454  44.121  1.00 67.90 ? 170  PRO A O   1 
ATOM   873   C  CB  . PRO A  1  142 ? 36.178  35.959  40.890  1.00 67.47 ? 170  PRO A CB  1 
ATOM   874   C  CG  . PRO A  1  142 ? 37.206  35.158  40.201  1.00 67.65 ? 170  PRO A CG  1 
ATOM   875   C  CD  . PRO A  1  142 ? 38.128  34.765  41.313  1.00 67.93 ? 170  PRO A CD  1 
ATOM   876   N  N   . VAL A  1  143 ? 35.345  38.081  43.097  1.00 66.83 ? 171  VAL A N   1 
ATOM   877   C  CA  . VAL A  1  143 ? 34.563  38.388  44.289  1.00 67.01 ? 171  VAL A CA  1 
ATOM   878   C  C   . VAL A  1  143 ? 33.325  37.490  44.323  1.00 66.91 ? 171  VAL A C   1 
ATOM   879   O  O   . VAL A  1  143 ? 32.449  37.585  43.461  1.00 67.24 ? 171  VAL A O   1 
ATOM   880   C  CB  . VAL A  1  143 ? 34.140  39.860  44.301  1.00 66.74 ? 171  VAL A CB  1 
ATOM   881   C  CG1 . VAL A  1  143 ? 35.160  40.697  45.053  1.00 66.35 ? 171  VAL A CG1 1 
ATOM   882   C  CG2 . VAL A  1  143 ? 34.055  40.354  42.886  1.00 68.39 ? 171  VAL A CG2 1 
ATOM   883   N  N   . LEU A  1  144 ? 33.274  36.608  45.320  1.00 66.98 ? 172  LEU A N   1 
ATOM   884   C  CA  . LEU A  1  144 ? 32.173  35.663  45.481  1.00 66.33 ? 172  LEU A CA  1 
ATOM   885   C  C   . LEU A  1  144 ? 30.853  36.378  45.674  1.00 66.88 ? 172  LEU A C   1 
ATOM   886   O  O   . LEU A  1  144 ? 30.813  37.516  46.133  1.00 66.56 ? 172  LEU A O   1 
ATOM   887   C  CB  . LEU A  1  144 ? 32.421  34.744  46.682  1.00 65.87 ? 172  LEU A CB  1 
ATOM   888   C  CG  . LEU A  1  144 ? 33.732  33.950  46.732  1.00 65.60 ? 172  LEU A CG  1 
ATOM   889   C  CD1 . LEU A  1  144 ? 33.789  33.159  48.022  1.00 65.19 ? 172  LEU A CD1 1 
ATOM   890   C  CD2 . LEU A  1  144 ? 33.833  33.021  45.538  1.00 65.25 ? 172  LEU A CD2 1 
ATOM   891   N  N   . PHE A  1  145 ? 29.770  35.697  45.314  1.00 68.37 ? 173  PHE A N   1 
ATOM   892   C  CA  . PHE A  1  145 ? 28.427  36.250  45.456  1.00 68.69 ? 173  PHE A CA  1 
ATOM   893   C  C   . PHE A  1  145 ? 28.197  36.592  46.936  1.00 68.22 ? 173  PHE A C   1 
ATOM   894   O  O   . PHE A  1  145 ? 27.337  37.413  47.274  1.00 68.48 ? 173  PHE A O   1 
ATOM   895   C  CB  . PHE A  1  145 ? 27.381  35.228  44.959  1.00 68.90 ? 173  PHE A CB  1 
ATOM   896   C  CG  . PHE A  1  145 ? 27.219  35.175  43.434  1.00 70.85 ? 173  PHE A CG  1 
ATOM   897   C  CD1 . PHE A  1  145 ? 26.766  34.001  42.807  1.00 70.81 ? 173  PHE A CD1 1 
ATOM   898   C  CD2 . PHE A  1  145 ? 27.454  36.307  42.634  1.00 70.31 ? 173  PHE A CD2 1 
ATOM   899   C  CE1 . PHE A  1  145 ? 26.545  33.955  41.415  1.00 70.36 ? 173  PHE A CE1 1 
ATOM   900   C  CE2 . PHE A  1  145 ? 27.233  36.269  41.244  1.00 69.46 ? 173  PHE A CE2 1 
ATOM   901   C  CZ  . PHE A  1  145 ? 26.778  35.091  40.637  1.00 69.63 ? 173  PHE A CZ  1 
ATOM   902   N  N   . GLN A  1  146 ? 28.988  35.964  47.806  1.00 67.91 ? 174  GLN A N   1 
ATOM   903   C  CA  . GLN A  1  146 ? 28.911  36.178  49.254  1.00 67.66 ? 174  GLN A CA  1 
ATOM   904   C  C   . GLN A  1  146 ? 29.591  37.489  49.643  1.00 66.85 ? 174  GLN A C   1 
ATOM   905   O  O   . GLN A  1  146 ? 29.010  38.316  50.341  1.00 67.42 ? 174  GLN A O   1 
ATOM   906   C  CB  . GLN A  1  146 ? 29.583  35.006  49.992  1.00 68.59 ? 174  GLN A CB  1 
ATOM   907   C  CG  . GLN A  1  146 ? 29.588  35.113  51.516  1.00 66.60 ? 174  GLN A CG  1 
ATOM   908   C  CD  . GLN A  1  146 ? 28.202  35.294  52.090  1.00 65.57 ? 174  GLN A CD  1 
ATOM   909   O  OE1 . GLN A  1  146 ? 27.276  34.563  51.749  1.00 65.67 ? 174  GLN A OE1 1 
ATOM   910   N  NE2 . GLN A  1  146 ? 28.053  36.270  52.973  1.00 66.45 ? 174  GLN A NE2 1 
ATOM   911   N  N   . GLU A  1  147 ? 30.827  37.666  49.191  1.00 67.10 ? 175  GLU A N   1 
ATOM   912   C  CA  . GLU A  1  147 ? 31.580  38.877  49.473  1.00 65.84 ? 175  GLU A CA  1 
ATOM   913   C  C   . GLU A  1  147 ? 30.716  40.081  49.113  1.00 67.05 ? 175  GLU A C   1 
ATOM   914   O  O   . GLU A  1  147 ? 30.743  41.101  49.803  1.00 68.02 ? 175  GLU A O   1 
ATOM   915   C  CB  . GLU A  1  147 ? 32.873  38.897  48.655  1.00 65.57 ? 175  GLU A CB  1 
ATOM   916   C  CG  . GLU A  1  147 ? 33.809  40.043  49.002  1.00 66.05 ? 175  GLU A CG  1 
ATOM   917   C  CD  . GLU A  1  147 ? 35.209  39.857  48.433  1.00 66.43 ? 175  GLU A CD  1 
ATOM   918   O  OE1 . GLU A  1  147 ? 35.545  38.709  48.067  1.00 66.56 ? 175  GLU A OE1 1 
ATOM   919   O  OE2 . GLU A  1  147 ? 35.976  40.850  48.368  1.00 65.50 ? 175  GLU A OE2 1 
ATOM   920   N  N   . TYR A  1  148 ? 29.946  39.950  48.032  1.00 66.90 ? 176  TYR A N   1 
ATOM   921   C  CA  . TYR A  1  148 ? 29.054  41.014  47.568  1.00 66.67 ? 176  TYR A CA  1 
ATOM   922   C  C   . TYR A  1  148 ? 27.986  41.302  48.636  1.00 66.09 ? 176  TYR A C   1 
ATOM   923   O  O   . TYR A  1  148 ? 27.663  42.453  48.919  1.00 65.40 ? 176  TYR A O   1 
ATOM   924   C  CB  . TYR A  1  148 ? 28.395  40.604  46.238  1.00 67.28 ? 176  TYR A CB  1 
ATOM   925   C  CG  . TYR A  1  148 ? 29.320  40.583  45.019  1.00 67.68 ? 176  TYR A CG  1 
ATOM   926   C  CD1 . TYR A  1  148 ? 29.243  39.548  44.074  1.00 68.37 ? 176  TYR A CD1 1 
ATOM   927   C  CD2 . TYR A  1  148 ? 30.226  41.617  44.780  1.00 67.04 ? 176  TYR A CD2 1 
ATOM   928   C  CE1 . TYR A  1  148 ? 30.039  39.550  42.926  1.00 67.86 ? 176  TYR A CE1 1 
ATOM   929   C  CE2 . TYR A  1  148 ? 31.025  41.630  43.637  1.00 67.17 ? 176  TYR A CE2 1 
ATOM   930   C  CZ  . TYR A  1  148 ? 30.926  40.597  42.715  1.00 68.08 ? 176  TYR A CZ  1 
ATOM   931   O  OH  . TYR A  1  148 ? 31.701  40.617  41.576  1.00 67.17 ? 176  TYR A OH  1 
ATOM   932   N  N   . LEU A  1  149 ? 27.434  40.250  49.224  1.00 65.81 ? 177  LEU A N   1 
ATOM   933   C  CA  . LEU A  1  149 ? 26.447  40.428  50.265  1.00 65.13 ? 177  LEU A CA  1 
ATOM   934   C  C   . LEU A  1  149 ? 27.151  41.122  51.390  1.00 65.50 ? 177  LEU A C   1 
ATOM   935   O  O   . LEU A  1  149 ? 26.737  42.195  51.814  1.00 66.66 ? 177  LEU A O   1 
ATOM   936   C  CB  . LEU A  1  149 ? 25.942  39.089  50.752  1.00 65.19 ? 177  LEU A CB  1 
ATOM   937   C  CG  . LEU A  1  149 ? 25.041  38.461  49.713  1.00 65.12 ? 177  LEU A CG  1 
ATOM   938   C  CD1 . LEU A  1  149 ? 24.604  37.089  50.163  1.00 66.18 ? 177  LEU A CD1 1 
ATOM   939   C  CD2 . LEU A  1  149 ? 23.849  39.374  49.512  1.00 66.12 ? 177  LEU A CD2 1 
ATOM   940   N  N   . ASP A  1  150 ? 28.224  40.490  51.864  1.00 65.26 ? 178  ASP A N   1 
ATOM   941   C  CA  . ASP A  1  150 ? 29.036  41.027  52.951  1.00 65.94 ? 178  ASP A CA  1 
ATOM   942   C  C   . ASP A  1  150 ? 29.265  42.521  52.724  1.00 66.34 ? 178  ASP A C   1 
ATOM   943   O  O   . ASP A  1  150 ? 29.260  43.315  53.671  1.00 66.10 ? 178  ASP A O   1 
ATOM   944   C  CB  . ASP A  1  150 ? 30.394  40.301  53.037  1.00 66.56 ? 178  ASP A CB  1 
ATOM   945   C  CG  . ASP A  1  150 ? 30.304  38.941  53.729  1.00 66.10 ? 178  ASP A CG  1 
ATOM   946   O  OD1 . ASP A  1  150 ? 29.388  38.758  54.552  1.00 65.84 ? 178  ASP A OD1 1 
ATOM   947   O  OD2 . ASP A  1  150 ? 31.161  38.065  53.472  1.00 66.40 ? 178  ASP A OD2 1 
ATOM   948   N  N   . ILE A  1  151 ? 29.461  42.901  51.464  1.00 65.89 ? 179  ILE A N   1 
ATOM   949   C  CA  . ILE A  1  151 ? 29.674  44.303  51.124  1.00 66.00 ? 179  ILE A CA  1 
ATOM   950   C  C   . ILE A  1  151 ? 28.394  45.107  51.354  1.00 64.86 ? 179  ILE A C   1 
ATOM   951   O  O   . ILE A  1  151 ? 28.390  46.047  52.143  1.00 65.79 ? 179  ILE A O   1 
ATOM   952   C  CB  . ILE A  1  151 ? 30.167  44.473  49.642  1.00 65.88 ? 179  ILE A CB  1 
ATOM   953   C  CG1 . ILE A  1  151 ? 31.664  44.133  49.544  1.00 64.95 ? 179  ILE A CG1 1 
ATOM   954   C  CG2 . ILE A  1  151 ? 29.905  45.892  49.151  1.00 65.14 ? 179  ILE A CG2 1 
ATOM   955   C  CD1 . ILE A  1  151 ? 32.289  44.363  48.175  1.00 64.10 ? 179  ILE A CD1 1 
ATOM   956   N  N   . ASP A  1  152 ? 27.306  44.730  50.689  1.00 64.69 ? 180  ASP A N   1 
ATOM   957   C  CA  . ASP A  1  152 ? 26.052  45.454  50.853  1.00 65.02 ? 180  ASP A CA  1 
ATOM   958   C  C   . ASP A  1  152 ? 25.709  45.673  52.306  1.00 65.61 ? 180  ASP A C   1 
ATOM   959   O  O   . ASP A  1  152 ? 25.135  46.704  52.672  1.00 65.00 ? 180  ASP A O   1 
ATOM   960   C  CB  . ASP A  1  152 ? 24.918  44.720  50.166  1.00 66.01 ? 180  ASP A CB  1 
ATOM   961   C  CG  . ASP A  1  152 ? 25.001  44.829  48.664  1.00 67.50 ? 180  ASP A CG  1 
ATOM   962   O  OD1 . ASP A  1  152 ? 25.734  45.723  48.172  1.00 66.07 ? 180  ASP A OD1 1 
ATOM   963   O  OD2 . ASP A  1  152 ? 24.323  44.033  47.976  1.00 68.90 ? 180  ASP A OD2 1 
ATOM   964   N  N   . GLN A  1  153 ? 26.056  44.694  53.134  1.00 64.99 ? 181  GLN A N   1 
ATOM   965   C  CA  . GLN A  1  153 ? 25.810  44.811  54.555  1.00 64.40 ? 181  GLN A CA  1 
ATOM   966   C  C   . GLN A  1  153 ? 26.620  46.024  55.006  1.00 64.63 ? 181  GLN A C   1 
ATOM   967   O  O   . GLN A  1  153 ? 26.086  46.944  55.617  1.00 65.95 ? 181  GLN A O   1 
ATOM   968   C  CB  . GLN A  1  153 ? 26.277  43.551  55.292  1.00 65.73 ? 181  GLN A CB  1 
ATOM   969   C  CG  . GLN A  1  153 ? 25.453  42.290  55.010  1.00 67.61 ? 181  GLN A CG  1 
ATOM   970   C  CD  . GLN A  1  153 ? 26.052  41.028  55.659  1.00 68.92 ? 181  GLN A CD  1 
ATOM   971   O  OE1 . GLN A  1  153 ? 26.377  41.023  56.851  1.00 68.88 ? 181  GLN A OE1 1 
ATOM   972   N  NE2 . GLN A  1  153 ? 26.191  39.954  54.873  1.00 68.68 ? 181  GLN A NE2 1 
ATOM   973   N  N   . MET A  1  154 ? 27.908  46.041  54.679  1.00 64.17 ? 182  MET A N   1 
ATOM   974   C  CA  . MET A  1  154 ? 28.751  47.161  55.071  1.00 64.02 ? 182  MET A CA  1 
ATOM   975   C  C   . MET A  1  154 ? 28.204  48.497  54.574  1.00 64.28 ? 182  MET A C   1 
ATOM   976   O  O   . MET A  1  154 ? 28.304  49.514  55.263  1.00 63.88 ? 182  MET A O   1 
ATOM   977   C  CB  . MET A  1  154 ? 30.176  46.993  54.548  1.00 62.82 ? 182  MET A CB  1 
ATOM   978   C  CG  . MET A  1  154 ? 31.076  48.144  54.987  1.00 64.14 ? 182  MET A CG  1 
ATOM   979   S  SD  . MET A  1  154 ? 32.768  48.167  54.345  1.00 66.11 ? 182  MET A SD  1 
ATOM   980   C  CE  . MET A  1  154 ? 33.209  49.855  54.704  1.00 64.11 ? 182  MET A CE  1 
ATOM   981   N  N   . ILE A  1  155 ? 27.634  48.499  53.374  1.00 63.42 ? 183  ILE A N   1 
ATOM   982   C  CA  . ILE A  1  155 ? 27.093  49.724  52.819  1.00 62.72 ? 183  ILE A CA  1 
ATOM   983   C  C   . ILE A  1  155 ? 25.841  50.162  53.543  1.00 64.24 ? 183  ILE A C   1 
ATOM   984   O  O   . ILE A  1  155 ? 25.852  51.136  54.296  1.00 63.99 ? 183  ILE A O   1 
ATOM   985   C  CB  . ILE A  1  155 ? 26.736  49.575  51.348  1.00 61.69 ? 183  ILE A CB  1 
ATOM   986   C  CG1 . ILE A  1  155 ? 27.982  49.232  50.546  1.00 63.22 ? 183  ILE A CG1 1 
ATOM   987   C  CG2 . ILE A  1  155 ? 26.151  50.868  50.830  1.00 62.05 ? 183  ILE A CG2 1 
ATOM   988   C  CD1 . ILE A  1  155 ? 27.794  49.346  49.045  1.00 62.84 ? 183  ILE A CD1 1 
ATOM   989   N  N   . PHE A  1  156 ? 24.760  49.427  53.317  1.00 64.60 ? 184  PHE A N   1 
ATOM   990   C  CA  . PHE A  1  156 ? 23.481  49.757  53.917  1.00 64.18 ? 184  PHE A CA  1 
ATOM   991   C  C   . PHE A  1  156 ? 23.470  49.748  55.428  1.00 64.18 ? 184  PHE A C   1 
ATOM   992   O  O   . PHE A  1  156 ? 22.965  50.675  56.057  1.00 64.67 ? 184  PHE A O   1 
ATOM   993   C  CB  . PHE A  1  156 ? 22.416  48.816  53.382  1.00 63.44 ? 184  PHE A CB  1 
ATOM   994   C  CG  . PHE A  1  156 ? 22.345  48.802  51.889  1.00 65.03 ? 184  PHE A CG  1 
ATOM   995   C  CD1 . PHE A  1  156 ? 23.218  48.013  51.142  1.00 65.29 ? 184  PHE A CD1 1 
ATOM   996   C  CD2 . PHE A  1  156 ? 21.442  49.622  51.216  1.00 65.57 ? 184  PHE A CD2 1 
ATOM   997   C  CE1 . PHE A  1  156 ? 23.190  48.044  49.736  1.00 65.76 ? 184  PHE A CE1 1 
ATOM   998   C  CE2 . PHE A  1  156 ? 21.407  49.663  49.810  1.00 64.81 ? 184  PHE A CE2 1 
ATOM   999   C  CZ  . PHE A  1  156 ? 22.280  48.874  49.071  1.00 64.66 ? 184  PHE A CZ  1 
ATOM   1000  N  N   . ASN A  1  157 ? 24.049  48.713  56.016  1.00 64.95 ? 185  ASN A N   1 
ATOM   1001  C  CA  . ASN A  1  157 ? 24.056  48.589  57.470  1.00 66.19 ? 185  ASN A CA  1 
ATOM   1002  C  C   . ASN A  1  157 ? 25.291  49.111  58.189  1.00 66.11 ? 185  ASN A C   1 
ATOM   1003  O  O   . ASN A  1  157 ? 25.746  48.501  59.159  1.00 66.17 ? 185  ASN A O   1 
ATOM   1004  C  CB  . ASN A  1  157 ? 23.832  47.126  57.860  1.00 65.48 ? 185  ASN A CB  1 
ATOM   1005  C  CG  . ASN A  1  157 ? 22.466  46.619  57.448  1.00 65.75 ? 185  ASN A CG  1 
ATOM   1006  O  OD1 . ASN A  1  157 ? 22.285  45.423  57.235  1.00 67.70 ? 185  ASN A OD1 1 
ATOM   1007  N  ND2 . ASN A  1  157 ? 21.493  47.524  57.346  1.00 66.43 ? 185  ASN A ND2 1 
ATOM   1008  N  N   . ARG A  1  158 ? 25.829  50.238  57.732  1.00 66.12 ? 186  ARG A N   1 
ATOM   1009  C  CA  . ARG A  1  158 ? 27.007  50.814  58.374  1.00 65.31 ? 186  ARG A CA  1 
ATOM   1010  C  C   . ARG A  1  158 ? 27.360  52.168  57.797  1.00 65.42 ? 186  ARG A C   1 
ATOM   1011  O  O   . ARG A  1  158 ? 27.739  53.086  58.524  1.00 64.76 ? 186  ARG A O   1 
ATOM   1012  C  CB  . ARG A  1  158 ? 28.218  49.888  58.218  1.00 65.97 ? 186  ARG A CB  1 
ATOM   1013  C  CG  . ARG A  1  158 ? 28.508  48.993  59.415  1.00 66.70 ? 186  ARG A CG  1 
ATOM   1014  C  CD  . ARG A  1  158 ? 29.767  48.157  59.183  1.00 68.43 ? 186  ARG A CD  1 
ATOM   1015  N  NE  . ARG A  1  158 ? 30.931  48.990  58.863  1.00 70.33 ? 186  ARG A NE  1 
ATOM   1016  C  CZ  . ARG A  1  158 ? 32.144  48.523  58.556  1.00 70.49 ? 186  ARG A CZ  1 
ATOM   1017  N  NH1 . ARG A  1  158 ? 32.388  47.211  58.523  1.00 69.52 ? 186  ARG A NH1 1 
ATOM   1018  N  NH2 . ARG A  1  158 ? 33.117  49.380  58.268  1.00 70.64 ? 186  ARG A NH2 1 
ATOM   1019  N  N   . GLU A  1  159 ? 27.226  52.287  56.483  1.00 65.34 ? 187  GLU A N   1 
ATOM   1020  C  CA  . GLU A  1  159 ? 27.581  53.519  55.807  1.00 64.73 ? 187  GLU A CA  1 
ATOM   1021  C  C   . GLU A  1  159 ? 26.396  54.361  55.364  1.00 64.21 ? 187  GLU A C   1 
ATOM   1022  O  O   . GLU A  1  159 ? 26.249  55.495  55.803  1.00 64.95 ? 187  GLU A O   1 
ATOM   1023  C  CB  . GLU A  1  159 ? 28.473  53.189  54.611  1.00 63.77 ? 187  GLU A CB  1 
ATOM   1024  C  CG  . GLU A  1  159 ? 29.640  52.269  54.960  1.00 64.11 ? 187  GLU A CG  1 
ATOM   1025  C  CD  . GLU A  1  159 ? 30.719  52.940  55.810  1.00 64.49 ? 187  GLU A CD  1 
ATOM   1026  O  OE1 . GLU A  1  159 ? 31.496  52.188  56.449  1.00 63.14 ? 187  GLU A OE1 1 
ATOM   1027  O  OE2 . GLU A  1  159 ? 30.802  54.198  55.824  1.00 63.08 ? 187  GLU A OE2 1 
ATOM   1028  N  N   . LEU A  1  160 ? 25.551  53.814  54.500  1.00 63.68 ? 188  LEU A N   1 
ATOM   1029  C  CA  . LEU A  1  160 ? 24.402  54.556  53.997  1.00 63.89 ? 188  LEU A CA  1 
ATOM   1030  C  C   . LEU A  1  160 ? 23.579  55.291  55.028  1.00 63.56 ? 188  LEU A C   1 
ATOM   1031  O  O   . LEU A  1  160 ? 23.069  56.370  54.759  1.00 64.21 ? 188  LEU A O   1 
ATOM   1032  C  CB  . LEU A  1  160 ? 23.493  53.639  53.201  1.00 64.39 ? 188  LEU A CB  1 
ATOM   1033  C  CG  . LEU A  1  160 ? 24.171  53.223  51.902  1.00 64.50 ? 188  LEU A CG  1 
ATOM   1034  C  CD1 . LEU A  1  160 ? 23.210  52.395  51.074  1.00 64.32 ? 188  LEU A CD1 1 
ATOM   1035  C  CD2 . LEU A  1  160 ? 24.613  54.467  51.144  1.00 63.18 ? 188  LEU A CD2 1 
ATOM   1036  N  N   . PRO A  1  161 ? 23.408  54.709  56.214  1.00 63.43 ? 189  PRO A N   1 
ATOM   1037  C  CA  . PRO A  1  161 ? 22.619  55.431  57.203  1.00 62.25 ? 189  PRO A CA  1 
ATOM   1038  C  C   . PRO A  1  161 ? 23.287  56.737  57.633  1.00 63.02 ? 189  PRO A C   1 
ATOM   1039  O  O   . PRO A  1  161 ? 22.594  57.701  57.938  1.00 64.07 ? 189  PRO A O   1 
ATOM   1040  C  CB  . PRO A  1  161 ? 22.487  54.420  58.330  1.00 62.67 ? 189  PRO A CB  1 
ATOM   1041  C  CG  . PRO A  1  161 ? 23.702  53.564  58.171  1.00 63.08 ? 189  PRO A CG  1 
ATOM   1042  C  CD  . PRO A  1  161 ? 23.761  53.369  56.701  1.00 63.71 ? 189  PRO A CD  1 
ATOM   1043  N  N   . GLN A  1  162 ? 24.625  56.769  57.638  1.00 64.07 ? 190  GLN A N   1 
ATOM   1044  C  CA  . GLN A  1  162 ? 25.411  57.962  58.017  1.00 62.62 ? 190  GLN A CA  1 
ATOM   1045  C  C   . GLN A  1  162 ? 25.109  59.166  57.139  1.00 63.55 ? 190  GLN A C   1 
ATOM   1046  O  O   . GLN A  1  162 ? 25.656  60.247  57.350  1.00 64.18 ? 190  GLN A O   1 
ATOM   1047  C  CB  . GLN A  1  162 ? 26.910  57.691  57.921  1.00 62.06 ? 190  GLN A CB  1 
ATOM   1048  C  CG  . GLN A  1  162 ? 27.466  56.760  58.970  1.00 62.90 ? 190  GLN A CG  1 
ATOM   1049  C  CD  . GLN A  1  162 ? 28.911  56.381  58.687  1.00 63.83 ? 190  GLN A CD  1 
ATOM   1050  O  OE1 . GLN A  1  162 ? 29.726  57.238  58.353  1.00 64.52 ? 190  GLN A OE1 1 
ATOM   1051  N  NE2 . GLN A  1  162 ? 29.238  55.097  58.819  1.00 63.40 ? 190  GLN A NE2 1 
ATOM   1052  N  N   . ALA A  1  163 ? 24.269  58.956  56.133  1.00 63.82 ? 191  ALA A N   1 
ATOM   1053  C  CA  . ALA A  1  163 ? 23.861  60.007  55.212  1.00 63.26 ? 191  ALA A CA  1 
ATOM   1054  C  C   . ALA A  1  163 ? 22.353  59.868  55.028  1.00 63.09 ? 191  ALA A C   1 
ATOM   1055  O  O   . ALA A  1  163 ? 21.802  60.107  53.955  1.00 63.17 ? 191  ALA A O   1 
ATOM   1056  C  CB  . ALA A  1  163 ? 24.576  59.851  53.891  1.00 62.83 ? 191  ALA A CB  1 
ATOM   1057  N  N   . SER A  1  164 ? 21.697  59.463  56.105  1.00 63.28 ? 192  SER A N   1 
ATOM   1058  C  CA  . SER A  1  164 ? 20.258  59.277  56.121  1.00 64.27 ? 192  SER A CA  1 
ATOM   1059  C  C   . SER A  1  164 ? 19.567  60.586  55.730  1.00 64.57 ? 192  SER A C   1 
ATOM   1060  O  O   . SER A  1  164 ? 18.595  60.600  54.969  1.00 62.60 ? 192  SER A O   1 
ATOM   1061  C  CB  . SER A  1  164 ? 19.832  58.847  57.530  1.00 63.62 ? 192  SER A CB  1 
ATOM   1062  O  OG  . SER A  1  164 ? 18.426  58.739  57.645  1.00 64.73 ? 192  SER A OG  1 
ATOM   1063  N  N   . GLY A  1  165 ? 20.083  61.686  56.264  1.00 64.40 ? 193  GLY A N   1 
ATOM   1064  C  CA  . GLY A  1  165 ? 19.502  62.969  55.963  1.00 64.21 ? 193  GLY A CA  1 
ATOM   1065  C  C   . GLY A  1  165 ? 19.535  63.249  54.482  1.00 64.86 ? 193  GLY A C   1 
ATOM   1066  O  O   . GLY A  1  165 ? 18.497  63.470  53.858  1.00 65.70 ? 193  GLY A O   1 
ATOM   1067  N  N   . LEU A  1  166 ? 20.734  63.234  53.913  1.00 65.18 ? 194  LEU A N   1 
ATOM   1068  C  CA  . LEU A  1  166 ? 20.927  63.509  52.490  1.00 66.26 ? 194  LEU A CA  1 
ATOM   1069  C  C   . LEU A  1  166 ? 20.032  62.676  51.587  1.00 66.30 ? 194  LEU A C   1 
ATOM   1070  O  O   . LEU A  1  166 ? 19.359  63.201  50.706  1.00 66.09 ? 194  LEU A O   1 
ATOM   1071  C  CB  . LEU A  1  166 ? 22.393  63.282  52.111  1.00 65.30 ? 194  LEU A CB  1 
ATOM   1072  C  CG  . LEU A  1  166 ? 22.728  63.383  50.621  1.00 65.38 ? 194  LEU A CG  1 
ATOM   1073  C  CD1 . LEU A  1  166 ? 22.062  64.596  50.013  1.00 65.74 ? 194  LEU A CD1 1 
ATOM   1074  C  CD2 . LEU A  1  166 ? 24.230  63.461  50.442  1.00 65.58 ? 194  LEU A CD2 1 
ATOM   1075  N  N   . LEU A  1  167 ? 20.034  61.374  51.830  1.00 67.14 ? 195  LEU A N   1 
ATOM   1076  C  CA  . LEU A  1  167 ? 19.255  60.428  51.061  1.00 66.99 ? 195  LEU A CA  1 
ATOM   1077  C  C   . LEU A  1  167 ? 17.765  60.636  51.198  1.00 67.83 ? 195  LEU A C   1 
ATOM   1078  O  O   . LEU A  1  167 ? 17.037  60.641  50.206  1.00 67.88 ? 195  LEU A O   1 
ATOM   1079  C  CB  . LEU A  1  167 ? 19.607  59.031  51.513  1.00 66.83 ? 195  LEU A CB  1 
ATOM   1080  C  CG  . LEU A  1  167 ? 21.090  58.717  51.414  1.00 67.05 ? 195  LEU A CG  1 
ATOM   1081  C  CD1 . LEU A  1  167 ? 21.384  57.337  51.984  1.00 66.75 ? 195  LEU A CD1 1 
ATOM   1082  C  CD2 . LEU A  1  167 ? 21.492  58.810  49.958  1.00 66.34 ? 195  LEU A CD2 1 
ATOM   1083  N  N   . HIS A  1  168 ? 17.311  60.794  52.435  1.00 68.91 ? 196  HIS A N   1 
ATOM   1084  C  CA  . HIS A  1  168 ? 15.892  61.007  52.713  1.00 71.12 ? 196  HIS A CA  1 
ATOM   1085  C  C   . HIS A  1  168 ? 15.345  62.167  51.908  1.00 70.82 ? 196  HIS A C   1 
ATOM   1086  O  O   . HIS A  1  168 ? 14.132  62.328  51.750  1.00 70.57 ? 196  HIS A O   1 
ATOM   1087  C  CB  . HIS A  1  168 ? 15.678  61.287  54.199  1.00 72.35 ? 196  HIS A CB  1 
ATOM   1088  C  CG  . HIS A  1  168 ? 14.941  60.200  54.916  1.00 74.30 ? 196  HIS A CG  1 
ATOM   1089  N  ND1 . HIS A  1  168 ? 15.481  59.514  55.986  1.00 74.42 ? 196  HIS A ND1 1 
ATOM   1090  C  CD2 . HIS A  1  168 ? 13.711  59.669  54.707  1.00 73.61 ? 196  HIS A CD2 1 
ATOM   1091  C  CE1 . HIS A  1  168 ? 14.615  58.607  56.406  1.00 74.24 ? 196  HIS A CE1 1 
ATOM   1092  N  NE2 . HIS A  1  168 ? 13.534  58.680  55.646  1.00 74.87 ? 196  HIS A NE2 1 
ATOM   1093  N  N   . HIS A  1  169 ? 16.268  62.975  51.409  1.00 71.52 ? 197  HIS A N   1 
ATOM   1094  C  CA  . HIS A  1  169 ? 15.933  64.139  50.626  1.00 72.22 ? 197  HIS A CA  1 
ATOM   1095  C  C   . HIS A  1  169 ? 16.028  63.804  49.145  1.00 73.02 ? 197  HIS A C   1 
ATOM   1096  O  O   . HIS A  1  169 ? 15.028  63.519  48.484  1.00 73.10 ? 197  HIS A O   1 
ATOM   1097  C  CB  . HIS A  1  169 ? 16.899  65.277  50.957  1.00 72.05 ? 197  HIS A CB  1 
ATOM   1098  C  CG  . HIS A  1  169 ? 16.308  66.630  50.747  1.00 73.68 ? 197  HIS A CG  1 
ATOM   1099  N  ND1 . HIS A  1  169 ? 15.332  67.144  51.576  1.00 74.31 ? 197  HIS A ND1 1 
ATOM   1100  C  CD2 . HIS A  1  169 ? 16.483  67.538  49.758  1.00 73.59 ? 197  HIS A CD2 1 
ATOM   1101  C  CE1 . HIS A  1  169 ? 14.925  68.309  51.100  1.00 74.80 ? 197  HIS A CE1 1 
ATOM   1102  N  NE2 . HIS A  1  169 ? 15.609  68.571  49.997  1.00 74.36 ? 197  HIS A NE2 1 
ATOM   1103  N  N   . CYS A  1  170 ? 17.256  63.842  48.642  1.00 73.79 ? 198  CYS A N   1 
ATOM   1104  C  CA  . CYS A  1  170 ? 17.569  63.559  47.249  1.00 73.23 ? 198  CYS A CA  1 
ATOM   1105  C  C   . CYS A  1  170 ? 16.967  62.330  46.672  1.00 73.16 ? 198  CYS A C   1 
ATOM   1106  O  O   . CYS A  1  170 ? 16.422  62.326  45.572  1.00 73.66 ? 198  CYS A O   1 
ATOM   1107  C  CB  . CYS A  1  170 ? 19.070  63.351  47.056  1.00 73.83 ? 198  CYS A CB  1 
ATOM   1108  S  SG  . CYS A  1  170 ? 19.801  61.818  47.778  1.00 76.77 ? 198  CYS A SG  1 
ATOM   1109  N  N   . CYS A  1  171 ? 17.080  61.276  47.452  1.00 74.25 ? 199  CYS A N   1 
ATOM   1110  C  CA  . CYS A  1  171 ? 16.748  59.977  46.962  1.00 74.58 ? 199  CYS A CA  1 
ATOM   1111  C  C   . CYS A  1  171 ? 15.639  59.136  47.585  1.00 75.49 ? 199  CYS A C   1 
ATOM   1112  O  O   . CYS A  1  171 ? 15.705  57.907  47.552  1.00 75.64 ? 199  CYS A O   1 
ATOM   1113  C  CB  . CYS A  1  171 ? 18.077  59.239  46.955  1.00 74.32 ? 199  CYS A CB  1 
ATOM   1114  S  SG  . CYS A  1  171 ? 19.512  60.291  46.428  1.00 78.49 ? 199  CYS A SG  1 
ATOM   1115  N  N   . PHE A  1  172 ? 14.614  59.790  48.126  1.00 76.76 ? 200  PHE A N   1 
ATOM   1116  C  CA  . PHE A  1  172 ? 13.472  59.085  48.711  1.00 76.93 ? 200  PHE A CA  1 
ATOM   1117  C  C   . PHE A  1  172 ? 13.940  57.951  49.615  1.00 77.40 ? 200  PHE A C   1 
ATOM   1118  O  O   . PHE A  1  172 ? 13.163  57.074  49.985  1.00 77.66 ? 200  PHE A O   1 
ATOM   1119  C  CB  . PHE A  1  172 ? 12.591  58.491  47.599  1.00 76.38 ? 200  PHE A CB  1 
ATOM   1120  C  CG  . PHE A  1  172 ? 12.354  59.423  46.433  1.00 77.57 ? 200  PHE A CG  1 
ATOM   1121  C  CD1 . PHE A  1  172 ? 13.356  59.643  45.488  1.00 77.74 ? 200  PHE A CD1 1 
ATOM   1122  C  CD2 . PHE A  1  172 ? 11.129  60.074  46.272  1.00 77.39 ? 200  PHE A CD2 1 
ATOM   1123  C  CE1 . PHE A  1  172 ? 13.147  60.492  44.404  1.00 77.41 ? 200  PHE A CE1 1 
ATOM   1124  C  CE2 . PHE A  1  172 ? 10.911  60.928  45.184  1.00 77.23 ? 200  PHE A CE2 1 
ATOM   1125  C  CZ  . PHE A  1  172 ? 11.923  61.135  44.251  1.00 77.02 ? 200  PHE A CZ  1 
ATOM   1126  N  N   . TYR A  1  173 ? 15.216  57.980  49.975  1.00 78.08 ? 201  TYR A N   1 
ATOM   1127  C  CA  . TYR A  1  173 ? 15.805  56.939  50.802  1.00 78.52 ? 201  TYR A CA  1 
ATOM   1128  C  C   . TYR A  1  173 ? 15.203  56.697  52.154  1.00 79.39 ? 201  TYR A C   1 
ATOM   1129  O  O   . TYR A  1  173 ? 15.532  57.384  53.116  1.00 79.81 ? 201  TYR A O   1 
ATOM   1130  C  CB  . TYR A  1  173 ? 17.279  57.208  51.037  1.00 78.98 ? 201  TYR A CB  1 
ATOM   1131  C  CG  . TYR A  1  173 ? 17.913  56.324  52.103  1.00 78.11 ? 201  TYR A CG  1 
ATOM   1132  C  CD1 . TYR A  1  173 ? 18.224  54.990  51.840  1.00 78.63 ? 201  TYR A CD1 1 
ATOM   1133  C  CD2 . TYR A  1  173 ? 18.279  56.851  53.342  1.00 77.92 ? 201  TYR A CD2 1 
ATOM   1134  C  CE1 . TYR A  1  173 ? 18.901  54.207  52.776  1.00 78.74 ? 201  TYR A CE1 1 
ATOM   1135  C  CE2 . TYR A  1  173 ? 18.953  56.083  54.279  1.00 78.27 ? 201  TYR A CE2 1 
ATOM   1136  C  CZ  . TYR A  1  173 ? 19.271  54.761  53.989  1.00 78.85 ? 201  TYR A CZ  1 
ATOM   1137  O  OH  . TYR A  1  173 ? 20.009  54.011  54.884  1.00 78.46 ? 201  TYR A OH  1 
ATOM   1138  N  N   . LYS A  1  174 ? 14.328  55.712  52.244  1.00 81.07 ? 202  LYS A N   1 
ATOM   1139  C  CA  . LYS A  1  174 ? 13.783  55.365  53.544  1.00 82.78 ? 202  LYS A CA  1 
ATOM   1140  C  C   . LYS A  1  174 ? 14.788  54.243  53.904  1.00 83.25 ? 202  LYS A C   1 
ATOM   1141  O  O   . LYS A  1  174 ? 15.044  53.393  53.039  1.00 82.62 ? 202  LYS A O   1 
ATOM   1142  C  CB  . LYS A  1  174 ? 12.342  54.829  53.388  1.00 82.04 ? 202  LYS A CB  1 
ATOM   1143  C  CG  . LYS A  1  174 ? 11.337  55.808  52.745  1.00 81.62 ? 202  LYS A CG  1 
ATOM   1144  C  CD  . LYS A  1  174 ? 10.001  55.118  52.452  1.00 81.70 ? 202  LYS A CD  1 
ATOM   1145  C  CE  . LYS A  1  174 ? 8.953   56.090  51.918  1.00 81.93 ? 202  LYS A CE  1 
ATOM   1146  N  NZ  . LYS A  1  174 ? 7.651   55.420  51.619  1.00 82.14 ? 202  LYS A NZ  1 
ATOM   1147  N  N   . HIS A  1  175 ? 15.398  54.256  55.108  1.00 82.53 ? 203  HIS A N   1 
ATOM   1148  C  CA  . HIS A  1  175 ? 16.362  53.179  55.511  1.00 70.26 ? 203  HIS A CA  1 
ATOM   1149  C  C   . HIS A  1  175 ? 15.596  51.881  55.290  1.00 82.88 ? 203  HIS A C   1 
ATOM   1150  O  O   . HIS A  1  175 ? 16.138  50.777  55.411  1.00 82.53 ? 203  HIS A O   1 
ATOM   1151  C  CB  . HIS A  1  175 ? 16.660  53.122  57.025  1.00 47.81 ? 203  HIS A CB  1 
ATOM   1152  C  CG  . HIS A  1  175 ? 17.803  53.965  57.521  1.00 48.65 ? 203  HIS A CG  1 
ATOM   1153  N  ND1 . HIS A  1  175 ? 18.539  54.829  56.726  1.00 32.79 ? 203  HIS A ND1 1 
ATOM   1154  C  CD2 . HIS A  1  175 ? 18.272  54.133  58.785  1.00 29.07 ? 203  HIS A CD2 1 
ATOM   1155  C  CE1 . HIS A  1  175 ? 19.401  55.498  57.480  1.00 20.33 ? 203  HIS A CE1 1 
ATOM   1156  N  NE2 . HIS A  1  175 ? 19.257  55.095  58.734  1.00 21.32 ? 203  HIS A NE2 1 
ATOM   1157  N  N   . ARG A  1  176 ? 14.307  52.058  55.017  1.00 84.80 ? 204  ARG A N   1 
ATOM   1158  C  CA  . ARG A  1  176 ? 13.332  50.990  54.847  1.00 72.10 ? 204  ARG A CA  1 
ATOM   1159  C  C   . ARG A  1  176 ? 13.133  50.176  53.570  1.00 83.77 ? 204  ARG A C   1 
ATOM   1160  O  O   . ARG A  1  176 ? 12.394  50.588  52.663  1.00 83.87 ? 204  ARG A O   1 
ATOM   1161  C  CB  . ARG A  1  176 ? 11.971  51.536  55.239  1.00 57.87 ? 204  ARG A CB  1 
ATOM   1162  C  CG  . ARG A  1  176 ? 11.240  50.631  56.165  1.00 50.16 ? 204  ARG A CG  1 
ATOM   1163  C  CD  . ARG A  1  176 ? 11.968  49.299  56.270  1.00 29.34 ? 204  ARG A CD  1 
ATOM   1164  N  NE  . ARG A  1  176 ? 11.577  48.548  57.456  1.00 18.23 ? 204  ARG A NE  1 
ATOM   1165  C  CZ  . ARG A  1  176 ? 12.243  48.588  58.609  1.00 21.70 ? 204  ARG A CZ  1 
ATOM   1166  N  NH1 . ARG A  1  176 ? 13.347  49.348  58.737  1.00 22.03 ? 204  ARG A NH1 1 
ATOM   1167  N  NH2 . ARG A  1  176 ? 11.810  47.861  59.638  1.00 20.57 ? 204  ARG A NH2 1 
ATOM   1168  N  N   . GLY A  1  177 ? 13.729  48.986  53.545  1.00 82.83 ? 205  GLY A N   1 
ATOM   1169  C  CA  . GLY A  1  177 ? 13.581  48.124  52.388  1.00 82.37 ? 205  GLY A CA  1 
ATOM   1170  C  C   . GLY A  1  177 ? 14.711  48.239  51.386  1.00 81.19 ? 205  GLY A C   1 
ATOM   1171  O  O   . GLY A  1  177 ? 14.717  47.521  50.380  1.00 82.40 ? 205  GLY A O   1 
ATOM   1172  N  N   . ARG A  1  178 ? 15.654  49.144  51.634  1.00 79.74 ? 206  ARG A N   1 
ATOM   1173  C  CA  . ARG A  1  178 ? 16.781  49.283  50.728  1.00 79.39 ? 206  ARG A CA  1 
ATOM   1174  C  C   . ARG A  1  178 ? 16.250  49.480  49.277  1.00 79.13 ? 206  ARG A C   1 
ATOM   1175  O  O   . ARG A  1  178 ? 16.281  48.556  48.460  1.00 78.59 ? 206  ARG A O   1 
ATOM   1176  C  CB  . ARG A  1  178 ? 17.643  48.005  50.870  1.00 78.44 ? 206  ARG A CB  1 
ATOM   1177  C  CG  . ARG A  1  178 ? 18.828  47.880  49.934  1.00 78.75 ? 206  ARG A CG  1 
ATOM   1178  C  CD  . ARG A  1  178 ? 19.490  46.489  49.976  1.00 77.87 ? 206  ARG A CD  1 
ATOM   1179  N  NE  . ARG A  1  178 ? 19.982  46.101  51.301  1.00 78.14 ? 206  ARG A NE  1 
ATOM   1180  C  CZ  . ARG A  1  178 ? 21.025  45.294  51.504  1.00 77.28 ? 206  ARG A CZ  1 
ATOM   1181  N  NH1 . ARG A  1  178 ? 21.689  44.794  50.469  1.00 75.77 ? 206  ARG A NH1 1 
ATOM   1182  N  NH2 . ARG A  1  178 ? 21.406  44.982  52.740  1.00 76.68 ? 206  ARG A NH2 1 
ATOM   1183  N  N   . ASN A  1  179 ? 15.739  50.671  48.959  1.00 77.81 ? 207  ASN A N   1 
ATOM   1184  C  CA  . ASN A  1  179 ? 15.225  50.911  47.604  1.00 76.56 ? 207  ASN A CA  1 
ATOM   1185  C  C   . ASN A  1  179 ? 16.351  51.150  46.582  1.00 75.29 ? 207  ASN A C   1 
ATOM   1186  O  O   . ASN A  1  179 ? 16.084  51.405  45.404  1.00 74.54 ? 207  ASN A O   1 
ATOM   1187  C  CB  . ASN A  1  179 ? 14.215  52.092  47.588  1.00 76.56 ? 207  ASN A CB  1 
ATOM   1188  C  CG  . ASN A  1  179 ? 14.865  53.461  47.804  1.00 75.56 ? 207  ASN A CG  1 
ATOM   1189  O  OD1 . ASN A  1  179 ? 15.420  53.750  48.866  1.00 75.26 ? 207  ASN A OD1 1 
ATOM   1190  N  ND2 . ASN A  1  179 ? 14.780  54.312  46.792  1.00 74.98 ? 207  ASN A ND2 1 
ATOM   1191  N  N   . LEU A  1  180 ? 17.602  51.049  47.036  1.00 73.87 ? 208  LEU A N   1 
ATOM   1192  C  CA  . LEU A  1  180 ? 18.750  51.261  46.163  1.00 72.07 ? 208  LEU A CA  1 
ATOM   1193  C  C   . LEU A  1  180 ? 19.613  50.028  46.058  1.00 71.63 ? 208  LEU A C   1 
ATOM   1194  O  O   . LEU A  1  180 ? 19.697  49.222  46.987  1.00 71.01 ? 208  LEU A O   1 
ATOM   1195  C  CB  . LEU A  1  180 ? 19.628  52.403  46.665  1.00 71.09 ? 208  LEU A CB  1 
ATOM   1196  C  CG  . LEU A  1  180 ? 18.962  53.707  47.087  1.00 71.36 ? 208  LEU A CG  1 
ATOM   1197  C  CD1 . LEU A  1  180 ? 20.054  54.742  47.248  1.00 71.04 ? 208  LEU A CD1 1 
ATOM   1198  C  CD2 . LEU A  1  180 ? 17.939  54.170  46.065  1.00 70.83 ? 208  LEU A CD2 1 
ATOM   1199  N  N   . VAL A  1  181 ? 20.267  49.904  44.912  1.00 71.20 ? 209  VAL A N   1 
ATOM   1200  C  CA  . VAL A  1  181 ? 21.147  48.788  44.652  1.00 70.25 ? 209  VAL A CA  1 
ATOM   1201  C  C   . VAL A  1  181 ? 22.493  49.308  44.159  1.00 68.80 ? 209  VAL A C   1 
ATOM   1202  O  O   . VAL A  1  181 ? 22.587  50.368  43.545  1.00 68.69 ? 209  VAL A O   1 
ATOM   1203  C  CB  . VAL A  1  181 ? 20.512  47.836  43.635  1.00 69.12 ? 209  VAL A CB  1 
ATOM   1204  C  CG1 . VAL A  1  181 ? 19.579  46.876  44.345  1.00 69.14 ? 209  VAL A CG1 1 
ATOM   1205  C  CG2 . VAL A  1  181 ? 19.723  48.628  42.620  1.00 69.31 ? 209  VAL A CG2 1 
ATOM   1206  N  N   . THR A  1  182 ? 23.537  48.560  44.466  1.00 67.50 ? 210  THR A N   1 
ATOM   1207  C  CA  . THR A  1  182 ? 24.886  48.930  44.090  1.00 68.18 ? 210  THR A CA  1 
ATOM   1208  C  C   . THR A  1  182 ? 25.300  48.128  42.882  1.00 69.39 ? 210  THR A C   1 
ATOM   1209  O  O   . THR A  1  182 ? 24.632  47.161  42.526  1.00 69.02 ? 210  THR A O   1 
ATOM   1210  C  CB  . THR A  1  182 ? 25.850  48.580  45.199  1.00 68.92 ? 210  THR A CB  1 
ATOM   1211  O  OG1 . THR A  1  182 ? 25.775  47.171  45.455  1.00 67.46 ? 210  THR A OG1 1 
ATOM   1212  C  CG2 . THR A  1  182 ? 25.488  49.326  46.458  1.00 69.75 ? 210  THR A CG2 1 
ATOM   1213  N  N   . MET A  1  183 ? 26.406  48.512  42.254  1.00 69.05 ? 211  MET A N   1 
ATOM   1214  C  CA  . MET A  1  183 ? 26.880  47.758  41.105  1.00 68.10 ? 211  MET A CA  1 
ATOM   1215  C  C   . MET A  1  183 ? 28.388  47.769  40.980  1.00 67.66 ? 211  MET A C   1 
ATOM   1216  O  O   . MET A  1  183 ? 28.998  48.802  40.721  1.00 67.26 ? 211  MET A O   1 
ATOM   1217  C  CB  . MET A  1  183 ? 26.266  48.275  39.819  1.00 68.08 ? 211  MET A CB  1 
ATOM   1218  C  CG  . MET A  1  183 ? 26.494  47.311  38.684  1.00 69.32 ? 211  MET A CG  1 
ATOM   1219  S  SD  . MET A  1  183 ? 25.791  47.860  37.132  1.00 71.78 ? 211  MET A SD  1 
ATOM   1220  C  CE  . MET A  1  183 ? 27.288  48.533  36.273  1.00 69.38 ? 211  MET A CE  1 
ATOM   1221  N  N   . THR A  1  184 ? 28.975  46.594  41.157  1.00 66.98 ? 212  THR A N   1 
ATOM   1222  C  CA  . THR A  1  184 ? 30.413  46.421  41.091  1.00 66.04 ? 212  THR A CA  1 
ATOM   1223  C  C   . THR A  1  184 ? 31.014  46.844  39.754  1.00 66.67 ? 212  THR A C   1 
ATOM   1224  O  O   . THR A  1  184 ? 30.319  46.902  38.741  1.00 66.40 ? 212  THR A O   1 
ATOM   1225  C  CB  . THR A  1  184 ? 30.782  44.951  41.371  1.00 66.14 ? 212  THR A CB  1 
ATOM   1226  O  OG1 . THR A  1  184 ? 32.178  44.756  41.146  1.00 65.24 ? 212  THR A OG1 1 
ATOM   1227  C  CG2 . THR A  1  184 ? 29.996  44.022  40.474  1.00 66.17 ? 212  THR A CG2 1 
ATOM   1228  N  N   . THR A  1  185 ? 32.309  47.163  39.775  1.00 67.33 ? 213  THR A N   1 
ATOM   1229  C  CA  . THR A  1  185 ? 33.068  47.558  38.581  1.00 66.49 ? 213  THR A CA  1 
ATOM   1230  C  C   . THR A  1  185 ? 34.360  46.715  38.523  1.00 65.86 ? 213  THR A C   1 
ATOM   1231  O  O   . THR A  1  185 ? 34.439  45.647  39.131  1.00 65.69 ? 213  THR A O   1 
ATOM   1232  C  CB  . THR A  1  185 ? 33.443  49.079  38.591  1.00 65.67 ? 213  THR A CB  1 
ATOM   1233  O  OG1 . THR A  1  185 ? 34.211  49.390  39.761  1.00 65.53 ? 213  THR A OG1 1 
ATOM   1234  C  CG2 . THR A  1  185 ? 32.193  49.940  38.563  1.00 65.35 ? 213  THR A CG2 1 
ATOM   1235  N  N   . ALA A  1  186 ? 35.365  47.185  37.794  1.00 64.67 ? 214  ALA A N   1 
ATOM   1236  C  CA  . ALA A  1  186 ? 36.622  46.457  37.687  1.00 64.03 ? 214  ALA A CA  1 
ATOM   1237  C  C   . ALA A  1  186 ? 37.554  47.192  36.726  1.00 64.52 ? 214  ALA A C   1 
ATOM   1238  O  O   . ALA A  1  186 ? 37.094  47.928  35.851  1.00 64.06 ? 214  ALA A O   1 
ATOM   1239  C  CB  . ALA A  1  186 ? 36.364  45.032  37.203  1.00 63.56 ? 214  ALA A CB  1 
ATOM   1240  N  N   . PRO A  1  187 ? 38.880  47.019  36.889  1.00 65.13 ? 215  PRO A N   1 
ATOM   1241  C  CA  . PRO A  1  187 ? 39.500  46.175  37.918  1.00 65.12 ? 215  PRO A CA  1 
ATOM   1242  C  C   . PRO A  1  187 ? 39.309  46.772  39.317  1.00 65.35 ? 215  PRO A C   1 
ATOM   1243  O  O   . PRO A  1  187 ? 38.810  47.891  39.469  1.00 65.63 ? 215  PRO A O   1 
ATOM   1244  C  CB  . PRO A  1  187 ? 40.966  46.148  37.491  1.00 64.67 ? 215  PRO A CB  1 
ATOM   1245  C  CG  . PRO A  1  187 ? 41.160  47.544  36.977  1.00 64.05 ? 215  PRO A CG  1 
ATOM   1246  C  CD  . PRO A  1  187 ? 39.909  47.771  36.143  1.00 64.50 ? 215  PRO A CD  1 
ATOM   1247  N  N   . ARG A  1  188 ? 39.708  46.022  40.337  1.00 65.18 ? 216  ARG A N   1 
ATOM   1248  C  CA  . ARG A  1  188 ? 39.581  46.482  41.713  1.00 64.39 ? 216  ARG A CA  1 
ATOM   1249  C  C   . ARG A  1  188 ? 40.980  46.871  42.194  1.00 65.47 ? 216  ARG A C   1 
ATOM   1250  O  O   . ARG A  1  188 ? 41.863  46.007  42.309  1.00 65.54 ? 216  ARG A O   1 
ATOM   1251  C  CB  . ARG A  1  188 ? 38.979  45.356  42.557  1.00 63.47 ? 216  ARG A CB  1 
ATOM   1252  C  CG  . ARG A  1  188 ? 37.731  44.737  41.896  1.00 62.91 ? 216  ARG A CG  1 
ATOM   1253  C  CD  . ARG A  1  188 ? 37.271  43.433  42.555  1.00 62.27 ? 216  ARG A CD  1 
ATOM   1254  N  NE  . ARG A  1  188 ? 36.272  42.710  41.762  1.00 61.19 ? 216  ARG A NE  1 
ATOM   1255  C  CZ  . ARG A  1  188 ? 35.021  43.120  41.553  1.00 61.32 ? 216  ARG A CZ  1 
ATOM   1256  N  NH1 . ARG A  1  188 ? 34.595  44.262  42.078  1.00 60.64 ? 216  ARG A NH1 1 
ATOM   1257  N  NH2 . ARG A  1  188 ? 34.188  42.381  40.825  1.00 61.42 ? 216  ARG A NH2 1 
ATOM   1258  N  N   . GLY A  1  189 ? 41.173  48.175  42.433  1.00 65.14 ? 217  GLY A N   1 
ATOM   1259  C  CA  . GLY A  1  189 ? 42.461  48.705  42.872  1.00 65.68 ? 217  GLY A CA  1 
ATOM   1260  C  C   . GLY A  1  189 ? 43.149  49.581  41.824  1.00 64.58 ? 217  GLY A C   1 
ATOM   1261  O  O   . GLY A  1  189 ? 42.576  49.848  40.767  1.00 64.53 ? 217  GLY A O   1 
ATOM   1262  N  N   . LEU A  1  190 ? 44.370  50.036  42.111  1.00 63.90 ? 218  LEU A N   1 
ATOM   1263  C  CA  . LEU A  1  190 ? 45.122  50.881  41.174  1.00 65.20 ? 218  LEU A CA  1 
ATOM   1264  C  C   . LEU A  1  190 ? 46.407  50.207  40.732  1.00 65.84 ? 218  LEU A C   1 
ATOM   1265  O  O   . LEU A  1  190 ? 46.805  50.279  39.567  1.00 66.95 ? 218  LEU A O   1 
ATOM   1266  C  CB  . LEU A  1  190 ? 45.482  52.223  41.800  1.00 64.82 ? 218  LEU A CB  1 
ATOM   1267  C  CG  . LEU A  1  190 ? 44.335  53.154  42.166  1.00 65.38 ? 218  LEU A CG  1 
ATOM   1268  C  CD1 . LEU A  1  190 ? 44.903  54.520  42.528  1.00 65.03 ? 218  LEU A CD1 1 
ATOM   1269  C  CD2 . LEU A  1  190 ? 43.368  53.260  41.003  1.00 64.71 ? 218  LEU A CD2 1 
ATOM   1270  N  N   . GLN A  1  191 ? 47.079  49.588  41.690  1.00 66.51 ? 219  GLN A N   1 
ATOM   1271  C  CA  . GLN A  1  191 ? 48.306  48.854  41.428  1.00 65.53 ? 219  GLN A CA  1 
ATOM   1272  C  C   . GLN A  1  191 ? 47.911  47.413  41.744  1.00 66.12 ? 219  GLN A C   1 
ATOM   1273  O  O   . GLN A  1  191 ? 46.794  47.165  42.214  1.00 66.07 ? 219  GLN A O   1 
ATOM   1274  C  CB  . GLN A  1  191 ? 49.428  49.354  42.350  1.00 66.02 ? 219  GLN A CB  1 
ATOM   1275  C  CG  . GLN A  1  191 ? 49.050  49.442  43.833  1.00 66.87 ? 219  GLN A CG  1 
ATOM   1276  C  CD  . GLN A  1  191 ? 50.027  50.287  44.647  1.00 68.16 ? 219  GLN A CD  1 
ATOM   1277  O  OE1 . GLN A  1  191 ? 51.233  50.020  44.667  1.00 67.86 ? 219  GLN A OE1 1 
ATOM   1278  N  NE2 . GLN A  1  191 ? 49.505  51.315  45.325  1.00 67.68 ? 219  GLN A NE2 1 
ATOM   1279  N  N   . SER A  1  192 ? 48.786  46.457  41.475  1.00 65.23 ? 220  SER A N   1 
ATOM   1280  C  CA  . SER A  1  192 ? 48.433  45.076  41.764  1.00 64.94 ? 220  SER A CA  1 
ATOM   1281  C  C   . SER A  1  192 ? 48.333  44.840  43.271  1.00 65.03 ? 220  SER A C   1 
ATOM   1282  O  O   . SER A  1  192 ? 48.770  45.671  44.077  1.00 65.37 ? 220  SER A O   1 
ATOM   1283  C  CB  . SER A  1  192 ? 49.467  44.132  41.160  1.00 64.97 ? 220  SER A CB  1 
ATOM   1284  O  OG  . SER A  1  192 ? 49.155  42.789  41.474  1.00 64.73 ? 220  SER A OG  1 
ATOM   1285  N  N   . GLY A  1  193 ? 47.745  43.710  43.650  1.00 64.45 ? 221  GLY A N   1 
ATOM   1286  C  CA  . GLY A  1  193 ? 47.619  43.386  45.062  1.00 64.77 ? 221  GLY A CA  1 
ATOM   1287  C  C   . GLY A  1  193 ? 46.421  44.005  45.754  1.00 64.93 ? 221  GLY A C   1 
ATOM   1288  O  O   . GLY A  1  193 ? 46.204  43.779  46.945  1.00 64.49 ? 221  GLY A O   1 
ATOM   1289  N  N   . ASP A  1  194 ? 45.632  44.767  45.002  1.00 64.90 ? 222  ASP A N   1 
ATOM   1290  C  CA  . ASP A  1  194 ? 44.462  45.443  45.539  1.00 62.38 ? 222  ASP A CA  1 
ATOM   1291  C  C   . ASP A  1  194 ? 43.176  44.655  45.500  1.00 63.10 ? 222  ASP A C   1 
ATOM   1292  O  O   . ASP A  1  194 ? 43.116  43.508  45.049  1.00 64.11 ? 222  ASP A O   1 
ATOM   1293  C  CB  . ASP A  1  194 ? 44.223  46.731  44.776  1.00 63.53 ? 222  ASP A CB  1 
ATOM   1294  C  CG  . ASP A  1  194 ? 45.292  47.750  45.018  1.00 65.11 ? 222  ASP A CG  1 
ATOM   1295  O  OD1 . ASP A  1  194 ? 46.418  47.353  45.398  1.00 64.92 ? 222  ASP A OD1 1 
ATOM   1296  O  OD2 . ASP A  1  194 ? 45.002  48.950  44.814  1.00 65.69 ? 222  ASP A OD2 1 
ATOM   1297  N  N   . ARG A  1  195 ? 42.136  45.324  45.975  1.00 63.18 ? 223  ARG A N   1 
ATOM   1298  C  CA  . ARG A  1  195 ? 40.790  44.796  46.007  1.00 61.81 ? 223  ARG A CA  1 
ATOM   1299  C  C   . ARG A  1  195 ? 39.989  45.929  46.604  1.00 61.69 ? 223  ARG A C   1 
ATOM   1300  O  O   . ARG A  1  195 ? 39.496  45.845  47.723  1.00 62.28 ? 223  ARG A O   1 
ATOM   1301  C  CB  . ARG A  1  195 ? 40.696  43.556  46.887  1.00 61.30 ? 223  ARG A CB  1 
ATOM   1302  C  CG  . ARG A  1  195 ? 39.464  42.723  46.615  1.00 61.10 ? 223  ARG A CG  1 
ATOM   1303  C  CD  . ARG A  1  195 ? 39.353  41.552  47.579  1.00 63.20 ? 223  ARG A CD  1 
ATOM   1304  N  NE  . ARG A  1  195 ? 38.487  40.497  47.053  1.00 64.28 ? 223  ARG A NE  1 
ATOM   1305  C  CZ  . ARG A  1  195 ? 38.788  39.730  46.003  1.00 65.12 ? 223  ARG A CZ  1 
ATOM   1306  N  NH1 . ARG A  1  195 ? 39.941  39.891  45.360  1.00 65.57 ? 223  ARG A NH1 1 
ATOM   1307  N  NH2 . ARG A  1  195 ? 37.933  38.805  45.581  1.00 64.72 ? 223  ARG A NH2 1 
ATOM   1308  N  N   . ALA A  1  196 ? 39.905  47.015  45.850  1.00 61.34 ? 224  ALA A N   1 
ATOM   1309  C  CA  . ALA A  1  196 ? 39.162  48.183  46.279  1.00 60.34 ? 224  ALA A CA  1 
ATOM   1310  C  C   . ALA A  1  196 ? 38.240  48.578  45.142  1.00 59.94 ? 224  ALA A C   1 
ATOM   1311  O  O   . ALA A  1  196 ? 38.637  49.304  44.226  1.00 60.63 ? 224  ALA A O   1 
ATOM   1312  C  CB  . ALA A  1  196 ? 40.111  49.309  46.600  1.00 60.61 ? 224  ALA A CB  1 
ATOM   1313  N  N   . THR A  1  197 ? 37.002  48.100  45.207  1.00 60.00 ? 225  THR A N   1 
ATOM   1314  C  CA  . THR A  1  197 ? 36.028  48.387  44.160  1.00 60.37 ? 225  THR A CA  1 
ATOM   1315  C  C   . THR A  1  197 ? 35.250  49.677  44.314  1.00 59.02 ? 225  THR A C   1 
ATOM   1316  O  O   . THR A  1  197 ? 35.080  50.193  45.412  1.00 60.01 ? 225  THR A O   1 
ATOM   1317  C  CB  . THR A  1  197 ? 35.015  47.260  44.039  1.00 59.34 ? 225  THR A CB  1 
ATOM   1318  O  OG1 . THR A  1  197 ? 35.716  46.020  43.936  1.00 60.15 ? 225  THR A OG1 1 
ATOM   1319  C  CG2 . THR A  1  197 ? 34.148  47.450  42.804  1.00 58.74 ? 225  THR A CG2 1 
ATOM   1320  N  N   . TRP A  1  198 ? 34.774  50.178  43.185  1.00 57.84 ? 226  TRP A N   1 
ATOM   1321  C  CA  . TRP A  1  198 ? 33.985  51.389  43.138  1.00 57.59 ? 226  TRP A CA  1 
ATOM   1322  C  C   . TRP A  1  198 ? 32.545  51.023  42.831  1.00 57.75 ? 226  TRP A C   1 
ATOM   1323  O  O   . TRP A  1  198 ? 32.266  50.507  41.752  1.00 59.01 ? 226  TRP A O   1 
ATOM   1324  C  CB  . TRP A  1  198 ? 34.489  52.294  42.027  1.00 58.24 ? 226  TRP A CB  1 
ATOM   1325  C  CG  . TRP A  1  198 ? 35.411  53.365  42.478  1.00 59.93 ? 226  TRP A CG  1 
ATOM   1326  C  CD1 . TRP A  1  198 ? 36.773  53.381  42.372  1.00 58.67 ? 226  TRP A CD1 1 
ATOM   1327  C  CD2 . TRP A  1  198 ? 35.036  54.616  43.069  1.00 60.35 ? 226  TRP A CD2 1 
ATOM   1328  N  NE1 . TRP A  1  198 ? 37.270  54.571  42.853  1.00 59.57 ? 226  TRP A NE1 1 
ATOM   1329  C  CE2 . TRP A  1  198 ? 36.227  55.347  43.288  1.00 58.96 ? 226  TRP A CE2 1 
ATOM   1330  C  CE3 . TRP A  1  198 ? 33.806  55.190  43.435  1.00 59.00 ? 226  TRP A CE3 1 
ATOM   1331  C  CZ2 . TRP A  1  198 ? 36.229  56.622  43.855  1.00 58.10 ? 226  TRP A CZ2 1 
ATOM   1332  C  CZ3 . TRP A  1  198 ? 33.806  56.455  43.999  1.00 58.89 ? 226  TRP A CZ3 1 
ATOM   1333  C  CH2 . TRP A  1  198 ? 35.014  57.159  44.204  1.00 59.77 ? 226  TRP A CH2 1 
ATOM   1334  N  N   . PHE A  1  199 ? 31.625  51.284  43.752  1.00 56.44 ? 227  PHE A N   1 
ATOM   1335  C  CA  . PHE A  1  199 ? 30.231  50.964  43.481  1.00 56.59 ? 227  PHE A CA  1 
ATOM   1336  C  C   . PHE A  1  199 ? 29.345  52.181  43.315  1.00 56.70 ? 227  PHE A C   1 
ATOM   1337  O  O   . PHE A  1  199 ? 29.322  53.070  44.165  1.00 55.91 ? 227  PHE A O   1 
ATOM   1338  C  CB  . PHE A  1  199 ? 29.633  50.109  44.584  1.00 55.43 ? 227  PHE A CB  1 
ATOM   1339  C  CG  . PHE A  1  199 ? 30.270  48.767  44.727  1.00 55.85 ? 227  PHE A CG  1 
ATOM   1340  C  CD1 . PHE A  1  199 ? 31.583  48.647  45.183  1.00 56.46 ? 227  PHE A CD1 1 
ATOM   1341  C  CD2 . PHE A  1  199 ? 29.538  47.608  44.466  1.00 55.80 ? 227  PHE A CD2 1 
ATOM   1342  C  CE1 . PHE A  1  199 ? 32.157  47.388  45.388  1.00 55.16 ? 227  PHE A CE1 1 
ATOM   1343  C  CE2 . PHE A  1  199 ? 30.103  46.346  44.665  1.00 55.30 ? 227  PHE A CE2 1 
ATOM   1344  C  CZ  . PHE A  1  199 ? 31.416  46.238  45.130  1.00 54.43 ? 227  PHE A CZ  1 
ATOM   1345  N  N   . GLY A  1  200 ? 28.616  52.216  42.208  1.00 57.37 ? 228  GLY A N   1 
ATOM   1346  C  CA  . GLY A  1  200 ? 27.695  53.308  41.979  1.00 57.19 ? 228  GLY A CA  1 
ATOM   1347  C  C   . GLY A  1  200 ? 26.397  52.835  42.599  1.00 56.83 ? 228  GLY A C   1 
ATOM   1348  O  O   . GLY A  1  200 ? 26.191  51.627  42.753  1.00 56.58 ? 228  GLY A O   1 
ATOM   1349  N  N   . LEU A  1  201 ? 25.527  53.762  42.979  1.00 56.65 ? 229  LEU A N   1 
ATOM   1350  C  CA  . LEU A  1  201 ? 24.256  53.367  43.566  1.00 57.44 ? 229  LEU A CA  1 
ATOM   1351  C  C   . LEU A  1  201 ? 23.114  53.811  42.701  1.00 56.91 ? 229  LEU A C   1 
ATOM   1352  O  O   . LEU A  1  201 ? 23.051  54.964  42.301  1.00 56.37 ? 229  LEU A O   1 
ATOM   1353  C  CB  . LEU A  1  201 ? 24.114  53.938  44.960  1.00 56.50 ? 229  LEU A CB  1 
ATOM   1354  C  CG  . LEU A  1  201 ? 25.064  53.162  45.862  1.00 56.66 ? 229  LEU A CG  1 
ATOM   1355  C  CD1 . LEU A  1  201 ? 26.116  54.087  46.444  1.00 57.25 ? 229  LEU A CD1 1 
ATOM   1356  C  CD2 . LEU A  1  201 ? 24.265  52.486  46.942  1.00 57.05 ? 229  LEU A CD2 1 
ATOM   1357  N  N   . TYR A  1  202 ? 22.212  52.879  42.417  1.00 56.81 ? 230  TYR A N   1 
ATOM   1358  C  CA  . TYR A  1  202 ? 21.079  53.152  41.553  1.00 57.60 ? 230  TYR A CA  1 
ATOM   1359  C  C   . TYR A  1  202 ? 19.774  52.735  42.208  1.00 59.15 ? 230  TYR A C   1 
ATOM   1360  O  O   . TYR A  1  202 ? 19.777  51.952  43.162  1.00 58.15 ? 230  TYR A O   1 
ATOM   1361  C  CB  . TYR A  1  202 ? 21.244  52.391  40.233  1.00 58.13 ? 230  TYR A CB  1 
ATOM   1362  C  CG  . TYR A  1  202 ? 22.672  52.305  39.735  1.00 59.12 ? 230  TYR A CG  1 
ATOM   1363  C  CD1 . TYR A  1  202 ? 23.596  51.442  40.345  1.00 59.03 ? 230  TYR A CD1 1 
ATOM   1364  C  CD2 . TYR A  1  202 ? 23.112  53.104  38.670  1.00 59.15 ? 230  TYR A CD2 1 
ATOM   1365  C  CE1 . TYR A  1  202 ? 24.926  51.378  39.912  1.00 59.61 ? 230  TYR A CE1 1 
ATOM   1366  C  CE2 . TYR A  1  202 ? 24.441  53.051  38.223  1.00 59.28 ? 230  TYR A CE2 1 
ATOM   1367  C  CZ  . TYR A  1  202 ? 25.344  52.188  38.849  1.00 60.82 ? 230  TYR A CZ  1 
ATOM   1368  O  OH  . TYR A  1  202 ? 26.662  52.141  38.427  1.00 60.34 ? 230  TYR A OH  1 
ATOM   1369  N  N   . TYR A  1  203 ? 18.665  53.266  41.688  1.00 59.74 ? 231  TYR A N   1 
ATOM   1370  C  CA  . TYR A  1  203 ? 17.332  52.943  42.190  1.00 59.33 ? 231  TYR A CA  1 
ATOM   1371  C  C   . TYR A  1  203 ? 17.043  51.492  41.875  1.00 59.89 ? 231  TYR A C   1 
ATOM   1372  O  O   . TYR A  1  203 ? 17.458  50.999  40.833  1.00 60.35 ? 231  TYR A O   1 
ATOM   1373  C  CB  . TYR A  1  203 ? 16.271  53.803  41.501  1.00 59.27 ? 231  TYR A CB  1 
ATOM   1374  C  CG  . TYR A  1  203 ? 16.267  55.263  41.910  1.00 62.36 ? 231  TYR A CG  1 
ATOM   1375  C  CD1 . TYR A  1  203 ? 15.565  56.223  41.162  1.00 62.29 ? 231  TYR A CD1 1 
ATOM   1376  C  CD2 . TYR A  1  203 ? 16.946  55.692  43.055  1.00 62.54 ? 231  TYR A CD2 1 
ATOM   1377  C  CE1 . TYR A  1  203 ? 15.544  57.577  41.548  1.00 62.30 ? 231  TYR A CE1 1 
ATOM   1378  C  CE2 . TYR A  1  203 ? 16.926  57.041  43.454  1.00 62.49 ? 231  TYR A CE2 1 
ATOM   1379  C  CZ  . TYR A  1  203 ? 16.227  57.975  42.701  1.00 63.02 ? 231  TYR A CZ  1 
ATOM   1380  O  OH  . TYR A  1  203 ? 16.207  59.288  43.124  1.00 62.67 ? 231  TYR A OH  1 
ATOM   1381  N  N   . ASN A  1  204 ? 16.347  50.799  42.769  1.00 61.15 ? 232  ASN A N   1 
ATOM   1382  C  CA  . ASN A  1  204 ? 15.999  49.409  42.506  1.00 61.74 ? 232  ASN A CA  1 
ATOM   1383  C  C   . ASN A  1  204 ? 14.699  49.393  41.696  1.00 62.17 ? 232  ASN A C   1 
ATOM   1384  O  O   . ASN A  1  204 ? 13.614  49.171  42.235  1.00 63.11 ? 232  ASN A O   1 
ATOM   1385  C  CB  . ASN A  1  204 ? 15.819  48.619  43.815  1.00 64.51 ? 232  ASN A CB  1 
ATOM   1386  C  CG  . ASN A  1  204 ? 15.313  47.178  43.576  1.00 67.63 ? 232  ASN A CG  1 
ATOM   1387  O  OD1 . ASN A  1  204 ? 15.813  46.502  42.664  1.00 65.95 ? 232  ASN A OD1 1 
ATOM   1388  N  ND2 . ASN A  1  204 ? 14.341  46.724  44.390  1.00 69.66 ? 232  ASN A ND2 1 
ATOM   1389  N  N   . ILE A  1  205 ? 14.807  49.669  40.402  1.00 61.43 ? 233  ILE A N   1 
ATOM   1390  C  CA  . ILE A  1  205 ? 13.635  49.653  39.547  1.00 61.44 ? 233  ILE A CA  1 
ATOM   1391  C  C   . ILE A  1  205 ? 13.240  48.191  39.454  1.00 60.82 ? 233  ILE A C   1 
ATOM   1392  O  O   . ILE A  1  205 ? 14.106  47.316  39.474  1.00 60.36 ? 233  ILE A O   1 
ATOM   1393  C  CB  . ILE A  1  205 ? 13.953  50.203  38.137  1.00 62.21 ? 233  ILE A CB  1 
ATOM   1394  C  CG1 . ILE A  1  205 ? 14.416  51.658  38.242  1.00 62.17 ? 233  ILE A CG1 1 
ATOM   1395  C  CG2 . ILE A  1  205 ? 12.729  50.107  37.246  1.00 62.64 ? 233  ILE A CG2 1 
ATOM   1396  C  CD1 . ILE A  1  205 ? 13.574  52.516  39.187  1.00 63.24 ? 233  ILE A CD1 1 
ATOM   1397  N  N   . SER A  1  206 ? 11.939  47.925  39.378  1.00 60.06 ? 234  SER A N   1 
ATOM   1398  C  CA  . SER A  1  206 ? 11.457  46.546  39.296  1.00 60.51 ? 234  SER A CA  1 
ATOM   1399  C  C   . SER A  1  206 ? 10.898  46.217  37.919  1.00 59.50 ? 234  SER A C   1 
ATOM   1400  O  O   . SER A  1  206 ? 9.945   46.855  37.458  1.00 59.18 ? 234  SER A O   1 
ATOM   1401  C  CB  . SER A  1  206 ? 10.380  46.278  40.363  1.00 60.75 ? 234  SER A CB  1 
ATOM   1402  O  OG  . SER A  1  206 ? 9.250   47.118  40.191  1.00 61.65 ? 234  SER A OG  1 
ATOM   1403  N  N   . GLY A  1  207 ? 11.503  45.220  37.274  1.00 57.48 ? 235  GLY A N   1 
ATOM   1404  C  CA  . GLY A  1  207 ? 11.062  44.800  35.958  1.00 55.71 ? 235  GLY A CA  1 
ATOM   1405  C  C   . GLY A  1  207 ? 11.711  45.564  34.825  1.00 55.05 ? 235  GLY A C   1 
ATOM   1406  O  O   . GLY A  1  207 ? 11.257  45.486  33.684  1.00 56.65 ? 235  GLY A O   1 
ATOM   1407  N  N   . ALA A  1  208 ? 12.766  46.309  35.134  1.00 53.63 ? 236  ALA A N   1 
ATOM   1408  C  CA  . ALA A  1  208 ? 13.473  47.086  34.130  1.00 52.13 ? 236  ALA A CA  1 
ATOM   1409  C  C   . ALA A  1  208 ? 14.925  47.257  34.553  1.00 54.22 ? 236  ALA A C   1 
ATOM   1410  O  O   . ALA A  1  208 ? 15.363  46.709  35.568  1.00 53.30 ? 236  ALA A O   1 
ATOM   1411  C  CB  . ALA A  1  208 ? 12.815  48.439  33.959  1.00 51.83 ? 236  ALA A CB  1 
ATOM   1412  N  N   . GLY A  1  209 ? 15.679  48.014  33.767  1.00 55.96 ? 237  GLY A N   1 
ATOM   1413  C  CA  . GLY A  1  209 ? 17.074  48.228  34.092  1.00 53.65 ? 237  GLY A CA  1 
ATOM   1414  C  C   . GLY A  1  209 ? 17.247  49.311  35.128  1.00 52.92 ? 237  GLY A C   1 
ATOM   1415  O  O   . GLY A  1  209 ? 16.626  50.377  35.051  1.00 52.33 ? 237  GLY A O   1 
ATOM   1416  N  N   . PHE A  1  210 ? 18.091  49.023  36.110  1.00 52.82 ? 238  PHE A N   1 
ATOM   1417  C  CA  . PHE A  1  210 ? 18.379  49.974  37.173  1.00 52.87 ? 238  PHE A CA  1 
ATOM   1418  C  C   . PHE A  1  210 ? 19.647  50.724  36.789  1.00 52.48 ? 238  PHE A C   1 
ATOM   1419  O  O   . PHE A  1  210 ? 20.068  51.648  37.483  1.00 52.15 ? 238  PHE A O   1 
ATOM   1420  C  CB  . PHE A  1  210 ? 18.601  49.231  38.493  1.00 51.82 ? 238  PHE A CB  1 
ATOM   1421  C  CG  . PHE A  1  210 ? 19.862  48.393  38.525  1.00 54.04 ? 238  PHE A CG  1 
ATOM   1422  C  CD1 . PHE A  1  210 ? 21.112  48.981  38.773  1.00 53.73 ? 238  PHE A CD1 1 
ATOM   1423  C  CD2 . PHE A  1  210 ? 19.806  47.010  38.317  1.00 54.36 ? 238  PHE A CD2 1 
ATOM   1424  C  CE1 . PHE A  1  210 ? 22.291  48.200  38.816  1.00 52.57 ? 238  PHE A CE1 1 
ATOM   1425  C  CE2 . PHE A  1  210 ? 20.982  46.220  38.359  1.00 53.01 ? 238  PHE A CE2 1 
ATOM   1426  C  CZ  . PHE A  1  210 ? 22.220  46.819  38.609  1.00 52.42 ? 238  PHE A CZ  1 
ATOM   1427  N  N   . PHE A  1  211 ? 20.249  50.311  35.674  1.00 52.83 ? 239  PHE A N   1 
ATOM   1428  C  CA  . PHE A  1  211 ? 21.489  50.907  35.199  1.00 51.94 ? 239  PHE A CA  1 
ATOM   1429  C  C   . PHE A  1  211 ? 21.279  52.308  34.666  1.00 51.73 ? 239  PHE A C   1 
ATOM   1430  O  O   . PHE A  1  211 ? 22.210  53.110  34.650  1.00 52.45 ? 239  PHE A O   1 
ATOM   1431  C  CB  . PHE A  1  211 ? 22.119  50.043  34.105  1.00 50.89 ? 239  PHE A CB  1 
ATOM   1432  C  CG  . PHE A  1  211 ? 21.951  48.564  34.317  1.00 50.83 ? 239  PHE A CG  1 
ATOM   1433  C  CD1 . PHE A  1  211 ? 20.810  47.907  33.854  1.00 49.74 ? 239  PHE A CD1 1 
ATOM   1434  C  CD2 . PHE A  1  211 ? 22.936  47.824  34.969  1.00 50.57 ? 239  PHE A CD2 1 
ATOM   1435  C  CE1 . PHE A  1  211 ? 20.656  46.541  34.034  1.00 49.56 ? 239  PHE A CE1 1 
ATOM   1436  C  CE2 . PHE A  1  211 ? 22.794  46.453  35.158  1.00 50.28 ? 239  PHE A CE2 1 
ATOM   1437  C  CZ  . PHE A  1  211 ? 21.653  45.810  34.689  1.00 50.34 ? 239  PHE A CZ  1 
ATOM   1438  N  N   . LEU A  1  212 ? 20.059  52.602  34.234  1.00 51.60 ? 240  LEU A N   1 
ATOM   1439  C  CA  . LEU A  1  212 ? 19.752  53.921  33.693  1.00 53.02 ? 240  LEU A CA  1 
ATOM   1440  C  C   . LEU A  1  212 ? 19.420  54.911  34.796  1.00 53.20 ? 240  LEU A C   1 
ATOM   1441  O  O   . LEU A  1  212 ? 19.022  56.053  34.536  1.00 51.62 ? 240  LEU A O   1 
ATOM   1442  C  CB  . LEU A  1  212 ? 18.566  53.828  32.738  1.00 52.72 ? 240  LEU A CB  1 
ATOM   1443  C  CG  . LEU A  1  212 ? 18.626  52.689  31.720  1.00 53.25 ? 240  LEU A CG  1 
ATOM   1444  C  CD1 . LEU A  1  212 ? 17.696  53.016  30.556  1.00 52.88 ? 240  LEU A CD1 1 
ATOM   1445  C  CD2 . LEU A  1  212 ? 20.055  52.507  31.215  1.00 53.95 ? 240  LEU A CD2 1 
ATOM   1446  N  N   . HIS A  1  213 ? 19.598  54.472  36.036  1.00 54.06 ? 241  HIS A N   1 
ATOM   1447  C  CA  . HIS A  1  213 ? 19.256  55.318  37.163  1.00 54.99 ? 241  HIS A CA  1 
ATOM   1448  C  C   . HIS A  1  213 ? 20.329  55.442  38.246  1.00 54.91 ? 241  HIS A C   1 
ATOM   1449  O  O   . HIS A  1  213 ? 20.200  54.918  39.358  1.00 53.44 ? 241  HIS A O   1 
ATOM   1450  C  CB  . HIS A  1  213 ? 17.913  54.835  37.734  1.00 54.76 ? 241  HIS A CB  1 
ATOM   1451  C  CG  . HIS A  1  213 ? 16.870  54.617  36.677  1.00 55.64 ? 241  HIS A CG  1 
ATOM   1452  N  ND1 . HIS A  1  213 ? 16.443  55.624  35.838  1.00 56.40 ? 241  HIS A ND1 1 
ATOM   1453  C  CD2 . HIS A  1  213 ? 16.255  53.488  36.250  1.00 55.58 ? 241  HIS A CD2 1 
ATOM   1454  C  CE1 . HIS A  1  213 ? 15.616  55.124  34.936  1.00 55.64 ? 241  HIS A CE1 1 
ATOM   1455  N  NE2 . HIS A  1  213 ? 15.486  53.830  35.163  1.00 55.95 ? 241  HIS A NE2 1 
ATOM   1456  N  N   . HIS A  1  214 ? 21.390  56.162  37.889  1.00 55.25 ? 242  HIS A N   1 
ATOM   1457  C  CA  . HIS A  1  214 ? 22.493  56.433  38.791  1.00 54.35 ? 242  HIS A CA  1 
ATOM   1458  C  C   . HIS A  1  214 ? 21.977  57.578  39.657  1.00 55.63 ? 242  HIS A C   1 
ATOM   1459  O  O   . HIS A  1  214 ? 21.367  58.518  39.133  1.00 56.88 ? 242  HIS A O   1 
ATOM   1460  C  CB  . HIS A  1  214 ? 23.702  56.913  37.996  1.00 55.13 ? 242  HIS A CB  1 
ATOM   1461  C  CG  . HIS A  1  214 ? 25.005  56.714  38.700  1.00 54.98 ? 242  HIS A CG  1 
ATOM   1462  N  ND1 . HIS A  1  214 ? 25.164  56.946  40.047  1.00 55.88 ? 242  HIS A ND1 1 
ATOM   1463  C  CD2 . HIS A  1  214 ? 26.205  56.286  38.246  1.00 55.34 ? 242  HIS A CD2 1 
ATOM   1464  C  CE1 . HIS A  1  214 ? 26.406  56.664  40.394  1.00 56.48 ? 242  HIS A CE1 1 
ATOM   1465  N  NE2 . HIS A  1  214 ? 27.058  56.261  39.320  1.00 56.06 ? 242  HIS A NE2 1 
ATOM   1466  N  N   . VAL A  1  215 ? 22.213  57.511  40.966  1.00 56.55 ? 243  VAL A N   1 
ATOM   1467  C  CA  . VAL A  1  215 ? 21.751  58.556  41.884  1.00 56.39 ? 243  VAL A CA  1 
ATOM   1468  C  C   . VAL A  1  215 ? 22.842  59.595  42.170  1.00 54.91 ? 243  VAL A C   1 
ATOM   1469  O  O   . VAL A  1  215 ? 22.697  60.462  43.031  1.00 54.35 ? 243  VAL A O   1 
ATOM   1470  C  CB  . VAL A  1  215 ? 21.261  57.932  43.214  1.00 55.93 ? 243  VAL A CB  1 
ATOM   1471  C  CG1 . VAL A  1  215 ? 20.145  56.937  42.936  1.00 53.43 ? 243  VAL A CG1 1 
ATOM   1472  C  CG2 . VAL A  1  215 ? 22.417  57.251  43.930  1.00 56.01 ? 243  VAL A CG2 1 
ATOM   1473  N  N   . GLY A  1  216 ? 23.933  59.500  41.427  1.00 55.26 ? 244  GLY A N   1 
ATOM   1474  C  CA  . GLY A  1  216 ? 25.022  60.429  41.611  1.00 56.61 ? 244  GLY A CA  1 
ATOM   1475  C  C   . GLY A  1  216 ? 26.001  59.976  42.675  1.00 56.78 ? 244  GLY A C   1 
ATOM   1476  O  O   . GLY A  1  216 ? 27.083  60.553  42.807  1.00 57.05 ? 244  GLY A O   1 
ATOM   1477  N  N   . LEU A  1  217 ? 25.646  58.948  43.437  1.00 55.03 ? 245  LEU A N   1 
ATOM   1478  C  CA  . LEU A  1  217 ? 26.557  58.482  44.473  1.00 55.43 ? 245  LEU A CA  1 
ATOM   1479  C  C   . LEU A  1  217 ? 27.317  57.199  44.177  1.00 56.27 ? 245  LEU A C   1 
ATOM   1480  O  O   . LEU A  1  217 ? 26.730  56.132  43.996  1.00 55.83 ? 245  LEU A O   1 
ATOM   1481  C  CB  . LEU A  1  217 ? 25.821  58.307  45.797  1.00 56.95 ? 245  LEU A CB  1 
ATOM   1482  C  CG  . LEU A  1  217 ? 26.701  57.670  46.880  1.00 57.08 ? 245  LEU A CG  1 
ATOM   1483  C  CD1 . LEU A  1  217 ? 27.898  58.562  47.139  1.00 57.24 ? 245  LEU A CD1 1 
ATOM   1484  C  CD2 . LEU A  1  217 ? 25.901  57.457  48.148  1.00 55.51 ? 245  LEU A CD2 1 
ATOM   1485  N  N   . GLU A  1  218 ? 28.635  57.311  44.140  1.00 55.94 ? 246  GLU A N   1 
ATOM   1486  C  CA  . GLU A  1  218 ? 29.466  56.150  43.904  1.00 57.54 ? 246  GLU A CA  1 
ATOM   1487  C  C   . GLU A  1  218 ? 30.295  56.021  45.172  1.00 58.54 ? 246  GLU A C   1 
ATOM   1488  O  O   . GLU A  1  218 ? 30.488  57.014  45.881  1.00 57.43 ? 246  GLU A O   1 
ATOM   1489  C  CB  . GLU A  1  218 ? 30.351  56.362  42.675  1.00 56.81 ? 246  GLU A CB  1 
ATOM   1490  C  CG  . GLU A  1  218 ? 29.571  56.751  41.427  1.00 57.15 ? 246  GLU A CG  1 
ATOM   1491  C  CD  . GLU A  1  218 ? 30.442  56.831  40.182  1.00 59.10 ? 246  GLU A CD  1 
ATOM   1492  O  OE1 . GLU A  1  218 ? 31.612  57.237  40.311  1.00 60.53 ? 246  GLU A OE1 1 
ATOM   1493  O  OE2 . GLU A  1  218 ? 29.967  56.508  39.068  1.00 59.18 ? 246  GLU A OE2 1 
ATOM   1494  N  N   . LEU A  1  219 ? 30.767  54.809  45.464  1.00 58.99 ? 247  LEU A N   1 
ATOM   1495  C  CA  . LEU A  1  219 ? 31.553  54.547  46.675  1.00 58.09 ? 247  LEU A CA  1 
ATOM   1496  C  C   . LEU A  1  219 ? 32.764  53.673  46.434  1.00 57.78 ? 247  LEU A C   1 
ATOM   1497  O  O   . LEU A  1  219 ? 32.747  52.809  45.559  1.00 58.28 ? 247  LEU A O   1 
ATOM   1498  C  CB  . LEU A  1  219 ? 30.680  53.863  47.719  1.00 57.92 ? 247  LEU A CB  1 
ATOM   1499  C  CG  . LEU A  1  219 ? 29.491  54.700  48.162  1.00 57.88 ? 247  LEU A CG  1 
ATOM   1500  C  CD1 . LEU A  1  219 ? 28.504  53.866  48.959  1.00 57.33 ? 247  LEU A CD1 1 
ATOM   1501  C  CD2 . LEU A  1  219 ? 30.023  55.855  48.975  1.00 58.76 ? 247  LEU A CD2 1 
ATOM   1502  N  N   . LEU A  1  220 ? 33.805  53.879  47.234  1.00 56.77 ? 248  LEU A N   1 
ATOM   1503  C  CA  . LEU A  1  220 ? 35.015  53.090  47.080  1.00 57.71 ? 248  LEU A CA  1 
ATOM   1504  C  C   . LEU A  1  220 ? 35.262  52.179  48.267  1.00 57.48 ? 248  LEU A C   1 
ATOM   1505  O  O   . LEU A  1  220 ? 35.950  52.537  49.218  1.00 57.58 ? 248  LEU A O   1 
ATOM   1506  C  CB  . LEU A  1  220 ? 36.224  53.994  46.859  1.00 58.35 ? 248  LEU A CB  1 
ATOM   1507  C  CG  . LEU A  1  220 ? 37.524  53.235  46.581  1.00 58.51 ? 248  LEU A CG  1 
ATOM   1508  C  CD1 . LEU A  1  220 ? 37.324  52.205  45.466  1.00 57.97 ? 248  LEU A CD1 1 
ATOM   1509  C  CD2 . LEU A  1  220 ? 38.604  54.239  46.216  1.00 58.67 ? 248  LEU A CD2 1 
ATOM   1510  N  N   . VAL A  1  221 ? 34.690  50.986  48.184  1.00 58.23 ? 249  VAL A N   1 
ATOM   1511  C  CA  . VAL A  1  221 ? 34.802  49.976  49.224  1.00 58.20 ? 249  VAL A CA  1 
ATOM   1512  C  C   . VAL A  1  221 ? 36.107  49.192  49.144  1.00 58.39 ? 249  VAL A C   1 
ATOM   1513  O  O   . VAL A  1  221 ? 36.331  48.442  48.194  1.00 58.09 ? 249  VAL A O   1 
ATOM   1514  C  CB  . VAL A  1  221 ? 33.645  48.983  49.114  1.00 57.88 ? 249  VAL A CB  1 
ATOM   1515  C  CG1 . VAL A  1  221 ? 33.797  47.868  50.146  1.00 57.38 ? 249  VAL A CG1 1 
ATOM   1516  C  CG2 . VAL A  1  221 ? 32.337  49.725  49.272  1.00 56.70 ? 249  VAL A CG2 1 
ATOM   1517  N  N   . ASN A  1  222 ? 36.965  49.366  50.142  1.00 58.35 ? 250  ASN A N   1 
ATOM   1518  C  CA  . ASN A  1  222 ? 38.229  48.648  50.179  1.00 57.99 ? 250  ASN A CA  1 
ATOM   1519  C  C   . ASN A  1  222 ? 38.021  47.319  50.889  1.00 57.09 ? 250  ASN A C   1 
ATOM   1520  O  O   . ASN A  1  222 ? 38.431  47.123  52.027  1.00 57.62 ? 250  ASN A O   1 
ATOM   1521  C  CB  . ASN A  1  222 ? 39.302  49.481  50.890  1.00 59.51 ? 250  ASN A CB  1 
ATOM   1522  C  CG  . ASN A  1  222 ? 40.593  48.688  51.162  1.00 60.87 ? 250  ASN A CG  1 
ATOM   1523  O  OD1 . ASN A  1  222 ? 40.924  47.731  50.446  1.00 61.44 ? 250  ASN A OD1 1 
ATOM   1524  N  ND2 . ASN A  1  222 ? 41.333  49.101  52.195  1.00 59.82 ? 250  ASN A ND2 1 
ATOM   1525  N  N   . HIS A  1  223 ? 37.362  46.411  50.194  1.00 57.51 ? 251  HIS A N   1 
ATOM   1526  C  CA  . HIS A  1  223 ? 37.084  45.092  50.731  1.00 58.99 ? 251  HIS A CA  1 
ATOM   1527  C  C   . HIS A  1  223 ? 38.287  44.181  50.532  1.00 59.57 ? 251  HIS A C   1 
ATOM   1528  O  O   . HIS A  1  223 ? 38.140  43.001  50.200  1.00 60.61 ? 251  HIS A O   1 
ATOM   1529  C  CB  . HIS A  1  223 ? 35.866  44.509  50.023  1.00 59.12 ? 251  HIS A CB  1 
ATOM   1530  C  CG  . HIS A  1  223 ? 35.949  44.596  48.535  1.00 59.31 ? 251  HIS A CG  1 
ATOM   1531  N  ND1 . HIS A  1  223 ? 35.899  43.487  47.721  1.00 59.18 ? 251  HIS A ND1 1 
ATOM   1532  C  CD2 . HIS A  1  223 ? 36.153  45.656  47.718  1.00 59.05 ? 251  HIS A CD2 1 
ATOM   1533  C  CE1 . HIS A  1  223 ? 36.074  43.861  46.466  1.00 59.34 ? 251  HIS A CE1 1 
ATOM   1534  N  NE2 . HIS A  1  223 ? 36.232  45.172  46.438  1.00 58.14 ? 251  HIS A NE2 1 
ATOM   1535  N  N   . LYS A  1  224 ? 39.479  44.728  50.745  1.00 59.48 ? 252  LYS A N   1 
ATOM   1536  C  CA  . LYS A  1  224 ? 40.699  43.948  50.574  1.00 60.82 ? 252  LYS A CA  1 
ATOM   1537  C  C   . LYS A  1  224 ? 40.900  42.867  51.625  1.00 61.18 ? 252  LYS A C   1 
ATOM   1538  O  O   . LYS A  1  224 ? 41.205  41.725  51.291  1.00 61.37 ? 252  LYS A O   1 
ATOM   1539  C  CB  . LYS A  1  224 ? 41.933  44.865  50.565  1.00 62.13 ? 252  LYS A CB  1 
ATOM   1540  C  CG  . LYS A  1  224 ? 43.288  44.117  50.554  1.00 62.40 ? 252  LYS A CG  1 
ATOM   1541  C  CD  . LYS A  1  224 ? 44.483  45.065  50.347  1.00 63.71 ? 252  LYS A CD  1 
ATOM   1542  C  CE  . LYS A  1  224 ? 45.828  44.387  50.645  1.00 62.70 ? 252  LYS A CE  1 
ATOM   1543  N  NZ  . LYS A  1  224 ? 46.072  43.175  49.804  1.00 62.32 ? 252  LYS A NZ  1 
ATOM   1544  N  N   . ALA A  1  225 ? 40.724  43.237  52.889  1.00 61.08 ? 253  ALA A N   1 
ATOM   1545  C  CA  . ALA A  1  225 ? 40.918  42.326  54.017  1.00 62.71 ? 253  ALA A CA  1 
ATOM   1546  C  C   . ALA A  1  225 ? 40.109  41.035  54.013  1.00 62.82 ? 253  ALA A C   1 
ATOM   1547  O  O   . ALA A  1  225 ? 39.133  40.901  53.279  1.00 63.57 ? 253  ALA A O   1 
ATOM   1548  C  CB  . ALA A  1  225 ? 40.661  43.074  55.314  1.00 63.63 ? 253  ALA A CB  1 
ATOM   1549  N  N   . LEU A  1  226 ? 40.530  40.094  54.859  1.00 63.05 ? 254  LEU A N   1 
ATOM   1550  C  CA  . LEU A  1  226 ? 39.868  38.798  55.009  1.00 64.05 ? 254  LEU A CA  1 
ATOM   1551  C  C   . LEU A  1  226 ? 38.714  38.836  56.014  1.00 65.40 ? 254  LEU A C   1 
ATOM   1552  O  O   . LEU A  1  226 ? 37.901  37.906  56.077  1.00 65.35 ? 254  LEU A O   1 
ATOM   1553  C  CB  . LEU A  1  226 ? 40.872  37.745  55.469  1.00 64.11 ? 254  LEU A CB  1 
ATOM   1554  C  CG  . LEU A  1  226 ? 41.842  37.208  54.430  1.00 64.71 ? 254  LEU A CG  1 
ATOM   1555  C  CD1 . LEU A  1  226 ? 42.684  36.115  55.060  1.00 65.27 ? 254  LEU A CD1 1 
ATOM   1556  C  CD2 . LEU A  1  226 ? 41.067  36.662  53.248  1.00 64.54 ? 254  LEU A CD2 1 
ATOM   1557  N  N   . ASP A  1  227 ? 38.656  39.908  56.802  1.00 66.09 ? 255  ASP A N   1 
ATOM   1558  C  CA  . ASP A  1  227 ? 37.616  40.084  57.805  1.00 65.29 ? 255  ASP A CA  1 
ATOM   1559  C  C   . ASP A  1  227 ? 36.748  41.308  57.505  1.00 65.51 ? 255  ASP A C   1 
ATOM   1560  O  O   . ASP A  1  227 ? 37.155  42.440  57.747  1.00 66.04 ? 255  ASP A O   1 
ATOM   1561  C  CB  . ASP A  1  227 ? 38.254  40.236  59.174  1.00 67.60 ? 255  ASP A CB  1 
ATOM   1562  C  CG  . ASP A  1  227 ? 37.237  40.509  60.251  1.00 69.44 ? 255  ASP A CG  1 
ATOM   1563  O  OD1 . ASP A  1  227 ? 36.436  39.595  60.557  1.00 69.89 ? 255  ASP A OD1 1 
ATOM   1564  O  OD2 . ASP A  1  227 ? 37.235  41.643  60.783  1.00 69.68 ? 255  ASP A OD2 1 
ATOM   1565  N  N   . PRO A  1  228 ? 35.529  41.081  56.989  1.00 65.62 ? 256  PRO A N   1 
ATOM   1566  C  CA  . PRO A  1  228 ? 34.507  42.061  56.604  1.00 67.12 ? 256  PRO A CA  1 
ATOM   1567  C  C   . PRO A  1  228 ? 34.372  43.342  57.431  1.00 67.90 ? 256  PRO A C   1 
ATOM   1568  O  O   . PRO A  1  228 ? 33.902  44.372  56.922  1.00 67.85 ? 256  PRO A O   1 
ATOM   1569  C  CB  . PRO A  1  228 ? 33.235  41.227  56.610  1.00 67.47 ? 256  PRO A CB  1 
ATOM   1570  C  CG  . PRO A  1  228 ? 33.734  39.920  56.070  1.00 66.20 ? 256  PRO A CG  1 
ATOM   1571  C  CD  . PRO A  1  228 ? 34.999  39.712  56.856  1.00 65.67 ? 256  PRO A CD  1 
ATOM   1572  N  N   . ALA A  1  229 ? 34.769  43.283  58.700  1.00 67.85 ? 257  ALA A N   1 
ATOM   1573  C  CA  . ALA A  1  229 ? 34.691  44.459  59.569  1.00 69.37 ? 257  ALA A CA  1 
ATOM   1574  C  C   . ALA A  1  229 ? 35.842  45.400  59.219  1.00 70.04 ? 257  ALA A C   1 
ATOM   1575  O  O   . ALA A  1  229 ? 35.697  46.630  59.232  1.00 69.49 ? 257  ALA A O   1 
ATOM   1576  C  CB  . ALA A  1  229 ? 34.785  44.043  61.027  1.00 67.98 ? 257  ALA A CB  1 
ATOM   1577  N  N   . ARG A  1  230 ? 36.981  44.791  58.901  1.00 68.81 ? 258  ARG A N   1 
ATOM   1578  C  CA  . ARG A  1  230 ? 38.188  45.506  58.528  1.00 67.92 ? 258  ARG A CA  1 
ATOM   1579  C  C   . ARG A  1  230 ? 37.984  46.405  57.296  1.00 69.40 ? 258  ARG A C   1 
ATOM   1580  O  O   . ARG A  1  230 ? 38.725  47.377  57.110  1.00 70.04 ? 258  ARG A O   1 
ATOM   1581  C  CB  . ARG A  1  230 ? 39.301  44.495  58.246  1.00 69.55 ? 258  ARG A CB  1 
ATOM   1582  C  CG  . ARG A  1  230 ? 39.693  43.595  59.429  1.00 71.60 ? 258  ARG A CG  1 
ATOM   1583  C  CD  . ARG A  1  230 ? 40.448  44.363  60.541  1.00 73.10 ? 258  ARG A CD  1 
ATOM   1584  N  NE  . ARG A  1  230 ? 41.122  43.486  61.516  1.00 75.38 ? 258  ARG A NE  1 
ATOM   1585  C  CZ  . ARG A  1  230 ? 42.319  42.906  61.342  1.00 76.37 ? 258  ARG A CZ  1 
ATOM   1586  N  NH1 . ARG A  1  230 ? 43.010  43.103  60.221  1.00 75.88 ? 258  ARG A NH1 1 
ATOM   1587  N  NH2 . ARG A  1  230 ? 42.828  42.112  62.289  1.00 75.85 ? 258  ARG A NH2 1 
ATOM   1588  N  N   . TRP A  1  231 ? 36.987  46.094  56.463  1.00 69.08 ? 259  TRP A N   1 
ATOM   1589  C  CA  . TRP A  1  231 ? 36.719  46.878  55.251  1.00 66.76 ? 259  TRP A CA  1 
ATOM   1590  C  C   . TRP A  1  231 ? 36.355  48.313  55.528  1.00 66.60 ? 259  TRP A C   1 
ATOM   1591  O  O   . TRP A  1  231 ? 35.858  48.635  56.603  1.00 67.53 ? 259  TRP A O   1 
ATOM   1592  C  CB  . TRP A  1  231 ? 35.592  46.263  54.450  1.00 65.44 ? 259  TRP A CB  1 
ATOM   1593  C  CG  . TRP A  1  231 ? 35.869  44.892  54.047  1.00 65.27 ? 259  TRP A CG  1 
ATOM   1594  C  CD1 . TRP A  1  231 ? 37.075  44.247  54.073  1.00 65.24 ? 259  TRP A CD1 1 
ATOM   1595  C  CD2 . TRP A  1  231 ? 34.927  43.967  53.537  1.00 65.09 ? 259  TRP A CD2 1 
ATOM   1596  N  NE1 . TRP A  1  231 ? 36.935  42.967  53.607  1.00 64.23 ? 259  TRP A NE1 1 
ATOM   1597  C  CE2 . TRP A  1  231 ? 35.622  42.769  53.270  1.00 65.77 ? 259  TRP A CE2 1 
ATOM   1598  C  CE3 . TRP A  1  231 ? 33.556  44.030  53.277  1.00 64.21 ? 259  TRP A CE3 1 
ATOM   1599  C  CZ2 . TRP A  1  231 ? 34.987  41.639  52.754  1.00 66.81 ? 259  TRP A CZ2 1 
ATOM   1600  C  CZ3 . TRP A  1  231 ? 32.922  42.909  52.763  1.00 65.62 ? 259  TRP A CZ3 1 
ATOM   1601  C  CH2 . TRP A  1  231 ? 33.637  41.727  52.507  1.00 66.60 ? 259  TRP A CH2 1 
ATOM   1602  N  N   . THR A  1  232 ? 36.586  49.173  54.541  1.00 67.07 ? 260  THR A N   1 
ATOM   1603  C  CA  . THR A  1  232 ? 36.287  50.597  54.680  1.00 66.37 ? 260  THR A CA  1 
ATOM   1604  C  C   . THR A  1  232 ? 36.046  51.305  53.356  1.00 65.87 ? 260  THR A C   1 
ATOM   1605  O  O   . THR A  1  232 ? 36.371  50.800  52.280  1.00 66.43 ? 260  THR A O   1 
ATOM   1606  C  CB  . THR A  1  232 ? 37.436  51.356  55.359  1.00 66.74 ? 260  THR A CB  1 
ATOM   1607  O  OG1 . THR A  1  232 ? 38.552  51.441  54.454  1.00 66.49 ? 260  THR A OG1 1 
ATOM   1608  C  CG2 . THR A  1  232 ? 37.858  50.649  56.645  1.00 66.80 ? 260  THR A CG2 1 
ATOM   1609  N  N   . ILE A  1  233 ? 35.488  52.502  53.455  1.00 65.76 ? 261  ILE A N   1 
ATOM   1610  C  CA  . ILE A  1  233 ? 35.223  53.319  52.284  1.00 65.11 ? 261  ILE A CA  1 
ATOM   1611  C  C   . ILE A  1  233 ? 36.371  54.328  52.213  1.00 64.62 ? 261  ILE A C   1 
ATOM   1612  O  O   . ILE A  1  233 ? 36.450  55.244  53.036  1.00 64.85 ? 261  ILE A O   1 
ATOM   1613  C  CB  . ILE A  1  233 ? 33.879  54.061  52.429  1.00 63.31 ? 261  ILE A CB  1 
ATOM   1614  C  CG1 . ILE A  1  233 ? 32.851  53.135  53.067  1.00 62.74 ? 261  ILE A CG1 1 
ATOM   1615  C  CG2 . ILE A  1  233 ? 33.379  54.512  51.062  1.00 64.23 ? 261  ILE A CG2 1 
ATOM   1616  C  CD1 . ILE A  1  233 ? 32.640  51.854  52.303  1.00 62.91 ? 261  ILE A CD1 1 
ATOM   1617  N  N   . GLN A  1  234 ? 37.263  54.157  51.240  1.00 63.70 ? 262  GLN A N   1 
ATOM   1618  C  CA  . GLN A  1  234 ? 38.409  55.052  51.099  1.00 63.43 ? 262  GLN A CA  1 
ATOM   1619  C  C   . GLN A  1  234 ? 38.082  56.411  50.502  1.00 63.41 ? 262  GLN A C   1 
ATOM   1620  O  O   . GLN A  1  234 ? 38.817  57.376  50.710  1.00 64.16 ? 262  GLN A O   1 
ATOM   1621  C  CB  . GLN A  1  234 ? 39.492  54.391  50.260  1.00 63.84 ? 262  GLN A CB  1 
ATOM   1622  C  CG  . GLN A  1  234 ? 39.899  53.029  50.777  1.00 64.49 ? 262  GLN A CG  1 
ATOM   1623  C  CD  . GLN A  1  234 ? 41.089  52.480  50.028  1.00 64.56 ? 262  GLN A CD  1 
ATOM   1624  O  OE1 . GLN A  1  234 ? 41.133  52.544  48.803  1.00 64.26 ? 262  GLN A OE1 1 
ATOM   1625  N  NE2 . GLN A  1  234 ? 42.060  51.933  50.757  1.00 64.73 ? 262  GLN A NE2 1 
ATOM   1626  N  N   . LYS A  1  235 ? 36.991  56.486  49.747  1.00 63.79 ? 263  LYS A N   1 
ATOM   1627  C  CA  . LYS A  1  235 ? 36.567  57.741  49.135  1.00 62.30 ? 263  LYS A CA  1 
ATOM   1628  C  C   . LYS A  1  235 ? 35.126  57.581  48.664  1.00 61.74 ? 263  LYS A C   1 
ATOM   1629  O  O   . LYS A  1  235 ? 34.674  56.477  48.341  1.00 61.77 ? 263  LYS A O   1 
ATOM   1630  C  CB  . LYS A  1  235 ? 37.467  58.089  47.944  1.00 62.99 ? 263  LYS A CB  1 
ATOM   1631  C  CG  . LYS A  1  235 ? 37.585  59.578  47.634  1.00 62.52 ? 263  LYS A CG  1 
ATOM   1632  C  CD  . LYS A  1  235 ? 38.620  60.267  48.520  1.00 63.17 ? 263  LYS A CD  1 
ATOM   1633  C  CE  . LYS A  1  235 ? 38.744  61.743  48.168  1.00 63.40 ? 263  LYS A CE  1 
ATOM   1634  N  NZ  . LYS A  1  235 ? 39.780  62.436  48.970  1.00 62.60 ? 263  LYS A NZ  1 
ATOM   1635  N  N   . VAL A  1  236 ? 34.401  58.687  48.649  1.00 60.89 ? 264  VAL A N   1 
ATOM   1636  C  CA  . VAL A  1  236 ? 33.020  58.679  48.218  1.00 60.10 ? 264  VAL A CA  1 
ATOM   1637  C  C   . VAL A  1  236 ? 32.875  59.762  47.186  1.00 61.24 ? 264  VAL A C   1 
ATOM   1638  O  O   . VAL A  1  236 ? 33.541  60.795  47.243  1.00 61.21 ? 264  VAL A O   1 
ATOM   1639  C  CB  . VAL A  1  236 ? 32.062  58.987  49.355  1.00 60.05 ? 264  VAL A CB  1 
ATOM   1640  C  CG1 . VAL A  1  236 ? 32.425  60.302  49.971  1.00 62.32 ? 264  VAL A CG1 1 
ATOM   1641  C  CG2 . VAL A  1  236 ? 30.649  59.066  48.836  1.00 61.07 ? 264  VAL A CG2 1 
ATOM   1642  N  N   . PHE A  1  237 ? 31.975  59.523  46.251  1.00 61.94 ? 265  PHE A N   1 
ATOM   1643  C  CA  . PHE A  1  237 ? 31.740  60.445  45.173  1.00 60.25 ? 265  PHE A CA  1 
ATOM   1644  C  C   . PHE A  1  237 ? 30.245  60.648  45.110  1.00 59.27 ? 265  PHE A C   1 
ATOM   1645  O  O   . PHE A  1  237 ? 29.482  59.688  44.999  1.00 58.77 ? 265  PHE A O   1 
ATOM   1646  C  CB  . PHE A  1  237 ? 32.258  59.806  43.884  1.00 60.75 ? 265  PHE A CB  1 
ATOM   1647  C  CG  . PHE A  1  237 ? 32.247  60.715  42.693  1.00 61.18 ? 265  PHE A CG  1 
ATOM   1648  C  CD1 . PHE A  1  237 ? 33.170  61.751  42.579  1.00 62.39 ? 265  PHE A CD1 1 
ATOM   1649  C  CD2 . PHE A  1  237 ? 31.328  60.519  41.665  1.00 61.15 ? 265  PHE A CD2 1 
ATOM   1650  C  CE1 . PHE A  1  237 ? 33.180  62.582  41.446  1.00 61.16 ? 265  PHE A CE1 1 
ATOM   1651  C  CE2 . PHE A  1  237 ? 31.327  61.339  40.534  1.00 60.96 ? 265  PHE A CE2 1 
ATOM   1652  C  CZ  . PHE A  1  237 ? 32.256  62.371  40.426  1.00 61.34 ? 265  PHE A CZ  1 
ATOM   1653  N  N   . TYR A  1  238 ? 29.824  61.896  45.216  1.00 59.23 ? 266  TYR A N   1 
ATOM   1654  C  CA  . TYR A  1  238 ? 28.409  62.190  45.134  1.00 61.12 ? 266  TYR A CA  1 
ATOM   1655  C  C   . TYR A  1  238 ? 28.158  63.377  44.225  1.00 61.48 ? 266  TYR A C   1 
ATOM   1656  O  O   . TYR A  1  238 ? 28.790  64.425  44.371  1.00 61.46 ? 266  TYR A O   1 
ATOM   1657  C  CB  . TYR A  1  238 ? 27.812  62.487  46.508  1.00 59.98 ? 266  TYR A CB  1 
ATOM   1658  C  CG  . TYR A  1  238 ? 26.338  62.813  46.422  1.00 58.04 ? 266  TYR A CG  1 
ATOM   1659  C  CD1 . TYR A  1  238 ? 25.409  61.821  46.141  1.00 57.76 ? 266  TYR A CD1 1 
ATOM   1660  C  CD2 . TYR A  1  238 ? 25.878  64.118  46.581  1.00 58.90 ? 266  TYR A CD2 1 
ATOM   1661  C  CE1 . TYR A  1  238 ? 24.058  62.113  46.019  1.00 58.71 ? 266  TYR A CE1 1 
ATOM   1662  C  CE2 . TYR A  1  238 ? 24.523  64.420  46.462  1.00 58.44 ? 266  TYR A CE2 1 
ATOM   1663  C  CZ  . TYR A  1  238 ? 23.618  63.409  46.182  1.00 57.40 ? 266  TYR A CZ  1 
ATOM   1664  O  OH  . TYR A  1  238 ? 22.272  63.675  46.085  1.00 56.69 ? 266  TYR A OH  1 
ATOM   1665  N  N   . GLN A  1  239 ? 27.219  63.194  43.297  1.00 62.51 ? 267  GLN A N   1 
ATOM   1666  C  CA  . GLN A  1  239 ? 26.825  64.213  42.322  1.00 63.24 ? 267  GLN A CA  1 
ATOM   1667  C  C   . GLN A  1  239 ? 27.883  65.264  41.968  1.00 63.99 ? 267  GLN A C   1 
ATOM   1668  O  O   . GLN A  1  239 ? 27.603  66.470  42.016  1.00 63.70 ? 267  GLN A O   1 
ATOM   1669  C  CB  . GLN A  1  239 ? 25.547  64.924  42.783  1.00 63.02 ? 267  GLN A CB  1 
ATOM   1670  C  CG  . GLN A  1  239 ? 24.277  64.158  42.480  1.00 63.54 ? 267  GLN A CG  1 
ATOM   1671  C  CD  . GLN A  1  239 ? 23.043  64.859  43.005  1.00 64.05 ? 267  GLN A CD  1 
ATOM   1672  O  OE1 . GLN A  1  239 ? 22.957  66.087  42.969  1.00 63.80 ? 267  GLN A OE1 1 
ATOM   1673  N  NE2 . GLN A  1  239 ? 22.072  64.080  43.485  1.00 64.30 ? 267  GLN A NE2 1 
ATOM   1674  N  N   . GLY A  1  240 ? 29.088  64.808  41.621  1.00 62.98 ? 268  GLY A N   1 
ATOM   1675  C  CA  . GLY A  1  240 ? 30.139  65.734  41.231  1.00 63.39 ? 268  GLY A CA  1 
ATOM   1676  C  C   . GLY A  1  240 ? 31.401  65.824  42.071  1.00 64.40 ? 268  GLY A C   1 
ATOM   1677  O  O   . GLY A  1  240 ? 32.506  65.765  41.527  1.00 63.68 ? 268  GLY A O   1 
ATOM   1678  N  N   . ARG A  1  241 ? 31.245  65.971  43.387  1.00 65.11 ? 269  ARG A N   1 
ATOM   1679  C  CA  . ARG A  1  241 ? 32.386  66.103  44.290  1.00 64.28 ? 269  ARG A CA  1 
ATOM   1680  C  C   . ARG A  1  241 ? 32.852  64.815  44.971  1.00 63.59 ? 269  ARG A C   1 
ATOM   1681  O  O   . ARG A  1  241 ? 32.118  63.828  45.078  1.00 63.35 ? 269  ARG A O   1 
ATOM   1682  C  CB  . ARG A  1  241 ? 32.078  67.153  45.381  1.00 66.16 ? 269  ARG A CB  1 
ATOM   1683  C  CG  . ARG A  1  241 ? 32.146  68.638  44.962  1.00 67.17 ? 269  ARG A CG  1 
ATOM   1684  C  CD  . ARG A  1  241 ? 30.879  69.157  44.242  1.00 68.76 ? 269  ARG A CD  1 
ATOM   1685  N  NE  . ARG A  1  241 ? 31.038  70.536  43.742  1.00 71.63 ? 269  ARG A NE  1 
ATOM   1686  C  CZ  . ARG A  1  241 ? 30.915  71.648  44.475  1.00 72.04 ? 269  ARG A CZ  1 
ATOM   1687  N  NH1 . ARG A  1  241 ? 30.616  71.573  45.770  1.00 72.31 ? 269  ARG A NH1 1 
ATOM   1688  N  NH2 . ARG A  1  241 ? 31.116  72.845  43.916  1.00 71.24 ? 269  ARG A NH2 1 
ATOM   1689  N  N   . TYR A  1  242 ? 34.098  64.846  45.426  1.00 64.51 ? 270  TYR A N   1 
ATOM   1690  C  CA  . TYR A  1  242 ? 34.695  63.734  46.151  1.00 65.01 ? 270  TYR A CA  1 
ATOM   1691  C  C   . TYR A  1  242 ? 34.600  64.097  47.624  1.00 65.26 ? 270  TYR A C   1 
ATOM   1692  O  O   . TYR A  1  242 ? 34.758  65.260  47.999  1.00 65.53 ? 270  TYR A O   1 
ATOM   1693  C  CB  . TYR A  1  242 ? 36.178  63.576  45.819  1.00 64.60 ? 270  TYR A CB  1 
ATOM   1694  C  CG  . TYR A  1  242 ? 36.485  62.918  44.505  1.00 64.49 ? 270  TYR A CG  1 
ATOM   1695  C  CD1 . TYR A  1  242 ? 36.079  63.483  43.300  1.00 65.38 ? 270  TYR A CD1 1 
ATOM   1696  C  CD2 . TYR A  1  242 ? 37.214  61.735  44.463  1.00 65.83 ? 270  TYR A CD2 1 
ATOM   1697  C  CE1 . TYR A  1  242 ? 36.398  62.881  42.072  1.00 65.97 ? 270  TYR A CE1 1 
ATOM   1698  C  CE2 . TYR A  1  242 ? 37.536  61.123  43.246  1.00 66.20 ? 270  TYR A CE2 1 
ATOM   1699  C  CZ  . TYR A  1  242 ? 37.125  61.699  42.054  1.00 65.67 ? 270  TYR A CZ  1 
ATOM   1700  O  OH  . TYR A  1  242 ? 37.427  61.091  40.854  1.00 64.58 ? 270  TYR A OH  1 
ATOM   1701  N  N   . TYR A  1  243 ? 34.343  63.109  48.464  1.00 64.45 ? 271  TYR A N   1 
ATOM   1702  C  CA  . TYR A  1  243 ? 34.281  63.368  49.881  1.00 63.81 ? 271  TYR A CA  1 
ATOM   1703  C  C   . TYR A  1  243 ? 35.135  62.308  50.539  1.00 64.33 ? 271  TYR A C   1 
ATOM   1704  O  O   . TYR A  1  243 ? 35.555  61.361  49.875  1.00 64.50 ? 271  TYR A O   1 
ATOM   1705  C  CB  . TYR A  1  243 ? 32.841  63.316  50.359  1.00 63.02 ? 271  TYR A CB  1 
ATOM   1706  C  CG  . TYR A  1  243 ? 31.978  64.366  49.713  1.00 62.18 ? 271  TYR A CG  1 
ATOM   1707  C  CD1 . TYR A  1  243 ? 31.425  64.169  48.453  1.00 63.22 ? 271  TYR A CD1 1 
ATOM   1708  C  CD2 . TYR A  1  243 ? 31.726  65.574  50.359  1.00 63.29 ? 271  TYR A CD2 1 
ATOM   1709  C  CE1 . TYR A  1  243 ? 30.628  65.167  47.849  1.00 64.22 ? 271  TYR A CE1 1 
ATOM   1710  C  CE2 . TYR A  1  243 ? 30.937  66.576  49.767  1.00 63.39 ? 271  TYR A CE2 1 
ATOM   1711  C  CZ  . TYR A  1  243 ? 30.393  66.369  48.517  1.00 63.26 ? 271  TYR A CZ  1 
ATOM   1712  O  OH  . TYR A  1  243 ? 29.623  67.361  47.949  1.00 62.56 ? 271  TYR A OH  1 
ATOM   1713  N  N   . ASP A  1  244 ? 35.413  62.467  51.830  1.00 65.01 ? 272  ASP A N   1 
ATOM   1714  C  CA  . ASP A  1  244 ? 36.253  61.507  52.549  1.00 65.53 ? 272  ASP A CA  1 
ATOM   1715  C  C   . ASP A  1  244 ? 35.473  60.406  53.254  1.00 64.47 ? 272  ASP A C   1 
ATOM   1716  O  O   . ASP A  1  244 ? 35.979  59.294  53.439  1.00 63.49 ? 272  ASP A O   1 
ATOM   1717  C  CB  . ASP A  1  244 ? 37.150  62.238  53.557  1.00 66.40 ? 272  ASP A CB  1 
ATOM   1718  C  CG  . ASP A  1  244 ? 38.282  63.023  52.879  1.00 68.51 ? 272  ASP A CG  1 
ATOM   1719  O  OD1 . ASP A  1  244 ? 39.096  62.395  52.155  1.00 68.90 ? 272  ASP A OD1 1 
ATOM   1720  O  OD2 . ASP A  1  244 ? 38.358  64.263  53.073  1.00 68.78 ? 272  ASP A OD2 1 
ATOM   1721  N  N   . SER A  1  245 ? 34.240  60.720  53.636  1.00 64.67 ? 273  SER A N   1 
ATOM   1722  C  CA  . SER A  1  245 ? 33.379  59.759  54.320  1.00 65.05 ? 273  SER A CA  1 
ATOM   1723  C  C   . SER A  1  245 ? 31.919  60.106  54.094  1.00 65.32 ? 273  SER A C   1 
ATOM   1724  O  O   . SER A  1  245 ? 31.588  61.226  53.678  1.00 64.33 ? 273  SER A O   1 
ATOM   1725  C  CB  . SER A  1  245 ? 33.645  59.777  55.823  1.00 65.69 ? 273  SER A CB  1 
ATOM   1726  O  OG  . SER A  1  245 ? 33.250  61.022  56.380  1.00 65.69 ? 273  SER A OG  1 
ATOM   1727  N  N   . LEU A  1  246 ? 31.046  59.145  54.382  1.00 64.28 ? 274  LEU A N   1 
ATOM   1728  C  CA  . LEU A  1  246 ? 29.626  59.375  54.223  1.00 63.75 ? 274  LEU A CA  1 
ATOM   1729  C  C   . LEU A  1  246 ? 29.227  60.471  55.180  1.00 64.33 ? 274  LEU A C   1 
ATOM   1730  O  O   . LEU A  1  246 ? 28.393  61.322  54.872  1.00 64.12 ? 274  LEU A O   1 
ATOM   1731  C  CB  . LEU A  1  246 ? 28.857  58.099  54.517  1.00 64.22 ? 274  LEU A CB  1 
ATOM   1732  C  CG  . LEU A  1  246 ? 28.839  57.235  53.269  1.00 64.36 ? 274  LEU A CG  1 
ATOM   1733  C  CD1 . LEU A  1  246 ? 28.011  56.015  53.474  1.00 65.59 ? 274  LEU A CD1 1 
ATOM   1734  C  CD2 . LEU A  1  246 ? 28.258  58.057  52.149  1.00 64.47 ? 274  LEU A CD2 1 
ATOM   1735  N  N   . ALA A  1  247 ? 29.852  60.444  56.348  1.00 64.75 ? 275  ALA A N   1 
ATOM   1736  C  CA  . ALA A  1  247 ? 29.602  61.433  57.380  1.00 64.85 ? 275  ALA A CA  1 
ATOM   1737  C  C   . ALA A  1  247 ? 29.925  62.836  56.873  1.00 64.95 ? 275  ALA A C   1 
ATOM   1738  O  O   . ALA A  1  247 ? 29.126  63.759  57.029  1.00 65.87 ? 275  ALA A O   1 
ATOM   1739  C  CB  . ALA A  1  247 ? 30.444  61.116  58.603  1.00 65.36 ? 275  ALA A CB  1 
ATOM   1740  N  N   . GLN A  1  248 ? 31.099  62.988  56.270  1.00 63.20 ? 276  GLN A N   1 
ATOM   1741  C  CA  . GLN A  1  248 ? 31.538  64.272  55.743  1.00 63.83 ? 276  GLN A CA  1 
ATOM   1742  C  C   . GLN A  1  248 ? 30.567  64.846  54.715  1.00 64.29 ? 276  GLN A C   1 
ATOM   1743  O  O   . GLN A  1  248 ? 30.427  66.066  54.584  1.00 63.77 ? 276  GLN A O   1 
ATOM   1744  C  CB  . GLN A  1  248 ? 32.919  64.115  55.122  1.00 64.57 ? 276  GLN A CB  1 
ATOM   1745  C  CG  . GLN A  1  248 ? 33.412  65.322  54.346  1.00 64.09 ? 276  GLN A CG  1 
ATOM   1746  C  CD  . GLN A  1  248 ? 34.847  65.139  53.892  1.00 64.81 ? 276  GLN A CD  1 
ATOM   1747  O  OE1 . GLN A  1  248 ? 35.217  65.511  52.774  1.00 64.29 ? 276  GLN A OE1 1 
ATOM   1748  N  NE2 . GLN A  1  248 ? 35.669  64.563  54.766  1.00 65.02 ? 276  GLN A NE2 1 
ATOM   1749  N  N   . LEU A  1  249 ? 29.905  63.957  53.984  1.00 64.02 ? 277  LEU A N   1 
ATOM   1750  C  CA  . LEU A  1  249 ? 28.933  64.359  52.975  1.00 63.86 ? 277  LEU A CA  1 
ATOM   1751  C  C   . LEU A  1  249 ? 27.649  64.817  53.666  1.00 63.44 ? 277  LEU A C   1 
ATOM   1752  O  O   . LEU A  1  249 ? 27.193  65.947  53.476  1.00 63.06 ? 277  LEU A O   1 
ATOM   1753  C  CB  . LEU A  1  249 ? 28.663  63.175  52.034  1.00 64.31 ? 277  LEU A CB  1 
ATOM   1754  C  CG  . LEU A  1  249 ? 27.629  63.199  50.895  1.00 64.28 ? 277  LEU A CG  1 
ATOM   1755  C  CD1 . LEU A  1  249 ? 27.478  64.585  50.275  1.00 63.65 ? 277  LEU A CD1 1 
ATOM   1756  C  CD2 . LEU A  1  249 ? 28.073  62.176  49.847  1.00 64.30 ? 277  LEU A CD2 1 
ATOM   1757  N  N   . GLU A  1  250 ? 27.080  63.929  54.476  1.00 63.93 ? 278  GLU A N   1 
ATOM   1758  C  CA  . GLU A  1  250 ? 25.864  64.222  55.216  1.00 63.54 ? 278  GLU A CA  1 
ATOM   1759  C  C   . GLU A  1  250 ? 26.055  65.545  55.972  1.00 63.35 ? 278  GLU A C   1 
ATOM   1760  O  O   . GLU A  1  250 ? 25.157  66.385  56.022  1.00 63.30 ? 278  GLU A O   1 
ATOM   1761  C  CB  . GLU A  1  250 ? 25.576  63.068  56.181  1.00 61.83 ? 278  GLU A CB  1 
ATOM   1762  C  CG  . GLU A  1  250 ? 24.322  63.230  57.009  1.00 63.10 ? 278  GLU A CG  1 
ATOM   1763  C  CD  . GLU A  1  250 ? 23.076  63.448  56.167  1.00 63.75 ? 278  GLU A CD  1 
ATOM   1764  O  OE1 . GLU A  1  250 ? 22.758  62.592  55.322  1.00 64.83 ? 278  GLU A OE1 1 
ATOM   1765  O  OE2 . GLU A  1  250 ? 22.403  64.479  56.350  1.00 63.68 ? 278  GLU A OE2 1 
ATOM   1766  N  N   . ALA A  1  251 ? 27.245  65.736  56.533  1.00 62.58 ? 279  ALA A N   1 
ATOM   1767  C  CA  . ALA A  1  251 ? 27.568  66.951  57.282  1.00 62.57 ? 279  ALA A CA  1 
ATOM   1768  C  C   . ALA A  1  251 ? 27.461  68.201  56.415  1.00 62.22 ? 279  ALA A C   1 
ATOM   1769  O  O   . ALA A  1  251 ? 26.830  69.186  56.791  1.00 60.35 ? 279  ALA A O   1 
ATOM   1770  C  CB  . ALA A  1  251 ? 28.973  66.841  57.858  1.00 61.58 ? 279  ALA A CB  1 
ATOM   1771  N  N   . GLN A  1  252 ? 28.095  68.159  55.254  1.00 61.56 ? 280  GLN A N   1 
ATOM   1772  C  CA  . GLN A  1  252 ? 28.052  69.287  54.363  1.00 60.64 ? 280  GLN A CA  1 
ATOM   1773  C  C   . GLN A  1  252 ? 26.659  69.450  53.798  1.00 61.25 ? 280  GLN A C   1 
ATOM   1774  O  O   . GLN A  1  252 ? 26.245  70.552  53.469  1.00 61.54 ? 280  GLN A O   1 
ATOM   1775  C  CB  . GLN A  1  252 ? 29.079  69.116  53.255  1.00 61.68 ? 280  GLN A CB  1 
ATOM   1776  C  CG  . GLN A  1  252 ? 30.078  70.262  53.235  1.00 63.06 ? 280  GLN A CG  1 
ATOM   1777  C  CD  . GLN A  1  252 ? 31.413  69.890  52.624  1.00 63.64 ? 280  GLN A CD  1 
ATOM   1778  O  OE1 . GLN A  1  252 ? 32.102  68.983  53.109  1.00 64.42 ? 280  GLN A OE1 1 
ATOM   1779  N  NE2 . GLN A  1  252 ? 31.794  70.594  51.558  1.00 63.38 ? 280  GLN A NE2 1 
ATOM   1780  N  N   . PHE A  1  253 ? 25.924  68.355  53.682  1.00 62.11 ? 281  PHE A N   1 
ATOM   1781  C  CA  . PHE A  1  253 ? 24.561  68.446  53.185  1.00 60.74 ? 281  PHE A CA  1 
ATOM   1782  C  C   . PHE A  1  253 ? 23.718  69.180  54.224  1.00 61.91 ? 281  PHE A C   1 
ATOM   1783  O  O   . PHE A  1  253 ? 22.971  70.110  53.899  1.00 61.91 ? 281  PHE A O   1 
ATOM   1784  C  CB  . PHE A  1  253 ? 23.970  67.057  52.964  1.00 60.95 ? 281  PHE A CB  1 
ATOM   1785  C  CG  . PHE A  1  253 ? 22.471  67.053  52.864  1.00 61.42 ? 281  PHE A CG  1 
ATOM   1786  C  CD1 . PHE A  1  253 ? 21.829  67.681  51.801  1.00 60.84 ? 281  PHE A CD1 1 
ATOM   1787  C  CD2 . PHE A  1  253 ? 21.694  66.461  53.859  1.00 61.36 ? 281  PHE A CD2 1 
ATOM   1788  C  CE1 . PHE A  1  253 ? 20.431  67.723  51.729  1.00 60.56 ? 281  PHE A CE1 1 
ATOM   1789  C  CE2 . PHE A  1  253 ? 20.296  66.497  53.796  1.00 60.92 ? 281  PHE A CE2 1 
ATOM   1790  C  CZ  . PHE A  1  253 ? 19.665  67.130  52.729  1.00 60.82 ? 281  PHE A CZ  1 
ATOM   1791  N  N   . GLU A  1  254 ? 23.843  68.750  55.477  1.00 61.57 ? 282  GLU A N   1 
ATOM   1792  C  CA  . GLU A  1  254 ? 23.087  69.348  56.566  1.00 61.16 ? 282  GLU A CA  1 
ATOM   1793  C  C   . GLU A  1  254 ? 23.562  70.765  56.793  1.00 61.43 ? 282  GLU A C   1 
ATOM   1794  O  O   . GLU A  1  254 ? 22.788  71.630  57.194  1.00 60.84 ? 282  GLU A O   1 
ATOM   1795  C  CB  . GLU A  1  254 ? 23.261  68.523  57.833  1.00 61.48 ? 282  GLU A CB  1 
ATOM   1796  C  CG  . GLU A  1  254 ? 23.034  67.040  57.604  1.00 63.57 ? 282  GLU A CG  1 
ATOM   1797  C  CD  . GLU A  1  254 ? 22.741  66.272  58.883  1.00 64.50 ? 282  GLU A CD  1 
ATOM   1798  O  OE1 . GLU A  1  254 ? 22.799  65.018  58.861  1.00 64.01 ? 282  GLU A OE1 1 
ATOM   1799  O  OE2 . GLU A  1  254 ? 22.439  66.923  59.908  1.00 65.44 ? 282  GLU A OE2 1 
ATOM   1800  N  N   . ALA A  1  255 ? 24.846  70.988  56.524  1.00 62.78 ? 283  ALA A N   1 
ATOM   1801  C  CA  . ALA A  1  255 ? 25.466  72.303  56.678  1.00 62.65 ? 283  ALA A CA  1 
ATOM   1802  C  C   . ALA A  1  255 ? 24.881  73.276  55.659  1.00 63.27 ? 283  ALA A C   1 
ATOM   1803  O  O   . ALA A  1  255 ? 24.631  74.452  55.974  1.00 63.07 ? 283  ALA A O   1 
ATOM   1804  C  CB  . ALA A  1  255 ? 26.975  72.193  56.485  1.00 62.08 ? 283  ALA A CB  1 
ATOM   1805  N  N   . GLY A  1  256 ? 24.682  72.768  54.438  1.00 63.48 ? 284  GLY A N   1 
ATOM   1806  C  CA  . GLY A  1  256 ? 24.116  73.554  53.347  1.00 64.01 ? 284  GLY A CA  1 
ATOM   1807  C  C   . GLY A  1  256 ? 24.986  73.697  52.105  1.00 63.85 ? 284  GLY A C   1 
ATOM   1808  O  O   . GLY A  1  256 ? 24.648  74.445  51.189  1.00 63.95 ? 284  GLY A O   1 
ATOM   1809  N  N   . LEU A  1  257 ? 26.096  72.971  52.057  1.00 64.84 ? 285  LEU A N   1 
ATOM   1810  C  CA  . LEU A  1  257 ? 27.019  73.066  50.933  1.00 65.08 ? 285  LEU A CA  1 
ATOM   1811  C  C   . LEU A  1  257 ? 26.972  71.851  50.007  1.00 66.04 ? 285  LEU A C   1 
ATOM   1812  O  O   . LEU A  1  257 ? 28.015  71.353  49.572  1.00 67.21 ? 285  LEU A O   1 
ATOM   1813  C  CB  . LEU A  1  257 ? 28.447  73.248  51.457  1.00 64.72 ? 285  LEU A CB  1 
ATOM   1814  C  CG  . LEU A  1  257 ? 29.408  74.030  50.565  1.00 64.90 ? 285  LEU A CG  1 
ATOM   1815  C  CD1 . LEU A  1  257 ? 28.983  75.509  50.574  1.00 64.95 ? 285  LEU A CD1 1 
ATOM   1816  C  CD2 . LEU A  1  257 ? 30.853  73.852  51.053  1.00 64.74 ? 285  LEU A CD2 1 
ATOM   1817  N  N   . VAL A  1  258 ? 25.773  71.358  49.722  1.00 65.85 ? 286  VAL A N   1 
ATOM   1818  C  CA  . VAL A  1  258 ? 25.615  70.219  48.820  1.00 66.95 ? 286  VAL A CA  1 
ATOM   1819  C  C   . VAL A  1  258 ? 24.274  70.387  48.113  1.00 68.32 ? 286  VAL A C   1 
ATOM   1820  O  O   . VAL A  1  258 ? 23.259  69.840  48.556  1.00 68.40 ? 286  VAL A O   1 
ATOM   1821  C  CB  . VAL A  1  258 ? 25.650  68.851  49.582  1.00 66.93 ? 286  VAL A CB  1 
ATOM   1822  C  CG1 . VAL A  1  258 ? 25.403  67.683  48.602  1.00 65.24 ? 286  VAL A CG1 1 
ATOM   1823  C  CG2 . VAL A  1  258 ? 27.001  68.675  50.279  1.00 66.46 ? 286  VAL A CG2 1 
ATOM   1824  N  N   . ASN A  1  259 ? 24.276  71.161  47.023  1.00 68.75 ? 287  ASN A N   1 
ATOM   1825  C  CA  . ASN A  1  259 ? 23.060  71.419  46.257  1.00 68.06 ? 287  ASN A CA  1 
ATOM   1826  C  C   . ASN A  1  259 ? 22.633  70.172  45.493  1.00 69.32 ? 287  ASN A C   1 
ATOM   1827  O  O   . ASN A  1  259 ? 23.078  69.930  44.367  1.00 69.56 ? 287  ASN A O   1 
ATOM   1828  C  CB  . ASN A  1  259 ? 23.281  72.571  45.284  1.00 68.50 ? 287  ASN A CB  1 
ATOM   1829  C  CG  . ASN A  1  259 ? 21.986  73.052  44.655  1.00 69.72 ? 287  ASN A CG  1 
ATOM   1830  O  OD1 . ASN A  1  259 ? 21.380  72.369  43.821  1.00 70.30 ? 287  ASN A OD1 1 
ATOM   1831  N  ND2 . ASN A  1  259 ? 21.547  74.234  45.064  1.00 69.59 ? 287  ASN A ND2 1 
ATOM   1832  N  N   . VAL A  1  260 ? 21.756  69.390  46.117  1.00 70.34 ? 288  VAL A N   1 
ATOM   1833  C  CA  . VAL A  1  260 ? 21.267  68.146  45.537  1.00 70.56 ? 288  VAL A CA  1 
ATOM   1834  C  C   . VAL A  1  260 ? 20.291  68.304  44.385  1.00 70.88 ? 288  VAL A C   1 
ATOM   1835  O  O   . VAL A  1  260 ? 19.425  69.186  44.384  1.00 71.00 ? 288  VAL A O   1 
ATOM   1836  C  CB  . VAL A  1  260 ? 20.590  67.261  46.604  1.00 69.61 ? 288  VAL A CB  1 
ATOM   1837  C  CG1 . VAL A  1  260 ? 19.943  66.067  45.954  1.00 69.52 ? 288  VAL A CG1 1 
ATOM   1838  C  CG2 . VAL A  1  260 ? 21.615  66.797  47.609  1.00 70.42 ? 288  VAL A CG2 1 
ATOM   1839  N  N   . VAL A  1  261 ? 20.460  67.429  43.401  1.00 71.05 ? 289  VAL A N   1 
ATOM   1840  C  CA  . VAL A  1  261 ? 19.604  67.376  42.232  1.00 71.38 ? 289  VAL A CA  1 
ATOM   1841  C  C   . VAL A  1  261 ? 18.808  66.101  42.467  1.00 72.35 ? 289  VAL A C   1 
ATOM   1842  O  O   . VAL A  1  261 ? 19.372  64.999  42.521  1.00 71.81 ? 289  VAL A O   1 
ATOM   1843  C  CB  . VAL A  1  261 ? 20.426  67.248  40.951  1.00 71.38 ? 289  VAL A CB  1 
ATOM   1844  C  CG1 . VAL A  1  261 ? 19.512  67.256  39.747  1.00 71.52 ? 289  VAL A CG1 1 
ATOM   1845  C  CG2 . VAL A  1  261 ? 21.433  68.389  40.876  1.00 71.74 ? 289  VAL A CG2 1 
ATOM   1846  N  N   . LEU A  1  262 ? 17.502  66.264  42.640  1.00 72.92 ? 290  LEU A N   1 
ATOM   1847  C  CA  . LEU A  1  262 ? 16.615  65.140  42.915  1.00 74.12 ? 290  LEU A CA  1 
ATOM   1848  C  C   . LEU A  1  262 ? 16.317  64.275  41.694  1.00 74.46 ? 290  LEU A C   1 
ATOM   1849  O  O   . LEU A  1  262 ? 15.687  64.726  40.726  1.00 73.83 ? 290  LEU A O   1 
ATOM   1850  C  CB  . LEU A  1  262 ? 15.309  65.658  43.513  1.00 74.49 ? 290  LEU A CB  1 
ATOM   1851  C  CG  . LEU A  1  262 ? 15.487  66.649  44.666  1.00 74.41 ? 290  LEU A CG  1 
ATOM   1852  C  CD1 . LEU A  1  262 ? 14.145  67.270  44.989  1.00 75.36 ? 290  LEU A CD1 1 
ATOM   1853  C  CD2 . LEU A  1  262 ? 16.068  65.957  45.884  1.00 74.37 ? 290  LEU A CD2 1 
ATOM   1854  N  N   . ILE A  1  263 ? 16.772  63.026  41.753  1.00 74.84 ? 291  ILE A N   1 
ATOM   1855  C  CA  . ILE A  1  263 ? 16.560  62.085  40.661  1.00 75.01 ? 291  ILE A CA  1 
ATOM   1856  C  C   . ILE A  1  263 ? 15.179  61.441  40.804  1.00 74.66 ? 291  ILE A C   1 
ATOM   1857  O  O   . ILE A  1  263 ? 14.884  60.790  41.803  1.00 74.08 ? 291  ILE A O   1 
ATOM   1858  C  CB  . ILE A  1  263 ? 17.636  60.960  40.650  1.00 74.33 ? 291  ILE A CB  1 
ATOM   1859  C  CG1 . ILE A  1  263 ? 18.857  61.362  41.487  1.00 74.20 ? 291  ILE A CG1 1 
ATOM   1860  C  CG2 . ILE A  1  263 ? 18.082  60.690  39.218  1.00 74.23 ? 291  ILE A CG2 1 
ATOM   1861  C  CD1 . ILE A  1  263 ? 19.699  62.466  40.883  1.00 74.28 ? 291  ILE A CD1 1 
ATOM   1862  N  N   . PRO A  1  264 ? 14.302  61.643  39.812  1.00 75.32 ? 292  PRO A N   1 
ATOM   1863  C  CA  . PRO A  1  264 ? 12.958  61.055  39.865  1.00 74.89 ? 292  PRO A CA  1 
ATOM   1864  C  C   . PRO A  1  264 ? 13.087  59.533  39.975  1.00 75.14 ? 292  PRO A C   1 
ATOM   1865  O  O   . PRO A  1  264 ? 13.892  58.924  39.271  1.00 74.94 ? 292  PRO A O   1 
ATOM   1866  C  CB  . PRO A  1  264 ? 12.344  61.494  38.542  1.00 75.73 ? 292  PRO A CB  1 
ATOM   1867  C  CG  . PRO A  1  264 ? 13.045  62.821  38.272  1.00 75.95 ? 292  PRO A CG  1 
ATOM   1868  C  CD  . PRO A  1  264 ? 14.467  62.499  38.622  1.00 75.00 ? 292  PRO A CD  1 
ATOM   1869  N  N   . ASP A  1  265 ? 12.303  58.922  40.857  1.00 75.93 ? 293  ASP A N   1 
ATOM   1870  C  CA  . ASP A  1  265 ? 12.381  57.477  41.056  1.00 75.81 ? 293  ASP A CA  1 
ATOM   1871  C  C   . ASP A  1  265 ? 11.441  56.711  40.150  1.00 75.61 ? 293  ASP A C   1 
ATOM   1872  O  O   . ASP A  1  265 ? 11.486  55.482  40.095  1.00 75.24 ? 293  ASP A O   1 
ATOM   1873  C  CB  . ASP A  1  265 ? 12.110  57.127  42.527  1.00 74.55 ? 293  ASP A CB  1 
ATOM   1874  C  CG  . ASP A  1  265 ? 10.710  57.511  42.977  1.00 74.94 ? 293  ASP A CG  1 
ATOM   1875  O  OD1 . ASP A  1  265 ? 10.181  58.544  42.508  1.00 75.60 ? 293  ASP A OD1 1 
ATOM   1876  O  OD2 . ASP A  1  265 ? 10.143  56.785  43.818  1.00 73.86 ? 293  ASP A OD2 1 
ATOM   1877  N  N   . ASN A  1  266 ? 10.595  57.443  39.436  1.00 74.94 ? 294  ASN A N   1 
ATOM   1878  C  CA  . ASN A  1  266 ? 9.649   56.825  38.521  1.00 76.38 ? 294  ASN A CA  1 
ATOM   1879  C  C   . ASN A  1  266 ? 9.557   57.698  37.272  1.00 76.10 ? 294  ASN A C   1 
ATOM   1880  O  O   . ASN A  1  266 ? 10.253  58.707  37.157  1.00 75.85 ? 294  ASN A O   1 
ATOM   1881  C  CB  . ASN A  1  266 ? 8.262   56.693  39.182  1.00 78.04 ? 294  ASN A CB  1 
ATOM   1882  C  CG  . ASN A  1  266 ? 7.539   55.400  38.796  1.00 79.05 ? 294  ASN A CG  1 
ATOM   1883  O  OD1 . ASN A  1  266 ? 7.770   54.840  37.726  1.00 78.17 ? 294  ASN A OD1 1 
ATOM   1884  N  ND2 . ASN A  1  266 ? 6.650   54.931  39.667  1.00 81.74 ? 294  ASN A ND2 1 
ATOM   1885  N  N   . GLY A  1  267 ? 8.688   57.304  36.347  1.00 75.99 ? 295  GLY A N   1 
ATOM   1886  C  CA  . GLY A  1  267 ? 8.500   58.037  35.108  1.00 75.68 ? 295  GLY A CA  1 
ATOM   1887  C  C   . GLY A  1  267 ? 8.166   57.022  34.036  1.00 75.59 ? 295  GLY A C   1 
ATOM   1888  O  O   . GLY A  1  267 ? 8.091   55.827  34.328  1.00 75.51 ? 295  GLY A O   1 
ATOM   1889  N  N   . THR A  1  268 ? 7.969   57.467  32.801  1.00 75.38 ? 296  THR A N   1 
ATOM   1890  C  CA  . THR A  1  268 ? 7.652   56.521  31.738  1.00 75.12 ? 296  THR A CA  1 
ATOM   1891  C  C   . THR A  1  268 ? 8.539   56.651  30.493  1.00 75.21 ? 296  THR A C   1 
ATOM   1892  O  O   . THR A  1  268 ? 9.343   57.577  30.365  1.00 75.19 ? 296  THR A O   1 
ATOM   1893  C  CB  . THR A  1  268 ? 6.179   56.633  31.328  1.00 74.83 ? 296  THR A CB  1 
ATOM   1894  O  OG1 . THR A  1  268 ? 5.959   57.878  30.659  1.00 74.67 ? 296  THR A OG1 1 
ATOM   1895  C  CG2 . THR A  1  268 ? 5.290   56.561  32.558  1.00 74.41 ? 296  THR A CG2 1 
ATOM   1896  N  N   . GLY A  1  269 ? 8.388   55.706  29.577  1.00 74.54 ? 297  GLY A N   1 
ATOM   1897  C  CA  . GLY A  1  269 ? 9.193   55.723  28.376  1.00 73.69 ? 297  GLY A CA  1 
ATOM   1898  C  C   . GLY A  1  269 ? 10.117  54.532  28.441  1.00 72.98 ? 297  GLY A C   1 
ATOM   1899  O  O   . GLY A  1  269 ? 9.984   53.692  29.330  1.00 72.96 ? 297  GLY A O   1 
ATOM   1900  N  N   . GLY A  1  270 ? 11.050  54.455  27.503  1.00 72.37 ? 298  GLY A N   1 
ATOM   1901  C  CA  . GLY A  1  270 ? 11.986  53.347  27.481  1.00 72.24 ? 298  GLY A CA  1 
ATOM   1902  C  C   . GLY A  1  270 ? 12.990  53.390  28.618  1.00 72.96 ? 298  GLY A C   1 
ATOM   1903  O  O   . GLY A  1  270 ? 13.590  52.366  28.961  1.00 73.12 ? 298  GLY A O   1 
ATOM   1904  N  N   . SER A  1  271 ? 13.182  54.573  29.201  1.00 73.47 ? 299  SER A N   1 
ATOM   1905  C  CA  . SER A  1  271 ? 14.120  54.748  30.310  1.00 72.43 ? 299  SER A CA  1 
ATOM   1906  C  C   . SER A  1  271 ? 13.584  54.148  31.620  1.00 72.75 ? 299  SER A C   1 
ATOM   1907  O  O   . SER A  1  271 ? 14.339  53.929  32.575  1.00 71.68 ? 299  SER A O   1 
ATOM   1908  C  CB  . SER A  1  271 ? 14.453  56.242  30.486  1.00 71.95 ? 299  SER A CB  1 
ATOM   1909  O  OG  . SER A  1  271 ? 13.341  57.078  30.192  1.00 72.10 ? 299  SER A OG  1 
ATOM   1910  N  N   . TRP A  1  272 ? 12.281  53.867  31.647  1.00 72.70 ? 300  TRP A N   1 
ATOM   1911  C  CA  . TRP A  1  272 ? 11.645  53.286  32.821  1.00 71.63 ? 300  TRP A CA  1 
ATOM   1912  C  C   . TRP A  1  272 ? 11.034  51.920  32.536  1.00 72.15 ? 300  TRP A C   1 
ATOM   1913  O  O   . TRP A  1  272 ? 11.176  51.002  33.341  1.00 72.92 ? 300  TRP A O   1 
ATOM   1914  C  CB  . TRP A  1  272 ? 10.580  54.237  33.372  1.00 70.67 ? 300  TRP A CB  1 
ATOM   1915  C  CG  . TRP A  1  272 ? 11.157  55.555  33.729  1.00 70.78 ? 300  TRP A CG  1 
ATOM   1916  C  CD1 . TRP A  1  272 ? 11.149  56.689  32.969  1.00 71.83 ? 300  TRP A CD1 1 
ATOM   1917  C  CD2 . TRP A  1  272 ? 11.947  55.850  34.880  1.00 70.63 ? 300  TRP A CD2 1 
ATOM   1918  N  NE1 . TRP A  1  272 ? 11.893  57.673  33.573  1.00 71.74 ? 300  TRP A NE1 1 
ATOM   1919  C  CE2 . TRP A  1  272 ? 12.397  57.182  34.748  1.00 70.82 ? 300  TRP A CE2 1 
ATOM   1920  C  CE3 . TRP A  1  272 ? 12.324  55.115  36.010  1.00 70.48 ? 300  TRP A CE3 1 
ATOM   1921  C  CZ2 . TRP A  1  272 ? 13.207  57.794  35.702  1.00 71.20 ? 300  TRP A CZ2 1 
ATOM   1922  C  CZ3 . TRP A  1  272 ? 13.127  55.721  36.957  1.00 71.12 ? 300  TRP A CZ3 1 
ATOM   1923  C  CH2 . TRP A  1  272 ? 13.562  57.051  36.797  1.00 72.10 ? 300  TRP A CH2 1 
ATOM   1924  N  N   . SER A  1  273 ? 10.365  51.778  31.393  1.00 71.70 ? 301  SER A N   1 
ATOM   1925  C  CA  . SER A  1  273 ? 9.739   50.511  31.030  1.00 71.59 ? 301  SER A CA  1 
ATOM   1926  C  C   . SER A  1  273 ? 10.569  49.712  30.040  1.00 71.57 ? 301  SER A C   1 
ATOM   1927  O  O   . SER A  1  273 ? 11.543  50.203  29.488  1.00 71.91 ? 301  SER A O   1 
ATOM   1928  C  CB  . SER A  1  273 ? 8.354   50.758  30.432  1.00 72.74 ? 301  SER A CB  1 
ATOM   1929  O  OG  . SER A  1  273 ? 7.795   49.558  29.920  1.00 73.74 ? 301  SER A OG  1 
ATOM   1930  N  N   . LEU A  1  274 ? 10.172  48.467  29.824  1.00 72.72 ? 302  LEU A N   1 
ATOM   1931  C  CA  . LEU A  1  274 ? 10.857  47.591  28.883  1.00 73.09 ? 302  LEU A CA  1 
ATOM   1932  C  C   . LEU A  1  274 ? 9.759   46.937  28.062  1.00 72.60 ? 302  LEU A C   1 
ATOM   1933  O  O   . LEU A  1  274 ? 9.992   46.356  27.000  1.00 72.82 ? 302  LEU A O   1 
ATOM   1934  C  CB  . LEU A  1  274 ? 11.668  46.536  29.641  1.00 73.29 ? 302  LEU A CB  1 
ATOM   1935  C  CG  . LEU A  1  274 ? 12.605  45.639  28.825  1.00 72.89 ? 302  LEU A CG  1 
ATOM   1936  C  CD1 . LEU A  1  274 ? 13.439  46.480  27.874  1.00 73.00 ? 302  LEU A CD1 1 
ATOM   1937  C  CD2 . LEU A  1  274 ? 13.502  44.858  29.769  1.00 73.03 ? 302  LEU A CD2 1 
ATOM   1938  N  N   . LYS A  1  275 ? 8.544   47.057  28.578  1.00 72.69 ? 303  LYS A N   1 
ATOM   1939  C  CA  . LYS A  1  275 ? 7.376   46.504  27.926  1.00 73.55 ? 303  LYS A CA  1 
ATOM   1940  C  C   . LYS A  1  275 ? 6.778   47.511  26.970  1.00 73.01 ? 303  LYS A C   1 
ATOM   1941  O  O   . LYS A  1  275 ? 6.434   48.627  27.362  1.00 71.92 ? 303  LYS A O   1 
ATOM   1942  C  CB  . LYS A  1  275 ? 6.318   46.123  28.954  1.00 74.57 ? 303  LYS A CB  1 
ATOM   1943  C  CG  . LYS A  1  275 ? 4.995   45.732  28.327  1.00 75.24 ? 303  LYS A CG  1 
ATOM   1944  C  CD  . LYS A  1  275 ? 3.943   45.484  29.383  1.00 75.99 ? 303  LYS A CD  1 
ATOM   1945  C  CE  . LYS A  1  275 ? 2.609   45.148  28.738  1.00 76.76 ? 303  LYS A CE  1 
ATOM   1946  N  NZ  . LYS A  1  275 ? 1.535   44.987  29.755  1.00 77.22 ? 303  LYS A NZ  1 
ATOM   1947  N  N   . SER A  1  276 ? 6.647   47.103  25.716  1.00 73.38 ? 304  SER A N   1 
ATOM   1948  C  CA  . SER A  1  276 ? 6.076   47.973  24.710  1.00 73.46 ? 304  SER A CA  1 
ATOM   1949  C  C   . SER A  1  276 ? 4.645   48.332  25.113  1.00 73.91 ? 304  SER A C   1 
ATOM   1950  O  O   . SER A  1  276 ? 3.912   47.493  25.636  1.00 73.49 ? 304  SER A O   1 
ATOM   1951  C  CB  . SER A  1  276 ? 6.073   47.269  23.352  1.00 73.54 ? 304  SER A CB  1 
ATOM   1952  O  OG  . SER A  1  276 ? 5.607   48.138  22.331  1.00 72.88 ? 304  SER A OG  1 
ATOM   1953  N  N   . PRO A  1  277 ? 4.247   49.600  24.908  1.00 74.09 ? 305  PRO A N   1 
ATOM   1954  C  CA  . PRO A  1  277 ? 2.906   50.096  25.230  1.00 73.32 ? 305  PRO A CA  1 
ATOM   1955  C  C   . PRO A  1  277 ? 1.919   49.635  24.157  1.00 74.15 ? 305  PRO A C   1 
ATOM   1956  O  O   . PRO A  1  277 ? 0.816   49.181  24.458  1.00 74.13 ? 305  PRO A O   1 
ATOM   1957  C  CB  . PRO A  1  277 ? 3.083   51.612  25.205  1.00 73.15 ? 305  PRO A CB  1 
ATOM   1958  C  CG  . PRO A  1  277 ? 4.522   51.805  25.523  1.00 73.54 ? 305  PRO A CG  1 
ATOM   1959  C  CD  . PRO A  1  277 ? 5.163   50.731  24.693  1.00 74.43 ? 305  PRO A CD  1 
ATOM   1960  N  N   . VAL A  1  278 ? 2.340   49.761  22.902  1.00 74.21 ? 306  VAL A N   1 
ATOM   1961  C  CA  . VAL A  1  278 ? 1.533   49.377  21.747  1.00 74.36 ? 306  VAL A CA  1 
ATOM   1962  C  C   . VAL A  1  278 ? 1.237   47.876  21.693  1.00 74.13 ? 306  VAL A C   1 
ATOM   1963  O  O   . VAL A  1  278 ? 2.147   47.043  21.667  1.00 74.27 ? 306  VAL A O   1 
ATOM   1964  C  CB  . VAL A  1  278 ? 2.228   49.784  20.425  1.00 74.67 ? 306  VAL A CB  1 
ATOM   1965  C  CG1 . VAL A  1  278 ? 2.389   51.299  20.360  1.00 74.32 ? 306  VAL A CG1 1 
ATOM   1966  C  CG2 . VAL A  1  278 ? 3.586   49.106  20.323  1.00 74.97 ? 306  VAL A CG2 1 
ATOM   1967  N  N   . PRO A  1  279 ? -0.054  47.516  21.653  1.00 75.16 ? 307  PRO A N   1 
ATOM   1968  C  CA  . PRO A  1  279 ? -0.488  46.114  21.601  1.00 75.15 ? 307  PRO A CA  1 
ATOM   1969  C  C   . PRO A  1  279 ? 0.018   45.336  20.384  1.00 74.92 ? 307  PRO A C   1 
ATOM   1970  O  O   . PRO A  1  279 ? 0.479   45.932  19.399  1.00 74.88 ? 307  PRO A O   1 
ATOM   1971  C  CB  . PRO A  1  279 ? -2.018  46.224  21.637  1.00 74.93 ? 307  PRO A CB  1 
ATOM   1972  C  CG  . PRO A  1  279 ? -2.289  47.567  21.002  1.00 74.18 ? 307  PRO A CG  1 
ATOM   1973  C  CD  . PRO A  1  279 ? -1.212  48.430  21.616  1.00 74.94 ? 307  PRO A CD  1 
ATOM   1974  N  N   . PRO A  1  280 ? -0.047  43.991  20.448  1.00 74.31 ? 308  PRO A N   1 
ATOM   1975  C  CA  . PRO A  1  280 ? 0.400   43.128  19.351  1.00 73.93 ? 308  PRO A CA  1 
ATOM   1976  C  C   . PRO A  1  280 ? -0.407  43.369  18.092  1.00 72.70 ? 308  PRO A C   1 
ATOM   1977  O  O   . PRO A  1  280 ? -1.622  43.513  18.152  1.00 73.25 ? 308  PRO A O   1 
ATOM   1978  C  CB  . PRO A  1  280 ? 0.199   41.726  19.915  1.00 73.48 ? 308  PRO A CB  1 
ATOM   1979  C  CG  . PRO A  1  280 ? 0.496   41.918  21.361  1.00 73.94 ? 308  PRO A CG  1 
ATOM   1980  C  CD  . PRO A  1  280 ? -0.288  43.188  21.659  1.00 73.89 ? 308  PRO A CD  1 
ATOM   1981  N  N   . GLY A  1  281 ? 0.279   43.430  16.956  1.00 73.26 ? 309  GLY A N   1 
ATOM   1982  C  CA  . GLY A  1  281 ? -0.397  43.651  15.691  1.00 73.19 ? 309  GLY A CA  1 
ATOM   1983  C  C   . GLY A  1  281 ? -0.228  42.443  14.793  1.00 72.28 ? 309  GLY A C   1 
ATOM   1984  O  O   . GLY A  1  281 ? 0.267   41.413  15.248  1.00 72.87 ? 309  GLY A O   1 
ATOM   1985  N  N   . PRO A  1  282 ? -0.625  42.531  13.516  1.00 71.35 ? 310  PRO A N   1 
ATOM   1986  C  CA  . PRO A  1  282 ? -0.483  41.394  12.606  1.00 70.38 ? 310  PRO A CA  1 
ATOM   1987  C  C   . PRO A  1  282 ? 0.791   40.656  12.959  1.00 71.11 ? 310  PRO A C   1 
ATOM   1988  O  O   . PRO A  1  282 ? 1.839   41.276  13.102  1.00 72.61 ? 310  PRO A O   1 
ATOM   1989  C  CB  . PRO A  1  282 ? -0.394  42.064  11.248  1.00 70.76 ? 310  PRO A CB  1 
ATOM   1990  C  CG  . PRO A  1  282 ? -1.302  43.233  11.411  1.00 71.14 ? 310  PRO A CG  1 
ATOM   1991  C  CD  . PRO A  1  282 ? -0.933  43.763  12.774  1.00 71.87 ? 310  PRO A CD  1 
ATOM   1992  N  N   . ALA A  1  283 ? 0.711   39.345  13.124  1.00 70.77 ? 311  ALA A N   1 
ATOM   1993  C  CA  . ALA A  1  283 ? 1.893   38.580  13.488  1.00 70.30 ? 311  ALA A CA  1 
ATOM   1994  C  C   . ALA A  1  283 ? 2.981   38.661  12.425  1.00 70.85 ? 311  ALA A C   1 
ATOM   1995  O  O   . ALA A  1  283 ? 2.699   38.727  11.224  1.00 68.79 ? 311  ALA A O   1 
ATOM   1996  C  CB  . ALA A  1  283 ? 1.527   37.136  13.756  1.00 70.20 ? 311  ALA A CB  1 
ATOM   1997  N  N   . PRO A  1  284 ? 4.247   38.661  12.868  1.00 70.97 ? 312  PRO A N   1 
ATOM   1998  C  CA  . PRO A  1  284 ? 5.454   38.728  12.045  1.00 70.43 ? 312  PRO A CA  1 
ATOM   1999  C  C   . PRO A  1  284 ? 5.706   37.400  11.367  1.00 70.73 ? 312  PRO A C   1 
ATOM   2000  O  O   . PRO A  1  284 ? 5.372   36.345  11.905  1.00 71.40 ? 312  PRO A O   1 
ATOM   2001  C  CB  . PRO A  1  284 ? 6.534   39.071  13.054  1.00 70.58 ? 312  PRO A CB  1 
ATOM   2002  C  CG  . PRO A  1  284 ? 6.106   38.292  14.225  1.00 70.43 ? 312  PRO A CG  1 
ATOM   2003  C  CD  . PRO A  1  284 ? 4.621   38.602  14.293  1.00 70.82 ? 312  PRO A CD  1 
ATOM   2004  N  N   . PRO A  1  285 ? 6.347   37.428  10.199  1.00 70.08 ? 313  PRO A N   1 
ATOM   2005  C  CA  . PRO A  1  285 ? 6.625   36.192  9.480   1.00 70.19 ? 313  PRO A CA  1 
ATOM   2006  C  C   . PRO A  1  285 ? 7.408   35.242  10.372  1.00 70.26 ? 313  PRO A C   1 
ATOM   2007  O  O   . PRO A  1  285 ? 7.866   35.624  11.446  1.00 70.38 ? 313  PRO A O   1 
ATOM   2008  C  CB  . PRO A  1  285 ? 7.445   36.676  8.302   1.00 71.17 ? 313  PRO A CB  1 
ATOM   2009  C  CG  . PRO A  1  285 ? 8.297   37.726  8.953   1.00 70.92 ? 313  PRO A CG  1 
ATOM   2010  C  CD  . PRO A  1  285 ? 7.273   38.495  9.761   1.00 70.78 ? 313  PRO A CD  1 
ATOM   2011  N  N   . LEU A  1  286 ? 7.555   34.004  9.926   1.00 70.53 ? 314  LEU A N   1 
ATOM   2012  C  CA  . LEU A  1  286 ? 8.311   33.016  10.677  1.00 70.37 ? 314  LEU A CA  1 
ATOM   2013  C  C   . LEU A  1  286 ? 8.530   31.766  9.843   1.00 70.90 ? 314  LEU A C   1 
ATOM   2014  O  O   . LEU A  1  286 ? 7.721   31.422  8.978   1.00 70.63 ? 314  LEU A O   1 
ATOM   2015  C  CB  . LEU A  1  286 ? 7.587   32.665  11.971  1.00 70.02 ? 314  LEU A CB  1 
ATOM   2016  C  CG  . LEU A  1  286 ? 6.293   31.863  11.839  1.00 69.95 ? 314  LEU A CG  1 
ATOM   2017  C  CD1 . LEU A  1  286 ? 5.662   31.745  13.206  1.00 68.67 ? 314  LEU A CD1 1 
ATOM   2018  C  CD2 . LEU A  1  286 ? 5.340   32.533  10.871  1.00 69.83 ? 314  LEU A CD2 1 
ATOM   2019  N  N   . GLN A  1  287 ? 9.640   31.088  10.107  1.00 71.27 ? 315  GLN A N   1 
ATOM   2020  C  CA  . GLN A  1  287 ? 9.977   29.885  9.367   1.00 71.79 ? 315  GLN A CA  1 
ATOM   2021  C  C   . GLN A  1  287 ? 9.357   28.660  9.984   1.00 71.51 ? 315  GLN A C   1 
ATOM   2022  O  O   . GLN A  1  287 ? 8.509   28.762  10.861  1.00 71.86 ? 315  GLN A O   1 
ATOM   2023  C  CB  . GLN A  1  287 ? 11.492  29.698  9.300   1.00 72.65 ? 315  GLN A CB  1 
ATOM   2024  C  CG  . GLN A  1  287 ? 12.166  30.613  8.303   1.00 72.78 ? 315  GLN A CG  1 
ATOM   2025  C  CD  . GLN A  1  287 ? 13.657  30.397  8.234   1.00 72.84 ? 315  GLN A CD  1 
ATOM   2026  O  OE1 . GLN A  1  287 ? 14.325  30.916  7.339   1.00 73.03 ? 315  GLN A OE1 1 
ATOM   2027  N  NE2 . GLN A  1  287 ? 14.194  29.630  9.181   1.00 72.04 ? 315  GLN A NE2 1 
ATOM   2028  N  N   . PHE A  1  288 ? 9.794   27.500  9.507   1.00 72.61 ? 316  PHE A N   1 
ATOM   2029  C  CA  . PHE A  1  288 ? 9.316   26.211  9.986   1.00 71.64 ? 316  PHE A CA  1 
ATOM   2030  C  C   . PHE A  1  288 ? 9.824   25.185  9.000   1.00 71.64 ? 316  PHE A C   1 
ATOM   2031  O  O   . PHE A  1  288 ? 9.857   25.445  7.797   1.00 71.52 ? 316  PHE A O   1 
ATOM   2032  C  CB  . PHE A  1  288 ? 7.791   26.187  10.017  1.00 71.59 ? 316  PHE A CB  1 
ATOM   2033  C  CG  . PHE A  1  288 ? 7.152   26.137  8.657   1.00 71.86 ? 316  PHE A CG  1 
ATOM   2034  C  CD1 . PHE A  1  288 ? 6.906   24.917  8.033   1.00 72.25 ? 316  PHE A CD1 1 
ATOM   2035  C  CD2 . PHE A  1  288 ? 6.778   27.306  8.006   1.00 71.49 ? 316  PHE A CD2 1 
ATOM   2036  C  CE1 . PHE A  1  288 ? 6.294   24.862  6.782   1.00 71.95 ? 316  PHE A CE1 1 
ATOM   2037  C  CE2 . PHE A  1  288 ? 6.164   27.261  6.752   1.00 71.80 ? 316  PHE A CE2 1 
ATOM   2038  C  CZ  . PHE A  1  288 ? 5.922   26.039  6.141   1.00 71.46 ? 316  PHE A CZ  1 
ATOM   2039  N  N   . TYR A  1  289 ? 10.222  24.023  9.495   1.00 71.25 ? 317  TYR A N   1 
ATOM   2040  C  CA  . TYR A  1  289 ? 10.729  22.987  8.609   1.00 72.06 ? 317  TYR A CA  1 
ATOM   2041  C  C   . TYR A  1  289 ? 9.549   22.173  8.098   1.00 72.90 ? 317  TYR A C   1 
ATOM   2042  O  O   . TYR A  1  289 ? 8.953   21.389  8.841   1.00 73.91 ? 317  TYR A O   1 
ATOM   2043  C  CB  . TYR A  1  289 ? 11.696  22.087  9.354   1.00 72.62 ? 317  TYR A CB  1 
ATOM   2044  C  CG  . TYR A  1  289 ? 12.772  22.831  10.096  1.00 73.08 ? 317  TYR A CG  1 
ATOM   2045  C  CD1 . TYR A  1  289 ? 12.451  23.844  10.996  1.00 73.95 ? 317  TYR A CD1 1 
ATOM   2046  C  CD2 . TYR A  1  289 ? 14.103  22.459  9.975   1.00 74.06 ? 317  TYR A CD2 1 
ATOM   2047  C  CE1 . TYR A  1  289 ? 13.424  24.459  11.763  1.00 73.91 ? 317  TYR A CE1 1 
ATOM   2048  C  CE2 . TYR A  1  289 ? 15.087  23.063  10.741  1.00 74.85 ? 317  TYR A CE2 1 
ATOM   2049  C  CZ  . TYR A  1  289 ? 14.738  24.062  11.638  1.00 74.66 ? 317  TYR A CZ  1 
ATOM   2050  O  OH  . TYR A  1  289 ? 15.697  24.633  12.440  1.00 75.33 ? 317  TYR A OH  1 
ATOM   2051  N  N   . PRO A  1  290 ? 9.202   22.355  6.816   1.00 72.19 ? 318  PRO A N   1 
ATOM   2052  C  CA  . PRO A  1  290 ? 8.110   21.711  6.075   1.00 71.96 ? 318  PRO A CA  1 
ATOM   2053  C  C   . PRO A  1  290 ? 8.067   20.190  6.215   1.00 71.39 ? 318  PRO A C   1 
ATOM   2054  O  O   . PRO A  1  290 ? 6.998   19.582  6.251   1.00 70.84 ? 318  PRO A O   1 
ATOM   2055  C  CB  . PRO A  1  290 ? 8.380   22.142  4.637   1.00 72.31 ? 318  PRO A CB  1 
ATOM   2056  C  CG  . PRO A  1  290 ? 9.052   23.474  4.804   1.00 72.14 ? 318  PRO A CG  1 
ATOM   2057  C  CD  . PRO A  1  290 ? 10.018  23.181  5.910   1.00 72.36 ? 318  PRO A CD  1 
ATOM   2058  N  N   . GLN A  1  291 ? 9.248   19.589  6.271   1.00 71.33 ? 319  GLN A N   1 
ATOM   2059  C  CA  . GLN A  1  291 ? 9.386   18.149  6.410   1.00 70.56 ? 319  GLN A CA  1 
ATOM   2060  C  C   . GLN A  1  291 ? 10.284  17.890  7.612   1.00 71.16 ? 319  GLN A C   1 
ATOM   2061  O  O   . GLN A  1  291 ? 11.131  16.992  7.583   1.00 72.38 ? 319  GLN A O   1 
ATOM   2062  C  CB  . GLN A  1  291 ? 10.027  17.553  5.151   1.00 70.39 ? 319  GLN A CB  1 
ATOM   2063  C  CG  . GLN A  1  291 ? 9.227   17.770  3.867   1.00 71.91 ? 319  GLN A CG  1 
ATOM   2064  C  CD  . GLN A  1  291 ? 9.919   17.207  2.617   1.00 72.27 ? 319  GLN A CD  1 
ATOM   2065  O  OE1 . GLN A  1  291 ? 10.186  16.003  2.521   1.00 72.12 ? 319  GLN A OE1 1 
ATOM   2066  N  NE2 . GLN A  1  291 ? 10.204  18.082  1.651   1.00 72.90 ? 319  GLN A NE2 1 
ATOM   2067  N  N   . GLY A  1  292 ? 10.103  18.679  8.668   1.00 70.09 ? 320  GLY A N   1 
ATOM   2068  C  CA  . GLY A  1  292 ? 10.927  18.513  9.849   1.00 69.38 ? 320  GLY A CA  1 
ATOM   2069  C  C   . GLY A  1  292 ? 12.346  19.020  9.636   1.00 68.87 ? 320  GLY A C   1 
ATOM   2070  O  O   . GLY A  1  292 ? 12.719  19.408  8.529   1.00 69.71 ? 320  GLY A O   1 
ATOM   2071  N  N   . PRO A  1  293 ? 13.168  19.020  10.688  1.00 68.07 ? 321  PRO A N   1 
ATOM   2072  C  CA  . PRO A  1  293 ? 14.558  19.475  10.673  1.00 69.59 ? 321  PRO A CA  1 
ATOM   2073  C  C   . PRO A  1  293 ? 15.542  18.527  10.018  1.00 68.88 ? 321  PRO A C   1 
ATOM   2074  O  O   . PRO A  1  293 ? 15.476  17.312  10.202  1.00 68.33 ? 321  PRO A O   1 
ATOM   2075  C  CB  . PRO A  1  293 ? 14.863  19.667  12.148  1.00 69.76 ? 321  PRO A CB  1 
ATOM   2076  C  CG  . PRO A  1  293 ? 14.129  18.530  12.750  1.00 69.46 ? 321  PRO A CG  1 
ATOM   2077  C  CD  . PRO A  1  293 ? 12.786  18.593  12.042  1.00 69.24 ? 321  PRO A CD  1 
ATOM   2078  N  N   . ARG A  1  294 ? 16.474  19.105  9.271   1.00 68.27 ? 322  ARG A N   1 
ATOM   2079  C  CA  . ARG A  1  294 ? 17.483  18.325  8.578   1.00 68.76 ? 322  ARG A CA  1 
ATOM   2080  C  C   . ARG A  1  294 ? 18.730  18.168  9.428   1.00 68.53 ? 322  ARG A C   1 
ATOM   2081  O  O   . ARG A  1  294 ? 19.826  17.963  8.905   1.00 69.91 ? 322  ARG A O   1 
ATOM   2082  C  CB  . ARG A  1  294 ? 17.849  18.986  7.242   1.00 68.45 ? 322  ARG A CB  1 
ATOM   2083  C  CG  . ARG A  1  294 ? 16.705  19.021  6.237   1.00 69.35 ? 322  ARG A CG  1 
ATOM   2084  C  CD  . ARG A  1  294 ? 15.833  20.259  6.376   1.00 68.63 ? 322  ARG A CD  1 
ATOM   2085  N  NE  . ARG A  1  294 ? 16.480  21.438  5.799   1.00 69.33 ? 322  ARG A NE  1 
ATOM   2086  C  CZ  . ARG A  1  294 ? 16.831  21.560  4.518   1.00 68.83 ? 322  ARG A CZ  1 
ATOM   2087  N  NH1 . ARG A  1  294 ? 16.601  20.572  3.661   1.00 68.41 ? 322  ARG A NH1 1 
ATOM   2088  N  NH2 . ARG A  1  294 ? 17.407  22.679  4.089   1.00 68.01 ? 322  ARG A NH2 1 
ATOM   2089  N  N   . PHE A  1  295 ? 18.571  18.257  10.739  1.00 66.80 ? 323  PHE A N   1 
ATOM   2090  C  CA  . PHE A  1  295 ? 19.725  18.132  11.607  1.00 67.72 ? 323  PHE A CA  1 
ATOM   2091  C  C   . PHE A  1  295 ? 19.331  17.556  12.953  1.00 68.03 ? 323  PHE A C   1 
ATOM   2092  O  O   . PHE A  1  295 ? 18.252  17.841  13.474  1.00 67.42 ? 323  PHE A O   1 
ATOM   2093  C  CB  . PHE A  1  295 ? 20.379  19.501  11.795  1.00 67.92 ? 323  PHE A CB  1 
ATOM   2094  C  CG  . PHE A  1  295 ? 19.540  20.468  12.583  1.00 67.81 ? 323  PHE A CG  1 
ATOM   2095  C  CD1 . PHE A  1  295 ? 19.753  20.638  13.948  1.00 66.80 ? 323  PHE A CD1 1 
ATOM   2096  C  CD2 . PHE A  1  295 ? 18.522  21.190  11.964  1.00 67.18 ? 323  PHE A CD2 1 
ATOM   2097  C  CE1 . PHE A  1  295 ? 18.971  21.506  14.682  1.00 66.76 ? 323  PHE A CE1 1 
ATOM   2098  C  CE2 . PHE A  1  295 ? 17.732  22.061  12.688  1.00 66.49 ? 323  PHE A CE2 1 
ATOM   2099  C  CZ  . PHE A  1  295 ? 17.956  22.222  14.054  1.00 67.50 ? 323  PHE A CZ  1 
ATOM   2100  N  N   . SER A  1  296 ? 20.222  16.745  13.513  1.00 67.93 ? 324  SER A N   1 
ATOM   2101  C  CA  . SER A  1  296 ? 19.975  16.112  14.797  1.00 67.80 ? 324  SER A CA  1 
ATOM   2102  C  C   . SER A  1  296 ? 20.911  16.627  15.881  1.00 68.25 ? 324  SER A C   1 
ATOM   2103  O  O   . SER A  1  296 ? 22.038  17.064  15.615  1.00 67.41 ? 324  SER A O   1 
ATOM   2104  C  CB  . SER A  1  296 ? 20.120  14.595  14.678  1.00 68.22 ? 324  SER A CB  1 
ATOM   2105  O  OG  . SER A  1  296 ? 21.444  14.236  14.324  1.00 68.94 ? 324  SER A OG  1 
ATOM   2106  N  N   . VAL A  1  297 ? 20.420  16.563  17.114  1.00 69.43 ? 325  VAL A N   1 
ATOM   2107  C  CA  . VAL A  1  297 ? 21.166  17.016  18.277  1.00 69.25 ? 325  VAL A CA  1 
ATOM   2108  C  C   . VAL A  1  297 ? 21.135  15.951  19.368  1.00 69.21 ? 325  VAL A C   1 
ATOM   2109  O  O   . VAL A  1  297 ? 20.084  15.687  19.964  1.00 68.77 ? 325  VAL A O   1 
ATOM   2110  C  CB  . VAL A  1  297 ? 20.567  18.320  18.855  1.00 67.53 ? 325  VAL A CB  1 
ATOM   2111  C  CG1 . VAL A  1  297 ? 21.442  18.836  19.977  1.00 67.60 ? 325  VAL A CG1 1 
ATOM   2112  C  CG2 . VAL A  1  297 ? 20.432  19.364  17.760  1.00 68.34 ? 325  VAL A CG2 1 
ATOM   2113  N  N   . GLN A  1  298 ? 22.290  15.335  19.611  1.00 69.29 ? 326  GLN A N   1 
ATOM   2114  C  CA  . GLN A  1  298 ? 22.429  14.313  20.646  1.00 69.04 ? 326  GLN A CA  1 
ATOM   2115  C  C   . GLN A  1  298 ? 23.610  14.722  21.526  1.00 68.33 ? 326  GLN A C   1 
ATOM   2116  O  O   . GLN A  1  298 ? 24.770  14.590  21.137  1.00 68.32 ? 326  GLN A O   1 
ATOM   2117  C  CB  . GLN A  1  298 ? 22.698  12.935  20.028  1.00 69.32 ? 326  GLN A CB  1 
ATOM   2118  C  CG  . GLN A  1  298 ? 21.701  12.499  18.963  1.00 70.13 ? 326  GLN A CG  1 
ATOM   2119  C  CD  . GLN A  1  298 ? 22.077  11.167  18.327  1.00 71.75 ? 326  GLN A CD  1 
ATOM   2120  O  OE1 . GLN A  1  298 ? 21.557  10.798  17.268  1.00 72.25 ? 326  GLN A OE1 1 
ATOM   2121  N  NE2 . GLN A  1  298 ? 22.980  10.434  18.978  1.00 72.57 ? 326  GLN A NE2 1 
ATOM   2122  N  N   . GLY A  1  299 ? 23.306  15.234  22.709  1.00 67.41 ? 327  GLY A N   1 
ATOM   2123  C  CA  . GLY A  1  299 ? 24.360  15.656  23.603  1.00 67.78 ? 327  GLY A CA  1 
ATOM   2124  C  C   . GLY A  1  299 ? 24.926  16.988  23.168  1.00 68.07 ? 327  GLY A C   1 
ATOM   2125  O  O   . GLY A  1  299 ? 24.197  17.971  23.036  1.00 68.61 ? 327  GLY A O   1 
ATOM   2126  N  N   . SER A  1  300 ? 26.233  17.026  22.947  1.00 67.98 ? 328  SER A N   1 
ATOM   2127  C  CA  . SER A  1  300 ? 26.881  18.254  22.521  1.00 67.93 ? 328  SER A CA  1 
ATOM   2128  C  C   . SER A  1  300 ? 27.253  18.210  21.035  1.00 67.23 ? 328  SER A C   1 
ATOM   2129  O  O   . SER A  1  300 ? 27.884  19.128  20.517  1.00 66.30 ? 328  SER A O   1 
ATOM   2130  C  CB  . SER A  1  300 ? 28.114  18.514  23.397  1.00 68.08 ? 328  SER A CB  1 
ATOM   2131  O  OG  . SER A  1  300 ? 27.730  18.794  24.739  1.00 67.50 ? 328  SER A OG  1 
ATOM   2132  N  N   . ARG A  1  301 ? 26.847  17.144  20.348  1.00 68.04 ? 329  ARG A N   1 
ATOM   2133  C  CA  . ARG A  1  301 ? 27.143  17.010  18.925  1.00 68.42 ? 329  ARG A CA  1 
ATOM   2134  C  C   . ARG A  1  301 ? 25.911  17.213  18.042  1.00 67.33 ? 329  ARG A C   1 
ATOM   2135  O  O   . ARG A  1  301 ? 24.830  16.680  18.303  1.00 65.60 ? 329  ARG A O   1 
ATOM   2136  C  CB  . ARG A  1  301 ? 27.787  15.643  18.606  1.00 68.24 ? 329  ARG A CB  1 
ATOM   2137  C  CG  . ARG A  1  301 ? 29.231  15.463  19.104  1.00 68.57 ? 329  ARG A CG  1 
ATOM   2138  C  CD  . ARG A  1  301 ? 29.966  14.337  18.358  1.00 69.16 ? 329  ARG A CD  1 
ATOM   2139  N  NE  . ARG A  1  301 ? 30.357  14.719  16.994  1.00 71.85 ? 329  ARG A NE  1 
ATOM   2140  C  CZ  . ARG A  1  301 ? 31.431  15.454  16.682  1.00 71.92 ? 329  ARG A CZ  1 
ATOM   2141  N  NH1 . ARG A  1  301 ? 32.245  15.897  17.636  1.00 70.23 ? 329  ARG A NH1 1 
ATOM   2142  N  NH2 . ARG A  1  301 ? 31.696  15.750  15.409  1.00 70.98 ? 329  ARG A NH2 1 
ATOM   2143  N  N   . VAL A  1  302 ? 26.100  18.018  17.002  1.00 67.99 ? 330  VAL A N   1 
ATOM   2144  C  CA  . VAL A  1  302 ? 25.061  18.326  16.029  1.00 67.13 ? 330  VAL A CA  1 
ATOM   2145  C  C   . VAL A  1  302 ? 25.571  17.722  14.738  1.00 66.37 ? 330  VAL A C   1 
ATOM   2146  O  O   . VAL A  1  302 ? 26.781  17.580  14.551  1.00 65.39 ? 330  VAL A O   1 
ATOM   2147  C  CB  . VAL A  1  302 ? 24.897  19.865  15.814  1.00 67.04 ? 330  VAL A CB  1 
ATOM   2148  C  CG1 . VAL A  1  302 ? 23.856  20.147  14.737  1.00 66.19 ? 330  VAL A CG1 1 
ATOM   2149  C  CG2 . VAL A  1  302 ? 24.487  20.536  17.106  1.00 67.00 ? 330  VAL A CG2 1 
ATOM   2150  N  N   . ALA A  1  303 ? 24.652  17.359  13.853  1.00 66.60 ? 331  ALA A N   1 
ATOM   2151  C  CA  . ALA A  1  303 ? 25.025  16.785  12.566  1.00 66.98 ? 331  ALA A CA  1 
ATOM   2152  C  C   . ALA A  1  303 ? 23.914  16.959  11.532  1.00 67.26 ? 331  ALA A C   1 
ATOM   2153  O  O   . ALA A  1  303 ? 22.733  16.735  11.820  1.00 67.23 ? 331  ALA A O   1 
ATOM   2154  C  CB  . ALA A  1  303 ? 25.362  15.312  12.726  1.00 67.46 ? 331  ALA A CB  1 
ATOM   2155  N  N   . SER A  1  304 ? 24.304  17.376  10.332  1.00 66.73 ? 332  SER A N   1 
ATOM   2156  C  CA  . SER A  1  304 ? 23.362  17.574  9.239   1.00 66.52 ? 332  SER A CA  1 
ATOM   2157  C  C   . SER A  1  304 ? 24.012  17.000  7.996   1.00 66.59 ? 332  SER A C   1 
ATOM   2158  O  O   . SER A  1  304 ? 25.171  16.580  8.029   1.00 66.87 ? 332  SER A O   1 
ATOM   2159  C  CB  . SER A  1  304 ? 23.090  19.061  9.029   1.00 66.91 ? 332  SER A CB  1 
ATOM   2160  O  OG  . SER A  1  304 ? 24.274  19.739  8.629   1.00 67.76 ? 332  SER A OG  1 
ATOM   2161  N  N   . SER A  1  305 ? 23.272  16.974  6.900   1.00 65.40 ? 333  SER A N   1 
ATOM   2162  C  CA  . SER A  1  305 ? 23.819  16.456  5.662   1.00 64.95 ? 333  SER A CA  1 
ATOM   2163  C  C   . SER A  1  305 ? 25.212  17.035  5.442   1.00 64.71 ? 333  SER A C   1 
ATOM   2164  O  O   . SER A  1  305 ? 26.142  16.325  5.070   1.00 65.61 ? 333  SER A O   1 
ATOM   2165  C  CB  . SER A  1  305 ? 22.909  16.844  4.501   1.00 65.74 ? 333  SER A CB  1 
ATOM   2166  O  OG  . SER A  1  305 ? 22.585  18.226  4.564   1.00 66.24 ? 333  SER A OG  1 
ATOM   2167  N  N   . LEU A  1  306 ? 25.350  18.327  5.712   1.00 64.47 ? 334  LEU A N   1 
ATOM   2168  C  CA  . LEU A  1  306 ? 26.607  19.026  5.515   1.00 63.14 ? 334  LEU A CA  1 
ATOM   2169  C  C   . LEU A  1  306 ? 27.581  19.016  6.672   1.00 63.41 ? 334  LEU A C   1 
ATOM   2170  O  O   . LEU A  1  306 ? 28.710  18.553  6.530   1.00 62.91 ? 334  LEU A O   1 
ATOM   2171  C  CB  . LEU A  1  306 ? 26.325  20.473  5.132   1.00 63.82 ? 334  LEU A CB  1 
ATOM   2172  C  CG  . LEU A  1  306 ? 25.796  20.668  3.714   1.00 64.21 ? 334  LEU A CG  1 
ATOM   2173  C  CD1 . LEU A  1  306 ? 25.332  22.099  3.492   1.00 64.56 ? 334  LEU A CD1 1 
ATOM   2174  C  CD2 . LEU A  1  306 ? 26.901  20.308  2.747   1.00 64.31 ? 334  LEU A CD2 1 
ATOM   2175  N  N   . TRP A  1  307 ? 27.138  19.519  7.821   1.00 64.04 ? 335  TRP A N   1 
ATOM   2176  C  CA  . TRP A  1  307 ? 28.010  19.630  8.991   1.00 63.91 ? 335  TRP A CA  1 
ATOM   2177  C  C   . TRP A  1  307 ? 27.946  18.609  10.135  1.00 63.04 ? 335  TRP A C   1 
ATOM   2178  O  O   . TRP A  1  307 ? 26.947  17.914  10.339  1.00 61.67 ? 335  TRP A O   1 
ATOM   2179  C  CB  . TRP A  1  307 ? 27.868  21.028  9.591   1.00 63.86 ? 335  TRP A CB  1 
ATOM   2180  C  CG  . TRP A  1  307 ? 28.082  22.147  8.613   1.00 63.23 ? 335  TRP A CG  1 
ATOM   2181  C  CD1 . TRP A  1  307 ? 27.147  22.713  7.794   1.00 62.81 ? 335  TRP A CD1 1 
ATOM   2182  C  CD2 . TRP A  1  307 ? 29.301  22.869  8.394   1.00 63.08 ? 335  TRP A CD2 1 
ATOM   2183  N  NE1 . TRP A  1  307 ? 27.706  23.748  7.086   1.00 63.58 ? 335  TRP A NE1 1 
ATOM   2184  C  CE2 . TRP A  1  307 ? 29.027  23.868  7.435   1.00 63.35 ? 335  TRP A CE2 1 
ATOM   2185  C  CE3 . TRP A  1  307 ? 30.598  22.770  8.918   1.00 62.54 ? 335  TRP A CE3 1 
ATOM   2186  C  CZ2 . TRP A  1  307 ? 30.004  24.770  6.987   1.00 62.98 ? 335  TRP A CZ2 1 
ATOM   2187  C  CZ3 . TRP A  1  307 ? 31.569  23.668  8.473   1.00 62.95 ? 335  TRP A CZ3 1 
ATOM   2188  C  CH2 . TRP A  1  307 ? 31.263  24.654  7.516   1.00 62.46 ? 335  TRP A CH2 1 
ATOM   2189  N  N   . THR A  1  308 ? 29.051  18.568  10.881  1.00 62.73 ? 336  THR A N   1 
ATOM   2190  C  CA  . THR A  1  308 ? 29.267  17.683  12.029  1.00 62.77 ? 336  THR A CA  1 
ATOM   2191  C  C   . THR A  1  308 ? 30.167  18.409  13.017  1.00 62.96 ? 336  THR A C   1 
ATOM   2192  O  O   . THR A  1  308 ? 31.238  18.885  12.643  1.00 64.02 ? 336  THR A O   1 
ATOM   2193  C  CB  . THR A  1  308 ? 29.991  16.365  11.612  1.00 62.81 ? 336  THR A CB  1 
ATOM   2194  O  OG1 . THR A  1  308 ? 29.024  15.321  11.473  1.00 64.02 ? 336  THR A OG1 1 
ATOM   2195  C  CG2 . THR A  1  308 ? 31.041  15.938  12.651  1.00 61.96 ? 336  THR A CG2 1 
ATOM   2196  N  N   . PHE A  1  309 ? 29.754  18.482  14.277  1.00 62.82 ? 337  PHE A N   1 
ATOM   2197  C  CA  . PHE A  1  309 ? 30.569  19.165  15.272  1.00 62.61 ? 337  PHE A CA  1 
ATOM   2198  C  C   . PHE A  1  309 ? 30.027  19.024  16.692  1.00 62.32 ? 337  PHE A C   1 
ATOM   2199  O  O   . PHE A  1  309 ? 28.892  18.591  16.908  1.00 61.18 ? 337  PHE A O   1 
ATOM   2200  C  CB  . PHE A  1  309 ? 30.684  20.647  14.911  1.00 60.73 ? 337  PHE A CB  1 
ATOM   2201  C  CG  . PHE A  1  309 ? 29.399  21.394  15.048  1.00 59.62 ? 337  PHE A CG  1 
ATOM   2202  C  CD1 . PHE A  1  309 ? 28.965  21.829  16.294  1.00 59.45 ? 337  PHE A CD1 1 
ATOM   2203  C  CD2 . PHE A  1  309 ? 28.594  21.617  13.943  1.00 59.29 ? 337  PHE A CD2 1 
ATOM   2204  C  CE1 . PHE A  1  309 ? 27.746  22.473  16.437  1.00 59.09 ? 337  PHE A CE1 1 
ATOM   2205  C  CE2 . PHE A  1  309 ? 27.368  22.262  14.078  1.00 59.64 ? 337  PHE A CE2 1 
ATOM   2206  C  CZ  . PHE A  1  309 ? 26.944  22.689  15.329  1.00 59.29 ? 337  PHE A CZ  1 
ATOM   2207  N  N   . SER A  1  310 ? 30.859  19.417  17.651  1.00 61.80 ? 338  SER A N   1 
ATOM   2208  C  CA  . SER A  1  310 ? 30.531  19.346  19.065  1.00 61.45 ? 338  SER A CA  1 
ATOM   2209  C  C   . SER A  1  310 ? 30.590  20.751  19.649  1.00 61.68 ? 338  SER A C   1 
ATOM   2210  O  O   . SER A  1  310 ? 31.545  21.489  19.408  1.00 62.86 ? 338  SER A O   1 
ATOM   2211  C  CB  . SER A  1  310 ? 31.543  18.430  19.774  1.00 62.29 ? 338  SER A CB  1 
ATOM   2212  O  OG  . SER A  1  310 ? 31.312  18.340  21.173  1.00 63.41 ? 338  SER A OG  1 
ATOM   2213  N  N   . PHE A  1  311 ? 29.567  21.123  20.410  1.00 61.39 ? 339  PHE A N   1 
ATOM   2214  C  CA  . PHE A  1  311 ? 29.523  22.445  21.024  1.00 62.05 ? 339  PHE A CA  1 
ATOM   2215  C  C   . PHE A  1  311 ? 29.599  22.348  22.550  1.00 62.27 ? 339  PHE A C   1 
ATOM   2216  O  O   . PHE A  1  311 ? 29.661  21.257  23.121  1.00 61.38 ? 339  PHE A O   1 
ATOM   2217  C  CB  . PHE A  1  311 ? 28.253  23.193  20.593  1.00 59.69 ? 339  PHE A CB  1 
ATOM   2218  C  CG  . PHE A  1  311 ? 26.978  22.544  21.045  1.00 59.57 ? 339  PHE A CG  1 
ATOM   2219  C  CD1 . PHE A  1  311 ? 26.505  22.734  22.331  1.00 60.62 ? 339  PHE A CD1 1 
ATOM   2220  C  CD2 . PHE A  1  311 ? 26.248  21.735  20.183  1.00 59.84 ? 339  PHE A CD2 1 
ATOM   2221  C  CE1 . PHE A  1  311 ? 25.322  22.126  22.748  1.00 61.19 ? 339  PHE A CE1 1 
ATOM   2222  C  CE2 . PHE A  1  311 ? 25.067  21.124  20.594  1.00 58.51 ? 339  PHE A CE2 1 
ATOM   2223  C  CZ  . PHE A  1  311 ? 24.604  21.321  21.875  1.00 59.34 ? 339  PHE A CZ  1 
ATOM   2224  N  N   . GLY A  1  312 ? 29.603  23.501  23.204  1.00 61.44 ? 340  GLY A N   1 
ATOM   2225  C  CA  . GLY A  1  312 ? 29.698  23.519  24.645  1.00 60.65 ? 340  GLY A CA  1 
ATOM   2226  C  C   . GLY A  1  312 ? 29.877  24.938  25.141  1.00 61.79 ? 340  GLY A C   1 
ATOM   2227  O  O   . GLY A  1  312 ? 29.758  25.903  24.379  1.00 61.39 ? 340  GLY A O   1 
ATOM   2228  N  N   . LEU A  1  313 ? 30.198  25.071  26.420  1.00 61.55 ? 341  LEU A N   1 
ATOM   2229  C  CA  . LEU A  1  313 ? 30.341  26.384  26.998  1.00 60.67 ? 341  LEU A CA  1 
ATOM   2230  C  C   . LEU A  1  313 ? 31.329  26.395  28.148  1.00 61.29 ? 341  LEU A C   1 
ATOM   2231  O  O   . LEU A  1  313 ? 31.189  25.637  29.106  1.00 61.67 ? 341  LEU A O   1 
ATOM   2232  C  CB  . LEU A  1  313 ? 28.979  26.832  27.509  1.00 60.35 ? 341  LEU A CB  1 
ATOM   2233  C  CG  . LEU A  1  313 ? 28.750  28.313  27.693  1.00 59.20 ? 341  LEU A CG  1 
ATOM   2234  C  CD1 . LEU A  1  313 ? 28.600  28.909  26.329  1.00 60.63 ? 341  LEU A CD1 1 
ATOM   2235  C  CD2 . LEU A  1  313 ? 27.511  28.563  28.501  1.00 59.68 ? 341  LEU A CD2 1 
ATOM   2236  N  N   . GLY A  1  314 ? 32.335  27.251  28.048  1.00 62.12 ? 342  GLY A N   1 
ATOM   2237  C  CA  . GLY A  1  314 ? 33.293  27.371  29.128  1.00 62.25 ? 342  GLY A CA  1 
ATOM   2238  C  C   . GLY A  1  314 ? 32.648  28.265  30.174  1.00 62.24 ? 342  GLY A C   1 
ATOM   2239  O  O   . GLY A  1  314 ? 31.884  29.171  29.836  1.00 62.27 ? 342  GLY A O   1 
ATOM   2240  N  N   . ALA A  1  315 ? 32.936  28.014  31.443  1.00 62.06 ? 343  ALA A N   1 
ATOM   2241  C  CA  . ALA A  1  315 ? 32.365  28.815  32.518  1.00 62.67 ? 343  ALA A CA  1 
ATOM   2242  C  C   . ALA A  1  315 ? 32.724  30.289  32.380  1.00 62.77 ? 343  ALA A C   1 
ATOM   2243  O  O   . ALA A  1  315 ? 31.875  31.163  32.543  1.00 61.84 ? 343  ALA A O   1 
ATOM   2244  C  CB  . ALA A  1  315 ? 32.847  28.297  33.843  1.00 63.07 ? 343  ALA A CB  1 
ATOM   2245  N  N   . PHE A  1  316 ? 33.993  30.553  32.085  1.00 64.11 ? 344  PHE A N   1 
ATOM   2246  C  CA  . PHE A  1  316 ? 34.487  31.915  31.913  1.00 64.99 ? 344  PHE A CA  1 
ATOM   2247  C  C   . PHE A  1  316 ? 34.802  32.162  30.440  1.00 65.01 ? 344  PHE A C   1 
ATOM   2248  O  O   . PHE A  1  316 ? 34.630  33.263  29.915  1.00 63.74 ? 344  PHE A O   1 
ATOM   2249  C  CB  . PHE A  1  316 ? 35.746  32.103  32.751  1.00 64.76 ? 344  PHE A CB  1 
ATOM   2250  C  CG  . PHE A  1  316 ? 35.651  31.477  34.092  1.00 64.38 ? 344  PHE A CG  1 
ATOM   2251  C  CD1 . PHE A  1  316 ? 36.276  30.272  34.349  1.00 64.66 ? 344  PHE A CD1 1 
ATOM   2252  C  CD2 . PHE A  1  316 ? 34.866  32.055  35.086  1.00 65.62 ? 344  PHE A CD2 1 
ATOM   2253  C  CE1 . PHE A  1  316 ? 36.120  29.641  35.581  1.00 65.57 ? 344  PHE A CE1 1 
ATOM   2254  C  CE2 . PHE A  1  316 ? 34.699  31.434  36.322  1.00 65.57 ? 344  PHE A CE2 1 
ATOM   2255  C  CZ  . PHE A  1  316 ? 35.327  30.222  36.570  1.00 65.67 ? 344  PHE A CZ  1 
ATOM   2256  N  N   . SER A  1  317 ? 35.269  31.103  29.790  1.00 66.56 ? 345  SER A N   1 
ATOM   2257  C  CA  . SER A  1  317 ? 35.636  31.124  28.384  1.00 65.09 ? 345  SER A CA  1 
ATOM   2258  C  C   . SER A  1  317 ? 34.443  31.379  27.478  1.00 65.10 ? 345  SER A C   1 
ATOM   2259  O  O   . SER A  1  317 ? 34.568  32.055  26.458  1.00 66.57 ? 345  SER A O   1 
ATOM   2260  C  CB  . SER A  1  317 ? 36.293  29.794  28.011  1.00 64.47 ? 345  SER A CB  1 
ATOM   2261  O  OG  . SER A  1  317 ? 35.979  29.430  26.684  1.00 64.74 ? 345  SER A OG  1 
ATOM   2262  N  N   . GLY A  1  318 ? 33.288  30.833  27.835  1.00 64.30 ? 346  GLY A N   1 
ATOM   2263  C  CA  . GLY A  1  318 ? 32.112  31.036  27.011  1.00 63.81 ? 346  GLY A CA  1 
ATOM   2264  C  C   . GLY A  1  318 ? 31.915  29.993  25.921  1.00 63.99 ? 346  GLY A C   1 
ATOM   2265  O  O   . GLY A  1  318 ? 32.421  28.875  26.028  1.00 65.11 ? 346  GLY A O   1 
ATOM   2266  N  N   . PRO A  1  319 ? 31.183  30.336  24.848  1.00 63.04 ? 347  PRO A N   1 
ATOM   2267  C  CA  . PRO A  1  319 ? 30.893  29.450  23.718  1.00 62.59 ? 347  PRO A CA  1 
ATOM   2268  C  C   . PRO A  1  319 ? 32.104  28.820  23.046  1.00 63.13 ? 347  PRO A C   1 
ATOM   2269  O  O   . PRO A  1  319 ? 33.104  29.487  22.770  1.00 63.29 ? 347  PRO A O   1 
ATOM   2270  C  CB  . PRO A  1  319 ? 30.128  30.357  22.768  1.00 62.65 ? 347  PRO A CB  1 
ATOM   2271  C  CG  . PRO A  1  319 ? 29.433  31.282  23.695  1.00 62.95 ? 347  PRO A CG  1 
ATOM   2272  C  CD  . PRO A  1  319 ? 30.520  31.635  24.660  1.00 62.39 ? 347  PRO A CD  1 
ATOM   2273  N  N   . ARG A  1  320 ? 32.002  27.525  22.774  1.00 62.74 ? 348  ARG A N   1 
ATOM   2274  C  CA  . ARG A  1  320 ? 33.083  26.814  22.119  1.00 62.67 ? 348  ARG A CA  1 
ATOM   2275  C  C   . ARG A  1  320 ? 32.550  25.704  21.235  1.00 62.43 ? 348  ARG A C   1 
ATOM   2276  O  O   . ARG A  1  320 ? 31.475  25.162  21.478  1.00 62.60 ? 348  ARG A O   1 
ATOM   2277  C  CB  . ARG A  1  320 ? 34.061  26.251  23.158  1.00 63.46 ? 348  ARG A CB  1 
ATOM   2278  C  CG  . ARG A  1  320 ? 33.491  25.241  24.129  1.00 62.52 ? 348  ARG A CG  1 
ATOM   2279  C  CD  . ARG A  1  320 ? 34.345  25.173  25.405  1.00 63.42 ? 348  ARG A CD  1 
ATOM   2280  N  NE  . ARG A  1  320 ? 33.883  24.125  26.316  1.00 63.96 ? 348  ARG A NE  1 
ATOM   2281  C  CZ  . ARG A  1  320 ? 34.307  23.958  27.566  1.00 63.33 ? 348  ARG A CZ  1 
ATOM   2282  N  NH1 . ARG A  1  320 ? 35.217  24.770  28.094  1.00 62.37 ? 348  ARG A NH1 1 
ATOM   2283  N  NH2 . ARG A  1  320 ? 33.813  22.966  28.291  1.00 63.96 ? 348  ARG A NH2 1 
ATOM   2284  N  N   . ILE A  1  321 ? 33.307  25.387  20.192  1.00 62.48 ? 349  ILE A N   1 
ATOM   2285  C  CA  . ILE A  1  321 ? 32.931  24.340  19.265  1.00 61.64 ? 349  ILE A CA  1 
ATOM   2286  C  C   . ILE A  1  321 ? 34.141  23.506  18.864  1.00 61.66 ? 349  ILE A C   1 
ATOM   2287  O  O   . ILE A  1  321 ? 35.238  24.031  18.651  1.00 60.28 ? 349  ILE A O   1 
ATOM   2288  C  CB  . ILE A  1  321 ? 32.249  24.940  18.030  1.00 61.96 ? 349  ILE A CB  1 
ATOM   2289  C  CG1 . ILE A  1  321 ? 30.741  24.920  18.239  1.00 62.28 ? 349  ILE A CG1 1 
ATOM   2290  C  CG2 . ILE A  1  321 ? 32.614  24.176  16.784  1.00 63.08 ? 349  ILE A CG2 1 
ATOM   2291  C  CD1 . ILE A  1  321 ? 29.957  25.279  17.000  1.00 63.32 ? 349  ILE A CD1 1 
ATOM   2292  N  N   . PHE A  1  322 ? 33.926  22.198  18.768  1.00 61.96 ? 350  PHE A N   1 
ATOM   2293  C  CA  . PHE A  1  322 ? 34.986  21.272  18.413  1.00 62.01 ? 350  PHE A CA  1 
ATOM   2294  C  C   . PHE A  1  322 ? 34.653  20.330  17.280  1.00 62.28 ? 350  PHE A C   1 
ATOM   2295  O  O   . PHE A  1  322 ? 33.488  20.106  16.951  1.00 61.33 ? 350  PHE A O   1 
ATOM   2296  C  CB  . PHE A  1  322 ? 35.366  20.418  19.614  1.00 61.46 ? 350  PHE A CB  1 
ATOM   2297  C  CG  . PHE A  1  322 ? 35.888  21.198  20.760  1.00 61.84 ? 350  PHE A CG  1 
ATOM   2298  C  CD1 . PHE A  1  322 ? 35.023  21.726  21.703  1.00 61.44 ? 350  PHE A CD1 1 
ATOM   2299  C  CD2 . PHE A  1  322 ? 37.253  21.422  20.893  1.00 61.68 ? 350  PHE A CD2 1 
ATOM   2300  C  CE1 . PHE A  1  322 ? 35.512  22.468  22.767  1.00 61.59 ? 350  PHE A CE1 1 
ATOM   2301  C  CE2 . PHE A  1  322 ? 37.753  22.161  21.951  1.00 61.08 ? 350  PHE A CE2 1 
ATOM   2302  C  CZ  . PHE A  1  322 ? 36.880  22.686  22.892  1.00 61.17 ? 350  PHE A CZ  1 
ATOM   2303  N  N   . ASP A  1  323 ? 35.713  19.774  16.701  1.00 63.19 ? 351  ASP A N   1 
ATOM   2304  C  CA  . ASP A  1  323 ? 35.613  18.801  15.630  1.00 63.09 ? 351  ASP A CA  1 
ATOM   2305  C  C   . ASP A  1  323 ? 34.554  19.164  14.601  1.00 63.28 ? 351  ASP A C   1 
ATOM   2306  O  O   . ASP A  1  323 ? 33.501  18.526  14.513  1.00 63.08 ? 351  ASP A O   1 
ATOM   2307  C  CB  . ASP A  1  323 ? 35.323  17.429  16.241  1.00 63.50 ? 351  ASP A CB  1 
ATOM   2308  C  CG  . ASP A  1  323 ? 35.332  16.320  15.221  1.00 64.90 ? 351  ASP A CG  1 
ATOM   2309  O  OD1 . ASP A  1  323 ? 35.160  15.154  15.625  1.00 65.74 ? 351  ASP A OD1 1 
ATOM   2310  O  OD2 . ASP A  1  323 ? 35.505  16.606  14.017  1.00 65.93 ? 351  ASP A OD2 1 
ATOM   2311  N  N   . VAL A  1  324 ? 34.847  20.200  13.823  1.00 63.97 ? 352  VAL A N   1 
ATOM   2312  C  CA  . VAL A  1  324 ? 33.945  20.661  12.775  1.00 64.27 ? 352  VAL A CA  1 
ATOM   2313  C  C   . VAL A  1  324 ? 34.303  19.930  11.489  1.00 63.83 ? 352  VAL A C   1 
ATOM   2314  O  O   . VAL A  1  324 ? 35.404  20.087  10.960  1.00 64.03 ? 352  VAL A O   1 
ATOM   2315  C  CB  . VAL A  1  324 ? 34.094  22.172  12.527  1.00 64.53 ? 352  VAL A CB  1 
ATOM   2316  C  CG1 . VAL A  1  324 ? 32.911  22.688  11.704  1.00 63.63 ? 352  VAL A CG1 1 
ATOM   2317  C  CG2 . VAL A  1  324 ? 34.212  22.904  13.857  1.00 64.44 ? 352  VAL A CG2 1 
ATOM   2318  N  N   . ARG A  1  325 ? 33.368  19.135  10.989  1.00 62.92 ? 353  ARG A N   1 
ATOM   2319  C  CA  . ARG A  1  325 ? 33.604  18.373  9.782   1.00 63.09 ? 353  ARG A CA  1 
ATOM   2320  C  C   . ARG A  1  325 ? 32.584  18.696  8.699   1.00 64.17 ? 353  ARG A C   1 
ATOM   2321  O  O   . ARG A  1  325 ? 31.379  18.531  8.900   1.00 64.81 ? 353  ARG A O   1 
ATOM   2322  C  CB  . ARG A  1  325 ? 33.536  16.878  10.097  1.00 64.18 ? 353  ARG A CB  1 
ATOM   2323  C  CG  . ARG A  1  325 ? 34.512  16.395  11.141  1.00 63.31 ? 353  ARG A CG  1 
ATOM   2324  C  CD  . ARG A  1  325 ? 34.145  14.990  11.581  1.00 64.41 ? 353  ARG A CD  1 
ATOM   2325  N  NE  . ARG A  1  325 ? 35.184  14.385  12.407  1.00 64.61 ? 353  ARG A NE  1 
ATOM   2326  C  CZ  . ARG A  1  325 ? 35.079  13.195  12.990  1.00 64.94 ? 353  ARG A CZ  1 
ATOM   2327  N  NH1 . ARG A  1  325 ? 33.974  12.470  12.844  1.00 65.21 ? 353  ARG A NH1 1 
ATOM   2328  N  NH2 . ARG A  1  325 ? 36.083  12.729  13.719  1.00 65.21 ? 353  ARG A NH2 1 
ATOM   2329  N  N   . PHE A  1  326 ? 33.060  19.166  7.551   1.00 64.23 ? 354  PHE A N   1 
ATOM   2330  C  CA  . PHE A  1  326 ? 32.158  19.450  6.438   1.00 64.18 ? 354  PHE A CA  1 
ATOM   2331  C  C   . PHE A  1  326 ? 32.181  18.167  5.608   1.00 63.83 ? 354  PHE A C   1 
ATOM   2332  O  O   . PHE A  1  326 ? 33.170  17.866  4.939   1.00 62.64 ? 354  PHE A O   1 
ATOM   2333  C  CB  . PHE A  1  326 ? 32.655  20.643  5.601   1.00 63.70 ? 354  PHE A CB  1 
ATOM   2334  C  CG  . PHE A  1  326 ? 31.599  21.237  4.684   1.00 63.37 ? 354  PHE A CG  1 
ATOM   2335  C  CD1 . PHE A  1  326 ? 30.434  21.795  5.206   1.00 63.22 ? 354  PHE A CD1 1 
ATOM   2336  C  CD2 . PHE A  1  326 ? 31.770  21.238  3.302   1.00 63.10 ? 354  PHE A CD2 1 
ATOM   2337  C  CE1 . PHE A  1  326 ? 29.459  22.344  4.363   1.00 62.77 ? 354  PHE A CE1 1 
ATOM   2338  C  CE2 . PHE A  1  326 ? 30.799  21.784  2.456   1.00 62.40 ? 354  PHE A CE2 1 
ATOM   2339  C  CZ  . PHE A  1  326 ? 29.645  22.337  2.990   1.00 62.13 ? 354  PHE A CZ  1 
ATOM   2340  N  N   . GLN A  1  327 ? 31.097  17.399  5.687   1.00 63.84 ? 355  GLN A N   1 
ATOM   2341  C  CA  . GLN A  1  327 ? 31.002  16.146  4.960   1.00 62.83 ? 355  GLN A CA  1 
ATOM   2342  C  C   . GLN A  1  327 ? 32.154  15.242  5.378   1.00 63.15 ? 355  GLN A C   1 
ATOM   2343  O  O   . GLN A  1  327 ? 32.849  14.663  4.539   1.00 63.13 ? 355  GLN A O   1 
ATOM   2344  C  CB  . GLN A  1  327 ? 31.067  16.398  3.463   1.00 62.35 ? 355  GLN A CB  1 
ATOM   2345  C  CG  . GLN A  1  327 ? 30.178  17.523  3.007   1.00 64.01 ? 355  GLN A CG  1 
ATOM   2346  C  CD  . GLN A  1  327 ? 30.434  17.910  1.559   1.00 65.59 ? 355  GLN A CD  1 
ATOM   2347  O  OE1 . GLN A  1  327 ? 31.582  17.931  1.107   1.00 65.49 ? 355  GLN A OE1 1 
ATOM   2348  N  NE2 . GLN A  1  327 ? 29.367  18.233  0.825   1.00 66.28 ? 355  GLN A NE2 1 
ATOM   2349  N  N   . GLY A  1  328 ? 32.370  15.142  6.683   1.00 62.49 ? 356  GLY A N   1 
ATOM   2350  C  CA  . GLY A  1  328 ? 33.423  14.278  7.171   1.00 62.51 ? 356  GLY A CA  1 
ATOM   2351  C  C   . GLY A  1  328 ? 34.813  14.867  7.299   1.00 62.32 ? 356  GLY A C   1 
ATOM   2352  O  O   . GLY A  1  328 ? 35.646  14.278  7.984   1.00 63.28 ? 356  GLY A O   1 
ATOM   2353  N  N   . GLU A  1  329 ? 35.095  15.998  6.658   1.00 60.99 ? 357  GLU A N   1 
ATOM   2354  C  CA  . GLU A  1  329 ? 36.430  16.579  6.785   1.00 60.59 ? 357  GLU A CA  1 
ATOM   2355  C  C   . GLU A  1  329 ? 36.535  17.639  7.869   1.00 60.53 ? 357  GLU A C   1 
ATOM   2356  O  O   . GLU A  1  329 ? 35.847  18.654  7.827   1.00 60.99 ? 357  GLU A O   1 
ATOM   2357  C  CB  . GLU A  1  329 ? 36.904  17.185  5.467   1.00 61.34 ? 357  GLU A CB  1 
ATOM   2358  C  CG  . GLU A  1  329 ? 38.239  17.933  5.615   1.00 62.79 ? 357  GLU A CG  1 
ATOM   2359  C  CD  . GLU A  1  329 ? 39.269  17.556  4.544   1.00 63.57 ? 357  GLU A CD  1 
ATOM   2360  O  OE1 . GLU A  1  329 ? 38.926  17.629  3.335   1.00 62.03 ? 357  GLU A OE1 1 
ATOM   2361  O  OE2 . GLU A  1  329 ? 40.419  17.192  4.918   1.00 63.10 ? 357  GLU A OE2 1 
ATOM   2362  N  N   . ARG A  1  330 ? 37.410  17.400  8.839   1.00 60.94 ? 358  ARG A N   1 
ATOM   2363  C  CA  . ARG A  1  330 ? 37.596  18.344  9.924   1.00 59.64 ? 358  ARG A CA  1 
ATOM   2364  C  C   . ARG A  1  330 ? 38.369  19.544  9.431   1.00 59.44 ? 358  ARG A C   1 
ATOM   2365  O  O   . ARG A  1  330 ? 39.458  19.426  8.859   1.00 58.26 ? 358  ARG A O   1 
ATOM   2366  C  CB  . ARG A  1  330 ? 38.317  17.694  11.103  1.00 59.26 ? 358  ARG A CB  1 
ATOM   2367  C  CG  . ARG A  1  330 ? 38.807  18.681  12.142  1.00 58.84 ? 358  ARG A CG  1 
ATOM   2368  C  CD  . ARG A  1  330 ? 38.991  18.036  13.509  1.00 59.03 ? 358  ARG A CD  1 
ATOM   2369  N  NE  . ARG A  1  330 ? 39.722  16.765  13.479  1.00 59.63 ? 358  ARG A NE  1 
ATOM   2370  C  CZ  . ARG A  1  330 ? 39.152  15.554  13.476  1.00 59.90 ? 358  ARG A CZ  1 
ATOM   2371  N  NH1 . ARG A  1  330 ? 37.827  15.421  13.498  1.00 58.47 ? 358  ARG A NH1 1 
ATOM   2372  N  NH2 . ARG A  1  330 ? 39.910  14.461  13.473  1.00 59.15 ? 358  ARG A NH2 1 
ATOM   2373  N  N   . LEU A  1  331 ? 37.760  20.700  9.657   1.00 59.29 ? 359  LEU A N   1 
ATOM   2374  C  CA  . LEU A  1  331 ? 38.306  21.981  9.266   1.00 58.47 ? 359  LEU A CA  1 
ATOM   2375  C  C   . LEU A  1  331 ? 38.956  22.586  10.488  1.00 57.74 ? 359  LEU A C   1 
ATOM   2376  O  O   . LEU A  1  331 ? 40.063  23.111  10.425  1.00 56.76 ? 359  LEU A O   1 
ATOM   2377  C  CB  . LEU A  1  331 ? 37.177  22.895  8.783   1.00 58.67 ? 359  LEU A CB  1 
ATOM   2378  C  CG  . LEU A  1  331 ? 36.305  22.348  7.649   1.00 57.96 ? 359  LEU A CG  1 
ATOM   2379  C  CD1 . LEU A  1  331 ? 35.196  23.320  7.280   1.00 58.06 ? 359  LEU A CD1 1 
ATOM   2380  C  CD2 . LEU A  1  331 ? 37.185  22.100  6.461   1.00 58.77 ? 359  LEU A CD2 1 
ATOM   2381  N  N   . VAL A  1  332 ? 38.251  22.493  11.608  1.00 58.35 ? 360  VAL A N   1 
ATOM   2382  C  CA  . VAL A  1  332 ? 38.745  23.051  12.856  1.00 59.30 ? 360  VAL A CA  1 
ATOM   2383  C  C   . VAL A  1  332 ? 38.691  22.079  14.018  1.00 58.94 ? 360  VAL A C   1 
ATOM   2384  O  O   . VAL A  1  332 ? 37.702  21.363  14.219  1.00 58.36 ? 360  VAL A O   1 
ATOM   2385  C  CB  . VAL A  1  332 ? 37.932  24.279  13.285  1.00 59.42 ? 360  VAL A CB  1 
ATOM   2386  C  CG1 . VAL A  1  332 ? 38.830  25.236  14.069  1.00 58.56 ? 360  VAL A CG1 1 
ATOM   2387  C  CG2 . VAL A  1  332 ? 37.290  24.938  12.065  1.00 58.74 ? 360  VAL A CG2 1 
ATOM   2388  N  N   . TYR A  1  333 ? 39.761  22.062  14.794  1.00 57.76 ? 361  TYR A N   1 
ATOM   2389  C  CA  . TYR A  1  333 ? 39.772  21.195  15.944  1.00 58.41 ? 361  TYR A CA  1 
ATOM   2390  C  C   . TYR A  1  333 ? 38.861  21.878  16.941  1.00 58.05 ? 361  TYR A C   1 
ATOM   2391  O  O   . TYR A  1  333 ? 38.051  21.240  17.616  1.00 56.60 ? 361  TYR A O   1 
ATOM   2392  C  CB  . TYR A  1  333 ? 41.174  21.077  16.533  1.00 58.48 ? 361  TYR A CB  1 
ATOM   2393  C  CG  . TYR A  1  333 ? 41.190  20.238  17.781  1.00 58.92 ? 361  TYR A CG  1 
ATOM   2394  C  CD1 . TYR A  1  333 ? 40.772  18.908  17.750  1.00 58.94 ? 361  TYR A CD1 1 
ATOM   2395  C  CD2 . TYR A  1  333 ? 41.571  20.781  19.003  1.00 59.12 ? 361  TYR A CD2 1 
ATOM   2396  C  CE1 . TYR A  1  333 ? 40.726  18.138  18.906  1.00 58.78 ? 361  TYR A CE1 1 
ATOM   2397  C  CE2 . TYR A  1  333 ? 41.531  20.022  20.166  1.00 59.84 ? 361  TYR A CE2 1 
ATOM   2398  C  CZ  . TYR A  1  333 ? 41.104  18.701  20.114  1.00 59.43 ? 361  TYR A CZ  1 
ATOM   2399  O  OH  . TYR A  1  333 ? 41.030  17.960  21.277  1.00 60.66 ? 361  TYR A OH  1 
ATOM   2400  N  N   . GLU A  1  334 ? 38.984  23.197  16.999  1.00 57.53 ? 362  GLU A N   1 
ATOM   2401  C  CA  . GLU A  1  334 ? 38.201  23.975  17.932  1.00 56.44 ? 362  GLU A CA  1 
ATOM   2402  C  C   . GLU A  1  334 ? 38.120  25.448  17.588  1.00 56.61 ? 362  GLU A C   1 
ATOM   2403  O  O   . GLU A  1  334 ? 39.034  26.025  17.001  1.00 57.47 ? 362  GLU A O   1 
ATOM   2404  C  CB  . GLU A  1  334 ? 38.805  23.825  19.322  1.00 57.24 ? 362  GLU A CB  1 
ATOM   2405  C  CG  . GLU A  1  334 ? 38.672  25.053  20.214  1.00 58.64 ? 362  GLU A CG  1 
ATOM   2406  C  CD  . GLU A  1  334 ? 39.796  25.150  21.252  1.00 59.61 ? 362  GLU A CD  1 
ATOM   2407  O  OE1 . GLU A  1  334 ? 39.814  26.134  22.032  1.00 57.70 ? 362  GLU A OE1 1 
ATOM   2408  O  OE2 . GLU A  1  334 ? 40.666  24.242  21.280  1.00 60.06 ? 362  GLU A OE2 1 
ATOM   2409  N  N   . ILE A  1  335 ? 36.996  26.040  17.960  1.00 55.71 ? 363  ILE A N   1 
ATOM   2410  C  CA  . ILE A  1  335 ? 36.759  27.458  17.774  1.00 55.06 ? 363  ILE A CA  1 
ATOM   2411  C  C   . ILE A  1  335 ? 35.968  27.832  19.003  1.00 55.06 ? 363  ILE A C   1 
ATOM   2412  O  O   . ILE A  1  335 ? 34.826  27.408  19.176  1.00 54.49 ? 363  ILE A O   1 
ATOM   2413  C  CB  . ILE A  1  335 ? 35.914  27.765  16.551  1.00 56.01 ? 363  ILE A CB  1 
ATOM   2414  C  CG1 . ILE A  1  335 ? 36.573  27.177  15.308  1.00 56.61 ? 363  ILE A CG1 1 
ATOM   2415  C  CG2 . ILE A  1  335 ? 35.781  29.285  16.396  1.00 56.62 ? 363  ILE A CG2 1 
ATOM   2416  C  CD1 . ILE A  1  335 ? 35.758  27.349  14.041  1.00 56.42 ? 363  ILE A CD1 1 
ATOM   2417  N  N   . SER A  1  336 ? 36.596  28.619  19.864  1.00 55.42 ? 364  SER A N   1 
ATOM   2418  C  CA  . SER A  1  336 ? 35.981  29.025  21.107  1.00 53.19 ? 364  SER A CA  1 
ATOM   2419  C  C   . SER A  1  336 ? 36.160  30.504  21.360  1.00 53.29 ? 364  SER A C   1 
ATOM   2420  O  O   . SER A  1  336 ? 36.956  31.179  20.705  1.00 53.17 ? 364  SER A O   1 
ATOM   2421  C  CB  . SER A  1  336 ? 36.634  28.275  22.255  1.00 53.23 ? 364  SER A CB  1 
ATOM   2422  O  OG  . SER A  1  336 ? 37.973  28.720  22.433  1.00 52.09 ? 364  SER A OG  1 
ATOM   2423  N  N   . LEU A  1  337 ? 35.401  31.001  22.322  1.00 52.78 ? 365  LEU A N   1 
ATOM   2424  C  CA  . LEU A  1  337 ? 35.511  32.384  22.725  1.00 52.62 ? 365  LEU A CA  1 
ATOM   2425  C  C   . LEU A  1  337 ? 36.637  32.268  23.735  1.00 49.90 ? 365  LEU A C   1 
ATOM   2426  O  O   . LEU A  1  337 ? 36.813  31.213  24.326  1.00 50.76 ? 365  LEU A O   1 
ATOM   2427  C  CB  . LEU A  1  337 ? 34.207  32.839  23.380  1.00 51.57 ? 365  LEU A CB  1 
ATOM   2428  C  CG  . LEU A  1  337 ? 34.166  34.226  24.008  1.00 50.18 ? 365  LEU A CG  1 
ATOM   2429  C  CD1 . LEU A  1  337 ? 34.803  35.259  23.111  1.00 51.04 ? 365  LEU A CD1 1 
ATOM   2430  C  CD2 . LEU A  1  337 ? 32.731  34.565  24.264  1.00 50.31 ? 365  LEU A CD2 1 
ATOM   2431  N  N   . GLN A  1  338 ? 37.417  33.317  23.926  1.00 48.11 ? 366  GLN A N   1 
ATOM   2432  C  CA  . GLN A  1  338 ? 38.514  33.223  24.868  1.00 49.33 ? 366  GLN A CA  1 
ATOM   2433  C  C   . GLN A  1  338 ? 38.476  34.262  25.949  1.00 48.98 ? 366  GLN A C   1 
ATOM   2434  O  O   . GLN A  1  338 ? 39.048  34.078  27.027  1.00 48.32 ? 366  GLN A O   1 
ATOM   2435  C  CB  . GLN A  1  338 ? 39.837  33.332  24.134  1.00 49.93 ? 366  GLN A CB  1 
ATOM   2436  C  CG  . GLN A  1  338 ? 40.340  32.010  23.616  1.00 50.32 ? 366  GLN A CG  1 
ATOM   2437  C  CD  . GLN A  1  338 ? 40.659  31.033  24.746  1.00 50.64 ? 366  GLN A CD  1 
ATOM   2438  O  OE1 . GLN A  1  338 ? 41.430  31.359  25.661  1.00 49.30 ? 366  GLN A OE1 1 
ATOM   2439  N  NE2 . GLN A  1  338 ? 40.072  29.826  24.685  1.00 49.01 ? 366  GLN A NE2 1 
ATOM   2440  N  N   . GLU A  1  339 ? 37.792  35.357  25.657  1.00 49.58 ? 367  GLU A N   1 
ATOM   2441  C  CA  . GLU A  1  339 ? 37.701  36.452  26.600  1.00 49.29 ? 367  GLU A CA  1 
ATOM   2442  C  C   . GLU A  1  339 ? 36.791  37.528  26.037  1.00 48.62 ? 367  GLU A C   1 
ATOM   2443  O  O   . GLU A  1  339 ? 36.446  37.502  24.861  1.00 48.65 ? 367  GLU A O   1 
ATOM   2444  C  CB  . GLU A  1  339 ? 39.100  37.031  26.826  1.00 49.33 ? 367  GLU A CB  1 
ATOM   2445  C  CG  . GLU A  1  339 ? 39.170  38.140  27.851  1.00 50.67 ? 367  GLU A CG  1 
ATOM   2446  C  CD  . GLU A  1  339 ? 38.635  37.708  29.194  1.00 51.69 ? 367  GLU A CD  1 
ATOM   2447  O  OE1 . GLU A  1  339 ? 39.208  36.772  29.799  1.00 52.03 ? 367  GLU A OE1 1 
ATOM   2448  O  OE2 . GLU A  1  339 ? 37.635  38.309  29.637  1.00 53.09 ? 367  GLU A OE2 1 
ATOM   2449  N  N   . ALA A  1  340 ? 36.401  38.467  26.888  1.00 48.31 ? 368  ALA A N   1 
ATOM   2450  C  CA  . ALA A  1  340 ? 35.563  39.585  26.485  1.00 46.57 ? 368  ALA A CA  1 
ATOM   2451  C  C   . ALA A  1  340 ? 36.067  40.753  27.302  1.00 46.34 ? 368  ALA A C   1 
ATOM   2452  O  O   . ALA A  1  340 ? 36.524  40.568  28.424  1.00 46.96 ? 368  ALA A O   1 
ATOM   2453  C  CB  . ALA A  1  340 ? 34.114  39.310  26.795  1.00 47.85 ? 368  ALA A CB  1 
ATOM   2454  N  N   . LEU A  1  341 ? 35.989  41.953  26.746  1.00 46.94 ? 369  LEU A N   1 
ATOM   2455  C  CA  . LEU A  1  341 ? 36.480  43.139  27.431  1.00 46.06 ? 369  LEU A CA  1 
ATOM   2456  C  C   . LEU A  1  341 ? 35.632  44.357  27.102  1.00 46.70 ? 369  LEU A C   1 
ATOM   2457  O  O   . LEU A  1  341 ? 35.093  44.470  26.003  1.00 49.00 ? 369  LEU A O   1 
ATOM   2458  C  CB  . LEU A  1  341 ? 37.927  43.391  27.009  1.00 46.49 ? 369  LEU A CB  1 
ATOM   2459  C  CG  . LEU A  1  341 ? 38.610  44.676  27.463  1.00 46.12 ? 369  LEU A CG  1 
ATOM   2460  C  CD1 . LEU A  1  341 ? 38.932  44.630  28.936  1.00 45.33 ? 369  LEU A CD1 1 
ATOM   2461  C  CD2 . LEU A  1  341 ? 39.871  44.842  26.660  1.00 47.23 ? 369  LEU A CD2 1 
ATOM   2462  N  N   . ALA A  1  342 ? 35.513  45.269  28.056  1.00 45.80 ? 370  ALA A N   1 
ATOM   2463  C  CA  . ALA A  1  342 ? 34.737  46.478  27.848  1.00 45.71 ? 370  ALA A CA  1 
ATOM   2464  C  C   . ALA A  1  342 ? 35.415  47.608  28.582  1.00 46.50 ? 370  ALA A C   1 
ATOM   2465  O  O   . ALA A  1  342 ? 35.202  47.784  29.775  1.00 46.95 ? 370  ALA A O   1 
ATOM   2466  C  CB  . ALA A  1  342 ? 33.340  46.291  28.367  1.00 45.99 ? 370  ALA A CB  1 
ATOM   2467  N  N   . ILE A  1  343 ? 36.231  48.371  27.865  1.00 47.55 ? 371  ILE A N   1 
ATOM   2468  C  CA  . ILE A  1  343 ? 36.963  49.491  28.450  1.00 47.69 ? 371  ILE A CA  1 
ATOM   2469  C  C   . ILE A  1  343 ? 36.201  50.820  28.389  1.00 46.27 ? 371  ILE A C   1 
ATOM   2470  O  O   . ILE A  1  343 ? 35.901  51.330  27.312  1.00 44.67 ? 371  ILE A O   1 
ATOM   2471  C  CB  . ILE A  1  343 ? 38.326  49.625  27.773  1.00 48.20 ? 371  ILE A CB  1 
ATOM   2472  C  CG1 . ILE A  1  343 ? 39.158  48.381  28.095  1.00 46.67 ? 371  ILE A CG1 1 
ATOM   2473  C  CG2 . ILE A  1  343 ? 39.011  50.905  28.217  1.00 47.91 ? 371  ILE A CG2 1 
ATOM   2474  C  CD1 . ILE A  1  343 ? 40.603  48.486  27.705  1.00 47.79 ? 371  ILE A CD1 1 
ATOM   2475  N  N   . TYR A  1  344 ? 35.929  51.377  29.571  1.00 47.71 ? 372  TYR A N   1 
ATOM   2476  C  CA  . TYR A  1  344 ? 35.149  52.612  29.731  1.00 49.96 ? 372  TYR A CA  1 
ATOM   2477  C  C   . TYR A  1  344 ? 35.865  53.940  29.990  1.00 51.02 ? 372  TYR A C   1 
ATOM   2478  O  O   . TYR A  1  344 ? 37.032  53.988  30.374  1.00 51.00 ? 372  TYR A O   1 
ATOM   2479  C  CB  . TYR A  1  344 ? 34.127  52.430  30.868  1.00 48.76 ? 372  TYR A CB  1 
ATOM   2480  C  CG  . TYR A  1  344 ? 32.919  51.582  30.542  1.00 46.02 ? 372  TYR A CG  1 
ATOM   2481  C  CD1 . TYR A  1  344 ? 31.726  52.168  30.112  1.00 47.32 ? 372  TYR A CD1 1 
ATOM   2482  C  CD2 . TYR A  1  344 ? 32.966  50.196  30.672  1.00 45.39 ? 372  TYR A CD2 1 
ATOM   2483  C  CE1 . TYR A  1  344 ? 30.596  51.390  29.818  1.00 47.38 ? 372  TYR A CE1 1 
ATOM   2484  C  CE2 . TYR A  1  344 ? 31.859  49.410  30.385  1.00 46.43 ? 372  TYR A CE2 1 
ATOM   2485  C  CZ  . TYR A  1  344 ? 30.668  50.008  29.960  1.00 47.70 ? 372  TYR A CZ  1 
ATOM   2486  O  OH  . TYR A  1  344 ? 29.542  49.234  29.704  1.00 47.93 ? 372  TYR A OH  1 
ATOM   2487  N  N   . GLY A  1  345 ? 35.104  55.017  29.798  1.00 52.43 ? 373  GLY A N   1 
ATOM   2488  C  CA  . GLY A  1  345 ? 35.578  56.368  30.029  1.00 53.12 ? 373  GLY A CA  1 
ATOM   2489  C  C   . GLY A  1  345 ? 34.415  57.074  30.707  1.00 54.60 ? 373  GLY A C   1 
ATOM   2490  O  O   . GLY A  1  345 ? 33.295  56.548  30.718  1.00 53.33 ? 373  GLY A O   1 
ATOM   2491  N  N   . GLY A  1  346 ? 34.658  58.256  31.268  1.00 56.01 ? 374  GLY A N   1 
ATOM   2492  C  CA  . GLY A  1  346 ? 33.586  58.975  31.946  1.00 55.66 ? 374  GLY A CA  1 
ATOM   2493  C  C   . GLY A  1  346 ? 34.099  59.974  32.976  1.00 57.00 ? 374  GLY A C   1 
ATOM   2494  O  O   . GLY A  1  346 ? 35.309  60.059  33.234  1.00 57.36 ? 374  GLY A O   1 
ATOM   2495  N  N   . ASN A  1  347 ? 33.181  60.732  33.570  1.00 57.14 ? 375  ASN A N   1 
ATOM   2496  C  CA  . ASN A  1  347 ? 33.550  61.736  34.562  1.00 56.31 ? 375  ASN A CA  1 
ATOM   2497  C  C   . ASN A  1  347 ? 33.434  61.192  35.978  1.00 56.87 ? 375  ASN A C   1 
ATOM   2498  O  O   . ASN A  1  347 ? 33.960  61.775  36.925  1.00 56.56 ? 375  ASN A O   1 
ATOM   2499  C  CB  . ASN A  1  347 ? 32.682  63.004  34.398  1.00 55.32 ? 375  ASN A CB  1 
ATOM   2500  C  CG  . ASN A  1  347 ? 31.170  62.737  34.538  1.00 57.04 ? 375  ASN A CG  1 
ATOM   2501  O  OD1 . ASN A  1  347 ? 30.351  63.606  34.211  1.00 57.12 ? 375  ASN A OD1 1 
ATOM   2502  N  ND2 . ASN A  1  347 ? 30.797  61.554  35.030  1.00 57.42 ? 375  ASN A ND2 1 
ATOM   2503  N  N   . SER A  1  348 ? 32.752  60.062  36.118  1.00 57.19 ? 376  SER A N   1 
ATOM   2504  C  CA  . SER A  1  348 ? 32.565  59.468  37.426  1.00 55.65 ? 376  SER A CA  1 
ATOM   2505  C  C   . SER A  1  348 ? 33.663  58.455  37.645  1.00 55.31 ? 376  SER A C   1 
ATOM   2506  O  O   . SER A  1  348 ? 34.034  57.739  36.726  1.00 55.71 ? 376  SER A O   1 
ATOM   2507  C  CB  . SER A  1  348 ? 31.192  58.817  37.498  1.00 56.80 ? 376  SER A CB  1 
ATOM   2508  O  OG  . SER A  1  348 ? 30.190  59.774  37.190  1.00 58.15 ? 376  SER A OG  1 
ATOM   2509  N  N   . PRO A  1  349 ? 34.212  58.399  38.868  1.00 55.27 ? 377  PRO A N   1 
ATOM   2510  C  CA  . PRO A  1  349 ? 35.286  57.492  39.269  1.00 55.63 ? 377  PRO A CA  1 
ATOM   2511  C  C   . PRO A  1  349 ? 35.081  56.064  38.798  1.00 56.51 ? 377  PRO A C   1 
ATOM   2512  O  O   . PRO A  1  349 ? 35.947  55.492  38.129  1.00 56.46 ? 377  PRO A O   1 
ATOM   2513  C  CB  . PRO A  1  349 ? 35.278  57.612  40.788  1.00 55.71 ? 377  PRO A CB  1 
ATOM   2514  C  CG  . PRO A  1  349 ? 34.941  59.031  40.989  1.00 54.86 ? 377  PRO A CG  1 
ATOM   2515  C  CD  . PRO A  1  349 ? 33.794  59.221  40.015  1.00 56.32 ? 377  PRO A CD  1 
ATOM   2516  N  N   . ALA A  1  350 ? 33.938  55.489  39.155  1.00 56.39 ? 378  ALA A N   1 
ATOM   2517  C  CA  . ALA A  1  350 ? 33.627  54.127  38.759  1.00 56.76 ? 378  ALA A CA  1 
ATOM   2518  C  C   . ALA A  1  350 ? 33.811  53.996  37.249  1.00 58.01 ? 378  ALA A C   1 
ATOM   2519  O  O   . ALA A  1  350 ? 34.687  53.255  36.784  1.00 58.42 ? 378  ALA A O   1 
ATOM   2520  C  CB  . ALA A  1  350 ? 32.206  53.789  39.149  1.00 57.09 ? 378  ALA A CB  1 
ATOM   2521  N  N   . ALA A  1  351 ? 32.990  54.727  36.494  1.00 56.93 ? 379  ALA A N   1 
ATOM   2522  C  CA  . ALA A  1  351 ? 33.042  54.723  35.033  1.00 56.36 ? 379  ALA A CA  1 
ATOM   2523  C  C   . ALA A  1  351 ? 34.469  54.971  34.585  1.00 56.83 ? 379  ALA A C   1 
ATOM   2524  O  O   . ALA A  1  351 ? 35.121  54.124  33.971  1.00 56.87 ? 379  ALA A O   1 
ATOM   2525  C  CB  . ALA A  1  351 ? 32.140  55.824  34.487  1.00 57.76 ? 379  ALA A CB  1 
ATOM   2526  N  N   . MET A  1  352 ? 34.921  56.170  34.916  1.00 57.45 ? 380  MET A N   1 
ATOM   2527  C  CA  . MET A  1  352 ? 36.243  56.679  34.624  1.00 56.07 ? 380  MET A CA  1 
ATOM   2528  C  C   . MET A  1  352 ? 37.375  55.669  34.642  1.00 56.11 ? 380  MET A C   1 
ATOM   2529  O  O   . MET A  1  352 ? 38.414  55.909  34.033  1.00 56.84 ? 380  MET A O   1 
ATOM   2530  C  CB  . MET A  1  352 ? 36.550  57.773  35.624  1.00 56.51 ? 380  MET A CB  1 
ATOM   2531  C  CG  . MET A  1  352 ? 37.767  58.561  35.339  1.00 57.53 ? 380  MET A CG  1 
ATOM   2532  S  SD  . MET A  1  352 ? 37.784  59.844  36.552  1.00 56.61 ? 380  MET A SD  1 
ATOM   2533  C  CE  . MET A  1  352 ? 39.135  59.341  37.486  1.00 58.58 ? 380  MET A CE  1 
ATOM   2534  N  N   . THR A  1  353 ? 37.188  54.548  35.332  1.00 55.81 ? 381  THR A N   1 
ATOM   2535  C  CA  . THR A  1  353 ? 38.246  53.538  35.422  1.00 56.56 ? 381  THR A CA  1 
ATOM   2536  C  C   . THR A  1  353 ? 37.814  52.094  35.275  1.00 55.80 ? 381  THR A C   1 
ATOM   2537  O  O   . THR A  1  353 ? 38.485  51.194  35.784  1.00 54.96 ? 381  THR A O   1 
ATOM   2538  C  CB  . THR A  1  353 ? 38.968  53.628  36.757  1.00 57.27 ? 381  THR A CB  1 
ATOM   2539  O  OG1 . THR A  1  353 ? 37.992  53.673  37.809  1.00 57.03 ? 381  THR A OG1 1 
ATOM   2540  C  CG2 . THR A  1  353 ? 39.865  54.865  36.801  1.00 57.17 ? 381  THR A CG2 1 
ATOM   2541  N  N   . THR A  1  354 ? 36.709  51.865  34.582  1.00 54.95 ? 382  THR A N   1 
ATOM   2542  C  CA  . THR A  1  354 ? 36.235  50.511  34.395  1.00 54.53 ? 382  THR A CA  1 
ATOM   2543  C  C   . THR A  1  354 ? 36.782  49.834  33.140  1.00 54.80 ? 382  THR A C   1 
ATOM   2544  O  O   . THR A  1  354 ? 36.587  50.314  32.019  1.00 53.78 ? 382  THR A O   1 
ATOM   2545  C  CB  . THR A  1  354 ? 34.716  50.477  34.351  1.00 54.70 ? 382  THR A CB  1 
ATOM   2546  O  OG1 . THR A  1  354 ? 34.200  50.688  35.672  1.00 54.35 ? 382  THR A OG1 1 
ATOM   2547  C  CG2 . THR A  1  354 ? 34.240  49.145  33.808  1.00 54.25 ? 382  THR A CG2 1 
ATOM   2548  N  N   . ARG A  1  355 ? 37.478  48.717  33.359  1.00 54.81 ? 383  ARG A N   1 
ATOM   2549  C  CA  . ARG A  1  355 ? 38.068  47.900  32.296  1.00 54.96 ? 383  ARG A CA  1 
ATOM   2550  C  C   . ARG A  1  355 ? 37.675  46.431  32.542  1.00 53.65 ? 383  ARG A C   1 
ATOM   2551  O  O   . ARG A  1  355 ? 38.456  45.654  33.084  1.00 54.01 ? 383  ARG A O   1 
ATOM   2552  C  CB  . ARG A  1  355 ? 39.604  48.040  32.280  1.00 53.51 ? 383  ARG A CB  1 
ATOM   2553  C  CG  . ARG A  1  355 ? 40.144  49.398  31.811  1.00 53.37 ? 383  ARG A CG  1 
ATOM   2554  C  CD  . ARG A  1  355 ? 40.337  50.383  32.960  1.00 53.80 ? 383  ARG A CD  1 
ATOM   2555  N  NE  . ARG A  1  355 ? 40.787  51.701  32.512  1.00 53.33 ? 383  ARG A NE  1 
ATOM   2556  C  CZ  . ARG A  1  355 ? 40.054  52.537  31.780  1.00 53.92 ? 383  ARG A CZ  1 
ATOM   2557  N  NH1 . ARG A  1  355 ? 38.831  52.189  31.412  1.00 54.24 ? 383  ARG A NH1 1 
ATOM   2558  N  NH2 . ARG A  1  355 ? 40.537  53.721  31.418  1.00 53.67 ? 383  ARG A NH2 1 
ATOM   2559  N  N   . TYR A  1  356 ? 36.461  46.064  32.138  1.00 53.27 ? 384  TYR A N   1 
ATOM   2560  C  CA  . TYR A  1  356 ? 35.935  44.709  32.326  1.00 53.48 ? 384  TYR A CA  1 
ATOM   2561  C  C   . TYR A  1  356 ? 36.564  43.573  31.532  1.00 53.37 ? 384  TYR A C   1 
ATOM   2562  O  O   . TYR A  1  356 ? 36.452  43.525  30.314  1.00 54.52 ? 384  TYR A O   1 
ATOM   2563  C  CB  . TYR A  1  356 ? 34.433  44.673  32.032  1.00 52.83 ? 384  TYR A CB  1 
ATOM   2564  C  CG  . TYR A  1  356 ? 33.568  45.346  33.064  1.00 53.35 ? 384  TYR A CG  1 
ATOM   2565  C  CD1 . TYR A  1  356 ? 33.631  44.969  34.407  1.00 53.36 ? 384  TYR A CD1 1 
ATOM   2566  C  CD2 . TYR A  1  356 ? 32.679  46.360  32.700  1.00 53.37 ? 384  TYR A CD2 1 
ATOM   2567  C  CE1 . TYR A  1  356 ? 32.831  45.592  35.371  1.00 53.79 ? 384  TYR A CE1 1 
ATOM   2568  C  CE2 . TYR A  1  356 ? 31.869  46.989  33.650  1.00 53.54 ? 384  TYR A CE2 1 
ATOM   2569  C  CZ  . TYR A  1  356 ? 31.951  46.602  34.988  1.00 54.32 ? 384  TYR A CZ  1 
ATOM   2570  O  OH  . TYR A  1  356 ? 31.161  47.219  35.946  1.00 54.91 ? 384  TYR A OH  1 
ATOM   2571  N  N   . VAL A  1  357 ? 37.220  42.652  32.217  1.00 51.89 ? 385  VAL A N   1 
ATOM   2572  C  CA  . VAL A  1  357 ? 37.779  41.494  31.545  1.00 52.18 ? 385  VAL A CA  1 
ATOM   2573  C  C   . VAL A  1  357 ? 36.774  40.446  31.998  1.00 53.58 ? 385  VAL A C   1 
ATOM   2574  O  O   . VAL A  1  357 ? 37.074  39.576  32.815  1.00 54.84 ? 385  VAL A O   1 
ATOM   2575  C  CB  . VAL A  1  357 ? 39.194  41.156  32.059  1.00 53.14 ? 385  VAL A CB  1 
ATOM   2576  C  CG1 . VAL A  1  357 ? 39.740  39.941  31.327  1.00 53.02 ? 385  VAL A CG1 1 
ATOM   2577  C  CG2 . VAL A  1  357 ? 40.108  42.346  31.860  1.00 51.85 ? 385  VAL A CG2 1 
ATOM   2578  N  N   . ASP A  1  358 ? 35.560  40.583  31.474  1.00 53.92 ? 386  ASP A N   1 
ATOM   2579  C  CA  . ASP A  1  358 ? 34.420  39.727  31.794  1.00 54.12 ? 386  ASP A CA  1 
ATOM   2580  C  C   . ASP A  1  358 ? 34.651  38.244  31.991  1.00 54.21 ? 386  ASP A C   1 
ATOM   2581  O  O   . ASP A  1  358 ? 33.817  37.573  32.593  1.00 54.18 ? 386  ASP A O   1 
ATOM   2582  C  CB  . ASP A  1  358 ? 33.326  39.929  30.759  1.00 53.22 ? 386  ASP A CB  1 
ATOM   2583  C  CG  . ASP A  1  358 ? 32.815  41.346  30.747  1.00 53.30 ? 386  ASP A CG  1 
ATOM   2584  O  OD1 . ASP A  1  358 ? 32.719  41.932  31.844  1.00 51.42 ? 386  ASP A OD1 1 
ATOM   2585  O  OD2 . ASP A  1  358 ? 32.511  41.867  29.655  1.00 53.56 ? 386  ASP A OD2 1 
ATOM   2586  N  N   . GLY A  1  359 ? 35.758  37.721  31.472  1.00 54.74 ? 387  GLY A N   1 
ATOM   2587  C  CA  . GLY A  1  359 ? 36.062  36.312  31.667  1.00 55.13 ? 387  GLY A CA  1 
ATOM   2588  C  C   . GLY A  1  359 ? 36.344  36.117  33.150  1.00 55.48 ? 387  GLY A C   1 
ATOM   2589  O  O   . GLY A  1  359 ? 36.330  34.995  33.664  1.00 54.58 ? 387  GLY A O   1 
ATOM   2590  N  N   . GLY A  1  360 ? 36.618  37.233  33.830  1.00 56.44 ? 388  GLY A N   1 
ATOM   2591  C  CA  . GLY A  1  360 ? 36.866  37.217  35.262  1.00 56.92 ? 388  GLY A CA  1 
ATOM   2592  C  C   . GLY A  1  360 ? 35.530  37.070  35.977  1.00 56.26 ? 388  GLY A C   1 
ATOM   2593  O  O   . GLY A  1  360 ? 35.474  36.961  37.200  1.00 54.40 ? 388  GLY A O   1 
ATOM   2594  N  N   . PHE A  1  361 ? 34.455  37.086  35.183  1.00 57.82 ? 389  PHE A N   1 
ATOM   2595  C  CA  . PHE A  1  361 ? 33.073  36.930  35.654  1.00 57.81 ? 389  PHE A CA  1 
ATOM   2596  C  C   . PHE A  1  361 ? 32.502  35.614  35.128  1.00 57.98 ? 389  PHE A C   1 
ATOM   2597  O  O   . PHE A  1  361 ? 31.802  34.908  35.849  1.00 58.15 ? 389  PHE A O   1 
ATOM   2598  C  CB  . PHE A  1  361 ? 32.184  38.086  35.173  1.00 57.48 ? 389  PHE A CB  1 
ATOM   2599  C  CG  . PHE A  1  361 ? 32.381  39.361  35.940  1.00 58.20 ? 389  PHE A CG  1 
ATOM   2600  C  CD1 . PHE A  1  361 ? 33.521  40.146  35.749  1.00 59.32 ? 389  PHE A CD1 1 
ATOM   2601  C  CD2 . PHE A  1  361 ? 31.438  39.771  36.876  1.00 57.96 ? 389  PHE A CD2 1 
ATOM   2602  C  CE1 . PHE A  1  361 ? 33.718  41.329  36.487  1.00 58.88 ? 389  PHE A CE1 1 
ATOM   2603  C  CE2 . PHE A  1  361 ? 31.624  40.946  37.617  1.00 59.41 ? 389  PHE A CE2 1 
ATOM   2604  C  CZ  . PHE A  1  361 ? 32.770  41.727  37.420  1.00 58.63 ? 389  PHE A CZ  1 
ATOM   2605  N  N   . GLY A  1  362 ? 32.797  35.303  33.867  1.00 57.49 ? 390  GLY A N   1 
ATOM   2606  C  CA  . GLY A  1  362 ? 32.334  34.060  33.278  1.00 57.18 ? 390  GLY A CA  1 
ATOM   2607  C  C   . GLY A  1  362 ? 31.214  34.198  32.272  1.00 56.95 ? 390  GLY A C   1 
ATOM   2608  O  O   . GLY A  1  362 ? 30.074  34.449  32.650  1.00 56.51 ? 390  GLY A O   1 
ATOM   2609  N  N   . MET A  1  363 ? 31.536  34.036  30.990  1.00 57.62 ? 391  MET A N   1 
ATOM   2610  C  CA  . MET A  1  363 ? 30.525  34.132  29.940  1.00 58.53 ? 391  MET A CA  1 
ATOM   2611  C  C   . MET A  1  363 ? 29.650  32.890  30.006  1.00 58.58 ? 391  MET A C   1 
ATOM   2612  O  O   . MET A  1  363 ? 28.446  32.947  29.757  1.00 58.94 ? 391  MET A O   1 
ATOM   2613  C  CB  . MET A  1  363 ? 31.166  34.241  28.554  1.00 58.15 ? 391  MET A CB  1 
ATOM   2614  C  CG  . MET A  1  363 ? 31.619  35.636  28.173  1.00 57.48 ? 391  MET A CG  1 
ATOM   2615  S  SD  . MET A  1  363 ? 32.860  36.323  29.305  1.00 61.86 ? 391  MET A SD  1 
ATOM   2616  C  CE  . MET A  1  363 ? 34.449  35.906  28.486  1.00 59.91 ? 391  MET A CE  1 
ATOM   2617  N  N   . GLY A  1  364 ? 30.253  31.756  30.329  1.00 58.46 ? 392  GLY A N   1 
ATOM   2618  C  CA  . GLY A  1  364 ? 29.446  30.568  30.441  1.00 58.83 ? 392  GLY A CA  1 
ATOM   2619  C  C   . GLY A  1  364 ? 28.570  30.840  31.641  1.00 57.15 ? 392  GLY A C   1 
ATOM   2620  O  O   . GLY A  1  364 ? 27.348  30.843  31.552  1.00 56.84 ? 392  GLY A O   1 
ATOM   2621  N  N   . LYS A  1  365 ? 29.231  31.121  32.756  1.00 56.84 ? 393  LYS A N   1 
ATOM   2622  C  CA  . LYS A  1  365 ? 28.594  31.394  34.041  1.00 57.53 ? 393  LYS A CA  1 
ATOM   2623  C  C   . LYS A  1  365 ? 27.407  32.356  34.017  1.00 58.79 ? 393  LYS A C   1 
ATOM   2624  O  O   . LYS A  1  365 ? 26.416  32.159  34.726  1.00 57.15 ? 393  LYS A O   1 
ATOM   2625  C  CB  . LYS A  1  365 ? 29.651  31.912  35.016  1.00 57.58 ? 393  LYS A CB  1 
ATOM   2626  C  CG  . LYS A  1  365 ? 29.190  32.056  36.455  1.00 56.87 ? 393  LYS A CG  1 
ATOM   2627  C  CD  . LYS A  1  365 ? 30.378  32.288  37.392  1.00 56.74 ? 393  LYS A CD  1 
ATOM   2628  C  CE  . LYS A  1  365 ? 29.966  32.270  38.863  1.00 56.64 ? 393  LYS A CE  1 
ATOM   2629  N  NZ  . LYS A  1  365 ? 31.148  32.281  39.784  1.00 57.55 ? 393  LYS A NZ  1 
ATOM   2630  N  N   . TYR A  1  366 ? 27.510  33.403  33.207  1.00 59.75 ? 394  TYR A N   1 
ATOM   2631  C  CA  . TYR A  1  366 ? 26.442  34.387  33.110  1.00 58.49 ? 394  TYR A CA  1 
ATOM   2632  C  C   . TYR A  1  366 ? 25.525  34.149  31.922  1.00 57.96 ? 394  TYR A C   1 
ATOM   2633  O  O   . TYR A  1  366 ? 24.806  35.052  31.500  1.00 58.18 ? 394  TYR A O   1 
ATOM   2634  C  CB  . TYR A  1  366 ? 27.041  35.792  33.037  1.00 58.52 ? 394  TYR A CB  1 
ATOM   2635  C  CG  . TYR A  1  366 ? 27.449  36.331  34.390  1.00 59.81 ? 394  TYR A CG  1 
ATOM   2636  C  CD1 . TYR A  1  366 ? 28.283  35.595  35.234  1.00 59.78 ? 394  TYR A CD1 1 
ATOM   2637  C  CD2 . TYR A  1  366 ? 26.953  37.559  34.856  1.00 61.61 ? 394  TYR A CD2 1 
ATOM   2638  C  CE1 . TYR A  1  366 ? 28.607  36.060  36.519  1.00 60.03 ? 394  TYR A CE1 1 
ATOM   2639  C  CE2 . TYR A  1  366 ? 27.271  38.037  36.139  1.00 60.74 ? 394  TYR A CE2 1 
ATOM   2640  C  CZ  . TYR A  1  366 ? 28.094  37.277  36.964  1.00 60.69 ? 394  TYR A CZ  1 
ATOM   2641  O  OH  . TYR A  1  366 ? 28.371  37.717  38.240  1.00 61.53 ? 394  TYR A OH  1 
ATOM   2642  N  N   . THR A  1  367 ? 25.551  32.937  31.381  1.00 57.44 ? 395  THR A N   1 
ATOM   2643  C  CA  . THR A  1  367 ? 24.704  32.631  30.244  1.00 57.96 ? 395  THR A CA  1 
ATOM   2644  C  C   . THR A  1  367 ? 23.274  32.560  30.750  1.00 57.68 ? 395  THR A C   1 
ATOM   2645  O  O   . THR A  1  367 ? 22.951  31.758  31.618  1.00 59.42 ? 395  THR A O   1 
ATOM   2646  C  CB  . THR A  1  367 ? 25.107  31.291  29.576  1.00 58.13 ? 395  THR A CB  1 
ATOM   2647  O  OG1 . THR A  1  367 ? 24.302  31.077  28.412  1.00 58.56 ? 395  THR A OG1 1 
ATOM   2648  C  CG2 . THR A  1  367 ? 24.909  30.128  30.524  1.00 58.68 ? 395  THR A CG2 1 
ATOM   2649  N  N   . THR A  1  368 ? 22.420  33.428  30.234  1.00 56.89 ? 396  THR A N   1 
ATOM   2650  C  CA  . THR A  1  368 ? 21.036  33.426  30.663  1.00 57.42 ? 396  THR A CA  1 
ATOM   2651  C  C   . THR A  1  368 ? 20.246  32.517  29.730  1.00 58.37 ? 396  THR A C   1 
ATOM   2652  O  O   . THR A  1  368 ? 20.739  32.142  28.654  1.00 56.85 ? 396  THR A O   1 
ATOM   2653  C  CB  . THR A  1  368 ? 20.448  34.853  30.646  1.00 57.37 ? 396  THR A CB  1 
ATOM   2654  O  OG1 . THR A  1  368 ? 20.744  35.475  29.393  1.00 57.74 ? 396  THR A OG1 1 
ATOM   2655  C  CG2 . THR A  1  368 ? 21.042  35.691  31.760  1.00 56.15 ? 396  THR A CG2 1 
ATOM   2656  N  N   . PRO A  1  369 ? 19.024  32.117  30.148  1.00 58.71 ? 397  PRO A N   1 
ATOM   2657  C  CA  . PRO A  1  369 ? 18.105  31.244  29.402  1.00 56.60 ? 397  PRO A CA  1 
ATOM   2658  C  C   . PRO A  1  369 ? 17.556  31.889  28.138  1.00 56.87 ? 397  PRO A C   1 
ATOM   2659  O  O   . PRO A  1  369 ? 17.187  33.063  28.135  1.00 57.75 ? 397  PRO A O   1 
ATOM   2660  C  CB  . PRO A  1  369 ? 17.001  30.963  30.410  1.00 55.69 ? 397  PRO A CB  1 
ATOM   2661  C  CG  . PRO A  1  369 ? 17.725  31.016  31.712  1.00 57.81 ? 397  PRO A CG  1 
ATOM   2662  C  CD  . PRO A  1  369 ? 18.577  32.245  31.546  1.00 57.52 ? 397  PRO A CD  1 
ATOM   2663  N  N   . LEU A  1  370 ? 17.493  31.115  27.063  1.00 57.08 ? 398  LEU A N   1 
ATOM   2664  C  CA  . LEU A  1  370 ? 16.990  31.638  25.805  1.00 57.14 ? 398  LEU A CA  1 
ATOM   2665  C  C   . LEU A  1  370 ? 15.463  31.622  25.728  1.00 56.75 ? 398  LEU A C   1 
ATOM   2666  O  O   . LEU A  1  370 ? 14.809  30.619  26.033  1.00 57.10 ? 398  LEU A O   1 
ATOM   2667  C  CB  . LEU A  1  370 ? 17.599  30.867  24.621  1.00 56.03 ? 398  LEU A CB  1 
ATOM   2668  C  CG  . LEU A  1  370 ? 19.105  31.049  24.366  1.00 56.49 ? 398  LEU A CG  1 
ATOM   2669  C  CD1 . LEU A  1  370 ? 19.572  30.070  23.307  1.00 57.43 ? 398  LEU A CD1 1 
ATOM   2670  C  CD2 . LEU A  1  370 ? 19.400  32.467  23.918  1.00 56.28 ? 398  LEU A CD2 1 
ATOM   2671  N  N   . THR A  1  371 ? 14.916  32.767  25.326  1.00 57.13 ? 399  THR A N   1 
ATOM   2672  C  CA  . THR A  1  371 ? 13.478  32.985  25.164  1.00 57.46 ? 399  THR A CA  1 
ATOM   2673  C  C   . THR A  1  371 ? 13.041  32.556  23.755  1.00 56.99 ? 399  THR A C   1 
ATOM   2674  O  O   . THR A  1  371 ? 13.235  33.290  22.777  1.00 55.41 ? 399  THR A O   1 
ATOM   2675  C  CB  . THR A  1  371 ? 13.134  34.490  25.377  1.00 56.61 ? 399  THR A CB  1 
ATOM   2676  O  OG1 . THR A  1  371 ? 13.473  34.871  26.719  1.00 56.24 ? 399  THR A OG1 1 
ATOM   2677  C  CG2 . THR A  1  371 ? 11.662  34.763  25.123  1.00 54.91 ? 399  THR A CG2 1 
ATOM   2678  N  N   . ARG A  1  372 ? 12.445  31.368  23.667  1.00 56.59 ? 400  ARG A N   1 
ATOM   2679  C  CA  . ARG A  1  372 ? 11.996  30.810  22.394  1.00 56.52 ? 400  ARG A CA  1 
ATOM   2680  C  C   . ARG A  1  372 ? 11.164  31.790  21.580  1.00 56.49 ? 400  ARG A C   1 
ATOM   2681  O  O   . ARG A  1  372 ? 10.198  32.348  22.085  1.00 56.52 ? 400  ARG A O   1 
ATOM   2682  C  CB  . ARG A  1  372 ? 11.178  29.545  22.641  1.00 57.10 ? 400  ARG A CB  1 
ATOM   2683  C  CG  . ARG A  1  372 ? 11.622  28.750  23.864  1.00 58.88 ? 400  ARG A CG  1 
ATOM   2684  C  CD  . ARG A  1  372 ? 11.124  27.297  23.810  1.00 58.96 ? 400  ARG A CD  1 
ATOM   2685  N  NE  . ARG A  1  372 ? 11.860  26.439  24.739  1.00 60.22 ? 400  ARG A NE  1 
ATOM   2686  C  CZ  . ARG A  1  372 ? 12.122  25.143  24.548  1.00 60.59 ? 400  ARG A CZ  1 
ATOM   2687  N  NH1 . ARG A  1  372 ? 12.810  24.460  25.465  1.00 59.16 ? 400  ARG A NH1 1 
ATOM   2688  N  NH2 . ARG A  1  372 ? 11.706  24.523  23.447  1.00 60.92 ? 400  ARG A NH2 1 
ATOM   2689  N  N   . GLY A  1  373 ? 11.540  32.000  20.321  1.00 55.70 ? 401  GLY A N   1 
ATOM   2690  C  CA  . GLY A  1  373 ? 10.781  32.902  19.476  1.00 55.52 ? 401  GLY A CA  1 
ATOM   2691  C  C   . GLY A  1  373 ? 11.303  34.324  19.409  1.00 57.62 ? 401  GLY A C   1 
ATOM   2692  O  O   . GLY A  1  373 ? 10.795  35.141  18.636  1.00 56.76 ? 401  GLY A O   1 
ATOM   2693  N  N   . VAL A  1  374 ? 12.307  34.629  20.228  1.00 59.01 ? 402  VAL A N   1 
ATOM   2694  C  CA  . VAL A  1  374 ? 12.921  35.963  20.253  1.00 56.42 ? 402  VAL A CA  1 
ATOM   2695  C  C   . VAL A  1  374 ? 14.418  35.768  20.124  1.00 55.49 ? 402  VAL A C   1 
ATOM   2696  O  O   . VAL A  1  374 ? 15.017  36.119  19.114  1.00 55.36 ? 402  VAL A O   1 
ATOM   2697  C  CB  . VAL A  1  374 ? 12.642  36.712  21.578  1.00 55.86 ? 402  VAL A CB  1 
ATOM   2698  C  CG1 . VAL A  1  374 ? 13.452  37.991  21.629  1.00 55.06 ? 402  VAL A CG1 1 
ATOM   2699  C  CG2 . VAL A  1  374 ? 11.164  37.028  21.701  1.00 55.59 ? 402  VAL A CG2 1 
ATOM   2700  N  N   . ASP A  1  375 ? 15.012  35.188  21.159  1.00 56.34 ? 403  ASP A N   1 
ATOM   2701  C  CA  . ASP A  1  375 ? 16.441  34.920  21.164  1.00 57.25 ? 403  ASP A CA  1 
ATOM   2702  C  C   . ASP A  1  375 ? 16.753  33.933  20.028  1.00 57.31 ? 403  ASP A C   1 
ATOM   2703  O  O   . ASP A  1  375 ? 17.823  33.975  19.431  1.00 57.06 ? 403  ASP A O   1 
ATOM   2704  C  CB  . ASP A  1  375 ? 16.882  34.341  22.533  1.00 58.33 ? 403  ASP A CB  1 
ATOM   2705  C  CG  . ASP A  1  375 ? 16.625  35.313  23.715  1.00 58.46 ? 403  ASP A CG  1 
ATOM   2706  O  OD1 . ASP A  1  375 ? 16.518  36.531  23.467  1.00 58.79 ? 403  ASP A OD1 1 
ATOM   2707  O  OD2 . ASP A  1  375 ? 16.548  34.871  24.893  1.00 57.09 ? 403  ASP A OD2 1 
ATOM   2708  N  N   . CYS A  1  376 ? 15.802  33.053  19.734  1.00 57.60 ? 404  CYS A N   1 
ATOM   2709  C  CA  . CYS A  1  376 ? 15.961  32.071  18.674  1.00 57.09 ? 404  CYS A CA  1 
ATOM   2710  C  C   . CYS A  1  376 ? 14.604  31.821  18.092  1.00 58.45 ? 404  CYS A C   1 
ATOM   2711  O  O   . CYS A  1  376 ? 13.586  32.107  18.722  1.00 57.75 ? 404  CYS A O   1 
ATOM   2712  C  CB  . CYS A  1  376 ? 16.488  30.757  19.220  1.00 56.25 ? 404  CYS A CB  1 
ATOM   2713  S  SG  . CYS A  1  376 ? 18.132  30.915  19.945  1.00 57.92 ? 404  CYS A SG  1 
ATOM   2714  N  N   . PRO A  1  377 ? 14.565  31.277  16.875  1.00 59.40 ? 405  PRO A N   1 
ATOM   2715  C  CA  . PRO A  1  377 ? 13.269  31.001  16.251  1.00 60.58 ? 405  PRO A CA  1 
ATOM   2716  C  C   . PRO A  1  377 ? 12.480  30.035  17.133  1.00 60.66 ? 405  PRO A C   1 
ATOM   2717  O  O   . PRO A  1  377 ? 13.048  29.372  18.011  1.00 59.34 ? 405  PRO A O   1 
ATOM   2718  C  CB  . PRO A  1  377 ? 13.656  30.379  14.908  1.00 59.46 ? 405  PRO A CB  1 
ATOM   2719  C  CG  . PRO A  1  377 ? 14.993  31.019  14.609  1.00 59.21 ? 405  PRO A CG  1 
ATOM   2720  C  CD  . PRO A  1  377 ? 15.678  30.977  15.958  1.00 58.95 ? 405  PRO A CD  1 
ATOM   2721  N  N   . TYR A  1  378 ? 11.173  29.964  16.914  1.00 61.32 ? 406  TYR A N   1 
ATOM   2722  C  CA  . TYR A  1  378 ? 10.354  29.050  17.694  1.00 62.55 ? 406  TYR A CA  1 
ATOM   2723  C  C   . TYR A  1  378 ? 10.782  27.626  17.394  1.00 62.11 ? 406  TYR A C   1 
ATOM   2724  O  O   . TYR A  1  378 ? 11.114  26.860  18.299  1.00 61.79 ? 406  TYR A O   1 
ATOM   2725  C  CB  . TYR A  1  378 ? 8.870   29.211  17.359  1.00 63.20 ? 406  TYR A CB  1 
ATOM   2726  C  CG  . TYR A  1  378 ? 8.161   30.292  18.158  1.00 65.70 ? 406  TYR A CG  1 
ATOM   2727  C  CD1 . TYR A  1  378 ? 8.171   31.629  17.734  1.00 65.79 ? 406  TYR A CD1 1 
ATOM   2728  C  CD2 . TYR A  1  378 ? 7.480   29.978  19.349  1.00 65.87 ? 406  TYR A CD2 1 
ATOM   2729  C  CE1 . TYR A  1  378 ? 7.516   32.637  18.478  1.00 66.10 ? 406  TYR A CE1 1 
ATOM   2730  C  CE2 . TYR A  1  378 ? 6.823   30.978  20.103  1.00 66.95 ? 406  TYR A CE2 1 
ATOM   2731  C  CZ  . TYR A  1  378 ? 6.846   32.306  19.661  1.00 67.01 ? 406  TYR A CZ  1 
ATOM   2732  O  OH  . TYR A  1  378 ? 6.211   33.291  20.400  1.00 67.18 ? 406  TYR A OH  1 
ATOM   2733  N  N   . LEU A  1  379 ? 10.780  27.282  16.111  1.00 61.76 ? 407  LEU A N   1 
ATOM   2734  C  CA  . LEU A  1  379 ? 11.156  25.945  15.690  1.00 61.36 ? 407  LEU A CA  1 
ATOM   2735  C  C   . LEU A  1  379 ? 12.660  25.697  15.692  1.00 61.64 ? 407  LEU A C   1 
ATOM   2736  O  O   . LEU A  1  379 ? 13.269  25.447  14.651  1.00 62.63 ? 407  LEU A O   1 
ATOM   2737  C  CB  . LEU A  1  379 ? 10.582  25.646  14.300  1.00 63.95 ? 407  LEU A CB  1 
ATOM   2738  C  CG  . LEU A  1  379 ? 9.423   24.630  14.212  1.00 64.69 ? 407  LEU A CG  1 
ATOM   2739  C  CD1 . LEU A  1  379 ? 9.137   24.268  12.734  1.00 62.78 ? 407  LEU A CD1 1 
ATOM   2740  C  CD2 . LEU A  1  379 ? 9.787   23.361  15.014  1.00 64.10 ? 407  LEU A CD2 1 
ATOM   2741  N  N   . ALA A  1  380 ? 13.260  25.771  16.869  1.00 61.12 ? 408  ALA A N   1 
ATOM   2742  C  CA  . ALA A  1  380 ? 14.682  25.522  17.002  1.00 60.92 ? 408  ALA A CA  1 
ATOM   2743  C  C   . ALA A  1  380 ? 14.800  24.432  18.050  1.00 61.27 ? 408  ALA A C   1 
ATOM   2744  O  O   . ALA A  1  380 ? 13.814  24.083  18.701  1.00 61.85 ? 408  ALA A O   1 
ATOM   2745  C  CB  . ALA A  1  380 ? 15.405  26.787  17.464  1.00 60.54 ? 408  ALA A CB  1 
ATOM   2746  N  N   . THR A  1  381 ? 15.995  23.877  18.199  1.00 61.43 ? 409  THR A N   1 
ATOM   2747  C  CA  . THR A  1  381 ? 16.228  22.846  19.200  1.00 60.92 ? 409  THR A CA  1 
ATOM   2748  C  C   . THR A  1  381 ? 16.907  23.537  20.372  1.00 60.53 ? 409  THR A C   1 
ATOM   2749  O  O   . THR A  1  381 ? 17.964  24.135  20.205  1.00 60.76 ? 409  THR A O   1 
ATOM   2750  C  CB  . THR A  1  381 ? 17.137  21.733  18.651  1.00 60.51 ? 409  THR A CB  1 
ATOM   2751  O  OG1 . THR A  1  381 ? 16.425  20.981  17.658  1.00 60.66 ? 409  THR A OG1 1 
ATOM   2752  C  CG2 . THR A  1  381 ? 17.591  20.815  19.769  1.00 60.02 ? 409  THR A CG2 1 
ATOM   2753  N  N   . TYR A  1  382 ? 16.298  23.482  21.550  1.00 60.37 ? 410  TYR A N   1 
ATOM   2754  C  CA  . TYR A  1  382 ? 16.886  24.137  22.707  1.00 60.82 ? 410  TYR A CA  1 
ATOM   2755  C  C   . TYR A  1  382 ? 17.615  23.191  23.621  1.00 61.58 ? 410  TYR A C   1 
ATOM   2756  O  O   . TYR A  1  382 ? 17.165  22.079  23.857  1.00 62.88 ? 410  TYR A O   1 
ATOM   2757  C  CB  . TYR A  1  382 ? 15.823  24.880  23.483  1.00 60.42 ? 410  TYR A CB  1 
ATOM   2758  C  CG  . TYR A  1  382 ? 15.262  26.021  22.694  1.00 59.72 ? 410  TYR A CG  1 
ATOM   2759  C  CD1 . TYR A  1  382 ? 14.444  25.792  21.595  1.00 59.57 ? 410  TYR A CD1 1 
ATOM   2760  C  CD2 . TYR A  1  382 ? 15.569  27.336  23.029  1.00 59.74 ? 410  TYR A CD2 1 
ATOM   2761  C  CE1 . TYR A  1  382 ? 13.936  26.849  20.841  1.00 61.66 ? 410  TYR A CE1 1 
ATOM   2762  C  CE2 . TYR A  1  382 ? 15.069  28.408  22.283  1.00 61.25 ? 410  TYR A CE2 1 
ATOM   2763  C  CZ  . TYR A  1  382 ? 14.249  28.161  21.186  1.00 61.61 ? 410  TYR A CZ  1 
ATOM   2764  O  OH  . TYR A  1  382 ? 13.743  29.210  20.436  1.00 59.95 ? 410  TYR A OH  1 
ATOM   2765  N  N   . VAL A  1  383 ? 18.739  23.649  24.154  1.00 61.53 ? 411  VAL A N   1 
ATOM   2766  C  CA  . VAL A  1  383 ? 19.553  22.814  25.018  1.00 62.22 ? 411  VAL A CA  1 
ATOM   2767  C  C   . VAL A  1  383 ? 19.859  23.406  26.386  1.00 63.72 ? 411  VAL A C   1 
ATOM   2768  O  O   . VAL A  1  383 ? 19.946  24.615  26.552  1.00 65.19 ? 411  VAL A O   1 
ATOM   2769  C  CB  . VAL A  1  383 ? 20.884  22.481  24.323  1.00 63.55 ? 411  VAL A CB  1 
ATOM   2770  C  CG1 . VAL A  1  383 ? 21.663  21.440  25.134  1.00 63.74 ? 411  VAL A CG1 1 
ATOM   2771  C  CG2 . VAL A  1  383 ? 20.613  21.981  22.908  1.00 63.07 ? 411  VAL A CG2 1 
ATOM   2772  N  N   . ASP A  1  384 ? 20.040  22.526  27.363  1.00 64.79 ? 412  ASP A N   1 
ATOM   2773  C  CA  . ASP A  1  384 ? 20.344  22.915  28.731  1.00 64.87 ? 412  ASP A CA  1 
ATOM   2774  C  C   . ASP A  1  384 ? 21.834  22.964  28.971  1.00 64.84 ? 412  ASP A C   1 
ATOM   2775  O  O   . ASP A  1  384 ? 22.621  22.685  28.076  1.00 65.47 ? 412  ASP A O   1 
ATOM   2776  C  CB  . ASP A  1  384 ? 19.725  21.918  29.691  1.00 65.44 ? 412  ASP A CB  1 
ATOM   2777  C  CG  . ASP A  1  384 ? 18.235  22.001  29.706  1.00 67.71 ? 412  ASP A CG  1 
ATOM   2778  O  OD1 . ASP A  1  384 ? 17.650  22.462  28.692  1.00 68.60 ? 412  ASP A OD1 1 
ATOM   2779  O  OD2 . ASP A  1  384 ? 17.651  21.599  30.732  1.00 68.77 ? 412  ASP A OD2 1 
ATOM   2780  N  N   . TRP A  1  385 ? 22.212  23.322  30.191  1.00 65.24 ? 413  TRP A N   1 
ATOM   2781  C  CA  . TRP A  1  385 ? 23.610  23.402  30.570  1.00 64.64 ? 413  TRP A CA  1 
ATOM   2782  C  C   . TRP A  1  385 ? 23.700  23.224  32.070  1.00 66.23 ? 413  TRP A C   1 
ATOM   2783  O  O   . TRP A  1  385 ? 23.018  23.922  32.825  1.00 65.45 ? 413  TRP A O   1 
ATOM   2784  C  CB  . TRP A  1  385 ? 24.199  24.756  30.186  1.00 63.95 ? 413  TRP A CB  1 
ATOM   2785  C  CG  . TRP A  1  385 ? 25.703  24.790  30.248  1.00 64.10 ? 413  TRP A CG  1 
ATOM   2786  C  CD1 . TRP A  1  385 ? 26.575  24.008  29.536  1.00 64.72 ? 413  TRP A CD1 1 
ATOM   2787  C  CD2 . TRP A  1  385 ? 26.513  25.677  31.029  1.00 63.90 ? 413  TRP A CD2 1 
ATOM   2788  N  NE1 . TRP A  1  385 ? 27.873  24.357  29.823  1.00 63.90 ? 413  TRP A NE1 1 
ATOM   2789  C  CE2 . TRP A  1  385 ? 27.865  25.379  30.736  1.00 63.67 ? 413  TRP A CE2 1 
ATOM   2790  C  CE3 . TRP A  1  385 ? 26.230  26.697  31.945  1.00 63.60 ? 413  TRP A CE3 1 
ATOM   2791  C  CZ2 . TRP A  1  385 ? 28.931  26.068  31.326  1.00 63.84 ? 413  TRP A CZ2 1 
ATOM   2792  C  CZ3 . TRP A  1  385 ? 27.292  27.379  32.533  1.00 63.74 ? 413  TRP A CZ3 1 
ATOM   2793  C  CH2 . TRP A  1  385 ? 28.626  27.061  32.219  1.00 63.36 ? 413  TRP A CH2 1 
ATOM   2794  N  N   . HIS A  1  386 ? 24.542  22.285  32.494  1.00 66.98 ? 414  HIS A N   1 
ATOM   2795  C  CA  . HIS A  1  386 ? 24.735  21.990  33.912  1.00 67.46 ? 414  HIS A CA  1 
ATOM   2796  C  C   . HIS A  1  386 ? 26.028  22.639  34.388  1.00 66.48 ? 414  HIS A C   1 
ATOM   2797  O  O   . HIS A  1  386 ? 26.954  22.813  33.597  1.00 66.06 ? 414  HIS A O   1 
ATOM   2798  C  CB  . HIS A  1  386 ? 24.794  20.479  34.116  1.00 70.16 ? 414  HIS A CB  1 
ATOM   2799  C  CG  . HIS A  1  386 ? 23.781  19.728  33.313  1.00 72.13 ? 414  HIS A CG  1 
ATOM   2800  N  ND1 . HIS A  1  386 ? 22.424  19.933  33.449  1.00 71.21 ? 414  HIS A ND1 1 
ATOM   2801  C  CD2 . HIS A  1  386 ? 23.928  18.779  32.357  1.00 72.52 ? 414  HIS A CD2 1 
ATOM   2802  C  CE1 . HIS A  1  386 ? 21.779  19.142  32.613  1.00 72.33 ? 414  HIS A CE1 1 
ATOM   2803  N  NE2 . HIS A  1  386 ? 22.669  18.431  31.940  1.00 73.68 ? 414  HIS A NE2 1 
ATOM   2804  N  N   . PHE A  1  387 ? 26.098  22.976  35.677  1.00 67.19 ? 415  PHE A N   1 
ATOM   2805  C  CA  . PHE A  1  387 ? 27.282  23.645  36.218  1.00 66.99 ? 415  PHE A CA  1 
ATOM   2806  C  C   . PHE A  1  387 ? 27.430  23.628  37.737  1.00 67.26 ? 415  PHE A C   1 
ATOM   2807  O  O   . PHE A  1  387 ? 26.451  23.679  38.488  1.00 66.91 ? 415  PHE A O   1 
ATOM   2808  C  CB  . PHE A  1  387 ? 27.290  25.107  35.757  1.00 67.57 ? 415  PHE A CB  1 
ATOM   2809  C  CG  . PHE A  1  387 ? 26.137  25.908  36.288  1.00 66.04 ? 415  PHE A CG  1 
ATOM   2810  C  CD1 . PHE A  1  387 ? 26.216  26.513  37.532  1.00 65.78 ? 415  PHE A CD1 1 
ATOM   2811  C  CD2 . PHE A  1  387 ? 24.942  25.987  35.574  1.00 65.62 ? 415  PHE A CD2 1 
ATOM   2812  C  CE1 . PHE A  1  387 ? 25.123  27.175  38.057  1.00 66.62 ? 415  PHE A CE1 1 
ATOM   2813  C  CE2 . PHE A  1  387 ? 23.842  26.647  36.091  1.00 65.05 ? 415  PHE A CE2 1 
ATOM   2814  C  CZ  . PHE A  1  387 ? 23.929  27.241  37.333  1.00 65.97 ? 415  PHE A CZ  1 
ATOM   2815  N  N   . LEU A  1  388 ? 28.677  23.582  38.183  1.00 68.04 ? 416  LEU A N   1 
ATOM   2816  C  CA  . LEU A  1  388 ? 28.957  23.602  39.601  1.00 68.57 ? 416  LEU A CA  1 
ATOM   2817  C  C   . LEU A  1  388 ? 29.807  24.827  39.853  1.00 67.89 ? 416  LEU A C   1 
ATOM   2818  O  O   . LEU A  1  388 ? 31.039  24.762  39.875  1.00 67.43 ? 416  LEU A O   1 
ATOM   2819  C  CB  . LEU A  1  388 ? 29.689  22.336  40.028  1.00 68.49 ? 416  LEU A CB  1 
ATOM   2820  C  CG  . LEU A  1  388 ? 29.574  22.105  41.532  1.00 68.56 ? 416  LEU A CG  1 
ATOM   2821  C  CD1 . LEU A  1  388 ? 28.169  22.453  42.021  1.00 69.13 ? 416  LEU A CD1 1 
ATOM   2822  C  CD2 . LEU A  1  388 ? 29.894  20.663  41.827  1.00 69.17 ? 416  LEU A CD2 1 
ATOM   2823  N  N   . LEU A  1  389 ? 29.123  25.949  40.025  1.00 67.17 ? 417  LEU A N   1 
ATOM   2824  C  CA  . LEU A  1  389 ? 29.781  27.220  40.254  1.00 68.14 ? 417  LEU A CA  1 
ATOM   2825  C  C   . LEU A  1  389 ? 29.326  27.869  41.533  1.00 68.28 ? 417  LEU A C   1 
ATOM   2826  O  O   . LEU A  1  389 ? 28.128  27.923  41.810  1.00 68.54 ? 417  LEU A O   1 
ATOM   2827  C  CB  . LEU A  1  389 ? 29.499  28.147  39.094  1.00 67.83 ? 417  LEU A CB  1 
ATOM   2828  C  CG  . LEU A  1  389 ? 30.340  27.799  37.882  1.00 68.07 ? 417  LEU A CG  1 
ATOM   2829  C  CD1 . LEU A  1  389 ? 29.626  28.270  36.629  1.00 67.90 ? 417  LEU A CD1 1 
ATOM   2830  C  CD2 . LEU A  1  389 ? 31.726  28.428  38.045  1.00 67.91 ? 417  LEU A CD2 1 
ATOM   2831  N  N   . GLU A  1  390 ? 30.291  28.379  42.293  1.00 68.27 ? 418  GLU A N   1 
ATOM   2832  C  CA  . GLU A  1  390 ? 30.020  29.014  43.575  1.00 68.56 ? 418  GLU A CA  1 
ATOM   2833  C  C   . GLU A  1  390 ? 28.956  28.266  44.381  1.00 69.84 ? 418  GLU A C   1 
ATOM   2834  O  O   . GLU A  1  390 ? 28.237  28.868  45.183  1.00 69.61 ? 418  GLU A O   1 
ATOM   2835  C  CB  . GLU A  1  390 ? 29.589  30.466  43.376  1.00 66.89 ? 418  GLU A CB  1 
ATOM   2836  C  CG  . GLU A  1  390 ? 30.746  31.416  43.173  1.00 67.36 ? 418  GLU A CG  1 
ATOM   2837  C  CD  . GLU A  1  390 ? 30.468  32.788  43.758  1.00 67.97 ? 418  GLU A CD  1 
ATOM   2838  O  OE1 . GLU A  1  390 ? 30.354  32.906  45.004  1.00 67.18 ? 418  GLU A OE1 1 
ATOM   2839  O  OE2 . GLU A  1  390 ? 30.357  33.751  42.969  1.00 68.23 ? 418  GLU A OE2 1 
ATOM   2840  N  N   . SER A  1  391 ? 28.873  26.952  44.177  1.00 70.22 ? 419  SER A N   1 
ATOM   2841  C  CA  . SER A  1  391 ? 27.892  26.118  44.867  1.00 69.45 ? 419  SER A CA  1 
ATOM   2842  C  C   . SER A  1  391 ? 28.453  24.725  45.159  1.00 69.29 ? 419  SER A C   1 
ATOM   2843  O  O   . SER A  1  391 ? 29.560  24.379  44.728  1.00 68.50 ? 419  SER A O   1 
ATOM   2844  C  CB  . SER A  1  391 ? 26.621  25.994  44.010  1.00 69.34 ? 419  SER A CB  1 
ATOM   2845  O  OG  . SER A  1  391 ? 25.565  25.365  44.720  1.00 70.05 ? 419  SER A OG  1 
ATOM   2846  N  N   . GLN A  1  392 ? 27.683  23.939  45.906  1.00 68.76 ? 420  GLN A N   1 
ATOM   2847  C  CA  . GLN A  1  392 ? 28.080  22.586  46.238  1.00 68.52 ? 420  GLN A CA  1 
ATOM   2848  C  C   . GLN A  1  392 ? 27.173  21.632  45.496  1.00 69.43 ? 420  GLN A C   1 
ATOM   2849  O  O   . GLN A  1  392 ? 27.410  20.425  45.472  1.00 70.95 ? 420  GLN A O   1 
ATOM   2850  C  CB  . GLN A  1  392 ? 27.982  22.346  47.741  1.00 69.60 ? 420  GLN A CB  1 
ATOM   2851  C  CG  . GLN A  1  392 ? 28.964  23.186  48.546  1.00 71.91 ? 420  GLN A CG  1 
ATOM   2852  C  CD  . GLN A  1  392 ? 29.452  22.490  49.812  1.00 72.36 ? 420  GLN A CD  1 
ATOM   2853  O  OE1 . GLN A  1  392 ? 28.649  22.086  50.661  1.00 72.50 ? 420  GLN A OE1 1 
ATOM   2854  N  NE2 . GLN A  1  392 ? 30.777  22.350  49.944  1.00 72.27 ? 420  GLN A NE2 1 
ATOM   2855  N  N   . ALA A  1  393 ? 26.133  22.186  44.884  1.00 69.07 ? 421  ALA A N   1 
ATOM   2856  C  CA  . ALA A  1  393 ? 25.184  21.398  44.116  1.00 68.32 ? 421  ALA A CA  1 
ATOM   2857  C  C   . ALA A  1  393 ? 25.109  21.952  42.705  1.00 68.75 ? 421  ALA A C   1 
ATOM   2858  O  O   . ALA A  1  393 ? 24.946  23.156  42.503  1.00 69.80 ? 421  ALA A O   1 
ATOM   2859  C  CB  . ALA A  1  393 ? 23.824  21.446  44.763  1.00 68.65 ? 421  ALA A CB  1 
ATOM   2860  N  N   . PRO A  1  394 ? 25.254  21.082  41.702  1.00 68.73 ? 422  PRO A N   1 
ATOM   2861  C  CA  . PRO A  1  394 ? 25.185  21.559  40.324  1.00 69.65 ? 422  PRO A CA  1 
ATOM   2862  C  C   . PRO A  1  394 ? 23.758  21.924  39.938  1.00 69.06 ? 422  PRO A C   1 
ATOM   2863  O  O   . PRO A  1  394 ? 22.805  21.232  40.305  1.00 68.61 ? 422  PRO A O   1 
ATOM   2864  C  CB  . PRO A  1  394 ? 25.737  20.379  39.524  1.00 69.83 ? 422  PRO A CB  1 
ATOM   2865  C  CG  . PRO A  1  394 ? 25.338  19.203  40.341  1.00 69.46 ? 422  PRO A CG  1 
ATOM   2866  C  CD  . PRO A  1  394 ? 25.643  19.663  41.746  1.00 69.79 ? 422  PRO A CD  1 
ATOM   2867  N  N   . LYS A  1  395 ? 23.627  23.023  39.204  1.00 68.77 ? 423  LYS A N   1 
ATOM   2868  C  CA  . LYS A  1  395 ? 22.335  23.521  38.752  1.00 68.45 ? 423  LYS A CA  1 
ATOM   2869  C  C   . LYS A  1  395 ? 22.309  23.522  37.229  1.00 67.78 ? 423  LYS A C   1 
ATOM   2870  O  O   . LYS A  1  395 ? 23.349  23.401  36.599  1.00 68.24 ? 423  LYS A O   1 
ATOM   2871  C  CB  . LYS A  1  395 ? 22.128  24.929  39.299  1.00 68.85 ? 423  LYS A CB  1 
ATOM   2872  C  CG  . LYS A  1  395 ? 22.097  24.972  40.820  1.00 70.23 ? 423  LYS A CG  1 
ATOM   2873  C  CD  . LYS A  1  395 ? 22.674  26.269  41.375  1.00 71.51 ? 423  LYS A CD  1 
ATOM   2874  C  CE  . LYS A  1  395 ? 24.202  26.271  41.334  1.00 72.00 ? 423  LYS A CE  1 
ATOM   2875  N  NZ  . LYS A  1  395 ? 24.757  27.559  41.845  1.00 73.70 ? 423  LYS A NZ  1 
ATOM   2876  N  N   . THR A  1  396 ? 21.127  23.655  36.635  1.00 68.30 ? 424  THR A N   1 
ATOM   2877  C  CA  . THR A  1  396 ? 21.002  23.642  35.175  1.00 67.60 ? 424  THR A CA  1 
ATOM   2878  C  C   . THR A  1  396 ? 20.356  24.924  34.629  1.00 67.61 ? 424  THR A C   1 
ATOM   2879  O  O   . THR A  1  396 ? 19.539  25.552  35.301  1.00 67.71 ? 424  THR A O   1 
ATOM   2880  C  CB  . THR A  1  396 ? 20.145  22.421  34.703  1.00 67.31 ? 424  THR A CB  1 
ATOM   2881  O  OG1 . THR A  1  396 ? 20.598  21.228  35.355  1.00 67.69 ? 424  THR A OG1 1 
ATOM   2882  C  CG2 . THR A  1  396 ? 20.263  22.222  33.199  1.00 67.53 ? 424  THR A CG2 1 
ATOM   2883  N  N   . ILE A  1  397 ? 20.737  25.318  33.416  1.00 67.01 ? 425  ILE A N   1 
ATOM   2884  C  CA  . ILE A  1  397 ? 20.155  26.499  32.778  1.00 66.29 ? 425  ILE A CA  1 
ATOM   2885  C  C   . ILE A  1  397 ? 19.404  26.014  31.559  1.00 65.86 ? 425  ILE A C   1 
ATOM   2886  O  O   . ILE A  1  397 ? 19.991  25.489  30.615  1.00 65.69 ? 425  ILE A O   1 
ATOM   2887  C  CB  . ILE A  1  397 ? 21.206  27.498  32.297  1.00 66.55 ? 425  ILE A CB  1 
ATOM   2888  C  CG1 . ILE A  1  397 ? 21.993  28.039  33.484  1.00 66.51 ? 425  ILE A CG1 1 
ATOM   2889  C  CG2 . ILE A  1  397 ? 20.522  28.643  31.553  1.00 66.24 ? 425  ILE A CG2 1 
ATOM   2890  C  CD1 . ILE A  1  397 ? 23.046  29.041  33.082  1.00 66.82 ? 425  ILE A CD1 1 
ATOM   2891  N  N   . ARG A  1  398 ? 18.097  26.196  31.570  1.00 66.08 ? 426  ARG A N   1 
ATOM   2892  C  CA  . ARG A  1  398 ? 17.307  25.724  30.456  1.00 66.13 ? 426  ARG A CA  1 
ATOM   2893  C  C   . ARG A  1  398 ? 17.516  26.502  29.194  1.00 65.62 ? 426  ARG A C   1 
ATOM   2894  O  O   . ARG A  1  398 ? 17.618  27.725  29.206  1.00 66.53 ? 426  ARG A O   1 
ATOM   2895  C  CB  . ARG A  1  398 ? 15.829  25.731  30.812  1.00 67.34 ? 426  ARG A CB  1 
ATOM   2896  C  CG  . ARG A  1  398 ? 15.519  24.793  31.940  1.00 68.44 ? 426  ARG A CG  1 
ATOM   2897  C  CD  . ARG A  1  398 ? 14.038  24.612  32.122  1.00 70.73 ? 426  ARG A CD  1 
ATOM   2898  N  NE  . ARG A  1  398 ? 13.758  23.880  33.358  1.00 74.06 ? 426  ARG A NE  1 
ATOM   2899  C  CZ  . ARG A  1  398 ? 12.540  23.536  33.776  1.00 75.01 ? 426  ARG A CZ  1 
ATOM   2900  N  NH1 . ARG A  1  398 ? 11.470  23.857  33.049  1.00 76.52 ? 426  ARG A NH1 1 
ATOM   2901  N  NH2 . ARG A  1  398 ? 12.392  22.878  34.925  1.00 74.82 ? 426  ARG A NH2 1 
ATOM   2902  N  N   . ASP A  1  399 ? 17.593  25.776  28.094  1.00 64.20 ? 427  ASP A N   1 
ATOM   2903  C  CA  . ASP A  1  399 ? 17.756  26.426  26.824  1.00 63.87 ? 427  ASP A CA  1 
ATOM   2904  C  C   . ASP A  1  399 ? 18.895  27.423  26.897  1.00 62.33 ? 427  ASP A C   1 
ATOM   2905  O  O   . ASP A  1  399 ? 18.698  28.611  26.694  1.00 62.76 ? 427  ASP A O   1 
ATOM   2906  C  CB  . ASP A  1  399 ? 16.457  27.129  26.486  1.00 64.13 ? 427  ASP A CB  1 
ATOM   2907  C  CG  . ASP A  1  399 ? 15.253  26.296  26.855  1.00 64.47 ? 427  ASP A CG  1 
ATOM   2908  O  OD1 . ASP A  1  399 ? 14.179  26.899  27.074  1.00 64.28 ? 427  ASP A OD1 1 
ATOM   2909  O  OD2 . ASP A  1  399 ? 15.388  25.046  26.925  1.00 62.99 ? 427  ASP A OD2 1 
ATOM   2910  N  N   . ALA A  1  400 ? 20.081  26.937  27.228  1.00 61.36 ? 428  ALA A N   1 
ATOM   2911  C  CA  . ALA A  1  400 ? 21.247  27.789  27.273  1.00 60.78 ? 428  ALA A CA  1 
ATOM   2912  C  C   . ALA A  1  400 ? 21.668  27.961  25.810  1.00 61.88 ? 428  ALA A C   1 
ATOM   2913  O  O   . ALA A  1  400 ? 21.984  29.069  25.358  1.00 61.70 ? 428  ALA A O   1 
ATOM   2914  C  CB  . ALA A  1  400 ? 22.335  27.123  28.061  1.00 61.46 ? 428  ALA A CB  1 
ATOM   2915  N  N   . PHE A  1  401 ? 21.662  26.849  25.073  1.00 60.76 ? 429  PHE A N   1 
ATOM   2916  C  CA  . PHE A  1  401 ? 22.007  26.860  23.654  1.00 60.08 ? 429  PHE A CA  1 
ATOM   2917  C  C   . PHE A  1  401 ? 20.755  26.668  22.818  1.00 60.03 ? 429  PHE A C   1 
ATOM   2918  O  O   . PHE A  1  401 ? 19.727  26.190  23.298  1.00 59.76 ? 429  PHE A O   1 
ATOM   2919  C  CB  . PHE A  1  401 ? 22.950  25.716  23.280  1.00 59.22 ? 429  PHE A CB  1 
ATOM   2920  C  CG  . PHE A  1  401 ? 24.132  25.595  24.159  1.00 59.94 ? 429  PHE A CG  1 
ATOM   2921  C  CD1 . PHE A  1  401 ? 24.067  24.842  25.321  1.00 60.49 ? 429  PHE A CD1 1 
ATOM   2922  C  CD2 . PHE A  1  401 ? 25.311  26.252  23.847  1.00 60.37 ? 429  PHE A CD2 1 
ATOM   2923  C  CE1 . PHE A  1  401 ? 25.165  24.741  26.170  1.00 60.84 ? 429  PHE A CE1 1 
ATOM   2924  C  CE2 . PHE A  1  401 ? 26.415  26.161  24.686  1.00 60.60 ? 429  PHE A CE2 1 
ATOM   2925  C  CZ  . PHE A  1  401 ? 26.341  25.403  25.853  1.00 60.83 ? 429  PHE A CZ  1 
ATOM   2926  N  N   . CYS A  1  402 ? 20.855  27.048  21.553  1.00 59.95 ? 430  CYS A N   1 
ATOM   2927  C  CA  . CYS A  1  402 ? 19.765  26.855  20.618  1.00 59.87 ? 430  CYS A CA  1 
ATOM   2928  C  C   . CYS A  1  402 ? 20.423  26.607  19.270  1.00 59.85 ? 430  CYS A C   1 
ATOM   2929  O  O   . CYS A  1  402 ? 21.353  27.312  18.870  1.00 58.07 ? 430  CYS A O   1 
ATOM   2930  C  CB  . CYS A  1  402 ? 18.827  28.065  20.574  1.00 58.99 ? 430  CYS A CB  1 
ATOM   2931  S  SG  . CYS A  1  402 ? 19.133  29.286  19.271  1.00 57.56 ? 430  CYS A SG  1 
ATOM   2932  N  N   . VAL A  1  403 ? 19.956  25.559  18.603  1.00 59.33 ? 431  VAL A N   1 
ATOM   2933  C  CA  . VAL A  1  403 ? 20.474  25.150  17.313  1.00 57.50 ? 431  VAL A CA  1 
ATOM   2934  C  C   . VAL A  1  403 ? 19.296  25.108  16.376  1.00 56.59 ? 431  VAL A C   1 
ATOM   2935  O  O   . VAL A  1  403 ? 18.235  24.608  16.727  1.00 57.52 ? 431  VAL A O   1 
ATOM   2936  C  CB  . VAL A  1  403 ? 21.095  23.743  17.397  1.00 57.04 ? 431  VAL A CB  1 
ATOM   2937  C  CG1 . VAL A  1  403 ? 21.613  23.314  16.031  1.00 57.63 ? 431  VAL A CG1 1 
ATOM   2938  C  CG2 . VAL A  1  403 ? 22.203  23.731  18.443  1.00 56.05 ? 431  VAL A CG2 1 
ATOM   2939  N  N   . PHE A  1  404 ? 19.475  25.636  15.179  1.00 56.68 ? 432  PHE A N   1 
ATOM   2940  C  CA  . PHE A  1  404 ? 18.388  25.638  14.223  1.00 57.19 ? 432  PHE A CA  1 
ATOM   2941  C  C   . PHE A  1  404 ? 18.912  25.840  12.812  1.00 57.45 ? 432  PHE A C   1 
ATOM   2942  O  O   . PHE A  1  404 ? 20.112  25.921  12.593  1.00 58.59 ? 432  PHE A O   1 
ATOM   2943  C  CB  . PHE A  1  404 ? 17.384  26.734  14.590  1.00 57.01 ? 432  PHE A CB  1 
ATOM   2944  C  CG  . PHE A  1  404 ? 17.976  28.113  14.610  1.00 57.27 ? 432  PHE A CG  1 
ATOM   2945  C  CD1 . PHE A  1  404 ? 17.738  29.002  13.564  1.00 56.76 ? 432  PHE A CD1 1 
ATOM   2946  C  CD2 . PHE A  1  404 ? 18.799  28.517  15.662  1.00 57.00 ? 432  PHE A CD2 1 
ATOM   2947  C  CE1 . PHE A  1  404 ? 18.310  30.270  13.564  1.00 56.41 ? 432  PHE A CE1 1 
ATOM   2948  C  CE2 . PHE A  1  404 ? 19.379  29.786  15.670  1.00 56.45 ? 432  PHE A CE2 1 
ATOM   2949  C  CZ  . PHE A  1  404 ? 19.134  30.664  14.619  1.00 55.98 ? 432  PHE A CZ  1 
ATOM   2950  N  N   . GLU A  1  405 ? 18.002  25.919  11.858  1.00 56.77 ? 433  GLU A N   1 
ATOM   2951  C  CA  . GLU A  1  405 ? 18.362  26.095  10.476  1.00 55.16 ? 433  GLU A CA  1 
ATOM   2952  C  C   . GLU A  1  405 ? 17.611  27.336  10.045  1.00 55.48 ? 433  GLU A C   1 
ATOM   2953  O  O   . GLU A  1  405 ? 16.448  27.501  10.378  1.00 55.60 ? 433  GLU A O   1 
ATOM   2954  C  CB  . GLU A  1  405 ? 17.901  24.871  9.715   1.00 56.05 ? 433  GLU A CB  1 
ATOM   2955  C  CG  . GLU A  1  405 ? 18.550  24.667  8.389   1.00 57.83 ? 433  GLU A CG  1 
ATOM   2956  C  CD  . GLU A  1  405 ? 18.165  23.339  7.778   1.00 57.29 ? 433  GLU A CD  1 
ATOM   2957  O  OE1 . GLU A  1  405 ? 18.580  23.077  6.628   1.00 57.51 ? 433  GLU A OE1 1 
ATOM   2958  O  OE2 . GLU A  1  405 ? 17.451  22.561  8.452   1.00 56.33 ? 433  GLU A OE2 1 
ATOM   2959  N  N   . GLN A  1  406 ? 18.267  28.213  9.302   1.00 57.20 ? 434  GLN A N   1 
ATOM   2960  C  CA  . GLN A  1  406 ? 17.629  29.456  8.889   1.00 57.28 ? 434  GLN A CA  1 
ATOM   2961  C  C   . GLN A  1  406 ? 17.646  29.766  7.400   1.00 55.04 ? 434  GLN A C   1 
ATOM   2962  O  O   . GLN A  1  406 ? 18.691  30.029  6.828   1.00 55.28 ? 434  GLN A O   1 
ATOM   2963  C  CB  . GLN A  1  406 ? 18.279  30.625  9.652   1.00 58.06 ? 434  GLN A CB  1 
ATOM   2964  C  CG  . GLN A  1  406 ? 17.684  32.029  9.410   1.00 58.80 ? 434  GLN A CG  1 
ATOM   2965  C  CD  . GLN A  1  406 ? 16.282  32.213  10.001  1.00 58.82 ? 434  GLN A CD  1 
ATOM   2966  O  OE1 . GLN A  1  406 ? 15.996  31.743  11.100  1.00 58.55 ? 434  GLN A OE1 1 
ATOM   2967  N  NE2 . GLN A  1  406 ? 15.413  32.916  9.275   1.00 60.39 ? 434  GLN A NE2 1 
ATOM   2968  N  N   . ASN A  1  407 ? 16.486  29.728  6.765   1.00 55.22 ? 435  ASN A N   1 
ATOM   2969  C  CA  . ASN A  1  407 ? 16.450  30.099  5.369   1.00 56.47 ? 435  ASN A CA  1 
ATOM   2970  C  C   . ASN A  1  407 ? 16.749  31.599  5.389   1.00 56.74 ? 435  ASN A C   1 
ATOM   2971  O  O   . ASN A  1  407 ? 15.931  32.408  5.835   1.00 56.44 ? 435  ASN A O   1 
ATOM   2972  C  CB  . ASN A  1  407 ? 15.074  29.878  4.759   1.00 56.58 ? 435  ASN A CB  1 
ATOM   2973  C  CG  . ASN A  1  407 ? 14.790  30.866  3.646   1.00 57.97 ? 435  ASN A CG  1 
ATOM   2974  O  OD1 . ASN A  1  407 ? 15.516  30.914  2.648   1.00 56.54 ? 435  ASN A OD1 1 
ATOM   2975  N  ND2 . ASN A  1  407 ? 13.746  31.685  3.821   1.00 58.38 ? 435  ASN A ND2 1 
ATOM   2976  N  N   . GLN A  1  408 ? 17.926  31.963  4.907   1.00 57.29 ? 436  GLN A N   1 
ATOM   2977  C  CA  . GLN A  1  408 ? 18.354  33.356  4.885   1.00 56.19 ? 436  GLN A CA  1 
ATOM   2978  C  C   . GLN A  1  408 ? 17.469  34.281  4.065   1.00 55.28 ? 436  GLN A C   1 
ATOM   2979  O  O   . GLN A  1  408 ? 17.414  35.476  4.332   1.00 56.00 ? 436  GLN A O   1 
ATOM   2980  C  CB  . GLN A  1  408 ? 19.783  33.446  4.354   1.00 56.30 ? 436  GLN A CB  1 
ATOM   2981  C  CG  . GLN A  1  408 ? 20.793  32.576  5.100   1.00 57.06 ? 436  GLN A CG  1 
ATOM   2982  C  CD  . GLN A  1  408 ? 21.000  33.000  6.545   1.00 56.37 ? 436  GLN A CD  1 
ATOM   2983  O  OE1 . GLN A  1  408 ? 20.094  32.896  7.373   1.00 56.84 ? 436  GLN A OE1 1 
ATOM   2984  N  NE2 . GLN A  1  408 ? 22.199  33.482  6.852   1.00 55.76 ? 436  GLN A NE2 1 
ATOM   2985  N  N   . GLY A  1  409 ? 16.789  33.735  3.062   1.00 56.16 ? 437  GLY A N   1 
ATOM   2986  C  CA  . GLY A  1  409 ? 15.932  34.557  2.217   1.00 57.46 ? 437  GLY A CA  1 
ATOM   2987  C  C   . GLY A  1  409 ? 16.730  35.362  1.199   1.00 57.45 ? 437  GLY A C   1 
ATOM   2988  O  O   . GLY A  1  409 ? 16.280  36.391  0.691   1.00 57.09 ? 437  GLY A O   1 
ATOM   2989  N  N   . LEU A  1  410 ? 17.929  34.866  0.910   1.00 58.07 ? 438  LEU A N   1 
ATOM   2990  C  CA  . LEU A  1  410 ? 18.875  35.474  -0.026  1.00 56.54 ? 438  LEU A CA  1 
ATOM   2991  C  C   . LEU A  1  410 ? 19.519  34.294  -0.748  1.00 55.73 ? 438  LEU A C   1 
ATOM   2992  O  O   . LEU A  1  410 ? 19.649  33.212  -0.173  1.00 56.97 ? 438  LEU A O   1 
ATOM   2993  C  CB  . LEU A  1  410 ? 19.955  36.248  0.751   1.00 56.60 ? 438  LEU A CB  1 
ATOM   2994  C  CG  . LEU A  1  410 ? 21.079  37.011  0.034   1.00 56.58 ? 438  LEU A CG  1 
ATOM   2995  C  CD1 . LEU A  1  410 ? 20.711  38.495  -0.047  1.00 55.57 ? 438  LEU A CD1 1 
ATOM   2996  C  CD2 . LEU A  1  410 ? 22.397  36.847  0.798   1.00 55.69 ? 438  LEU A CD2 1 
ATOM   2997  N  N   . PRO A  1  411 ? 19.918  34.475  -2.014  1.00 55.54 ? 439  PRO A N   1 
ATOM   2998  C  CA  . PRO A  1  411 ? 20.544  33.350  -2.727  1.00 55.95 ? 439  PRO A CA  1 
ATOM   2999  C  C   . PRO A  1  411 ? 22.044  33.128  -2.437  1.00 56.78 ? 439  PRO A C   1 
ATOM   3000  O  O   . PRO A  1  411 ? 22.802  34.070  -2.169  1.00 57.90 ? 439  PRO A O   1 
ATOM   3001  C  CB  . PRO A  1  411 ? 20.260  33.676  -4.191  1.00 55.56 ? 439  PRO A CB  1 
ATOM   3002  C  CG  . PRO A  1  411 ? 20.229  35.191  -4.198  1.00 54.81 ? 439  PRO A CG  1 
ATOM   3003  C  CD  . PRO A  1  411 ? 19.500  35.542  -2.941  1.00 54.48 ? 439  PRO A CD  1 
ATOM   3004  N  N   . LEU A  1  412 ? 22.464  31.870  -2.485  1.00 56.32 ? 440  LEU A N   1 
ATOM   3005  C  CA  . LEU A  1  412 ? 23.855  31.509  -2.231  1.00 55.87 ? 440  LEU A CA  1 
ATOM   3006  C  C   . LEU A  1  412 ? 24.685  31.742  -3.491  1.00 56.56 ? 440  LEU A C   1 
ATOM   3007  O  O   . LEU A  1  412 ? 25.681  32.466  -3.475  1.00 57.07 ? 440  LEU A O   1 
ATOM   3008  C  CB  . LEU A  1  412 ? 23.929  30.041  -1.843  1.00 54.90 ? 440  LEU A CB  1 
ATOM   3009  C  CG  . LEU A  1  412 ? 25.289  29.535  -1.401  1.00 55.35 ? 440  LEU A CG  1 
ATOM   3010  C  CD1 . LEU A  1  412 ? 25.577  30.049  0.009   1.00 55.16 ? 440  LEU A CD1 1 
ATOM   3011  C  CD2 . LEU A  1  412 ? 25.293  28.011  -1.458  1.00 54.30 ? 440  LEU A CD2 1 
ATOM   3012  N  N   . ARG A  1  413 ? 24.265  31.087  -4.569  1.00 56.23 ? 441  ARG A N   1 
ATOM   3013  C  CA  . ARG A  1  413 ? 24.889  31.192  -5.880  1.00 55.44 ? 441  ARG A CA  1 
ATOM   3014  C  C   . ARG A  1  413 ? 23.679  31.386  -6.780  1.00 56.91 ? 441  ARG A C   1 
ATOM   3015  O  O   . ARG A  1  413 ? 22.585  30.918  -6.444  1.00 56.69 ? 441  ARG A O   1 
ATOM   3016  C  CB  . ARG A  1  413 ? 25.640  29.903  -6.222  1.00 56.26 ? 441  ARG A CB  1 
ATOM   3017  C  CG  . ARG A  1  413 ? 24.818  28.635  -6.130  1.00 56.18 ? 441  ARG A CG  1 
ATOM   3018  C  CD  . ARG A  1  413 ? 24.681  27.999  -7.501  1.00 57.50 ? 441  ARG A CD  1 
ATOM   3019  N  NE  . ARG A  1  413 ? 24.213  26.618  -7.439  1.00 58.13 ? 441  ARG A NE  1 
ATOM   3020  C  CZ  . ARG A  1  413 ? 24.711  25.695  -6.616  1.00 59.17 ? 441  ARG A CZ  1 
ATOM   3021  N  NH1 . ARG A  1  413 ? 25.689  26.018  -5.775  1.00 58.50 ? 441  ARG A NH1 1 
ATOM   3022  N  NH2 . ARG A  1  413 ? 24.254  24.441  -6.647  1.00 58.64 ? 441  ARG A NH2 1 
ATOM   3023  N  N   . ARG A  1  414 ? 23.845  32.066  -7.912  1.00 57.30 ? 442  ARG A N   1 
ATOM   3024  C  CA  . ARG A  1  414 ? 22.689  32.328  -8.770  1.00 56.99 ? 442  ARG A CA  1 
ATOM   3025  C  C   . ARG A  1  414 ? 23.038  32.999  -10.088 1.00 56.48 ? 442  ARG A C   1 
ATOM   3026  O  O   . ARG A  1  414 ? 23.741  34.004  -10.111 1.00 58.09 ? 442  ARG A O   1 
ATOM   3027  C  CB  . ARG A  1  414 ? 21.693  33.209  -7.987  1.00 56.98 ? 442  ARG A CB  1 
ATOM   3028  C  CG  . ARG A  1  414 ? 20.470  33.739  -8.736  1.00 56.42 ? 442  ARG A CG  1 
ATOM   3029  C  CD  . ARG A  1  414 ? 20.742  34.987  -9.581  1.00 55.98 ? 442  ARG A CD  1 
ATOM   3030  N  NE  . ARG A  1  414 ? 19.496  35.499  -10.152 1.00 55.39 ? 442  ARG A NE  1 
ATOM   3031  C  CZ  . ARG A  1  414 ? 19.421  36.427  -11.097 1.00 56.52 ? 442  ARG A CZ  1 
ATOM   3032  N  NH1 . ARG A  1  414 ? 20.532  36.962  -11.596 1.00 56.65 ? 442  ARG A NH1 1 
ATOM   3033  N  NH2 . ARG A  1  414 ? 18.229  36.818  -11.542 1.00 55.79 ? 442  ARG A NH2 1 
ATOM   3034  N  N   . HIS A  1  415 ? 22.532  32.443  -11.183 1.00 56.44 ? 443  HIS A N   1 
ATOM   3035  C  CA  . HIS A  1  415 ? 22.766  33.013  -12.499 1.00 57.42 ? 443  HIS A CA  1 
ATOM   3036  C  C   . HIS A  1  415 ? 21.546  32.793  -13.379 1.00 56.59 ? 443  HIS A C   1 
ATOM   3037  O  O   . HIS A  1  415 ? 21.044  31.681  -13.504 1.00 56.73 ? 443  HIS A O   1 
ATOM   3038  C  CB  . HIS A  1  415 ? 24.012  32.394  -13.160 1.00 57.30 ? 443  HIS A CB  1 
ATOM   3039  C  CG  . HIS A  1  415 ? 24.363  33.003  -14.487 1.00 57.25 ? 443  HIS A CG  1 
ATOM   3040  N  ND1 . HIS A  1  415 ? 24.729  34.325  -14.628 1.00 56.91 ? 443  HIS A ND1 1 
ATOM   3041  C  CD2 . HIS A  1  415 ? 24.374  32.476  -15.735 1.00 57.10 ? 443  HIS A CD2 1 
ATOM   3042  C  CE1 . HIS A  1  415 ? 24.947  34.586  -15.905 1.00 57.33 ? 443  HIS A CE1 1 
ATOM   3043  N  NE2 . HIS A  1  415 ? 24.738  33.481  -16.598 1.00 56.66 ? 443  HIS A NE2 1 
ATOM   3044  N  N   . HIS A  1  416 ? 21.073  33.882  -13.969 1.00 56.71 ? 444  HIS A N   1 
ATOM   3045  C  CA  . HIS A  1  416 ? 19.929  33.873  -14.871 1.00 57.52 ? 444  HIS A CA  1 
ATOM   3046  C  C   . HIS A  1  416 ? 20.475  34.245  -16.249 1.00 59.34 ? 444  HIS A C   1 
ATOM   3047  O  O   . HIS A  1  416 ? 20.945  35.372  -16.442 1.00 60.05 ? 444  HIS A O   1 
ATOM   3048  C  CB  . HIS A  1  416 ? 18.923  34.929  -14.432 1.00 60.13 ? 444  HIS A CB  1 
ATOM   3049  C  CG  . HIS A  1  416 ? 17.635  34.890  -15.187 1.00 60.57 ? 444  HIS A CG  1 
ATOM   3050  N  ND1 . HIS A  1  416 ? 16.563  34.127  -14.784 1.00 61.17 ? 444  HIS A ND1 1 
ATOM   3051  C  CD2 . HIS A  1  416 ? 17.255  35.502  -16.332 1.00 60.08 ? 444  HIS A CD2 1 
ATOM   3052  C  CE1 . HIS A  1  416 ? 15.576  34.270  -15.650 1.00 62.19 ? 444  HIS A CE1 1 
ATOM   3053  N  NE2 . HIS A  1  416 ? 15.971  35.099  -16.599 1.00 60.06 ? 444  HIS A NE2 1 
ATOM   3054  N  N   . SER A  1  417 ? 20.410  33.318  -17.206 1.00 60.05 ? 445  SER A N   1 
ATOM   3055  C  CA  . SER A  1  417 ? 20.942  33.565  -18.550 1.00 59.33 ? 445  SER A CA  1 
ATOM   3056  C  C   . SER A  1  417 ? 19.930  33.912  -19.649 1.00 59.34 ? 445  SER A C   1 
ATOM   3057  O  O   . SER A  1  417 ? 19.002  33.151  -19.923 1.00 58.98 ? 445  SER A O   1 
ATOM   3058  C  CB  . SER A  1  417 ? 21.767  32.361  -18.994 1.00 58.17 ? 445  SER A CB  1 
ATOM   3059  O  OG  . SER A  1  417 ? 22.490  32.669  -20.166 1.00 59.03 ? 445  SER A OG  1 
ATOM   3060  N  N   . ASP A  1  418 ? 20.130  35.075  -20.270 1.00 59.83 ? 446  ASP A N   1 
ATOM   3061  C  CA  . ASP A  1  418 ? 19.280  35.574  -21.359 1.00 59.74 ? 446  ASP A CA  1 
ATOM   3062  C  C   . ASP A  1  418 ? 20.143  35.850  -22.599 1.00 60.99 ? 446  ASP A C   1 
ATOM   3063  O  O   . ASP A  1  418 ? 19.650  36.331  -23.633 1.00 61.29 ? 446  ASP A O   1 
ATOM   3064  C  CB  . ASP A  1  418 ? 18.559  36.873  -20.949 1.00 61.24 ? 446  ASP A CB  1 
ATOM   3065  C  CG  . ASP A  1  418 ? 17.311  36.620  -20.101 1.00 62.30 ? 446  ASP A CG  1 
ATOM   3066  O  OD1 . ASP A  1  418 ? 16.526  35.707  -20.457 1.00 62.82 ? 446  ASP A OD1 1 
ATOM   3067  O  OD2 . ASP A  1  418 ? 17.105  37.347  -19.098 1.00 60.89 ? 446  ASP A OD2 1 
ATOM   3068  N  N   . LEU A  1  419 ? 21.434  35.536  -22.472 1.00 61.24 ? 447  LEU A N   1 
ATOM   3069  C  CA  . LEU A  1  419 ? 22.422  35.722  -23.532 1.00 60.07 ? 447  LEU A CA  1 
ATOM   3070  C  C   . LEU A  1  419 ? 22.806  34.366  -24.112 1.00 61.03 ? 447  LEU A C   1 
ATOM   3071  O  O   . LEU A  1  419 ? 23.361  33.518  -23.400 1.00 59.66 ? 447  LEU A O   1 
ATOM   3072  C  CB  . LEU A  1  419 ? 23.678  36.397  -22.966 1.00 60.04 ? 447  LEU A CB  1 
ATOM   3073  C  CG  . LEU A  1  419 ? 24.872  36.731  -23.878 1.00 60.84 ? 447  LEU A CG  1 
ATOM   3074  C  CD1 . LEU A  1  419 ? 24.520  37.892  -24.822 1.00 61.60 ? 447  LEU A CD1 1 
ATOM   3075  C  CD2 . LEU A  1  419 ? 26.078  37.108  -23.020 1.00 59.73 ? 447  LEU A CD2 1 
ATOM   3076  N  N   . TYR A  1  420 ? 22.499  34.172  -25.398 1.00 62.17 ? 448  TYR A N   1 
ATOM   3077  C  CA  . TYR A  1  420 ? 22.808  32.930  -26.123 1.00 62.08 ? 448  TYR A CA  1 
ATOM   3078  C  C   . TYR A  1  420 ? 21.901  31.767  -25.697 1.00 62.70 ? 448  TYR A C   1 
ATOM   3079  O  O   . TYR A  1  420 ? 20.940  31.427  -26.400 1.00 61.71 ? 448  TYR A O   1 
ATOM   3080  C  CB  . TYR A  1  420 ? 24.297  32.585  -25.933 1.00 60.20 ? 448  TYR A CB  1 
ATOM   3081  C  CG  . TYR A  1  420 ? 25.232  33.683  -26.441 1.00 61.14 ? 448  TYR A CG  1 
ATOM   3082  C  CD1 . TYR A  1  420 ? 26.457  33.934  -25.822 1.00 61.53 ? 448  TYR A CD1 1 
ATOM   3083  C  CD2 . TYR A  1  420 ? 24.891  34.466  -27.553 1.00 61.71 ? 448  TYR A CD2 1 
ATOM   3084  C  CE1 . TYR A  1  420 ? 27.317  34.938  -26.297 1.00 61.60 ? 448  TYR A CE1 1 
ATOM   3085  C  CE2 . TYR A  1  420 ? 25.743  35.466  -28.033 1.00 60.40 ? 448  TYR A CE2 1 
ATOM   3086  C  CZ  . TYR A  1  420 ? 26.952  35.695  -27.402 1.00 60.99 ? 448  TYR A CZ  1 
ATOM   3087  O  OH  . TYR A  1  420 ? 27.798  36.671  -27.884 1.00 62.40 ? 448  TYR A OH  1 
ATOM   3088  N  N   . SER A  1  421 ? 22.200  31.181  -24.539 1.00 63.73 ? 449  SER A N   1 
ATOM   3089  C  CA  . SER A  1  421 ? 21.417  30.071  -23.982 1.00 62.83 ? 449  SER A CA  1 
ATOM   3090  C  C   . SER A  1  421 ? 20.646  30.594  -22.741 1.00 63.07 ? 449  SER A C   1 
ATOM   3091  O  O   . SER A  1  421 ? 21.266  31.102  -21.792 1.00 62.84 ? 449  SER A O   1 
ATOM   3092  C  CB  . SER A  1  421 ? 22.376  28.921  -23.590 1.00 62.34 ? 449  SER A CB  1 
ATOM   3093  O  OG  . SER A  1  421 ? 21.723  27.666  -23.444 1.00 61.02 ? 449  SER A OG  1 
ATOM   3094  N  N   . HIS A  1  422 ? 19.309  30.491  -22.754 1.00 62.66 ? 450  HIS A N   1 
ATOM   3095  C  CA  . HIS A  1  422 ? 18.479  30.950  -21.617 1.00 62.94 ? 450  HIS A CA  1 
ATOM   3096  C  C   . HIS A  1  422 ? 18.236  29.873  -20.531 1.00 62.67 ? 450  HIS A C   1 
ATOM   3097  O  O   . HIS A  1  422 ? 17.219  29.171  -20.561 1.00 62.79 ? 450  HIS A O   1 
ATOM   3098  C  CB  . HIS A  1  422 ? 17.099  31.456  -22.090 1.00 63.41 ? 450  HIS A CB  1 
ATOM   3099  C  CG  . HIS A  1  422 ? 17.146  32.666  -22.976 1.00 65.90 ? 450  HIS A CG  1 
ATOM   3100  N  ND1 . HIS A  1  422 ? 16.265  33.721  -22.835 1.00 66.03 ? 450  HIS A ND1 1 
ATOM   3101  C  CD2 . HIS A  1  422 ? 17.923  32.965  -24.048 1.00 66.46 ? 450  HIS A CD2 1 
ATOM   3102  C  CE1 . HIS A  1  422 ? 16.500  34.616  -23.782 1.00 66.91 ? 450  HIS A CE1 1 
ATOM   3103  N  NE2 . HIS A  1  422 ? 17.500  34.183  -24.531 1.00 66.91 ? 450  HIS A NE2 1 
ATOM   3104  N  N   . TYR A  1  423 ? 19.155  29.744  -19.578 1.00 60.30 ? 451  TYR A N   1 
ATOM   3105  C  CA  . TYR A  1  423 ? 19.008  28.768  -18.505 1.00 58.56 ? 451  TYR A CA  1 
ATOM   3106  C  C   . TYR A  1  423 ? 19.067  29.572  -17.222 1.00 59.55 ? 451  TYR A C   1 
ATOM   3107  O  O   . TYR A  1  423 ? 19.321  30.776  -17.263 1.00 59.00 ? 451  TYR A O   1 
ATOM   3108  C  CB  . TYR A  1  423 ? 20.157  27.743  -18.538 1.00 58.04 ? 451  TYR A CB  1 
ATOM   3109  C  CG  . TYR A  1  423 ? 21.527  28.382  -18.481 1.00 58.69 ? 451  TYR A CG  1 
ATOM   3110  C  CD1 . TYR A  1  423 ? 22.155  28.648  -17.264 1.00 57.93 ? 451  TYR A CD1 1 
ATOM   3111  C  CD2 . TYR A  1  423 ? 22.135  28.842  -19.644 1.00 58.95 ? 451  TYR A CD2 1 
ATOM   3112  C  CE1 . TYR A  1  423 ? 23.345  29.373  -17.212 1.00 57.79 ? 451  TYR A CE1 1 
ATOM   3113  C  CE2 . TYR A  1  423 ? 23.317  29.562  -19.604 1.00 58.91 ? 451  TYR A CE2 1 
ATOM   3114  C  CZ  . TYR A  1  423 ? 23.914  29.834  -18.391 1.00 59.00 ? 451  TYR A CZ  1 
ATOM   3115  O  OH  . TYR A  1  423 ? 25.045  30.620  -18.385 1.00 59.64 ? 451  TYR A OH  1 
ATOM   3116  N  N   . PHE A  1  424 ? 18.810  28.912  -16.095 1.00 59.55 ? 452  PHE A N   1 
ATOM   3117  C  CA  . PHE A  1  424 ? 18.879  29.546  -14.782 1.00 57.23 ? 452  PHE A CA  1 
ATOM   3118  C  C   . PHE A  1  424 ? 19.250  28.539  -13.716 1.00 57.53 ? 452  PHE A C   1 
ATOM   3119  O  O   . PHE A  1  424 ? 18.676  27.455  -13.643 1.00 57.57 ? 452  PHE A O   1 
ATOM   3120  C  CB  . PHE A  1  424 ? 17.560  30.169  -14.358 1.00 56.85 ? 452  PHE A CB  1 
ATOM   3121  C  CG  . PHE A  1  424 ? 17.595  30.700  -12.952 1.00 56.02 ? 452  PHE A CG  1 
ATOM   3122  C  CD1 . PHE A  1  424 ? 18.133  31.950  -12.680 1.00 56.22 ? 452  PHE A CD1 1 
ATOM   3123  C  CD2 . PHE A  1  424 ? 17.164  29.921  -11.892 1.00 55.88 ? 452  PHE A CD2 1 
ATOM   3124  C  CE1 . PHE A  1  424 ? 18.242  32.410  -11.378 1.00 55.08 ? 452  PHE A CE1 1 
ATOM   3125  C  CE2 . PHE A  1  424 ? 17.273  30.377  -10.590 1.00 55.95 ? 452  PHE A CE2 1 
ATOM   3126  C  CZ  . PHE A  1  424 ? 17.814  31.622  -10.333 1.00 54.68 ? 452  PHE A CZ  1 
ATOM   3127  N  N   . GLY A  1  425 ? 20.196  28.917  -12.870 1.00 58.54 ? 453  GLY A N   1 
ATOM   3128  C  CA  . GLY A  1  425 ? 20.620  28.029  -11.808 1.00 58.40 ? 453  GLY A CA  1 
ATOM   3129  C  C   . GLY A  1  425 ? 20.828  28.802  -10.529 1.00 58.08 ? 453  GLY A C   1 
ATOM   3130  O  O   . GLY A  1  425 ? 21.652  29.716  -10.469 1.00 58.10 ? 453  GLY A O   1 
ATOM   3131  N  N   . GLY A  1  426 ? 20.079  28.440  -9.497  1.00 57.85 ? 454  GLY A N   1 
ATOM   3132  C  CA  . GLY A  1  426 ? 20.221  29.134  -8.232  1.00 58.80 ? 454  GLY A CA  1 
ATOM   3133  C  C   . GLY A  1  426 ? 20.134  28.244  -7.004  1.00 58.37 ? 454  GLY A C   1 
ATOM   3134  O  O   . GLY A  1  426 ? 20.136  27.012  -7.090  1.00 58.12 ? 454  GLY A O   1 
ATOM   3135  N  N   . LEU A  1  427 ? 20.062  28.880  -5.844  1.00 57.42 ? 455  LEU A N   1 
ATOM   3136  C  CA  . LEU A  1  427 ? 19.964  28.150  -4.596  1.00 57.46 ? 455  LEU A CA  1 
ATOM   3137  C  C   . LEU A  1  427 ? 19.883  29.153  -3.471  1.00 57.36 ? 455  LEU A C   1 
ATOM   3138  O  O   . LEU A  1  427 ? 20.904  29.693  -3.058  1.00 58.62 ? 455  LEU A O   1 
ATOM   3139  C  CB  . LEU A  1  427 ? 21.196  27.265  -4.401  1.00 57.10 ? 455  LEU A CB  1 
ATOM   3140  C  CG  . LEU A  1  427 ? 21.303  26.506  -3.074  1.00 56.89 ? 455  LEU A CG  1 
ATOM   3141  C  CD1 . LEU A  1  427 ? 20.243  25.422  -3.017  1.00 56.59 ? 455  LEU A CD1 1 
ATOM   3142  C  CD2 . LEU A  1  427 ? 22.694  25.899  -2.950  1.00 56.64 ? 455  LEU A CD2 1 
ATOM   3143  N  N   . ALA A  1  428 ? 18.679  29.439  -2.987  1.00 57.00 ? 456  ALA A N   1 
ATOM   3144  C  CA  . ALA A  1  428 ? 18.572  30.378  -1.884  1.00 57.22 ? 456  ALA A CA  1 
ATOM   3145  C  C   . ALA A  1  428 ? 19.360  29.701  -0.761  1.00 57.41 ? 456  ALA A C   1 
ATOM   3146  O  O   . ALA A  1  428 ? 19.351  28.468  -0.645  1.00 57.06 ? 456  ALA A O   1 
ATOM   3147  C  CB  . ALA A  1  428 ? 17.120  30.580  -1.487  1.00 56.75 ? 456  ALA A CB  1 
ATOM   3148  N  N   . GLU A  1  429 ? 20.065  30.495  0.042   1.00 57.38 ? 457  GLU A N   1 
ATOM   3149  C  CA  . GLU A  1  429 ? 20.870  29.944  1.123   1.00 55.87 ? 457  GLU A CA  1 
ATOM   3150  C  C   . GLU A  1  429 ? 20.118  29.695  2.405   1.00 56.31 ? 457  GLU A C   1 
ATOM   3151  O  O   . GLU A  1  429 ? 19.258  30.479  2.811   1.00 56.06 ? 457  GLU A O   1 
ATOM   3152  C  CB  . GLU A  1  429 ? 22.061  30.847  1.440   1.00 54.97 ? 457  GLU A CB  1 
ATOM   3153  C  CG  . GLU A  1  429 ? 22.640  30.589  2.821   1.00 55.41 ? 457  GLU A CG  1 
ATOM   3154  C  CD  . GLU A  1  429 ? 23.950  31.310  3.067   1.00 56.82 ? 457  GLU A CD  1 
ATOM   3155  O  OE1 . GLU A  1  429 ? 24.021  32.543  2.861   1.00 57.18 ? 457  GLU A OE1 1 
ATOM   3156  O  OE2 . GLU A  1  429 ? 24.917  30.633  3.477   1.00 58.03 ? 457  GLU A OE2 1 
ATOM   3157  N  N   . THR A  1  430 ? 20.464  28.580  3.031   1.00 55.26 ? 458  THR A N   1 
ATOM   3158  C  CA  . THR A  1  430 ? 19.886  28.189  4.295   1.00 54.66 ? 458  THR A CA  1 
ATOM   3159  C  C   . THR A  1  430 ? 21.106  27.889  5.130   1.00 55.56 ? 458  THR A C   1 
ATOM   3160  O  O   . THR A  1  430 ? 22.011  27.188  4.666   1.00 55.40 ? 458  THR A O   1 
ATOM   3161  C  CB  . THR A  1  430 ? 19.035  26.929  4.157   1.00 54.83 ? 458  THR A CB  1 
ATOM   3162  O  OG1 . THR A  1  430 ? 17.807  27.252  3.492   1.00 55.11 ? 458  THR A OG1 1 
ATOM   3163  C  CG2 . THR A  1  430 ? 18.741  26.347  5.522   1.00 54.21 ? 458  THR A CG2 1 
ATOM   3164  N  N   . VAL A  1  431 ? 21.143  28.432  6.345   1.00 55.57 ? 459  VAL A N   1 
ATOM   3165  C  CA  . VAL A  1  431 ? 22.283  28.223  7.238   1.00 55.92 ? 459  VAL A CA  1 
ATOM   3166  C  C   . VAL A  1  431 ? 21.943  27.488  8.535   1.00 56.23 ? 459  VAL A C   1 
ATOM   3167  O  O   . VAL A  1  431 ? 20.782  27.401  8.948   1.00 56.06 ? 459  VAL A O   1 
ATOM   3168  C  CB  . VAL A  1  431 ? 22.965  29.559  7.614   1.00 53.47 ? 459  VAL A CB  1 
ATOM   3169  C  CG1 . VAL A  1  431 ? 23.185  30.385  6.375   1.00 54.82 ? 459  VAL A CG1 1 
ATOM   3170  C  CG2 . VAL A  1  431 ? 22.128  30.318  8.611   1.00 54.23 ? 459  VAL A CG2 1 
ATOM   3171  N  N   . LEU A  1  432 ? 22.983  26.954  9.165   1.00 55.80 ? 460  LEU A N   1 
ATOM   3172  C  CA  . LEU A  1  432 ? 22.844  26.233  10.413  1.00 54.18 ? 460  LEU A CA  1 
ATOM   3173  C  C   . LEU A  1  432 ? 23.440  27.135  11.479  1.00 54.98 ? 460  LEU A C   1 
ATOM   3174  O  O   . LEU A  1  432 ? 24.531  27.675  11.303  1.00 54.98 ? 460  LEU A O   1 
ATOM   3175  C  CB  . LEU A  1  432 ? 23.598  24.914  10.342  1.00 53.51 ? 460  LEU A CB  1 
ATOM   3176  C  CG  . LEU A  1  432 ? 23.382  24.013  11.553  1.00 55.32 ? 460  LEU A CG  1 
ATOM   3177  C  CD1 . LEU A  1  432 ? 21.898  23.743  11.757  1.00 55.06 ? 460  LEU A CD1 1 
ATOM   3178  C  CD2 . LEU A  1  432 ? 24.134  22.716  11.343  1.00 56.25 ? 460  LEU A CD2 1 
ATOM   3179  N  N   . VAL A  1  433 ? 22.721  27.292  12.585  1.00 55.03 ? 461  VAL A N   1 
ATOM   3180  C  CA  . VAL A  1  433 ? 23.152  28.171  13.656  1.00 52.51 ? 461  VAL A CA  1 
ATOM   3181  C  C   . VAL A  1  433 ? 23.200  27.545  15.033  1.00 51.90 ? 461  VAL A C   1 
ATOM   3182  O  O   . VAL A  1  433 ? 22.356  26.729  15.389  1.00 51.89 ? 461  VAL A O   1 
ATOM   3183  C  CB  . VAL A  1  433 ? 22.208  29.370  13.757  1.00 52.78 ? 461  VAL A CB  1 
ATOM   3184  C  CG1 . VAL A  1  433 ? 22.790  30.413  14.690  1.00 53.08 ? 461  VAL A CG1 1 
ATOM   3185  C  CG2 . VAL A  1  433 ? 21.939  29.933  12.376  1.00 52.38 ? 461  VAL A CG2 1 
ATOM   3186  N  N   . VAL A  1  434 ? 24.199  27.949  15.806  1.00 52.28 ? 462  VAL A N   1 
ATOM   3187  C  CA  . VAL A  1  434 ? 24.351  27.500  17.186  1.00 52.66 ? 462  VAL A CA  1 
ATOM   3188  C  C   . VAL A  1  434 ? 24.481  28.815  17.932  1.00 53.16 ? 462  VAL A C   1 
ATOM   3189  O  O   . VAL A  1  434 ? 25.387  29.605  17.637  1.00 53.39 ? 462  VAL A O   1 
ATOM   3190  C  CB  . VAL A  1  434 ? 25.631  26.667  17.418  1.00 51.77 ? 462  VAL A CB  1 
ATOM   3191  C  CG1 . VAL A  1  434 ? 25.669  26.188  18.846  1.00 51.06 ? 462  VAL A CG1 1 
ATOM   3192  C  CG2 . VAL A  1  434 ? 25.664  25.483  16.481  1.00 52.04 ? 462  VAL A CG2 1 
ATOM   3193  N  N   . ARG A  1  435 ? 23.568  29.061  18.875  1.00 53.90 ? 463  ARG A N   1 
ATOM   3194  C  CA  . ARG A  1  435 ? 23.567  30.310  19.640  1.00 52.01 ? 463  ARG A CA  1 
ATOM   3195  C  C   . ARG A  1  435 ? 23.535  30.132  21.151  1.00 53.41 ? 463  ARG A C   1 
ATOM   3196  O  O   . ARG A  1  435 ? 23.121  29.088  21.672  1.00 53.28 ? 463  ARG A O   1 
ATOM   3197  C  CB  . ARG A  1  435 ? 22.390  31.175  19.210  1.00 49.46 ? 463  ARG A CB  1 
ATOM   3198  C  CG  . ARG A  1  435 ? 22.261  32.470  19.957  1.00 48.37 ? 463  ARG A CG  1 
ATOM   3199  C  CD  . ARG A  1  435 ? 21.148  33.271  19.353  1.00 46.66 ? 463  ARG A CD  1 
ATOM   3200  N  NE  . ARG A  1  435 ? 21.440  33.577  17.961  1.00 47.00 ? 463  ARG A NE  1 
ATOM   3201  C  CZ  . ARG A  1  435 ? 20.535  33.959  17.065  1.00 46.79 ? 463  ARG A CZ  1 
ATOM   3202  N  NH1 . ARG A  1  435 ? 19.264  34.078  17.411  1.00 48.73 ? 463  ARG A NH1 1 
ATOM   3203  N  NH2 . ARG A  1  435 ? 20.900  34.235  15.823  1.00 45.79 ? 463  ARG A NH2 1 
ATOM   3204  N  N   . SER A  1  436 ? 23.990  31.173  21.841  1.00 54.52 ? 464  SER A N   1 
ATOM   3205  C  CA  . SER A  1  436 ? 24.048  31.208  23.299  1.00 54.73 ? 464  SER A CA  1 
ATOM   3206  C  C   . SER A  1  436 ? 24.170  32.670  23.695  1.00 53.59 ? 464  SER A C   1 
ATOM   3207  O  O   . SER A  1  436 ? 24.842  33.436  23.007  1.00 53.55 ? 464  SER A O   1 
ATOM   3208  C  CB  . SER A  1  436 ? 25.270  30.432  23.812  1.00 53.17 ? 464  SER A CB  1 
ATOM   3209  O  OG  . SER A  1  436 ? 25.500  30.698  25.185  1.00 52.28 ? 464  SER A OG  1 
ATOM   3210  N  N   . MET A  1  437 ? 23.521  33.055  24.792  1.00 54.63 ? 465  MET A N   1 
ATOM   3211  C  CA  . MET A  1  437 ? 23.573  34.438  25.271  1.00 54.63 ? 465  MET A CA  1 
ATOM   3212  C  C   . MET A  1  437 ? 23.988  34.587  26.728  1.00 53.94 ? 465  MET A C   1 
ATOM   3213  O  O   . MET A  1  437 ? 23.388  33.998  27.626  1.00 54.15 ? 465  MET A O   1 
ATOM   3214  C  CB  . MET A  1  437 ? 22.223  35.121  25.076  1.00 53.83 ? 465  MET A CB  1 
ATOM   3215  C  CG  . MET A  1  437 ? 21.947  35.556  23.660  1.00 52.91 ? 465  MET A CG  1 
ATOM   3216  S  SD  . MET A  1  437 ? 20.253  36.101  23.517  1.00 53.78 ? 465  MET A SD  1 
ATOM   3217  C  CE  . MET A  1  437 ? 19.999  36.057  21.759  1.00 52.21 ? 465  MET A CE  1 
ATOM   3218  N  N   . SER A  1  438 ? 25.019  35.392  26.949  1.00 54.43 ? 466  SER A N   1 
ATOM   3219  C  CA  . SER A  1  438 ? 25.531  35.647  28.287  1.00 55.15 ? 466  SER A CA  1 
ATOM   3220  C  C   . SER A  1  438 ? 25.080  37.041  28.705  1.00 56.13 ? 466  SER A C   1 
ATOM   3221  O  O   . SER A  1  438 ? 25.084  37.975  27.903  1.00 56.96 ? 466  SER A O   1 
ATOM   3222  C  CB  . SER A  1  438 ? 27.064  35.577  28.294  1.00 54.97 ? 466  SER A CB  1 
ATOM   3223  O  OG  . SER A  1  438 ? 27.528  34.346  27.771  1.00 54.16 ? 466  SER A OG  1 
ATOM   3224  N  N   . THR A  1  439 ? 24.687  37.184  29.962  1.00 56.65 ? 467  THR A N   1 
ATOM   3225  C  CA  . THR A  1  439 ? 24.240  38.475  30.446  1.00 56.50 ? 467  THR A CA  1 
ATOM   3226  C  C   . THR A  1  439 ? 25.138  38.947  31.577  1.00 57.08 ? 467  THR A C   1 
ATOM   3227  O  O   . THR A  1  439 ? 24.901  38.617  32.742  1.00 56.12 ? 467  THR A O   1 
ATOM   3228  C  CB  . THR A  1  439 ? 22.803  38.400  30.961  1.00 56.23 ? 467  THR A CB  1 
ATOM   3229  O  OG1 . THR A  1  439 ? 21.987  37.734  29.990  1.00 55.75 ? 467  THR A OG1 1 
ATOM   3230  C  CG2 . THR A  1  439 ? 22.260  39.807  31.219  1.00 56.15 ? 467  THR A CG2 1 
ATOM   3231  N  N   . LEU A  1  440 ? 26.182  39.696  31.228  1.00 57.14 ? 468  LEU A N   1 
ATOM   3232  C  CA  . LEU A  1  440 ? 27.095  40.231  32.230  1.00 57.00 ? 468  LEU A CA  1 
ATOM   3233  C  C   . LEU A  1  440 ? 26.507  41.531  32.709  1.00 56.35 ? 468  LEU A C   1 
ATOM   3234  O  O   . LEU A  1  440 ? 26.640  42.559  32.053  1.00 55.32 ? 468  LEU A O   1 
ATOM   3235  C  CB  . LEU A  1  440 ? 28.461  40.476  31.628  1.00 55.34 ? 468  LEU A CB  1 
ATOM   3236  C  CG  . LEU A  1  440 ? 29.231  39.180  31.457  1.00 55.19 ? 468  LEU A CG  1 
ATOM   3237  C  CD1 . LEU A  1  440 ? 30.263  39.371  30.382  1.00 56.41 ? 468  LEU A CD1 1 
ATOM   3238  C  CD2 . LEU A  1  440 ? 29.864  38.775  32.776  1.00 55.39 ? 468  LEU A CD2 1 
ATOM   3239  N  N   . LEU A  1  441 ? 25.850  41.463  33.860  1.00 56.92 ? 469  LEU A N   1 
ATOM   3240  C  CA  . LEU A  1  441 ? 25.180  42.614  34.449  1.00 58.27 ? 469  LEU A CA  1 
ATOM   3241  C  C   . LEU A  1  441 ? 24.306  43.346  33.418  1.00 58.46 ? 469  LEU A C   1 
ATOM   3242  O  O   . LEU A  1  441 ? 23.199  42.882  33.097  1.00 57.64 ? 469  LEU A O   1 
ATOM   3243  C  CB  . LEU A  1  441 ? 26.197  43.589  35.074  1.00 58.22 ? 469  LEU A CB  1 
ATOM   3244  C  CG  . LEU A  1  441 ? 27.094  43.109  36.227  1.00 57.77 ? 469  LEU A CG  1 
ATOM   3245  C  CD1 . LEU A  1  441 ? 27.423  44.297  37.132  1.00 55.47 ? 469  LEU A CD1 1 
ATOM   3246  C  CD2 . LEU A  1  441 ? 26.399  42.007  37.026  1.00 58.65 ? 469  LEU A CD2 1 
ATOM   3247  N  N   . ASN A  1  442 ? 24.814  44.465  32.890  1.00 58.48 ? 470  ASN A N   1 
ATOM   3248  C  CA  . ASN A  1  442 ? 24.081  45.280  31.923  1.00 57.95 ? 470  ASN A CA  1 
ATOM   3249  C  C   . ASN A  1  442 ? 23.840  44.735  30.508  1.00 57.09 ? 470  ASN A C   1 
ATOM   3250  O  O   . ASN A  1  442 ? 22.687  44.631  30.098  1.00 56.52 ? 470  ASN A O   1 
ATOM   3251  C  CB  . ASN A  1  442 ? 24.706  46.685  31.837  1.00 56.18 ? 470  ASN A CB  1 
ATOM   3252  C  CG  . ASN A  1  442 ? 26.187  46.657  31.539  1.00 56.30 ? 470  ASN A CG  1 
ATOM   3253  O  OD1 . ASN A  1  442 ? 26.994  46.247  32.364  1.00 55.76 ? 470  ASN A OD1 1 
ATOM   3254  N  ND2 . ASN A  1  442 ? 26.551  47.102  30.350  1.00 56.26 ? 470  ASN A ND2 1 
HETATM 3255  N  N   . PAQ A  1  443 ? 24.883  44.391  29.753  1.00 56.41 ? 471  PAQ A N   1 
HETATM 3256  C  CA  . PAQ A  1  443 ? 24.629  43.899  28.368  1.00 57.66 ? 471  PAQ A CA  1 
HETATM 3257  C  CB  . PAQ A  1  443 ? 25.650  44.405  27.352  1.00 59.14 ? 471  PAQ A CB  1 
HETATM 3258  C  CG  . PAQ A  1  443 ? 26.996  44.674  27.984  1.00 59.05 ? 471  PAQ A CG  1 
HETATM 3259  C  CD1 . PAQ A  1  443 ? 27.694  45.970  27.755  1.00 60.36 ? 471  PAQ A CD1 1 
HETATM 3260  O  O2  . PAQ A  1  443 ? 27.238  46.818  26.957  1.00 63.00 ? 471  PAQ A O2  1 
HETATM 3261  C  CD2 . PAQ A  1  443 ? 27.572  43.742  28.841  1.00 58.74 ? 471  PAQ A CD2 1 
HETATM 3262  C  CE1 . PAQ A  1  443 ? 28.885  46.221  28.431  1.00 58.54 ? 471  PAQ A CE1 1 
HETATM 3263  C  CE2 . PAQ A  1  443 ? 28.770  44.037  29.486  1.00 60.90 ? 471  PAQ A CE2 1 
HETATM 3264  C  CZ  . PAQ A  1  443 ? 29.411  45.261  29.291  1.00 60.51 ? 471  PAQ A CZ  1 
HETATM 3265  O  OH  . PAQ A  1  443 ? 30.578  45.526  29.943  1.00 60.70 ? 471  PAQ A OH  1 
HETATM 3266  N  N1  . PAQ A  1  443 ? 29.282  43.106  30.327  1.00 61.50 ? 471  PAQ A N1  1 
HETATM 3267  N  N2  . PAQ A  1  443 ? 30.387  43.317  31.021  1.00 59.91 ? 471  PAQ A N2  1 
HETATM 3268  C  C1  . PAQ A  1  443 ? 30.275  43.405  32.364  1.00 59.57 ? 471  PAQ A C1  1 
HETATM 3269  C  C2  . PAQ A  1  443 ? 29.547  44.451  32.926  1.00 59.21 ? 471  PAQ A C2  1 
HETATM 3270  C  C3  . PAQ A  1  443 ? 29.392  44.494  34.309  1.00 60.58 ? 471  PAQ A C3  1 
HETATM 3271  C  C4  . PAQ A  1  443 ? 29.965  43.500  35.097  1.00 59.77 ? 471  PAQ A C4  1 
HETATM 3272  C  C5  . PAQ A  1  443 ? 30.683  42.481  34.478  1.00 60.35 ? 471  PAQ A C5  1 
HETATM 3273  N  N3  . PAQ A  1  443 ? 30.817  42.463  33.143  1.00 60.18 ? 471  PAQ A N3  1 
HETATM 3274  C  C   . PAQ A  1  443 ? 24.601  42.402  28.315  1.00 57.37 ? 471  PAQ A C   1 
HETATM 3275  O  O   . PAQ A  1  443 ? 25.144  41.757  29.216  1.00 57.47 ? 471  PAQ A O   1 
ATOM   3276  N  N   . ASP A  1  444 ? 23.984  41.895  27.255  1.00 57.95 ? 472  ASP A N   1 
ATOM   3277  C  CA  . ASP A  1  444 ? 23.866  40.484  26.996  1.00 57.30 ? 472  ASP A CA  1 
ATOM   3278  C  C   . ASP A  1  444 ? 24.583  40.299  25.680  1.00 55.97 ? 472  ASP A C   1 
ATOM   3279  O  O   . ASP A  1  444 ? 24.334  41.015  24.719  1.00 54.89 ? 472  ASP A O   1 
ATOM   3280  C  CB  . ASP A  1  444 ? 22.399  40.109  26.863  1.00 55.51 ? 472  ASP A CB  1 
ATOM   3281  C  CG  . ASP A  1  444 ? 21.535  40.909  27.786  1.00 54.26 ? 472  ASP A CG  1 
ATOM   3282  O  OD1 . ASP A  1  444 ? 21.334  42.098  27.508  1.00 53.41 ? 472  ASP A OD1 1 
ATOM   3283  O  OD2 . ASP A  1  444 ? 21.074  40.366  28.801  1.00 54.14 ? 472  ASP A OD2 1 
ATOM   3284  N  N   . TYR A  1  445 ? 25.504  39.354  25.655  1.00 55.26 ? 473  TYR A N   1 
ATOM   3285  C  CA  . TYR A  1  445 ? 26.249  39.082  24.455  1.00 55.16 ? 473  TYR A CA  1 
ATOM   3286  C  C   . TYR A  1  445 ? 25.584  37.937  23.702  1.00 56.78 ? 473  TYR A C   1 
ATOM   3287  O  O   . TYR A  1  445 ? 25.271  36.894  24.284  1.00 55.32 ? 473  TYR A O   1 
ATOM   3288  C  CB  . TYR A  1  445 ? 27.659  38.672  24.812  1.00 55.37 ? 473  TYR A CB  1 
ATOM   3289  C  CG  . TYR A  1  445 ? 28.493  39.726  25.481  1.00 56.29 ? 473  TYR A CG  1 
ATOM   3290  C  CD1 . TYR A  1  445 ? 29.002  39.527  26.769  1.00 56.82 ? 473  TYR A CD1 1 
ATOM   3291  C  CD2 . TYR A  1  445 ? 28.880  40.874  24.789  1.00 57.31 ? 473  TYR A CD2 1 
ATOM   3292  C  CE1 . TYR A  1  445 ? 29.900  40.445  27.351  1.00 57.18 ? 473  TYR A CE1 1 
ATOM   3293  C  CE2 . TYR A  1  445 ? 29.774  41.802  25.356  1.00 58.52 ? 473  TYR A CE2 1 
ATOM   3294  C  CZ  . TYR A  1  445 ? 30.289  41.582  26.636  1.00 59.30 ? 473  TYR A CZ  1 
ATOM   3295  O  OH  . TYR A  1  445 ? 31.215  42.474  27.168  1.00 57.91 ? 473  TYR A OH  1 
ATOM   3296  N  N   . VAL A  1  446 ? 25.359  38.138  22.408  1.00 57.77 ? 474  VAL A N   1 
ATOM   3297  C  CA  . VAL A  1  446 ? 24.763  37.106  21.574  1.00 55.54 ? 474  VAL A CA  1 
ATOM   3298  C  C   . VAL A  1  446 ? 25.878  36.464  20.786  1.00 55.39 ? 474  VAL A C   1 
ATOM   3299  O  O   . VAL A  1  446 ? 26.468  37.095  19.909  1.00 55.15 ? 474  VAL A O   1 
ATOM   3300  C  CB  . VAL A  1  446 ? 23.780  37.667  20.567  1.00 54.31 ? 474  VAL A CB  1 
ATOM   3301  C  CG1 . VAL A  1  446 ? 23.147  36.524  19.802  1.00 54.14 ? 474  VAL A CG1 1 
ATOM   3302  C  CG2 . VAL A  1  446 ? 22.748  38.501  21.270  1.00 54.34 ? 474  VAL A CG2 1 
ATOM   3303  N  N   . TRP A  1  447 ? 26.163  35.208  21.100  1.00 55.63 ? 475  TRP A N   1 
ATOM   3304  C  CA  . TRP A  1  447 ? 27.217  34.486  20.420  1.00 55.28 ? 475  TRP A CA  1 
ATOM   3305  C  C   . TRP A  1  447 ? 26.670  33.621  19.313  1.00 55.45 ? 475  TRP A C   1 
ATOM   3306  O  O   . TRP A  1  447 ? 25.824  32.750  19.532  1.00 55.58 ? 475  TRP A O   1 
ATOM   3307  C  CB  . TRP A  1  447 ? 27.977  33.622  21.407  1.00 56.37 ? 475  TRP A CB  1 
ATOM   3308  C  CG  . TRP A  1  447 ? 28.310  34.350  22.654  1.00 57.66 ? 475  TRP A CG  1 
ATOM   3309  C  CD1 . TRP A  1  447 ? 27.763  34.152  23.890  1.00 57.41 ? 475  TRP A CD1 1 
ATOM   3310  C  CD2 . TRP A  1  447 ? 29.283  35.395  22.804  1.00 57.81 ? 475  TRP A CD2 1 
ATOM   3311  N  NE1 . TRP A  1  447 ? 28.338  35.004  24.801  1.00 58.71 ? 475  TRP A NE1 1 
ATOM   3312  C  CE2 . TRP A  1  447 ? 29.274  35.779  24.163  1.00 58.44 ? 475  TRP A CE2 1 
ATOM   3313  C  CE3 . TRP A  1  447 ? 30.163  36.044  21.922  1.00 57.52 ? 475  TRP A CE3 1 
ATOM   3314  C  CZ2 . TRP A  1  447 ? 30.117  36.788  24.664  1.00 58.15 ? 475  TRP A CZ2 1 
ATOM   3315  C  CZ3 . TRP A  1  447 ? 30.999  37.046  22.422  1.00 57.03 ? 475  TRP A CZ3 1 
ATOM   3316  C  CH2 . TRP A  1  447 ? 30.967  37.406  23.778  1.00 57.19 ? 475  TRP A CH2 1 
ATOM   3317  N  N   . ASP A  1  448 ? 27.163  33.885  18.112  1.00 56.36 ? 476  ASP A N   1 
ATOM   3318  C  CA  . ASP A  1  448 ? 26.769  33.141  16.934  1.00 55.65 ? 476  ASP A CA  1 
ATOM   3319  C  C   . ASP A  1  448 ? 27.913  32.367  16.346  1.00 54.45 ? 476  ASP A C   1 
ATOM   3320  O  O   . ASP A  1  448 ? 29.084  32.568  16.652  1.00 53.87 ? 476  ASP A O   1 
ATOM   3321  C  CB  . ASP A  1  448 ? 26.237  34.059  15.847  1.00 56.33 ? 476  ASP A CB  1 
ATOM   3322  C  CG  . ASP A  1  448 ? 24.784  34.301  15.984  1.00 56.97 ? 476  ASP A CG  1 
ATOM   3323  O  OD1 . ASP A  1  448 ? 24.167  33.552  16.764  1.00 57.03 ? 476  ASP A OD1 1 
ATOM   3324  O  OD2 . ASP A  1  448 ? 24.267  35.222  15.311  1.00 59.00 ? 476  ASP A OD2 1 
ATOM   3325  N  N   . THR A  1  449 ? 27.533  31.471  15.470  1.00 54.13 ? 477  THR A N   1 
ATOM   3326  C  CA  . THR A  1  449 ? 28.471  30.644  14.777  1.00 53.93 ? 477  THR A CA  1 
ATOM   3327  C  C   . THR A  1  449 ? 27.543  30.010  13.770  1.00 54.53 ? 477  THR A C   1 
ATOM   3328  O  O   . THR A  1  449 ? 26.702  29.163  14.094  1.00 54.17 ? 477  THR A O   1 
ATOM   3329  C  CB  . THR A  1  449 ? 29.120  29.621  15.718  1.00 53.34 ? 477  THR A CB  1 
ATOM   3330  O  OG1 . THR A  1  449 ? 29.876  28.691  14.940  1.00 51.45 ? 477  THR A OG1 1 
ATOM   3331  C  CG2 . THR A  1  449 ? 28.071  28.903  16.559  1.00 53.92 ? 477  THR A CG2 1 
ATOM   3332  N  N   . VAL A  1  450 ? 27.665  30.492  12.545  1.00 53.34 ? 478  VAL A N   1 
ATOM   3333  C  CA  . VAL A  1  450 ? 26.829  30.036  11.466  1.00 53.23 ? 478  VAL A CA  1 
ATOM   3334  C  C   . VAL A  1  450 ? 27.617  29.231  10.430  1.00 54.59 ? 478  VAL A C   1 
ATOM   3335  O  O   . VAL A  1  450 ? 28.636  29.686  9.900   1.00 53.44 ? 478  VAL A O   1 
ATOM   3336  C  CB  . VAL A  1  450 ? 26.153  31.247  10.808  1.00 51.88 ? 478  VAL A CB  1 
ATOM   3337  C  CG1 . VAL A  1  450 ? 25.146  30.794  9.787   1.00 52.36 ? 478  VAL A CG1 1 
ATOM   3338  C  CG2 . VAL A  1  450 ? 25.501  32.099  11.880  1.00 51.41 ? 478  VAL A CG2 1 
ATOM   3339  N  N   . PHE A  1  451 ? 27.143  28.017  10.169  1.00 53.77 ? 479  PHE A N   1 
ATOM   3340  C  CA  . PHE A  1  451 ? 27.761  27.150  9.187   1.00 52.76 ? 479  PHE A CA  1 
ATOM   3341  C  C   . PHE A  1  451 ? 26.930  27.335  7.935   1.00 54.64 ? 479  PHE A C   1 
ATOM   3342  O  O   . PHE A  1  451 ? 25.702  27.230  7.973   1.00 54.75 ? 479  PHE A O   1 
ATOM   3343  C  CB  . PHE A  1  451 ? 27.711  25.713  9.662   1.00 51.81 ? 479  PHE A CB  1 
ATOM   3344  C  CG  . PHE A  1  451 ? 28.308  25.520  11.010  1.00 51.87 ? 479  PHE A CG  1 
ATOM   3345  C  CD1 . PHE A  1  451 ? 27.618  25.909  12.149  1.00 51.75 ? 479  PHE A CD1 1 
ATOM   3346  C  CD2 . PHE A  1  451 ? 29.584  24.984  11.143  1.00 51.70 ? 479  PHE A CD2 1 
ATOM   3347  C  CE1 . PHE A  1  451 ? 28.190  25.766  13.401  1.00 51.84 ? 479  PHE A CE1 1 
ATOM   3348  C  CE2 . PHE A  1  451 ? 30.170  24.835  12.389  1.00 50.88 ? 479  PHE A CE2 1 
ATOM   3349  C  CZ  . PHE A  1  451 ? 29.474  25.226  13.522  1.00 51.90 ? 479  PHE A CZ  1 
ATOM   3350  N  N   . HIS A  1  452 ? 27.599  27.635  6.829   1.00 54.34 ? 480  HIS A N   1 
ATOM   3351  C  CA  . HIS A  1  452 ? 26.918  27.873  5.570   1.00 53.27 ? 480  HIS A CA  1 
ATOM   3352  C  C   . HIS A  1  452 ? 27.117  26.682  4.638   1.00 54.03 ? 480  HIS A C   1 
ATOM   3353  O  O   . HIS A  1  452 ? 28.117  25.971  4.735   1.00 54.74 ? 480  HIS A O   1 
ATOM   3354  C  CB  . HIS A  1  452 ? 27.454  29.171  4.957   1.00 52.20 ? 480  HIS A CB  1 
ATOM   3355  C  CG  . HIS A  1  452 ? 27.388  30.354  5.886   1.00 52.69 ? 480  HIS A CG  1 
ATOM   3356  N  ND1 . HIS A  1  452 ? 26.498  31.394  5.712   1.00 53.36 ? 480  HIS A ND1 1 
ATOM   3357  C  CD2 . HIS A  1  452 ? 28.103  30.659  6.997   1.00 51.92 ? 480  HIS A CD2 1 
ATOM   3358  C  CE1 . HIS A  1  452 ? 26.670  32.287  6.671   1.00 52.15 ? 480  HIS A CE1 1 
ATOM   3359  N  NE2 . HIS A  1  452 ? 27.637  31.864  7.464   1.00 51.02 ? 480  HIS A NE2 1 
ATOM   3360  N  N   . PRO A  1  453 ? 26.167  26.453  3.715   1.00 54.32 ? 481  PRO A N   1 
ATOM   3361  C  CA  . PRO A  1  453 ? 26.208  25.347  2.753   1.00 54.14 ? 481  PRO A CA  1 
ATOM   3362  C  C   . PRO A  1  453 ? 27.419  25.367  1.823   1.00 53.29 ? 481  PRO A C   1 
ATOM   3363  O  O   . PRO A  1  453 ? 27.590  24.470  0.998   1.00 52.82 ? 481  PRO A O   1 
ATOM   3364  C  CB  . PRO A  1  453 ? 24.898  25.520  1.991   1.00 53.75 ? 481  PRO A CB  1 
ATOM   3365  C  CG  . PRO A  1  453 ? 24.764  27.001  1.943   1.00 52.91 ? 481  PRO A CG  1 
ATOM   3366  C  CD  . PRO A  1  453 ? 25.091  27.397  3.362   1.00 53.58 ? 481  PRO A CD  1 
ATOM   3367  N  N   . SER A  1  454 ? 28.253  26.392  1.963   1.00 53.76 ? 482  SER A N   1 
ATOM   3368  C  CA  . SER A  1  454 ? 29.438  26.543  1.128   1.00 53.42 ? 482  SER A CA  1 
ATOM   3369  C  C   . SER A  1  454 ? 30.712  26.027  1.794   1.00 54.49 ? 482  SER A C   1 
ATOM   3370  O  O   . SER A  1  454 ? 31.740  25.845  1.129   1.00 54.02 ? 482  SER A O   1 
ATOM   3371  C  CB  . SER A  1  454 ? 29.628  28.014  0.748   1.00 51.28 ? 482  SER A CB  1 
ATOM   3372  O  OG  . SER A  1  454 ? 29.910  28.815  1.879   1.00 51.08 ? 482  SER A OG  1 
ATOM   3373  N  N   . GLY A  1  455 ? 30.645  25.784  3.100   1.00 53.46 ? 483  GLY A N   1 
ATOM   3374  C  CA  . GLY A  1  455 ? 31.822  25.316  3.808   1.00 53.77 ? 483  GLY A CA  1 
ATOM   3375  C  C   . GLY A  1  455 ? 32.558  26.503  4.392   1.00 53.42 ? 483  GLY A C   1 
ATOM   3376  O  O   . GLY A  1  455 ? 33.778  26.489  4.573   1.00 52.89 ? 483  GLY A O   1 
ATOM   3377  N  N   . ALA A  1  456 ? 31.790  27.551  4.664   1.00 54.53 ? 484  ALA A N   1 
ATOM   3378  C  CA  . ALA A  1  456 ? 32.311  28.776  5.244   1.00 53.81 ? 484  ALA A CA  1 
ATOM   3379  C  C   . ALA A  1  456 ? 31.713  28.832  6.641   1.00 54.43 ? 484  ALA A C   1 
ATOM   3380  O  O   . ALA A  1  456 ? 30.508  28.655  6.809   1.00 54.23 ? 484  ALA A O   1 
ATOM   3381  C  CB  . ALA A  1  456 ? 31.865  29.985  4.417   1.00 53.04 ? 484  ALA A CB  1 
ATOM   3382  N  N   . ILE A  1  457 ? 32.552  29.035  7.650   1.00 55.59 ? 485  ILE A N   1 
ATOM   3383  C  CA  . ILE A  1  457 ? 32.048  29.108  9.009   1.00 54.51 ? 485  ILE A CA  1 
ATOM   3384  C  C   . ILE A  1  457 ? 32.169  30.548  9.481   1.00 54.46 ? 485  ILE A C   1 
ATOM   3385  O  O   . ILE A  1  457 ? 33.244  31.148  9.467   1.00 54.62 ? 485  ILE A O   1 
ATOM   3386  C  CB  . ILE A  1  457 ? 32.815  28.178  9.965   1.00 53.84 ? 485  ILE A CB  1 
ATOM   3387  C  CG1 . ILE A  1  457 ? 33.068  26.816  9.309   1.00 52.85 ? 485  ILE A CG1 1 
ATOM   3388  C  CG2 . ILE A  1  457 ? 31.990  27.978  11.217  1.00 54.08 ? 485  ILE A CG2 1 
ATOM   3389  C  CD1 . ILE A  1  457 ? 33.728  25.807  10.221  1.00 52.70 ? 485  ILE A CD1 1 
ATOM   3390  N  N   . GLU A  1  458 ? 31.039  31.099  9.888   1.00 55.66 ? 486  GLU A N   1 
ATOM   3391  C  CA  . GLU A  1  458 ? 30.966  32.473  10.336  1.00 54.51 ? 486  GLU A CA  1 
ATOM   3392  C  C   . GLU A  1  458 ? 30.811  32.565  11.843  1.00 54.36 ? 486  GLU A C   1 
ATOM   3393  O  O   . GLU A  1  458 ? 30.064  31.810  12.457  1.00 55.28 ? 486  GLU A O   1 
ATOM   3394  C  CB  . GLU A  1  458 ? 29.781  33.141  9.654   1.00 53.22 ? 486  GLU A CB  1 
ATOM   3395  C  CG  . GLU A  1  458 ? 29.622  34.595  9.950   1.00 52.94 ? 486  GLU A CG  1 
ATOM   3396  C  CD  . GLU A  1  458 ? 28.214  35.053  9.688   1.00 52.72 ? 486  GLU A CD  1 
ATOM   3397  O  OE1 . GLU A  1  458 ? 27.737  34.903  8.548   1.00 52.98 ? 486  GLU A OE1 1 
ATOM   3398  O  OE2 . GLU A  1  458 ? 27.568  35.554  10.625  1.00 53.75 ? 486  GLU A OE2 1 
ATOM   3399  N  N   . ILE A  1  459 ? 31.526  33.503  12.437  1.00 54.63 ? 487  ILE A N   1 
ATOM   3400  C  CA  . ILE A  1  459 ? 31.458  33.705  13.868  1.00 55.41 ? 487  ILE A CA  1 
ATOM   3401  C  C   . ILE A  1  459 ? 31.109  35.167  14.120  1.00 56.27 ? 487  ILE A C   1 
ATOM   3402  O  O   . ILE A  1  459 ? 31.865  36.061  13.747  1.00 56.80 ? 487  ILE A O   1 
ATOM   3403  C  CB  . ILE A  1  459 ? 32.818  33.378  14.541  1.00 54.80 ? 487  ILE A CB  1 
ATOM   3404  C  CG1 . ILE A  1  459 ? 33.211  31.923  14.276  1.00 55.95 ? 487  ILE A CG1 1 
ATOM   3405  C  CG2 . ILE A  1  459 ? 32.734  33.605  16.023  1.00 55.56 ? 487  ILE A CG2 1 
ATOM   3406  C  CD1 . ILE A  1  459 ? 32.208  30.903  14.773  1.00 56.59 ? 487  ILE A CD1 1 
ATOM   3407  N  N   . ARG A  1  460 ? 29.945  35.413  14.711  1.00 57.03 ? 488  ARG A N   1 
ATOM   3408  C  CA  . ARG A  1  460 ? 29.529  36.776  15.038  1.00 57.22 ? 488  ARG A CA  1 
ATOM   3409  C  C   . ARG A  1  460 ? 29.060  36.856  16.470  1.00 57.91 ? 488  ARG A C   1 
ATOM   3410  O  O   . ARG A  1  460 ? 28.492  35.910  17.002  1.00 58.49 ? 488  ARG A O   1 
ATOM   3411  C  CB  . ARG A  1  460 ? 28.396  37.260  14.139  1.00 56.69 ? 488  ARG A CB  1 
ATOM   3412  C  CG  . ARG A  1  460 ? 28.872  37.754  12.809  1.00 58.39 ? 488  ARG A CG  1 
ATOM   3413  C  CD  . ARG A  1  460 ? 28.195  39.056  12.398  1.00 59.31 ? 488  ARG A CD  1 
ATOM   3414  N  NE  . ARG A  1  460 ? 28.621  39.431  11.051  1.00 60.46 ? 488  ARG A NE  1 
ATOM   3415  C  CZ  . ARG A  1  460 ? 28.047  38.976  9.939   1.00 62.35 ? 488  ARG A CZ  1 
ATOM   3416  N  NH1 . ARG A  1  460 ? 27.011  38.145  10.024  1.00 63.94 ? 488  ARG A NH1 1 
ATOM   3417  N  NH2 . ARG A  1  460 ? 28.519  39.324  8.742   1.00 62.63 ? 488  ARG A NH2 1 
ATOM   3418  N  N   . PHE A  1  461 ? 29.299  37.994  17.098  1.00 57.89 ? 489  PHE A N   1 
ATOM   3419  C  CA  . PHE A  1  461 ? 28.863  38.173  18.463  1.00 59.09 ? 489  PHE A CA  1 
ATOM   3420  C  C   . PHE A  1  461 ? 28.351  39.595  18.554  1.00 58.59 ? 489  PHE A C   1 
ATOM   3421  O  O   . PHE A  1  461 ? 28.936  40.495  17.967  1.00 58.37 ? 489  PHE A O   1 
ATOM   3422  C  CB  . PHE A  1  461 ? 30.034  37.924  19.412  1.00 60.53 ? 489  PHE A CB  1 
ATOM   3423  C  CG  . PHE A  1  461 ? 30.697  39.164  19.908  1.00 61.32 ? 489  PHE A CG  1 
ATOM   3424  C  CD1 . PHE A  1  461 ? 30.119  39.920  20.925  1.00 61.89 ? 489  PHE A CD1 1 
ATOM   3425  C  CD2 . PHE A  1  461 ? 31.912  39.573  19.376  1.00 61.66 ? 489  PHE A CD2 1 
ATOM   3426  C  CE1 . PHE A  1  461 ? 30.746  41.074  21.414  1.00 63.24 ? 489  PHE A CE1 1 
ATOM   3427  C  CE2 . PHE A  1  461 ? 32.554  40.727  19.853  1.00 63.36 ? 489  PHE A CE2 1 
ATOM   3428  C  CZ  . PHE A  1  461 ? 31.968  41.480  20.878  1.00 63.53 ? 489  PHE A CZ  1 
ATOM   3429  N  N   . TYR A  1  462 ? 27.241  39.793  19.254  1.00 58.99 ? 490  TYR A N   1 
ATOM   3430  C  CA  . TYR A  1  462 ? 26.683  41.130  19.387  1.00 59.67 ? 490  TYR A CA  1 
ATOM   3431  C  C   . TYR A  1  462 ? 26.628  41.493  20.861  1.00 59.91 ? 490  TYR A C   1 
ATOM   3432  O  O   . TYR A  1  462 ? 26.740  40.623  21.733  1.00 59.43 ? 490  TYR A O   1 
ATOM   3433  C  CB  . TYR A  1  462 ? 25.258  41.210  18.798  1.00 58.67 ? 490  TYR A CB  1 
ATOM   3434  C  CG  . TYR A  1  462 ? 25.091  40.617  17.414  1.00 58.32 ? 490  TYR A CG  1 
ATOM   3435  C  CD1 . TYR A  1  462 ? 25.336  39.266  17.191  1.00 59.22 ? 490  TYR A CD1 1 
ATOM   3436  C  CD2 . TYR A  1  462 ? 24.702  41.403  16.324  1.00 57.51 ? 490  TYR A CD2 1 
ATOM   3437  C  CE1 . TYR A  1  462 ? 25.209  38.701  15.919  1.00 59.96 ? 490  TYR A CE1 1 
ATOM   3438  C  CE2 . TYR A  1  462 ? 24.567  40.847  15.038  1.00 57.67 ? 490  TYR A CE2 1 
ATOM   3439  C  CZ  . TYR A  1  462 ? 24.828  39.488  14.845  1.00 59.10 ? 490  TYR A CZ  1 
ATOM   3440  O  OH  . TYR A  1  462 ? 24.745  38.882  13.601  1.00 59.45 ? 490  TYR A OH  1 
ATOM   3441  N  N   . ALA A  1  463 ? 26.478  42.785  21.134  1.00 59.78 ? 491  ALA A N   1 
ATOM   3442  C  CA  . ALA A  1  463 ? 26.352  43.278  22.508  1.00 60.46 ? 491  ALA A CA  1 
ATOM   3443  C  C   . ALA A  1  463 ? 24.996  44.000  22.540  1.00 60.91 ? 491  ALA A C   1 
ATOM   3444  O  O   . ALA A  1  463 ? 24.747  44.875  21.706  1.00 59.75 ? 491  ALA A O   1 
ATOM   3445  C  CB  . ALA A  1  463 ? 27.499  44.248  22.840  1.00 58.74 ? 491  ALA A CB  1 
ATOM   3446  N  N   . THR A  1  464 ? 24.111  43.608  23.461  1.00 60.94 ? 492  THR A N   1 
ATOM   3447  C  CA  . THR A  1  464 ? 22.787  44.229  23.568  1.00 59.35 ? 492  THR A CA  1 
ATOM   3448  C  C   . THR A  1  464 ? 22.405  44.420  25.030  1.00 59.83 ? 492  THR A C   1 
ATOM   3449  O  O   . THR A  1  464 ? 23.282  44.557  25.884  1.00 59.41 ? 492  THR A O   1 
ATOM   3450  C  CB  . THR A  1  464 ? 21.684  43.378  22.856  1.00 58.32 ? 492  THR A CB  1 
ATOM   3451  O  OG1 . THR A  1  464 ? 20.432  44.085  22.873  1.00 57.66 ? 492  THR A OG1 1 
ATOM   3452  C  CG2 . THR A  1  464 ? 21.514  42.035  23.547  1.00 59.38 ? 492  THR A CG2 1 
ATOM   3453  N  N   . GLY A  1  465 ? 21.100  44.433  25.310  1.00 60.18 ? 493  GLY A N   1 
ATOM   3454  C  CA  . GLY A  1  465 ? 20.628  44.622  26.672  1.00 60.01 ? 493  GLY A CA  1 
ATOM   3455  C  C   . GLY A  1  465 ? 20.694  46.079  27.089  1.00 60.26 ? 493  GLY A C   1 
ATOM   3456  O  O   . GLY A  1  465 ? 20.297  46.965  26.329  1.00 60.86 ? 493  GLY A O   1 
ATOM   3457  N  N   . TYR A  1  466 ? 21.185  46.338  28.295  1.00 59.20 ? 494  TYR A N   1 
ATOM   3458  C  CA  . TYR A  1  466 ? 21.291  47.708  28.771  1.00 59.31 ? 494  TYR A CA  1 
ATOM   3459  C  C   . TYR A  1  466 ? 22.740  48.173  28.762  1.00 58.55 ? 494  TYR A C   1 
ATOM   3460  O  O   . TYR A  1  466 ? 23.658  47.366  28.697  1.00 58.69 ? 494  TYR A O   1 
ATOM   3461  C  CB  . TYR A  1  466 ? 20.740  47.830  30.193  1.00 59.82 ? 494  TYR A CB  1 
ATOM   3462  C  CG  . TYR A  1  466 ? 19.231  47.826  30.316  1.00 59.58 ? 494  TYR A CG  1 
ATOM   3463  C  CD1 . TYR A  1  466 ? 18.528  46.641  30.527  1.00 60.02 ? 494  TYR A CD1 1 
ATOM   3464  C  CD2 . TYR A  1  466 ? 18.507  49.019  30.268  1.00 59.72 ? 494  TYR A CD2 1 
ATOM   3465  C  CE1 . TYR A  1  466 ? 17.132  46.643  30.700  1.00 60.10 ? 494  TYR A CE1 1 
ATOM   3466  C  CE2 . TYR A  1  466 ? 17.112  49.034  30.438  1.00 60.44 ? 494  TYR A CE2 1 
ATOM   3467  C  CZ  . TYR A  1  466 ? 16.433  47.841  30.656  1.00 60.12 ? 494  TYR A CZ  1 
ATOM   3468  O  OH  . TYR A  1  466 ? 15.067  47.839  30.841  1.00 59.28 ? 494  TYR A OH  1 
ATOM   3469  N  N   . ILE A  1  467 ? 22.935  49.485  28.819  1.00 59.03 ? 495  ILE A N   1 
ATOM   3470  C  CA  . ILE A  1  467 ? 24.278  50.069  28.845  1.00 60.29 ? 495  ILE A CA  1 
ATOM   3471  C  C   . ILE A  1  467 ? 24.632  50.278  30.296  1.00 60.35 ? 495  ILE A C   1 
ATOM   3472  O  O   . ILE A  1  467 ? 24.040  49.664  31.182  1.00 61.37 ? 495  ILE A O   1 
ATOM   3473  C  CB  . ILE A  1  467 ? 24.325  51.463  28.170  1.00 59.28 ? 495  ILE A CB  1 
ATOM   3474  C  CG1 . ILE A  1  467 ? 23.037  52.234  28.487  1.00 59.12 ? 495  ILE A CG1 1 
ATOM   3475  C  CG2 . ILE A  1  467 ? 24.569  51.317  26.677  1.00 59.67 ? 495  ILE A CG2 1 
ATOM   3476  C  CD1 . ILE A  1  467 ? 22.997  53.635  27.943  1.00 57.27 ? 495  ILE A CD1 1 
ATOM   3477  N  N   . SER A  1  468 ? 25.620  51.130  30.534  1.00 59.89 ? 496  SER A N   1 
ATOM   3478  C  CA  . SER A  1  468 ? 26.014  51.483  31.889  1.00 60.92 ? 496  SER A CA  1 
ATOM   3479  C  C   . SER A  1  468 ? 25.927  52.993  31.832  1.00 61.73 ? 496  SER A C   1 
ATOM   3480  O  O   . SER A  1  468 ? 26.526  53.606  30.945  1.00 62.43 ? 496  SER A O   1 
ATOM   3481  C  CB  . SER A  1  468 ? 27.447  51.046  32.203  1.00 60.08 ? 496  SER A CB  1 
ATOM   3482  O  OG  . SER A  1  468 ? 27.489  49.686  32.591  1.00 60.20 ? 496  SER A OG  1 
ATOM   3483  N  N   . SER A  1  469 ? 25.146  53.587  32.733  1.00 62.08 ? 497  SER A N   1 
ATOM   3484  C  CA  . SER A  1  469 ? 24.998  55.041  32.762  1.00 62.04 ? 497  SER A CA  1 
ATOM   3485  C  C   . SER A  1  469 ? 25.621  55.617  34.034  1.00 62.60 ? 497  SER A C   1 
ATOM   3486  O  O   . SER A  1  469 ? 25.923  54.887  34.983  1.00 62.62 ? 497  SER A O   1 
ATOM   3487  C  CB  . SER A  1  469 ? 23.515  55.442  32.689  1.00 60.20 ? 497  SER A CB  1 
ATOM   3488  O  OG  . SER A  1  469 ? 22.908  55.453  33.971  1.00 59.09 ? 497  SER A OG  1 
ATOM   3489  N  N   . ALA A  1  470 ? 25.836  56.927  34.036  1.00 63.74 ? 498  ALA A N   1 
ATOM   3490  C  CA  . ALA A  1  470 ? 26.389  57.606  35.202  1.00 63.79 ? 498  ALA A CA  1 
ATOM   3491  C  C   . ALA A  1  470 ? 25.539  58.840  35.472  1.00 63.54 ? 498  ALA A C   1 
ATOM   3492  O  O   . ALA A  1  470 ? 24.569  59.125  34.760  1.00 62.43 ? 498  ALA A O   1 
ATOM   3493  C  CB  . ALA A  1  470 ? 27.852  58.010  34.960  1.00 62.59 ? 498  ALA A CB  1 
ATOM   3494  N  N   . PHE A  1  471 ? 25.880  59.568  36.519  1.00 65.05 ? 499  PHE A N   1 
ATOM   3495  C  CA  . PHE A  1  471 ? 25.115  60.755  36.780  1.00 65.89 ? 499  PHE A CA  1 
ATOM   3496  C  C   . PHE A  1  471 ? 25.655  61.873  35.898  1.00 66.06 ? 499  PHE A C   1 
ATOM   3497  O  O   . PHE A  1  471 ? 26.869  62.079  35.773  1.00 64.49 ? 499  PHE A O   1 
ATOM   3498  C  CB  . PHE A  1  471 ? 25.180  61.151  38.248  1.00 65.26 ? 499  PHE A CB  1 
ATOM   3499  C  CG  . PHE A  1  471 ? 24.328  62.329  38.564  1.00 65.48 ? 499  PHE A CG  1 
ATOM   3500  C  CD1 . PHE A  1  471 ? 24.900  63.529  38.980  1.00 65.10 ? 499  PHE A CD1 1 
ATOM   3501  C  CD2 . PHE A  1  471 ? 22.952  62.270  38.364  1.00 65.74 ? 499  PHE A CD2 1 
ATOM   3502  C  CE1 . PHE A  1  471 ? 24.114  64.666  39.187  1.00 65.40 ? 499  PHE A CE1 1 
ATOM   3503  C  CE2 . PHE A  1  471 ? 22.150  63.403  38.568  1.00 66.49 ? 499  PHE A CE2 1 
ATOM   3504  C  CZ  . PHE A  1  471 ? 22.734  64.604  38.979  1.00 66.25 ? 499  PHE A CZ  1 
ATOM   3505  N  N   . LEU A  1  472 ? 24.724  62.577  35.274  1.00 66.66 ? 500  LEU A N   1 
ATOM   3506  C  CA  . LEU A  1  472 ? 25.035  63.677  34.380  1.00 67.91 ? 500  LEU A CA  1 
ATOM   3507  C  C   . LEU A  1  472 ? 25.368  64.959  35.149  1.00 68.98 ? 500  LEU A C   1 
ATOM   3508  O  O   . LEU A  1  472 ? 24.738  65.268  36.161  1.00 68.98 ? 500  LEU A O   1 
ATOM   3509  C  CB  . LEU A  1  472 ? 23.829  63.928  33.477  1.00 68.49 ? 500  LEU A CB  1 
ATOM   3510  C  CG  . LEU A  1  472 ? 24.002  64.768  32.212  1.00 68.72 ? 500  LEU A CG  1 
ATOM   3511  C  CD1 . LEU A  1  472 ? 24.632  63.914  31.120  1.00 68.37 ? 500  LEU A CD1 1 
ATOM   3512  C  CD2 . LEU A  1  472 ? 22.645  65.292  31.762  1.00 68.61 ? 500  LEU A CD2 1 
ATOM   3513  N  N   . PHE A  1  473 ? 26.357  65.701  34.658  1.00 69.85 ? 501  PHE A N   1 
ATOM   3514  C  CA  . PHE A  1  473 ? 26.770  66.967  35.270  1.00 70.48 ? 501  PHE A CA  1 
ATOM   3515  C  C   . PHE A  1  473 ? 28.004  67.512  34.532  1.00 72.02 ? 501  PHE A C   1 
ATOM   3516  O  O   . PHE A  1  473 ? 28.789  66.741  33.959  1.00 71.14 ? 501  PHE A O   1 
ATOM   3517  C  CB  . PHE A  1  473 ? 27.078  66.775  36.766  1.00 68.46 ? 501  PHE A CB  1 
ATOM   3518  C  CG  . PHE A  1  473 ? 28.338  65.999  37.035  1.00 68.91 ? 501  PHE A CG  1 
ATOM   3519  C  CD1 . PHE A  1  473 ? 29.524  66.661  37.332  1.00 68.46 ? 501  PHE A CD1 1 
ATOM   3520  C  CD2 . PHE A  1  473 ? 28.348  64.602  36.968  1.00 70.16 ? 501  PHE A CD2 1 
ATOM   3521  C  CE1 . PHE A  1  473 ? 30.707  65.945  37.557  1.00 69.21 ? 501  PHE A CE1 1 
ATOM   3522  C  CE2 . PHE A  1  473 ? 29.530  63.873  37.192  1.00 69.32 ? 501  PHE A CE2 1 
ATOM   3523  C  CZ  . PHE A  1  473 ? 30.709  64.549  37.487  1.00 68.79 ? 501  PHE A CZ  1 
ATOM   3524  N  N   . GLY A  1  474 ? 28.151  68.837  34.524  1.00 71.68 ? 502  GLY A N   1 
ATOM   3525  C  CA  . GLY A  1  474 ? 29.292  69.459  33.869  1.00 71.38 ? 502  GLY A CA  1 
ATOM   3526  C  C   . GLY A  1  474 ? 29.266  69.527  32.347  1.00 72.53 ? 502  GLY A C   1 
ATOM   3527  O  O   . GLY A  1  474 ? 28.212  69.376  31.711  1.00 72.76 ? 502  GLY A O   1 
ATOM   3528  N  N   . ALA A  1  475 ? 30.444  69.773  31.766  1.00 72.53 ? 503  ALA A N   1 
ATOM   3529  C  CA  . ALA A  1  475 ? 30.610  69.869  30.314  1.00 72.86 ? 503  ALA A CA  1 
ATOM   3530  C  C   . ALA A  1  475 ? 30.594  68.471  29.711  1.00 72.27 ? 503  ALA A C   1 
ATOM   3531  O  O   . ALA A  1  475 ? 31.605  67.751  29.714  1.00 71.55 ? 503  ALA A O   1 
ATOM   3532  C  CB  . ALA A  1  475 ? 31.926  70.582  29.974  1.00 73.38 ? 503  ALA A CB  1 
ATOM   3533  N  N   . THR A  1  476 ? 29.423  68.104  29.204  1.00 72.15 ? 504  THR A N   1 
ATOM   3534  C  CA  . THR A  1  476 ? 29.206  66.800  28.604  1.00 72.18 ? 504  THR A CA  1 
ATOM   3535  C  C   . THR A  1  476 ? 29.603  66.771  27.153  1.00 71.44 ? 504  THR A C   1 
ATOM   3536  O  O   . THR A  1  476 ? 29.109  67.555  26.346  1.00 70.86 ? 504  THR A O   1 
ATOM   3537  C  CB  . THR A  1  476 ? 27.737  66.388  28.691  1.00 72.02 ? 504  THR A CB  1 
ATOM   3538  O  OG1 . THR A  1  476 ? 27.399  66.147  30.064  1.00 72.89 ? 504  THR A OG1 1 
ATOM   3539  C  CG2 . THR A  1  476 ? 27.482  65.131  27.846  1.00 71.53 ? 504  THR A CG2 1 
ATOM   3540  N  N   . GLY A  1  477 ? 30.493  65.849  26.822  1.00 71.23 ? 505  GLY A N   1 
ATOM   3541  C  CA  . GLY A  1  477 ? 30.914  65.744  25.448  1.00 70.24 ? 505  GLY A CA  1 
ATOM   3542  C  C   . GLY A  1  477 ? 32.154  64.915  25.326  1.00 68.29 ? 505  GLY A C   1 
ATOM   3543  O  O   . GLY A  1  477 ? 32.464  64.405  24.250  1.00 68.72 ? 505  GLY A O   1 
ATOM   3544  N  N   . LYS A  1  478 ? 32.873  64.774  26.426  1.00 65.59 ? 506  LYS A N   1 
ATOM   3545  C  CA  . LYS A  1  478 ? 34.090  64.002  26.367  1.00 66.32 ? 506  LYS A CA  1 
ATOM   3546  C  C   . LYS A  1  478 ? 33.867  62.581  26.803  1.00 66.46 ? 506  LYS A C   1 
ATOM   3547  O  O   . LYS A  1  478 ? 34.705  61.718  26.547  1.00 66.23 ? 506  LYS A O   1 
ATOM   3548  C  CB  . LYS A  1  478 ? 35.179  64.632  27.243  1.00 66.84 ? 506  LYS A CB  1 
ATOM   3549  C  CG  . LYS A  1  478 ? 35.788  65.907  26.673  1.00 68.21 ? 506  LYS A CG  1 
ATOM   3550  C  CD  . LYS A  1  478 ? 37.111  66.263  27.346  1.00 68.30 ? 506  LYS A CD  1 
ATOM   3551  C  CE  . LYS A  1  478 ? 37.833  67.394  26.603  1.00 68.86 ? 506  LYS A CE  1 
ATOM   3552  N  NZ  . LYS A  1  478 ? 39.162  67.727  27.214  1.00 68.06 ? 506  LYS A NZ  1 
ATOM   3553  N  N   . TYR A  1  479 ? 32.722  62.323  27.425  1.00 65.95 ? 507  TYR A N   1 
ATOM   3554  C  CA  . TYR A  1  479 ? 32.480  60.991  27.955  1.00 65.55 ? 507  TYR A CA  1 
ATOM   3555  C  C   . TYR A  1  479 ? 31.244  60.274  27.479  1.00 64.31 ? 507  TYR A C   1 
ATOM   3556  O  O   . TYR A  1  479 ? 31.011  59.117  27.824  1.00 62.89 ? 507  TYR A O   1 
ATOM   3557  C  CB  . TYR A  1  479 ? 32.491  61.093  29.473  1.00 64.44 ? 507  TYR A CB  1 
ATOM   3558  C  CG  . TYR A  1  479 ? 33.751  61.776  29.934  1.00 64.69 ? 507  TYR A CG  1 
ATOM   3559  C  CD1 . TYR A  1  479 ? 34.989  61.118  29.846  1.00 65.17 ? 507  TYR A CD1 1 
ATOM   3560  C  CD2 . TYR A  1  479 ? 33.737  63.118  30.338  1.00 63.69 ? 507  TYR A CD2 1 
ATOM   3561  C  CE1 . TYR A  1  479 ? 36.186  61.783  30.137  1.00 64.98 ? 507  TYR A CE1 1 
ATOM   3562  C  CE2 . TYR A  1  479 ? 34.930  63.797  30.631  1.00 63.69 ? 507  TYR A CE2 1 
ATOM   3563  C  CZ  . TYR A  1  479 ? 36.147  63.121  30.524  1.00 64.43 ? 507  TYR A CZ  1 
ATOM   3564  O  OH  . TYR A  1  479 ? 37.327  63.779  30.771  1.00 64.59 ? 507  TYR A OH  1 
ATOM   3565  N  N   . GLY A  1  480 ? 30.456  60.958  26.675  1.00 63.11 ? 508  GLY A N   1 
ATOM   3566  C  CA  . GLY A  1  480 ? 29.261  60.331  26.184  1.00 63.28 ? 508  GLY A CA  1 
ATOM   3567  C  C   . GLY A  1  480 ? 28.225  61.379  25.916  1.00 63.45 ? 508  GLY A C   1 
ATOM   3568  O  O   . GLY A  1  480 ? 28.466  62.568  26.125  1.00 63.11 ? 508  GLY A O   1 
ATOM   3569  N  N   . ASN A  1  481 ? 27.071  60.923  25.445  1.00 63.76 ? 509  ASN A N   1 
ATOM   3570  C  CA  . ASN A  1  481 ? 25.956  61.796  25.128  1.00 62.78 ? 509  ASN A CA  1 
ATOM   3571  C  C   . ASN A  1  481 ? 24.911  61.621  26.205  1.00 62.58 ? 509  ASN A C   1 
ATOM   3572  O  O   . ASN A  1  481 ? 24.910  60.620  26.922  1.00 61.78 ? 509  ASN A O   1 
ATOM   3573  C  CB  . ASN A  1  481 ? 25.349  61.405  23.785  1.00 62.69 ? 509  ASN A CB  1 
ATOM   3574  C  CG  . ASN A  1  481 ? 26.390  61.236  22.707  1.00 63.84 ? 509  ASN A CG  1 
ATOM   3575  O  OD1 . ASN A  1  481 ? 27.067  62.191  22.323  1.00 64.46 ? 509  ASN A OD1 1 
ATOM   3576  N  ND2 . ASN A  1  481 ? 26.533  60.011  22.213  1.00 64.38 ? 509  ASN A ND2 1 
ATOM   3577  N  N   . GLN A  1  482 ? 24.023  62.597  26.326  1.00 62.48 ? 510  GLN A N   1 
ATOM   3578  C  CA  . GLN A  1  482 ? 22.970  62.495  27.312  1.00 62.43 ? 510  GLN A CA  1 
ATOM   3579  C  C   . GLN A  1  482 ? 21.866  61.653  26.690  1.00 62.46 ? 510  GLN A C   1 
ATOM   3580  O  O   . GLN A  1  482 ? 21.349  61.988  25.622  1.00 61.09 ? 510  GLN A O   1 
ATOM   3581  C  CB  . GLN A  1  482 ? 22.420  63.867  27.672  1.00 62.57 ? 510  GLN A CB  1 
ATOM   3582  C  CG  . GLN A  1  482 ? 21.704  63.858  29.012  1.00 62.78 ? 510  GLN A CG  1 
ATOM   3583  C  CD  . GLN A  1  482 ? 20.785  65.038  29.198  1.00 62.49 ? 510  GLN A CD  1 
ATOM   3584  O  OE1 . GLN A  1  482 ? 21.150  66.179  28.900  1.00 62.66 ? 510  GLN A OE1 1 
ATOM   3585  N  NE2 . GLN A  1  482 ? 19.583  64.775  29.705  1.00 61.80 ? 510  GLN A NE2 1 
ATOM   3586  N  N   . VAL A  1  483 ? 21.508  60.565  27.364  1.00 61.74 ? 511  VAL A N   1 
ATOM   3587  C  CA  . VAL A  1  483 ? 20.481  59.659  26.864  1.00 62.22 ? 511  VAL A CA  1 
ATOM   3588  C  C   . VAL A  1  483 ? 19.174  59.761  27.643  1.00 62.14 ? 511  VAL A C   1 
ATOM   3589  O  O   . VAL A  1  483 ? 18.147  59.198  27.243  1.00 60.80 ? 511  VAL A O   1 
ATOM   3590  C  CB  . VAL A  1  483 ? 20.973  58.200  26.929  1.00 61.47 ? 511  VAL A CB  1 
ATOM   3591  C  CG1 . VAL A  1  483 ? 22.192  58.009  26.036  1.00 61.66 ? 511  VAL A CG1 1 
ATOM   3592  C  CG2 . VAL A  1  483 ? 21.326  57.852  28.350  1.00 61.95 ? 511  VAL A CG2 1 
ATOM   3593  N  N   . SER A  1  484 ? 19.217  60.485  28.754  1.00 62.12 ? 512  SER A N   1 
ATOM   3594  C  CA  . SER A  1  484 ? 18.039  60.636  29.589  1.00 63.73 ? 512  SER A CA  1 
ATOM   3595  C  C   . SER A  1  484 ? 18.317  61.565  30.782  1.00 64.49 ? 512  SER A C   1 
ATOM   3596  O  O   . SER A  1  484 ? 19.466  61.901  31.087  1.00 63.56 ? 512  SER A O   1 
ATOM   3597  C  CB  . SER A  1  484 ? 17.586  59.250  30.083  1.00 63.80 ? 512  SER A CB  1 
ATOM   3598  O  OG  . SER A  1  484 ? 16.216  59.230  30.463  1.00 64.24 ? 512  SER A OG  1 
ATOM   3599  N  N   . GLU A  1  485 ? 17.242  61.973  31.447  1.00 64.67 ? 513  GLU A N   1 
ATOM   3600  C  CA  . GLU A  1  485 ? 17.309  62.858  32.595  1.00 63.39 ? 513  GLU A CA  1 
ATOM   3601  C  C   . GLU A  1  485 ? 18.394  62.508  33.591  1.00 64.16 ? 513  GLU A C   1 
ATOM   3602  O  O   . GLU A  1  485 ? 18.363  61.439  34.204  1.00 64.55 ? 513  GLU A O   1 
ATOM   3603  C  CB  . GLU A  1  485 ? 15.959  62.877  33.315  1.00 63.93 ? 513  GLU A CB  1 
ATOM   3604  C  CG  . GLU A  1  485 ? 14.893  63.616  32.551  1.00 66.14 ? 513  GLU A CG  1 
ATOM   3605  C  CD  . GLU A  1  485 ? 15.253  65.083  32.364  1.00 68.33 ? 513  GLU A CD  1 
ATOM   3606  O  OE1 . GLU A  1  485 ? 14.675  65.740  31.466  1.00 68.72 ? 513  GLU A OE1 1 
ATOM   3607  O  OE2 . GLU A  1  485 ? 16.116  65.581  33.125  1.00 69.57 ? 513  GLU A OE2 1 
ATOM   3608  N  N   . HIS A  1  486 ? 19.353  63.420  33.735  1.00 64.29 ? 514  HIS A N   1 
ATOM   3609  C  CA  . HIS A  1  486 ? 20.447  63.281  34.697  1.00 63.78 ? 514  HIS A CA  1 
ATOM   3610  C  C   . HIS A  1  486 ? 21.354  62.052  34.488  1.00 63.76 ? 514  HIS A C   1 
ATOM   3611  O  O   . HIS A  1  486 ? 22.153  61.686  35.370  1.00 62.56 ? 514  HIS A O   1 
ATOM   3612  C  CB  . HIS A  1  486 ? 19.859  63.264  36.125  1.00 65.70 ? 514  HIS A CB  1 
ATOM   3613  C  CG  . HIS A  1  486 ? 18.696  64.201  36.326  1.00 66.90 ? 514  HIS A CG  1 
ATOM   3614  N  ND1 . HIS A  1  486 ? 18.781  65.561  36.109  1.00 66.80 ? 514  HIS A ND1 1 
ATOM   3615  C  CD2 . HIS A  1  486 ? 17.423  63.966  36.731  1.00 66.80 ? 514  HIS A CD2 1 
ATOM   3616  C  CE1 . HIS A  1  486 ? 17.613  66.122  36.370  1.00 66.85 ? 514  HIS A CE1 1 
ATOM   3617  N  NE2 . HIS A  1  486 ? 16.771  65.176  36.749  1.00 66.84 ? 514  HIS A NE2 1 
ATOM   3618  N  N   . THR A  1  487 ? 21.236  61.413  33.324  1.00 63.24 ? 515  THR A N   1 
ATOM   3619  C  CA  . THR A  1  487 ? 22.055  60.238  33.038  1.00 62.15 ? 515  THR A CA  1 
ATOM   3620  C  C   . THR A  1  487 ? 22.829  60.313  31.735  1.00 59.95 ? 515  THR A C   1 
ATOM   3621  O  O   . THR A  1  487 ? 22.310  60.674  30.679  1.00 58.79 ? 515  THR A O   1 
ATOM   3622  C  CB  . THR A  1  487 ? 21.222  58.931  33.056  1.00 62.07 ? 515  THR A CB  1 
ATOM   3623  O  OG1 . THR A  1  487 ? 19.976  59.145  32.376  1.00 61.06 ? 515  THR A OG1 1 
ATOM   3624  C  CG2 . THR A  1  487 ? 20.986  58.462  34.523  1.00 61.56 ? 515  THR A CG2 1 
ATOM   3625  N  N   . LEU A  1  488 ? 24.098  59.954  31.838  1.00 60.05 ? 516  LEU A N   1 
ATOM   3626  C  CA  . LEU A  1  488 ? 24.996  59.986  30.707  1.00 59.93 ? 516  LEU A CA  1 
ATOM   3627  C  C   . LEU A  1  488 ? 25.273  58.592  30.166  1.00 58.14 ? 516  LEU A C   1 
ATOM   3628  O  O   . LEU A  1  488 ? 25.223  57.603  30.901  1.00 56.33 ? 516  LEU A O   1 
ATOM   3629  C  CB  . LEU A  1  488 ? 26.311  60.660  31.126  1.00 59.09 ? 516  LEU A CB  1 
ATOM   3630  C  CG  . LEU A  1  488 ? 27.422  60.860  30.081  1.00 59.86 ? 516  LEU A CG  1 
ATOM   3631  C  CD1 . LEU A  1  488 ? 27.798  62.342  30.032  1.00 59.69 ? 516  LEU A CD1 1 
ATOM   3632  C  CD2 . LEU A  1  488 ? 28.646  59.987  30.414  1.00 59.05 ? 516  LEU A CD2 1 
ATOM   3633  N  N   . GLY A  1  489 ? 25.546  58.536  28.865  1.00 56.99 ? 517  GLY A N   1 
ATOM   3634  C  CA  . GLY A  1  489 ? 25.867  57.288  28.211  1.00 55.69 ? 517  GLY A CA  1 
ATOM   3635  C  C   . GLY A  1  489 ? 27.373  57.235  28.090  1.00 54.96 ? 517  GLY A C   1 
ATOM   3636  O  O   . GLY A  1  489 ? 27.949  57.771  27.138  1.00 55.00 ? 517  GLY A O   1 
ATOM   3637  N  N   . THR A  1  490 ? 27.998  56.592  29.074  1.00 53.82 ? 518  THR A N   1 
ATOM   3638  C  CA  . THR A  1  490 ? 29.448  56.452  29.159  1.00 53.27 ? 518  THR A CA  1 
ATOM   3639  C  C   . THR A  1  490 ? 30.117  55.836  27.940  1.00 53.79 ? 518  THR A C   1 
ATOM   3640  O  O   . THR A  1  490 ? 29.808  54.708  27.536  1.00 54.28 ? 518  THR A O   1 
ATOM   3641  C  CB  . THR A  1  490 ? 29.859  55.591  30.360  1.00 54.87 ? 518  THR A CB  1 
ATOM   3642  O  OG1 . THR A  1  490 ? 29.481  54.225  30.121  1.00 56.82 ? 518  THR A OG1 1 
ATOM   3643  C  CG2 . THR A  1  490 ? 29.187  56.095  31.625  1.00 54.62 ? 518  THR A CG2 1 
ATOM   3644  N  N   . VAL A  1  491 ? 31.057  56.580  27.372  1.00 52.93 ? 519  VAL A N   1 
ATOM   3645  C  CA  . VAL A  1  491 ? 31.801  56.124  26.217  1.00 50.42 ? 519  VAL A CA  1 
ATOM   3646  C  C   . VAL A  1  491 ? 32.579  54.859  26.595  1.00 49.63 ? 519  VAL A C   1 
ATOM   3647  O  O   . VAL A  1  491 ? 33.169  54.783  27.677  1.00 49.29 ? 519  VAL A O   1 
ATOM   3648  C  CB  . VAL A  1  491 ? 32.754  57.229  25.776  1.00 50.86 ? 519  VAL A CB  1 
ATOM   3649  C  CG1 . VAL A  1  491 ? 33.419  57.847  26.998  1.00 50.73 ? 519  VAL A CG1 1 
ATOM   3650  C  CG2 . VAL A  1  491 ? 33.784  56.675  24.838  1.00 51.36 ? 519  VAL A CG2 1 
ATOM   3651  N  N   . HIS A  1  492 ? 32.567  53.858  25.721  1.00 48.28 ? 520  HIS A N   1 
ATOM   3652  C  CA  . HIS A  1  492 ? 33.291  52.619  26.004  1.00 47.95 ? 520  HIS A CA  1 
ATOM   3653  C  C   . HIS A  1  492 ? 33.650  51.834  24.756  1.00 47.34 ? 520  HIS A C   1 
ATOM   3654  O  O   . HIS A  1  492 ? 33.180  52.141  23.663  1.00 47.32 ? 520  HIS A O   1 
ATOM   3655  C  CB  . HIS A  1  492 ? 32.475  51.709  26.918  1.00 47.34 ? 520  HIS A CB  1 
ATOM   3656  C  CG  . HIS A  1  492 ? 31.164  51.298  26.338  1.00 46.86 ? 520  HIS A CG  1 
ATOM   3657  N  ND1 . HIS A  1  492 ? 30.020  52.052  26.476  1.00 48.97 ? 520  HIS A ND1 1 
ATOM   3658  C  CD2 . HIS A  1  492 ? 30.815  50.216  25.605  1.00 48.35 ? 520  HIS A CD2 1 
ATOM   3659  C  CE1 . HIS A  1  492 ? 29.021  51.451  25.856  1.00 48.40 ? 520  HIS A CE1 1 
ATOM   3660  N  NE2 . HIS A  1  492 ? 29.477  50.335  25.319  1.00 47.92 ? 520  HIS A NE2 1 
ATOM   3661  N  N   . THR A  1  493 ? 34.490  50.816  24.930  1.00 48.55 ? 521  THR A N   1 
ATOM   3662  C  CA  . THR A  1  493 ? 34.898  49.958  23.821  1.00 47.49 ? 521  THR A CA  1 
ATOM   3663  C  C   . THR A  1  493 ? 34.618  48.483  24.134  1.00 47.39 ? 521  THR A C   1 
ATOM   3664  O  O   . THR A  1  493 ? 34.832  48.020  25.257  1.00 48.15 ? 521  THR A O   1 
ATOM   3665  C  CB  . THR A  1  493 ? 36.405  50.113  23.484  1.00 46.82 ? 521  THR A CB  1 
ATOM   3666  O  OG1 . THR A  1  493 ? 37.195  49.748  24.623  1.00 48.42 ? 521  THR A OG1 1 
ATOM   3667  C  CG2 . THR A  1  493 ? 36.728  51.541  23.061  1.00 45.60 ? 521  THR A CG2 1 
ATOM   3668  N  N   . HIS A  1  494 ? 34.121  47.762  23.134  1.00 46.58 ? 522  HIS A N   1 
ATOM   3669  C  CA  . HIS A  1  494 ? 33.814  46.339  23.261  1.00 46.25 ? 522  HIS A CA  1 
ATOM   3670  C  C   . HIS A  1  494 ? 34.805  45.563  22.395  1.00 46.50 ? 522  HIS A C   1 
ATOM   3671  O  O   . HIS A  1  494 ? 35.058  45.943  21.254  1.00 46.29 ? 522  HIS A O   1 
ATOM   3672  C  CB  . HIS A  1  494 ? 32.403  46.035  22.744  1.00 48.63 ? 522  HIS A CB  1 
ATOM   3673  C  CG  . HIS A  1  494 ? 31.293  46.573  23.594  1.00 48.69 ? 522  HIS A CG  1 
ATOM   3674  N  ND1 . HIS A  1  494 ? 30.942  46.014  24.804  1.00 49.43 ? 522  HIS A ND1 1 
ATOM   3675  C  CD2 . HIS A  1  494 ? 30.414  47.581  23.376  1.00 49.19 ? 522  HIS A CD2 1 
ATOM   3676  C  CE1 . HIS A  1  494 ? 29.892  46.652  25.292  1.00 49.18 ? 522  HIS A CE1 1 
ATOM   3677  N  NE2 . HIS A  1  494 ? 29.552  47.607  24.445  1.00 48.96 ? 522  HIS A NE2 1 
ATOM   3678  N  N   . SER A  1  495 ? 35.349  44.473  22.928  1.00 48.28 ? 523  SER A N   1 
ATOM   3679  C  CA  . SER A  1  495 ? 36.308  43.638  22.195  1.00 46.32 ? 523  SER A CA  1 
ATOM   3680  C  C   . SER A  1  495 ? 36.149  42.195  22.683  1.00 45.97 ? 523  SER A C   1 
ATOM   3681  O  O   . SER A  1  495 ? 35.834  41.967  23.846  1.00 45.96 ? 523  SER A O   1 
ATOM   3682  C  CB  . SER A  1  495 ? 37.756  44.102  22.461  1.00 45.65 ? 523  SER A CB  1 
ATOM   3683  O  OG  . SER A  1  495 ? 37.926  45.505  22.308  1.00 46.16 ? 523  SER A OG  1 
ATOM   3684  N  N   . ALA A  1  496 ? 36.367  41.226  21.800  1.00 46.19 ? 524  ALA A N   1 
ATOM   3685  C  CA  . ALA A  1  496 ? 36.260  39.811  22.161  1.00 45.89 ? 524  ALA A CA  1 
ATOM   3686  C  C   . ALA A  1  496 ? 37.321  39.006  21.421  1.00 46.14 ? 524  ALA A C   1 
ATOM   3687  O  O   . ALA A  1  496 ? 37.485  39.136  20.212  1.00 47.47 ? 524  ALA A O   1 
ATOM   3688  C  CB  . ALA A  1  496 ? 34.876  39.282  21.822  1.00 46.08 ? 524  ALA A CB  1 
ATOM   3689  N  N   . HIS A  1  497 ? 38.029  38.153  22.140  1.00 46.72 ? 525  HIS A N   1 
ATOM   3690  C  CA  . HIS A  1  497 ? 39.090  37.364  21.532  1.00 47.55 ? 525  HIS A CA  1 
ATOM   3691  C  C   . HIS A  1  497 ? 38.676  35.928  21.259  1.00 47.48 ? 525  HIS A C   1 
ATOM   3692  O  O   . HIS A  1  497 ? 38.139  35.265  22.138  1.00 48.60 ? 525  HIS A O   1 
ATOM   3693  C  CB  . HIS A  1  497 ? 40.285  37.358  22.466  1.00 48.96 ? 525  HIS A CB  1 
ATOM   3694  C  CG  . HIS A  1  497 ? 41.573  37.006  21.802  1.00 50.83 ? 525  HIS A CG  1 
ATOM   3695  N  ND1 . HIS A  1  497 ? 42.505  36.178  22.388  1.00 50.44 ? 525  HIS A ND1 1 
ATOM   3696  C  CD2 . HIS A  1  497 ? 42.113  37.417  20.632  1.00 51.27 ? 525  HIS A CD2 1 
ATOM   3697  C  CE1 . HIS A  1  497 ? 43.566  36.096  21.608  1.00 50.87 ? 525  HIS A CE1 1 
ATOM   3698  N  NE2 . HIS A  1  497 ? 43.355  36.838  20.536  1.00 51.41 ? 525  HIS A NE2 1 
ATOM   3699  N  N   . PHE A  1  498 ? 38.935  35.434  20.055  1.00 47.53 ? 526  PHE A N   1 
ATOM   3700  C  CA  . PHE A  1  498 ? 38.577  34.055  19.742  1.00 48.81 ? 526  PHE A CA  1 
ATOM   3701  C  C   . PHE A  1  498 ? 39.750  33.176  19.321  1.00 50.67 ? 526  PHE A C   1 
ATOM   3702  O  O   . PHE A  1  498 ? 40.588  33.574  18.498  1.00 49.47 ? 526  PHE A O   1 
ATOM   3703  C  CB  . PHE A  1  498 ? 37.555  33.980  18.621  1.00 48.29 ? 526  PHE A CB  1 
ATOM   3704  C  CG  . PHE A  1  498 ? 36.367  34.853  18.809  1.00 48.09 ? 526  PHE A CG  1 
ATOM   3705  C  CD1 . PHE A  1  498 ? 36.470  36.232  18.647  1.00 48.89 ? 526  PHE A CD1 1 
ATOM   3706  C  CD2 . PHE A  1  498 ? 35.118  34.291  19.074  1.00 48.53 ? 526  PHE A CD2 1 
ATOM   3707  C  CE1 . PHE A  1  498 ? 35.336  37.050  18.738  1.00 49.87 ? 526  PHE A CE1 1 
ATOM   3708  C  CE2 . PHE A  1  498 ? 33.972  35.092  19.168  1.00 48.85 ? 526  PHE A CE2 1 
ATOM   3709  C  CZ  . PHE A  1  498 ? 34.079  36.477  18.998  1.00 49.20 ? 526  PHE A CZ  1 
ATOM   3710  N  N   . LYS A  1  499 ? 39.776  31.962  19.867  1.00 52.18 ? 527  LYS A N   1 
ATOM   3711  C  CA  . LYS A  1  499 ? 40.814  30.991  19.543  1.00 53.09 ? 527  LYS A CA  1 
ATOM   3712  C  C   . LYS A  1  499 ? 40.320  30.110  18.410  1.00 52.86 ? 527  LYS A C   1 
ATOM   3713  O  O   . LYS A  1  499 ? 39.525  29.194  18.618  1.00 53.24 ? 527  LYS A O   1 
ATOM   3714  C  CB  . LYS A  1  499 ? 41.148  30.108  20.746  1.00 53.06 ? 527  LYS A CB  1 
ATOM   3715  C  CG  . LYS A  1  499 ? 42.172  29.022  20.428  1.00 54.02 ? 527  LYS A CG  1 
ATOM   3716  C  CD  . LYS A  1  499 ? 42.434  28.092  21.610  1.00 53.92 ? 527  LYS A CD  1 
ATOM   3717  C  CE  . LYS A  1  499 ? 43.390  26.971  21.211  1.00 54.41 ? 527  LYS A CE  1 
ATOM   3718  N  NZ  . LYS A  1  499 ? 43.683  25.996  22.299  1.00 54.31 ? 527  LYS A NZ  1 
ATOM   3719  N  N   . VAL A  1  500 ? 40.786  30.398  17.205  1.00 53.71 ? 528  VAL A N   1 
ATOM   3720  C  CA  . VAL A  1  500 ? 40.383  29.608  16.062  1.00 54.10 ? 528  VAL A CA  1 
ATOM   3721  C  C   . VAL A  1  500 ? 41.525  28.653  15.727  1.00 55.62 ? 528  VAL A C   1 
ATOM   3722  O  O   . VAL A  1  500 ? 42.527  29.036  15.123  1.00 54.85 ? 528  VAL A O   1 
ATOM   3723  C  CB  . VAL A  1  500 ? 40.076  30.497  14.852  1.00 52.11 ? 528  VAL A CB  1 
ATOM   3724  C  CG1 . VAL A  1  500 ? 39.462  29.664  13.772  1.00 52.96 ? 528  VAL A CG1 1 
ATOM   3725  C  CG2 . VAL A  1  500 ? 39.133  31.619  15.243  1.00 52.64 ? 528  VAL A CG2 1 
ATOM   3726  N  N   . ASP A  1  501 ? 41.392  27.406  16.151  1.00 55.00 ? 529  ASP A N   1 
ATOM   3727  C  CA  . ASP A  1  501 ? 42.434  26.449  15.872  1.00 55.52 ? 529  ASP A CA  1 
ATOM   3728  C  C   . ASP A  1  501 ? 42.029  25.537  14.743  1.00 56.90 ? 529  ASP A C   1 
ATOM   3729  O  O   . ASP A  1  501 ? 41.465  24.463  14.952  1.00 56.96 ? 529  ASP A O   1 
ATOM   3730  C  CB  . ASP A  1  501 ? 42.762  25.628  17.103  1.00 56.53 ? 529  ASP A CB  1 
ATOM   3731  C  CG  . ASP A  1  501 ? 43.603  24.435  16.771  1.00 57.38 ? 529  ASP A CG  1 
ATOM   3732  O  OD1 . ASP A  1  501 ? 44.590  24.597  16.014  1.00 58.15 ? 529  ASP A OD1 1 
ATOM   3733  O  OD2 . ASP A  1  501 ? 43.271  23.339  17.261  1.00 58.20 ? 529  ASP A OD2 1 
ATOM   3734  N  N   . LEU A  1  502 ? 42.325  25.989  13.537  1.00 56.75 ? 530  LEU A N   1 
ATOM   3735  C  CA  . LEU A  1  502 ? 42.014  25.238  12.347  1.00 56.22 ? 530  LEU A CA  1 
ATOM   3736  C  C   . LEU A  1  502 ? 43.022  24.122  12.182  1.00 56.67 ? 530  LEU A C   1 
ATOM   3737  O  O   . LEU A  1  502 ? 44.070  24.113  12.816  1.00 57.62 ? 530  LEU A O   1 
ATOM   3738  C  CB  . LEU A  1  502 ? 42.075  26.152  11.123  1.00 56.79 ? 530  LEU A CB  1 
ATOM   3739  C  CG  . LEU A  1  502 ? 41.058  27.291  10.984  1.00 56.49 ? 530  LEU A CG  1 
ATOM   3740  C  CD1 . LEU A  1  502 ? 41.374  28.143  9.782   1.00 55.61 ? 530  LEU A CD1 1 
ATOM   3741  C  CD2 . LEU A  1  502 ? 39.674  26.710  10.830  1.00 58.39 ? 530  LEU A CD2 1 
ATOM   3742  N  N   . ASP A  1  503 ? 42.682  23.180  11.320  1.00 57.46 ? 531  ASP A N   1 
ATOM   3743  C  CA  . ASP A  1  503 ? 43.540  22.055  11.002  1.00 57.51 ? 531  ASP A CA  1 
ATOM   3744  C  C   . ASP A  1  503 ? 43.202  21.717  9.556   1.00 58.39 ? 531  ASP A C   1 
ATOM   3745  O  O   . ASP A  1  503 ? 42.564  20.692  9.273   1.00 59.05 ? 531  ASP A O   1 
ATOM   3746  C  CB  . ASP A  1  503 ? 43.241  20.880  11.932  1.00 57.36 ? 531  ASP A CB  1 
ATOM   3747  C  CG  . ASP A  1  503 ? 43.550  21.205  13.373  1.00 56.91 ? 531  ASP A CG  1 
ATOM   3748  O  OD1 . ASP A  1  503 ? 44.697  21.586  13.678  1.00 55.89 ? 531  ASP A OD1 1 
ATOM   3749  O  OD2 . ASP A  1  503 ? 42.642  21.084  14.208  1.00 57.86 ? 531  ASP A OD2 1 
ATOM   3750  N  N   . VAL A  1  504 ? 43.628  22.611  8.657   1.00 57.50 ? 532  VAL A N   1 
ATOM   3751  C  CA  . VAL A  1  504 ? 43.380  22.494  7.220   1.00 57.81 ? 532  VAL A CA  1 
ATOM   3752  C  C   . VAL A  1  504 ? 43.921  21.208  6.632   1.00 58.33 ? 532  VAL A C   1 
ATOM   3753  O  O   . VAL A  1  504 ? 45.105  21.127  6.291   1.00 58.71 ? 532  VAL A O   1 
ATOM   3754  C  CB  . VAL A  1  504 ? 44.002  23.677  6.441   1.00 58.12 ? 532  VAL A CB  1 
ATOM   3755  C  CG1 . VAL A  1  504 ? 43.650  23.570  4.978   1.00 57.65 ? 532  VAL A CG1 1 
ATOM   3756  C  CG2 . VAL A  1  504 ? 43.499  24.994  6.996   1.00 57.87 ? 532  VAL A CG2 1 
ATOM   3757  N  N   . ALA A  1  505 ? 43.049  20.206  6.517   1.00 58.37 ? 533  ALA A N   1 
ATOM   3758  C  CA  . ALA A  1  505 ? 43.436  18.914  5.969   1.00 58.57 ? 533  ALA A CA  1 
ATOM   3759  C  C   . ALA A  1  505 ? 44.763  18.442  6.575   1.00 59.17 ? 533  ALA A C   1 
ATOM   3760  O  O   . ALA A  1  505 ? 45.687  18.066  5.850   1.00 58.97 ? 533  ALA A O   1 
ATOM   3761  C  CB  . ALA A  1  505 ? 43.566  19.032  4.469   1.00 58.62 ? 533  ALA A CB  1 
ATOM   3762  N  N   . GLY A  1  506 ? 44.851  18.467  7.903   1.00 58.87 ? 534  GLY A N   1 
ATOM   3763  C  CA  . GLY A  1  506 ? 46.073  18.063  8.576   1.00 59.04 ? 534  GLY A CA  1 
ATOM   3764  C  C   . GLY A  1  506 ? 46.525  19.155  9.523   1.00 58.40 ? 534  GLY A C   1 
ATOM   3765  O  O   . GLY A  1  506 ? 46.049  20.279  9.441   1.00 58.83 ? 534  GLY A O   1 
ATOM   3766  N  N   . LEU A  1  507 ? 47.456  18.841  10.413  1.00 58.13 ? 535  LEU A N   1 
ATOM   3767  C  CA  . LEU A  1  507 ? 47.936  19.823  11.381  1.00 58.46 ? 535  LEU A CA  1 
ATOM   3768  C  C   . LEU A  1  507 ? 48.900  20.854  10.789  1.00 58.76 ? 535  LEU A C   1 
ATOM   3769  O  O   . LEU A  1  507 ? 48.947  22.003  11.228  1.00 59.45 ? 535  LEU A O   1 
ATOM   3770  C  CB  . LEU A  1  507 ? 48.623  19.105  12.547  1.00 58.59 ? 535  LEU A CB  1 
ATOM   3771  C  CG  . LEU A  1  507 ? 47.886  17.905  13.151  1.00 58.75 ? 535  LEU A CG  1 
ATOM   3772  C  CD1 . LEU A  1  507 ? 48.891  17.040  13.904  1.00 59.02 ? 535  LEU A CD1 1 
ATOM   3773  C  CD2 . LEU A  1  507 ? 46.746  18.365  14.057  1.00 57.87 ? 535  LEU A CD2 1 
ATOM   3774  N  N   . GLU A  1  508 ? 49.674  20.438  9.797   1.00 59.13 ? 536  GLU A N   1 
ATOM   3775  C  CA  . GLU A  1  508 ? 50.644  21.324  9.164   1.00 58.50 ? 536  GLU A CA  1 
ATOM   3776  C  C   . GLU A  1  508 ? 49.934  22.319  8.287   1.00 57.40 ? 536  GLU A C   1 
ATOM   3777  O  O   . GLU A  1  508 ? 49.361  21.971  7.250   1.00 57.72 ? 536  GLU A O   1 
ATOM   3778  C  CB  . GLU A  1  508 ? 51.632  20.519  8.328   1.00 60.84 ? 536  GLU A CB  1 
ATOM   3779  C  CG  . GLU A  1  508 ? 51.338  19.037  8.360   1.00 63.02 ? 536  GLU A CG  1 
ATOM   3780  C  CD  . GLU A  1  508 ? 51.358  18.490  9.770   1.00 63.67 ? 536  GLU A CD  1 
ATOM   3781  O  OE1 . GLU A  1  508 ? 50.660  17.476  10.021  1.00 64.80 ? 536  GLU A OE1 1 
ATOM   3782  O  OE2 . GLU A  1  508 ? 52.074  19.079  10.619  1.00 64.34 ? 536  GLU A OE2 1 
ATOM   3783  N  N   . ASN A  1  509 ? 49.972  23.566  8.724   1.00 56.54 ? 537  ASN A N   1 
ATOM   3784  C  CA  . ASN A  1  509 ? 49.331  24.635  7.995   1.00 57.32 ? 537  ASN A CA  1 
ATOM   3785  C  C   . ASN A  1  509 ? 50.325  25.773  7.881   1.00 55.47 ? 537  ASN A C   1 
ATOM   3786  O  O   . ASN A  1  509 ? 51.209  25.920  8.720   1.00 55.43 ? 537  ASN A O   1 
ATOM   3787  C  CB  . ASN A  1  509 ? 48.071  25.094  8.738   1.00 55.56 ? 537  ASN A CB  1 
ATOM   3788  C  CG  . ASN A  1  509 ? 47.039  23.989  8.884   1.00 54.06 ? 537  ASN A CG  1 
ATOM   3789  O  OD1 . ASN A  1  509 ? 46.544  23.742  9.980   1.00 55.65 ? 537  ASN A OD1 1 
ATOM   3790  N  ND2 . ASN A  1  509 ? 46.707  23.325  7.781   1.00 52.78 ? 537  ASN A ND2 1 
ATOM   3791  N  N   . TRP A  1  510 ? 50.182  26.565  6.830   1.00 53.96 ? 538  TRP A N   1 
ATOM   3792  C  CA  . TRP A  1  510 ? 51.066  27.687  6.611   1.00 54.47 ? 538  TRP A CA  1 
ATOM   3793  C  C   . TRP A  1  510 ? 50.225  28.925  6.481   1.00 53.85 ? 538  TRP A C   1 
ATOM   3794  O  O   . TRP A  1  510 ? 49.013  28.850  6.334   1.00 53.73 ? 538  TRP A O   1 
ATOM   3795  C  CB  . TRP A  1  510 ? 51.863  27.484  5.331   1.00 54.69 ? 538  TRP A CB  1 
ATOM   3796  C  CG  . TRP A  1  510 ? 53.024  26.550  5.469   1.00 55.09 ? 538  TRP A CG  1 
ATOM   3797  C  CD1 . TRP A  1  510 ? 54.320  26.888  5.732   1.00 55.40 ? 538  TRP A CD1 1 
ATOM   3798  C  CD2 . TRP A  1  510 ? 53.005  25.121  5.325   1.00 55.36 ? 538  TRP A CD2 1 
ATOM   3799  N  NE1 . TRP A  1  510 ? 55.112  25.763  5.755   1.00 54.54 ? 538  TRP A NE1 1 
ATOM   3800  C  CE2 . TRP A  1  510 ? 54.330  24.665  5.508   1.00 54.94 ? 538  TRP A CE2 1 
ATOM   3801  C  CE3 . TRP A  1  510 ? 51.999  24.183  5.060   1.00 55.51 ? 538  TRP A CE3 1 
ATOM   3802  C  CZ2 . TRP A  1  510 ? 54.674  23.309  5.432   1.00 55.20 ? 538  TRP A CZ2 1 
ATOM   3803  C  CZ3 . TRP A  1  510 ? 52.342  22.838  4.989   1.00 54.39 ? 538  TRP A CZ3 1 
ATOM   3804  C  CH2 . TRP A  1  510 ? 53.666  22.416  5.174   1.00 54.84 ? 538  TRP A CH2 1 
ATOM   3805  N  N   . VAL A  1  511 ? 50.875  30.071  6.511   1.00 53.72 ? 539  VAL A N   1 
ATOM   3806  C  CA  . VAL A  1  511 ? 50.148  31.305  6.392   1.00 53.97 ? 539  VAL A CA  1 
ATOM   3807  C  C   . VAL A  1  511 ? 50.524  32.055  5.158   1.00 55.74 ? 539  VAL A C   1 
ATOM   3808  O  O   . VAL A  1  511 ? 51.673  32.447  4.972   1.00 55.35 ? 539  VAL A O   1 
ATOM   3809  C  CB  . VAL A  1  511 ? 50.416  32.210  7.538   1.00 55.23 ? 539  VAL A CB  1 
ATOM   3810  C  CG1 . VAL A  1  511 ? 49.423  33.352  7.517   1.00 55.03 ? 539  VAL A CG1 1 
ATOM   3811  C  CG2 . VAL A  1  511 ? 50.348  31.425  8.816   1.00 57.25 ? 539  VAL A CG2 1 
ATOM   3812  N  N   . TRP A  1  512 ? 49.528  32.271  4.319   1.00 56.94 ? 540  TRP A N   1 
ATOM   3813  C  CA  . TRP A  1  512 ? 49.738  32.988  3.092   1.00 55.42 ? 540  TRP A CA  1 
ATOM   3814  C  C   . TRP A  1  512 ? 49.054  34.317  3.183   1.00 55.03 ? 540  TRP A C   1 
ATOM   3815  O  O   . TRP A  1  512 ? 47.999  34.450  3.789   1.00 53.93 ? 540  TRP A O   1 
ATOM   3816  C  CB  . TRP A  1  512 ? 49.169  32.213  1.914   1.00 55.89 ? 540  TRP A CB  1 
ATOM   3817  C  CG  . TRP A  1  512 ? 49.878  30.944  1.671   1.00 56.18 ? 540  TRP A CG  1 
ATOM   3818  C  CD1 . TRP A  1  512 ? 49.491  29.686  2.055   1.00 55.99 ? 540  TRP A CD1 1 
ATOM   3819  C  CD2 . TRP A  1  512 ? 51.133  30.798  1.020   1.00 56.08 ? 540  TRP A CD2 1 
ATOM   3820  N  NE1 . TRP A  1  512 ? 50.437  28.763  1.680   1.00 55.64 ? 540  TRP A NE1 1 
ATOM   3821  C  CE2 . TRP A  1  512 ? 51.458  29.420  1.040   1.00 56.82 ? 540  TRP A CE2 1 
ATOM   3822  C  CE3 . TRP A  1  512 ? 52.022  31.698  0.419   1.00 55.09 ? 540  TRP A CE3 1 
ATOM   3823  C  CZ2 . TRP A  1  512 ? 52.639  28.922  0.479   1.00 56.77 ? 540  TRP A CZ2 1 
ATOM   3824  C  CZ3 . TRP A  1  512 ? 53.191  31.208  -0.137  1.00 55.70 ? 540  TRP A CZ3 1 
ATOM   3825  C  CH2 . TRP A  1  512 ? 53.491  29.829  -0.104  1.00 56.56 ? 540  TRP A CH2 1 
ATOM   3826  N  N   . ALA A  1  513 ? 49.686  35.302  2.574   1.00 56.31 ? 541  ALA A N   1 
ATOM   3827  C  CA  . ALA A  1  513 ? 49.163  36.643  2.524   1.00 55.35 ? 541  ALA A CA  1 
ATOM   3828  C  C   . ALA A  1  513 ? 49.222  37.032  1.055   1.00 55.19 ? 541  ALA A C   1 
ATOM   3829  O  O   . ALA A  1  513 ? 50.287  37.315  0.510   1.00 54.92 ? 541  ALA A O   1 
ATOM   3830  C  CB  . ALA A  1  513 ? 50.015  37.577  3.365   1.00 54.44 ? 541  ALA A CB  1 
ATOM   3831  N  N   . GLU A  1  514 ? 48.071  36.998  0.405   1.00 54.56 ? 542  GLU A N   1 
ATOM   3832  C  CA  . GLU A  1  514 ? 47.991  37.365  -0.983  1.00 52.79 ? 542  GLU A CA  1 
ATOM   3833  C  C   . GLU A  1  514 ? 47.303  38.712  -1.027  1.00 53.92 ? 542  GLU A C   1 
ATOM   3834  O  O   . GLU A  1  514 ? 46.442  38.994  -0.201  1.00 54.44 ? 542  GLU A O   1 
ATOM   3835  C  CB  . GLU A  1  514 ? 47.191  36.325  -1.729  1.00 52.63 ? 542  GLU A CB  1 
ATOM   3836  C  CG  . GLU A  1  514 ? 47.665  34.935  -1.437  1.00 53.23 ? 542  GLU A CG  1 
ATOM   3837  C  CD  . GLU A  1  514 ? 47.166  33.946  -2.456  1.00 53.66 ? 542  GLU A CD  1 
ATOM   3838  O  OE1 . GLU A  1  514 ? 47.441  32.741  -2.301  1.00 53.62 ? 542  GLU A OE1 1 
ATOM   3839  O  OE2 . GLU A  1  514 ? 46.497  34.369  -3.421  1.00 53.41 ? 542  GLU A OE2 1 
ATOM   3840  N  N   . ASP A  1  515 ? 47.690  39.552  -1.978  1.00 55.37 ? 543  ASP A N   1 
ATOM   3841  C  CA  . ASP A  1  515 ? 47.101  40.879  -2.099  1.00 54.59 ? 543  ASP A CA  1 
ATOM   3842  C  C   . ASP A  1  515 ? 47.551  41.559  -3.398  1.00 54.81 ? 543  ASP A C   1 
ATOM   3843  O  O   . ASP A  1  515 ? 48.625  41.271  -3.919  1.00 56.70 ? 543  ASP A O   1 
ATOM   3844  C  CB  . ASP A  1  515 ? 47.494  41.707  -0.877  1.00 54.68 ? 543  ASP A CB  1 
ATOM   3845  C  CG  . ASP A  1  515 ? 46.532  42.834  -0.601  1.00 54.67 ? 543  ASP A CG  1 
ATOM   3846  O  OD1 . ASP A  1  515 ? 46.518  43.324  0.549   1.00 56.35 ? 543  ASP A OD1 1 
ATOM   3847  O  OD2 . ASP A  1  515 ? 45.799  43.234  -1.526  1.00 54.69 ? 543  ASP A OD2 1 
ATOM   3848  N  N   . MET A  1  516 ? 46.725  42.468  -3.902  1.00 54.65 ? 544  MET A N   1 
ATOM   3849  C  CA  . MET A  1  516 ? 46.965  43.189  -5.156  1.00 54.77 ? 544  MET A CA  1 
ATOM   3850  C  C   . MET A  1  516 ? 48.098  44.221  -5.232  1.00 55.64 ? 544  MET A C   1 
ATOM   3851  O  O   . MET A  1  516 ? 48.791  44.500  -4.252  1.00 55.35 ? 544  MET A O   1 
ATOM   3852  C  CB  . MET A  1  516 ? 45.672  43.887  -5.564  1.00 55.21 ? 544  MET A CB  1 
ATOM   3853  C  CG  . MET A  1  516 ? 45.194  44.872  -4.521  1.00 54.38 ? 544  MET A CG  1 
ATOM   3854  S  SD  . MET A  1  516 ? 43.731  45.731  -5.026  1.00 57.06 ? 544  MET A SD  1 
ATOM   3855  C  CE  . MET A  1  516 ? 44.436  46.901  -6.154  1.00 55.56 ? 544  MET A CE  1 
ATOM   3856  N  N   . VAL A  1  517 ? 48.239  44.789  -6.434  1.00 57.57 ? 545  VAL A N   1 
ATOM   3857  C  CA  . VAL A  1  517 ? 49.222  45.825  -6.779  1.00 57.13 ? 545  VAL A CA  1 
ATOM   3858  C  C   . VAL A  1  517 ? 49.131  46.168  -8.287  1.00 57.35 ? 545  VAL A C   1 
ATOM   3859  O  O   . VAL A  1  517 ? 48.885  45.296  -9.125  1.00 57.76 ? 545  VAL A O   1 
ATOM   3860  C  CB  . VAL A  1  517 ? 50.674  45.377  -6.442  1.00 55.75 ? 545  VAL A CB  1 
ATOM   3861  C  CG1 . VAL A  1  517 ? 51.097  44.218  -7.328  1.00 55.72 ? 545  VAL A CG1 1 
ATOM   3862  C  CG2 . VAL A  1  517 ? 51.624  46.541  -6.601  1.00 55.83 ? 545  VAL A CG2 1 
ATOM   3863  N  N   . PHE A  1  518 ? 49.298  47.445  -8.621  1.00 59.01 ? 546  PHE A N   1 
ATOM   3864  C  CA  . PHE A  1  518 ? 49.266  47.898  -10.018 1.00 59.63 ? 546  PHE A CA  1 
ATOM   3865  C  C   . PHE A  1  518 ? 50.697  48.098  -10.518 1.00 59.70 ? 546  PHE A C   1 
ATOM   3866  O  O   . PHE A  1  518 ? 51.442  48.918  -9.971  1.00 58.60 ? 546  PHE A O   1 
ATOM   3867  C  CB  . PHE A  1  518 ? 48.504  49.226  -10.154 1.00 60.18 ? 546  PHE A CB  1 
ATOM   3868  C  CG  . PHE A  1  518 ? 47.013  49.075  -10.180 1.00 59.32 ? 546  PHE A CG  1 
ATOM   3869  C  CD1 . PHE A  1  518 ? 46.223  49.719  -9.244  1.00 59.79 ? 546  PHE A CD1 1 
ATOM   3870  C  CD2 . PHE A  1  518 ? 46.400  48.291  -11.145 1.00 60.10 ? 546  PHE A CD2 1 
ATOM   3871  C  CE1 . PHE A  1  518 ? 44.841  49.584  -9.266  1.00 60.68 ? 546  PHE A CE1 1 
ATOM   3872  C  CE2 . PHE A  1  518 ? 45.021  48.147  -11.178 1.00 60.37 ? 546  PHE A CE2 1 
ATOM   3873  C  CZ  . PHE A  1  518 ? 44.239  48.795  -10.236 1.00 61.22 ? 546  PHE A CZ  1 
ATOM   3874  N  N   . VAL A  1  519 ? 51.068  47.347  -11.554 1.00 60.34 ? 547  VAL A N   1 
ATOM   3875  C  CA  . VAL A  1  519 ? 52.408  47.417  -12.135 1.00 60.83 ? 547  VAL A CA  1 
ATOM   3876  C  C   . VAL A  1  519 ? 52.335  48.049  -13.523 1.00 62.19 ? 547  VAL A C   1 
ATOM   3877  O  O   . VAL A  1  519 ? 51.782  47.457  -14.451 1.00 62.81 ? 547  VAL A O   1 
ATOM   3878  C  CB  . VAL A  1  519 ? 53.028  46.004  -12.285 1.00 60.77 ? 547  VAL A CB  1 
ATOM   3879  C  CG1 . VAL A  1  519 ? 54.493  46.109  -12.636 1.00 60.38 ? 547  VAL A CG1 1 
ATOM   3880  C  CG2 . VAL A  1  519 ? 52.839  45.214  -11.013 1.00 60.92 ? 547  VAL A CG2 1 
ATOM   3881  N  N   . PRO A  1  520 ? 52.894  49.262  -13.689 1.00 62.98 ? 548  PRO A N   1 
ATOM   3882  C  CA  . PRO A  1  520 ? 52.846  49.900  -15.002 1.00 62.78 ? 548  PRO A CA  1 
ATOM   3883  C  C   . PRO A  1  520 ? 53.863  49.304  -15.974 1.00 63.45 ? 548  PRO A C   1 
ATOM   3884  O  O   . PRO A  1  520 ? 55.008  49.031  -15.609 1.00 62.94 ? 548  PRO A O   1 
ATOM   3885  C  CB  . PRO A  1  520 ? 53.138  51.360  -14.675 1.00 62.42 ? 548  PRO A CB  1 
ATOM   3886  C  CG  . PRO A  1  520 ? 54.140  51.239  -13.586 1.00 61.80 ? 548  PRO A CG  1 
ATOM   3887  C  CD  . PRO A  1  520 ? 53.546  50.150  -12.708 1.00 63.15 ? 548  PRO A CD  1 
ATOM   3888  N  N   . MET A  1  521 ? 53.413  49.088  -17.207 1.00 65.16 ? 549  MET A N   1 
ATOM   3889  C  CA  . MET A  1  521 ? 54.233  48.559  -18.298 1.00 65.06 ? 549  MET A CA  1 
ATOM   3890  C  C   . MET A  1  521 ? 53.494  48.927  -19.576 1.00 65.30 ? 549  MET A C   1 
ATOM   3891  O  O   . MET A  1  521 ? 52.265  48.892  -19.616 1.00 65.93 ? 549  MET A O   1 
ATOM   3892  C  CB  . MET A  1  521 ? 54.397  47.042  -18.186 1.00 64.65 ? 549  MET A CB  1 
ATOM   3893  C  CG  . MET A  1  521 ? 53.108  46.271  -18.169 1.00 64.43 ? 549  MET A CG  1 
ATOM   3894  S  SD  . MET A  1  521 ? 53.445  44.663  -17.510 1.00 63.90 ? 549  MET A SD  1 
ATOM   3895  C  CE  . MET A  1  521 ? 53.613  45.052  -15.786 1.00 64.19 ? 549  MET A CE  1 
ATOM   3896  N  N   . ALA A  1  522 ? 54.239  49.301  -20.610 1.00 65.89 ? 550  ALA A N   1 
ATOM   3897  C  CA  . ALA A  1  522 ? 53.634  49.702  -21.877 1.00 65.70 ? 550  ALA A CA  1 
ATOM   3898  C  C   . ALA A  1  522 ? 52.776  48.616  -22.520 1.00 65.67 ? 550  ALA A C   1 
ATOM   3899  O  O   . ALA A  1  522 ? 53.093  47.420  -22.447 1.00 65.30 ? 550  ALA A O   1 
ATOM   3900  C  CB  . ALA A  1  522 ? 54.718  50.155  -22.852 1.00 65.90 ? 550  ALA A CB  1 
ATOM   3901  N  N   . VAL A  1  523 ? 51.689  49.055  -23.152 1.00 66.04 ? 551  VAL A N   1 
ATOM   3902  C  CA  . VAL A  1  523 ? 50.746  48.164  -23.827 1.00 65.93 ? 551  VAL A CA  1 
ATOM   3903  C  C   . VAL A  1  523 ? 51.414  47.313  -24.901 1.00 65.90 ? 551  VAL A C   1 
ATOM   3904  O  O   . VAL A  1  523 ? 51.835  47.822  -25.939 1.00 66.31 ? 551  VAL A O   1 
ATOM   3905  C  CB  . VAL A  1  523 ? 49.614  48.958  -24.497 1.00 64.91 ? 551  VAL A CB  1 
ATOM   3906  C  CG1 . VAL A  1  523 ? 48.645  48.005  -25.161 1.00 64.62 ? 551  VAL A CG1 1 
ATOM   3907  C  CG2 . VAL A  1  523 ? 48.908  49.816  -23.472 1.00 65.29 ? 551  VAL A CG2 1 
ATOM   3908  N  N   . PRO A  1  524 ? 51.498  45.996  -24.672 1.00 65.86 ? 552  PRO A N   1 
ATOM   3909  C  CA  . PRO A  1  524 ? 52.114  45.071  -25.620 1.00 65.84 ? 552  PRO A CA  1 
ATOM   3910  C  C   . PRO A  1  524 ? 51.925  45.482  -27.068 1.00 65.84 ? 552  PRO A C   1 
ATOM   3911  O  O   . PRO A  1  524 ? 52.888  45.767  -27.777 1.00 66.59 ? 552  PRO A O   1 
ATOM   3912  C  CB  . PRO A  1  524 ? 51.416  43.760  -25.304 1.00 65.70 ? 552  PRO A CB  1 
ATOM   3913  C  CG  . PRO A  1  524 ? 51.313  43.831  -23.826 1.00 66.65 ? 552  PRO A CG  1 
ATOM   3914  C  CD  . PRO A  1  524 ? 50.830  45.253  -23.590 1.00 67.13 ? 552  PRO A CD  1 
ATOM   3915  N  N   . TRP A  1  525 ? 50.672  45.533  -27.489 1.00 65.48 ? 553  TRP A N   1 
ATOM   3916  C  CA  . TRP A  1  525 ? 50.337  45.873  -28.862 1.00 66.58 ? 553  TRP A CA  1 
ATOM   3917  C  C   . TRP A  1  525 ? 50.401  47.346  -29.265 1.00 66.49 ? 553  TRP A C   1 
ATOM   3918  O  O   . TRP A  1  525 ? 50.118  47.681  -30.411 1.00 66.70 ? 553  TRP A O   1 
ATOM   3919  C  CB  . TRP A  1  525 ? 48.949  45.319  -29.183 1.00 66.57 ? 553  TRP A CB  1 
ATOM   3920  C  CG  . TRP A  1  525 ? 47.896  45.775  -28.237 1.00 65.49 ? 553  TRP A CG  1 
ATOM   3921  C  CD1 . TRP A  1  525 ? 47.106  46.879  -28.358 1.00 65.08 ? 553  TRP A CD1 1 
ATOM   3922  C  CD2 . TRP A  1  525 ? 47.530  45.148  -27.007 1.00 66.09 ? 553  TRP A CD2 1 
ATOM   3923  N  NE1 . TRP A  1  525 ? 46.265  46.981  -27.275 1.00 65.54 ? 553  TRP A NE1 1 
ATOM   3924  C  CE2 . TRP A  1  525 ? 46.504  45.930  -26.430 1.00 66.34 ? 553  TRP A CE2 1 
ATOM   3925  C  CE3 . TRP A  1  525 ? 47.969  43.997  -26.334 1.00 65.48 ? 553  TRP A CE3 1 
ATOM   3926  C  CZ2 . TRP A  1  525 ? 45.908  45.600  -25.209 1.00 66.48 ? 553  TRP A CZ2 1 
ATOM   3927  C  CZ3 . TRP A  1  525 ? 47.378  43.667  -25.119 1.00 66.21 ? 553  TRP A CZ3 1 
ATOM   3928  C  CH2 . TRP A  1  525 ? 46.357  44.467  -24.569 1.00 66.93 ? 553  TRP A CH2 1 
ATOM   3929  N  N   . SER A  1  526 ? 50.770  48.228  -28.347 1.00 66.02 ? 554  SER A N   1 
ATOM   3930  C  CA  . SER A  1  526 ? 50.837  49.651  -28.676 1.00 66.82 ? 554  SER A CA  1 
ATOM   3931  C  C   . SER A  1  526 ? 51.717  50.344  -27.647 1.00 67.70 ? 554  SER A C   1 
ATOM   3932  O  O   . SER A  1  526 ? 51.241  51.154  -26.848 1.00 67.18 ? 554  SER A O   1 
ATOM   3933  C  CB  . SER A  1  526 ? 49.422  50.259  -28.677 1.00 67.69 ? 554  SER A CB  1 
ATOM   3934  O  OG  . SER A  1  526 ? 49.410  51.640  -29.008 1.00 67.36 ? 554  SER A OG  1 
ATOM   3935  N  N   . PRO A  1  527 ? 53.023  50.024  -27.658 1.00 68.47 ? 555  PRO A N   1 
ATOM   3936  C  CA  . PRO A  1  527 ? 54.022  50.582  -26.743 1.00 68.12 ? 555  PRO A CA  1 
ATOM   3937  C  C   . PRO A  1  527 ? 53.936  52.091  -26.497 1.00 66.72 ? 555  PRO A C   1 
ATOM   3938  O  O   . PRO A  1  527 ? 54.284  52.572  -25.422 1.00 67.18 ? 555  PRO A O   1 
ATOM   3939  C  CB  . PRO A  1  527 ? 55.332  50.151  -27.386 1.00 67.78 ? 555  PRO A CB  1 
ATOM   3940  C  CG  . PRO A  1  527 ? 54.983  48.798  -27.930 1.00 66.63 ? 555  PRO A CG  1 
ATOM   3941  C  CD  . PRO A  1  527 ? 53.652  49.064  -28.586 1.00 67.04 ? 555  PRO A CD  1 
ATOM   3942  N  N   . GLU A  1  528 ? 53.471  52.841  -27.482 1.00 66.04 ? 556  GLU A N   1 
ATOM   3943  C  CA  . GLU A  1  528 ? 53.355  54.280  -27.303 1.00 68.35 ? 556  GLU A CA  1 
ATOM   3944  C  C   . GLU A  1  528 ? 52.450  54.576  -26.101 1.00 68.60 ? 556  GLU A C   1 
ATOM   3945  O  O   . GLU A  1  528 ? 52.582  55.612  -25.444 1.00 68.04 ? 556  GLU A O   1 
ATOM   3946  C  CB  . GLU A  1  528 ? 52.773  54.935  -28.572 1.00 69.68 ? 556  GLU A CB  1 
ATOM   3947  C  CG  . GLU A  1  528 ? 51.327  54.507  -28.938 1.00 69.96 ? 556  GLU A CG  1 
ATOM   3948  C  CD  . GLU A  1  528 ? 50.709  55.327  -30.094 1.00 70.84 ? 556  GLU A CD  1 
ATOM   3949  O  OE1 . GLU A  1  528 ? 51.276  55.288  -31.214 1.00 70.76 ? 556  GLU A OE1 1 
ATOM   3950  O  OE2 . GLU A  1  528 ? 49.659  56.004  -29.882 1.00 70.49 ? 556  GLU A OE2 1 
ATOM   3951  N  N   . HIS A  1  529 ? 51.544  53.641  -25.819 1.00 69.24 ? 557  HIS A N   1 
ATOM   3952  C  CA  . HIS A  1  529 ? 50.580  53.768  -24.725 1.00 69.41 ? 557  HIS A CA  1 
ATOM   3953  C  C   . HIS A  1  529 ? 50.959  53.050  -23.427 1.00 68.76 ? 557  HIS A C   1 
ATOM   3954  O  O   . HIS A  1  529 ? 51.528  51.953  -23.435 1.00 68.05 ? 557  HIS A O   1 
ATOM   3955  C  CB  . HIS A  1  529 ? 49.207  53.278  -25.194 1.00 69.96 ? 557  HIS A CB  1 
ATOM   3956  C  CG  . HIS A  1  529 ? 48.543  54.190  -26.177 1.00 71.03 ? 557  HIS A CG  1 
ATOM   3957  N  ND1 . HIS A  1  529 ? 48.114  55.457  -25.841 1.00 71.96 ? 557  HIS A ND1 1 
ATOM   3958  C  CD2 . HIS A  1  529 ? 48.245  54.027  -27.489 1.00 71.67 ? 557  HIS A CD2 1 
ATOM   3959  C  CE1 . HIS A  1  529 ? 47.581  56.035  -26.905 1.00 72.79 ? 557  HIS A CE1 1 
ATOM   3960  N  NE2 . HIS A  1  529 ? 47.647  55.189  -27.918 1.00 72.20 ? 557  HIS A NE2 1 
ATOM   3961  N  N   . GLN A  1  530 ? 50.607  53.671  -22.306 1.00 68.77 ? 558  GLN A N   1 
ATOM   3962  C  CA  . GLN A  1  530 ? 50.918  53.123  -20.986 1.00 68.30 ? 558  GLN A CA  1 
ATOM   3963  C  C   . GLN A  1  530 ? 49.821  52.196  -20.425 1.00 68.05 ? 558  GLN A C   1 
ATOM   3964  O  O   . GLN A  1  530 ? 48.650  52.312  -20.785 1.00 68.33 ? 558  GLN A O   1 
ATOM   3965  C  CB  . GLN A  1  530 ? 51.182  54.290  -20.018 1.00 68.90 ? 558  GLN A CB  1 
ATOM   3966  C  CG  . GLN A  1  530 ? 51.998  53.918  -18.780 1.00 70.41 ? 558  GLN A CG  1 
ATOM   3967  C  CD  . GLN A  1  530 ? 53.022  52.811  -19.068 1.00 70.82 ? 558  GLN A CD  1 
ATOM   3968  O  OE1 . GLN A  1  530 ? 53.696  52.819  -20.104 1.00 69.95 ? 558  GLN A OE1 1 
ATOM   3969  N  NE2 . GLN A  1  530 ? 53.140  51.856  -18.147 1.00 70.87 ? 558  GLN A NE2 1 
ATOM   3970  N  N   . LEU A  1  531 ? 50.206  51.287  -19.532 1.00 67.26 ? 559  LEU A N   1 
ATOM   3971  C  CA  . LEU A  1  531 ? 49.256  50.360  -18.929 1.00 66.34 ? 559  LEU A CA  1 
ATOM   3972  C  C   . LEU A  1  531 ? 49.523  50.081  -17.427 1.00 67.07 ? 559  LEU A C   1 
ATOM   3973  O  O   . LEU A  1  531 ? 50.681  49.993  -16.996 1.00 66.35 ? 559  LEU A O   1 
ATOM   3974  C  CB  . LEU A  1  531 ? 49.281  49.050  -19.719 1.00 66.21 ? 559  LEU A CB  1 
ATOM   3975  C  CG  . LEU A  1  531 ? 48.319  47.944  -19.288 1.00 66.44 ? 559  LEU A CG  1 
ATOM   3976  C  CD1 . LEU A  1  531 ? 46.892  48.364  -19.630 1.00 66.25 ? 559  LEU A CD1 1 
ATOM   3977  C  CD2 . LEU A  1  531 ? 48.694  46.642  -19.982 1.00 65.89 ? 559  LEU A CD2 1 
ATOM   3978  N  N   . GLN A  1  532 ? 48.450  49.955  -16.637 1.00 66.28 ? 560  GLN A N   1 
ATOM   3979  C  CA  . GLN A  1  532 ? 48.562  49.654  -15.204 1.00 63.94 ? 560  GLN A CA  1 
ATOM   3980  C  C   . GLN A  1  532 ? 48.210  48.178  -15.028 1.00 63.23 ? 560  GLN A C   1 
ATOM   3981  O  O   . GLN A  1  532 ? 47.040  47.826  -14.898 1.00 62.71 ? 560  GLN A O   1 
ATOM   3982  C  CB  . GLN A  1  532 ? 47.594  50.524  -14.398 1.00 64.14 ? 560  GLN A CB  1 
ATOM   3983  C  CG  . GLN A  1  532 ? 47.753  52.025  -14.631 1.00 65.24 ? 560  GLN A CG  1 
ATOM   3984  C  CD  . GLN A  1  532 ? 49.191  52.520  -14.446 1.00 66.03 ? 560  GLN A CD  1 
ATOM   3985  O  OE1 . GLN A  1  532 ? 49.869  52.176  -13.467 1.00 65.47 ? 560  GLN A OE1 1 
ATOM   3986  N  NE2 . GLN A  1  532 ? 49.658  53.344  -15.388 1.00 65.62 ? 560  GLN A NE2 1 
ATOM   3987  N  N   . ARG A  1  533 ? 49.236  47.326  -15.022 1.00 63.17 ? 561  ARG A N   1 
ATOM   3988  C  CA  . ARG A  1  533 ? 49.070  45.872  -14.917 1.00 62.64 ? 561  ARG A CA  1 
ATOM   3989  C  C   . ARG A  1  533 ? 48.746  45.355  -13.520 1.00 61.97 ? 561  ARG A C   1 
ATOM   3990  O  O   . ARG A  1  533 ? 49.614  45.269  -12.647 1.00 60.66 ? 561  ARG A O   1 
ATOM   3991  C  CB  . ARG A  1  533 ? 50.327  45.160  -15.452 1.00 62.05 ? 561  ARG A CB  1 
ATOM   3992  C  CG  . ARG A  1  533 ? 50.202  43.644  -15.642 1.00 61.72 ? 561  ARG A CG  1 
ATOM   3993  C  CD  . ARG A  1  533 ? 49.200  43.284  -16.736 1.00 62.22 ? 561  ARG A CD  1 
ATOM   3994  N  NE  . ARG A  1  533 ? 49.218  41.860  -17.094 1.00 63.30 ? 561  ARG A NE  1 
ATOM   3995  C  CZ  . ARG A  1  533 ? 50.225  41.240  -17.716 1.00 62.69 ? 561  ARG A CZ  1 
ATOM   3996  N  NH1 . ARG A  1  533 ? 51.317  41.910  -18.060 1.00 61.67 ? 561  ARG A NH1 1 
ATOM   3997  N  NH2 . ARG A  1  533 ? 50.137  39.944  -18.004 1.00 61.33 ? 561  ARG A NH2 1 
ATOM   3998  N  N   . LEU A  1  534 ? 47.482  44.989  -13.331 1.00 61.86 ? 562  LEU A N   1 
ATOM   3999  C  CA  . LEU A  1  534 ? 47.011  44.467  -12.060 1.00 60.74 ? 562  LEU A CA  1 
ATOM   4000  C  C   . LEU A  1  534 ? 47.633  43.091  -11.828 1.00 60.22 ? 562  LEU A C   1 
ATOM   4001  O  O   . LEU A  1  534 ? 47.577  42.217  -12.700 1.00 58.71 ? 562  LEU A O   1 
ATOM   4002  C  CB  . LEU A  1  534 ? 45.485  44.360  -12.082 1.00 60.47 ? 562  LEU A CB  1 
ATOM   4003  C  CG  . LEU A  1  534 ? 44.797  44.050  -10.756 1.00 59.46 ? 562  LEU A CG  1 
ATOM   4004  C  CD1 . LEU A  1  534 ? 44.552  45.348  -10.035 1.00 58.94 ? 562  LEU A CD1 1 
ATOM   4005  C  CD2 . LEU A  1  534 ? 43.488  43.314  -10.990 1.00 58.51 ? 562  LEU A CD2 1 
ATOM   4006  N  N   . GLN A  1  535 ? 48.227  42.915  -10.650 1.00 59.50 ? 563  GLN A N   1 
ATOM   4007  C  CA  . GLN A  1  535 ? 48.875  41.664  -10.282 1.00 58.85 ? 563  GLN A CA  1 
ATOM   4008  C  C   . GLN A  1  535 ? 48.611  41.316  -8.822  1.00 60.19 ? 563  GLN A C   1 
ATOM   4009  O  O   . GLN A  1  535 ? 48.254  42.184  -8.026  1.00 60.20 ? 563  GLN A O   1 
ATOM   4010  C  CB  . GLN A  1  535 ? 50.383  41.780  -10.467 1.00 59.40 ? 563  GLN A CB  1 
ATOM   4011  C  CG  . GLN A  1  535 ? 50.835  42.444  -11.747 1.00 61.37 ? 563  GLN A CG  1 
ATOM   4012  C  CD  . GLN A  1  535 ? 52.214  41.966  -12.152 1.00 62.02 ? 563  GLN A CD  1 
ATOM   4013  O  OE1 . GLN A  1  535 ? 53.095  41.821  -11.305 1.00 63.00 ? 563  GLN A OE1 1 
ATOM   4014  N  NE2 . GLN A  1  535 ? 52.410  41.715  -13.445 1.00 60.82 ? 563  GLN A NE2 1 
ATOM   4015  N  N   . VAL A  1  536 ? 48.804  40.044  -8.470  1.00 60.66 ? 564  VAL A N   1 
ATOM   4016  C  CA  . VAL A  1  536 ? 48.618  39.585  -7.088  1.00 59.91 ? 564  VAL A CA  1 
ATOM   4017  C  C   . VAL A  1  536 ? 49.975  39.245  -6.443  1.00 59.59 ? 564  VAL A C   1 
ATOM   4018  O  O   . VAL A  1  536 ? 50.877  38.725  -7.105  1.00 59.90 ? 564  VAL A O   1 
ATOM   4019  C  CB  . VAL A  1  536 ? 47.679  38.328  -7.006  1.00 58.13 ? 564  VAL A CB  1 
ATOM   4020  C  CG1 . VAL A  1  536 ? 46.489  38.509  -7.924  1.00 58.36 ? 564  VAL A CG1 1 
ATOM   4021  C  CG2 . VAL A  1  536 ? 48.434  37.059  -7.348  1.00 58.62 ? 564  VAL A CG2 1 
ATOM   4022  N  N   . THR A  1  537 ? 50.121  39.555  -5.157  1.00 59.24 ? 565  THR A N   1 
ATOM   4023  C  CA  . THR A  1  537 ? 51.354  39.269  -4.434  1.00 59.29 ? 565  THR A CA  1 
ATOM   4024  C  C   . THR A  1  537 ? 51.095  38.092  -3.495  1.00 59.19 ? 565  THR A C   1 
ATOM   4025  O  O   . THR A  1  537 ? 50.131  38.096  -2.740  1.00 59.55 ? 565  THR A O   1 
ATOM   4026  C  CB  . THR A  1  537 ? 51.813  40.498  -3.638  1.00 59.11 ? 565  THR A CB  1 
ATOM   4027  O  OG1 . THR A  1  537 ? 50.881  40.769  -2.591  1.00 59.51 ? 565  THR A OG1 1 
ATOM   4028  C  CG2 . THR A  1  537 ? 51.883  41.708  -4.541  1.00 59.05 ? 565  THR A CG2 1 
ATOM   4029  N  N   . ARG A  1  538 ? 51.957  37.084  -3.549  1.00 60.18 ? 566  ARG A N   1 
ATOM   4030  C  CA  . ARG A  1  538 ? 51.798  35.877  -2.733  1.00 61.91 ? 566  ARG A CA  1 
ATOM   4031  C  C   . ARG A  1  538 ? 53.005  35.683  -1.815  1.00 62.17 ? 566  ARG A C   1 
ATOM   4032  O  O   . ARG A  1  538 ? 53.968  34.999  -2.182  1.00 62.91 ? 566  ARG A O   1 
ATOM   4033  C  CB  . ARG A  1  538 ? 51.632  34.656  -3.664  1.00 62.33 ? 566  ARG A CB  1 
ATOM   4034  C  CG  . ARG A  1  538 ? 51.029  33.402  -3.061  1.00 61.24 ? 566  ARG A CG  1 
ATOM   4035  C  CD  . ARG A  1  538 ? 50.452  32.526  -4.177  1.00 62.46 ? 566  ARG A CD  1 
ATOM   4036  N  NE  . ARG A  1  538 ? 49.473  31.560  -3.663  1.00 66.98 ? 566  ARG A NE  1 
ATOM   4037  C  CZ  . ARG A  1  538 ? 48.612  30.865  -4.413  1.00 67.95 ? 566  ARG A CZ  1 
ATOM   4038  N  NH1 . ARG A  1  538 ? 48.604  31.024  -5.737  1.00 67.52 ? 566  ARG A NH1 1 
ATOM   4039  N  NH2 . ARG A  1  538 ? 47.746  30.022  -3.837  1.00 66.23 ? 566  ARG A NH2 1 
ATOM   4040  N  N   . LYS A  1  539 ? 52.949  36.288  -0.629  1.00 62.39 ? 567  LYS A N   1 
ATOM   4041  C  CA  . LYS A  1  539 ? 54.033  36.178  0.346   1.00 62.36 ? 567  LYS A CA  1 
ATOM   4042  C  C   . LYS A  1  539 ? 53.711  35.215  1.482   1.00 61.35 ? 567  LYS A C   1 
ATOM   4043  O  O   . LYS A  1  539 ? 52.595  35.188  1.984   1.00 61.35 ? 567  LYS A O   1 
ATOM   4044  C  CB  . LYS A  1  539 ? 54.364  37.549  0.930   1.00 63.08 ? 567  LYS A CB  1 
ATOM   4045  C  CG  . LYS A  1  539 ? 55.264  37.475  2.157   1.00 65.05 ? 567  LYS A CG  1 
ATOM   4046  C  CD  . LYS A  1  539 ? 55.637  38.859  2.705   1.00 67.21 ? 567  LYS A CD  1 
ATOM   4047  C  CE  . LYS A  1  539 ? 56.452  38.750  4.005   1.00 68.13 ? 567  LYS A CE  1 
ATOM   4048  N  NZ  . LYS A  1  539 ? 56.909  40.075  4.534   1.00 68.70 ? 567  LYS A NZ  1 
ATOM   4049  N  N   . LEU A  1  540 ? 54.703  34.431  1.890   1.00 62.65 ? 568  LEU A N   1 
ATOM   4050  C  CA  . LEU A  1  540 ? 54.512  33.465  2.970   1.00 63.48 ? 568  LEU A CA  1 
ATOM   4051  C  C   . LEU A  1  540 ? 55.023  33.962  4.325   1.00 63.86 ? 568  LEU A C   1 
ATOM   4052  O  O   . LEU A  1  540 ? 56.148  34.459  4.455   1.00 63.33 ? 568  LEU A O   1 
ATOM   4053  C  CB  . LEU A  1  540 ? 55.193  32.136  2.618   1.00 62.97 ? 568  LEU A CB  1 
ATOM   4054  C  CG  . LEU A  1  540 ? 55.040  30.965  3.597   1.00 62.17 ? 568  LEU A CG  1 
ATOM   4055  C  CD1 . LEU A  1  540 ? 53.579  30.586  3.751   1.00 62.49 ? 568  LEU A CD1 1 
ATOM   4056  C  CD2 . LEU A  1  540 ? 55.838  29.788  3.090   1.00 62.20 ? 568  LEU A CD2 1 
ATOM   4057  N  N   . LEU A  1  541 ? 54.174  33.823  5.336   1.00 64.42 ? 569  LEU A N   1 
ATOM   4058  C  CA  . LEU A  1  541 ? 54.511  34.238  6.687   1.00 64.05 ? 569  LEU A CA  1 
ATOM   4059  C  C   . LEU A  1  541 ? 55.141  33.061  7.398   1.00 64.87 ? 569  LEU A C   1 
ATOM   4060  O  O   . LEU A  1  541 ? 54.510  32.013  7.576   1.00 64.33 ? 569  LEU A O   1 
ATOM   4061  C  CB  . LEU A  1  541 ? 53.249  34.684  7.407   1.00 63.12 ? 569  LEU A CB  1 
ATOM   4062  C  CG  . LEU A  1  541 ? 52.571  35.726  6.524   1.00 63.13 ? 569  LEU A CG  1 
ATOM   4063  C  CD1 . LEU A  1  541 ? 51.226  36.139  7.104   1.00 62.99 ? 569  LEU A CD1 1 
ATOM   4064  C  CD2 . LEU A  1  541 ? 53.522  36.908  6.377   1.00 62.30 ? 569  LEU A CD2 1 
ATOM   4065  N  N   . GLU A  1  542 ? 56.392  33.246  7.804   1.00 64.76 ? 570  GLU A N   1 
ATOM   4066  C  CA  . GLU A  1  542 ? 57.140  32.191  8.463   1.00 66.39 ? 570  GLU A CA  1 
ATOM   4067  C  C   . GLU A  1  542 ? 57.300  32.334  9.971   1.00 67.44 ? 570  GLU A C   1 
ATOM   4068  O  O   . GLU A  1  542 ? 57.455  31.333  10.675  1.00 67.63 ? 570  GLU A O   1 
ATOM   4069  C  CB  . GLU A  1  542 ? 58.512  32.076  7.808   1.00 67.31 ? 570  GLU A CB  1 
ATOM   4070  C  CG  . GLU A  1  542 ? 58.439  31.730  6.329   1.00 68.30 ? 570  GLU A CG  1 
ATOM   4071  C  CD  . GLU A  1  542 ? 59.738  32.017  5.583   1.00 69.50 ? 570  GLU A CD  1 
ATOM   4072  O  OE1 . GLU A  1  542 ? 60.149  33.200  5.528   1.00 70.14 ? 570  GLU A OE1 1 
ATOM   4073  O  OE2 . GLU A  1  542 ? 60.348  31.062  5.046   1.00 70.56 ? 570  GLU A OE2 1 
ATOM   4074  N  N   . MET A  1  543 ? 57.280  33.564  10.474  1.00 68.02 ? 571  MET A N   1 
ATOM   4075  C  CA  . MET A  1  543 ? 57.422  33.774  11.915  1.00 67.84 ? 571  MET A CA  1 
ATOM   4076  C  C   . MET A  1  543 ? 56.103  34.216  12.534  1.00 67.69 ? 571  MET A C   1 
ATOM   4077  O  O   . MET A  1  543 ? 55.238  34.763  11.850  1.00 68.08 ? 571  MET A O   1 
ATOM   4078  C  CB  . MET A  1  543 ? 58.517  34.814  12.213  1.00 68.61 ? 571  MET A CB  1 
ATOM   4079  C  CG  . MET A  1  543 ? 59.895  34.442  11.663  1.00 69.95 ? 571  MET A CG  1 
ATOM   4080  S  SD  . MET A  1  543 ? 60.345  32.664  11.850  1.00 74.25 ? 571  MET A SD  1 
ATOM   4081  C  CE  . MET A  1  543 ? 61.342  32.670  13.387  1.00 70.38 ? 571  MET A CE  1 
ATOM   4082  N  N   . GLU A  1  544 ? 55.945  33.966  13.829  1.00 67.36 ? 572  GLU A N   1 
ATOM   4083  C  CA  . GLU A  1  544 ? 54.719  34.355  14.505  1.00 67.15 ? 572  GLU A CA  1 
ATOM   4084  C  C   . GLU A  1  544 ? 54.584  35.869  14.417  1.00 65.96 ? 572  GLU A C   1 
ATOM   4085  O  O   . GLU A  1  544 ? 53.489  36.401  14.228  1.00 65.41 ? 572  GLU A O   1 
ATOM   4086  C  CB  . GLU A  1  544 ? 54.743  33.893  15.974  1.00 66.92 ? 572  GLU A CB  1 
ATOM   4087  C  CG  . GLU A  1  544 ? 54.696  32.374  16.155  1.00 66.40 ? 572  GLU A CG  1 
ATOM   4088  C  CD  . GLU A  1  544 ? 54.494  31.937  17.598  1.00 66.04 ? 572  GLU A CD  1 
ATOM   4089  O  OE1 . GLU A  1  544 ? 54.329  30.717  17.827  1.00 65.67 ? 572  GLU A OE1 1 
ATOM   4090  O  OE2 . GLU A  1  544 ? 54.497  32.803  18.499  1.00 66.17 ? 572  GLU A OE2 1 
ATOM   4091  N  N   . GLU A  1  545 ? 55.719  36.552  14.525  1.00 65.78 ? 573  GLU A N   1 
ATOM   4092  C  CA  . GLU A  1  545 ? 55.750  38.003  14.480  1.00 65.30 ? 573  GLU A CA  1 
ATOM   4093  C  C   . GLU A  1  545 ? 55.221  38.487  13.146  1.00 65.13 ? 573  GLU A C   1 
ATOM   4094  O  O   . GLU A  1  545 ? 54.569  39.527  13.077  1.00 65.86 ? 573  GLU A O   1 
ATOM   4095  C  CB  . GLU A  1  545 ? 57.176  38.513  14.686  1.00 66.26 ? 573  GLU A CB  1 
ATOM   4096  C  CG  . GLU A  1  545 ? 57.986  37.736  15.723  1.00 68.31 ? 573  GLU A CG  1 
ATOM   4097  C  CD  . GLU A  1  545 ? 57.463  37.862  17.156  1.00 69.26 ? 573  GLU A CD  1 
ATOM   4098  O  OE1 . GLU A  1  545 ? 57.467  38.980  17.717  1.00 70.14 ? 573  GLU A OE1 1 
ATOM   4099  O  OE2 . GLU A  1  545 ? 57.055  36.832  17.733  1.00 69.22 ? 573  GLU A OE2 1 
ATOM   4100  N  N   . GLN A  1  546 ? 55.511  37.735  12.085  1.00 65.12 ? 574  GLN A N   1 
ATOM   4101  C  CA  . GLN A  1  546 ? 55.041  38.092  10.744  1.00 64.24 ? 574  GLN A CA  1 
ATOM   4102  C  C   . GLN A  1  546 ? 53.513  37.992  10.681  1.00 64.04 ? 574  GLN A C   1 
ATOM   4103  O  O   . GLN A  1  546 ? 52.854  38.820  10.053  1.00 62.76 ? 574  GLN A O   1 
ATOM   4104  C  CB  . GLN A  1  546 ? 55.638  37.151  9.689   1.00 62.97 ? 574  GLN A CB  1 
ATOM   4105  C  CG  . GLN A  1  546 ? 56.989  37.555  9.104   1.00 62.90 ? 574  GLN A CG  1 
ATOM   4106  C  CD  . GLN A  1  546 ? 57.513  36.525  8.090   1.00 64.37 ? 574  GLN A CD  1 
ATOM   4107  O  OE1 . GLN A  1  546 ? 57.927  35.422  8.465   1.00 63.39 ? 574  GLN A OE1 1 
ATOM   4108  N  NE2 . GLN A  1  546 ? 57.482  36.879  6.803   1.00 63.31 ? 574  GLN A NE2 1 
ATOM   4109  N  N   . ALA A  1  547 ? 52.964  36.981  11.358  1.00 63.86 ? 575  ALA A N   1 
ATOM   4110  C  CA  . ALA A  1  547 ? 51.525  36.723  11.371  1.00 62.37 ? 575  ALA A CA  1 
ATOM   4111  C  C   . ALA A  1  547 ? 50.697  37.477  12.413  1.00 62.46 ? 575  ALA A C   1 
ATOM   4112  O  O   . ALA A  1  547 ? 49.470  37.456  12.352  1.00 62.76 ? 575  ALA A O   1 
ATOM   4113  C  CB  . ALA A  1  547 ? 51.277  35.225  11.504  1.00 62.28 ? 575  ALA A CB  1 
ATOM   4114  N  N   . ALA A  1  548 ? 51.341  38.127  13.376  1.00 62.23 ? 576  ALA A N   1 
ATOM   4115  C  CA  . ALA A  1  548 ? 50.589  38.892  14.374  1.00 61.72 ? 576  ALA A CA  1 
ATOM   4116  C  C   . ALA A  1  548 ? 50.377  40.312  13.846  1.00 61.25 ? 576  ALA A C   1 
ATOM   4117  O  O   . ALA A  1  548 ? 51.343  41.037  13.573  1.00 59.85 ? 576  ALA A O   1 
ATOM   4118  C  CB  . ALA A  1  548 ? 51.334  38.931  15.679  1.00 61.95 ? 576  ALA A CB  1 
ATOM   4119  N  N   . PHE A  1  549 ? 49.107  40.697  13.714  1.00 60.64 ? 577  PHE A N   1 
ATOM   4120  C  CA  . PHE A  1  549 ? 48.723  42.005  13.180  1.00 60.17 ? 577  PHE A CA  1 
ATOM   4121  C  C   . PHE A  1  549 ? 48.082  42.950  14.165  1.00 59.84 ? 577  PHE A C   1 
ATOM   4122  O  O   . PHE A  1  549 ? 46.934  42.749  14.578  1.00 59.47 ? 577  PHE A O   1 
ATOM   4123  C  CB  . PHE A  1  549 ? 47.764  41.828  12.003  1.00 61.05 ? 577  PHE A CB  1 
ATOM   4124  C  CG  . PHE A  1  549 ? 48.440  41.426  10.734  1.00 61.20 ? 577  PHE A CG  1 
ATOM   4125  C  CD1 . PHE A  1  549 ? 49.088  42.377  9.951   1.00 61.31 ? 577  PHE A CD1 1 
ATOM   4126  C  CD2 . PHE A  1  549 ? 48.479  40.089  10.345  1.00 61.12 ? 577  PHE A CD2 1 
ATOM   4127  C  CE1 . PHE A  1  549 ? 49.770  42.006  8.796   1.00 61.91 ? 577  PHE A CE1 1 
ATOM   4128  C  CE2 . PHE A  1  549 ? 49.159  39.703  9.193   1.00 61.42 ? 577  PHE A CE2 1 
ATOM   4129  C  CZ  . PHE A  1  549 ? 49.807  40.663  8.414   1.00 61.91 ? 577  PHE A CZ  1 
ATOM   4130  N  N   . LEU A  1  550 ? 48.819  44.001  14.503  1.00 60.11 ? 578  LEU A N   1 
ATOM   4131  C  CA  . LEU A  1  550 ? 48.342  45.011  15.438  1.00 60.96 ? 578  LEU A CA  1 
ATOM   4132  C  C   . LEU A  1  550 ? 47.095  45.726  14.938  1.00 60.70 ? 578  LEU A C   1 
ATOM   4133  O  O   . LEU A  1  550 ? 46.936  45.987  13.753  1.00 60.49 ? 578  LEU A O   1 
ATOM   4134  C  CB  . LEU A  1  550 ? 49.426  46.053  15.696  1.00 60.23 ? 578  LEU A CB  1 
ATOM   4135  C  CG  . LEU A  1  550 ? 50.673  45.634  16.465  1.00 59.36 ? 578  LEU A CG  1 
ATOM   4136  C  CD1 . LEU A  1  550 ? 51.688  46.751  16.384  1.00 59.27 ? 578  LEU A CD1 1 
ATOM   4137  C  CD2 . LEU A  1  550 ? 50.324  45.327  17.899  1.00 58.77 ? 578  LEU A CD2 1 
ATOM   4138  N  N   . VAL A  1  551 ? 46.209  46.041  15.866  1.00 61.00 ? 579  VAL A N   1 
ATOM   4139  C  CA  . VAL A  1  551 ? 44.991  46.749  15.543  1.00 61.32 ? 579  VAL A CA  1 
ATOM   4140  C  C   . VAL A  1  551 ? 45.358  48.036  14.814  1.00 61.90 ? 579  VAL A C   1 
ATOM   4141  O  O   . VAL A  1  551 ? 46.448  48.571  15.000  1.00 62.35 ? 579  VAL A O   1 
ATOM   4142  C  CB  . VAL A  1  551 ? 44.225  47.088  16.836  1.00 62.11 ? 579  VAL A CB  1 
ATOM   4143  C  CG1 . VAL A  1  551 ? 43.150  48.145  16.561  1.00 61.94 ? 579  VAL A CG1 1 
ATOM   4144  C  CG2 . VAL A  1  551 ? 43.620  45.810  17.419  1.00 61.65 ? 579  VAL A CG2 1 
ATOM   4145  N  N   . GLY A  1  552 ? 44.455  48.523  13.973  1.00 62.39 ? 580  GLY A N   1 
ATOM   4146  C  CA  . GLY A  1  552 ? 44.718  49.758  13.258  1.00 63.22 ? 580  GLY A CA  1 
ATOM   4147  C  C   . GLY A  1  552 ? 45.820  49.727  12.211  1.00 62.42 ? 580  GLY A C   1 
ATOM   4148  O  O   . GLY A  1  552 ? 46.283  50.780  11.773  1.00 62.80 ? 580  GLY A O   1 
ATOM   4149  N  N   . SER A  1  553 ? 46.257  48.537  11.813  1.00 62.19 ? 581  SER A N   1 
ATOM   4150  C  CA  . SER A  1  553 ? 47.289  48.424  10.786  1.00 61.84 ? 581  SER A CA  1 
ATOM   4151  C  C   . SER A  1  553 ? 46.731  47.615  9.603   1.00 62.97 ? 581  SER A C   1 
ATOM   4152  O  O   . SER A  1  553 ? 45.917  46.702  9.787   1.00 62.85 ? 581  SER A O   1 
ATOM   4153  C  CB  . SER A  1  553 ? 48.536  47.743  11.346  1.00 61.39 ? 581  SER A CB  1 
ATOM   4154  O  OG  . SER A  1  553 ? 48.407  46.339  11.286  1.00 61.75 ? 581  SER A OG  1 
ATOM   4155  N  N   . ALA A  1  554 ? 47.163  47.962  8.390   1.00 62.82 ? 582  ALA A N   1 
ATOM   4156  C  CA  . ALA A  1  554 ? 46.699  47.288  7.178   1.00 61.06 ? 582  ALA A CA  1 
ATOM   4157  C  C   . ALA A  1  554 ? 47.075  45.824  7.186   1.00 61.53 ? 582  ALA A C   1 
ATOM   4158  O  O   . ALA A  1  554 ? 48.171  45.459  7.620   1.00 61.50 ? 582  ALA A O   1 
ATOM   4159  C  CB  . ALA A  1  554 ? 47.288  47.950  5.952   1.00 61.27 ? 582  ALA A CB  1 
ATOM   4160  N  N   . THR A  1  555 ? 46.161  44.989  6.701   1.00 60.52 ? 583  THR A N   1 
ATOM   4161  C  CA  . THR A  1  555 ? 46.404  43.555  6.639   1.00 60.24 ? 583  THR A CA  1 
ATOM   4162  C  C   . THR A  1  555 ? 46.185  43.040  5.213   1.00 60.59 ? 583  THR A C   1 
ATOM   4163  O  O   . THR A  1  555 ? 45.453  43.655  4.427   1.00 60.56 ? 583  THR A O   1 
ATOM   4164  C  CB  . THR A  1  555 ? 45.483  42.798  7.603   1.00 59.49 ? 583  THR A CB  1 
ATOM   4165  O  OG1 . THR A  1  555 ? 44.125  42.965  7.190   1.00 60.21 ? 583  THR A OG1 1 
ATOM   4166  C  CG2 . THR A  1  555 ? 45.655  43.326  9.025   1.00 59.20 ? 583  THR A CG2 1 
ATOM   4167  N  N   . PRO A  1  556 ? 46.834  41.914  4.854   1.00 60.07 ? 584  PRO A N   1 
ATOM   4168  C  CA  . PRO A  1  556 ? 46.687  41.348  3.508   1.00 58.65 ? 584  PRO A CA  1 
ATOM   4169  C  C   . PRO A  1  556 ? 45.242  40.971  3.219   1.00 58.25 ? 584  PRO A C   1 
ATOM   4170  O  O   . PRO A  1  556 ? 44.627  40.192  3.960   1.00 58.07 ? 584  PRO A O   1 
ATOM   4171  C  CB  . PRO A  1  556 ? 47.618  40.131  3.534   1.00 58.70 ? 584  PRO A CB  1 
ATOM   4172  C  CG  . PRO A  1  556 ? 47.590  39.717  4.975   1.00 59.57 ? 584  PRO A CG  1 
ATOM   4173  C  CD  . PRO A  1  556 ? 47.679  41.047  5.697   1.00 58.76 ? 584  PRO A CD  1 
ATOM   4174  N  N   . ARG A  1  557 ? 44.706  41.536  2.141   1.00 58.06 ? 585  ARG A N   1 
ATOM   4175  C  CA  . ARG A  1  557 ? 43.329  41.273  1.751   1.00 56.48 ? 585  ARG A CA  1 
ATOM   4176  C  C   . ARG A  1  557 ? 43.049  39.782  1.840   1.00 56.14 ? 585  ARG A C   1 
ATOM   4177  O  O   . ARG A  1  557 ? 42.243  39.346  2.663   1.00 56.82 ? 585  ARG A O   1 
ATOM   4178  C  CB  . ARG A  1  557 ? 43.068  41.820  0.344   1.00 54.13 ? 585  ARG A CB  1 
ATOM   4179  C  CG  . ARG A  1  557 ? 43.204  43.343  0.282   1.00 51.96 ? 585  ARG A CG  1 
ATOM   4180  C  CD  . ARG A  1  557 ? 42.529  43.929  -0.942  1.00 51.00 ? 585  ARG A CD  1 
ATOM   4181  N  NE  . ARG A  1  557 ? 42.447  45.390  -0.901  1.00 47.30 ? 585  ARG A NE  1 
ATOM   4182  C  CZ  . ARG A  1  557 ? 43.496  46.210  -0.922  1.00 45.15 ? 585  ARG A CZ  1 
ATOM   4183  N  NH1 . ARG A  1  557 ? 44.732  45.726  -0.982  1.00 42.28 ? 585  ARG A NH1 1 
ATOM   4184  N  NH2 . ARG A  1  557 ? 43.303  47.521  -0.889  1.00 44.19 ? 585  ARG A NH2 1 
ATOM   4185  N  N   . TYR A  1  558 ? 43.723  38.988  1.022   1.00 55.92 ? 586  TYR A N   1 
ATOM   4186  C  CA  . TYR A  1  558 ? 43.509  37.556  1.088   1.00 55.18 ? 586  TYR A CA  1 
ATOM   4187  C  C   . TYR A  1  558 ? 44.510  36.920  2.050   1.00 56.18 ? 586  TYR A C   1 
ATOM   4188  O  O   . TYR A  1  558 ? 45.646  36.630  1.681   1.00 57.20 ? 586  TYR A O   1 
ATOM   4189  C  CB  . TYR A  1  558 ? 43.616  36.932  -0.309  1.00 53.91 ? 586  TYR A CB  1 
ATOM   4190  C  CG  . TYR A  1  558 ? 42.294  36.848  -1.054  1.00 54.33 ? 586  TYR A CG  1 
ATOM   4191  C  CD1 . TYR A  1  558 ? 41.653  37.994  -1.540  1.00 53.73 ? 586  TYR A CD1 1 
ATOM   4192  C  CD2 . TYR A  1  558 ? 41.660  35.614  -1.244  1.00 56.10 ? 586  TYR A CD2 1 
ATOM   4193  C  CE1 . TYR A  1  558 ? 40.402  37.912  -2.199  1.00 54.65 ? 586  TYR A CE1 1 
ATOM   4194  C  CE2 . TYR A  1  558 ? 40.407  35.516  -1.901  1.00 55.98 ? 586  TYR A CE2 1 
ATOM   4195  C  CZ  . TYR A  1  558 ? 39.784  36.665  -2.373  1.00 55.86 ? 586  TYR A CZ  1 
ATOM   4196  O  OH  . TYR A  1  558 ? 38.546  36.556  -2.989  1.00 55.45 ? 586  TYR A OH  1 
ATOM   4197  N  N   . LEU A  1  559 ? 44.094  36.737  3.300   1.00 56.86 ? 587  LEU A N   1 
ATOM   4198  C  CA  . LEU A  1  559 ? 44.955  36.108  4.292   1.00 56.74 ? 587  LEU A CA  1 
ATOM   4199  C  C   . LEU A  1  559 ? 44.319  34.805  4.723   1.00 56.63 ? 587  LEU A C   1 
ATOM   4200  O  O   . LEU A  1  559 ? 43.132  34.767  5.050   1.00 55.94 ? 587  LEU A O   1 
ATOM   4201  C  CB  . LEU A  1  559 ? 45.162  37.006  5.503   1.00 56.73 ? 587  LEU A CB  1 
ATOM   4202  C  CG  . LEU A  1  559 ? 45.919  36.354  6.666   1.00 56.18 ? 587  LEU A CG  1 
ATOM   4203  C  CD1 . LEU A  1  559 ? 46.959  35.351  6.208   1.00 56.56 ? 587  LEU A CD1 1 
ATOM   4204  C  CD2 . LEU A  1  559 ? 46.581  37.455  7.436   1.00 56.93 ? 587  LEU A CD2 1 
ATOM   4205  N  N   . TYR A  1  560 ? 45.123  33.745  4.738   1.00 56.46 ? 588  TYR A N   1 
ATOM   4206  C  CA  . TYR A  1  560 ? 44.615  32.431  5.068   1.00 57.09 ? 588  TYR A CA  1 
ATOM   4207  C  C   . TYR A  1  560 ? 45.675  31.424  5.480   1.00 57.85 ? 588  TYR A C   1 
ATOM   4208  O  O   . TYR A  1  560 ? 46.873  31.615  5.257   1.00 56.71 ? 588  TYR A O   1 
ATOM   4209  C  CB  . TYR A  1  560 ? 43.876  31.890  3.857   1.00 57.34 ? 588  TYR A CB  1 
ATOM   4210  C  CG  . TYR A  1  560 ? 44.771  31.717  2.656   1.00 58.39 ? 588  TYR A CG  1 
ATOM   4211  C  CD1 . TYR A  1  560 ? 45.442  30.513  2.437   1.00 58.77 ? 588  TYR A CD1 1 
ATOM   4212  C  CD2 . TYR A  1  560 ? 44.981  32.768  1.752   1.00 58.10 ? 588  TYR A CD2 1 
ATOM   4213  C  CE1 . TYR A  1  560 ? 46.303  30.349  1.346   1.00 58.30 ? 588  TYR A CE1 1 
ATOM   4214  C  CE2 . TYR A  1  560 ? 45.847  32.618  0.653   1.00 58.18 ? 588  TYR A CE2 1 
ATOM   4215  C  CZ  . TYR A  1  560 ? 46.504  31.400  0.459   1.00 58.06 ? 588  TYR A CZ  1 
ATOM   4216  O  OH  . TYR A  1  560 ? 47.357  31.210  -0.610  1.00 57.65 ? 588  TYR A OH  1 
ATOM   4217  N  N   . LEU A  1  561 ? 45.195  30.338  6.077   1.00 58.94 ? 589  LEU A N   1 
ATOM   4218  C  CA  . LEU A  1  561 ? 46.036  29.247  6.527   1.00 58.35 ? 589  LEU A CA  1 
ATOM   4219  C  C   . LEU A  1  561 ? 45.828  28.153  5.526   1.00 58.83 ? 589  LEU A C   1 
ATOM   4220  O  O   . LEU A  1  561 ? 44.695  27.869  5.143   1.00 58.63 ? 589  LEU A O   1 
ATOM   4221  C  CB  . LEU A  1  561 ? 45.605  28.751  7.900   1.00 58.13 ? 589  LEU A CB  1 
ATOM   4222  C  CG  . LEU A  1  561 ? 45.711  29.704  9.089   1.00 58.05 ? 589  LEU A CG  1 
ATOM   4223  C  CD1 . LEU A  1  561 ? 46.269  28.930  10.272  1.00 57.17 ? 589  LEU A CD1 1 
ATOM   4224  C  CD2 . LEU A  1  561 ? 46.616  30.889  8.761   1.00 58.27 ? 589  LEU A CD2 1 
ATOM   4225  N  N   . ALA A  1  562 ? 46.919  27.530  5.108   1.00 60.34 ? 590  ALA A N   1 
ATOM   4226  C  CA  . ALA A  1  562 ? 46.831  26.482  4.113   1.00 61.18 ? 590  ALA A CA  1 
ATOM   4227  C  C   . ALA A  1  562 ? 47.556  25.233  4.527   1.00 61.85 ? 590  ALA A C   1 
ATOM   4228  O  O   . ALA A  1  562 ? 48.379  25.244  5.436   1.00 62.02 ? 590  ALA A O   1 
ATOM   4229  C  CB  . ALA A  1  562 ? 47.395  26.977  2.783   1.00 60.35 ? 590  ALA A CB  1 
ATOM   4230  N  N   . SER A  1  563 ? 47.231  24.153  3.833   1.00 63.17 ? 591  SER A N   1 
ATOM   4231  C  CA  . SER A  1  563 ? 47.856  22.872  4.060   1.00 64.48 ? 591  SER A CA  1 
ATOM   4232  C  C   . SER A  1  563 ? 49.080  22.824  3.157   1.00 65.38 ? 591  SER A C   1 
ATOM   4233  O  O   . SER A  1  563 ? 49.394  23.783  2.441   1.00 64.24 ? 591  SER A O   1 
ATOM   4234  C  CB  . SER A  1  563 ? 46.899  21.739  3.686   1.00 64.36 ? 591  SER A CB  1 
ATOM   4235  O  OG  . SER A  1  563 ? 47.522  20.471  3.797   1.00 63.15 ? 591  SER A OG  1 
ATOM   4236  N  N   . ASN A  1  564 ? 49.775  21.697  3.210   1.00 68.35 ? 592  ASN A N   1 
ATOM   4237  C  CA  . ASN A  1  564 ? 50.956  21.486  2.394   1.00 68.26 ? 592  ASN A CA  1 
ATOM   4238  C  C   . ASN A  1  564 ? 50.398  21.047  1.048   1.00 68.08 ? 592  ASN A C   1 
ATOM   4239  O  O   . ASN A  1  564 ? 50.778  21.551  -0.012  1.00 67.25 ? 592  ASN A O   1 
ATOM   4240  C  CB  . ASN A  1  564 ? 51.831  20.370  3.002   1.00 69.66 ? 592  ASN A CB  1 
ATOM   4241  C  CG  . ASN A  1  564 ? 53.271  20.448  2.521   1.00 74.08 ? 592  ASN A CG  1 
ATOM   4242  O  OD1 . ASN A  1  564 ? 53.576  21.346  1.726   1.00 73.79 ? 592  ASN A OD1 1 
ATOM   4243  N  ND2 . ASN A  1  564 ? 54.178  19.568  2.969   1.00 78.25 ? 592  ASN A ND2 1 
ATOM   4244  N  N   . HIS A  1  565 ? 49.449  20.121  1.138   1.00 67.76 ? 593  HIS A N   1 
ATOM   4245  C  CA  . HIS A  1  565 ? 48.781  19.524  0.001   1.00 67.97 ? 593  HIS A CA  1 
ATOM   4246  C  C   . HIS A  1  565 ? 47.903  20.497  -0.808  1.00 68.58 ? 593  HIS A C   1 
ATOM   4247  O  O   . HIS A  1  565 ? 47.212  21.357  -0.252  1.00 68.33 ? 593  HIS A O   1 
ATOM   4248  C  CB  . HIS A  1  565 ? 47.959  18.332  0.509   1.00 69.16 ? 593  HIS A CB  1 
ATOM   4249  C  CG  . HIS A  1  565 ? 48.758  17.350  1.319   1.00 71.02 ? 593  HIS A CG  1 
ATOM   4250  N  ND1 . HIS A  1  565 ? 49.364  16.239  0.764   1.00 71.95 ? 593  HIS A ND1 1 
ATOM   4251  C  CD2 . HIS A  1  565 ? 49.068  17.324  2.639   1.00 70.44 ? 593  HIS A CD2 1 
ATOM   4252  C  CE1 . HIS A  1  565 ? 50.012  15.574  1.707   1.00 70.49 ? 593  HIS A CE1 1 
ATOM   4253  N  NE2 . HIS A  1  565 ? 49.846  16.210  2.853   1.00 70.88 ? 593  HIS A NE2 1 
ATOM   4254  N  N   . SER A  1  566 ? 47.939  20.330  -2.130  1.00 68.46 ? 594  SER A N   1 
ATOM   4255  C  CA  . SER A  1  566 ? 47.187  21.158  -3.068  1.00 67.03 ? 594  SER A CA  1 
ATOM   4256  C  C   . SER A  1  566 ? 45.940  20.445  -3.575  1.00 66.47 ? 594  SER A C   1 
ATOM   4257  O  O   . SER A  1  566 ? 45.778  19.235  -3.409  1.00 66.79 ? 594  SER A O   1 
ATOM   4258  C  CB  . SER A  1  566 ? 48.067  21.505  -4.275  1.00 68.08 ? 594  SER A CB  1 
ATOM   4259  O  OG  . SER A  1  566 ? 49.394  21.845  -3.884  1.00 67.87 ? 594  SER A OG  1 
ATOM   4260  N  N   . ASN A  1  567 ? 45.056  21.201  -4.207  1.00 66.28 ? 595  ASN A N   1 
ATOM   4261  C  CA  . ASN A  1  567 ? 43.853  20.604  -4.750  1.00 67.02 ? 595  ASN A CA  1 
ATOM   4262  C  C   . ASN A  1  567 ? 44.097  20.239  -6.226  1.00 67.94 ? 595  ASN A C   1 
ATOM   4263  O  O   . ASN A  1  567 ? 45.180  20.504  -6.775  1.00 66.14 ? 595  ASN A O   1 
ATOM   4264  C  CB  . ASN A  1  567 ? 42.661  21.563  -4.581  1.00 65.91 ? 595  ASN A CB  1 
ATOM   4265  C  CG  . ASN A  1  567 ? 42.825  22.860  -5.351  1.00 65.74 ? 595  ASN A CG  1 
ATOM   4266  O  OD1 . ASN A  1  567 ? 43.934  23.266  -5.695  1.00 65.60 ? 595  ASN A OD1 1 
ATOM   4267  N  ND2 . ASN A  1  567 ? 41.709  23.530  -5.608  1.00 65.66 ? 595  ASN A ND2 1 
ATOM   4268  N  N   . LYS A  1  568 ? 43.093  19.617  -6.847  1.00 67.55 ? 596  LYS A N   1 
ATOM   4269  C  CA  . LYS A  1  568 ? 43.152  19.179  -8.244  1.00 65.25 ? 596  LYS A CA  1 
ATOM   4270  C  C   . LYS A  1  568 ? 43.712  20.203  -9.239  1.00 64.39 ? 596  LYS A C   1 
ATOM   4271  O  O   . LYS A  1  568 ? 44.064  19.846  -10.362 1.00 64.70 ? 596  LYS A O   1 
ATOM   4272  C  CB  . LYS A  1  568 ? 41.752  18.733  -8.687  1.00 65.08 ? 596  LYS A CB  1 
ATOM   4273  C  CG  . LYS A  1  568 ? 41.628  18.361  -10.155 1.00 65.39 ? 596  LYS A CG  1 
ATOM   4274  C  CD  . LYS A  1  568 ? 40.237  17.824  -10.481 1.00 65.81 ? 596  LYS A CD  1 
ATOM   4275  C  CE  . LYS A  1  568 ? 39.973  16.505  -9.748  1.00 66.78 ? 596  LYS A CE  1 
ATOM   4276  N  NZ  . LYS A  1  568 ? 38.673  15.881  -10.126 1.00 66.47 ? 596  LYS A NZ  1 
ATOM   4277  N  N   . TRP A  1  569 ? 43.807  21.465  -8.838  1.00 63.58 ? 597  TRP A N   1 
ATOM   4278  C  CA  . TRP A  1  569 ? 44.314  22.490  -9.737  1.00 62.65 ? 597  TRP A CA  1 
ATOM   4279  C  C   . TRP A  1  569 ? 45.666  23.010  -9.287  1.00 63.13 ? 597  TRP A C   1 
ATOM   4280  O  O   . TRP A  1  569 ? 46.104  24.081  -9.713  1.00 63.13 ? 597  TRP A O   1 
ATOM   4281  C  CB  . TRP A  1  569 ? 43.298  23.625  -9.858  1.00 63.10 ? 597  TRP A CB  1 
ATOM   4282  C  CG  . TRP A  1  569 ? 41.935  23.079  -10.109 1.00 63.16 ? 597  TRP A CG  1 
ATOM   4283  C  CD1 . TRP A  1  569 ? 40.896  23.032  -9.227  1.00 63.00 ? 597  TRP A CD1 1 
ATOM   4284  C  CD2 . TRP A  1  569 ? 41.509  22.356  -11.264 1.00 63.39 ? 597  TRP A CD2 1 
ATOM   4285  N  NE1 . TRP A  1  569 ? 39.853  22.314  -9.754  1.00 62.25 ? 597  TRP A NE1 1 
ATOM   4286  C  CE2 . TRP A  1  569 ? 40.200  21.885  -11.005 1.00 63.09 ? 597  TRP A CE2 1 
ATOM   4287  C  CE3 . TRP A  1  569 ? 42.107  22.054  -12.494 1.00 64.10 ? 597  TRP A CE3 1 
ATOM   4288  C  CZ2 . TRP A  1  569 ? 39.476  21.123  -11.930 1.00 63.02 ? 597  TRP A CZ2 1 
ATOM   4289  C  CZ3 . TRP A  1  569 ? 41.385  21.293  -13.418 1.00 64.54 ? 597  TRP A CZ3 1 
ATOM   4290  C  CH2 . TRP A  1  569 ? 40.080  20.837  -13.126 1.00 63.20 ? 597  TRP A CH2 1 
ATOM   4291  N  N   . GLY A  1  570 ? 46.316  22.235  -8.417  1.00 62.52 ? 598  GLY A N   1 
ATOM   4292  C  CA  . GLY A  1  570 ? 47.649  22.568  -7.931  1.00 62.47 ? 598  GLY A CA  1 
ATOM   4293  C  C   . GLY A  1  570 ? 47.878  23.775  -7.036  1.00 61.95 ? 598  GLY A C   1 
ATOM   4294  O  O   . GLY A  1  570 ? 48.998  24.292  -6.975  1.00 61.54 ? 598  GLY A O   1 
ATOM   4295  N  N   . HIS A  1  571 ? 46.835  24.232  -6.348  1.00 62.65 ? 599  HIS A N   1 
ATOM   4296  C  CA  . HIS A  1  571 ? 46.949  25.374  -5.441  1.00 61.06 ? 599  HIS A CA  1 
ATOM   4297  C  C   . HIS A  1  571 ? 46.829  24.835  -4.016  1.00 61.25 ? 599  HIS A C   1 
ATOM   4298  O  O   . HIS A  1  571 ? 46.115  23.852  -3.779  1.00 60.43 ? 599  HIS A O   1 
ATOM   4299  C  CB  . HIS A  1  571 ? 45.846  26.404  -5.729  1.00 59.14 ? 599  HIS A CB  1 
ATOM   4300  C  CG  . HIS A  1  571 ? 46.002  27.096  -7.049  1.00 60.54 ? 599  HIS A CG  1 
ATOM   4301  N  ND1 . HIS A  1  571 ? 47.047  27.956  -7.317  1.00 61.39 ? 599  HIS A ND1 1 
ATOM   4302  C  CD2 . HIS A  1  571 ? 45.287  27.007  -8.196  1.00 60.33 ? 599  HIS A CD2 1 
ATOM   4303  C  CE1 . HIS A  1  571 ? 46.970  28.362  -8.573  1.00 60.85 ? 599  HIS A CE1 1 
ATOM   4304  N  NE2 . HIS A  1  571 ? 45.912  27.799  -9.129  1.00 60.15 ? 599  HIS A NE2 1 
ATOM   4305  N  N   . PRO A  1  572 ? 47.555  25.442  -3.054  1.00 61.67 ? 600  PRO A N   1 
ATOM   4306  C  CA  . PRO A  1  572 ? 47.484  24.978  -1.663  1.00 59.33 ? 600  PRO A CA  1 
ATOM   4307  C  C   . PRO A  1  572 ? 46.054  25.023  -1.094  1.00 59.94 ? 600  PRO A C   1 
ATOM   4308  O  O   . PRO A  1  572 ? 45.313  25.999  -1.293  1.00 59.78 ? 600  PRO A O   1 
ATOM   4309  C  CB  . PRO A  1  572 ? 48.436  25.925  -0.941  1.00 58.90 ? 600  PRO A CB  1 
ATOM   4310  C  CG  . PRO A  1  572 ? 49.462  26.221  -1.995  1.00 59.00 ? 600  PRO A CG  1 
ATOM   4311  C  CD  . PRO A  1  572 ? 48.610  26.464  -3.208  1.00 60.60 ? 600  PRO A CD  1 
ATOM   4312  N  N   . ARG A  1  573 ? 45.681  23.950  -0.398  1.00 59.60 ? 601  ARG A N   1 
ATOM   4313  C  CA  . ARG A  1  573 ? 44.361  23.807  0.216   1.00 58.29 ? 601  ARG A CA  1 
ATOM   4314  C  C   . ARG A  1  573 ? 44.257  24.666  1.463   1.00 58.71 ? 601  ARG A C   1 
ATOM   4315  O  O   . ARG A  1  573 ? 44.936  24.394  2.457   1.00 59.91 ? 601  ARG A O   1 
ATOM   4316  C  CB  . ARG A  1  573 ? 44.154  22.358  0.598   1.00 55.49 ? 601  ARG A CB  1 
ATOM   4317  C  CG  . ARG A  1  573 ? 44.323  21.447  -0.558  1.00 54.74 ? 601  ARG A CG  1 
ATOM   4318  C  CD  . ARG A  1  573 ? 43.065  20.680  -0.702  1.00 54.74 ? 601  ARG A CD  1 
ATOM   4319  N  NE  . ARG A  1  573 ? 42.822  19.908  0.507   1.00 52.37 ? 601  ARG A NE  1 
ATOM   4320  C  CZ  . ARG A  1  573 ? 41.629  19.448  0.863   1.00 53.11 ? 601  ARG A CZ  1 
ATOM   4321  N  NH1 . ARG A  1  573 ? 40.572  19.699  0.098   1.00 53.54 ? 601  ARG A NH1 1 
ATOM   4322  N  NH2 . ARG A  1  573 ? 41.491  18.725  1.970   1.00 52.36 ? 601  ARG A NH2 1 
ATOM   4323  N  N   . GLY A  1  574 ? 43.406  25.686  1.439   1.00 57.55 ? 602  GLY A N   1 
ATOM   4324  C  CA  . GLY A  1  574 ? 43.323  26.524  2.616   1.00 57.60 ? 602  GLY A CA  1 
ATOM   4325  C  C   . GLY A  1  574 ? 42.024  27.226  2.916   1.00 57.31 ? 602  GLY A C   1 
ATOM   4326  O  O   . GLY A  1  574 ? 41.041  27.126  2.184   1.00 56.54 ? 602  GLY A O   1 
ATOM   4327  N  N   . TYR A  1  575 ? 42.037  27.930  4.039   1.00 57.51 ? 603  TYR A N   1 
ATOM   4328  C  CA  . TYR A  1  575 ? 40.899  28.696  4.489   1.00 56.74 ? 603  TYR A CA  1 
ATOM   4329  C  C   . TYR A  1  575 ? 41.394  30.085  4.797   1.00 56.04 ? 603  TYR A C   1 
ATOM   4330  O  O   . TYR A  1  575 ? 42.442  30.262  5.410   1.00 55.62 ? 603  TYR A O   1 
ATOM   4331  C  CB  . TYR A  1  575 ? 40.297  28.083  5.741   1.00 55.21 ? 603  TYR A CB  1 
ATOM   4332  C  CG  . TYR A  1  575 ? 39.062  27.284  5.469   1.00 54.46 ? 603  TYR A CG  1 
ATOM   4333  C  CD1 . TYR A  1  575 ? 39.137  26.048  4.847   1.00 55.23 ? 603  TYR A CD1 1 
ATOM   4334  C  CD2 . TYR A  1  575 ? 37.809  27.765  5.829   1.00 54.83 ? 603  TYR A CD2 1 
ATOM   4335  C  CE1 . TYR A  1  575 ? 37.989  25.301  4.589   1.00 55.20 ? 603  TYR A CE1 1 
ATOM   4336  C  CE2 . TYR A  1  575 ? 36.655  27.025  5.575   1.00 54.78 ? 603  TYR A CE2 1 
ATOM   4337  C  CZ  . TYR A  1  575 ? 36.757  25.794  4.956   1.00 53.92 ? 603  TYR A CZ  1 
ATOM   4338  O  OH  . TYR A  1  575 ? 35.640  25.045  4.714   1.00 52.06 ? 603  TYR A OH  1 
ATOM   4339  N  N   . ARG A  1  576 ? 40.644  31.076  4.358   1.00 55.56 ? 604  ARG A N   1 
ATOM   4340  C  CA  . ARG A  1  576 ? 41.041  32.433  4.612   1.00 57.12 ? 604  ARG A CA  1 
ATOM   4341  C  C   . ARG A  1  576 ? 40.256  32.953  5.778   1.00 57.09 ? 604  ARG A C   1 
ATOM   4342  O  O   . ARG A  1  576 ? 39.161  32.485  6.058   1.00 56.09 ? 604  ARG A O   1 
ATOM   4343  C  CB  . ARG A  1  576 ? 40.798  33.306  3.386   1.00 57.43 ? 604  ARG A CB  1 
ATOM   4344  C  CG  . ARG A  1  576 ? 39.356  33.355  2.942   1.00 57.89 ? 604  ARG A CG  1 
ATOM   4345  C  CD  . ARG A  1  576 ? 39.162  34.396  1.849   1.00 57.03 ? 604  ARG A CD  1 
ATOM   4346  N  NE  . ARG A  1  576 ? 39.670  35.703  2.262   1.00 55.20 ? 604  ARG A NE  1 
ATOM   4347  C  CZ  . ARG A  1  576 ? 39.347  36.854  1.676   1.00 53.94 ? 604  ARG A CZ  1 
ATOM   4348  N  NH1 . ARG A  1  576 ? 38.510  36.876  0.647   1.00 51.79 ? 604  ARG A NH1 1 
ATOM   4349  N  NH2 . ARG A  1  576 ? 39.869  37.986  2.119   1.00 54.17 ? 604  ARG A NH2 1 
ATOM   4350  N  N   . ILE A  1  577 ? 40.829  33.931  6.458   1.00 58.81 ? 605  ILE A N   1 
ATOM   4351  C  CA  . ILE A  1  577 ? 40.183  34.525  7.603   1.00 58.85 ? 605  ILE A CA  1 
ATOM   4352  C  C   . ILE A  1  577 ? 39.760  35.946  7.326   1.00 59.35 ? 605  ILE A C   1 
ATOM   4353  O  O   . ILE A  1  577 ? 40.540  36.884  7.476   1.00 59.31 ? 605  ILE A O   1 
ATOM   4354  C  CB  . ILE A  1  577 ? 41.107  34.492  8.783   1.00 57.98 ? 605  ILE A CB  1 
ATOM   4355  C  CG1 . ILE A  1  577 ? 41.372  33.032  9.139   1.00 57.71 ? 605  ILE A CG1 1 
ATOM   4356  C  CG2 . ILE A  1  577 ? 40.512  35.283  9.929   1.00 58.92 ? 605  ILE A CG2 1 
ATOM   4357  C  CD1 . ILE A  1  577 ? 42.427  32.843  10.158  1.00 57.91 ? 605  ILE A CD1 1 
ATOM   4358  N  N   . GLN A  1  578 ? 38.512  36.090  6.904   1.00 60.68 ? 606  GLN A N   1 
ATOM   4359  C  CA  . GLN A  1  578 ? 37.967  37.392  6.599   1.00 61.14 ? 606  GLN A CA  1 
ATOM   4360  C  C   . GLN A  1  578 ? 37.451  37.974  7.891   1.00 62.58 ? 606  GLN A C   1 
ATOM   4361  O  O   . GLN A  1  578 ? 36.603  37.381  8.563   1.00 61.94 ? 606  GLN A O   1 
ATOM   4362  C  CB  . GLN A  1  578 ? 36.841  37.272  5.576   1.00 62.20 ? 606  GLN A CB  1 
ATOM   4363  C  CG  . GLN A  1  578 ? 36.143  38.585  5.273   1.00 63.50 ? 606  GLN A CG  1 
ATOM   4364  C  CD  . GLN A  1  578 ? 35.316  38.531  4.001   1.00 65.07 ? 606  GLN A CD  1 
ATOM   4365  O  OE1 . GLN A  1  578 ? 34.453  37.663  3.838   1.00 64.55 ? 606  GLN A OE1 1 
ATOM   4366  N  NE2 . GLN A  1  578 ? 35.576  39.466  3.087   1.00 66.14 ? 606  GLN A NE2 1 
ATOM   4367  N  N   . MET A  1  579 ? 37.982  39.139  8.239   1.00 63.34 ? 607  MET A N   1 
ATOM   4368  C  CA  . MET A  1  579 ? 37.590  39.804  9.464   1.00 64.23 ? 607  MET A CA  1 
ATOM   4369  C  C   . MET A  1  579 ? 36.542  40.873  9.290   1.00 64.72 ? 607  MET A C   1 
ATOM   4370  O  O   . MET A  1  579 ? 36.435  41.506  8.239   1.00 64.55 ? 607  MET A O   1 
ATOM   4371  C  CB  . MET A  1  579 ? 38.805  40.410  10.133  1.00 64.07 ? 607  MET A CB  1 
ATOM   4372  C  CG  . MET A  1  579 ? 39.658  39.400  10.830  1.00 63.89 ? 607  MET A CG  1 
ATOM   4373  S  SD  . MET A  1  579 ? 41.007  40.283  11.546  1.00 66.62 ? 607  MET A SD  1 
ATOM   4374  C  CE  . MET A  1  579 ? 40.095  41.483  12.659  1.00 66.40 ? 607  MET A CE  1 
ATOM   4375  N  N   . LEU A  1  580 ? 35.769  41.061  10.353  1.00 66.98 ? 608  LEU A N   1 
ATOM   4376  C  CA  . LEU A  1  580 ? 34.699  42.056  10.395  1.00 67.94 ? 608  LEU A CA  1 
ATOM   4377  C  C   . LEU A  1  580 ? 34.774  42.782  11.756  1.00 68.37 ? 608  LEU A C   1 
ATOM   4378  O  O   . LEU A  1  580 ? 34.145  42.353  12.732  1.00 67.10 ? 608  LEU A O   1 
ATOM   4379  C  CB  . LEU A  1  580 ? 33.329  41.368  10.251  1.00 67.05 ? 608  LEU A CB  1 
ATOM   4380  C  CG  . LEU A  1  580 ? 33.197  40.120  9.362   1.00 67.14 ? 608  LEU A CG  1 
ATOM   4381  C  CD1 . LEU A  1  580 ? 31.836  39.476  9.615   1.00 65.99 ? 608  LEU A CD1 1 
ATOM   4382  C  CD2 . LEU A  1  580 ? 33.390  40.483  7.889   1.00 67.23 ? 608  LEU A CD2 1 
ATOM   4383  N  N   . SER A  1  581 ? 35.556  43.862  11.825  1.00 67.48 ? 609  SER A N   1 
ATOM   4384  C  CA  . SER A  1  581 ? 35.687  44.624  13.058  1.00 66.98 ? 609  SER A CA  1 
ATOM   4385  C  C   . SER A  1  581 ? 36.120  46.053  12.784  1.00 68.20 ? 609  SER A C   1 
ATOM   4386  O  O   . SER A  1  581 ? 36.659  46.366  11.722  1.00 68.30 ? 609  SER A O   1 
ATOM   4387  C  CB  . SER A  1  581 ? 36.683  43.953  14.017  1.00 67.32 ? 609  SER A CB  1 
ATOM   4388  O  OG  . SER A  1  581 ? 38.028  44.093  13.591  1.00 69.85 ? 609  SER A OG  1 
ATOM   4389  N  N   . PHE A  1  582 ? 35.867  46.914  13.761  1.00 68.93 ? 610  PHE A N   1 
ATOM   4390  C  CA  . PHE A  1  582 ? 36.203  48.333  13.688  1.00 69.23 ? 610  PHE A CA  1 
ATOM   4391  C  C   . PHE A  1  582 ? 36.774  48.643  15.063  1.00 68.93 ? 610  PHE A C   1 
ATOM   4392  O  O   . PHE A  1  582 ? 36.560  49.723  15.630  1.00 68.73 ? 610  PHE A O   1 
ATOM   4393  C  CB  . PHE A  1  582 ? 34.938  49.176  13.474  1.00 71.95 ? 610  PHE A CB  1 
ATOM   4394  C  CG  . PHE A  1  582 ? 33.899  48.536  12.565  1.00 72.85 ? 610  PHE A CG  1 
ATOM   4395  C  CD1 . PHE A  1  582 ? 33.256  47.343  12.932  1.00 72.37 ? 610  PHE A CD1 1 
ATOM   4396  C  CD2 . PHE A  1  582 ? 33.540  49.149  11.358  1.00 71.99 ? 610  PHE A CD2 1 
ATOM   4397  C  CE1 . PHE A  1  582 ? 32.271  46.769  12.111  1.00 73.01 ? 610  PHE A CE1 1 
ATOM   4398  C  CE2 . PHE A  1  582 ? 32.557  48.589  10.527  1.00 72.64 ? 610  PHE A CE2 1 
ATOM   4399  C  CZ  . PHE A  1  582 ? 31.920  47.396  10.903  1.00 73.51 ? 610  PHE A CZ  1 
ATOM   4400  N  N   . ALA A  1  583 ? 37.476  47.650  15.593  1.00 69.24 ? 611  ALA A N   1 
ATOM   4401  C  CA  . ALA A  1  583 ? 38.090  47.712  16.910  1.00 69.61 ? 611  ALA A CA  1 
ATOM   4402  C  C   . ALA A  1  583 ? 38.596  49.100  17.288  1.00 69.74 ? 611  ALA A C   1 
ATOM   4403  O  O   . ALA A  1  583 ? 39.491  49.646  16.636  1.00 68.85 ? 611  ALA A O   1 
ATOM   4404  C  CB  . ALA A  1  583 ? 39.237  46.677  16.996  1.00 68.70 ? 611  ALA A CB  1 
ATOM   4405  N  N   . GLY A  1  584 ? 38.006  49.674  18.335  1.00 69.80 ? 612  GLY A N   1 
ATOM   4406  C  CA  . GLY A  1  584 ? 38.443  50.981  18.792  1.00 69.38 ? 612  GLY A CA  1 
ATOM   4407  C  C   . GLY A  1  584 ? 39.851  50.820  19.338  1.00 69.18 ? 612  GLY A C   1 
ATOM   4408  O  O   . GLY A  1  584 ? 40.224  49.716  19.738  1.00 69.49 ? 612  GLY A O   1 
ATOM   4409  N  N   . GLU A  1  585 ? 40.631  51.898  19.354  1.00 68.16 ? 613  GLU A N   1 
ATOM   4410  C  CA  . GLU A  1  585 ? 42.008  51.861  19.851  1.00 68.08 ? 613  GLU A CA  1 
ATOM   4411  C  C   . GLU A  1  585 ? 42.159  51.136  21.178  1.00 69.25 ? 613  GLU A C   1 
ATOM   4412  O  O   . GLU A  1  585 ? 41.529  51.508  22.166  1.00 70.17 ? 613  GLU A O   1 
ATOM   4413  C  CB  . GLU A  1  585 ? 42.537  53.276  20.027  1.00 68.06 ? 613  GLU A CB  1 
ATOM   4414  C  CG  . GLU A  1  585 ? 42.953  53.965  18.753  1.00 69.59 ? 613  GLU A CG  1 
ATOM   4415  C  CD  . GLU A  1  585 ? 42.684  55.461  18.815  1.00 71.02 ? 613  GLU A CD  1 
ATOM   4416  O  OE1 . GLU A  1  585 ? 42.889  56.055  19.905  1.00 70.41 ? 613  GLU A OE1 1 
ATOM   4417  O  OE2 . GLU A  1  585 ? 42.272  56.036  17.776  1.00 70.22 ? 613  GLU A OE2 1 
ATOM   4418  N  N   . PRO A  1  586 ? 43.006  50.094  21.230  1.00 69.03 ? 614  PRO A N   1 
ATOM   4419  C  CA  . PRO A  1  586 ? 43.154  49.400  22.510  1.00 70.28 ? 614  PRO A CA  1 
ATOM   4420  C  C   . PRO A  1  586 ? 43.869  50.281  23.539  1.00 70.89 ? 614  PRO A C   1 
ATOM   4421  O  O   . PRO A  1  586 ? 44.600  51.204  23.173  1.00 70.72 ? 614  PRO A O   1 
ATOM   4422  C  CB  . PRO A  1  586 ? 43.948  48.144  22.132  1.00 69.81 ? 614  PRO A CB  1 
ATOM   4423  C  CG  . PRO A  1  586 ? 44.756  48.587  20.968  1.00 68.96 ? 614  PRO A CG  1 
ATOM   4424  C  CD  . PRO A  1  586 ? 43.786  49.427  20.174  1.00 69.04 ? 614  PRO A CD  1 
ATOM   4425  N  N   . LEU A  1  587 ? 43.636  50.005  24.820  1.00 71.20 ? 615  LEU A N   1 
ATOM   4426  C  CA  . LEU A  1  587 ? 44.254  50.760  25.908  1.00 70.67 ? 615  LEU A CA  1 
ATOM   4427  C  C   . LEU A  1  587 ? 45.766  50.832  25.658  1.00 71.63 ? 615  LEU A C   1 
ATOM   4428  O  O   . LEU A  1  587 ? 46.392  49.807  25.383  1.00 72.97 ? 615  LEU A O   1 
ATOM   4429  C  CB  . LEU A  1  587 ? 43.984  50.043  27.224  1.00 70.86 ? 615  LEU A CB  1 
ATOM   4430  C  CG  . LEU A  1  587 ? 44.347  50.791  28.499  1.00 71.42 ? 615  LEU A CG  1 
ATOM   4431  C  CD1 . LEU A  1  587 ? 43.211  51.740  28.854  1.00 70.76 ? 615  LEU A CD1 1 
ATOM   4432  C  CD2 . LEU A  1  587 ? 44.606  49.782  29.621  1.00 71.36 ? 615  LEU A CD2 1 
ATOM   4433  N  N   . PRO A  1  588 ? 46.374  52.032  25.768  1.00 71.83 ? 616  PRO A N   1 
ATOM   4434  C  CA  . PRO A  1  588 ? 47.817  52.205  25.542  1.00 71.22 ? 616  PRO A CA  1 
ATOM   4435  C  C   . PRO A  1  588 ? 48.670  51.163  26.254  1.00 71.91 ? 616  PRO A C   1 
ATOM   4436  O  O   . PRO A  1  588 ? 48.156  50.311  26.970  1.00 72.41 ? 616  PRO A O   1 
ATOM   4437  C  CB  . PRO A  1  588 ? 48.080  53.613  26.068  1.00 71.38 ? 616  PRO A CB  1 
ATOM   4438  C  CG  . PRO A  1  588 ? 46.784  54.315  25.821  1.00 71.20 ? 616  PRO A CG  1 
ATOM   4439  C  CD  . PRO A  1  588 ? 45.777  53.283  26.269  1.00 71.41 ? 616  PRO A CD  1 
ATOM   4440  N  N   . GLN A  1  589 ? 49.980  51.226  26.053  1.00 73.54 ? 617  GLN A N   1 
ATOM   4441  C  CA  . GLN A  1  589 ? 50.885  50.289  26.716  1.00 74.49 ? 617  GLN A CA  1 
ATOM   4442  C  C   . GLN A  1  589 ? 51.521  50.952  27.939  1.00 74.01 ? 617  GLN A C   1 
ATOM   4443  O  O   . GLN A  1  589 ? 51.919  50.274  28.887  1.00 74.11 ? 617  GLN A O   1 
ATOM   4444  C  CB  . GLN A  1  589 ? 51.961  49.811  25.740  1.00 75.15 ? 617  GLN A CB  1 
ATOM   4445  C  CG  . GLN A  1  589 ? 51.424  48.875  24.667  1.00 75.88 ? 617  GLN A CG  1 
ATOM   4446  C  CD  . GLN A  1  589 ? 52.439  48.588  23.570  1.00 76.51 ? 617  GLN A CD  1 
ATOM   4447  O  OE1 . GLN A  1  589 ? 53.574  48.189  23.839  1.00 76.36 ? 617  GLN A OE1 1 
ATOM   4448  N  NE2 . GLN A  1  589 ? 52.026  48.785  22.320  1.00 76.94 ? 617  GLN A NE2 1 
ATOM   4449  N  N   . ASN A  1  590 ? 51.608  52.281  27.906  1.00 73.72 ? 618  ASN A N   1 
ATOM   4450  C  CA  . ASN A  1  590 ? 52.154  53.062  29.015  1.00 73.56 ? 618  ASN A CA  1 
ATOM   4451  C  C   . ASN A  1  590 ? 51.371  52.727  30.292  1.00 74.23 ? 618  ASN A C   1 
ATOM   4452  O  O   . ASN A  1  590 ? 51.888  52.883  31.404  1.00 73.86 ? 618  ASN A O   1 
ATOM   4453  C  CB  . ASN A  1  590 ? 52.029  54.569  28.710  1.00 74.68 ? 618  ASN A CB  1 
ATOM   4454  C  CG  . ASN A  1  590 ? 53.229  55.125  27.931  1.00 75.92 ? 618  ASN A CG  1 
ATOM   4455  O  OD1 . ASN A  1  590 ? 53.119  56.118  27.188  1.00 75.54 ? 618  ASN A OD1 1 
ATOM   4456  N  ND2 . ASN A  1  590 ? 54.388  54.500  28.121  1.00 75.54 ? 618  ASN A ND2 1 
ATOM   4457  N  N   . SER A  1  591 ? 50.130  52.256  30.115  1.00 74.56 ? 619  SER A N   1 
ATOM   4458  C  CA  . SER A  1  591 ? 49.241  51.903  31.230  1.00 73.77 ? 619  SER A CA  1 
ATOM   4459  C  C   . SER A  1  591 ? 49.622  50.608  31.939  1.00 73.12 ? 619  SER A C   1 
ATOM   4460  O  O   . SER A  1  591 ? 49.778  49.556  31.317  1.00 71.86 ? 619  SER A O   1 
ATOM   4461  C  CB  . SER A  1  591 ? 47.783  51.807  30.762  1.00 72.53 ? 619  SER A CB  1 
ATOM   4462  O  OG  . SER A  1  591 ? 46.925  51.528  31.860  1.00 72.60 ? 619  SER A OG  1 
ATOM   4463  N  N   . SER A  1  592 ? 49.740  50.713  33.259  1.00 72.95 ? 620  SER A N   1 
ATOM   4464  C  CA  . SER A  1  592 ? 50.117  49.607  34.125  1.00 72.27 ? 620  SER A CA  1 
ATOM   4465  C  C   . SER A  1  592 ? 49.371  48.294  33.896  1.00 72.66 ? 620  SER A C   1 
ATOM   4466  O  O   . SER A  1  592 ? 49.951  47.211  34.055  1.00 72.56 ? 620  SER A O   1 
ATOM   4467  C  CB  . SER A  1  592 ? 49.956  50.029  35.592  1.00 72.21 ? 620  SER A CB  1 
ATOM   4468  O  OG  . SER A  1  592 ? 48.630  50.460  35.869  1.00 72.41 ? 620  SER A OG  1 
ATOM   4469  N  N   . MET A  1  593 ? 48.100  48.377  33.510  1.00 71.79 ? 621  MET A N   1 
ATOM   4470  C  CA  . MET A  1  593 ? 47.307  47.165  33.330  1.00 71.56 ? 621  MET A CA  1 
ATOM   4471  C  C   . MET A  1  593 ? 47.234  46.533  31.957  1.00 71.29 ? 621  MET A C   1 
ATOM   4472  O  O   . MET A  1  593 ? 46.829  45.380  31.842  1.00 71.58 ? 621  MET A O   1 
ATOM   4473  C  CB  . MET A  1  593 ? 45.883  47.398  33.831  1.00 71.87 ? 621  MET A CB  1 
ATOM   4474  C  CG  . MET A  1  593 ? 45.199  48.613  33.241  1.00 72.31 ? 621  MET A CG  1 
ATOM   4475  S  SD  . MET A  1  593 ? 43.484  48.703  33.793  1.00 72.25 ? 621  MET A SD  1 
ATOM   4476  C  CE  . MET A  1  593 ? 43.652  49.667  35.294  1.00 71.82 ? 621  MET A CE  1 
ATOM   4477  N  N   . ALA A  1  594 ? 47.624  47.275  30.926  1.00 71.24 ? 622  ALA A N   1 
ATOM   4478  C  CA  . ALA A  1  594 ? 47.578  46.784  29.545  1.00 71.81 ? 622  ALA A CA  1 
ATOM   4479  C  C   . ALA A  1  594 ? 47.837  45.279  29.320  1.00 71.99 ? 622  ALA A C   1 
ATOM   4480  O  O   . ALA A  1  594 ? 47.102  44.620  28.577  1.00 70.80 ? 622  ALA A O   1 
ATOM   4481  C  CB  . ALA A  1  594 ? 48.536  47.603  28.684  1.00 71.67 ? 622  ALA A CB  1 
ATOM   4482  N  N   . ARG A  1  595 ? 48.873  44.734  29.952  1.00 71.33 ? 623  ARG A N   1 
ATOM   4483  C  CA  . ARG A  1  595 ? 49.208  43.321  29.781  1.00 69.61 ? 623  ARG A CA  1 
ATOM   4484  C  C   . ARG A  1  595 ? 48.101  42.327  30.118  1.00 69.85 ? 623  ARG A C   1 
ATOM   4485  O  O   . ARG A  1  595 ? 48.091  41.217  29.586  1.00 70.45 ? 623  ARG A O   1 
ATOM   4486  C  CB  . ARG A  1  595 ? 50.451  42.988  30.600  1.00 70.95 ? 623  ARG A CB  1 
ATOM   4487  C  CG  . ARG A  1  595 ? 51.741  43.425  29.942  1.00 72.70 ? 623  ARG A CG  1 
ATOM   4488  C  CD  . ARG A  1  595 ? 52.257  42.373  28.948  1.00 75.03 ? 623  ARG A CD  1 
ATOM   4489  N  NE  . ARG A  1  595 ? 53.310  42.911  28.076  1.00 77.99 ? 623  ARG A NE  1 
ATOM   4490  C  CZ  . ARG A  1  595 ? 54.259  42.189  27.474  1.00 77.94 ? 623  ARG A CZ  1 
ATOM   4491  N  NH1 . ARG A  1  595 ? 54.322  40.868  27.638  1.00 77.54 ? 623  ARG A NH1 1 
ATOM   4492  N  NH2 . ARG A  1  595 ? 55.146  42.796  26.688  1.00 78.42 ? 623  ARG A NH2 1 
ATOM   4493  N  N   . GLY A  1  596 ? 47.179  42.720  30.996  1.00 69.36 ? 624  GLY A N   1 
ATOM   4494  C  CA  . GLY A  1  596 ? 46.088  41.839  31.394  1.00 68.35 ? 624  GLY A CA  1 
ATOM   4495  C  C   . GLY A  1  596 ? 45.168  41.419  30.262  1.00 68.14 ? 624  GLY A C   1 
ATOM   4496  O  O   . GLY A  1  596 ? 44.408  40.456  30.376  1.00 67.59 ? 624  GLY A O   1 
ATOM   4497  N  N   . PHE A  1  597 ? 45.232  42.153  29.162  1.00 66.68 ? 625  PHE A N   1 
ATOM   4498  C  CA  . PHE A  1  597 ? 44.415  41.859  28.001  1.00 66.17 ? 625  PHE A CA  1 
ATOM   4499  C  C   . PHE A  1  597 ? 45.172  42.341  26.787  1.00 65.88 ? 625  PHE A C   1 
ATOM   4500  O  O   . PHE A  1  597 ? 44.666  43.109  25.968  1.00 65.45 ? 625  PHE A O   1 
ATOM   4501  C  CB  . PHE A  1  597 ? 43.058  42.548  28.121  1.00 66.45 ? 625  PHE A CB  1 
ATOM   4502  C  CG  . PHE A  1  597 ? 43.091  43.828  28.910  1.00 66.96 ? 625  PHE A CG  1 
ATOM   4503  C  CD1 . PHE A  1  597 ? 43.463  45.030  28.311  1.00 67.34 ? 625  PHE A CD1 1 
ATOM   4504  C  CD2 . PHE A  1  597 ? 42.741  43.834  30.261  1.00 67.00 ? 625  PHE A CD2 1 
ATOM   4505  C  CE1 . PHE A  1  597 ? 43.482  46.231  29.049  1.00 66.71 ? 625  PHE A CE1 1 
ATOM   4506  C  CE2 . PHE A  1  597 ? 42.759  45.025  31.006  1.00 66.92 ? 625  PHE A CE2 1 
ATOM   4507  C  CZ  . PHE A  1  597 ? 43.129  46.225  30.397  1.00 66.28 ? 625  PHE A CZ  1 
ATOM   4508  N  N   . SER A  1  598 ? 46.411  41.865  26.706  1.00 67.53 ? 626  SER A N   1 
ATOM   4509  C  CA  . SER A  1  598 ? 47.350  42.184  25.632  1.00 66.97 ? 626  SER A CA  1 
ATOM   4510  C  C   . SER A  1  598 ? 46.809  41.830  24.253  1.00 65.51 ? 626  SER A C   1 
ATOM   4511  O  O   . SER A  1  598 ? 47.187  42.452  23.255  1.00 64.62 ? 626  SER A O   1 
ATOM   4512  C  CB  . SER A  1  598 ? 48.678  41.453  25.882  1.00 66.23 ? 626  SER A CB  1 
ATOM   4513  O  OG  . SER A  1  598 ? 48.466  40.084  26.190  1.00 65.53 ? 626  SER A OG  1 
ATOM   4514  N  N   . TRP A  1  599 ? 45.926  40.833  24.207  1.00 64.96 ? 627  TRP A N   1 
ATOM   4515  C  CA  . TRP A  1  599 ? 45.322  40.400  22.956  1.00 63.83 ? 627  TRP A CA  1 
ATOM   4516  C  C   . TRP A  1  599 ? 44.495  41.518  22.336  1.00 64.28 ? 627  TRP A C   1 
ATOM   4517  O  O   . TRP A  1  599 ? 44.334  41.559  21.120  1.00 64.50 ? 627  TRP A O   1 
ATOM   4518  C  CB  . TRP A  1  599 ? 44.431  39.176  23.171  1.00 63.44 ? 627  TRP A CB  1 
ATOM   4519  C  CG  . TRP A  1  599 ? 43.347  39.389  24.180  1.00 63.33 ? 627  TRP A CG  1 
ATOM   4520  C  CD1 . TRP A  1  599 ? 43.399  39.093  25.513  1.00 63.29 ? 627  TRP A CD1 1 
ATOM   4521  C  CD2 . TRP A  1  599 ? 42.055  39.977  23.949  1.00 63.63 ? 627  TRP A CD2 1 
ATOM   4522  N  NE1 . TRP A  1  599 ? 42.223  39.458  26.126  1.00 63.24 ? 627  TRP A NE1 1 
ATOM   4523  C  CE2 . TRP A  1  599 ? 41.381  40.004  25.191  1.00 63.85 ? 627  TRP A CE2 1 
ATOM   4524  C  CE3 . TRP A  1  599 ? 41.402  40.486  22.815  1.00 63.64 ? 627  TRP A CE3 1 
ATOM   4525  C  CZ2 . TRP A  1  599 ? 40.080  40.524  25.330  1.00 63.30 ? 627  TRP A CZ2 1 
ATOM   4526  C  CZ3 . TRP A  1  599 ? 40.109  41.001  22.954  1.00 62.41 ? 627  TRP A CZ3 1 
ATOM   4527  C  CH2 . TRP A  1  599 ? 39.467  41.015  24.203  1.00 62.79 ? 627  TRP A CH2 1 
ATOM   4528  N  N   . GLU A  1  600 ? 43.970  42.424  23.163  1.00 64.21 ? 628  GLU A N   1 
ATOM   4529  C  CA  . GLU A  1  600 ? 43.163  43.529  22.645  1.00 63.95 ? 628  GLU A CA  1 
ATOM   4530  C  C   . GLU A  1  600 ? 43.971  44.409  21.691  1.00 64.82 ? 628  GLU A C   1 
ATOM   4531  O  O   . GLU A  1  600 ? 43.414  45.195  20.924  1.00 64.46 ? 628  GLU A O   1 
ATOM   4532  C  CB  . GLU A  1  600 ? 42.616  44.414  23.775  1.00 64.16 ? 628  GLU A CB  1 
ATOM   4533  C  CG  . GLU A  1  600 ? 41.739  45.560  23.225  1.00 64.95 ? 628  GLU A CG  1 
ATOM   4534  C  CD  . GLU A  1  600 ? 41.604  46.761  24.147  1.00 64.21 ? 628  GLU A CD  1 
ATOM   4535  O  OE1 . GLU A  1  600 ? 42.576  47.068  24.876  1.00 63.49 ? 628  GLU A OE1 1 
ATOM   4536  O  OE2 . GLU A  1  600 ? 40.530  47.412  24.114  1.00 64.00 ? 628  GLU A OE2 1 
ATOM   4537  N  N   . ARG A  1  601 ? 45.288  44.272  21.735  1.00 65.30 ? 629  ARG A N   1 
ATOM   4538  C  CA  . ARG A  1  601 ? 46.149  45.073  20.885  1.00 65.01 ? 629  ARG A CA  1 
ATOM   4539  C  C   . ARG A  1  601 ? 46.409  44.411  19.528  1.00 64.77 ? 629  ARG A C   1 
ATOM   4540  O  O   . ARG A  1  601 ? 47.306  44.817  18.792  1.00 64.34 ? 629  ARG A O   1 
ATOM   4541  C  CB  . ARG A  1  601 ? 47.457  45.324  21.619  1.00 65.18 ? 629  ARG A CB  1 
ATOM   4542  C  CG  . ARG A  1  601 ? 48.156  46.600  21.230  1.00 67.07 ? 629  ARG A CG  1 
ATOM   4543  C  CD  . ARG A  1  601 ? 49.088  47.002  22.343  1.00 69.01 ? 629  ARG A CD  1 
ATOM   4544  N  NE  . ARG A  1  601 ? 49.874  45.853  22.788  1.00 72.65 ? 629  ARG A NE  1 
ATOM   4545  C  CZ  . ARG A  1  601 ? 50.811  45.259  22.052  1.00 73.63 ? 629  ARG A CZ  1 
ATOM   4546  N  NH1 . ARG A  1  601 ? 51.084  45.713  20.830  1.00 73.24 ? 629  ARG A NH1 1 
ATOM   4547  N  NH2 . ARG A  1  601 ? 51.469  44.208  22.535  1.00 73.71 ? 629  ARG A NH2 1 
ATOM   4548  N  N   . TYR A  1  602 ? 45.610  43.400  19.198  1.00 64.26 ? 630  TYR A N   1 
ATOM   4549  C  CA  . TYR A  1  602 ? 45.761  42.681  17.937  1.00 64.65 ? 630  TYR A CA  1 
ATOM   4550  C  C   . TYR A  1  602 ? 44.437  42.491  17.215  1.00 64.30 ? 630  TYR A C   1 
ATOM   4551  O  O   . TYR A  1  602 ? 43.386  42.440  17.839  1.00 65.48 ? 630  TYR A O   1 
ATOM   4552  C  CB  . TYR A  1  602 ? 46.384  41.300  18.183  1.00 64.66 ? 630  TYR A CB  1 
ATOM   4553  C  CG  . TYR A  1  602 ? 47.774  41.346  18.775  1.00 64.46 ? 630  TYR A CG  1 
ATOM   4554  C  CD1 . TYR A  1  602 ? 48.136  40.486  19.807  1.00 65.46 ? 630  TYR A CD1 1 
ATOM   4555  C  CD2 . TYR A  1  602 ? 48.718  42.277  18.329  1.00 65.03 ? 630  TYR A CD2 1 
ATOM   4556  C  CE1 . TYR A  1  602 ? 49.405  40.556  20.395  1.00 66.50 ? 630  TYR A CE1 1 
ATOM   4557  C  CE2 . TYR A  1  602 ? 49.992  42.355  18.904  1.00 65.41 ? 630  TYR A CE2 1 
ATOM   4558  C  CZ  . TYR A  1  602 ? 50.330  41.496  19.939  1.00 66.37 ? 630  TYR A CZ  1 
ATOM   4559  O  OH  . TYR A  1  602 ? 51.575  41.591  20.532  1.00 65.11 ? 630  TYR A OH  1 
ATOM   4560  N  N   . GLN A  1  603 ? 44.492  42.399  15.895  1.00 63.46 ? 631  GLN A N   1 
ATOM   4561  C  CA  . GLN A  1  603 ? 43.296  42.165  15.113  1.00 62.31 ? 631  GLN A CA  1 
ATOM   4562  C  C   . GLN A  1  603 ? 43.350  40.681  14.950  1.00 60.88 ? 631  GLN A C   1 
ATOM   4563  O  O   . GLN A  1  603 ? 42.374  39.959  15.122  1.00 59.96 ? 631  GLN A O   1 
ATOM   4564  C  CB  . GLN A  1  603 ? 43.424  42.783  13.737  1.00 62.88 ? 631  GLN A CB  1 
ATOM   4565  C  CG  . GLN A  1  603 ? 43.653  44.257  13.733  1.00 64.09 ? 631  GLN A CG  1 
ATOM   4566  C  CD  . GLN A  1  603 ? 43.909  44.767  12.338  1.00 64.54 ? 631  GLN A CD  1 
ATOM   4567  O  OE1 . GLN A  1  603 ? 43.176  44.443  11.403  1.00 64.32 ? 631  GLN A OE1 1 
ATOM   4568  N  NE2 . GLN A  1  603 ? 44.952  45.572  12.186  1.00 65.32 ? 631  GLN A NE2 1 
ATOM   4569  N  N   . LEU A  1  604 ? 44.553  40.244  14.630  1.00 61.00 ? 632  LEU A N   1 
ATOM   4570  C  CA  . LEU A  1  604 ? 44.811  38.854  14.394  1.00 60.34 ? 632  LEU A CA  1 
ATOM   4571  C  C   . LEU A  1  604 ? 46.238  38.510  14.685  1.00 58.68 ? 632  LEU A C   1 
ATOM   4572  O  O   . LEU A  1  604 ? 47.128  39.333  14.557  1.00 58.76 ? 632  LEU A O   1 
ATOM   4573  C  CB  . LEU A  1  604 ? 44.523  38.530  12.938  1.00 61.49 ? 632  LEU A CB  1 
ATOM   4574  C  CG  . LEU A  1  604 ? 44.775  37.088  12.510  1.00 61.62 ? 632  LEU A CG  1 
ATOM   4575  C  CD1 . LEU A  1  604 ? 44.008  36.147  13.436  1.00 62.29 ? 632  LEU A CD1 1 
ATOM   4576  C  CD2 . LEU A  1  604 ? 44.338  36.903  11.063  1.00 60.47 ? 632  LEU A CD2 1 
ATOM   4577  N  N   . ALA A  1  605 ? 46.440  37.266  15.069  1.00 58.54 ? 633  ALA A N   1 
ATOM   4578  C  CA  . ALA A  1  605 ? 47.758  36.764  15.361  1.00 59.14 ? 633  ALA A CA  1 
ATOM   4579  C  C   . ALA A  1  605 ? 47.674  35.277  15.089  1.00 59.26 ? 633  ALA A C   1 
ATOM   4580  O  O   . ALA A  1  605 ? 46.588  34.693  15.120  1.00 58.35 ? 633  ALA A O   1 
ATOM   4581  C  CB  . ALA A  1  605 ? 48.103  37.021  16.806  1.00 59.29 ? 633  ALA A CB  1 
ATOM   4582  N  N   . VAL A  1  606 ? 48.808  34.659  14.802  1.00 58.46 ? 634  VAL A N   1 
ATOM   4583  C  CA  . VAL A  1  606 ? 48.787  33.240  14.542  1.00 58.53 ? 634  VAL A CA  1 
ATOM   4584  C  C   . VAL A  1  606 ? 49.944  32.588  15.215  1.00 58.77 ? 634  VAL A C   1 
ATOM   4585  O  O   . VAL A  1  606 ? 51.061  33.093  15.144  1.00 58.52 ? 634  VAL A O   1 
ATOM   4586  C  CB  . VAL A  1  606 ? 48.879  32.950  13.084  1.00 57.51 ? 634  VAL A CB  1 
ATOM   4587  C  CG1 . VAL A  1  606 ? 48.754  31.459  12.862  1.00 58.52 ? 634  VAL A CG1 1 
ATOM   4588  C  CG2 . VAL A  1  606 ? 47.801  33.696  12.370  1.00 56.86 ? 634  VAL A CG2 1 
ATOM   4589  N  N   . THR A  1  607 ? 49.678  31.455  15.852  1.00 58.72 ? 635  THR A N   1 
ATOM   4590  C  CA  . THR A  1  607 ? 50.723  30.753  16.567  1.00 60.08 ? 635  THR A CA  1 
ATOM   4591  C  C   . THR A  1  607 ? 50.699  29.237  16.444  1.00 60.56 ? 635  THR A C   1 
ATOM   4592  O  O   . THR A  1  607 ? 49.829  28.649  15.792  1.00 60.11 ? 635  THR A O   1 
ATOM   4593  C  CB  . THR A  1  607 ? 50.681  31.088  18.067  1.00 59.38 ? 635  THR A CB  1 
ATOM   4594  O  OG1 . THR A  1  607 ? 49.495  30.530  18.643  1.00 59.14 ? 635  THR A OG1 1 
ATOM   4595  C  CG2 . THR A  1  607 ? 50.691  32.592  18.286  1.00 58.54 ? 635  THR A CG2 1 
ATOM   4596  N  N   . GLN A  1  608 ? 51.689  28.627  17.089  1.00 60.15 ? 636  GLN A N   1 
ATOM   4597  C  CA  . GLN A  1  608 ? 51.847  27.185  17.131  1.00 61.25 ? 636  GLN A CA  1 
ATOM   4598  C  C   . GLN A  1  608 ? 50.944  26.630  18.210  1.00 61.36 ? 636  GLN A C   1 
ATOM   4599  O  O   . GLN A  1  608 ? 51.145  26.925  19.377  1.00 62.58 ? 636  GLN A O   1 
ATOM   4600  C  CB  . GLN A  1  608 ? 53.280  26.826  17.496  1.00 61.92 ? 636  GLN A CB  1 
ATOM   4601  C  CG  . GLN A  1  608 ? 54.291  27.061  16.410  1.00 62.34 ? 636  GLN A CG  1 
ATOM   4602  C  CD  . GLN A  1  608 ? 55.672  26.547  16.789  1.00 62.41 ? 636  GLN A CD  1 
ATOM   4603  O  OE1 . GLN A  1  608 ? 55.827  25.401  17.239  1.00 60.85 ? 636  GLN A OE1 1 
ATOM   4604  N  NE2 . GLN A  1  608 ? 56.686  27.390  16.600  1.00 61.75 ? 636  GLN A NE2 1 
ATOM   4605  N  N   . ARG A  1  609 ? 49.965  25.823  17.832  1.00 61.71 ? 637  ARG A N   1 
ATOM   4606  C  CA  . ARG A  1  609 ? 49.042  25.233  18.801  1.00 63.20 ? 637  ARG A CA  1 
ATOM   4607  C  C   . ARG A  1  609 ? 49.734  24.434  19.920  1.00 65.15 ? 637  ARG A C   1 
ATOM   4608  O  O   . ARG A  1  609 ? 49.841  23.204  19.852  1.00 65.67 ? 637  ARG A O   1 
ATOM   4609  C  CB  . ARG A  1  609 ? 48.038  24.332  18.064  1.00 65.73 ? 637  ARG A CB  1 
ATOM   4610  C  CG  . ARG A  1  609 ? 47.213  23.346  18.931  1.00 66.37 ? 637  ARG A CG  1 
ATOM   4611  C  CD  . ARG A  1  609 ? 46.112  24.040  19.727  1.00 68.98 ? 637  ARG A CD  1 
ATOM   4612  N  NE  . ARG A  1  609 ? 45.157  23.118  20.353  1.00 68.91 ? 637  ARG A NE  1 
ATOM   4613  C  CZ  . ARG A  1  609 ? 45.483  22.177  21.234  1.00 69.38 ? 637  ARG A CZ  1 
ATOM   4614  N  NH1 . ARG A  1  609 ? 44.535  21.399  21.747  1.00 69.39 ? 637  ARG A NH1 1 
ATOM   4615  N  NH2 . ARG A  1  609 ? 46.754  22.006  21.595  1.00 68.89 ? 637  ARG A NH2 1 
ATOM   4616  N  N   . LYS A  1  610 ? 50.205  25.135  20.950  1.00 66.37 ? 638  LYS A N   1 
ATOM   4617  C  CA  . LYS A  1  610 ? 50.854  24.491  22.094  1.00 65.08 ? 638  LYS A CA  1 
ATOM   4618  C  C   . LYS A  1  610 ? 49.778  24.218  23.156  1.00 65.69 ? 638  LYS A C   1 
ATOM   4619  O  O   . LYS A  1  610 ? 48.953  25.085  23.445  1.00 66.29 ? 638  LYS A O   1 
ATOM   4620  C  CB  . LYS A  1  610 ? 51.923  25.405  22.703  1.00 64.79 ? 638  LYS A CB  1 
ATOM   4621  C  CG  . LYS A  1  610 ? 53.098  25.755  21.815  1.00 64.12 ? 638  LYS A CG  1 
ATOM   4622  C  CD  . LYS A  1  610 ? 54.084  26.631  22.591  1.00 65.12 ? 638  LYS A CD  1 
ATOM   4623  C  CE  . LYS A  1  610 ? 55.211  27.132  21.710  1.00 65.39 ? 638  LYS A CE  1 
ATOM   4624  N  NZ  . LYS A  1  610 ? 54.661  27.872  20.542  1.00 67.12 ? 638  LYS A NZ  1 
ATOM   4625  N  N   . GLU A  1  611 ? 49.795  23.023  23.742  1.00 66.84 ? 639  GLU A N   1 
ATOM   4626  C  CA  . GLU A  1  611 ? 48.816  22.646  24.765  1.00 66.84 ? 639  GLU A CA  1 
ATOM   4627  C  C   . GLU A  1  611 ? 48.862  23.587  25.984  1.00 65.31 ? 639  GLU A C   1 
ATOM   4628  O  O   . GLU A  1  611 ? 47.861  23.752  26.683  1.00 65.40 ? 639  GLU A O   1 
ATOM   4629  C  CB  . GLU A  1  611 ? 49.072  21.191  25.205  1.00 66.33 ? 639  GLU A CB  1 
ATOM   4630  C  CG  . GLU A  1  611 ? 47.921  20.520  25.965  1.00 66.70 ? 639  GLU A CG  1 
ATOM   4631  C  CD  . GLU A  1  611 ? 46.844  19.956  25.051  1.00 66.77 ? 639  GLU A CD  1 
ATOM   4632  O  OE1 . GLU A  1  611 ? 47.141  19.023  24.273  1.00 66.18 ? 639  GLU A OE1 1 
ATOM   4633  O  OE2 . GLU A  1  611 ? 45.696  20.443  25.114  1.00 66.76 ? 639  GLU A OE2 1 
ATOM   4634  N  N   . GLU A  1  612 ? 50.021  24.211  26.209  1.00 66.07 ? 640  GLU A N   1 
ATOM   4635  C  CA  . GLU A  1  612 ? 50.256  25.123  27.343  1.00 67.03 ? 640  GLU A CA  1 
ATOM   4636  C  C   . GLU A  1  612 ? 49.825  26.547  27.074  1.00 67.08 ? 640  GLU A C   1 
ATOM   4637  O  O   . GLU A  1  612 ? 49.937  27.413  27.945  1.00 66.86 ? 640  GLU A O   1 
ATOM   4638  C  CB  . GLU A  1  612 ? 51.736  25.151  27.732  1.00 66.89 ? 640  GLU A CB  1 
ATOM   4639  C  CG  . GLU A  1  612 ? 52.428  23.821  27.581  1.00 69.84 ? 640  GLU A CG  1 
ATOM   4640  C  CD  . GLU A  1  612 ? 52.604  23.434  26.117  1.00 71.58 ? 640  GLU A CD  1 
ATOM   4641  O  OE1 . GLU A  1  612 ? 52.079  22.362  25.703  1.00 71.19 ? 640  GLU A OE1 1 
ATOM   4642  O  OE2 . GLU A  1  612 ? 53.267  24.217  25.387  1.00 72.20 ? 640  GLU A OE2 1 
ATOM   4643  N  N   . GLU A  1  613 ? 49.376  26.789  25.851  1.00 67.08 ? 641  GLU A N   1 
ATOM   4644  C  CA  . GLU A  1  613 ? 48.878  28.091  25.451  1.00 65.80 ? 641  GLU A CA  1 
ATOM   4645  C  C   . GLU A  1  613 ? 47.490  27.709  24.986  1.00 64.87 ? 641  GLU A C   1 
ATOM   4646  O  O   . GLU A  1  613 ? 47.208  27.679  23.793  1.00 66.11 ? 641  GLU A O   1 
ATOM   4647  C  CB  . GLU A  1  613 ? 49.709  28.671  24.298  1.00 66.35 ? 641  GLU A CB  1 
ATOM   4648  C  CG  . GLU A  1  613 ? 51.153  29.036  24.668  1.00 66.42 ? 641  GLU A CG  1 
ATOM   4649  C  CD  . GLU A  1  613 ? 51.892  29.764  23.547  1.00 67.88 ? 641  GLU A CD  1 
ATOM   4650  O  OE1 . GLU A  1  613 ? 51.546  29.550  22.359  1.00 68.56 ? 641  GLU A OE1 1 
ATOM   4651  O  OE2 . GLU A  1  613 ? 52.829  30.537  23.853  1.00 66.69 ? 641  GLU A OE2 1 
ATOM   4652  N  N   . PRO A  1  614 ? 46.612  27.365  25.932  1.00 63.54 ? 642  PRO A N   1 
ATOM   4653  C  CA  . PRO A  1  614 ? 45.248  26.965  25.630  1.00 65.05 ? 642  PRO A CA  1 
ATOM   4654  C  C   . PRO A  1  614 ? 44.299  28.145  25.744  1.00 65.07 ? 642  PRO A C   1 
ATOM   4655  O  O   . PRO A  1  614 ? 43.170  28.095  25.258  1.00 66.39 ? 642  PRO A O   1 
ATOM   4656  C  CB  . PRO A  1  614 ? 44.980  25.932  26.695  1.00 64.81 ? 642  PRO A CB  1 
ATOM   4657  C  CG  . PRO A  1  614 ? 45.543  26.626  27.877  1.00 64.03 ? 642  PRO A CG  1 
ATOM   4658  C  CD  . PRO A  1  614 ? 46.869  27.185  27.369  1.00 64.41 ? 642  PRO A CD  1 
ATOM   4659  N  N   . SER A  1  615 ? 44.748  29.211  26.386  1.00 63.37 ? 643  SER A N   1 
ATOM   4660  C  CA  . SER A  1  615 ? 43.872  30.351  26.539  1.00 63.09 ? 643  SER A CA  1 
ATOM   4661  C  C   . SER A  1  615 ? 44.610  31.671  26.526  1.00 63.18 ? 643  SER A C   1 
ATOM   4662  O  O   . SER A  1  615 ? 45.727  31.779  27.035  1.00 62.76 ? 643  SER A O   1 
ATOM   4663  C  CB  . SER A  1  615 ? 43.075  30.194  27.826  1.00 64.67 ? 643  SER A CB  1 
ATOM   4664  O  OG  . SER A  1  615 ? 42.597  28.860  27.944  1.00 65.06 ? 643  SER A OG  1 
ATOM   4665  N  N   . SER A  1  616 ? 43.961  32.673  25.942  1.00 62.31 ? 644  SER A N   1 
ATOM   4666  C  CA  . SER A  1  616 ? 44.523  34.015  25.811  1.00 62.61 ? 644  SER A CA  1 
ATOM   4667  C  C   . SER A  1  616 ? 44.333  34.910  27.039  1.00 62.83 ? 644  SER A C   1 
ATOM   4668  O  O   . SER A  1  616 ? 44.965  35.974  27.155  1.00 62.26 ? 644  SER A O   1 
ATOM   4669  C  CB  . SER A  1  616 ? 43.913  34.699  24.588  1.00 62.25 ? 644  SER A CB  1 
ATOM   4670  O  OG  . SER A  1  616 ? 42.503  34.553  24.582  1.00 61.64 ? 644  SER A OG  1 
ATOM   4671  N  N   . SER A  1  617 ? 43.464  34.476  27.949  1.00 62.38 ? 645  SER A N   1 
ATOM   4672  C  CA  . SER A  1  617 ? 43.175  35.229  29.163  1.00 61.38 ? 645  SER A CA  1 
ATOM   4673  C  C   . SER A  1  617 ? 42.754  34.249  30.264  1.00 60.29 ? 645  SER A C   1 
ATOM   4674  O  O   . SER A  1  617 ? 42.452  33.088  29.990  1.00 59.46 ? 645  SER A O   1 
ATOM   4675  C  CB  . SER A  1  617 ? 42.047  36.240  28.879  1.00 61.54 ? 645  SER A CB  1 
ATOM   4676  O  OG  . SER A  1  617 ? 42.209  37.467  29.585  1.00 60.93 ? 645  SER A OG  1 
ATOM   4677  N  N   . SER A  1  618 ? 42.751  34.717  31.508  1.00 61.21 ? 646  SER A N   1 
ATOM   4678  C  CA  . SER A  1  618 ? 42.349  33.883  32.633  1.00 61.64 ? 646  SER A CA  1 
ATOM   4679  C  C   . SER A  1  618 ? 41.267  34.571  33.459  1.00 60.61 ? 646  SER A C   1 
ATOM   4680  O  O   . SER A  1  618 ? 41.109  35.798  33.447  1.00 58.53 ? 646  SER A O   1 
ATOM   4681  C  CB  . SER A  1  618 ? 43.548  33.551  33.535  1.00 60.24 ? 646  SER A CB  1 
ATOM   4682  O  OG  . SER A  1  618 ? 43.197  32.601  34.527  1.00 57.02 ? 646  SER A OG  1 
ATOM   4683  N  N   . VAL A  1  619 ? 40.507  33.751  34.165  1.00 61.33 ? 647  VAL A N   1 
ATOM   4684  C  CA  . VAL A  1  619 ? 39.456  34.256  35.010  1.00 60.80 ? 647  VAL A CA  1 
ATOM   4685  C  C   . VAL A  1  619 ? 40.138  35.110  36.072  1.00 59.78 ? 647  VAL A C   1 
ATOM   4686  O  O   . VAL A  1  619 ? 39.567  36.075  36.579  1.00 59.44 ? 647  VAL A O   1 
ATOM   4687  C  CB  . VAL A  1  619 ? 38.684  33.086  35.653  1.00 58.74 ? 647  VAL A CB  1 
ATOM   4688  C  CG1 . VAL A  1  619 ? 39.642  31.986  36.044  1.00 58.48 ? 647  VAL A CG1 1 
ATOM   4689  C  CG2 . VAL A  1  619 ? 37.931  33.570  36.853  1.00 58.62 ? 647  VAL A CG2 1 
ATOM   4690  N  N   . PHE A  1  620 ? 41.389  34.776  36.363  1.00 59.16 ? 648  PHE A N   1 
ATOM   4691  C  CA  . PHE A  1  620 ? 42.140  35.487  37.387  1.00 60.31 ? 648  PHE A CA  1 
ATOM   4692  C  C   . PHE A  1  620 ? 42.748  36.795  36.955  1.00 60.29 ? 648  PHE A C   1 
ATOM   4693  O  O   . PHE A  1  620 ? 43.253  37.547  37.788  1.00 60.78 ? 648  PHE A O   1 
ATOM   4694  C  CB  . PHE A  1  620 ? 43.251  34.603  37.954  1.00 60.94 ? 648  PHE A CB  1 
ATOM   4695  C  CG  . PHE A  1  620 ? 42.763  33.282  38.459  1.00 60.29 ? 648  PHE A CG  1 
ATOM   4696  C  CD1 . PHE A  1  620 ? 42.649  32.198  37.593  1.00 60.48 ? 648  PHE A CD1 1 
ATOM   4697  C  CD2 . PHE A  1  620 ? 42.341  33.141  39.780  1.00 59.05 ? 648  PHE A CD2 1 
ATOM   4698  C  CE1 . PHE A  1  620 ? 42.116  30.990  38.034  1.00 60.74 ? 648  PHE A CE1 1 
ATOM   4699  C  CE2 . PHE A  1  620 ? 41.807  31.945  40.232  1.00 59.02 ? 648  PHE A CE2 1 
ATOM   4700  C  CZ  . PHE A  1  620 ? 41.691  30.863  39.358  1.00 59.99 ? 648  PHE A CZ  1 
ATOM   4701  N  N   . ASN A  1  621 ? 42.719  37.070  35.662  1.00 61.00 ? 649  ASN A N   1 
ATOM   4702  C  CA  . ASN A  1  621 ? 43.290  38.316  35.168  1.00 62.31 ? 649  ASN A CA  1 
ATOM   4703  C  C   . ASN A  1  621 ? 42.521  39.571  35.601  1.00 62.29 ? 649  ASN A C   1 
ATOM   4704  O  O   . ASN A  1  621 ? 43.137  40.590  35.928  1.00 62.50 ? 649  ASN A O   1 
ATOM   4705  C  CB  . ASN A  1  621 ? 43.393  38.273  33.643  1.00 61.93 ? 649  ASN A CB  1 
ATOM   4706  C  CG  . ASN A  1  621 ? 44.564  37.451  33.172  1.00 61.70 ? 649  ASN A CG  1 
ATOM   4707  O  OD1 . ASN A  1  621 ? 44.745  36.310  33.595  1.00 61.05 ? 649  ASN A OD1 1 
ATOM   4708  N  ND2 . ASN A  1  621 ? 45.372  38.028  32.289  1.00 61.99 ? 649  ASN A ND2 1 
ATOM   4709  N  N   . GLN A  1  622 ? 41.189  39.485  35.610  1.00 61.26 ? 650  GLN A N   1 
ATOM   4710  C  CA  . GLN A  1  622 ? 40.313  40.607  35.963  1.00 61.62 ? 650  GLN A CA  1 
ATOM   4711  C  C   . GLN A  1  622 ? 40.650  41.414  37.224  1.00 61.70 ? 650  GLN A C   1 
ATOM   4712  O  O   . GLN A  1  622 ? 40.605  42.656  37.210  1.00 59.60 ? 650  GLN A O   1 
ATOM   4713  C  CB  . GLN A  1  622 ? 38.869  40.108  36.074  1.00 61.79 ? 650  GLN A CB  1 
ATOM   4714  C  CG  . GLN A  1  622 ? 37.915  41.148  36.663  1.00 61.00 ? 650  GLN A CG  1 
ATOM   4715  C  CD  . GLN A  1  622 ? 37.223  41.992  35.622  1.00 59.88 ? 650  GLN A CD  1 
ATOM   4716  O  OE1 . GLN A  1  622 ? 36.251  41.556  35.005  1.00 60.05 ? 650  GLN A OE1 1 
ATOM   4717  N  NE2 . GLN A  1  622 ? 37.719  43.210  35.405  1.00 58.68 ? 650  GLN A NE2 1 
ATOM   4718  N  N   . ASN A  1  623 ? 40.944  40.707  38.314  1.00 62.53 ? 651  ASN A N   1 
ATOM   4719  C  CA  . ASN A  1  623 ? 41.269  41.346  39.589  1.00 62.67 ? 651  ASN A CA  1 
ATOM   4720  C  C   . ASN A  1  623 ? 42.759  41.685  39.744  1.00 63.24 ? 651  ASN A C   1 
ATOM   4721  O  O   . ASN A  1  623 ? 43.171  42.353  40.707  1.00 62.58 ? 651  ASN A O   1 
ATOM   4722  C  CB  . ASN A  1  623 ? 40.786  40.466  40.741  1.00 63.18 ? 651  ASN A CB  1 
ATOM   4723  C  CG  . ASN A  1  623 ? 39.277  40.352  40.778  1.00 62.93 ? 651  ASN A CG  1 
ATOM   4724  O  OD1 . ASN A  1  623 ? 38.579  41.214  40.261  1.00 62.86 ? 651  ASN A OD1 1 
ATOM   4725  N  ND2 . ASN A  1  623 ? 38.767  39.298  41.402  1.00 63.65 ? 651  ASN A ND2 1 
ATOM   4726  N  N   . ASP A  1  624 ? 43.557  41.215  38.788  1.00 63.90 ? 652  ASP A N   1 
ATOM   4727  C  CA  . ASP A  1  624 ? 44.984  41.502  38.754  1.00 64.30 ? 652  ASP A CA  1 
ATOM   4728  C  C   . ASP A  1  624 ? 45.420  41.677  37.294  1.00 63.74 ? 652  ASP A C   1 
ATOM   4729  O  O   . ASP A  1  624 ? 46.014  40.783  36.691  1.00 62.89 ? 652  ASP A O   1 
ATOM   4730  C  CB  . ASP A  1  624 ? 45.806  40.391  39.416  1.00 64.68 ? 652  ASP A CB  1 
ATOM   4731  C  CG  . ASP A  1  624 ? 47.192  40.879  39.863  1.00 65.39 ? 652  ASP A CG  1 
ATOM   4732  O  OD1 . ASP A  1  624 ? 47.603  41.979  39.425  1.00 65.38 ? 652  ASP A OD1 1 
ATOM   4733  O  OD2 . ASP A  1  624 ? 47.874  40.172  40.641  1.00 63.89 ? 652  ASP A OD2 1 
ATOM   4734  N  N   . PRO A  1  625 ? 45.095  42.838  36.701  1.00 64.00 ? 653  PRO A N   1 
ATOM   4735  C  CA  . PRO A  1  625 ? 45.440  43.165  35.317  1.00 63.70 ? 653  PRO A CA  1 
ATOM   4736  C  C   . PRO A  1  625 ? 46.904  43.613  35.307  1.00 64.17 ? 653  PRO A C   1 
ATOM   4737  O  O   . PRO A  1  625 ? 47.588  43.600  34.273  1.00 63.60 ? 653  PRO A O   1 
ATOM   4738  C  CB  . PRO A  1  625 ? 44.503  44.335  34.992  1.00 63.22 ? 653  PRO A CB  1 
ATOM   4739  C  CG  . PRO A  1  625 ? 43.463  44.315  36.093  1.00 62.22 ? 653  PRO A CG  1 
ATOM   4740  C  CD  . PRO A  1  625 ? 44.242  43.890  37.276  1.00 62.88 ? 653  PRO A CD  1 
ATOM   4741  N  N   . TRP A  1  626 ? 47.359  44.017  36.490  1.00 64.82 ? 654  TRP A N   1 
ATOM   4742  C  CA  . TRP A  1  626 ? 48.713  44.512  36.707  1.00 63.95 ? 654  TRP A CA  1 
ATOM   4743  C  C   . TRP A  1  626 ? 49.712  43.374  36.804  1.00 63.31 ? 654  TRP A C   1 
ATOM   4744  O  O   . TRP A  1  626 ? 50.916  43.584  36.713  1.00 63.25 ? 654  TRP A O   1 
ATOM   4745  C  CB  . TRP A  1  626 ? 48.736  45.361  37.978  1.00 63.57 ? 654  TRP A CB  1 
ATOM   4746  C  CG  . TRP A  1  626 ? 47.706  46.450  37.947  1.00 62.95 ? 654  TRP A CG  1 
ATOM   4747  C  CD1 . TRP A  1  626 ? 47.714  47.560  37.158  1.00 62.46 ? 654  TRP A CD1 1 
ATOM   4748  C  CD2 . TRP A  1  626 ? 46.484  46.500  38.698  1.00 63.60 ? 654  TRP A CD2 1 
ATOM   4749  N  NE1 . TRP A  1  626 ? 46.575  48.299  37.366  1.00 63.23 ? 654  TRP A NE1 1 
ATOM   4750  C  CE2 . TRP A  1  626 ? 45.802  47.670  38.307  1.00 63.19 ? 654  TRP A CE2 1 
ATOM   4751  C  CE3 . TRP A  1  626 ? 45.899  45.668  39.664  1.00 64.63 ? 654  TRP A CE3 1 
ATOM   4752  C  CZ2 . TRP A  1  626 ? 44.560  48.032  38.848  1.00 62.71 ? 654  TRP A CZ2 1 
ATOM   4753  C  CZ3 . TRP A  1  626 ? 44.660  46.031  40.202  1.00 64.58 ? 654  TRP A CZ3 1 
ATOM   4754  C  CH2 . TRP A  1  626 ? 44.009  47.203  39.790  1.00 62.72 ? 654  TRP A CH2 1 
ATOM   4755  N  N   . ALA A  1  627 ? 49.194  42.168  36.992  1.00 63.62 ? 655  ALA A N   1 
ATOM   4756  C  CA  . ALA A  1  627 ? 50.018  40.973  37.074  1.00 62.79 ? 655  ALA A CA  1 
ATOM   4757  C  C   . ALA A  1  627 ? 49.206  39.870  36.404  1.00 62.56 ? 655  ALA A C   1 
ATOM   4758  O  O   . ALA A  1  627 ? 48.671  38.985  37.058  1.00 63.01 ? 655  ALA A O   1 
ATOM   4759  C  CB  . ALA A  1  627 ? 50.300  40.634  38.519  1.00 63.02 ? 655  ALA A CB  1 
ATOM   4760  N  N   . PRO A  1  628 ? 49.088  39.929  35.076  1.00 62.82 ? 656  PRO A N   1 
ATOM   4761  C  CA  . PRO A  1  628 ? 48.338  38.949  34.292  1.00 63.29 ? 656  PRO A CA  1 
ATOM   4762  C  C   . PRO A  1  628 ? 48.646  37.507  34.630  1.00 62.95 ? 656  PRO A C   1 
ATOM   4763  O  O   . PRO A  1  628 ? 49.810  37.124  34.754  1.00 62.41 ? 656  PRO A O   1 
ATOM   4764  C  CB  . PRO A  1  628 ? 48.724  39.294  32.863  1.00 63.60 ? 656  PRO A CB  1 
ATOM   4765  C  CG  . PRO A  1  628 ? 48.848  40.775  32.926  1.00 64.14 ? 656  PRO A CG  1 
ATOM   4766  C  CD  . PRO A  1  628 ? 49.643  40.974  34.201  1.00 63.95 ? 656  PRO A CD  1 
ATOM   4767  N  N   . THR A  1  629 ? 47.584  36.720  34.773  1.00 61.94 ? 657  THR A N   1 
ATOM   4768  C  CA  . THR A  1  629 ? 47.691  35.302  35.079  1.00 61.95 ? 657  THR A CA  1 
ATOM   4769  C  C   . THR A  1  629 ? 48.022  34.545  33.787  1.00 62.86 ? 657  THR A C   1 
ATOM   4770  O  O   . THR A  1  629 ? 48.639  33.469  33.813  1.00 62.17 ? 657  THR A O   1 
ATOM   4771  C  CB  . THR A  1  629 ? 46.374  34.803  35.675  1.00 61.78 ? 657  THR A CB  1 
ATOM   4772  O  OG1 . THR A  1  629 ? 46.043  35.621  36.802  1.00 61.42 ? 657  THR A OG1 1 
ATOM   4773  C  CG2 . THR A  1  629 ? 46.488  33.357  36.117  1.00 61.32 ? 657  THR A CG2 1 
ATOM   4774  N  N   . VAL A  1  630 ? 47.608  35.135  32.662  1.00 63.19 ? 658  VAL A N   1 
ATOM   4775  C  CA  . VAL A  1  630 ? 47.851  34.603  31.318  1.00 63.20 ? 658  VAL A CA  1 
ATOM   4776  C  C   . VAL A  1  630 ? 48.146  35.772  30.358  1.00 63.90 ? 658  VAL A C   1 
ATOM   4777  O  O   . VAL A  1  630 ? 47.227  36.396  29.818  1.00 64.62 ? 658  VAL A O   1 
ATOM   4778  C  CB  . VAL A  1  630 ? 46.634  33.808  30.786  1.00 62.88 ? 658  VAL A CB  1 
ATOM   4779  C  CG1 . VAL A  1  630 ? 46.909  33.306  29.382  1.00 62.91 ? 658  VAL A CG1 1 
ATOM   4780  C  CG2 . VAL A  1  630 ? 46.342  32.636  31.693  1.00 63.70 ? 658  VAL A CG2 1 
ATOM   4781  N  N   . ASP A  1  631 ? 49.431  36.068  30.162  1.00 64.06 ? 659  ASP A N   1 
ATOM   4782  C  CA  . ASP A  1  631 ? 49.868  37.159  29.285  1.00 65.28 ? 659  ASP A CA  1 
ATOM   4783  C  C   . ASP A  1  631 ? 49.885  36.648  27.856  1.00 65.06 ? 659  ASP A C   1 
ATOM   4784  O  O   . ASP A  1  631 ? 50.620  35.722  27.523  1.00 64.63 ? 659  ASP A O   1 
ATOM   4785  C  CB  . ASP A  1  631 ? 51.268  37.651  29.700  1.00 65.70 ? 659  ASP A CB  1 
ATOM   4786  C  CG  . ASP A  1  631 ? 51.729  38.893  28.927  1.00 65.19 ? 659  ASP A CG  1 
ATOM   4787  O  OD1 . ASP A  1  631 ? 50.906  39.549  28.246  1.00 64.62 ? 659  ASP A OD1 1 
ATOM   4788  O  OD2 . ASP A  1  631 ? 52.935  39.218  29.025  1.00 65.14 ? 659  ASP A OD2 1 
ATOM   4789  N  N   . PHE A  1  632 ? 49.062  37.260  27.016  1.00 66.66 ? 660  PHE A N   1 
ATOM   4790  C  CA  . PHE A  1  632 ? 48.958  36.851  25.629  1.00 65.50 ? 660  PHE A CA  1 
ATOM   4791  C  C   . PHE A  1  632 ? 50.126  37.293  24.749  1.00 64.76 ? 660  PHE A C   1 
ATOM   4792  O  O   . PHE A  1  632 ? 50.437  36.631  23.770  1.00 65.58 ? 660  PHE A O   1 
ATOM   4793  C  CB  . PHE A  1  632 ? 47.635  37.347  25.043  1.00 66.53 ? 660  PHE A CB  1 
ATOM   4794  C  CG  . PHE A  1  632 ? 47.342  36.791  23.690  1.00 66.73 ? 660  PHE A CG  1 
ATOM   4795  C  CD1 . PHE A  1  632 ? 47.223  35.418  23.507  1.00 66.50 ? 660  PHE A CD1 1 
ATOM   4796  C  CD2 . PHE A  1  632 ? 47.249  37.631  22.582  1.00 66.67 ? 660  PHE A CD2 1 
ATOM   4797  C  CE1 . PHE A  1  632 ? 47.022  34.889  22.237  1.00 67.15 ? 660  PHE A CE1 1 
ATOM   4798  C  CE2 . PHE A  1  632 ? 47.049  37.114  21.308  1.00 65.65 ? 660  PHE A CE2 1 
ATOM   4799  C  CZ  . PHE A  1  632 ? 46.937  35.742  21.132  1.00 66.55 ? 660  PHE A CZ  1 
ATOM   4800  N  N   . SER A  1  633 ? 50.780  38.397  25.083  1.00 64.26 ? 661  SER A N   1 
ATOM   4801  C  CA  . SER A  1  633 ? 51.913  38.849  24.279  1.00 65.16 ? 661  SER A CA  1 
ATOM   4802  C  C   . SER A  1  633 ? 53.059  37.841  24.311  1.00 65.80 ? 661  SER A C   1 
ATOM   4803  O  O   . SER A  1  633 ? 53.972  37.888  23.481  1.00 66.31 ? 661  SER A O   1 
ATOM   4804  C  CB  . SER A  1  633 ? 52.427  40.189  24.786  1.00 65.07 ? 661  SER A CB  1 
ATOM   4805  O  OG  . SER A  1  633 ? 51.501  41.216  24.510  1.00 66.04 ? 661  SER A OG  1 
ATOM   4806  N  N   . ASP A  1  634 ? 53.005  36.941  25.285  1.00 66.09 ? 662  ASP A N   1 
ATOM   4807  C  CA  . ASP A  1  634 ? 54.022  35.913  25.461  1.00 65.43 ? 662  ASP A CA  1 
ATOM   4808  C  C   . ASP A  1  634 ? 53.811  34.755  24.478  1.00 65.55 ? 662  ASP A C   1 
ATOM   4809  O  O   . ASP A  1  634 ? 54.730  33.985  24.225  1.00 66.58 ? 662  ASP A O   1 
ATOM   4810  C  CB  . ASP A  1  634 ? 54.008  35.389  26.916  1.00 68.10 ? 662  ASP A CB  1 
ATOM   4811  C  CG  . ASP A  1  634 ? 54.446  36.452  27.956  1.00 68.96 ? 662  ASP A CG  1 
ATOM   4812  O  OD1 . ASP A  1  634 ? 54.466  36.132  29.176  1.00 67.54 ? 662  ASP A OD1 1 
ATOM   4813  O  OD2 . ASP A  1  634 ? 54.770  37.600  27.559  1.00 70.31 ? 662  ASP A OD2 1 
ATOM   4814  N  N   . PHE A  1  635 ? 52.605  34.633  23.928  1.00 65.57 ? 663  PHE A N   1 
ATOM   4815  C  CA  . PHE A  1  635 ? 52.287  33.577  22.958  1.00 65.31 ? 663  PHE A CA  1 
ATOM   4816  C  C   . PHE A  1  635 ? 52.949  33.882  21.629  1.00 65.49 ? 663  PHE A C   1 
ATOM   4817  O  O   . PHE A  1  635 ? 52.970  33.061  20.715  1.00 64.91 ? 663  PHE A O   1 
ATOM   4818  C  CB  . PHE A  1  635 ? 50.788  33.519  22.714  1.00 65.63 ? 663  PHE A CB  1 
ATOM   4819  C  CG  . PHE A  1  635 ? 50.015  32.904  23.826  1.00 66.96 ? 663  PHE A CG  1 
ATOM   4820  C  CD1 . PHE A  1  635 ? 50.482  32.956  25.134  1.00 66.80 ? 663  PHE A CD1 1 
ATOM   4821  C  CD2 . PHE A  1  635 ? 48.798  32.288  23.569  1.00 66.42 ? 663  PHE A CD2 1 
ATOM   4822  C  CE1 . PHE A  1  635 ? 49.747  32.401  26.168  1.00 67.25 ? 663  PHE A CE1 1 
ATOM   4823  C  CE2 . PHE A  1  635 ? 48.053  31.729  24.597  1.00 66.77 ? 663  PHE A CE2 1 
ATOM   4824  C  CZ  . PHE A  1  635 ? 48.526  31.784  25.900  1.00 67.02 ? 663  PHE A CZ  1 
ATOM   4825  N  N   . ILE A  1  636 ? 53.468  35.094  21.530  1.00 66.65 ? 664  ILE A N   1 
ATOM   4826  C  CA  . ILE A  1  636 ? 54.106  35.548  20.320  1.00 65.65 ? 664  ILE A CA  1 
ATOM   4827  C  C   . ILE A  1  636 ? 55.566  35.788  20.538  1.00 65.85 ? 664  ILE A C   1 
ATOM   4828  O  O   . ILE A  1  636 ? 55.995  36.866  20.947  1.00 66.75 ? 664  ILE A O   1 
ATOM   4829  C  CB  . ILE A  1  636 ? 53.499  36.833  19.841  1.00 66.62 ? 664  ILE A CB  1 
ATOM   4830  C  CG1 . ILE A  1  636 ? 51.979  36.719  19.897  1.00 66.76 ? 664  ILE A CG1 1 
ATOM   4831  C  CG2 . ILE A  1  636 ? 53.981  37.119  18.435  1.00 66.81 ? 664  ILE A CG2 1 
ATOM   4832  C  CD1 . ILE A  1  636 ? 51.250  38.017  19.654  1.00 66.96 ? 664  ILE A CD1 1 
ATOM   4833  N  N   . ASN A  1  637 ? 56.315  34.747  20.244  1.00 66.17 ? 665  ASN A N   1 
ATOM   4834  C  CA  . ASN A  1  637 ? 57.752  34.718  20.355  1.00 67.10 ? 665  ASN A CA  1 
ATOM   4835  C  C   . ASN A  1  637 ? 58.148  34.442  18.909  1.00 68.35 ? 665  ASN A C   1 
ATOM   4836  O  O   . ASN A  1  637 ? 57.291  34.129  18.082  1.00 69.25 ? 665  ASN A O   1 
ATOM   4837  C  CB  . ASN A  1  637 ? 58.115  33.560  21.260  1.00 66.54 ? 665  ASN A CB  1 
ATOM   4838  C  CG  . ASN A  1  637 ? 56.946  32.602  21.441  1.00 67.45 ? 665  ASN A CG  1 
ATOM   4839  O  OD1 . ASN A  1  637 ? 56.296  32.205  20.465  1.00 65.92 ? 665  ASN A OD1 1 
ATOM   4840  N  ND2 . ASN A  1  637 ? 56.667  32.231  22.689  1.00 67.48 ? 665  ASN A ND2 1 
ATOM   4841  N  N   . ASN A  1  638 ? 59.424  34.549  18.575  1.00 68.12 ? 666  ASN A N   1 
ATOM   4842  C  CA  . ASN A  1  638 ? 59.818  34.313  17.191  1.00 68.76 ? 666  ASN A CA  1 
ATOM   4843  C  C   . ASN A  1  638 ? 59.933  32.836  16.773  1.00 69.08 ? 666  ASN A C   1 
ATOM   4844  O  O   . ASN A  1  638 ? 61.032  32.346  16.493  1.00 69.79 ? 666  ASN A O   1 
ATOM   4845  C  CB  . ASN A  1  638 ? 61.132  35.049  16.915  1.00 70.11 ? 666  ASN A CB  1 
ATOM   4846  C  CG  . ASN A  1  638 ? 60.949  36.247  15.994  1.00 70.60 ? 666  ASN A CG  1 
ATOM   4847  O  OD1 . ASN A  1  638 ? 60.993  36.125  14.769  1.00 71.00 ? 666  ASN A OD1 1 
ATOM   4848  N  ND2 . ASN A  1  638 ? 60.733  37.408  16.584  1.00 70.15 ? 666  ASN A ND2 1 
ATOM   4849  N  N   . GLU A  1  639 ? 58.799  32.132  16.715  1.00 68.08 ? 667  GLU A N   1 
ATOM   4850  C  CA  . GLU A  1  639 ? 58.781  30.713  16.327  1.00 67.97 ? 667  GLU A CA  1 
ATOM   4851  C  C   . GLU A  1  639 ? 58.215  30.515  14.917  1.00 68.20 ? 667  GLU A C   1 
ATOM   4852  O  O   . GLU A  1  639 ? 57.259  31.186  14.527  1.00 68.92 ? 667  GLU A O   1 
ATOM   4853  C  CB  . GLU A  1  639 ? 57.940  29.896  17.311  1.00 67.33 ? 667  GLU A CB  1 
ATOM   4854  C  CG  . GLU A  1  639 ? 58.387  29.948  18.762  1.00 67.31 ? 667  GLU A CG  1 
ATOM   4855  C  CD  . GLU A  1  639 ? 57.518  29.088  19.656  1.00 67.04 ? 667  GLU A CD  1 
ATOM   4856  O  OE1 . GLU A  1  639 ? 57.697  29.119  20.888  1.00 66.97 ? 667  GLU A OE1 1 
ATOM   4857  O  OE2 . GLU A  1  639 ? 56.649  28.373  19.121  1.00 67.56 ? 667  GLU A OE2 1 
ATOM   4858  N  N   . THR A  1  640 ? 58.791  29.588  14.156  1.00 67.38 ? 668  THR A N   1 
ATOM   4859  C  CA  . THR A  1  640 ? 58.321  29.350  12.797  1.00 66.27 ? 668  THR A CA  1 
ATOM   4860  C  C   . THR A  1  640 ? 56.894  28.827  12.779  1.00 65.93 ? 668  THR A C   1 
ATOM   4861  O  O   . THR A  1  640 ? 56.548  27.890  13.499  1.00 65.35 ? 668  THR A O   1 
ATOM   4862  C  CB  . THR A  1  640 ? 59.206  28.334  12.044  1.00 67.59 ? 668  THR A CB  1 
ATOM   4863  O  OG1 . THR A  1  640 ? 58.846  28.316  10.652  1.00 66.44 ? 668  THR A OG1 1 
ATOM   4864  C  CG2 . THR A  1  640 ? 59.031  26.933  12.641  1.00 67.25 ? 668  THR A CG2 1 
ATOM   4865  N  N   . ILE A  1  641 ? 56.075  29.451  11.943  1.00 65.21 ? 669  ILE A N   1 
ATOM   4866  C  CA  . ILE A  1  641 ? 54.680  29.077  11.779  1.00 63.70 ? 669  ILE A CA  1 
ATOM   4867  C  C   . ILE A  1  641 ? 54.548  28.432  10.397  1.00 63.33 ? 669  ILE A C   1 
ATOM   4868  O  O   . ILE A  1  641 ? 53.584  28.661  9.663   1.00 62.93 ? 669  ILE A O   1 
ATOM   4869  C  CB  . ILE A  1  641 ? 53.772  30.331  11.905  1.00 62.69 ? 669  ILE A CB  1 
ATOM   4870  C  CG1 . ILE A  1  641 ? 54.168  31.394  10.878  1.00 62.24 ? 669  ILE A CG1 1 
ATOM   4871  C  CG2 . ILE A  1  641 ? 53.920  30.927  13.295  1.00 62.27 ? 669  ILE A CG2 1 
ATOM   4872  C  CD1 . ILE A  1  641 ? 53.330  32.657  10.943  1.00 60.38 ? 669  ILE A CD1 1 
ATOM   4873  N  N   . ALA A  1  642 ? 55.537  27.604  10.064  1.00 63.21 ? 670  ALA A N   1 
ATOM   4874  C  CA  . ALA A  1  642 ? 55.590  26.934  8.770   1.00 61.83 ? 670  ALA A CA  1 
ATOM   4875  C  C   . ALA A  1  642 ? 55.561  25.415  8.841   1.00 60.54 ? 670  ALA A C   1 
ATOM   4876  O  O   . ALA A  1  642 ? 56.556  24.784  9.197   1.00 60.85 ? 670  ALA A O   1 
ATOM   4877  C  CB  . ALA A  1  642 ? 56.840  27.385  8.022   1.00 62.45 ? 670  ALA A CB  1 
ATOM   4878  N  N   . GLY A  1  643 ? 54.418  24.836  8.482   1.00 60.21 ? 671  GLY A N   1 
ATOM   4879  C  CA  . GLY A  1  643 ? 54.278  23.391  8.486   1.00 60.58 ? 671  GLY A CA  1 
ATOM   4880  C  C   . GLY A  1  643 ? 54.021  22.835  9.861   1.00 60.64 ? 671  GLY A C   1 
ATOM   4881  O  O   . GLY A  1  643 ? 54.350  21.684  10.142  1.00 60.09 ? 671  GLY A O   1 
ATOM   4882  N  N   . LYS A  1  644 ? 53.413  23.660  10.711  1.00 61.87 ? 672  LYS A N   1 
ATOM   4883  C  CA  . LYS A  1  644 ? 53.111  23.283  12.090  1.00 60.43 ? 672  LYS A CA  1 
ATOM   4884  C  C   . LYS A  1  644 ? 51.608  23.251  12.330  1.00 59.70 ? 672  LYS A C   1 
ATOM   4885  O  O   . LYS A  1  644 ? 50.817  23.517  11.424  1.00 59.60 ? 672  LYS A O   1 
ATOM   4886  C  CB  . LYS A  1  644 ? 53.737  24.300  13.050  1.00 59.67 ? 672  LYS A CB  1 
ATOM   4887  C  CG  . LYS A  1  644 ? 55.148  24.770  12.665  1.00 61.00 ? 672  LYS A CG  1 
ATOM   4888  C  CD  . LYS A  1  644 ? 56.184  23.635  12.672  1.00 61.73 ? 672  LYS A CD  1 
ATOM   4889  C  CE  . LYS A  1  644 ? 56.520  23.138  14.086  1.00 62.04 ? 672  LYS A CE  1 
ATOM   4890  N  NZ  . LYS A  1  644 ? 57.497  21.997  14.090  1.00 61.05 ? 672  LYS A NZ  1 
ATOM   4891  N  N   . ASP A  1  645 ? 51.222  22.898  13.551  1.00 59.91 ? 673  ASP A N   1 
ATOM   4892  C  CA  . ASP A  1  645 ? 49.816  22.900  13.918  1.00 58.99 ? 673  ASP A CA  1 
ATOM   4893  C  C   . ASP A  1  645 ? 49.594  24.332  14.373  1.00 58.00 ? 673  ASP A C   1 
ATOM   4894  O  O   . ASP A  1  645 ? 50.152  24.769  15.380  1.00 57.75 ? 673  ASP A O   1 
ATOM   4895  C  CB  . ASP A  1  645 ? 49.537  21.929  15.064  1.00 59.42 ? 673  ASP A CB  1 
ATOM   4896  C  CG  . ASP A  1  645 ? 48.104  22.023  15.566  1.00 59.77 ? 673  ASP A CG  1 
ATOM   4897  O  OD1 . ASP A  1  645 ? 47.227  22.487  14.805  1.00 59.84 ? 673  ASP A OD1 1 
ATOM   4898  O  OD2 . ASP A  1  645 ? 47.850  21.625  16.721  1.00 60.30 ? 673  ASP A OD2 1 
ATOM   4899  N  N   . LEU A  1  646 ? 48.791  25.074  13.626  1.00 57.75 ? 674  LEU A N   1 
ATOM   4900  C  CA  . LEU A  1  646 ? 48.589  26.461  13.975  1.00 57.48 ? 674  LEU A CA  1 
ATOM   4901  C  C   . LEU A  1  646 ? 47.220  26.808  14.516  1.00 57.03 ? 674  LEU A C   1 
ATOM   4902  O  O   . LEU A  1  646 ? 46.258  26.044  14.437  1.00 56.55 ? 674  LEU A O   1 
ATOM   4903  C  CB  . LEU A  1  646 ? 48.922  27.338  12.769  1.00 57.57 ? 674  LEU A CB  1 
ATOM   4904  C  CG  . LEU A  1  646 ? 50.260  26.997  12.091  1.00 58.14 ? 674  LEU A CG  1 
ATOM   4905  C  CD1 . LEU A  1  646 ? 50.471  27.872  10.877  1.00 57.94 ? 674  LEU A CD1 1 
ATOM   4906  C  CD2 . LEU A  1  646 ? 51.402  27.179  13.070  1.00 57.97 ? 674  LEU A CD2 1 
ATOM   4907  N  N   . VAL A  1  647 ? 47.153  27.995  15.077  1.00 56.00 ? 675  VAL A N   1 
ATOM   4908  C  CA  . VAL A  1  647 ? 45.933  28.471  15.654  1.00 55.47 ? 675  VAL A CA  1 
ATOM   4909  C  C   . VAL A  1  647 ? 45.958  29.979  15.534  1.00 55.47 ? 675  VAL A C   1 
ATOM   4910  O  O   . VAL A  1  647 ? 46.943  30.638  15.875  1.00 54.63 ? 675  VAL A O   1 
ATOM   4911  C  CB  . VAL A  1  647 ? 45.848  28.040  17.123  1.00 56.08 ? 675  VAL A CB  1 
ATOM   4912  C  CG1 . VAL A  1  647 ? 47.229  28.062  17.738  1.00 55.61 ? 675  VAL A CG1 1 
ATOM   4913  C  CG2 . VAL A  1  647 ? 44.919  28.964  17.888  1.00 56.62 ? 675  VAL A CG2 1 
ATOM   4914  N  N   . ALA A  1  648 ? 44.864  30.517  15.023  1.00 54.48 ? 676  ALA A N   1 
ATOM   4915  C  CA  . ALA A  1  648 ? 44.735  31.944  14.833  1.00 53.00 ? 676  ALA A CA  1 
ATOM   4916  C  C   . ALA A  1  648 ? 43.934  32.577  15.941  1.00 53.10 ? 676  ALA A C   1 
ATOM   4917  O  O   . ALA A  1  648 ? 42.967  32.001  16.453  1.00 51.76 ? 676  ALA A O   1 
ATOM   4918  C  CB  . ALA A  1  648 ? 44.074  32.224  13.523  1.00 53.37 ? 676  ALA A CB  1 
ATOM   4919  N  N   . TRP A  1  649 ? 44.337  33.789  16.289  1.00 53.11 ? 677  TRP A N   1 
ATOM   4920  C  CA  . TRP A  1  649 ? 43.668  34.527  17.340  1.00 52.50 ? 677  TRP A CA  1 
ATOM   4921  C  C   . TRP A  1  649 ? 43.063  35.794  16.779  1.00 51.40 ? 677  TRP A C   1 
ATOM   4922  O  O   . TRP A  1  649 ? 43.767  36.766  16.492  1.00 50.82 ? 677  TRP A O   1 
ATOM   4923  C  CB  . TRP A  1  649 ? 44.663  34.840  18.443  1.00 51.57 ? 677  TRP A CB  1 
ATOM   4924  C  CG  . TRP A  1  649 ? 45.376  33.605  18.904  1.00 51.76 ? 677  TRP A CG  1 
ATOM   4925  C  CD1 . TRP A  1  649 ? 46.422  32.983  18.284  1.00 52.83 ? 677  TRP A CD1 1 
ATOM   4926  C  CD2 . TRP A  1  649 ? 45.084  32.829  20.072  1.00 51.51 ? 677  TRP A CD2 1 
ATOM   4927  N  NE1 . TRP A  1  649 ? 46.804  31.869  18.996  1.00 52.70 ? 677  TRP A NE1 1 
ATOM   4928  C  CE2 . TRP A  1  649 ? 45.999  31.752  20.099  1.00 52.40 ? 677  TRP A CE2 1 
ATOM   4929  C  CE3 . TRP A  1  649 ? 44.136  32.937  21.100  1.00 51.74 ? 677  TRP A CE3 1 
ATOM   4930  C  CZ2 . TRP A  1  649 ? 45.997  30.793  21.113  1.00 52.82 ? 677  TRP A CZ2 1 
ATOM   4931  C  CZ3 . TRP A  1  649 ? 44.132  31.987  22.106  1.00 51.88 ? 677  TRP A CZ3 1 
ATOM   4932  C  CH2 . TRP A  1  649 ? 45.059  30.926  22.107  1.00 52.93 ? 677  TRP A CH2 1 
ATOM   4933  N  N   . VAL A  1  650 ? 41.746  35.768  16.623  1.00 50.16 ? 678  VAL A N   1 
ATOM   4934  C  CA  . VAL A  1  650 ? 41.051  36.906  16.069  1.00 49.85 ? 678  VAL A CA  1 
ATOM   4935  C  C   . VAL A  1  650 ? 40.455  37.799  17.108  1.00 48.68 ? 678  VAL A C   1 
ATOM   4936  O  O   . VAL A  1  650 ? 39.939  37.350  18.122  1.00 48.41 ? 678  VAL A O   1 
ATOM   4937  C  CB  . VAL A  1  650 ? 39.919  36.480  15.136  1.00 50.13 ? 678  VAL A CB  1 
ATOM   4938  C  CG1 . VAL A  1  650 ? 39.366  37.702  14.405  1.00 50.58 ? 678  VAL A CG1 1 
ATOM   4939  C  CG2 . VAL A  1  650 ? 40.425  35.441  14.149  1.00 50.38 ? 678  VAL A CG2 1 
ATOM   4940  N  N   . THR A  1  651 ? 40.532  39.086  16.828  1.00 49.60 ? 679  THR A N   1 
ATOM   4941  C  CA  . THR A  1  651 ? 39.983  40.089  17.706  1.00 50.47 ? 679  THR A CA  1 
ATOM   4942  C  C   . THR A  1  651 ? 39.046  40.978  16.902  1.00 50.22 ? 679  THR A C   1 
ATOM   4943  O  O   . THR A  1  651 ? 39.411  41.536  15.855  1.00 50.34 ? 679  THR A O   1 
ATOM   4944  C  CB  . THR A  1  651 ? 41.092  40.946  18.331  1.00 50.32 ? 679  THR A CB  1 
ATOM   4945  O  OG1 . THR A  1  651 ? 41.879  40.131  19.204  1.00 49.78 ? 679  THR A OG1 1 
ATOM   4946  C  CG2 . THR A  1  651 ? 40.503  42.120  19.109  1.00 49.58 ? 679  THR A CG2 1 
ATOM   4947  N  N   . ALA A  1  652 ? 37.820  41.082  17.389  1.00 48.96 ? 680  ALA A N   1 
ATOM   4948  C  CA  . ALA A  1  652 ? 36.814  41.915  16.751  1.00 49.26 ? 680  ALA A CA  1 
ATOM   4949  C  C   . ALA A  1  652 ? 36.141  42.752  17.840  1.00 48.44 ? 680  ALA A C   1 
ATOM   4950  O  O   . ALA A  1  652 ? 35.865  42.261  18.936  1.00 49.08 ? 680  ALA A O   1 
ATOM   4951  C  CB  . ALA A  1  652 ? 35.798  41.045  16.034  1.00 49.03 ? 680  ALA A CB  1 
ATOM   4952  N  N   . GLY A  1  653 ? 35.893  44.022  17.543  1.00 47.70 ? 681  GLY A N   1 
ATOM   4953  C  CA  . GLY A  1  653 ? 35.271  44.898  18.521  1.00 46.78 ? 681  GLY A CA  1 
ATOM   4954  C  C   . GLY A  1  653 ? 35.023  46.258  17.913  1.00 46.33 ? 681  GLY A C   1 
ATOM   4955  O  O   . GLY A  1  653 ? 35.236  46.436  16.708  1.00 45.80 ? 681  GLY A O   1 
ATOM   4956  N  N   . PHE A  1  654 ? 34.591  47.218  18.733  1.00 47.16 ? 682  PHE A N   1 
ATOM   4957  C  CA  . PHE A  1  654 ? 34.291  48.564  18.236  1.00 46.39 ? 682  PHE A CA  1 
ATOM   4958  C  C   . PHE A  1  654 ? 34.126  49.570  19.354  1.00 43.24 ? 682  PHE A C   1 
ATOM   4959  O  O   . PHE A  1  654 ? 34.146  49.215  20.527  1.00 42.63 ? 682  PHE A O   1 
ATOM   4960  C  CB  . PHE A  1  654 ? 33.010  48.528  17.383  1.00 44.74 ? 682  PHE A CB  1 
ATOM   4961  C  CG  . PHE A  1  654 ? 31.858  47.820  18.048  1.00 44.67 ? 682  PHE A CG  1 
ATOM   4962  C  CD1 . PHE A  1  654 ? 30.876  48.541  18.724  1.00 46.54 ? 682  PHE A CD1 1 
ATOM   4963  C  CD2 . PHE A  1  654 ? 31.773  46.428  18.030  1.00 44.38 ? 682  PHE A CD2 1 
ATOM   4964  C  CE1 . PHE A  1  654 ? 29.819  47.884  19.376  1.00 46.38 ? 682  PHE A CE1 1 
ATOM   4965  C  CE2 . PHE A  1  654 ? 30.729  45.761  18.675  1.00 45.04 ? 682  PHE A CE2 1 
ATOM   4966  C  CZ  . PHE A  1  654 ? 29.747  46.490  19.351  1.00 45.58 ? 682  PHE A CZ  1 
ATOM   4967  N  N   . LEU A  1  655 ? 33.978  50.832  18.973  1.00 44.62 ? 683  LEU A N   1 
ATOM   4968  C  CA  . LEU A  1  655 ? 33.778  51.909  19.938  1.00 44.68 ? 683  LEU A CA  1 
ATOM   4969  C  C   . LEU A  1  655 ? 32.283  52.133  20.084  1.00 43.12 ? 683  LEU A C   1 
ATOM   4970  O  O   . LEU A  1  655 ? 31.570  52.137  19.089  1.00 43.74 ? 683  LEU A O   1 
ATOM   4971  C  CB  . LEU A  1  655 ? 34.406  53.205  19.433  1.00 44.01 ? 683  LEU A CB  1 
ATOM   4972  C  CG  . LEU A  1  655 ? 34.081  54.436  20.278  1.00 42.76 ? 683  LEU A CG  1 
ATOM   4973  C  CD1 . LEU A  1  655 ? 35.007  54.448  21.475  1.00 42.29 ? 683  LEU A CD1 1 
ATOM   4974  C  CD2 . LEU A  1  655 ? 34.254  55.708  19.461  1.00 42.46 ? 683  LEU A CD2 1 
ATOM   4975  N  N   . HIS A  1  656 ? 31.803  52.312  21.308  1.00 41.99 ? 684  HIS A N   1 
ATOM   4976  C  CA  . HIS A  1  656 ? 30.378  52.565  21.513  1.00 44.54 ? 684  HIS A CA  1 
ATOM   4977  C  C   . HIS A  1  656 ? 30.191  53.884  22.260  1.00 44.44 ? 684  HIS A C   1 
ATOM   4978  O  O   . HIS A  1  656 ? 30.597  54.027  23.428  1.00 43.01 ? 684  HIS A O   1 
ATOM   4979  C  CB  . HIS A  1  656 ? 29.694  51.418  22.304  1.00 46.07 ? 684  HIS A CB  1 
ATOM   4980  C  CG  . HIS A  1  656 ? 28.215  51.619  22.546  1.00 46.43 ? 684  HIS A CG  1 
ATOM   4981  N  ND1 . HIS A  1  656 ? 27.471  50.786  23.359  1.00 45.65 ? 684  HIS A ND1 1 
ATOM   4982  C  CD2 . HIS A  1  656 ? 27.343  52.544  22.071  1.00 45.68 ? 684  HIS A CD2 1 
ATOM   4983  C  CE1 . HIS A  1  656 ? 26.212  51.187  23.375  1.00 44.50 ? 684  HIS A CE1 1 
ATOM   4984  N  NE2 . HIS A  1  656 ? 26.107  52.253  22.602  1.00 44.88 ? 684  HIS A NE2 1 
ATOM   4985  N  N   . ILE A  1  657 ? 29.588  54.848  21.568  1.00 43.80 ? 685  ILE A N   1 
ATOM   4986  C  CA  . ILE A  1  657 ? 29.299  56.152  22.155  1.00 44.01 ? 685  ILE A CA  1 
ATOM   4987  C  C   . ILE A  1  657 ? 27.784  56.185  22.337  1.00 43.68 ? 685  ILE A C   1 
ATOM   4988  O  O   . ILE A  1  657 ? 27.042  56.553  21.425  1.00 45.11 ? 685  ILE A O   1 
ATOM   4989  C  CB  . ILE A  1  657 ? 29.734  57.305  21.226  1.00 43.88 ? 685  ILE A CB  1 
ATOM   4990  C  CG1 . ILE A  1  657 ? 31.164  57.063  20.726  1.00 43.96 ? 685  ILE A CG1 1 
ATOM   4991  C  CG2 . ILE A  1  657 ? 29.642  58.625  21.978  1.00 43.31 ? 685  ILE A CG2 1 
ATOM   4992  C  CD1 . ILE A  1  657 ? 31.727  58.184  19.881  1.00 43.42 ? 685  ILE A CD1 1 
ATOM   4993  N  N   . PRO A  1  658 ? 27.306  55.796  23.524  1.00 43.32 ? 686  PRO A N   1 
ATOM   4994  C  CA  . PRO A  1  658 ? 25.870  55.771  23.816  1.00 44.21 ? 686  PRO A CA  1 
ATOM   4995  C  C   . PRO A  1  658 ? 25.041  56.957  23.301  1.00 43.75 ? 686  PRO A C   1 
ATOM   4996  O  O   . PRO A  1  658 ? 25.420  58.121  23.422  1.00 43.93 ? 686  PRO A O   1 
ATOM   4997  C  CB  . PRO A  1  658 ? 25.839  55.640  25.338  1.00 44.05 ? 686  PRO A CB  1 
ATOM   4998  C  CG  . PRO A  1  658 ? 27.075  54.842  25.623  1.00 43.57 ? 686  PRO A CG  1 
ATOM   4999  C  CD  . PRO A  1  658 ? 28.092  55.512  24.737  1.00 42.92 ? 686  PRO A CD  1 
ATOM   5000  N  N   . HIS A  1  659 ? 23.900  56.634  22.714  1.00 44.70 ? 687  HIS A N   1 
ATOM   5001  C  CA  . HIS A  1  659 ? 22.997  57.639  22.191  1.00 45.02 ? 687  HIS A CA  1 
ATOM   5002  C  C   . HIS A  1  659 ? 21.565  57.213  22.516  1.00 45.29 ? 687  HIS A C   1 
ATOM   5003  O  O   . HIS A  1  659 ? 21.305  56.054  22.867  1.00 42.89 ? 687  HIS A O   1 
ATOM   5004  C  CB  . HIS A  1  659 ? 23.210  57.809  20.685  1.00 45.48 ? 687  HIS A CB  1 
ATOM   5005  C  CG  . HIS A  1  659 ? 23.397  56.517  19.949  1.00 47.22 ? 687  HIS A CG  1 
ATOM   5006  N  ND1 . HIS A  1  659 ? 22.360  55.852  19.330  1.00 47.67 ? 687  HIS A ND1 1 
ATOM   5007  C  CD2 . HIS A  1  659 ? 24.504  55.766  19.737  1.00 47.61 ? 687  HIS A CD2 1 
ATOM   5008  C  CE1 . HIS A  1  659 ? 22.820  54.750  18.766  1.00 47.41 ? 687  HIS A CE1 1 
ATOM   5009  N  NE2 . HIS A  1  659 ? 24.118  54.676  18.999  1.00 47.88 ? 687  HIS A NE2 1 
ATOM   5010  N  N   . ALA A  1  660 ? 20.647  58.167  22.410  1.00 45.92 ? 688  ALA A N   1 
ATOM   5011  C  CA  . ALA A  1  660 ? 19.242  57.951  22.726  1.00 45.27 ? 688  ALA A CA  1 
ATOM   5012  C  C   . ALA A  1  660 ? 18.660  56.632  22.249  1.00 45.60 ? 688  ALA A C   1 
ATOM   5013  O  O   . ALA A  1  660 ? 17.866  56.008  22.943  1.00 46.03 ? 688  ALA A O   1 
ATOM   5014  C  CB  . ALA A  1  660 ? 18.418  59.098  22.177  1.00 45.41 ? 688  ALA A CB  1 
ATOM   5015  N  N   . GLU A  1  661 ? 19.051  56.204  21.062  1.00 46.37 ? 689  GLU A N   1 
ATOM   5016  C  CA  . GLU A  1  661 ? 18.519  54.972  20.513  1.00 46.57 ? 689  GLU A CA  1 
ATOM   5017  C  C   . GLU A  1  661 ? 18.960  53.701  21.255  1.00 46.91 ? 689  GLU A C   1 
ATOM   5018  O  O   . GLU A  1  661 ? 18.524  52.590  20.934  1.00 46.62 ? 689  GLU A O   1 
ATOM   5019  C  CB  . GLU A  1  661 ? 18.859  54.907  19.025  1.00 46.79 ? 689  GLU A CB  1 
ATOM   5020  C  CG  . GLU A  1  661 ? 18.182  56.019  18.209  1.00 48.12 ? 689  GLU A CG  1 
ATOM   5021  C  CD  . GLU A  1  661 ? 19.039  57.278  18.022  1.00 47.83 ? 689  GLU A CD  1 
ATOM   5022  O  OE1 . GLU A  1  661 ? 20.011  57.491  18.783  1.00 48.04 ? 689  GLU A OE1 1 
ATOM   5023  O  OE2 . GLU A  1  661 ? 18.720  58.066  17.104  1.00 47.44 ? 689  GLU A OE2 1 
ATOM   5024  N  N   . ASP A  1  662 ? 19.816  53.864  22.258  1.00 46.46 ? 690  ASP A N   1 
ATOM   5025  C  CA  . ASP A  1  662 ? 20.257  52.720  23.046  1.00 46.67 ? 690  ASP A CA  1 
ATOM   5026  C  C   . ASP A  1  662 ? 19.276  52.520  24.212  1.00 47.96 ? 690  ASP A C   1 
ATOM   5027  O  O   . ASP A  1  662 ? 19.494  51.672  25.081  1.00 47.51 ? 690  ASP A O   1 
ATOM   5028  C  CB  . ASP A  1  662 ? 21.670  52.940  23.598  1.00 44.93 ? 690  ASP A CB  1 
ATOM   5029  C  CG  . ASP A  1  662 ? 22.743  52.904  22.521  1.00 47.42 ? 690  ASP A CG  1 
ATOM   5030  O  OD1 . ASP A  1  662 ? 22.721  51.972  21.675  1.00 47.45 ? 690  ASP A OD1 1 
ATOM   5031  O  OD2 . ASP A  1  662 ? 23.620  53.802  22.536  1.00 45.52 ? 690  ASP A OD2 1 
ATOM   5032  N  N   . ILE A  1  663 ? 18.198  53.305  24.220  1.00 48.15 ? 691  ILE A N   1 
ATOM   5033  C  CA  . ILE A  1  663 ? 17.179  53.239  25.271  1.00 47.86 ? 691  ILE A CA  1 
ATOM   5034  C  C   . ILE A  1  663 ? 15.835  52.787  24.700  1.00 48.94 ? 691  ILE A C   1 
ATOM   5035  O  O   . ILE A  1  663 ? 15.303  53.410  23.777  1.00 48.06 ? 691  ILE A O   1 
ATOM   5036  C  CB  . ILE A  1  663 ? 16.978  54.612  25.923  1.00 47.14 ? 691  ILE A CB  1 
ATOM   5037  C  CG1 . ILE A  1  663 ? 18.325  55.205  26.329  1.00 47.46 ? 691  ILE A CG1 1 
ATOM   5038  C  CG2 . ILE A  1  663 ? 16.100  54.480  27.140  1.00 48.77 ? 691  ILE A CG2 1 
ATOM   5039  C  CD1 . ILE A  1  663 ? 19.055  54.414  27.381  1.00 47.57 ? 691  ILE A CD1 1 
ATOM   5040  N  N   . PRO A  1  664 ? 15.231  51.739  25.287  1.00 49.39 ? 692  PRO A N   1 
ATOM   5041  C  CA  . PRO A  1  664 ? 15.643  50.949  26.457  1.00 49.56 ? 692  PRO A CA  1 
ATOM   5042  C  C   . PRO A  1  664 ? 16.869  50.057  26.301  1.00 51.10 ? 692  PRO A C   1 
ATOM   5043  O  O   . PRO A  1  664 ? 17.651  49.908  27.242  1.00 50.75 ? 692  PRO A O   1 
ATOM   5044  C  CB  . PRO A  1  664 ? 14.402  50.124  26.752  1.00 50.09 ? 692  PRO A CB  1 
ATOM   5045  C  CG  . PRO A  1  664 ? 13.924  49.809  25.374  1.00 49.49 ? 692  PRO A CG  1 
ATOM   5046  C  CD  . PRO A  1  664 ? 14.023  51.155  24.677  1.00 48.76 ? 692  PRO A CD  1 
ATOM   5047  N  N   . ASN A  1  665 ? 17.018  49.442  25.129  1.00 52.20 ? 693  ASN A N   1 
ATOM   5048  C  CA  . ASN A  1  665 ? 18.147  48.549  24.875  1.00 51.70 ? 693  ASN A CA  1 
ATOM   5049  C  C   . ASN A  1  665 ? 18.960  48.983  23.674  1.00 53.11 ? 693  ASN A C   1 
ATOM   5050  O  O   . ASN A  1  665 ? 18.506  49.811  22.871  1.00 53.98 ? 693  ASN A O   1 
ATOM   5051  C  CB  . ASN A  1  665 ? 17.661  47.115  24.614  1.00 51.12 ? 693  ASN A CB  1 
ATOM   5052  C  CG  . ASN A  1  665 ? 17.471  46.314  25.884  1.00 52.77 ? 693  ASN A CG  1 
ATOM   5053  O  OD1 . ASN A  1  665 ? 17.251  45.102  25.839  1.00 53.09 ? 693  ASN A OD1 1 
ATOM   5054  N  ND2 . ASN A  1  665 ? 17.550  46.985  27.028  1.00 52.37 ? 693  ASN A ND2 1 
ATOM   5055  N  N   . THR A  1  666 ? 20.169  48.423  23.568  1.00 53.59 ? 694  THR A N   1 
ATOM   5056  C  CA  . THR A  1  666 ? 21.054  48.664  22.425  1.00 54.01 ? 694  THR A CA  1 
ATOM   5057  C  C   . THR A  1  666 ? 20.687  47.549  21.430  1.00 55.08 ? 694  THR A C   1 
ATOM   5058  O  O   . THR A  1  666 ? 20.594  46.370  21.815  1.00 54.16 ? 694  THR A O   1 
ATOM   5059  C  CB  . THR A  1  666 ? 22.556  48.534  22.795  1.00 53.26 ? 694  THR A CB  1 
ATOM   5060  O  OG1 . THR A  1  666 ? 22.966  49.665  23.569  1.00 54.06 ? 694  THR A OG1 1 
ATOM   5061  C  CG2 . THR A  1  666 ? 23.408  48.478  21.539  1.00 53.12 ? 694  THR A CG2 1 
ATOM   5062  N  N   . VAL A  1  667 ? 20.455  47.922  20.169  1.00 55.48 ? 695  VAL A N   1 
ATOM   5063  C  CA  . VAL A  1  667 ? 20.069  46.953  19.143  1.00 54.30 ? 695  VAL A CA  1 
ATOM   5064  C  C   . VAL A  1  667 ? 21.259  46.287  18.470  1.00 53.38 ? 695  VAL A C   1 
ATOM   5065  O  O   . VAL A  1  667 ? 22.348  46.863  18.389  1.00 52.74 ? 695  VAL A O   1 
ATOM   5066  C  CB  . VAL A  1  667 ? 19.185  47.606  18.074  1.00 52.08 ? 695  VAL A CB  1 
ATOM   5067  C  CG1 . VAL A  1  667 ? 17.878  48.049  18.687  1.00 51.03 ? 695  VAL A CG1 1 
ATOM   5068  C  CG2 . VAL A  1  667 ? 19.907  48.778  17.473  1.00 53.23 ? 695  VAL A CG2 1 
ATOM   5069  N  N   . THR A  1  668 ? 21.026  45.066  17.994  1.00 52.24 ? 696  THR A N   1 
ATOM   5070  C  CA  . THR A  1  668 ? 22.048  44.253  17.348  1.00 52.54 ? 696  THR A CA  1 
ATOM   5071  C  C   . THR A  1  668 ? 22.406  44.726  15.941  1.00 51.66 ? 696  THR A C   1 
ATOM   5072  O  O   . THR A  1  668 ? 23.529  44.534  15.476  1.00 50.52 ? 696  THR A O   1 
ATOM   5073  C  CB  . THR A  1  668 ? 21.582  42.781  17.257  1.00 52.31 ? 696  THR A CB  1 
ATOM   5074  O  OG1 . THR A  1  668 ? 20.414  42.705  16.426  1.00 53.14 ? 696  THR A OG1 1 
ATOM   5075  C  CG2 . THR A  1  668 ? 21.264  42.225  18.642  1.00 49.63 ? 696  THR A CG2 1 
ATOM   5076  N  N   . VAL A  1  669 ? 21.436  45.341  15.276  1.00 52.23 ? 697  VAL A N   1 
ATOM   5077  C  CA  . VAL A  1  669 ? 21.600  45.826  13.908  1.00 53.46 ? 697  VAL A CA  1 
ATOM   5078  C  C   . VAL A  1  669 ? 22.976  46.391  13.560  1.00 54.01 ? 697  VAL A C   1 
ATOM   5079  O  O   . VAL A  1  669 ? 23.362  47.463  14.039  1.00 54.04 ? 697  VAL A O   1 
ATOM   5080  C  CB  . VAL A  1  669 ? 20.523  46.888  13.560  1.00 51.14 ? 697  VAL A CB  1 
ATOM   5081  C  CG1 . VAL A  1  669 ? 20.778  47.469  12.177  1.00 49.91 ? 697  VAL A CG1 1 
ATOM   5082  C  CG2 . VAL A  1  669 ? 19.139  46.251  13.619  1.00 51.11 ? 697  VAL A CG2 1 
ATOM   5083  N  N   . GLY A  1  670 ? 23.703  45.651  12.718  1.00 53.42 ? 698  GLY A N   1 
ATOM   5084  C  CA  . GLY A  1  670 ? 25.015  46.078  12.262  1.00 52.56 ? 698  GLY A CA  1 
ATOM   5085  C  C   . GLY A  1  670 ? 26.067  46.281  13.333  1.00 54.06 ? 698  GLY A C   1 
ATOM   5086  O  O   . GLY A  1  670 ? 27.085  46.950  13.094  1.00 53.91 ? 698  GLY A O   1 
ATOM   5087  N  N   . ASN A  1  671 ? 25.819  45.709  14.512  1.00 55.04 ? 699  ASN A N   1 
ATOM   5088  C  CA  . ASN A  1  671 ? 26.744  45.797  15.642  1.00 54.44 ? 699  ASN A CA  1 
ATOM   5089  C  C   . ASN A  1  671 ? 27.298  44.420  15.931  1.00 53.31 ? 699  ASN A C   1 
ATOM   5090  O  O   . ASN A  1  671 ? 27.889  44.185  16.986  1.00 54.05 ? 699  ASN A O   1 
ATOM   5091  C  CB  . ASN A  1  671 ? 26.043  46.340  16.896  1.00 54.01 ? 699  ASN A CB  1 
ATOM   5092  C  CG  . ASN A  1  671 ? 25.926  47.857  16.883  1.00 55.74 ? 699  ASN A CG  1 
ATOM   5093  O  OD1 . ASN A  1  671 ? 26.762  48.547  16.285  1.00 56.85 ? 699  ASN A OD1 1 
ATOM   5094  N  ND2 . ASN A  1  671 ? 24.903  48.388  17.556  1.00 55.89 ? 699  ASN A ND2 1 
ATOM   5095  N  N   . GLY A  1  672 ? 27.085  43.509  14.990  1.00 51.97 ? 700  GLY A N   1 
ATOM   5096  C  CA  . GLY A  1  672 ? 27.579  42.165  15.167  1.00 53.01 ? 700  GLY A CA  1 
ATOM   5097  C  C   . GLY A  1  672 ? 28.904  42.024  14.461  1.00 52.93 ? 700  GLY A C   1 
ATOM   5098  O  O   . GLY A  1  672 ? 28.956  42.080  13.234  1.00 53.53 ? 700  GLY A O   1 
ATOM   5099  N  N   . VAL A  1  673 ? 29.974  41.849  15.232  1.00 52.16 ? 701  VAL A N   1 
ATOM   5100  C  CA  . VAL A  1  673 ? 31.311  41.697  14.667  1.00 51.77 ? 701  VAL A CA  1 
ATOM   5101  C  C   . VAL A  1  673 ? 31.846  40.280  14.862  1.00 51.89 ? 701  VAL A C   1 
ATOM   5102  O  O   . VAL A  1  673 ? 31.404  39.558  15.754  1.00 53.79 ? 701  VAL A O   1 
ATOM   5103  C  CB  . VAL A  1  673 ? 32.279  42.697  15.300  1.00 51.01 ? 701  VAL A CB  1 
ATOM   5104  C  CG1 . VAL A  1  673 ? 31.836  44.100  14.962  1.00 52.88 ? 701  VAL A CG1 1 
ATOM   5105  C  CG2 . VAL A  1  673 ? 32.317  42.518  16.796  1.00 50.13 ? 701  VAL A CG2 1 
ATOM   5106  N  N   . GLY A  1  674 ? 32.786  39.879  14.015  1.00 52.09 ? 702  GLY A N   1 
ATOM   5107  C  CA  . GLY A  1  674 ? 33.358  38.544  14.114  1.00 51.85 ? 702  GLY A CA  1 
ATOM   5108  C  C   . GLY A  1  674 ? 34.350  38.233  13.000  1.00 52.70 ? 702  GLY A C   1 
ATOM   5109  O  O   . GLY A  1  674 ? 35.438  38.832  12.931  1.00 51.86 ? 702  GLY A O   1 
ATOM   5110  N  N   . PHE A  1  675 ? 33.972  37.301  12.123  1.00 51.49 ? 703  PHE A N   1 
ATOM   5111  C  CA  . PHE A  1  675 ? 34.820  36.895  11.000  1.00 51.07 ? 703  PHE A CA  1 
ATOM   5112  C  C   . PHE A  1  675 ? 34.267  35.661  10.294  1.00 50.88 ? 703  PHE A C   1 
ATOM   5113  O  O   . PHE A  1  675 ? 33.335  35.011  10.778  1.00 49.81 ? 703  PHE A O   1 
ATOM   5114  C  CB  . PHE A  1  675 ? 36.249  36.593  11.484  1.00 50.98 ? 703  PHE A CB  1 
ATOM   5115  C  CG  . PHE A  1  675 ? 36.321  35.550  12.585  1.00 50.57 ? 703  PHE A CG  1 
ATOM   5116  C  CD1 . PHE A  1  675 ? 35.974  34.219  12.340  1.00 50.40 ? 703  PHE A CD1 1 
ATOM   5117  C  CD2 . PHE A  1  675 ? 36.728  35.903  13.871  1.00 50.13 ? 703  PHE A CD2 1 
ATOM   5118  C  CE1 . PHE A  1  675 ? 36.034  33.255  13.365  1.00 51.08 ? 703  PHE A CE1 1 
ATOM   5119  C  CE2 . PHE A  1  675 ? 36.790  34.949  14.897  1.00 50.12 ? 703  PHE A CE2 1 
ATOM   5120  C  CZ  . PHE A  1  675 ? 36.442  33.622  14.642  1.00 50.13 ? 703  PHE A CZ  1 
ATOM   5121  N  N   . PHE A  1  676 ? 34.850  35.341  9.143   1.00 50.69 ? 704  PHE A N   1 
ATOM   5122  C  CA  . PHE A  1  676 ? 34.429  34.177  8.389   1.00 49.57 ? 704  PHE A CA  1 
ATOM   5123  C  C   . PHE A  1  676 ? 35.619  33.295  8.118   1.00 50.79 ? 704  PHE A C   1 
ATOM   5124  O  O   . PHE A  1  676 ? 36.755  33.767  8.021   1.00 49.88 ? 704  PHE A O   1 
ATOM   5125  C  CB  . PHE A  1  676 ? 33.851  34.548  7.025   1.00 50.57 ? 704  PHE A CB  1 
ATOM   5126  C  CG  . PHE A  1  676 ? 32.550  35.309  7.070   1.00 51.37 ? 704  PHE A CG  1 
ATOM   5127  C  CD1 . PHE A  1  676 ? 32.527  36.676  7.380   1.00 52.04 ? 704  PHE A CD1 1 
ATOM   5128  C  CD2 . PHE A  1  676 ? 31.357  34.679  6.720   1.00 48.96 ? 704  PHE A CD2 1 
ATOM   5129  C  CE1 . PHE A  1  676 ? 31.330  37.403  7.330   1.00 51.56 ? 704  PHE A CE1 1 
ATOM   5130  C  CE2 . PHE A  1  676 ? 30.168  35.393  6.669   1.00 49.58 ? 704  PHE A CE2 1 
ATOM   5131  C  CZ  . PHE A  1  676 ? 30.151  36.760  6.973   1.00 50.54 ? 704  PHE A CZ  1 
ATOM   5132  N  N   . LEU A  1  677 ? 35.340  32.006  7.988   1.00 50.88 ? 705  LEU A N   1 
ATOM   5133  C  CA  . LEU A  1  677 ? 36.357  31.030  7.664   1.00 50.68 ? 705  LEU A CA  1 
ATOM   5134  C  C   . LEU A  1  677 ? 35.888  30.498  6.338   1.00 51.89 ? 705  LEU A C   1 
ATOM   5135  O  O   . LEU A  1  677 ? 35.000  29.653  6.281   1.00 52.43 ? 705  LEU A O   1 
ATOM   5136  C  CB  . LEU A  1  677 ? 36.399  29.918  8.696   1.00 49.90 ? 705  LEU A CB  1 
ATOM   5137  C  CG  . LEU A  1  677 ? 36.882  30.439  10.041  1.00 50.56 ? 705  LEU A CG  1 
ATOM   5138  C  CD1 . LEU A  1  677 ? 36.962  29.282  11.024  1.00 49.97 ? 705  LEU A CD1 1 
ATOM   5139  C  CD2 . LEU A  1  677 ? 38.239  31.137  9.863   1.00 49.90 ? 705  LEU A CD2 1 
ATOM   5140  N  N   . ARG A  1  678 ? 36.475  31.023  5.269   1.00 53.12 ? 706  ARG A N   1 
ATOM   5141  C  CA  . ARG A  1  678 ? 36.101  30.634  3.929   1.00 52.52 ? 706  ARG A CA  1 
ATOM   5142  C  C   . ARG A  1  678 ? 37.040  29.709  3.202   1.00 53.85 ? 706  ARG A C   1 
ATOM   5143  O  O   . ARG A  1  678 ? 38.266  29.836  3.282   1.00 52.58 ? 706  ARG A O   1 
ATOM   5144  C  CB  . ARG A  1  678 ? 35.886  31.870  3.079   1.00 51.37 ? 706  ARG A CB  1 
ATOM   5145  C  CG  . ARG A  1  678 ? 34.478  32.345  3.131   1.00 52.64 ? 706  ARG A CG  1 
ATOM   5146  C  CD  . ARG A  1  678 ? 34.428  33.825  3.367   1.00 54.69 ? 706  ARG A CD  1 
ATOM   5147  N  NE  . ARG A  1  678 ? 35.000  34.612  2.273   1.00 56.57 ? 706  ARG A NE  1 
ATOM   5148  C  CZ  . ARG A  1  678 ? 34.534  34.643  1.022   1.00 55.97 ? 706  ARG A CZ  1 
ATOM   5149  N  NH1 . ARG A  1  678 ? 33.464  33.918  0.655   1.00 54.23 ? 706  ARG A NH1 1 
ATOM   5150  N  NH2 . ARG A  1  678 ? 35.145  35.424  0.141   1.00 54.90 ? 706  ARG A NH2 1 
ATOM   5151  N  N   . PRO A  1  679 ? 36.460  28.739  2.485   1.00 54.89 ? 707  PRO A N   1 
ATOM   5152  C  CA  . PRO A  1  679 ? 37.257  27.784  1.720   1.00 53.66 ? 707  PRO A CA  1 
ATOM   5153  C  C   . PRO A  1  679 ? 37.922  28.553  0.585   1.00 54.72 ? 707  PRO A C   1 
ATOM   5154  O  O   . PRO A  1  679 ? 37.264  29.307  -0.147  1.00 55.71 ? 707  PRO A O   1 
ATOM   5155  C  CB  . PRO A  1  679 ? 36.218  26.784  1.222   1.00 53.84 ? 707  PRO A CB  1 
ATOM   5156  C  CG  . PRO A  1  679 ? 34.946  27.603  1.163   1.00 53.44 ? 707  PRO A CG  1 
ATOM   5157  C  CD  . PRO A  1  679 ? 35.026  28.400  2.431   1.00 53.08 ? 707  PRO A CD  1 
ATOM   5158  N  N   . TYR A  1  680 ? 39.231  28.379  0.465   1.00 55.43 ? 708  TYR A N   1 
ATOM   5159  C  CA  . TYR A  1  680 ? 40.013  29.039  -0.569  1.00 53.45 ? 708  TYR A CA  1 
ATOM   5160  C  C   . TYR A  1  680 ? 40.931  27.988  -1.184  1.00 54.44 ? 708  TYR A C   1 
ATOM   5161  O  O   . TYR A  1  680 ? 41.948  27.602  -0.595  1.00 54.08 ? 708  TYR A O   1 
ATOM   5162  C  CB  . TYR A  1  680 ? 40.818  30.180  0.052   1.00 53.18 ? 708  TYR A CB  1 
ATOM   5163  C  CG  . TYR A  1  680 ? 41.640  30.964  -0.931  1.00 52.70 ? 708  TYR A CG  1 
ATOM   5164  C  CD1 . TYR A  1  680 ? 42.953  30.609  -1.208  1.00 52.42 ? 708  TYR A CD1 1 
ATOM   5165  C  CD2 . TYR A  1  680 ? 41.093  32.047  -1.611  1.00 53.82 ? 708  TYR A CD2 1 
ATOM   5166  C  CE1 . TYR A  1  680 ? 43.706  31.315  -2.140  1.00 54.15 ? 708  TYR A CE1 1 
ATOM   5167  C  CE2 . TYR A  1  680 ? 41.833  32.761  -2.548  1.00 53.80 ? 708  TYR A CE2 1 
ATOM   5168  C  CZ  . TYR A  1  680 ? 43.140  32.394  -2.812  1.00 54.50 ? 708  TYR A CZ  1 
ATOM   5169  O  OH  . TYR A  1  680 ? 43.878  33.091  -3.753  1.00 53.68 ? 708  TYR A OH  1 
ATOM   5170  N  N   . ASN A  1  681 ? 40.553  27.523  -2.372  1.00 54.26 ? 709  ASN A N   1 
ATOM   5171  C  CA  . ASN A  1  681 ? 41.304  26.499  -3.085  1.00 55.21 ? 709  ASN A CA  1 
ATOM   5172  C  C   . ASN A  1  681 ? 41.409  25.278  -2.214  1.00 54.84 ? 709  ASN A C   1 
ATOM   5173  O  O   . ASN A  1  681 ? 42.333  24.483  -2.338  1.00 55.02 ? 709  ASN A O   1 
ATOM   5174  C  CB  . ASN A  1  681 ? 42.702  26.986  -3.462  1.00 55.77 ? 709  ASN A CB  1 
ATOM   5175  C  CG  . ASN A  1  681 ? 42.682  27.952  -4.629  1.00 55.74 ? 709  ASN A CG  1 
ATOM   5176  O  OD1 . ASN A  1  681 ? 41.881  27.801  -5.559  1.00 53.67 ? 709  ASN A OD1 1 
ATOM   5177  N  ND2 . ASN A  1  681 ? 43.573  28.943  -4.596  1.00 55.91 ? 709  ASN A ND2 1 
ATOM   5178  N  N   . PHE A  1  682 ? 40.450  25.145  -1.314  1.00 56.59 ? 710  PHE A N   1 
ATOM   5179  C  CA  . PHE A  1  682 ? 40.420  24.004  -0.425  1.00 57.28 ? 710  PHE A CA  1 
ATOM   5180  C  C   . PHE A  1  682 ? 39.639  22.926  -1.148  1.00 56.76 ? 710  PHE A C   1 
ATOM   5181  O  O   . PHE A  1  682 ? 39.897  21.740  -0.997  1.00 55.00 ? 710  PHE A O   1 
ATOM   5182  C  CB  . PHE A  1  682 ? 39.729  24.372  0.880   1.00 57.21 ? 710  PHE A CB  1 
ATOM   5183  C  CG  . PHE A  1  682 ? 39.590  23.226  1.821   1.00 57.36 ? 710  PHE A CG  1 
ATOM   5184  C  CD1 . PHE A  1  682 ? 38.661  22.219  1.577   1.00 56.36 ? 710  PHE A CD1 1 
ATOM   5185  C  CD2 . PHE A  1  682 ? 40.407  23.136  2.944   1.00 57.67 ? 710  PHE A CD2 1 
ATOM   5186  C  CE1 . PHE A  1  682 ? 38.548  21.141  2.431   1.00 56.16 ? 710  PHE A CE1 1 
ATOM   5187  C  CE2 . PHE A  1  682 ? 40.303  22.056  3.813   1.00 57.47 ? 710  PHE A CE2 1 
ATOM   5188  C  CZ  . PHE A  1  682 ? 39.371  21.055  3.555   1.00 56.75 ? 710  PHE A CZ  1 
ATOM   5189  N  N   . PHE A  1  683 ? 38.672  23.361  -1.941  1.00 57.44 ? 711  PHE A N   1 
ATOM   5190  C  CA  . PHE A  1  683 ? 37.868  22.434  -2.700  1.00 57.93 ? 711  PHE A CA  1 
ATOM   5191  C  C   . PHE A  1  683 ? 38.311  22.458  -4.149  1.00 58.30 ? 711  PHE A C   1 
ATOM   5192  O  O   . PHE A  1  683 ? 39.180  23.240  -4.541  1.00 56.80 ? 711  PHE A O   1 
ATOM   5193  C  CB  . PHE A  1  683 ? 36.390  22.804  -2.609  1.00 57.75 ? 711  PHE A CB  1 
ATOM   5194  C  CG  . PHE A  1  683 ? 35.846  22.757  -1.220  1.00 58.55 ? 711  PHE A CG  1 
ATOM   5195  C  CD1 . PHE A  1  683 ? 35.334  23.898  -0.624  1.00 59.35 ? 711  PHE A CD1 1 
ATOM   5196  C  CD2 . PHE A  1  683 ? 35.851  21.569  -0.498  1.00 58.95 ? 711  PHE A CD2 1 
ATOM   5197  C  CE1 . PHE A  1  683 ? 34.832  23.855  0.679   1.00 59.65 ? 711  PHE A CE1 1 
ATOM   5198  C  CE2 . PHE A  1  683 ? 35.353  21.516  0.802   1.00 57.84 ? 711  PHE A CE2 1 
ATOM   5199  C  CZ  . PHE A  1  683 ? 34.844  22.657  1.390   1.00 58.56 ? 711  PHE A CZ  1 
ATOM   5200  N  N   . ASP A  1  684 ? 37.713  21.568  -4.931  1.00 59.61 ? 712  ASP A N   1 
ATOM   5201  C  CA  . ASP A  1  684 ? 37.997  21.463  -6.350  1.00 59.50 ? 712  ASP A CA  1 
ATOM   5202  C  C   . ASP A  1  684 ? 36.915  22.313  -7.008  1.00 59.37 ? 712  ASP A C   1 
ATOM   5203  O  O   . ASP A  1  684 ? 36.947  22.573  -8.209  1.00 60.76 ? 712  ASP A O   1 
ATOM   5204  C  CB  . ASP A  1  684 ? 37.882  19.999  -6.813  1.00 59.99 ? 712  ASP A CB  1 
ATOM   5205  C  CG  . ASP A  1  684 ? 38.977  19.109  -6.244  1.00 58.90 ? 712  ASP A CG  1 
ATOM   5206  O  OD1 . ASP A  1  684 ? 38.773  17.876  -6.217  1.00 58.40 ? 712  ASP A OD1 1 
ATOM   5207  O  OD2 . ASP A  1  684 ? 40.037  19.638  -5.841  1.00 57.76 ? 712  ASP A OD2 1 
ATOM   5208  N  N   . GLU A  1  685 ? 35.958  22.754  -6.199  1.00 59.69 ? 713  GLU A N   1 
ATOM   5209  C  CA  . GLU A  1  685 ? 34.859  23.576  -6.690  1.00 58.66 ? 713  GLU A CA  1 
ATOM   5210  C  C   . GLU A  1  685 ? 33.905  23.916  -5.550  1.00 58.18 ? 713  GLU A C   1 
ATOM   5211  O  O   . GLU A  1  685 ? 34.108  23.511  -4.406  1.00 59.28 ? 713  GLU A O   1 
ATOM   5212  C  CB  . GLU A  1  685 ? 34.093  22.819  -7.764  1.00 58.55 ? 713  GLU A CB  1 
ATOM   5213  C  CG  . GLU A  1  685 ? 33.432  21.569  -7.214  1.00 61.18 ? 713  GLU A CG  1 
ATOM   5214  C  CD  . GLU A  1  685 ? 32.689  20.771  -8.269  1.00 63.37 ? 713  GLU A CD  1 
ATOM   5215  O  OE1 . GLU A  1  685 ? 31.838  21.357  -8.988  1.00 63.46 ? 713  GLU A OE1 1 
ATOM   5216  O  OE2 . GLU A  1  685 ? 32.956  19.549  -8.369  1.00 63.87 ? 713  GLU A OE2 1 
ATOM   5217  N  N   . ASP A  1  686 ? 32.858  24.659  -5.874  1.00 57.25 ? 714  ASP A N   1 
ATOM   5218  C  CA  . ASP A  1  686 ? 31.863  25.042  -4.894  1.00 56.47 ? 714  ASP A CA  1 
ATOM   5219  C  C   . ASP A  1  686 ? 31.093  23.784  -4.494  1.00 57.81 ? 714  ASP A C   1 
ATOM   5220  O  O   . ASP A  1  686 ? 30.262  23.287  -5.254  1.00 57.75 ? 714  ASP A O   1 
ATOM   5221  C  CB  . ASP A  1  686 ? 30.918  26.051  -5.511  1.00 55.66 ? 714  ASP A CB  1 
ATOM   5222  C  CG  . ASP A  1  686 ? 29.836  26.457  -4.571  1.00 55.14 ? 714  ASP A CG  1 
ATOM   5223  O  OD1 . ASP A  1  686 ? 28.846  27.061  -5.038  1.00 56.64 ? 714  ASP A OD1 1 
ATOM   5224  O  OD2 . ASP A  1  686 ? 29.986  26.171  -3.366  1.00 52.07 ? 714  ASP A OD2 1 
ATOM   5225  N  N   . PRO A  1  687 ? 31.346  23.261  -3.286  1.00 57.83 ? 715  PRO A N   1 
ATOM   5226  C  CA  . PRO A  1  687 ? 30.669  22.048  -2.809  1.00 57.67 ? 715  PRO A CA  1 
ATOM   5227  C  C   . PRO A  1  687 ? 29.145  22.096  -2.770  1.00 57.43 ? 715  PRO A C   1 
ATOM   5228  O  O   . PRO A  1  687 ? 28.491  21.073  -2.573  1.00 57.10 ? 715  PRO A O   1 
ATOM   5229  C  CB  . PRO A  1  687 ? 31.290  21.831  -1.435  1.00 56.76 ? 715  PRO A CB  1 
ATOM   5230  C  CG  . PRO A  1  687 ? 31.626  23.214  -0.993  1.00 56.79 ? 715  PRO A CG  1 
ATOM   5231  C  CD  . PRO A  1  687 ? 32.182  23.852  -2.228  1.00 57.01 ? 715  PRO A CD  1 
ATOM   5232  N  N   . SER A  1  688 ? 28.588  23.283  -2.974  1.00 57.79 ? 716  SER A N   1 
ATOM   5233  C  CA  . SER A  1  688 ? 27.143  23.463  -2.962  1.00 58.68 ? 716  SER A CA  1 
ATOM   5234  C  C   . SER A  1  688 ? 26.546  23.176  -4.332  1.00 59.72 ? 716  SER A C   1 
ATOM   5235  O  O   . SER A  1  688 ? 25.331  23.244  -4.520  1.00 60.49 ? 716  SER A O   1 
ATOM   5236  C  CB  . SER A  1  688 ? 26.789  24.888  -2.551  1.00 58.75 ? 716  SER A CB  1 
ATOM   5237  O  OG  . SER A  1  688 ? 27.135  25.802  -3.575  1.00 58.22 ? 716  SER A OG  1 
ATOM   5238  N  N   . PHE A  1  689 ? 27.402  22.884  -5.301  1.00 59.77 ? 717  PHE A N   1 
ATOM   5239  C  CA  . PHE A  1  689 ? 26.924  22.557  -6.635  1.00 61.31 ? 717  PHE A CA  1 
ATOM   5240  C  C   . PHE A  1  689 ? 26.088  21.287  -6.477  1.00 62.32 ? 717  PHE A C   1 
ATOM   5241  O  O   . PHE A  1  689 ? 25.117  21.060  -7.204  1.00 61.72 ? 717  PHE A O   1 
ATOM   5242  C  CB  . PHE A  1  689 ? 28.122  22.300  -7.561  1.00 61.87 ? 717  PHE A CB  1 
ATOM   5243  C  CG  . PHE A  1  689 ? 27.768  21.592  -8.846  1.00 61.59 ? 717  PHE A CG  1 
ATOM   5244  C  CD1 . PHE A  1  689 ? 26.938  22.195  -9.789  1.00 61.62 ? 717  PHE A CD1 1 
ATOM   5245  C  CD2 . PHE A  1  689 ? 28.256  20.313  -9.109  1.00 61.08 ? 717  PHE A CD2 1 
ATOM   5246  C  CE1 . PHE A  1  689 ? 26.600  21.531  -10.973 1.00 61.37 ? 717  PHE A CE1 1 
ATOM   5247  C  CE2 . PHE A  1  689 ? 27.922  19.643  -10.289 1.00 60.96 ? 717  PHE A CE2 1 
ATOM   5248  C  CZ  . PHE A  1  689 ? 27.094  20.252  -11.221 1.00 60.65 ? 717  PHE A CZ  1 
ATOM   5249  N  N   . TYR A  1  690 ? 26.487  20.481  -5.491  1.00 64.70 ? 718  TYR A N   1 
ATOM   5250  C  CA  . TYR A  1  690 ? 25.860  19.204  -5.150  1.00 63.23 ? 718  TYR A CA  1 
ATOM   5251  C  C   . TYR A  1  690 ? 24.705  19.337  -4.180  1.00 63.21 ? 718  TYR A C   1 
ATOM   5252  O  O   . TYR A  1  690 ? 24.193  18.341  -3.693  1.00 63.93 ? 718  TYR A O   1 
ATOM   5253  C  CB  . TYR A  1  690 ? 26.895  18.269  -4.530  1.00 64.84 ? 718  TYR A CB  1 
ATOM   5254  C  CG  . TYR A  1  690 ? 28.089  18.054  -5.414  1.00 67.43 ? 718  TYR A CG  1 
ATOM   5255  C  CD1 . TYR A  1  690 ? 29.312  18.685  -5.150  1.00 67.45 ? 718  TYR A CD1 1 
ATOM   5256  C  CD2 . TYR A  1  690 ? 27.981  17.261  -6.559  1.00 68.08 ? 718  TYR A CD2 1 
ATOM   5257  C  CE1 . TYR A  1  690 ? 30.400  18.529  -6.021  1.00 68.35 ? 718  TYR A CE1 1 
ATOM   5258  C  CE2 . TYR A  1  690 ? 29.053  17.097  -7.433  1.00 68.37 ? 718  TYR A CE2 1 
ATOM   5259  C  CZ  . TYR A  1  690 ? 30.256  17.729  -7.168  1.00 69.36 ? 718  TYR A CZ  1 
ATOM   5260  O  OH  . TYR A  1  690 ? 31.287  17.560  -8.073  1.00 68.94 ? 718  TYR A OH  1 
ATOM   5261  N  N   . SER A  1  691 ? 24.313  20.565  -3.876  1.00 63.80 ? 719  SER A N   1 
ATOM   5262  C  CA  . SER A  1  691 ? 23.205  20.796  -2.969  1.00 63.61 ? 719  SER A CA  1 
ATOM   5263  C  C   . SER A  1  691 ? 21.993  20.024  -3.497  1.00 64.02 ? 719  SER A C   1 
ATOM   5264  O  O   . SER A  1  691 ? 21.700  20.069  -4.687  1.00 64.08 ? 719  SER A O   1 
ATOM   5265  C  CB  . SER A  1  691 ? 22.907  22.293  -2.907  1.00 63.17 ? 719  SER A CB  1 
ATOM   5266  O  OG  . SER A  1  691 ? 21.842  22.563  -2.022  1.00 63.71 ? 719  SER A OG  1 
ATOM   5267  N  N   . ALA A  1  692 ? 21.303  19.293  -2.629  1.00 63.90 ? 720  ALA A N   1 
ATOM   5268  C  CA  . ALA A  1  692 ? 20.145  18.536  -3.074  1.00 64.20 ? 720  ALA A CA  1 
ATOM   5269  C  C   . ALA A  1  692 ? 19.037  19.529  -3.319  1.00 64.55 ? 720  ALA A C   1 
ATOM   5270  O  O   . ALA A  1  692 ? 18.096  19.270  -4.064  1.00 65.22 ? 720  ALA A O   1 
ATOM   5271  C  CB  . ALA A  1  692 ? 19.726  17.544  -2.018  1.00 63.67 ? 720  ALA A CB  1 
ATOM   5272  N  N   . ASP A  1  693 ? 19.179  20.688  -2.695  1.00 64.92 ? 721  ASP A N   1 
ATOM   5273  C  CA  . ASP A  1  693 ? 18.189  21.743  -2.801  1.00 66.64 ? 721  ASP A CA  1 
ATOM   5274  C  C   . ASP A  1  693 ? 18.495  22.764  -3.901  1.00 67.76 ? 721  ASP A C   1 
ATOM   5275  O  O   . ASP A  1  693 ? 17.855  23.817  -3.970  1.00 67.86 ? 721  ASP A O   1 
ATOM   5276  C  CB  . ASP A  1  693 ? 18.058  22.469  -1.454  1.00 67.40 ? 721  ASP A CB  1 
ATOM   5277  C  CG  . ASP A  1  693 ? 17.913  21.511  -0.270  1.00 66.90 ? 721  ASP A CG  1 
ATOM   5278  O  OD1 . ASP A  1  693 ? 17.048  20.605  -0.323  1.00 68.04 ? 721  ASP A OD1 1 
ATOM   5279  O  OD2 . ASP A  1  693 ? 18.660  21.677  0.721   1.00 65.42 ? 721  ASP A OD2 1 
ATOM   5280  N  N   . SER A  1  694 ? 19.471  22.457  -4.752  1.00 68.27 ? 722  SER A N   1 
ATOM   5281  C  CA  . SER A  1  694 ? 19.850  23.350  -5.853  1.00 68.42 ? 722  SER A CA  1 
ATOM   5282  C  C   . SER A  1  694 ? 18.705  23.425  -6.858  1.00 68.68 ? 722  SER A C   1 
ATOM   5283  O  O   . SER A  1  694 ? 17.864  22.527  -6.892  1.00 69.36 ? 722  SER A O   1 
ATOM   5284  C  CB  . SER A  1  694 ? 21.114  22.821  -6.546  1.00 69.14 ? 722  SER A CB  1 
ATOM   5285  O  OG  . SER A  1  694 ? 21.488  23.611  -7.666  1.00 69.72 ? 722  SER A OG  1 
ATOM   5286  N  N   . ILE A  1  695 ? 18.672  24.486  -7.669  1.00 69.64 ? 723  ILE A N   1 
ATOM   5287  C  CA  . ILE A  1  695 ? 17.620  24.668  -8.683  1.00 70.41 ? 723  ILE A CA  1 
ATOM   5288  C  C   . ILE A  1  695 ? 18.170  24.942  -10.091 1.00 70.10 ? 723  ILE A C   1 
ATOM   5289  O  O   . ILE A  1  695 ? 19.172  25.639  -10.255 1.00 70.05 ? 723  ILE A O   1 
ATOM   5290  C  CB  . ILE A  1  695 ? 16.664  25.844  -8.322  1.00 69.82 ? 723  ILE A CB  1 
ATOM   5291  C  CG1 . ILE A  1  695 ? 16.124  25.678  -6.897  1.00 69.07 ? 723  ILE A CG1 1 
ATOM   5292  C  CG2 . ILE A  1  695 ? 15.516  25.911  -9.326  1.00 68.45 ? 723  ILE A CG2 1 
ATOM   5293  C  CD1 . ILE A  1  695 ? 15.259  24.469  -6.702  1.00 69.16 ? 723  ILE A CD1 1 
ATOM   5294  N  N   . TYR A  1  696 ? 17.493  24.395  -11.100 1.00 71.08 ? 724  TYR A N   1 
ATOM   5295  C  CA  . TYR A  1  696 ? 17.890  24.574  -12.493 1.00 70.74 ? 724  TYR A CA  1 
ATOM   5296  C  C   . TYR A  1  696 ? 16.694  24.483  -13.453 1.00 71.05 ? 724  TYR A C   1 
ATOM   5297  O  O   . TYR A  1  696 ? 15.658  23.911  -13.115 1.00 71.36 ? 724  TYR A O   1 
ATOM   5298  C  CB  . TYR A  1  696 ? 18.933  23.524  -12.886 1.00 70.10 ? 724  TYR A CB  1 
ATOM   5299  C  CG  . TYR A  1  696 ? 19.518  23.797  -14.245 1.00 70.96 ? 724  TYR A CG  1 
ATOM   5300  C  CD1 . TYR A  1  696 ? 20.353  24.896  -14.452 1.00 70.80 ? 724  TYR A CD1 1 
ATOM   5301  C  CD2 . TYR A  1  696 ? 19.158  23.026  -15.348 1.00 71.16 ? 724  TYR A CD2 1 
ATOM   5302  C  CE1 . TYR A  1  696 ? 20.805  25.229  -15.719 1.00 70.70 ? 724  TYR A CE1 1 
ATOM   5303  C  CE2 . TYR A  1  696 ? 19.606  23.353  -16.625 1.00 71.27 ? 724  TYR A CE2 1 
ATOM   5304  C  CZ  . TYR A  1  696 ? 20.424  24.460  -16.800 1.00 71.05 ? 724  TYR A CZ  1 
ATOM   5305  O  OH  . TYR A  1  696 ? 20.824  24.826  -18.058 1.00 70.88 ? 724  TYR A OH  1 
ATOM   5306  N  N   . PHE A  1  697 ? 16.840  25.058  -14.645 1.00 71.22 ? 725  PHE A N   1 
ATOM   5307  C  CA  . PHE A  1  697 ? 15.786  25.029  -15.662 1.00 72.64 ? 725  PHE A CA  1 
ATOM   5308  C  C   . PHE A  1  697 ? 16.089  25.989  -16.811 1.00 72.97 ? 725  PHE A C   1 
ATOM   5309  O  O   . PHE A  1  697 ? 17.138  26.625  -16.824 1.00 73.57 ? 725  PHE A O   1 
ATOM   5310  C  CB  . PHE A  1  697 ? 14.430  25.370  -15.042 1.00 72.89 ? 725  PHE A CB  1 
ATOM   5311  C  CG  . PHE A  1  697 ? 14.329  26.775  -14.531 1.00 73.50 ? 725  PHE A CG  1 
ATOM   5312  C  CD1 . PHE A  1  697 ? 14.181  27.845  -15.410 1.00 73.38 ? 725  PHE A CD1 1 
ATOM   5313  C  CD2 . PHE A  1  697 ? 14.364  27.031  -13.167 1.00 73.11 ? 725  PHE A CD2 1 
ATOM   5314  C  CE1 . PHE A  1  697 ? 14.063  29.150  -14.938 1.00 72.25 ? 725  PHE A CE1 1 
ATOM   5315  C  CE2 . PHE A  1  697 ? 14.248  28.330  -12.686 1.00 72.79 ? 725  PHE A CE2 1 
ATOM   5316  C  CZ  . PHE A  1  697 ? 14.096  29.391  -13.576 1.00 72.84 ? 725  PHE A CZ  1 
ATOM   5317  N  N   . ARG A  1  698 ? 15.170  26.098  -17.770 1.00 72.95 ? 726  ARG A N   1 
ATOM   5318  C  CA  . ARG A  1  698 ? 15.365  26.980  -18.921 1.00 72.95 ? 726  ARG A CA  1 
ATOM   5319  C  C   . ARG A  1  698 ? 14.126  27.813  -19.275 1.00 75.10 ? 726  ARG A C   1 
ATOM   5320  O  O   . ARG A  1  698 ? 13.002  27.292  -19.267 1.00 75.82 ? 726  ARG A O   1 
ATOM   5321  C  CB  . ARG A  1  698 ? 15.766  26.153  -20.136 1.00 73.19 ? 726  ARG A CB  1 
ATOM   5322  C  CG  . ARG A  1  698 ? 16.971  25.261  -19.917 1.00 74.80 ? 726  ARG A CG  1 
ATOM   5323  C  CD  . ARG A  1  698 ? 17.438  24.653  -21.237 1.00 75.64 ? 726  ARG A CD  1 
ATOM   5324  N  NE  . ARG A  1  698 ? 18.785  24.084  -21.149 1.00 77.22 ? 726  ARG A NE  1 
ATOM   5325  C  CZ  . ARG A  1  698 ? 19.596  23.902  -22.195 1.00 78.39 ? 726  ARG A CZ  1 
ATOM   5326  N  NH1 . ARG A  1  698 ? 19.198  24.243  -23.421 1.00 77.80 ? 726  ARG A NH1 1 
ATOM   5327  N  NH2 . ARG A  1  698 ? 20.815  23.393  -22.021 1.00 77.75 ? 726  ARG A NH2 1 
ATOM   5328  N  N   . GLY A  1  699 ? 14.336  29.099  -19.586 1.00 75.15 ? 727  GLY A N   1 
ATOM   5329  C  CA  . GLY A  1  699 ? 13.240  29.992  -19.953 1.00 74.56 ? 727  GLY A CA  1 
ATOM   5330  C  C   . GLY A  1  699 ? 12.647  30.765  -18.790 1.00 75.19 ? 727  GLY A C   1 
ATOM   5331  O  O   . GLY A  1  699 ? 13.343  31.586  -18.188 1.00 74.81 ? 727  GLY A O   1 
ATOM   5332  N  N   . ASP A  1  700 ? 11.365  30.508  -18.492 1.00 75.59 ? 728  ASP A N   1 
ATOM   5333  C  CA  . ASP A  1  700 ? 10.636  31.147  -17.381 1.00 73.22 ? 728  ASP A CA  1 
ATOM   5334  C  C   . ASP A  1  700 ? 10.435  30.160  -16.228 1.00 72.43 ? 728  ASP A C   1 
ATOM   5335  O  O   . ASP A  1  700 ? 10.606  28.943  -16.468 1.00 75.05 ? 728  ASP A O   1 
ATOM   5336  C  CB  . ASP A  1  700 ? 9.257   31.658  -17.851 1.00 75.63 ? 728  ASP A CB  1 
ATOM   5337  C  CG  . ASP A  1  700 ? 8.351   32.110  -16.686 1.00 76.19 ? 728  ASP A CG  1 
ATOM   5338  O  OD1 . ASP A  1  700 ? 7.561   31.282  -16.168 1.00 76.00 ? 728  ASP A OD1 1 
ATOM   5339  O  OD2 . ASP A  1  700 ? 8.431   33.293  -16.284 1.00 75.57 ? 728  ASP A OD2 1 
ATOM   5340  N  N   . GLN A  1  701 ? 10.093  30.609  -15.107 1.00 72.00 ? 729  GLN A N   1 
ATOM   5341  N  N   . GLN B  1  30  ? 2.558   58.948  -7.470  1.00 75.20 ? 58   GLN B N   1 
ATOM   5342  C  CA  . GLN B  1  30  ? 4.032   58.739  -7.501  1.00 74.27 ? 58   GLN B CA  1 
ATOM   5343  C  C   . GLN B  1  30  ? 4.752   59.607  -8.517  1.00 74.08 ? 58   GLN B C   1 
ATOM   5344  O  O   . GLN B  1  30  ? 4.599   59.465  -9.736  1.00 73.00 ? 58   GLN B O   1 
ATOM   5345  C  CB  . GLN B  1  30  ? 4.370   57.264  -7.729  1.00 74.66 ? 58   GLN B CB  1 
ATOM   5346  C  CG  . GLN B  1  30  ? 3.331   56.479  -8.493  1.00 75.34 ? 58   GLN B CG  1 
ATOM   5347  C  CD  . GLN B  1  30  ? 3.274   55.027  -8.052  1.00 75.75 ? 58   GLN B CD  1 
ATOM   5348  O  OE1 . GLN B  1  30  ? 4.297   54.391  -7.800  1.00 76.12 ? 58   GLN B OE1 1 
ATOM   5349  N  NE2 . GLN B  1  30  ? 2.068   54.487  -7.966  1.00 75.36 ? 58   GLN B NE2 1 
ATOM   5350  N  N   . LEU B  1  31  ? 5.538   60.517  -7.952  1.00 74.65 ? 59   LEU B N   1 
ATOM   5351  C  CA  . LEU B  1  31  ? 6.352   61.499  -8.654  1.00 72.43 ? 59   LEU B CA  1 
ATOM   5352  C  C   . LEU B  1  31  ? 7.640   60.835  -9.149  1.00 71.26 ? 59   LEU B C   1 
ATOM   5353  O  O   . LEU B  1  31  ? 8.299   61.338  -10.055 1.00 70.36 ? 59   LEU B O   1 
ATOM   5354  C  CB  . LEU B  1  31  ? 6.673   62.623  -7.664  1.00 71.42 ? 59   LEU B CB  1 
ATOM   5355  C  CG  . LEU B  1  31  ? 7.181   63.988  -8.101  1.00 71.10 ? 59   LEU B CG  1 
ATOM   5356  C  CD1 . LEU B  1  31  ? 6.169   64.615  -9.026  1.00 71.39 ? 59   LEU B CD1 1 
ATOM   5357  C  CD2 . LEU B  1  31  ? 7.392   64.867  -6.882  1.00 70.03 ? 59   LEU B CD2 1 
ATOM   5358  N  N   . PHE B  1  32  ? 7.982   59.701  -8.539  1.00 71.77 ? 60   PHE B N   1 
ATOM   5359  C  CA  . PHE B  1  32  ? 9.186   58.949  -8.889  1.00 71.24 ? 60   PHE B CA  1 
ATOM   5360  C  C   . PHE B  1  32  ? 8.865   57.552  -9.384  1.00 71.79 ? 60   PHE B C   1 
ATOM   5361  O  O   . PHE B  1  32  ? 9.534   56.585  -9.010  1.00 71.66 ? 60   PHE B O   1 
ATOM   5362  C  CB  . PHE B  1  32  ? 10.103  58.799  -7.683  1.00 71.40 ? 60   PHE B CB  1 
ATOM   5363  C  CG  . PHE B  1  32  ? 10.332  60.065  -6.943  1.00 70.92 ? 60   PHE B CG  1 
ATOM   5364  C  CD1 . PHE B  1  32  ? 9.813   60.236  -5.670  1.00 70.31 ? 60   PHE B CD1 1 
ATOM   5365  C  CD2 . PHE B  1  32  ? 11.056  61.097  -7.522  1.00 71.33 ? 60   PHE B CD2 1 
ATOM   5366  C  CE1 . PHE B  1  32  ? 10.007  61.416  -4.984  1.00 69.83 ? 60   PHE B CE1 1 
ATOM   5367  C  CE2 . PHE B  1  32  ? 11.257  62.282  -6.846  1.00 70.65 ? 60   PHE B CE2 1 
ATOM   5368  C  CZ  . PHE B  1  32  ? 10.730  62.442  -5.573  1.00 70.58 ? 60   PHE B CZ  1 
ATOM   5369  N  N   . ALA B  1  33  ? 7.827   57.431  -10.197 1.00 71.77 ? 61   ALA B N   1 
ATOM   5370  C  CA  . ALA B  1  33  ? 7.468   56.132  -10.730 1.00 70.98 ? 61   ALA B CA  1 
ATOM   5371  C  C   . ALA B  1  33  ? 8.076   56.070  -12.127 1.00 71.70 ? 61   ALA B C   1 
ATOM   5372  O  O   . ALA B  1  33  ? 7.728   56.876  -12.992 1.00 71.70 ? 61   ALA B O   1 
ATOM   5373  C  CB  . ALA B  1  33  ? 5.954   55.992  -10.794 1.00 71.45 ? 61   ALA B CB  1 
ATOM   5374  N  N   . ASP B  1  34  ? 9.007   55.139  -12.337 1.00 71.99 ? 62   ASP B N   1 
ATOM   5375  C  CA  . ASP B  1  34  ? 9.651   54.988  -13.643 1.00 71.70 ? 62   ASP B CA  1 
ATOM   5376  C  C   . ASP B  1  34  ? 8.570   55.038  -14.718 1.00 72.17 ? 62   ASP B C   1 
ATOM   5377  O  O   . ASP B  1  34  ? 7.447   54.573  -14.500 1.00 72.57 ? 62   ASP B O   1 
ATOM   5378  C  CB  . ASP B  1  34  ? 10.401  53.653  -13.727 1.00 71.35 ? 62   ASP B CB  1 
ATOM   5379  C  CG  . ASP B  1  34  ? 11.472  53.515  -12.666 1.00 71.13 ? 62   ASP B CG  1 
ATOM   5380  O  OD1 . ASP B  1  34  ? 11.131  53.596  -11.468 1.00 71.17 ? 62   ASP B OD1 1 
ATOM   5381  O  OD2 . ASP B  1  34  ? 12.651  53.321  -13.030 1.00 70.63 ? 62   ASP B OD2 1 
ATOM   5382  N  N   . LEU B  1  35  ? 8.897   55.598  -15.876 1.00 71.75 ? 63   LEU B N   1 
ATOM   5383  C  CA  . LEU B  1  35  ? 7.913   55.695  -16.943 1.00 71.12 ? 63   LEU B CA  1 
ATOM   5384  C  C   . LEU B  1  35  ? 7.088   54.415  -17.099 1.00 72.28 ? 63   LEU B C   1 
ATOM   5385  O  O   . LEU B  1  35  ? 7.612   53.296  -17.014 1.00 71.43 ? 63   LEU B O   1 
ATOM   5386  C  CB  . LEU B  1  35  ? 8.600   56.053  -18.256 1.00 70.38 ? 63   LEU B CB  1 
ATOM   5387  C  CG  . LEU B  1  35  ? 9.259   57.432  -18.235 1.00 69.98 ? 63   LEU B CG  1 
ATOM   5388  C  CD1 . LEU B  1  35  ? 9.732   57.776  -19.631 1.00 69.95 ? 63   LEU B CD1 1 
ATOM   5389  C  CD2 . LEU B  1  35  ? 8.272   58.470  -17.740 1.00 69.55 ? 63   LEU B CD2 1 
ATOM   5390  N  N   . SER B  1  36  ? 5.787   54.606  -17.313 1.00 72.55 ? 64   SER B N   1 
ATOM   5391  C  CA  . SER B  1  36  ? 4.831   53.517  -17.474 1.00 72.17 ? 64   SER B CA  1 
ATOM   5392  C  C   . SER B  1  36  ? 4.839   52.928  -18.880 1.00 73.43 ? 64   SER B C   1 
ATOM   5393  O  O   . SER B  1  36  ? 5.348   53.533  -19.829 1.00 73.25 ? 64   SER B O   1 
ATOM   5394  C  CB  . SER B  1  36  ? 3.419   54.011  -17.183 1.00 71.47 ? 64   SER B CB  1 
ATOM   5395  O  OG  . SER B  1  36  ? 2.973   54.870  -18.223 1.00 70.05 ? 64   SER B OG  1 
ATOM   5396  N  N   . ARG B  1  37  ? 4.249   51.741  -18.995 1.00 74.39 ? 65   ARG B N   1 
ATOM   5397  C  CA  . ARG B  1  37  ? 4.140   51.022  -20.257 1.00 73.98 ? 65   ARG B CA  1 
ATOM   5398  C  C   . ARG B  1  37  ? 3.627   51.993  -21.333 1.00 73.75 ? 65   ARG B C   1 
ATOM   5399  O  O   . ARG B  1  37  ? 4.224   52.133  -22.408 1.00 73.04 ? 65   ARG B O   1 
ATOM   5400  C  CB  . ARG B  1  37  ? 3.172   49.854  -20.051 1.00 74.45 ? 65   ARG B CB  1 
ATOM   5401  C  CG  . ARG B  1  37  ? 3.071   48.888  -21.191 1.00 77.39 ? 65   ARG B CG  1 
ATOM   5402  C  CD  . ARG B  1  37  ? 1.886   47.958  -20.965 1.00 79.69 ? 65   ARG B CD  1 
ATOM   5403  N  NE  . ARG B  1  37  ? 1.605   47.149  -22.148 1.00 82.85 ? 65   ARG B NE  1 
ATOM   5404  C  CZ  . ARG B  1  37  ? 0.492   46.443  -22.331 1.00 83.81 ? 65   ARG B CZ  1 
ATOM   5405  N  NH1 . ARG B  1  37  ? -0.458  46.445  -21.398 1.00 84.11 ? 65   ARG B NH1 1 
ATOM   5406  N  NH2 . ARG B  1  37  ? 0.328   45.743  -23.452 1.00 84.11 ? 65   ARG B NH2 1 
ATOM   5407  N  N   . GLU B  1  38  ? 2.530   52.678  -21.005 1.00 74.15 ? 66   GLU B N   1 
ATOM   5408  C  CA  . GLU B  1  38  ? 1.883   53.654  -21.888 1.00 73.51 ? 66   GLU B CA  1 
ATOM   5409  C  C   . GLU B  1  38  ? 2.724   54.901  -22.116 1.00 72.81 ? 66   GLU B C   1 
ATOM   5410  O  O   . GLU B  1  38  ? 2.971   55.295  -23.255 1.00 73.53 ? 66   GLU B O   1 
ATOM   5411  C  CB  . GLU B  1  38  ? 0.529   54.077  -21.305 1.00 73.31 ? 66   GLU B CB  1 
ATOM   5412  C  CG  . GLU B  1  38  ? -0.671  53.188  -21.678 1.00 75.78 ? 66   GLU B CG  1 
ATOM   5413  C  CD  . GLU B  1  38  ? -0.654  51.781  -21.048 1.00 76.45 ? 66   GLU B CD  1 
ATOM   5414  O  OE1 . GLU B  1  38  ? 0.130   50.916  -21.503 1.00 75.77 ? 66   GLU B OE1 1 
ATOM   5415  O  OE2 . GLU B  1  38  ? -1.440  51.540  -20.097 1.00 76.60 ? 66   GLU B OE2 1 
ATOM   5416  N  N   . GLU B  1  39  ? 3.144   55.527  -21.023 1.00 72.25 ? 67   GLU B N   1 
ATOM   5417  C  CA  . GLU B  1  39  ? 3.957   56.732  -21.096 1.00 71.86 ? 67   GLU B CA  1 
ATOM   5418  C  C   . GLU B  1  39  ? 5.111   56.578  -22.072 1.00 71.26 ? 67   GLU B C   1 
ATOM   5419  O  O   . GLU B  1  39  ? 5.377   57.478  -22.863 1.00 71.57 ? 67   GLU B O   1 
ATOM   5420  C  CB  . GLU B  1  39  ? 4.484   57.092  -19.703 1.00 72.45 ? 67   GLU B CB  1 
ATOM   5421  C  CG  . GLU B  1  39  ? 3.807   58.319  -19.094 1.00 72.88 ? 67   GLU B CG  1 
ATOM   5422  C  CD  . GLU B  1  39  ? 3.981   58.412  -17.591 1.00 72.60 ? 67   GLU B CD  1 
ATOM   5423  O  OE1 . GLU B  1  39  ? 3.537   59.423  -16.997 1.00 71.90 ? 67   GLU B OE1 1 
ATOM   5424  O  OE2 . GLU B  1  39  ? 4.555   57.467  -17.007 1.00 72.32 ? 67   GLU B OE2 1 
ATOM   5425  N  N   . LEU B  1  40  ? 5.794   55.438  -22.021 1.00 71.55 ? 68   LEU B N   1 
ATOM   5426  C  CA  . LEU B  1  40  ? 6.921   55.182  -22.916 1.00 71.59 ? 68   LEU B CA  1 
ATOM   5427  C  C   . LEU B  1  40  ? 6.448   55.246  -24.364 1.00 71.67 ? 68   LEU B C   1 
ATOM   5428  O  O   . LEU B  1  40  ? 7.120   55.804  -25.238 1.00 70.92 ? 68   LEU B O   1 
ATOM   5429  C  CB  . LEU B  1  40  ? 7.524   53.806  -22.620 1.00 71.28 ? 68   LEU B CB  1 
ATOM   5430  C  CG  . LEU B  1  40  ? 8.191   53.652  -21.251 1.00 70.72 ? 68   LEU B CG  1 
ATOM   5431  C  CD1 . LEU B  1  40  ? 8.460   52.188  -20.965 1.00 71.02 ? 68   LEU B CD1 1 
ATOM   5432  C  CD2 . LEU B  1  40  ? 9.477   54.455  -21.222 1.00 70.56 ? 68   LEU B CD2 1 
ATOM   5433  N  N   . THR B  1  41  ? 5.271   54.674  -24.593 1.00 71.83 ? 69   THR B N   1 
ATOM   5434  C  CA  . THR B  1  41  ? 4.656   54.634  -25.906 1.00 70.82 ? 69   THR B CA  1 
ATOM   5435  C  C   . THR B  1  41  ? 4.401   56.019  -26.476 1.00 71.29 ? 69   THR B C   1 
ATOM   5436  O  O   . THR B  1  41  ? 4.655   56.255  -27.653 1.00 72.00 ? 69   THR B O   1 
ATOM   5437  C  CB  . THR B  1  41  ? 3.331   53.899  -25.845 1.00 70.41 ? 69   THR B CB  1 
ATOM   5438  O  OG1 . THR B  1  41  ? 3.550   52.566  -25.375 1.00 70.30 ? 69   THR B OG1 1 
ATOM   5439  C  CG2 . THR B  1  41  ? 2.702   53.859  -27.206 1.00 71.87 ? 69   THR B CG2 1 
ATOM   5440  N  N   . ALA B  1  42  ? 3.894   56.925  -25.643 1.00 71.45 ? 70   ALA B N   1 
ATOM   5441  C  CA  . ALA B  1  42  ? 3.595   58.293  -26.062 1.00 71.79 ? 70   ALA B CA  1 
ATOM   5442  C  C   . ALA B  1  42  ? 4.847   59.109  -26.370 1.00 72.09 ? 70   ALA B C   1 
ATOM   5443  O  O   . ALA B  1  42  ? 4.839   59.957  -27.259 1.00 72.10 ? 70   ALA B O   1 
ATOM   5444  C  CB  . ALA B  1  42  ? 2.779   58.991  -25.000 1.00 71.98 ? 70   ALA B CB  1 
ATOM   5445  N  N   . VAL B  1  43  ? 5.919   58.864  -25.625 1.00 72.41 ? 71   VAL B N   1 
ATOM   5446  C  CA  . VAL B  1  43  ? 7.171   59.574  -25.855 1.00 73.04 ? 71   VAL B CA  1 
ATOM   5447  C  C   . VAL B  1  43  ? 7.738   59.092  -27.183 1.00 73.70 ? 71   VAL B C   1 
ATOM   5448  O  O   . VAL B  1  43  ? 8.246   59.878  -27.983 1.00 73.82 ? 71   VAL B O   1 
ATOM   5449  C  CB  . VAL B  1  43  ? 8.203   59.286  -24.736 1.00 73.17 ? 71   VAL B CB  1 
ATOM   5450  C  CG1 . VAL B  1  43  ? 9.545   59.938  -25.061 1.00 72.45 ? 71   VAL B CG1 1 
ATOM   5451  C  CG2 . VAL B  1  43  ? 7.682   59.805  -23.418 1.00 73.10 ? 71   VAL B CG2 1 
ATOM   5452  N  N   . MET B  1  44  ? 7.648   57.790  -27.416 1.00 72.20 ? 72   MET B N   1 
ATOM   5453  C  CA  . MET B  1  44  ? 8.151   57.236  -28.651 1.00 72.47 ? 72   MET B CA  1 
ATOM   5454  C  C   . MET B  1  44  ? 7.315   57.749  -29.831 1.00 73.43 ? 72   MET B C   1 
ATOM   5455  O  O   . MET B  1  44  ? 7.871   58.176  -30.839 1.00 73.44 ? 72   MET B O   1 
ATOM   5456  C  CB  . MET B  1  44  ? 8.134   55.706  -28.575 1.00 73.74 ? 72   MET B CB  1 
ATOM   5457  C  CG  . MET B  1  44  ? 8.686   54.985  -29.812 1.00 74.47 ? 72   MET B CG  1 
ATOM   5458  S  SD  . MET B  1  44  ? 10.227  55.691  -30.496 1.00 74.99 ? 72   MET B SD  1 
ATOM   5459  C  CE  . MET B  1  44  ? 11.416  55.052  -29.382 1.00 73.90 ? 72   MET B CE  1 
ATOM   5460  N  N   . ARG B  1  45  ? 5.987   57.728  -29.703 1.00 73.84 ? 73   ARG B N   1 
ATOM   5461  C  CA  . ARG B  1  45  ? 5.107   58.204  -30.778 1.00 74.21 ? 73   ARG B CA  1 
ATOM   5462  C  C   . ARG B  1  45  ? 5.354   59.675  -31.065 1.00 73.41 ? 73   ARG B C   1 
ATOM   5463  O  O   . ARG B  1  45  ? 5.247   60.124  -32.200 1.00 73.41 ? 73   ARG B O   1 
ATOM   5464  C  CB  . ARG B  1  45  ? 3.633   58.009  -30.415 1.00 75.90 ? 73   ARG B CB  1 
ATOM   5465  C  CG  . ARG B  1  45  ? 3.193   56.551  -30.302 1.00 77.62 ? 73   ARG B CG  1 
ATOM   5466  C  CD  . ARG B  1  45  ? 1.687   56.467  -30.011 1.00 80.84 ? 73   ARG B CD  1 
ATOM   5467  N  NE  . ARG B  1  45  ? 1.205   55.092  -29.807 1.00 82.40 ? 73   ARG B NE  1 
ATOM   5468  C  CZ  . ARG B  1  45  ? -0.078  54.752  -29.638 1.00 83.41 ? 73   ARG B CZ  1 
ATOM   5469  N  NH1 . ARG B  1  45  ? -1.034  55.682  -29.648 1.00 84.85 ? 73   ARG B NH1 1 
ATOM   5470  N  NH2 . ARG B  1  45  ? -0.413  53.478  -29.457 1.00 82.57 ? 73   ARG B NH2 1 
ATOM   5471  N  N   . PHE B  1  46  ? 5.681   60.422  -30.021 1.00 73.84 ? 74   PHE B N   1 
ATOM   5472  C  CA  . PHE B  1  46  ? 5.971   61.840  -30.150 1.00 73.36 ? 74   PHE B CA  1 
ATOM   5473  C  C   . PHE B  1  46  ? 7.241   62.018  -30.987 1.00 72.95 ? 74   PHE B C   1 
ATOM   5474  O  O   . PHE B  1  46  ? 7.282   62.822  -31.913 1.00 72.42 ? 74   PHE B O   1 
ATOM   5475  C  CB  . PHE B  1  46  ? 6.179   62.444  -28.759 1.00 72.90 ? 74   PHE B CB  1 
ATOM   5476  C  CG  . PHE B  1  46  ? 6.425   63.921  -28.769 1.00 72.82 ? 74   PHE B CG  1 
ATOM   5477  C  CD1 . PHE B  1  46  ? 5.372   64.815  -28.932 1.00 72.94 ? 74   PHE B CD1 1 
ATOM   5478  C  CD2 . PHE B  1  46  ? 7.715   64.423  -28.639 1.00 73.07 ? 74   PHE B CD2 1 
ATOM   5479  C  CE1 . PHE B  1  46  ? 5.601   66.192  -28.966 1.00 72.96 ? 74   PHE B CE1 1 
ATOM   5480  C  CE2 . PHE B  1  46  ? 7.957   65.798  -28.672 1.00 73.20 ? 74   PHE B CE2 1 
ATOM   5481  C  CZ  . PHE B  1  46  ? 6.899   66.683  -28.836 1.00 73.05 ? 74   PHE B CZ  1 
ATOM   5482  N  N   . LEU B  1  47  ? 8.266   61.238  -30.653 1.00 73.36 ? 75   LEU B N   1 
ATOM   5483  C  CA  . LEU B  1  47  ? 9.563   61.281  -31.324 1.00 74.23 ? 75   LEU B CA  1 
ATOM   5484  C  C   . LEU B  1  47  ? 9.588   60.866  -32.792 1.00 74.69 ? 75   LEU B C   1 
ATOM   5485  O  O   . LEU B  1  47  ? 10.184  61.549  -33.627 1.00 74.93 ? 75   LEU B O   1 
ATOM   5486  C  CB  . LEU B  1  47  ? 10.561  60.425  -30.551 1.00 74.13 ? 75   LEU B CB  1 
ATOM   5487  C  CG  . LEU B  1  47  ? 11.034  61.040  -29.237 1.00 74.04 ? 75   LEU B CG  1 
ATOM   5488  C  CD1 . LEU B  1  47  ? 11.962  60.072  -28.539 1.00 74.36 ? 75   LEU B CD1 1 
ATOM   5489  C  CD2 . LEU B  1  47  ? 11.740  62.359  -29.513 1.00 72.46 ? 75   LEU B CD2 1 
ATOM   5490  N  N   . THR B  1  48  ? 8.973   59.731  -33.101 1.00 75.15 ? 76   THR B N   1 
ATOM   5491  C  CA  . THR B  1  48  ? 8.917   59.257  -34.477 1.00 75.75 ? 76   THR B CA  1 
ATOM   5492  C  C   . THR B  1  48  ? 8.451   60.438  -35.337 1.00 76.26 ? 76   THR B C   1 
ATOM   5493  O  O   . THR B  1  48  ? 8.861   60.602  -36.492 1.00 75.04 ? 76   THR B O   1 
ATOM   5494  C  CB  . THR B  1  48  ? 7.892   58.101  -34.619 1.00 74.96 ? 76   THR B CB  1 
ATOM   5495  O  OG1 . THR B  1  48  ? 6.563   58.611  -34.445 1.00 73.55 ? 76   THR B OG1 1 
ATOM   5496  C  CG2 . THR B  1  48  ? 8.149   57.025  -33.568 1.00 74.87 ? 76   THR B CG2 1 
ATOM   5497  N  N   . GLN B  1  49  ? 7.607   61.267  -34.727 1.00 77.34 ? 77   GLN B N   1 
ATOM   5498  C  CA  . GLN B  1  49  ? 7.017   62.440  -35.358 1.00 76.66 ? 77   GLN B CA  1 
ATOM   5499  C  C   . GLN B  1  49  ? 7.910   63.664  -35.471 1.00 76.97 ? 77   GLN B C   1 
ATOM   5500  O  O   . GLN B  1  49  ? 7.851   64.375  -36.465 1.00 77.64 ? 77   GLN B O   1 
ATOM   5501  C  CB  . GLN B  1  49  ? 5.757   62.836  -34.604 1.00 76.05 ? 77   GLN B CB  1 
ATOM   5502  C  CG  . GLN B  1  49  ? 4.694   61.767  -34.587 1.00 78.04 ? 77   GLN B CG  1 
ATOM   5503  C  CD  . GLN B  1  49  ? 3.510   62.146  -33.715 1.00 79.57 ? 77   GLN B CD  1 
ATOM   5504  O  OE1 . GLN B  1  49  ? 3.015   63.275  -33.785 1.00 79.88 ? 77   GLN B OE1 1 
ATOM   5505  N  NE2 . GLN B  1  49  ? 3.042   61.203  -32.892 1.00 79.51 ? 77   GLN B NE2 1 
ATOM   5506  N  N   . ARG B  1  50  ? 8.723   63.923  -34.456 1.00 77.82 ? 78   ARG B N   1 
ATOM   5507  C  CA  . ARG B  1  50  ? 9.595   65.096  -34.475 1.00 78.59 ? 78   ARG B CA  1 
ATOM   5508  C  C   . ARG B  1  50  ? 10.970  64.859  -35.085 1.00 78.63 ? 78   ARG B C   1 
ATOM   5509  O  O   . ARG B  1  50  ? 11.534  65.751  -35.721 1.00 78.35 ? 78   ARG B O   1 
ATOM   5510  C  CB  . ARG B  1  50  ? 9.781   65.647  -33.059 1.00 79.70 ? 78   ARG B CB  1 
ATOM   5511  C  CG  . ARG B  1  50  ? 8.505   66.118  -32.390 1.00 80.24 ? 78   ARG B CG  1 
ATOM   5512  C  CD  . ARG B  1  50  ? 7.876   67.288  -33.129 1.00 80.42 ? 78   ARG B CD  1 
ATOM   5513  N  NE  . ARG B  1  50  ? 6.479   67.477  -32.733 1.00 82.53 ? 78   ARG B NE  1 
ATOM   5514  C  CZ  . ARG B  1  50  ? 5.507   66.582  -32.933 1.00 83.32 ? 78   ARG B CZ  1 
ATOM   5515  N  NH1 . ARG B  1  50  ? 5.771   65.424  -33.531 1.00 82.87 ? 78   ARG B NH1 1 
ATOM   5516  N  NH2 . ARG B  1  50  ? 4.263   66.841  -32.535 1.00 82.87 ? 78   ARG B NH2 1 
ATOM   5517  N  N   . LEU B  1  51  ? 11.512  63.663  -34.888 1.00 78.90 ? 79   LEU B N   1 
ATOM   5518  C  CA  . LEU B  1  51  ? 12.837  63.349  -35.405 1.00 80.18 ? 79   LEU B CA  1 
ATOM   5519  C  C   . LEU B  1  51  ? 12.883  63.063  -36.904 1.00 80.91 ? 79   LEU B C   1 
ATOM   5520  O  O   . LEU B  1  51  ? 13.921  62.643  -37.432 1.00 80.30 ? 79   LEU B O   1 
ATOM   5521  C  CB  . LEU B  1  51  ? 13.432  62.169  -34.632 1.00 79.37 ? 79   LEU B CB  1 
ATOM   5522  C  CG  . LEU B  1  51  ? 13.844  62.447  -33.182 1.00 79.29 ? 79   LEU B CG  1 
ATOM   5523  C  CD1 . LEU B  1  51  ? 14.378  61.170  -32.559 1.00 79.93 ? 79   LEU B CD1 1 
ATOM   5524  C  CD2 . LEU B  1  51  ? 14.907  63.539  -33.134 1.00 79.13 ? 79   LEU B CD2 1 
ATOM   5525  N  N   . GLY B  1  52  ? 11.770  63.320  -37.593 1.00 81.13 ? 80   GLY B N   1 
ATOM   5526  C  CA  . GLY B  1  52  ? 11.709  63.058  -39.023 1.00 81.07 ? 80   GLY B CA  1 
ATOM   5527  C  C   . GLY B  1  52  ? 11.486  61.567  -39.242 1.00 81.22 ? 80   GLY B C   1 
ATOM   5528  O  O   . GLY B  1  52  ? 11.438  60.801  -38.271 1.00 81.19 ? 80   GLY B O   1 
ATOM   5529  N  N   . PRO B  1  53  ? 11.307  61.122  -40.490 1.00 80.94 ? 81   PRO B N   1 
ATOM   5530  C  CA  . PRO B  1  53  ? 11.095  59.680  -40.700 1.00 80.77 ? 81   PRO B CA  1 
ATOM   5531  C  C   . PRO B  1  53  ? 12.387  58.853  -40.880 1.00 81.08 ? 81   PRO B C   1 
ATOM   5532  O  O   . PRO B  1  53  ? 12.357  57.615  -40.792 1.00 80.25 ? 81   PRO B O   1 
ATOM   5533  C  CB  . PRO B  1  53  ? 10.201  59.639  -41.941 1.00 80.23 ? 81   PRO B CB  1 
ATOM   5534  C  CG  . PRO B  1  53  ? 9.512   60.989  -41.919 1.00 80.33 ? 81   PRO B CG  1 
ATOM   5535  C  CD  . PRO B  1  53  ? 10.656  61.895  -41.557 1.00 80.65 ? 81   PRO B CD  1 
ATOM   5536  N  N   . GLY B  1  54  ? 13.512  59.533  -41.125 1.00 80.03 ? 82   GLY B N   1 
ATOM   5537  C  CA  . GLY B  1  54  ? 14.788  58.847  -41.311 1.00 79.10 ? 82   GLY B CA  1 
ATOM   5538  C  C   . GLY B  1  54  ? 15.244  58.076  -40.080 1.00 78.63 ? 82   GLY B C   1 
ATOM   5539  O  O   . GLY B  1  54  ? 16.341  57.488  -40.044 1.00 77.16 ? 82   GLY B O   1 
ATOM   5540  N  N   . LEU B  1  55  ? 14.383  58.096  -39.066 1.00 78.06 ? 83   LEU B N   1 
ATOM   5541  C  CA  . LEU B  1  55  ? 14.624  57.424  -37.802 1.00 76.68 ? 83   LEU B CA  1 
ATOM   5542  C  C   . LEU B  1  55  ? 14.344  55.933  -37.990 1.00 76.89 ? 83   LEU B C   1 
ATOM   5543  O  O   . LEU B  1  55  ? 13.339  55.546  -38.600 1.00 76.03 ? 83   LEU B O   1 
ATOM   5544  C  CB  . LEU B  1  55  ? 13.706  58.007  -36.732 1.00 75.97 ? 83   LEU B CB  1 
ATOM   5545  C  CG  . LEU B  1  55  ? 13.920  57.546  -35.293 1.00 76.64 ? 83   LEU B CG  1 
ATOM   5546  C  CD1 . LEU B  1  55  ? 15.164  58.211  -34.729 1.00 76.81 ? 83   LEU B CD1 1 
ATOM   5547  C  CD2 . LEU B  1  55  ? 12.698  57.911  -34.461 1.00 77.37 ? 83   LEU B CD2 1 
ATOM   5548  N  N   . VAL B  1  56  ? 15.247  55.108  -37.462 1.00 76.23 ? 84   VAL B N   1 
ATOM   5549  C  CA  . VAL B  1  56  ? 15.146  53.657  -37.562 1.00 74.33 ? 84   VAL B CA  1 
ATOM   5550  C  C   . VAL B  1  56  ? 15.083  53.028  -36.167 1.00 72.99 ? 84   VAL B C   1 
ATOM   5551  O  O   . VAL B  1  56  ? 15.503  53.638  -35.181 1.00 73.55 ? 84   VAL B O   1 
ATOM   5552  C  CB  . VAL B  1  56  ? 16.376  53.078  -38.338 1.00 74.79 ? 84   VAL B CB  1 
ATOM   5553  C  CG1 . VAL B  1  56  ? 16.724  53.991  -39.518 1.00 74.21 ? 84   VAL B CG1 1 
ATOM   5554  C  CG2 . VAL B  1  56  ? 17.579  52.928  -37.412 1.00 73.90 ? 84   VAL B CG2 1 
ATOM   5555  N  N   . ASP B  1  57  ? 14.541  51.817  -36.078 1.00 71.43 ? 85   ASP B N   1 
ATOM   5556  C  CA  . ASP B  1  57  ? 14.472  51.128  -34.795 1.00 70.78 ? 85   ASP B CA  1 
ATOM   5557  C  C   . ASP B  1  57  ? 15.921  50.816  -34.433 1.00 71.13 ? 85   ASP B C   1 
ATOM   5558  O  O   . ASP B  1  57  ? 16.643  50.221  -35.239 1.00 71.46 ? 85   ASP B O   1 
ATOM   5559  C  CB  . ASP B  1  57  ? 13.673  49.826  -34.922 1.00 70.69 ? 85   ASP B CB  1 
ATOM   5560  C  CG  . ASP B  1  57  ? 13.525  49.098  -33.599 1.00 70.54 ? 85   ASP B CG  1 
ATOM   5561  O  OD1 . ASP B  1  57  ? 14.533  49.004  -32.879 1.00 71.74 ? 85   ASP B OD1 1 
ATOM   5562  O  OD2 . ASP B  1  57  ? 12.416  48.613  -33.279 1.00 69.96 ? 85   ASP B OD2 1 
ATOM   5563  N  N   . ALA B  1  58  ? 16.343  51.224  -33.236 1.00 70.09 ? 86   ALA B N   1 
ATOM   5564  C  CA  . ALA B  1  58  ? 17.718  51.002  -32.776 1.00 68.76 ? 86   ALA B CA  1 
ATOM   5565  C  C   . ALA B  1  58  ? 18.082  49.518  -32.626 1.00 68.24 ? 86   ALA B C   1 
ATOM   5566  O  O   . ALA B  1  58  ? 19.251  49.164  -32.425 1.00 67.60 ? 86   ALA B O   1 
ATOM   5567  C  CB  . ALA B  1  58  ? 17.937  51.735  -31.455 1.00 68.29 ? 86   ALA B CB  1 
ATOM   5568  N  N   . ALA B  1  59  ? 17.074  48.658  -32.733 1.00 67.33 ? 87   ALA B N   1 
ATOM   5569  C  CA  . ALA B  1  59  ? 17.262  47.220  -32.609 1.00 65.94 ? 87   ALA B CA  1 
ATOM   5570  C  C   . ALA B  1  59  ? 17.963  46.655  -33.827 1.00 65.84 ? 87   ALA B C   1 
ATOM   5571  O  O   . ALA B  1  59  ? 18.458  45.530  -33.796 1.00 66.39 ? 87   ALA B O   1 
ATOM   5572  C  CB  . ALA B  1  59  ? 15.922  46.532  -32.423 1.00 66.68 ? 87   ALA B CB  1 
ATOM   5573  N  N   . GLN B  1  60  ? 18.000  47.432  -34.901 1.00 65.16 ? 88   GLN B N   1 
ATOM   5574  C  CA  . GLN B  1  60  ? 18.652  46.992  -36.124 1.00 64.44 ? 88   GLN B CA  1 
ATOM   5575  C  C   . GLN B  1  60  ? 19.210  48.163  -36.912 1.00 63.67 ? 88   GLN B C   1 
ATOM   5576  O  O   . GLN B  1  60  ? 19.170  48.174  -38.137 1.00 63.77 ? 88   GLN B O   1 
ATOM   5577  C  CB  . GLN B  1  60  ? 17.668  46.202  -36.981 1.00 64.56 ? 88   GLN B CB  1 
ATOM   5578  C  CG  . GLN B  1  60  ? 16.329  46.898  -37.182 1.00 66.42 ? 88   GLN B CG  1 
ATOM   5579  C  CD  . GLN B  1  60  ? 15.331  46.027  -37.935 1.00 67.39 ? 88   GLN B CD  1 
ATOM   5580  O  OE1 . GLN B  1  60  ? 15.004  44.922  -37.496 1.00 67.74 ? 88   GLN B OE1 1 
ATOM   5581  N  NE2 . GLN B  1  60  ? 14.846  46.520  -39.075 1.00 67.54 ? 88   GLN B NE2 1 
ATOM   5582  N  N   . ALA B  1  61  ? 19.733  49.150  -36.197 1.00 63.09 ? 89   ALA B N   1 
ATOM   5583  C  CA  . ALA B  1  61  ? 20.308  50.323  -36.825 1.00 62.78 ? 89   ALA B CA  1 
ATOM   5584  C  C   . ALA B  1  61  ? 21.814  50.147  -36.965 1.00 63.03 ? 89   ALA B C   1 
ATOM   5585  O  O   . ALA B  1  61  ? 22.436  49.360  -36.252 1.00 63.09 ? 89   ALA B O   1 
ATOM   5586  C  CB  . ALA B  1  61  ? 20.007  51.542  -36.000 1.00 63.00 ? 89   ALA B CB  1 
ATOM   5587  N  N   . ARG B  1  62  ? 22.399  50.879  -37.898 1.00 62.29 ? 90   ARG B N   1 
ATOM   5588  C  CA  . ARG B  1  62  ? 23.830  50.813  -38.121 1.00 62.37 ? 90   ARG B CA  1 
ATOM   5589  C  C   . ARG B  1  62  ? 24.415  52.151  -37.767 1.00 61.59 ? 90   ARG B C   1 
ATOM   5590  O  O   . ARG B  1  62  ? 23.691  53.130  -37.626 1.00 61.51 ? 90   ARG B O   1 
ATOM   5591  C  CB  . ARG B  1  62  ? 24.138  50.504  -39.585 1.00 62.46 ? 90   ARG B CB  1 
ATOM   5592  C  CG  . ARG B  1  62  ? 24.138  49.026  -39.931 1.00 63.21 ? 90   ARG B CG  1 
ATOM   5593  C  CD  . ARG B  1  62  ? 22.798  48.358  -39.641 1.00 63.62 ? 90   ARG B CD  1 
ATOM   5594  N  NE  . ARG B  1  62  ? 22.649  47.115  -40.398 1.00 64.21 ? 90   ARG B NE  1 
ATOM   5595  C  CZ  . ARG B  1  62  ? 23.404  46.032  -40.234 1.00 63.18 ? 90   ARG B CZ  1 
ATOM   5596  N  NH1 . ARG B  1  62  ? 24.371  46.021  -39.328 1.00 61.63 ? 90   ARG B NH1 1 
ATOM   5597  N  NH2 . ARG B  1  62  ? 23.199  44.967  -40.996 1.00 63.51 ? 90   ARG B NH2 1 
ATOM   5598  N  N   . PRO B  1  63  ? 25.741  52.213  -37.617 1.00 62.61 ? 91   PRO B N   1 
ATOM   5599  C  CA  . PRO B  1  63  ? 26.440  53.457  -37.276 1.00 62.37 ? 91   PRO B CA  1 
ATOM   5600  C  C   . PRO B  1  63  ? 25.905  54.687  -38.008 1.00 61.65 ? 91   PRO B C   1 
ATOM   5601  O  O   . PRO B  1  63  ? 25.863  55.777  -37.448 1.00 62.76 ? 91   PRO B O   1 
ATOM   5602  C  CB  . PRO B  1  63  ? 27.884  53.148  -37.653 1.00 62.53 ? 91   PRO B CB  1 
ATOM   5603  C  CG  . PRO B  1  63  ? 28.005  51.701  -37.273 1.00 62.66 ? 91   PRO B CG  1 
ATOM   5604  C  CD  . PRO B  1  63  ? 26.688  51.087  -37.742 1.00 61.90 ? 91   PRO B CD  1 
ATOM   5605  N  N   . SER B  1  64  ? 25.478  54.500  -39.252 1.00 62.42 ? 92   SER B N   1 
ATOM   5606  C  CA  . SER B  1  64  ? 24.976  55.601  -40.070 1.00 62.63 ? 92   SER B CA  1 
ATOM   5607  C  C   . SER B  1  64  ? 23.500  55.956  -39.916 1.00 62.20 ? 92   SER B C   1 
ATOM   5608  O  O   . SER B  1  64  ? 23.043  56.935  -40.504 1.00 62.16 ? 92   SER B O   1 
ATOM   5609  C  CB  . SER B  1  64  ? 25.252  55.305  -41.543 1.00 62.68 ? 92   SER B CB  1 
ATOM   5610  O  OG  . SER B  1  64  ? 24.622  54.099  -41.945 1.00 62.75 ? 92   SER B OG  1 
ATOM   5611  N  N   . ASP B  1  65  ? 22.754  55.177  -39.136 1.00 62.20 ? 93   ASP B N   1 
ATOM   5612  C  CA  . ASP B  1  65  ? 21.325  55.444  -38.964 1.00 62.60 ? 93   ASP B CA  1 
ATOM   5613  C  C   . ASP B  1  65  ? 21.017  56.319  -37.761 1.00 61.89 ? 93   ASP B C   1 
ATOM   5614  O  O   . ASP B  1  65  ? 21.823  56.422  -36.831 1.00 61.41 ? 93   ASP B O   1 
ATOM   5615  C  CB  . ASP B  1  65  ? 20.514  54.139  -38.805 1.00 64.23 ? 93   ASP B CB  1 
ATOM   5616  C  CG  . ASP B  1  65  ? 20.798  53.108  -39.901 1.00 64.52 ? 93   ASP B CG  1 
ATOM   5617  O  OD1 . ASP B  1  65  ? 21.078  53.505  -41.055 1.00 63.35 ? 93   ASP B OD1 1 
ATOM   5618  O  OD2 . ASP B  1  65  ? 20.722  51.891  -39.603 1.00 64.47 ? 93   ASP B OD2 1 
ATOM   5619  N  N   . ASN B  1  66  ? 19.840  56.948  -37.804 1.00 61.60 ? 94   ASN B N   1 
ATOM   5620  C  CA  . ASN B  1  66  ? 19.341  57.780  -36.713 1.00 60.83 ? 94   ASN B CA  1 
ATOM   5621  C  C   . ASN B  1  66  ? 18.375  56.887  -35.941 1.00 61.79 ? 94   ASN B C   1 
ATOM   5622  O  O   . ASN B  1  66  ? 17.372  56.446  -36.497 1.00 61.44 ? 94   ASN B O   1 
ATOM   5623  C  CB  . ASN B  1  66  ? 18.576  58.991  -37.239 1.00 59.97 ? 94   ASN B CB  1 
ATOM   5624  C  CG  . ASN B  1  66  ? 19.483  60.137  -37.614 1.00 61.36 ? 94   ASN B CG  1 
ATOM   5625  O  OD1 . ASN B  1  66  ? 20.613  60.248  -37.123 1.00 61.43 ? 94   ASN B OD1 1 
ATOM   5626  N  ND2 . ASN B  1  66  ? 18.987  61.019  -38.474 1.00 61.21 ? 94   ASN B ND2 1 
ATOM   5627  N  N   . CYS B  1  67  ? 18.673  56.612  -34.673 1.00 62.06 ? 95   CYS B N   1 
ATOM   5628  C  CA  . CYS B  1  67  ? 17.818  55.745  -33.865 1.00 60.89 ? 95   CYS B CA  1 
ATOM   5629  C  C   . CYS B  1  67  ? 17.770  56.169  -32.415 1.00 60.39 ? 95   CYS B C   1 
ATOM   5630  O  O   . CYS B  1  67  ? 18.728  56.737  -31.882 1.00 59.50 ? 95   CYS B O   1 
ATOM   5631  C  CB  . CYS B  1  67  ? 18.304  54.295  -33.931 1.00 61.77 ? 95   CYS B CB  1 
ATOM   5632  S  SG  . CYS B  1  67  ? 19.909  54.017  -33.134 1.00 62.70 ? 95   CYS B SG  1 
ATOM   5633  N  N   . VAL B  1  68  ? 16.644  55.869  -31.779 1.00 60.56 ? 96   VAL B N   1 
ATOM   5634  C  CA  . VAL B  1  68  ? 16.443  56.208  -30.382 1.00 60.72 ? 96   VAL B CA  1 
ATOM   5635  C  C   . VAL B  1  68  ? 16.937  55.062  -29.488 1.00 61.59 ? 96   VAL B C   1 
ATOM   5636  O  O   . VAL B  1  68  ? 16.314  53.992  -29.403 1.00 60.76 ? 96   VAL B O   1 
ATOM   5637  C  CB  . VAL B  1  68  ? 14.953  56.518  -30.104 1.00 59.73 ? 96   VAL B CB  1 
ATOM   5638  C  CG1 . VAL B  1  68  ? 14.772  56.944  -28.676 1.00 60.07 ? 96   VAL B CG1 1 
ATOM   5639  C  CG2 . VAL B  1  68  ? 14.473  57.627  -31.022 1.00 59.51 ? 96   VAL B CG2 1 
ATOM   5640  N  N   . PHE B  1  69  ? 18.074  55.314  -28.834 1.00 60.65 ? 97   PHE B N   1 
ATOM   5641  C  CA  . PHE B  1  69  ? 18.735  54.364  -27.947 1.00 58.92 ? 97   PHE B CA  1 
ATOM   5642  C  C   . PHE B  1  69  ? 17.931  54.066  -26.689 1.00 59.81 ? 97   PHE B C   1 
ATOM   5643  O  O   . PHE B  1  69  ? 17.772  52.903  -26.302 1.00 60.01 ? 97   PHE B O   1 
ATOM   5644  C  CB  . PHE B  1  69  ? 20.119  54.904  -27.551 1.00 58.62 ? 97   PHE B CB  1 
ATOM   5645  C  CG  . PHE B  1  69  ? 20.899  53.984  -26.652 1.00 59.43 ? 97   PHE B CG  1 
ATOM   5646  C  CD1 . PHE B  1  69  ? 21.338  52.749  -27.108 1.00 60.16 ? 97   PHE B CD1 1 
ATOM   5647  C  CD2 . PHE B  1  69  ? 21.143  54.325  -25.331 1.00 59.05 ? 97   PHE B CD2 1 
ATOM   5648  C  CE1 . PHE B  1  69  ? 21.999  51.873  -26.255 1.00 59.81 ? 97   PHE B CE1 1 
ATOM   5649  C  CE2 . PHE B  1  69  ? 21.801  53.453  -24.482 1.00 58.02 ? 97   PHE B CE2 1 
ATOM   5650  C  CZ  . PHE B  1  69  ? 22.226  52.229  -24.942 1.00 58.72 ? 97   PHE B CZ  1 
ATOM   5651  N  N   . SER B  1  70  ? 17.421  55.115  -26.050 1.00 60.19 ? 98   SER B N   1 
ATOM   5652  C  CA  . SER B  1  70  ? 16.665  54.928  -24.821 1.00 60.13 ? 98   SER B CA  1 
ATOM   5653  C  C   . SER B  1  70  ? 15.689  56.041  -24.493 1.00 59.55 ? 98   SER B C   1 
ATOM   5654  O  O   . SER B  1  70  ? 15.798  57.157  -24.991 1.00 60.83 ? 98   SER B O   1 
ATOM   5655  C  CB  . SER B  1  70  ? 17.634  54.789  -23.652 1.00 60.48 ? 98   SER B CB  1 
ATOM   5656  O  OG  . SER B  1  70  ? 18.367  55.991  -23.476 1.00 58.96 ? 98   SER B OG  1 
ATOM   5657  N  N   . VAL B  1  71  ? 14.737  55.706  -23.634 1.00 59.66 ? 99   VAL B N   1 
ATOM   5658  C  CA  . VAL B  1  71  ? 13.735  56.639  -23.151 1.00 60.95 ? 99   VAL B CA  1 
ATOM   5659  C  C   . VAL B  1  71  ? 13.298  56.070  -21.815 1.00 61.44 ? 99   VAL B C   1 
ATOM   5660  O  O   . VAL B  1  71  ? 12.861  54.918  -21.741 1.00 60.92 ? 99   VAL B O   1 
ATOM   5661  C  CB  . VAL B  1  71  ? 12.500  56.720  -24.073 1.00 60.18 ? 99   VAL B CB  1 
ATOM   5662  C  CG1 . VAL B  1  71  ? 11.487  57.694  -23.506 1.00 59.20 ? 99   VAL B CG1 1 
ATOM   5663  C  CG2 . VAL B  1  71  ? 12.908  57.162  -25.438 1.00 60.24 ? 99   VAL B CG2 1 
ATOM   5664  N  N   . GLU B  1  72  ? 13.463  56.859  -20.757 1.00 61.43 ? 100  GLU B N   1 
ATOM   5665  C  CA  . GLU B  1  72  ? 13.052  56.444  -19.416 1.00 61.55 ? 100  GLU B CA  1 
ATOM   5666  C  C   . GLU B  1  72  ? 12.732  57.678  -18.584 1.00 61.66 ? 100  GLU B C   1 
ATOM   5667  O  O   . GLU B  1  72  ? 12.820  58.804  -19.090 1.00 60.79 ? 100  GLU B O   1 
ATOM   5668  C  CB  . GLU B  1  72  ? 14.136  55.607  -18.717 1.00 61.95 ? 100  GLU B CB  1 
ATOM   5669  C  CG  . GLU B  1  72  ? 15.292  56.389  -18.091 1.00 62.36 ? 100  GLU B CG  1 
ATOM   5670  C  CD  . GLU B  1  72  ? 15.959  55.610  -16.960 1.00 62.79 ? 100  GLU B CD  1 
ATOM   5671  O  OE1 . GLU B  1  72  ? 15.281  55.339  -15.940 1.00 62.20 ? 100  GLU B OE1 1 
ATOM   5672  O  OE2 . GLU B  1  72  ? 17.154  55.266  -17.092 1.00 63.16 ? 100  GLU B OE2 1 
ATOM   5673  N  N   . LEU B  1  73  ? 12.360  57.476  -17.319 1.00 60.74 ? 101  LEU B N   1 
ATOM   5674  C  CA  . LEU B  1  73  ? 12.023  58.608  -16.465 1.00 61.20 ? 101  LEU B CA  1 
ATOM   5675  C  C   . LEU B  1  73  ? 13.157  59.607  -16.287 1.00 60.84 ? 101  LEU B C   1 
ATOM   5676  O  O   . LEU B  1  73  ? 14.322  59.248  -16.077 1.00 59.98 ? 101  LEU B O   1 
ATOM   5677  C  CB  . LEU B  1  73  ? 11.561  58.153  -15.076 1.00 61.21 ? 101  LEU B CB  1 
ATOM   5678  C  CG  . LEU B  1  73  ? 11.289  59.321  -14.113 1.00 60.07 ? 101  LEU B CG  1 
ATOM   5679  C  CD1 . LEU B  1  73  ? 10.164  60.167  -14.659 1.00 59.50 ? 101  LEU B CD1 1 
ATOM   5680  C  CD2 . LEU B  1  73  ? 10.947  58.808  -12.727 1.00 59.65 ? 101  LEU B CD2 1 
ATOM   5681  N  N   . GLN B  1  74  ? 12.787  60.872  -16.397 1.00 59.36 ? 102  GLN B N   1 
ATOM   5682  C  CA  . GLN B  1  74  ? 13.708  61.960  -16.205 1.00 58.91 ? 102  GLN B CA  1 
ATOM   5683  C  C   . GLN B  1  74  ? 13.280  62.409  -14.827 1.00 59.72 ? 102  GLN B C   1 
ATOM   5684  O  O   . GLN B  1  74  ? 12.117  62.745  -14.625 1.00 60.70 ? 102  GLN B O   1 
ATOM   5685  C  CB  . GLN B  1  74  ? 13.452  63.046  -17.242 1.00 59.69 ? 102  GLN B CB  1 
ATOM   5686  C  CG  . GLN B  1  74  ? 14.079  64.377  -16.918 1.00 59.72 ? 102  GLN B CG  1 
ATOM   5687  C  CD  . GLN B  1  74  ? 15.531  64.258  -16.524 1.00 60.18 ? 102  GLN B CD  1 
ATOM   5688  O  OE1 . GLN B  1  74  ? 16.363  63.765  -17.284 1.00 60.19 ? 102  GLN B OE1 1 
ATOM   5689  N  NE2 . GLN B  1  74  ? 15.845  64.715  -15.324 1.00 61.37 ? 102  GLN B NE2 1 
ATOM   5690  N  N   . LEU B  1  75  ? 14.200  62.374  -13.870 1.00 60.10 ? 103  LEU B N   1 
ATOM   5691  C  CA  . LEU B  1  75  ? 13.885  62.765  -12.502 1.00 59.18 ? 103  LEU B CA  1 
ATOM   5692  C  C   . LEU B  1  75  ? 13.522  64.232  -12.338 1.00 60.06 ? 103  LEU B C   1 
ATOM   5693  O  O   . LEU B  1  75  ? 14.118  65.119  -12.952 1.00 59.82 ? 103  LEU B O   1 
ATOM   5694  C  CB  . LEU B  1  75  ? 15.049  62.435  -11.586 1.00 58.14 ? 103  LEU B CB  1 
ATOM   5695  C  CG  . LEU B  1  75  ? 15.406  60.956  -11.546 1.00 59.17 ? 103  LEU B CG  1 
ATOM   5696  C  CD1 . LEU B  1  75  ? 16.581  60.780  -10.614 1.00 59.01 ? 103  LEU B CD1 1 
ATOM   5697  C  CD2 . LEU B  1  75  ? 14.208  60.123  -11.088 1.00 58.78 ? 103  LEU B CD2 1 
ATOM   5698  N  N   . PRO B  1  76  ? 12.520  64.508  -11.498 1.00 61.02 ? 104  PRO B N   1 
ATOM   5699  C  CA  . PRO B  1  76  ? 12.118  65.897  -11.290 1.00 60.18 ? 104  PRO B CA  1 
ATOM   5700  C  C   . PRO B  1  76  ? 13.086  66.592  -10.338 1.00 60.29 ? 104  PRO B C   1 
ATOM   5701  O  O   . PRO B  1  76  ? 13.705  65.945  -9.494  1.00 60.91 ? 104  PRO B O   1 
ATOM   5702  C  CB  . PRO B  1  76  ? 10.719  65.751  -10.703 1.00 59.45 ? 104  PRO B CB  1 
ATOM   5703  C  CG  . PRO B  1  76  ? 10.832  64.494  -9.892  1.00 58.78 ? 104  PRO B CG  1 
ATOM   5704  C  CD  . PRO B  1  76  ? 11.616  63.576  -10.793 1.00 60.12 ? 104  PRO B CD  1 
ATOM   5705  N  N   . PRO B  1  77  ? 13.252  67.917  -10.479 1.00 60.30 ? 105  PRO B N   1 
ATOM   5706  C  CA  . PRO B  1  77  ? 14.153  68.694  -9.608  1.00 61.08 ? 105  PRO B CA  1 
ATOM   5707  C  C   . PRO B  1  77  ? 13.689  68.527  -8.160  1.00 60.70 ? 105  PRO B C   1 
ATOM   5708  O  O   . PRO B  1  77  ? 12.489  68.425  -7.904  1.00 60.71 ? 105  PRO B O   1 
ATOM   5709  C  CB  . PRO B  1  77  ? 13.987  70.121  -10.121 1.00 60.53 ? 105  PRO B CB  1 
ATOM   5710  C  CG  . PRO B  1  77  ? 12.569  70.107  -10.687 1.00 61.10 ? 105  PRO B CG  1 
ATOM   5711  C  CD  . PRO B  1  77  ? 12.534  68.792  -11.417 1.00 60.09 ? 105  PRO B CD  1 
ATOM   5712  N  N   . LYS B  1  78  ? 14.623  68.503  -7.215  1.00 60.98 ? 106  LYS B N   1 
ATOM   5713  C  CA  . LYS B  1  78  ? 14.262  68.268  -5.819  1.00 60.80 ? 106  LYS B CA  1 
ATOM   5714  C  C   . LYS B  1  78  ? 13.390  69.336  -5.192  1.00 61.33 ? 106  LYS B C   1 
ATOM   5715  O  O   . LYS B  1  78  ? 12.501  69.023  -4.399  1.00 61.57 ? 106  LYS B O   1 
ATOM   5716  C  CB  . LYS B  1  78  ? 15.523  68.067  -4.979  1.00 59.96 ? 106  LYS B CB  1 
ATOM   5717  C  CG  . LYS B  1  78  ? 15.287  67.539  -3.573  1.00 59.51 ? 106  LYS B CG  1 
ATOM   5718  C  CD  . LYS B  1  78  ? 16.626  67.349  -2.865  1.00 60.57 ? 106  LYS B CD  1 
ATOM   5719  C  CE  . LYS B  1  78  ? 16.477  66.779  -1.459  1.00 60.62 ? 106  LYS B CE  1 
ATOM   5720  N  NZ  . LYS B  1  78  ? 17.799  66.547  -0.789  1.00 59.17 ? 106  LYS B NZ  1 
ATOM   5721  N  N   . ALA B  1  79  ? 13.635  70.591  -5.547  1.00 61.52 ? 107  ALA B N   1 
ATOM   5722  C  CA  . ALA B  1  79  ? 12.864  71.696  -4.990  1.00 61.92 ? 107  ALA B CA  1 
ATOM   5723  C  C   . ALA B  1  79  ? 11.367  71.528  -5.249  1.00 61.84 ? 107  ALA B C   1 
ATOM   5724  O  O   . ALA B  1  79  ? 10.559  71.464  -4.319  1.00 61.41 ? 107  ALA B O   1 
ATOM   5725  C  CB  . ALA B  1  79  ? 13.357  73.009  -5.577  1.00 61.51 ? 107  ALA B CB  1 
ATOM   5726  N  N   . ALA B  1  80  ? 11.005  71.467  -6.521  1.00 61.14 ? 108  ALA B N   1 
ATOM   5727  C  CA  . ALA B  1  80  ? 9.620   71.305  -6.908  1.00 61.78 ? 108  ALA B CA  1 
ATOM   5728  C  C   . ALA B  1  80  ? 9.112   69.987  -6.361  1.00 62.07 ? 108  ALA B C   1 
ATOM   5729  O  O   . ALA B  1  80  ? 7.976   69.884  -5.904  1.00 62.62 ? 108  ALA B O   1 
ATOM   5730  C  CB  . ALA B  1  80  ? 9.514   71.309  -8.411  1.00 63.59 ? 108  ALA B CB  1 
ATOM   5731  N  N   . ALA B  1  81  ? 9.971   68.977  -6.424  1.00 63.01 ? 109  ALA B N   1 
ATOM   5732  C  CA  . ALA B  1  81  ? 9.633   67.649  -5.948  1.00 62.62 ? 109  ALA B CA  1 
ATOM   5733  C  C   . ALA B  1  81  ? 9.177   67.736  -4.505  1.00 63.52 ? 109  ALA B C   1 
ATOM   5734  O  O   . ALA B  1  81  ? 8.115   67.228  -4.153  1.00 63.76 ? 109  ALA B O   1 
ATOM   5735  C  CB  . ALA B  1  81  ? 10.832  66.743  -6.063  1.00 63.00 ? 109  ALA B CB  1 
ATOM   5736  N  N   . LEU B  1  82  ? 9.982   68.387  -3.674  1.00 63.69 ? 110  LEU B N   1 
ATOM   5737  C  CA  . LEU B  1  82  ? 9.653   68.541  -2.267  1.00 64.31 ? 110  LEU B CA  1 
ATOM   5738  C  C   . LEU B  1  82  ? 8.420   69.421  -2.049  1.00 65.42 ? 110  LEU B C   1 
ATOM   5739  O  O   . LEU B  1  82  ? 7.501   69.040  -1.318  1.00 66.12 ? 110  LEU B O   1 
ATOM   5740  C  CB  . LEU B  1  82  ? 10.848  69.121  -1.507  1.00 64.32 ? 110  LEU B CB  1 
ATOM   5741  C  CG  . LEU B  1  82  ? 12.092  68.238  -1.423  1.00 64.01 ? 110  LEU B CG  1 
ATOM   5742  C  CD1 . LEU B  1  82  ? 13.078  68.821  -0.422  1.00 63.59 ? 110  LEU B CD1 1 
ATOM   5743  C  CD2 . LEU B  1  82  ? 11.679  66.841  -0.999  1.00 63.71 ? 110  LEU B CD2 1 
ATOM   5744  N  N   . ALA B  1  83  ? 8.390   70.592  -2.681  1.00 65.72 ? 111  ALA B N   1 
ATOM   5745  C  CA  . ALA B  1  83  ? 7.251   71.498  -2.529  1.00 66.53 ? 111  ALA B CA  1 
ATOM   5746  C  C   . ALA B  1  83  ? 5.924   70.758  -2.708  1.00 66.87 ? 111  ALA B C   1 
ATOM   5747  O  O   . ALA B  1  83  ? 4.976   70.964  -1.960  1.00 66.40 ? 111  ALA B O   1 
ATOM   5748  C  CB  . ALA B  1  83  ? 7.353   72.634  -3.526  1.00 66.31 ? 111  ALA B CB  1 
ATOM   5749  N  N   . HIS B  1  84  ? 5.864   69.891  -3.704  1.00 66.81 ? 112  HIS B N   1 
ATOM   5750  C  CA  . HIS B  1  84  ? 4.661   69.127  -3.956  1.00 67.60 ? 112  HIS B CA  1 
ATOM   5751  C  C   . HIS B  1  84  ? 4.320   68.183  -2.798  1.00 67.74 ? 112  HIS B C   1 
ATOM   5752  O  O   . HIS B  1  84  ? 3.166   68.041  -2.394  1.00 67.36 ? 112  HIS B O   1 
ATOM   5753  C  CB  . HIS B  1  84  ? 4.842   68.313  -5.228  1.00 69.06 ? 112  HIS B CB  1 
ATOM   5754  C  CG  . HIS B  1  84  ? 3.827   67.229  -5.390  1.00 71.62 ? 112  HIS B CG  1 
ATOM   5755  N  ND1 . HIS B  1  84  ? 2.503   67.485  -5.669  1.00 71.74 ? 112  HIS B ND1 1 
ATOM   5756  C  CD2 . HIS B  1  84  ? 3.932   65.886  -5.259  1.00 72.21 ? 112  HIS B CD2 1 
ATOM   5757  C  CE1 . HIS B  1  84  ? 1.835   66.348  -5.702  1.00 72.84 ? 112  HIS B CE1 1 
ATOM   5758  N  NE2 . HIS B  1  84  ? 2.679   65.363  -5.454  1.00 73.50 ? 112  HIS B NE2 1 
ATOM   5759  N  N   . LEU B  1  85  ? 5.342   67.533  -2.269  1.00 68.50 ? 113  LEU B N   1 
ATOM   5760  C  CA  . LEU B  1  85  ? 5.156   66.578  -1.190  1.00 69.88 ? 113  LEU B CA  1 
ATOM   5761  C  C   . LEU B  1  85  ? 4.899   67.190  0.175   1.00 70.43 ? 113  LEU B C   1 
ATOM   5762  O  O   . LEU B  1  85  ? 4.282   66.555  1.041   1.00 70.41 ? 113  LEU B O   1 
ATOM   5763  C  CB  . LEU B  1  85  ? 6.371   65.655  -1.107  1.00 69.40 ? 113  LEU B CB  1 
ATOM   5764  C  CG  . LEU B  1  85  ? 6.633   64.829  -2.366  1.00 69.10 ? 113  LEU B CG  1 
ATOM   5765  C  CD1 . LEU B  1  85  ? 7.785   63.883  -2.114  1.00 69.08 ? 113  LEU B CD1 1 
ATOM   5766  C  CD2 . LEU B  1  85  ? 5.380   64.045  -2.745  1.00 70.07 ? 113  LEU B CD2 1 
ATOM   5767  N  N   . ASP B  1  86  ? 5.372   68.415  0.377   1.00 70.22 ? 114  ASP B N   1 
ATOM   5768  C  CA  . ASP B  1  86  ? 5.181   69.071  1.663   1.00 70.59 ? 114  ASP B CA  1 
ATOM   5769  C  C   . ASP B  1  86  ? 4.146   70.190  1.647   1.00 70.58 ? 114  ASP B C   1 
ATOM   5770  O  O   . ASP B  1  86  ? 3.100   70.040  2.272   1.00 71.29 ? 114  ASP B O   1 
ATOM   5771  C  CB  . ASP B  1  86  ? 6.520   69.569  2.195   1.00 71.56 ? 114  ASP B CB  1 
ATOM   5772  C  CG  . ASP B  1  86  ? 7.516   68.435  2.405   1.00 72.48 ? 114  ASP B CG  1 
ATOM   5773  O  OD1 . ASP B  1  86  ? 7.089   67.251  2.390   1.00 72.21 ? 114  ASP B OD1 1 
ATOM   5774  O  OD2 . ASP B  1  86  ? 8.724   68.726  2.591   1.00 72.86 ? 114  ASP B OD2 1 
ATOM   5775  N  N   . ARG B  1  87  ? 4.411   71.300  0.955   1.00 70.41 ? 115  ARG B N   1 
ATOM   5776  C  CA  . ARG B  1  87  ? 3.424   72.384  0.900   1.00 69.88 ? 115  ARG B CA  1 
ATOM   5777  C  C   . ARG B  1  87  ? 2.151   71.823  0.263   1.00 69.96 ? 115  ARG B C   1 
ATOM   5778  O  O   . ARG B  1  87  ? 1.032   72.121  0.693   1.00 70.41 ? 115  ARG B O   1 
ATOM   5779  C  CB  . ARG B  1  87  ? 3.887   73.558  0.022   1.00 71.02 ? 115  ARG B CB  1 
ATOM   5780  C  CG  . ARG B  1  87  ? 5.090   74.381  0.474   1.00 71.36 ? 115  ARG B CG  1 
ATOM   5781  C  CD  . ARG B  1  87  ? 5.321   75.497  -0.563  1.00 72.62 ? 115  ARG B CD  1 
ATOM   5782  N  NE  . ARG B  1  87  ? 6.731   75.703  -0.916  1.00 74.60 ? 115  ARG B NE  1 
ATOM   5783  C  CZ  . ARG B  1  87  ? 7.148   76.251  -2.062  1.00 75.79 ? 115  ARG B CZ  1 
ATOM   5784  N  NH1 . ARG B  1  87  ? 6.269   76.648  -2.979  1.00 76.01 ? 115  ARG B NH1 1 
ATOM   5785  N  NH2 . ARG B  1  87  ? 8.445   76.412  -2.297  1.00 76.15 ? 115  ARG B NH2 1 
ATOM   5786  N  N   . GLY B  1  88  ? 2.345   71.005  -0.766  1.00 69.00 ? 116  GLY B N   1 
ATOM   5787  C  CA  . GLY B  1  88  ? 1.232   70.425  -1.489  1.00 68.26 ? 116  GLY B CA  1 
ATOM   5788  C  C   . GLY B  1  88  ? 1.242   71.052  -2.870  1.00 67.64 ? 116  GLY B C   1 
ATOM   5789  O  O   . GLY B  1  88  ? 0.475   70.665  -3.749  1.00 67.01 ? 116  GLY B O   1 
ATOM   5790  N  N   . SER B  1  89  ? 2.137   72.023  -3.046  1.00 67.26 ? 117  SER B N   1 
ATOM   5791  C  CA  . SER B  1  89  ? 2.305   72.752  -4.300  1.00 67.16 ? 117  SER B CA  1 
ATOM   5792  C  C   . SER B  1  89  ? 2.193   71.862  -5.530  1.00 67.17 ? 117  SER B C   1 
ATOM   5793  O  O   . SER B  1  89  ? 2.381   70.649  -5.449  1.00 67.39 ? 117  SER B O   1 
ATOM   5794  C  CB  . SER B  1  89  ? 3.665   73.458  -4.322  1.00 66.80 ? 117  SER B CB  1 
ATOM   5795  O  OG  . SER B  1  89  ? 3.728   74.487  -3.355  1.00 66.46 ? 117  SER B OG  1 
ATOM   5796  N  N   . PRO B  1  90  ? 1.890   72.463  -6.695  1.00 67.23 ? 118  PRO B N   1 
ATOM   5797  C  CA  . PRO B  1  90  ? 1.757   71.708  -7.945  1.00 67.57 ? 118  PRO B CA  1 
ATOM   5798  C  C   . PRO B  1  90  ? 3.073   71.040  -8.372  1.00 66.98 ? 118  PRO B C   1 
ATOM   5799  O  O   . PRO B  1  90  ? 4.077   71.711  -8.624  1.00 66.49 ? 118  PRO B O   1 
ATOM   5800  C  CB  . PRO B  1  90  ? 1.262   72.768  -8.938  1.00 67.63 ? 118  PRO B CB  1 
ATOM   5801  C  CG  . PRO B  1  90  ? 1.866   74.036  -8.414  1.00 67.07 ? 118  PRO B CG  1 
ATOM   5802  C  CD  . PRO B  1  90  ? 1.644   73.899  -6.922  1.00 67.42 ? 118  PRO B CD  1 
ATOM   5803  N  N   . PRO B  1  91  ? 3.068   69.701  -8.474  1.00 67.26 ? 119  PRO B N   1 
ATOM   5804  C  CA  . PRO B  1  91  ? 4.249   68.929  -8.861  1.00 66.68 ? 119  PRO B CA  1 
ATOM   5805  C  C   . PRO B  1  91  ? 4.833   69.382  -10.177 1.00 66.74 ? 119  PRO B C   1 
ATOM   5806  O  O   . PRO B  1  91  ? 4.135   69.977  -10.999 1.00 66.16 ? 119  PRO B O   1 
ATOM   5807  C  CB  . PRO B  1  91  ? 3.719   67.501  -8.929  1.00 66.70 ? 119  PRO B CB  1 
ATOM   5808  C  CG  . PRO B  1  91  ? 2.328   67.699  -9.403  1.00 66.99 ? 119  PRO B CG  1 
ATOM   5809  C  CD  . PRO B  1  91  ? 1.864   68.852  -8.532  1.00 68.07 ? 119  PRO B CD  1 
ATOM   5810  N  N   . PRO B  1  92  ? 6.137   69.120  -10.383 1.00 67.33 ? 120  PRO B N   1 
ATOM   5811  C  CA  . PRO B  1  92  ? 6.814   69.506  -11.625 1.00 67.62 ? 120  PRO B CA  1 
ATOM   5812  C  C   . PRO B  1  92  ? 6.258   68.694  -12.798 1.00 66.91 ? 120  PRO B C   1 
ATOM   5813  O  O   . PRO B  1  92  ? 5.321   67.910  -12.623 1.00 66.91 ? 120  PRO B O   1 
ATOM   5814  C  CB  . PRO B  1  92  ? 8.288   69.214  -11.322 1.00 66.89 ? 120  PRO B CB  1 
ATOM   5815  C  CG  . PRO B  1  92  ? 8.219   68.096  -10.325 1.00 66.36 ? 120  PRO B CG  1 
ATOM   5816  C  CD  . PRO B  1  92  ? 7.091   68.525  -9.427  1.00 65.93 ? 120  PRO B CD  1 
ATOM   5817  N  N   . ALA B  1  93  ? 6.822   68.877  -13.986 1.00 65.91 ? 121  ALA B N   1 
ATOM   5818  C  CA  . ALA B  1  93  ? 6.330   68.150  -15.145 1.00 66.72 ? 121  ALA B CA  1 
ATOM   5819  C  C   . ALA B  1  93  ? 7.004   66.782  -15.331 1.00 67.75 ? 121  ALA B C   1 
ATOM   5820  O  O   . ALA B  1  93  ? 8.225   66.647  -15.140 1.00 67.08 ? 121  ALA B O   1 
ATOM   5821  C  CB  . ALA B  1  93  ? 6.503   69.005  -16.396 1.00 67.25 ? 121  ALA B CB  1 
ATOM   5822  N  N   . ARG B  1  94  ? 6.192   65.776  -15.682 1.00 67.63 ? 122  ARG B N   1 
ATOM   5823  C  CA  . ARG B  1  94  ? 6.667   64.404  -15.926 1.00 66.92 ? 122  ARG B CA  1 
ATOM   5824  C  C   . ARG B  1  94  ? 7.427   64.383  -17.234 1.00 66.16 ? 122  ARG B C   1 
ATOM   5825  O  O   . ARG B  1  94  ? 6.830   64.387  -18.316 1.00 66.47 ? 122  ARG B O   1 
ATOM   5826  C  CB  . ARG B  1  94  ? 5.499   63.413  -16.038 1.00 67.18 ? 122  ARG B CB  1 
ATOM   5827  C  CG  . ARG B  1  94  ? 4.918   62.963  -14.713 1.00 68.53 ? 122  ARG B CG  1 
ATOM   5828  C  CD  . ARG B  1  94  ? 5.758   61.875  -14.076 1.00 68.45 ? 122  ARG B CD  1 
ATOM   5829  N  NE  . ARG B  1  94  ? 5.567   60.586  -14.727 1.00 67.98 ? 122  ARG B NE  1 
ATOM   5830  C  CZ  . ARG B  1  94  ? 6.128   59.457  -14.308 1.00 69.18 ? 122  ARG B CZ  1 
ATOM   5831  N  NH1 . ARG B  1  94  ? 6.917   59.461  -13.242 1.00 69.87 ? 122  ARG B NH1 1 
ATOM   5832  N  NH2 . ARG B  1  94  ? 5.895   58.321  -14.947 1.00 69.83 ? 122  ARG B NH2 1 
ATOM   5833  N  N   . GLU B  1  95  ? 8.747   64.359  -17.135 1.00 65.67 ? 123  GLU B N   1 
ATOM   5834  C  CA  . GLU B  1  95  ? 9.568   64.351  -18.322 1.00 65.28 ? 123  GLU B CA  1 
ATOM   5835  C  C   . GLU B  1  95  ? 10.268  63.027  -18.513 1.00 64.96 ? 123  GLU B C   1 
ATOM   5836  O  O   . GLU B  1  95  ? 10.316  62.185  -17.614 1.00 65.34 ? 123  GLU B O   1 
ATOM   5837  C  CB  . GLU B  1  95  ? 10.582  65.485  -18.252 1.00 64.38 ? 123  GLU B CB  1 
ATOM   5838  C  CG  . GLU B  1  95  ? 9.928   66.851  -18.214 1.00 64.10 ? 123  GLU B CG  1 
ATOM   5839  C  CD  . GLU B  1  95  ? 10.900  67.943  -17.825 1.00 66.05 ? 123  GLU B CD  1 
ATOM   5840  O  OE1 . GLU B  1  95  ? 11.494  67.842  -16.723 1.00 66.27 ? 123  GLU B OE1 1 
ATOM   5841  O  OE2 . GLU B  1  95  ? 11.068  68.901  -18.616 1.00 66.22 ? 123  GLU B OE2 1 
ATOM   5842  N  N   . ALA B  1  96  ? 10.800  62.843  -19.710 1.00 64.89 ? 124  ALA B N   1 
ATOM   5843  C  CA  . ALA B  1  96  ? 11.508  61.628  -20.033 1.00 64.23 ? 124  ALA B CA  1 
ATOM   5844  C  C   . ALA B  1  96  ? 12.780  62.007  -20.761 1.00 62.97 ? 124  ALA B C   1 
ATOM   5845  O  O   . ALA B  1  96  ? 12.817  62.984  -21.506 1.00 62.60 ? 124  ALA B O   1 
ATOM   5846  C  CB  . ALA B  1  96  ? 10.643  60.744  -20.901 1.00 64.61 ? 124  ALA B CB  1 
ATOM   5847  N  N   . LEU B  1  97  ? 13.831  61.244  -20.521 1.00 62.73 ? 125  LEU B N   1 
ATOM   5848  C  CA  . LEU B  1  97  ? 15.091  61.508  -21.176 1.00 63.09 ? 125  LEU B CA  1 
ATOM   5849  C  C   . LEU B  1  97  ? 15.290  60.422  -22.229 1.00 64.15 ? 125  LEU B C   1 
ATOM   5850  O  O   . LEU B  1  97  ? 15.208  59.219  -21.945 1.00 63.78 ? 125  LEU B O   1 
ATOM   5851  C  CB  . LEU B  1  97  ? 16.224  61.496  -20.156 1.00 62.29 ? 125  LEU B CB  1 
ATOM   5852  C  CG  . LEU B  1  97  ? 17.590  61.983  -20.627 1.00 61.43 ? 125  LEU B CG  1 
ATOM   5853  C  CD1 . LEU B  1  97  ? 17.457  63.385  -21.188 1.00 62.35 ? 125  LEU B CD1 1 
ATOM   5854  C  CD2 . LEU B  1  97  ? 18.568  61.956  -19.456 1.00 62.43 ? 125  LEU B CD2 1 
ATOM   5855  N  N   . ALA B  1  98  ? 15.520  60.858  -23.459 1.00 63.53 ? 126  ALA B N   1 
ATOM   5856  C  CA  . ALA B  1  98  ? 15.718  59.935  -24.543 1.00 62.14 ? 126  ALA B CA  1 
ATOM   5857  C  C   . ALA B  1  98  ? 17.056  60.224  -25.153 1.00 62.61 ? 126  ALA B C   1 
ATOM   5858  O  O   . ALA B  1  98  ? 17.398  61.378  -25.399 1.00 61.74 ? 126  ALA B O   1 
ATOM   5859  C  CB  . ALA B  1  98  ? 14.636  60.111  -25.572 1.00 62.58 ? 126  ALA B CB  1 
ATOM   5860  N  N   . ILE B  1  99  ? 17.836  59.177  -25.361 1.00 63.75 ? 127  ILE B N   1 
ATOM   5861  C  CA  . ILE B  1  99  ? 19.121  59.360  -25.993 1.00 64.89 ? 127  ILE B CA  1 
ATOM   5862  C  C   . ILE B  1  99  ? 18.893  58.907  -27.408 1.00 64.03 ? 127  ILE B C   1 
ATOM   5863  O  O   . ILE B  1  99  ? 18.296  57.860  -27.648 1.00 62.60 ? 127  ILE B O   1 
ATOM   5864  C  CB  . ILE B  1  99  ? 20.223  58.521  -25.344 1.00 63.93 ? 127  ILE B CB  1 
ATOM   5865  C  CG1 . ILE B  1  99  ? 20.341  58.907  -23.872 1.00 63.34 ? 127  ILE B CG1 1 
ATOM   5866  C  CG2 . ILE B  1  99  ? 21.552  58.775  -26.056 1.00 62.80 ? 127  ILE B CG2 1 
ATOM   5867  C  CD1 . ILE B  1  99  ? 21.363  58.134  -23.130 1.00 63.80 ? 127  ILE B CD1 1 
ATOM   5868  N  N   . VAL B  1  100 ? 19.336  59.728  -28.344 1.00 65.12 ? 128  VAL B N   1 
ATOM   5869  C  CA  . VAL B  1  100 ? 19.171  59.416  -29.744 1.00 65.49 ? 128  VAL B CA  1 
ATOM   5870  C  C   . VAL B  1  100 ? 20.544  59.440  -30.374 1.00 66.11 ? 128  VAL B C   1 
ATOM   5871  O  O   . VAL B  1  100 ? 21.331  60.344  -30.114 1.00 66.35 ? 128  VAL B O   1 
ATOM   5872  C  CB  . VAL B  1  100 ? 18.301  60.467  -30.446 1.00 65.73 ? 128  VAL B CB  1 
ATOM   5873  C  CG1 . VAL B  1  100 ? 17.667  59.866  -31.693 1.00 65.35 ? 128  VAL B CG1 1 
ATOM   5874  C  CG2 . VAL B  1  100 ? 17.249  60.994  -29.489 1.00 65.38 ? 128  VAL B CG2 1 
ATOM   5875  N  N   . PHE B  1  101 ? 20.841  58.427  -31.176 1.00 66.71 ? 129  PHE B N   1 
ATOM   5876  C  CA  . PHE B  1  101 ? 22.122  58.365  -31.868 1.00 67.95 ? 129  PHE B CA  1 
ATOM   5877  C  C   . PHE B  1  101 ? 21.851  59.056  -33.209 1.00 68.15 ? 129  PHE B C   1 
ATOM   5878  O  O   . PHE B  1  101 ? 20.874  58.730  -33.884 1.00 68.72 ? 129  PHE B O   1 
ATOM   5879  C  CB  . PHE B  1  101 ? 22.550  56.896  -32.102 1.00 67.28 ? 129  PHE B CB  1 
ATOM   5880  C  CG  . PHE B  1  101 ? 22.932  56.133  -30.837 1.00 66.59 ? 129  PHE B CG  1 
ATOM   5881  C  CD1 . PHE B  1  101 ? 23.366  54.810  -30.919 1.00 65.68 ? 129  PHE B CD1 1 
ATOM   5882  C  CD2 . PHE B  1  101 ? 22.845  56.723  -29.576 1.00 66.90 ? 129  PHE B CD2 1 
ATOM   5883  C  CE1 . PHE B  1  101 ? 23.705  54.087  -29.774 1.00 64.63 ? 129  PHE B CE1 1 
ATOM   5884  C  CE2 . PHE B  1  101 ? 23.182  56.004  -28.425 1.00 66.04 ? 129  PHE B CE2 1 
ATOM   5885  C  CZ  . PHE B  1  101 ? 23.612  54.684  -28.529 1.00 65.51 ? 129  PHE B CZ  1 
ATOM   5886  N  N   . PHE B  1  102 ? 22.681  60.017  -33.599 1.00 67.48 ? 130  PHE B N   1 
ATOM   5887  C  CA  . PHE B  1  102 ? 22.447  60.696  -34.869 1.00 68.92 ? 130  PHE B CA  1 
ATOM   5888  C  C   . PHE B  1  102 ? 23.537  60.393  -35.882 1.00 70.26 ? 130  PHE B C   1 
ATOM   5889  O  O   . PHE B  1  102 ? 24.453  61.191  -36.066 1.00 71.36 ? 130  PHE B O   1 
ATOM   5890  C  CB  . PHE B  1  102 ? 22.341  62.210  -34.646 1.00 69.52 ? 130  PHE B CB  1 
ATOM   5891  C  CG  . PHE B  1  102 ? 20.991  62.664  -34.139 1.00 69.13 ? 130  PHE B CG  1 
ATOM   5892  C  CD1 . PHE B  1  102 ? 20.888  63.720  -33.235 1.00 68.95 ? 130  PHE B CD1 1 
ATOM   5893  C  CD2 . PHE B  1  102 ? 19.819  62.045  -34.573 1.00 69.10 ? 130  PHE B CD2 1 
ATOM   5894  C  CE1 . PHE B  1  102 ? 19.636  64.151  -32.768 1.00 69.35 ? 130  PHE B CE1 1 
ATOM   5895  C  CE2 . PHE B  1  102 ? 18.562  62.473  -34.111 1.00 69.27 ? 130  PHE B CE2 1 
ATOM   5896  C  CZ  . PHE B  1  102 ? 18.473  63.525  -33.208 1.00 69.04 ? 130  PHE B CZ  1 
ATOM   5897  N  N   . GLY B  1  103 ? 23.429  59.244  -36.545 1.00 70.68 ? 131  GLY B N   1 
ATOM   5898  C  CA  . GLY B  1  103 ? 24.430  58.854  -37.525 1.00 72.19 ? 131  GLY B CA  1 
ATOM   5899  C  C   . GLY B  1  103 ? 24.088  59.300  -38.929 1.00 73.08 ? 131  GLY B C   1 
ATOM   5900  O  O   . GLY B  1  103 ? 24.930  59.271  -39.830 1.00 72.97 ? 131  GLY B O   1 
ATOM   5901  N  N   . ARG B  1  104 ? 22.837  59.710  -39.102 1.00 73.39 ? 132  ARG B N   1 
ATOM   5902  C  CA  . ARG B  1  104 ? 22.328  60.175  -40.381 1.00 73.54 ? 132  ARG B CA  1 
ATOM   5903  C  C   . ARG B  1  104 ? 22.676  61.633  -40.572 1.00 74.16 ? 132  ARG B C   1 
ATOM   5904  O  O   . ARG B  1  104 ? 21.787  62.469  -40.704 1.00 75.01 ? 132  ARG B O   1 
ATOM   5905  C  CB  . ARG B  1  104 ? 20.813  60.047  -40.417 1.00 75.88 ? 132  ARG B CB  1 
ATOM   5906  C  CG  . ARG B  1  104 ? 20.201  60.456  -41.732 1.00 77.13 ? 132  ARG B CG  1 
ATOM   5907  C  CD  . ARG B  1  104 ? 20.528  59.386  -42.728 1.00 80.06 ? 132  ARG B CD  1 
ATOM   5908  N  NE  . ARG B  1  104 ? 20.050  58.098  -42.231 1.00 82.85 ? 132  ARG B NE  1 
ATOM   5909  C  CZ  . ARG B  1  104 ? 20.578  56.920  -42.552 1.00 84.09 ? 132  ARG B CZ  1 
ATOM   5910  N  NH1 . ARG B  1  104 ? 21.623  56.848  -43.377 1.00 83.48 ? 132  ARG B NH1 1 
ATOM   5911  N  NH2 . ARG B  1  104 ? 20.054  55.810  -42.044 1.00 84.70 ? 132  ARG B NH2 1 
ATOM   5912  N  N   . GLN B  1  105 ? 23.961  61.947  -40.588 1.00 74.63 ? 133  GLN B N   1 
ATOM   5913  C  CA  . GLN B  1  105 ? 24.366  63.331  -40.755 1.00 74.92 ? 133  GLN B CA  1 
ATOM   5914  C  C   . GLN B  1  105 ? 25.866  63.470  -40.925 1.00 76.40 ? 133  GLN B C   1 
ATOM   5915  O  O   . GLN B  1  105 ? 26.635  62.577  -40.539 1.00 76.14 ? 133  GLN B O   1 
ATOM   5916  C  CB  . GLN B  1  105 ? 23.920  64.149  -39.545 1.00 75.09 ? 133  GLN B CB  1 
ATOM   5917  C  CG  . GLN B  1  105 ? 24.489  63.656  -38.226 1.00 74.75 ? 133  GLN B CG  1 
ATOM   5918  C  CD  . GLN B  1  105 ? 23.955  64.433  -37.048 1.00 74.79 ? 133  GLN B CD  1 
ATOM   5919  O  OE1 . GLN B  1  105 ? 22.747  64.483  -36.823 1.00 74.74 ? 133  GLN B OE1 1 
ATOM   5920  N  NE2 . GLN B  1  105 ? 24.849  65.049  -36.286 1.00 74.36 ? 133  GLN B NE2 1 
ATOM   5921  N  N   . PRO B  1  106 ? 26.306  64.598  -41.510 1.00 76.67 ? 134  PRO B N   1 
ATOM   5922  C  CA  . PRO B  1  106 ? 27.736  64.828  -41.716 1.00 77.08 ? 134  PRO B CA  1 
ATOM   5923  C  C   . PRO B  1  106 ? 28.499  64.632  -40.410 1.00 77.44 ? 134  PRO B C   1 
ATOM   5924  O  O   . PRO B  1  106 ? 29.329  63.727  -40.304 1.00 77.56 ? 134  PRO B O   1 
ATOM   5925  C  CB  . PRO B  1  106 ? 27.787  66.267  -42.232 1.00 76.20 ? 134  PRO B CB  1 
ATOM   5926  C  CG  . PRO B  1  106 ? 26.548  66.883  -41.663 1.00 76.73 ? 134  PRO B CG  1 
ATOM   5927  C  CD  . PRO B  1  106 ? 25.533  65.797  -41.873 1.00 76.50 ? 134  PRO B CD  1 
ATOM   5928  N  N   . GLN B  1  107 ? 28.201  65.468  -39.417 1.00 77.65 ? 135  GLN B N   1 
ATOM   5929  C  CA  . GLN B  1  107 ? 28.857  65.369  -38.116 1.00 77.93 ? 135  GLN B CA  1 
ATOM   5930  C  C   . GLN B  1  107 ? 27.961  64.667  -37.090 1.00 78.17 ? 135  GLN B C   1 
ATOM   5931  O  O   . GLN B  1  107 ? 27.286  65.319  -36.289 1.00 78.49 ? 135  GLN B O   1 
ATOM   5932  C  CB  . GLN B  1  107 ? 29.241  66.765  -37.616 1.00 77.92 ? 135  GLN B CB  1 
ATOM   5933  C  CG  . GLN B  1  107 ? 30.294  67.452  -38.477 1.00 79.30 ? 135  GLN B CG  1 
ATOM   5934  C  CD  . GLN B  1  107 ? 30.865  68.700  -37.827 1.00 80.50 ? 135  GLN B CD  1 
ATOM   5935  O  OE1 . GLN B  1  107 ? 31.375  68.650  -36.701 1.00 80.92 ? 135  GLN B OE1 1 
ATOM   5936  N  NE2 . GLN B  1  107 ? 30.790  69.830  -38.536 1.00 81.47 ? 135  GLN B NE2 1 
ATOM   5937  N  N   . PRO B  1  108 ? 27.950  63.320  -37.099 1.00 77.18 ? 136  PRO B N   1 
ATOM   5938  C  CA  . PRO B  1  108 ? 27.130  62.546  -36.168 1.00 76.50 ? 136  PRO B CA  1 
ATOM   5939  C  C   . PRO B  1  108 ? 27.407  62.818  -34.690 1.00 76.42 ? 136  PRO B C   1 
ATOM   5940  O  O   . PRO B  1  108 ? 28.545  63.063  -34.282 1.00 77.09 ? 136  PRO B O   1 
ATOM   5941  C  CB  . PRO B  1  108 ? 27.446  61.103  -36.561 1.00 77.27 ? 136  PRO B CB  1 
ATOM   5942  C  CG  . PRO B  1  108 ? 27.717  61.210  -38.028 1.00 77.12 ? 136  PRO B CG  1 
ATOM   5943  C  CD  . PRO B  1  108 ? 28.617  62.419  -38.055 1.00 77.17 ? 136  PRO B CD  1 
ATOM   5944  N  N   . ASN B  1  109 ? 26.343  62.779  -33.894 1.00 76.54 ? 137  ASN B N   1 
ATOM   5945  C  CA  . ASN B  1  109 ? 26.440  62.991  -32.457 1.00 75.63 ? 137  ASN B CA  1 
ATOM   5946  C  C   . ASN B  1  109 ? 25.392  62.128  -31.763 1.00 75.21 ? 137  ASN B C   1 
ATOM   5947  O  O   . ASN B  1  109 ? 24.593  61.442  -32.413 1.00 74.45 ? 137  ASN B O   1 
ATOM   5948  C  CB  . ASN B  1  109 ? 26.239  64.492  -32.102 1.00 75.80 ? 137  ASN B CB  1 
ATOM   5949  C  CG  . ASN B  1  109 ? 24.765  64.975  -32.207 1.00 75.31 ? 137  ASN B CG  1 
ATOM   5950  O  OD1 . ASN B  1  109 ? 23.890  64.482  -31.487 1.00 74.73 ? 137  ASN B OD1 1 
ATOM   5951  N  ND2 . ASN B  1  109 ? 24.513  65.956  -33.085 1.00 75.53 ? 137  ASN B ND2 1 
ATOM   5952  N  N   . VAL B  1  110 ? 25.442  62.121  -30.440 1.00 75.31 ? 138  VAL B N   1 
ATOM   5953  C  CA  . VAL B  1  110 ? 24.458  61.407  -29.637 1.00 75.69 ? 138  VAL B CA  1 
ATOM   5954  C  C   . VAL B  1  110 ? 23.932  62.532  -28.763 1.00 74.24 ? 138  VAL B C   1 
ATOM   5955  O  O   . VAL B  1  110 ? 24.701  63.397  -28.330 1.00 73.26 ? 138  VAL B O   1 
ATOM   5956  C  CB  . VAL B  1  110 ? 25.078  60.269  -28.762 1.00 75.12 ? 138  VAL B CB  1 
ATOM   5957  C  CG1 . VAL B  1  110 ? 25.430  59.072  -29.632 1.00 74.07 ? 138  VAL B CG1 1 
ATOM   5958  C  CG2 . VAL B  1  110 ? 26.308  60.767  -28.047 1.00 74.88 ? 138  VAL B CG2 1 
ATOM   5959  N  N   . SER B  1  111 ? 22.629  62.554  -28.527 1.00 73.70 ? 139  SER B N   1 
ATOM   5960  C  CA  . SER B  1  111 ? 22.093  63.629  -27.730 1.00 73.40 ? 139  SER B CA  1 
ATOM   5961  C  C   . SER B  1  111 ? 21.002  63.246  -26.771 1.00 72.38 ? 139  SER B C   1 
ATOM   5962  O  O   . SER B  1  111 ? 20.253  62.291  -26.972 1.00 71.23 ? 139  SER B O   1 
ATOM   5963  C  CB  . SER B  1  111 ? 21.622  64.762  -28.635 1.00 73.69 ? 139  SER B CB  1 
ATOM   5964  O  OG  . SER B  1  111 ? 20.797  64.256  -29.659 1.00 74.83 ? 139  SER B OG  1 
ATOM   5965  N  N   . GLU B  1  112 ? 20.958  64.028  -25.706 1.00 72.34 ? 140  GLU B N   1 
ATOM   5966  C  CA  . GLU B  1  112 ? 20.011  63.866  -24.640 1.00 72.61 ? 140  GLU B CA  1 
ATOM   5967  C  C   . GLU B  1  112 ? 18.919  64.873  -24.864 1.00 72.47 ? 140  GLU B C   1 
ATOM   5968  O  O   . GLU B  1  112 ? 19.163  66.077  -24.886 1.00 71.69 ? 140  GLU B O   1 
ATOM   5969  C  CB  . GLU B  1  112 ? 20.702  64.118  -23.303 1.00 73.23 ? 140  GLU B CB  1 
ATOM   5970  C  CG  . GLU B  1  112 ? 21.702  63.034  -22.946 1.00 73.72 ? 140  GLU B CG  1 
ATOM   5971  C  CD  . GLU B  1  112 ? 22.471  63.316  -21.669 1.00 73.99 ? 140  GLU B CD  1 
ATOM   5972  O  OE1 . GLU B  1  112 ? 23.035  62.349  -21.111 1.00 73.97 ? 140  GLU B OE1 1 
ATOM   5973  O  OE2 . GLU B  1  112 ? 22.523  64.487  -21.231 1.00 73.39 ? 140  GLU B OE2 1 
ATOM   5974  N  N   . LEU B  1  113 ? 17.712  64.365  -25.047 1.00 72.72 ? 141  LEU B N   1 
ATOM   5975  C  CA  . LEU B  1  113 ? 16.566  65.216  -25.272 1.00 72.85 ? 141  LEU B CA  1 
ATOM   5976  C  C   . LEU B  1  113 ? 15.539  64.929  -24.207 1.00 72.68 ? 141  LEU B C   1 
ATOM   5977  O  O   . LEU B  1  113 ? 15.239  63.772  -23.912 1.00 72.07 ? 141  LEU B O   1 
ATOM   5978  C  CB  . LEU B  1  113 ? 15.958  64.939  -26.643 1.00 72.03 ? 141  LEU B CB  1 
ATOM   5979  C  CG  . LEU B  1  113 ? 16.972  64.849  -27.779 1.00 72.29 ? 141  LEU B CG  1 
ATOM   5980  C  CD1 . LEU B  1  113 ? 16.250  64.545  -29.082 1.00 71.94 ? 141  LEU B CD1 1 
ATOM   5981  C  CD2 . LEU B  1  113 ? 17.762  66.142  -27.865 1.00 71.38 ? 141  LEU B CD2 1 
ATOM   5982  N  N   . VAL B  1  114 ? 15.004  65.993  -23.629 1.00 73.16 ? 142  VAL B N   1 
ATOM   5983  C  CA  . VAL B  1  114 ? 13.990  65.863  -22.602 1.00 73.80 ? 142  VAL B CA  1 
ATOM   5984  C  C   . VAL B  1  114 ? 12.618  66.087  -23.255 1.00 73.56 ? 142  VAL B C   1 
ATOM   5985  O  O   . VAL B  1  114 ? 12.372  67.121  -23.877 1.00 73.10 ? 142  VAL B O   1 
ATOM   5986  C  CB  . VAL B  1  114 ? 14.233  66.881  -21.483 1.00 73.11 ? 142  VAL B CB  1 
ATOM   5987  C  CG1 . VAL B  1  114 ? 13.484  66.467  -20.238 1.00 74.06 ? 142  VAL B CG1 1 
ATOM   5988  C  CG2 . VAL B  1  114 ? 15.712  66.976  -21.197 1.00 72.39 ? 142  VAL B CG2 1 
ATOM   5989  N  N   . VAL B  1  115 ? 11.737  65.101  -23.114 1.00 73.78 ? 143  VAL B N   1 
ATOM   5990  C  CA  . VAL B  1  115 ? 10.404  65.147  -23.708 1.00 74.16 ? 143  VAL B CA  1 
ATOM   5991  C  C   . VAL B  1  115 ? 9.283   65.210  -22.682 1.00 75.05 ? 143  VAL B C   1 
ATOM   5992  O  O   . VAL B  1  115 ? 9.417   64.691  -21.577 1.00 75.91 ? 143  VAL B O   1 
ATOM   5993  C  CB  . VAL B  1  115 ? 10.163  63.905  -24.573 1.00 74.76 ? 143  VAL B CB  1 
ATOM   5994  C  CG1 . VAL B  1  115 ? 8.774   63.957  -25.195 1.00 74.66 ? 143  VAL B CG1 1 
ATOM   5995  C  CG2 . VAL B  1  115 ? 11.244  63.805  -25.631 1.00 74.85 ? 143  VAL B CG2 1 
ATOM   5996  N  N   . GLY B  1  116 ? 8.168   65.828  -23.063 1.00 75.38 ? 144  GLY B N   1 
ATOM   5997  C  CA  . GLY B  1  116 ? 7.037   65.938  -22.163 1.00 74.86 ? 144  GLY B CA  1 
ATOM   5998  C  C   . GLY B  1  116 ? 6.134   67.097  -22.531 1.00 74.52 ? 144  GLY B C   1 
ATOM   5999  O  O   . GLY B  1  116 ? 6.282   67.690  -23.597 1.00 74.33 ? 144  GLY B O   1 
ATOM   6000  N  N   . PRO B  1  117 ? 5.176   67.436  -21.665 1.00 74.73 ? 145  PRO B N   1 
ATOM   6001  C  CA  . PRO B  1  117 ? 4.944   66.749  -20.395 1.00 75.43 ? 145  PRO B CA  1 
ATOM   6002  C  C   . PRO B  1  117 ? 3.958   65.585  -20.530 1.00 75.88 ? 145  PRO B C   1 
ATOM   6003  O  O   . PRO B  1  117 ? 2.905   65.711  -21.167 1.00 75.19 ? 145  PRO B O   1 
ATOM   6004  C  CB  . PRO B  1  117 ? 4.413   67.862  -19.510 1.00 75.45 ? 145  PRO B CB  1 
ATOM   6005  C  CG  . PRO B  1  117 ? 3.582   68.644  -20.470 1.00 75.66 ? 145  PRO B CG  1 
ATOM   6006  C  CD  . PRO B  1  117 ? 4.447   68.714  -21.710 1.00 75.04 ? 145  PRO B CD  1 
ATOM   6007  N  N   . LEU B  1  118 ? 4.315   64.455  -19.925 1.00 76.54 ? 146  LEU B N   1 
ATOM   6008  C  CA  . LEU B  1  118 ? 3.487   63.253  -19.958 1.00 76.09 ? 146  LEU B CA  1 
ATOM   6009  C  C   . LEU B  1  118 ? 2.165   63.467  -19.246 1.00 76.53 ? 146  LEU B C   1 
ATOM   6010  O  O   . LEU B  1  118 ? 2.046   64.339  -18.386 1.00 76.52 ? 146  LEU B O   1 
ATOM   6011  C  CB  . LEU B  1  118 ? 4.226   62.083  -19.309 1.00 75.36 ? 146  LEU B CB  1 
ATOM   6012  C  CG  . LEU B  1  118 ? 5.394   61.556  -20.133 1.00 74.92 ? 146  LEU B CG  1 
ATOM   6013  C  CD1 . LEU B  1  118 ? 6.231   60.631  -19.293 1.00 75.48 ? 146  LEU B CD1 1 
ATOM   6014  C  CD2 . LEU B  1  118 ? 4.864   60.851  -21.360 1.00 74.82 ? 146  LEU B CD2 1 
ATOM   6015  N  N   . PRO B  1  119 ? 1.155   62.650  -19.579 1.00 76.74 ? 147  PRO B N   1 
ATOM   6016  C  CA  . PRO B  1  119 ? 1.221   61.562  -20.561 1.00 76.55 ? 147  PRO B CA  1 
ATOM   6017  C  C   . PRO B  1  119 ? 1.092   62.051  -22.010 1.00 76.91 ? 147  PRO B C   1 
ATOM   6018  O  O   . PRO B  1  119 ? 1.328   61.292  -22.956 1.00 76.32 ? 147  PRO B O   1 
ATOM   6019  C  CB  . PRO B  1  119 ? 0.054   60.678  -20.149 1.00 76.73 ? 147  PRO B CB  1 
ATOM   6020  C  CG  . PRO B  1  119 ? -0.986  61.713  -19.798 1.00 76.77 ? 147  PRO B CG  1 
ATOM   6021  C  CD  . PRO B  1  119 ? -0.194  62.736  -18.987 1.00 76.57 ? 147  PRO B CD  1 
ATOM   6022  N  N   . HIS B  1  120 ? 0.703   63.313  -22.178 1.00 76.93 ? 148  HIS B N   1 
ATOM   6023  C  CA  . HIS B  1  120 ? 0.545   63.883  -23.509 1.00 75.58 ? 148  HIS B CA  1 
ATOM   6024  C  C   . HIS B  1  120 ? 1.642   64.906  -23.738 1.00 76.31 ? 148  HIS B C   1 
ATOM   6025  O  O   . HIS B  1  120 ? 1.516   66.076  -23.366 1.00 75.77 ? 148  HIS B O   1 
ATOM   6026  C  CB  . HIS B  1  120 ? -0.838  64.514  -23.646 1.00 74.97 ? 148  HIS B CB  1 
ATOM   6027  C  CG  . HIS B  1  120 ? -1.953  63.571  -23.314 1.00 75.67 ? 148  HIS B CG  1 
ATOM   6028  N  ND1 . HIS B  1  120 ? -2.066  62.322  -23.888 1.00 75.72 ? 148  HIS B ND1 1 
ATOM   6029  C  CD2 . HIS B  1  120 ? -2.988  63.680  -22.447 1.00 75.64 ? 148  HIS B CD2 1 
ATOM   6030  C  CE1 . HIS B  1  120 ? -3.122  61.703  -23.390 1.00 75.22 ? 148  HIS B CE1 1 
ATOM   6031  N  NE2 . HIS B  1  120 ? -3.699  62.505  -22.513 1.00 75.28 ? 148  HIS B NE2 1 
ATOM   6032  N  N   . PRO B  1  121 ? 2.754   64.456  -24.341 1.00 76.10 ? 149  PRO B N   1 
ATOM   6033  C  CA  . PRO B  1  121 ? 3.918   65.285  -24.644 1.00 75.05 ? 149  PRO B CA  1 
ATOM   6034  C  C   . PRO B  1  121 ? 3.562   66.434  -25.564 1.00 75.24 ? 149  PRO B C   1 
ATOM   6035  O  O   . PRO B  1  121 ? 2.524   66.419  -26.215 1.00 75.04 ? 149  PRO B O   1 
ATOM   6036  C  CB  . PRO B  1  121 ? 4.879   64.300  -25.305 1.00 75.13 ? 149  PRO B CB  1 
ATOM   6037  C  CG  . PRO B  1  121 ? 4.512   62.995  -24.685 1.00 75.44 ? 149  PRO B CG  1 
ATOM   6038  C  CD  . PRO B  1  121 ? 3.011   63.055  -24.718 1.00 75.73 ? 149  PRO B CD  1 
ATOM   6039  N  N   . SER B  1  122 ? 4.428   67.437  -25.598 1.00 75.48 ? 150  SER B N   1 
ATOM   6040  C  CA  . SER B  1  122 ? 4.228   68.586  -26.455 1.00 74.17 ? 150  SER B CA  1 
ATOM   6041  C  C   . SER B  1  122 ? 5.595   69.161  -26.768 1.00 74.83 ? 150  SER B C   1 
ATOM   6042  O  O   . SER B  1  122 ? 5.947   69.308  -27.931 1.00 76.18 ? 150  SER B O   1 
ATOM   6043  C  CB  . SER B  1  122 ? 3.340   69.637  -25.780 1.00 74.90 ? 150  SER B CB  1 
ATOM   6044  O  OG  . SER B  1  122 ? 4.011   70.312  -24.734 1.00 75.89 ? 150  SER B OG  1 
ATOM   6045  N  N   . TYR B  1  123 ? 6.384   69.473  -25.746 1.00 75.47 ? 151  TYR B N   1 
ATOM   6046  C  CA  . TYR B  1  123 ? 7.713   70.014  -26.006 1.00 75.56 ? 151  TYR B CA  1 
ATOM   6047  C  C   . TYR B  1  123 ? 8.740   68.903  -26.158 1.00 75.14 ? 151  TYR B C   1 
ATOM   6048  O  O   . TYR B  1  123 ? 8.414   67.718  -26.181 1.00 74.61 ? 151  TYR B O   1 
ATOM   6049  C  CB  . TYR B  1  123 ? 8.156   71.008  -24.911 1.00 74.88 ? 151  TYR B CB  1 
ATOM   6050  C  CG  . TYR B  1  123 ? 8.186   70.449  -23.506 1.00 75.56 ? 151  TYR B CG  1 
ATOM   6051  C  CD1 . TYR B  1  123 ? 9.092   69.451  -23.143 1.00 75.78 ? 151  TYR B CD1 1 
ATOM   6052  C  CD2 . TYR B  1  123 ? 7.287   70.903  -22.538 1.00 76.23 ? 151  TYR B CD2 1 
ATOM   6053  C  CE1 . TYR B  1  123 ? 9.097   68.913  -21.843 1.00 76.04 ? 151  TYR B CE1 1 
ATOM   6054  C  CE2 . TYR B  1  123 ? 7.281   70.373  -21.237 1.00 75.83 ? 151  TYR B CE2 1 
ATOM   6055  C  CZ  . TYR B  1  123 ? 8.185   69.380  -20.898 1.00 75.98 ? 151  TYR B CZ  1 
ATOM   6056  O  OH  . TYR B  1  123 ? 8.165   68.846  -19.629 1.00 74.91 ? 151  TYR B OH  1 
ATOM   6057  N  N   . MET B  1  124 ? 9.990   69.311  -26.261 1.00 75.20 ? 152  MET B N   1 
ATOM   6058  C  CA  . MET B  1  124 ? 11.100  68.400  -26.441 1.00 75.41 ? 152  MET B CA  1 
ATOM   6059  C  C   . MET B  1  124 ? 12.272  69.355  -26.445 1.00 75.58 ? 152  MET B C   1 
ATOM   6060  O  O   . MET B  1  124 ? 12.131  70.482  -26.920 1.00 76.29 ? 152  MET B O   1 
ATOM   6061  C  CB  . MET B  1  124 ? 10.977  67.702  -27.799 1.00 75.42 ? 152  MET B CB  1 
ATOM   6062  C  CG  . MET B  1  124 ? 12.223  66.939  -28.244 1.00 76.42 ? 152  MET B CG  1 
ATOM   6063  S  SD  . MET B  1  124 ? 12.068  66.162  -29.889 1.00 77.85 ? 152  MET B SD  1 
ATOM   6064  C  CE  . MET B  1  124 ? 13.097  67.231  -30.907 1.00 75.76 ? 152  MET B CE  1 
ATOM   6065  N  N   . ARG B  1  125 ? 13.417  68.944  -25.916 1.00 74.18 ? 153  ARG B N   1 
ATOM   6066  C  CA  . ARG B  1  125 ? 14.543  69.858  -25.909 1.00 74.52 ? 153  ARG B CA  1 
ATOM   6067  C  C   . ARG B  1  125 ? 15.891  69.242  -25.606 1.00 74.83 ? 153  ARG B C   1 
ATOM   6068  O  O   . ARG B  1  125 ? 16.098  68.632  -24.554 1.00 74.55 ? 153  ARG B O   1 
ATOM   6069  C  CB  . ARG B  1  125 ? 14.271  71.008  -24.931 1.00 74.90 ? 153  ARG B CB  1 
ATOM   6070  C  CG  . ARG B  1  125 ? 14.071  70.571  -23.497 1.00 75.23 ? 153  ARG B CG  1 
ATOM   6071  C  CD  . ARG B  1  125 ? 13.422  71.666  -22.663 1.00 75.42 ? 153  ARG B CD  1 
ATOM   6072  N  NE  . ARG B  1  125 ? 13.232  71.244  -21.274 1.00 75.59 ? 153  ARG B NE  1 
ATOM   6073  C  CZ  . ARG B  1  125 ? 14.198  71.200  -20.358 1.00 74.67 ? 153  ARG B CZ  1 
ATOM   6074  N  NH1 . ARG B  1  125 ? 15.438  71.562  -20.674 1.00 74.19 ? 153  ARG B NH1 1 
ATOM   6075  N  NH2 . ARG B  1  125 ? 13.920  70.780  -19.127 1.00 73.96 ? 153  ARG B NH2 1 
ATOM   6076  N  N   . ASP B  1  126 ? 16.810  69.406  -26.550 1.00 74.43 ? 154  ASP B N   1 
ATOM   6077  C  CA  . ASP B  1  126 ? 18.148  68.902  -26.368 1.00 74.11 ? 154  ASP B CA  1 
ATOM   6078  C  C   . ASP B  1  126 ? 18.654  69.592  -25.126 1.00 74.99 ? 154  ASP B C   1 
ATOM   6079  O  O   . ASP B  1  126 ? 18.342  70.757  -24.869 1.00 73.42 ? 154  ASP B O   1 
ATOM   6080  C  CB  . ASP B  1  126 ? 19.038  69.250  -27.556 1.00 75.18 ? 154  ASP B CB  1 
ATOM   6081  C  CG  . ASP B  1  126 ? 20.520  69.115  -27.236 1.00 76.65 ? 154  ASP B CG  1 
ATOM   6082  O  OD1 . ASP B  1  126 ? 21.026  69.912  -26.411 1.00 78.05 ? 154  ASP B OD1 1 
ATOM   6083  O  OD2 . ASP B  1  126 ? 21.180  68.217  -27.805 1.00 77.27 ? 154  ASP B OD2 1 
ATOM   6084  N  N   . VAL B  1  127 ? 19.436  68.851  -24.359 1.00 75.83 ? 155  VAL B N   1 
ATOM   6085  C  CA  . VAL B  1  127 ? 19.993  69.344  -23.121 1.00 74.53 ? 155  VAL B CA  1 
ATOM   6086  C  C   . VAL B  1  127 ? 21.444  68.913  -23.070 1.00 74.66 ? 155  VAL B C   1 
ATOM   6087  O  O   . VAL B  1  127 ? 22.187  69.308  -22.175 1.00 75.02 ? 155  VAL B O   1 
ATOM   6088  C  CB  . VAL B  1  127 ? 19.221  68.748  -21.940 1.00 74.32 ? 155  VAL B CB  1 
ATOM   6089  C  CG1 . VAL B  1  127 ? 17.779  69.217  -21.999 1.00 74.50 ? 155  VAL B CG1 1 
ATOM   6090  C  CG2 . VAL B  1  127 ? 19.268  67.221  -21.998 1.00 74.02 ? 155  VAL B CG2 1 
ATOM   6091  N  N   . THR B  1  128 ? 21.827  68.104  -24.055 1.00 74.49 ? 156  THR B N   1 
ATOM   6092  C  CA  . THR B  1  128 ? 23.177  67.559  -24.193 1.00 74.68 ? 156  THR B CA  1 
ATOM   6093  C  C   . THR B  1  128 ? 24.299  68.565  -23.913 1.00 75.37 ? 156  THR B C   1 
ATOM   6094  O  O   . THR B  1  128 ? 25.046  68.442  -22.928 1.00 75.43 ? 156  THR B O   1 
ATOM   6095  C  CB  . THR B  1  128 ? 23.362  67.004  -25.606 1.00 74.55 ? 156  THR B CB  1 
ATOM   6096  O  OG1 . THR B  1  128 ? 22.307  66.073  -25.886 1.00 74.49 ? 156  THR B OG1 1 
ATOM   6097  C  CG2 . THR B  1  128 ? 24.716  66.323  -25.739 1.00 74.76 ? 156  THR B CG2 1 
ATOM   6098  N  N   . VAL B  1  129 ? 24.420  69.546  -24.803 1.00 75.65 ? 157  VAL B N   1 
ATOM   6099  C  CA  . VAL B  1  129 ? 25.424  70.610  -24.695 1.00 75.42 ? 157  VAL B CA  1 
ATOM   6100  C  C   . VAL B  1  129 ? 25.291  71.306  -23.344 1.00 74.41 ? 157  VAL B C   1 
ATOM   6101  O  O   . VAL B  1  129 ? 26.273  71.618  -22.665 1.00 73.92 ? 157  VAL B O   1 
ATOM   6102  C  CB  . VAL B  1  129 ? 25.215  71.665  -25.809 1.00 75.01 ? 157  VAL B CB  1 
ATOM   6103  C  CG1 . VAL B  1  129 ? 25.686  71.112  -27.149 1.00 74.83 ? 157  VAL B CG1 1 
ATOM   6104  C  CG2 . VAL B  1  129 ? 23.721  72.049  -25.895 1.00 74.57 ? 157  VAL B CG2 1 
ATOM   6105  N  N   . GLU B  1  130 ? 24.040  71.546  -22.982 1.00 74.22 ? 158  GLU B N   1 
ATOM   6106  C  CA  . GLU B  1  130 ? 23.683  72.193  -21.740 1.00 73.63 ? 158  GLU B CA  1 
ATOM   6107  C  C   . GLU B  1  130 ? 24.214  71.419  -20.534 1.00 74.14 ? 158  GLU B C   1 
ATOM   6108  O  O   . GLU B  1  130 ? 24.676  72.019  -19.564 1.00 74.31 ? 158  GLU B O   1 
ATOM   6109  C  CB  . GLU B  1  130 ? 22.160  72.290  -21.664 1.00 73.81 ? 158  GLU B CB  1 
ATOM   6110  C  CG  . GLU B  1  130 ? 21.633  73.112  -20.510 1.00 74.54 ? 158  GLU B CG  1 
ATOM   6111  C  CD  . GLU B  1  130 ? 20.130  73.010  -20.385 1.00 74.57 ? 158  GLU B CD  1 
ATOM   6112  O  OE1 . GLU B  1  130 ? 19.643  71.934  -19.962 1.00 74.75 ? 158  GLU B OE1 1 
ATOM   6113  O  OE2 . GLU B  1  130 ? 19.442  74.002  -20.722 1.00 74.27 ? 158  GLU B OE2 1 
ATOM   6114  N  N   . ARG B  1  131 ? 24.154  70.089  -20.608 1.00 73.38 ? 159  ARG B N   1 
ATOM   6115  C  CA  . ARG B  1  131 ? 24.586  69.226  -19.514 1.00 71.36 ? 159  ARG B CA  1 
ATOM   6116  C  C   . ARG B  1  131 ? 26.043  68.846  -19.536 1.00 71.05 ? 159  ARG B C   1 
ATOM   6117  O  O   . ARG B  1  131 ? 26.656  68.684  -18.485 1.00 71.32 ? 159  ARG B O   1 
ATOM   6118  C  CB  . ARG B  1  131 ? 23.769  67.939  -19.507 1.00 71.04 ? 159  ARG B CB  1 
ATOM   6119  C  CG  . ARG B  1  131 ? 22.305  68.131  -19.220 1.00 70.36 ? 159  ARG B CG  1 
ATOM   6120  C  CD  . ARG B  1  131 ? 21.627  66.778  -19.168 1.00 70.19 ? 159  ARG B CD  1 
ATOM   6121  N  NE  . ARG B  1  131 ? 20.266  66.860  -18.654 1.00 69.79 ? 159  ARG B NE  1 
ATOM   6122  C  CZ  . ARG B  1  131 ? 19.513  65.800  -18.377 1.00 70.01 ? 159  ARG B CZ  1 
ATOM   6123  N  NH1 . ARG B  1  131 ? 19.991  64.574  -18.582 1.00 69.54 ? 159  ARG B NH1 1 
ATOM   6124  N  NH2 . ARG B  1  131 ? 18.287  65.964  -17.883 1.00 69.22 ? 159  ARG B NH2 1 
ATOM   6125  N  N   . HIS B  1  132 ? 26.602  68.713  -20.729 1.00 71.05 ? 160  HIS B N   1 
ATOM   6126  C  CA  . HIS B  1  132 ? 27.980  68.290  -20.840 1.00 71.49 ? 160  HIS B CA  1 
ATOM   6127  C  C   . HIS B  1  132 ? 28.882  69.287  -21.519 1.00 71.66 ? 160  HIS B C   1 
ATOM   6128  O  O   . HIS B  1  132 ? 29.920  68.918  -22.062 1.00 72.73 ? 160  HIS B O   1 
ATOM   6129  C  CB  . HIS B  1  132 ? 27.997  66.952  -21.557 1.00 70.86 ? 160  HIS B CB  1 
ATOM   6130  C  CG  . HIS B  1  132 ? 26.984  65.999  -21.018 1.00 70.57 ? 160  HIS B CG  1 
ATOM   6131  N  ND1 . HIS B  1  132 ? 27.108  65.416  -19.775 1.00 70.27 ? 160  HIS B ND1 1 
ATOM   6132  C  CD2 . HIS B  1  132 ? 25.769  65.634  -21.487 1.00 69.91 ? 160  HIS B CD2 1 
ATOM   6133  C  CE1 . HIS B  1  132 ? 26.008  64.739  -19.502 1.00 69.98 ? 160  HIS B CE1 1 
ATOM   6134  N  NE2 . HIS B  1  132 ? 25.180  64.857  -20.524 1.00 69.32 ? 160  HIS B NE2 1 
ATOM   6135  N  N   . GLY B  1  133 ? 28.491  70.554  -21.477 1.00 71.28 ? 161  GLY B N   1 
ATOM   6136  C  CA  . GLY B  1  133 ? 29.300  71.587  -22.088 1.00 71.62 ? 161  GLY B CA  1 
ATOM   6137  C  C   . GLY B  1  133 ? 29.202  71.653  -23.606 1.00 72.19 ? 161  GLY B C   1 
ATOM   6138  O  O   . GLY B  1  133 ? 29.073  72.736  -24.175 1.00 72.89 ? 161  GLY B O   1 
ATOM   6139  N  N   . GLY B  1  134 ? 29.257  70.507  -24.271 1.00 71.69 ? 162  GLY B N   1 
ATOM   6140  C  CA  . GLY B  1  134 ? 29.190  70.520  -25.718 1.00 70.16 ? 162  GLY B CA  1 
ATOM   6141  C  C   . GLY B  1  134 ? 28.524  69.293  -26.287 1.00 70.35 ? 162  GLY B C   1 
ATOM   6142  O  O   . GLY B  1  134 ? 27.730  68.644  -25.606 1.00 71.02 ? 162  GLY B O   1 
ATOM   6143  N  N   . PRO B  1  135 ? 28.841  68.943  -27.548 1.00 69.98 ? 163  PRO B N   1 
ATOM   6144  C  CA  . PRO B  1  135 ? 28.309  67.794  -28.292 1.00 69.88 ? 163  PRO B CA  1 
ATOM   6145  C  C   . PRO B  1  135 ? 28.846  66.485  -27.752 1.00 69.53 ? 163  PRO B C   1 
ATOM   6146  O  O   . PRO B  1  135 ? 30.019  66.402  -27.380 1.00 69.42 ? 163  PRO B O   1 
ATOM   6147  C  CB  . PRO B  1  135 ? 28.810  68.028  -29.719 1.00 68.92 ? 163  PRO B CB  1 
ATOM   6148  C  CG  . PRO B  1  135 ? 29.239  69.478  -29.732 1.00 70.39 ? 163  PRO B CG  1 
ATOM   6149  C  CD  . PRO B  1  135 ? 29.799  69.690  -28.372 1.00 69.50 ? 163  PRO B CD  1 
ATOM   6150  N  N   . LEU B  1  136 ? 28.001  65.463  -27.699 1.00 68.23 ? 164  LEU B N   1 
ATOM   6151  C  CA  . LEU B  1  136 ? 28.484  64.183  -27.218 1.00 67.67 ? 164  LEU B CA  1 
ATOM   6152  C  C   . LEU B  1  136 ? 29.065  63.439  -28.418 1.00 67.97 ? 164  LEU B C   1 
ATOM   6153  O  O   . LEU B  1  136 ? 28.333  63.065  -29.340 1.00 67.63 ? 164  LEU B O   1 
ATOM   6154  C  CB  . LEU B  1  136 ? 27.355  63.372  -26.556 1.00 66.85 ? 164  LEU B CB  1 
ATOM   6155  C  CG  . LEU B  1  136 ? 26.972  63.727  -25.107 1.00 67.08 ? 164  LEU B CG  1 
ATOM   6156  C  CD1 . LEU B  1  136 ? 25.950  62.744  -24.576 1.00 67.02 ? 164  LEU B CD1 1 
ATOM   6157  C  CD2 . LEU B  1  136 ? 28.199  63.688  -24.217 1.00 67.47 ? 164  LEU B CD2 1 
ATOM   6158  N  N   . PRO B  1  137 ? 30.402  63.259  -28.443 1.00 66.64 ? 165  PRO B N   1 
ATOM   6159  C  CA  . PRO B  1  137 ? 31.090  62.560  -29.530 1.00 65.87 ? 165  PRO B CA  1 
ATOM   6160  C  C   . PRO B  1  137 ? 30.427  61.213  -29.806 1.00 65.56 ? 165  PRO B C   1 
ATOM   6161  O  O   . PRO B  1  137 ? 30.065  60.489  -28.885 1.00 64.94 ? 165  PRO B O   1 
ATOM   6162  C  CB  . PRO B  1  137 ? 32.505  62.429  -28.995 1.00 65.75 ? 165  PRO B CB  1 
ATOM   6163  C  CG  . PRO B  1  137 ? 32.668  63.695  -28.232 1.00 65.58 ? 165  PRO B CG  1 
ATOM   6164  C  CD  . PRO B  1  137 ? 31.375  63.784  -27.470 1.00 65.38 ? 165  PRO B CD  1 
ATOM   6165  N  N   . TYR B  1  138 ? 30.282  60.877  -31.080 1.00 65.32 ? 166  TYR B N   1 
ATOM   6166  C  CA  . TYR B  1  138 ? 29.609  59.647  -31.465 1.00 65.78 ? 166  TYR B CA  1 
ATOM   6167  C  C   . TYR B  1  138 ? 30.284  58.340  -31.031 1.00 65.50 ? 166  TYR B C   1 
ATOM   6168  O  O   . TYR B  1  138 ? 29.619  57.317  -30.855 1.00 65.64 ? 166  TYR B O   1 
ATOM   6169  C  CB  . TYR B  1  138 ? 29.389  59.658  -32.984 1.00 65.38 ? 166  TYR B CB  1 
ATOM   6170  C  CG  . TYR B  1  138 ? 28.219  58.817  -33.455 1.00 65.33 ? 166  TYR B CG  1 
ATOM   6171  C  CD1 . TYR B  1  138 ? 26.939  59.011  -32.933 1.00 66.07 ? 166  TYR B CD1 1 
ATOM   6172  C  CD2 . TYR B  1  138 ? 28.389  57.832  -34.424 1.00 64.68 ? 166  TYR B CD2 1 
ATOM   6173  C  CE1 . TYR B  1  138 ? 25.853  58.239  -33.369 1.00 65.98 ? 166  TYR B CE1 1 
ATOM   6174  C  CE2 . TYR B  1  138 ? 27.314  57.056  -34.865 1.00 65.58 ? 166  TYR B CE2 1 
ATOM   6175  C  CZ  . TYR B  1  138 ? 26.047  57.261  -34.337 1.00 65.70 ? 166  TYR B CZ  1 
ATOM   6176  O  OH  . TYR B  1  138 ? 24.979  56.497  -34.778 1.00 65.25 ? 166  TYR B OH  1 
ATOM   6177  N  N   . HIS B  1  139 ? 31.594  58.367  -30.837 1.00 64.44 ? 167  HIS B N   1 
ATOM   6178  C  CA  . HIS B  1  139 ? 32.306  57.151  -30.457 1.00 65.84 ? 167  HIS B CA  1 
ATOM   6179  C  C   . HIS B  1  139 ? 32.074  56.693  -29.028 1.00 64.98 ? 167  HIS B C   1 
ATOM   6180  O  O   . HIS B  1  139 ? 32.379  55.547  -28.681 1.00 63.42 ? 167  HIS B O   1 
ATOM   6181  C  CB  . HIS B  1  139 ? 33.810  57.316  -30.680 1.00 68.22 ? 167  HIS B CB  1 
ATOM   6182  C  CG  . HIS B  1  139 ? 34.464  58.281  -29.741 1.00 67.98 ? 167  HIS B CG  1 
ATOM   6183  N  ND1 . HIS B  1  139 ? 34.195  59.633  -29.751 1.00 65.89 ? 167  HIS B ND1 1 
ATOM   6184  C  CD2 . HIS B  1  139 ? 35.412  58.093  -28.793 1.00 67.68 ? 167  HIS B CD2 1 
ATOM   6185  C  CE1 . HIS B  1  139 ? 34.955  60.238  -28.856 1.00 68.05 ? 167  HIS B CE1 1 
ATOM   6186  N  NE2 . HIS B  1  139 ? 35.703  59.326  -28.262 1.00 68.86 ? 167  HIS B NE2 1 
ATOM   6187  N  N   . ARG B  1  140 ? 31.551  57.595  -28.204 1.00 64.70 ? 168  ARG B N   1 
ATOM   6188  C  CA  . ARG B  1  140 ? 31.275  57.288  -26.801 1.00 65.02 ? 168  ARG B CA  1 
ATOM   6189  C  C   . ARG B  1  140 ? 30.005  56.453  -26.632 1.00 64.39 ? 168  ARG B C   1 
ATOM   6190  O  O   . ARG B  1  140 ? 29.845  55.711  -25.651 1.00 63.55 ? 168  ARG B O   1 
ATOM   6191  C  CB  . ARG B  1  140 ? 31.147  58.582  -25.988 1.00 63.79 ? 168  ARG B CB  1 
ATOM   6192  C  CG  . ARG B  1  140 ? 32.455  59.310  -25.775 1.00 62.53 ? 168  ARG B CG  1 
ATOM   6193  C  CD  . ARG B  1  140 ? 32.283  60.505  -24.861 1.00 62.64 ? 168  ARG B CD  1 
ATOM   6194  N  NE  . ARG B  1  140 ? 33.483  61.334  -24.867 1.00 63.25 ? 168  ARG B NE  1 
ATOM   6195  C  CZ  . ARG B  1  140 ? 33.578  62.533  -24.299 1.00 63.47 ? 168  ARG B CZ  1 
ATOM   6196  N  NH1 . ARG B  1  140 ? 32.533  63.059  -23.665 1.00 61.96 ? 168  ARG B NH1 1 
ATOM   6197  N  NH2 . ARG B  1  140 ? 34.722  63.211  -24.376 1.00 62.86 ? 168  ARG B NH2 1 
ATOM   6198  N  N   . ARG B  1  141 ? 29.105  56.579  -27.598 1.00 64.17 ? 169  ARG B N   1 
ATOM   6199  C  CA  . ARG B  1  141 ? 27.851  55.852  -27.562 1.00 62.67 ? 169  ARG B CA  1 
ATOM   6200  C  C   . ARG B  1  141 ? 28.096  54.371  -27.307 1.00 62.21 ? 169  ARG B C   1 
ATOM   6201  O  O   . ARG B  1  141 ? 28.948  53.740  -27.950 1.00 62.34 ? 169  ARG B O   1 
ATOM   6202  C  CB  . ARG B  1  141 ? 27.102  56.042  -28.882 1.00 62.86 ? 169  ARG B CB  1 
ATOM   6203  C  CG  . ARG B  1  141 ? 27.632  55.230  -30.038 1.00 62.29 ? 169  ARG B CG  1 
ATOM   6204  C  CD  . ARG B  1  141 ? 26.930  55.635  -31.300 1.00 63.06 ? 169  ARG B CD  1 
ATOM   6205  N  NE  . ARG B  1  141 ? 26.928  54.559  -32.267 1.00 63.59 ? 169  ARG B NE  1 
ATOM   6206  C  CZ  . ARG B  1  141 ? 27.995  54.126  -32.917 1.00 64.92 ? 169  ARG B CZ  1 
ATOM   6207  N  NH1 . ARG B  1  141 ? 27.853  53.124  -33.769 1.00 65.24 ? 169  ARG B NH1 1 
ATOM   6208  N  NH2 . ARG B  1  141 ? 29.184  54.695  -32.734 1.00 64.37 ? 169  ARG B NH2 1 
ATOM   6209  N  N   . PRO B  1  142 ? 27.357  53.797  -26.349 1.00 61.16 ? 170  PRO B N   1 
ATOM   6210  C  CA  . PRO B  1  142 ? 27.498  52.380  -26.016 1.00 61.10 ? 170  PRO B CA  1 
ATOM   6211  C  C   . PRO B  1  142 ? 27.288  51.526  -27.258 1.00 60.78 ? 170  PRO B C   1 
ATOM   6212  O  O   . PRO B  1  142 ? 26.765  52.000  -28.265 1.00 60.88 ? 170  PRO B O   1 
ATOM   6213  C  CB  . PRO B  1  142 ? 26.419  52.169  -24.962 1.00 61.23 ? 170  PRO B CB  1 
ATOM   6214  C  CG  . PRO B  1  142 ? 25.395  53.188  -25.317 1.00 61.02 ? 170  PRO B CG  1 
ATOM   6215  C  CD  . PRO B  1  142 ? 26.236  54.395  -25.612 1.00 60.41 ? 170  PRO B CD  1 
ATOM   6216  N  N   . VAL B  1  143 ? 27.696  50.268  -27.199 1.00 61.62 ? 171  VAL B N   1 
ATOM   6217  C  CA  . VAL B  1  143 ? 27.532  49.408  -28.360 1.00 61.39 ? 171  VAL B CA  1 
ATOM   6218  C  C   . VAL B  1  143 ? 26.099  48.866  -28.485 1.00 61.19 ? 171  VAL B C   1 
ATOM   6219  O  O   . VAL B  1  143 ? 25.560  48.236  -27.567 1.00 60.27 ? 171  VAL B O   1 
ATOM   6220  C  CB  . VAL B  1  143 ? 28.559  48.255  -28.322 1.00 60.16 ? 171  VAL B CB  1 
ATOM   6221  C  CG1 . VAL B  1  143 ? 28.463  47.416  -29.582 1.00 59.79 ? 171  VAL B CG1 1 
ATOM   6222  C  CG2 . VAL B  1  143 ? 29.956  48.836  -28.186 1.00 60.16 ? 171  VAL B CG2 1 
ATOM   6223  N  N   . LEU B  1  144 ? 25.486  49.149  -29.630 1.00 60.45 ? 172  LEU B N   1 
ATOM   6224  C  CA  . LEU B  1  144 ? 24.133  48.715  -29.926 1.00 60.28 ? 172  LEU B CA  1 
ATOM   6225  C  C   . LEU B  1  144 ? 24.086  47.208  -30.052 1.00 60.89 ? 172  LEU B C   1 
ATOM   6226  O  O   . LEU B  1  144 ? 25.074  46.577  -30.397 1.00 60.61 ? 172  LEU B O   1 
ATOM   6227  C  CB  . LEU B  1  144 ? 23.663  49.320  -31.244 1.00 60.73 ? 172  LEU B CB  1 
ATOM   6228  C  CG  . LEU B  1  144 ? 23.377  50.815  -31.271 1.00 60.74 ? 172  LEU B CG  1 
ATOM   6229  C  CD1 . LEU B  1  144 ? 23.144  51.240  -32.701 1.00 61.65 ? 172  LEU B CD1 1 
ATOM   6230  C  CD2 . LEU B  1  144 ? 22.174  51.132  -30.404 1.00 60.61 ? 172  LEU B CD2 1 
ATOM   6231  N  N   . PHE B  1  145 ? 22.927  46.634  -29.769 1.00 62.07 ? 173  PHE B N   1 
ATOM   6232  C  CA  . PHE B  1  145 ? 22.742  45.197  -29.888 1.00 62.22 ? 173  PHE B CA  1 
ATOM   6233  C  C   . PHE B  1  145 ? 23.121  44.851  -31.317 1.00 61.71 ? 173  PHE B C   1 
ATOM   6234  O  O   . PHE B  1  145 ? 23.919  43.947  -31.556 1.00 60.65 ? 173  PHE B O   1 
ATOM   6235  C  CB  . PHE B  1  145 ? 21.265  44.841  -29.633 1.00 65.10 ? 173  PHE B CB  1 
ATOM   6236  C  CG  . PHE B  1  145 ? 20.879  43.423  -30.031 1.00 66.52 ? 173  PHE B CG  1 
ATOM   6237  C  CD1 . PHE B  1  145 ? 20.397  42.530  -29.075 1.00 66.82 ? 173  PHE B CD1 1 
ATOM   6238  C  CD2 . PHE B  1  145 ? 20.968  42.988  -31.362 1.00 66.12 ? 173  PHE B CD2 1 
ATOM   6239  C  CE1 . PHE B  1  145 ? 20.007  41.224  -29.435 1.00 67.38 ? 173  PHE B CE1 1 
ATOM   6240  C  CE2 . PHE B  1  145 ? 20.583  41.689  -31.733 1.00 65.82 ? 173  PHE B CE2 1 
ATOM   6241  C  CZ  . PHE B  1  145 ? 20.103  40.807  -30.772 1.00 67.09 ? 173  PHE B CZ  1 
ATOM   6242  N  N   . GLN B  1  146 ? 22.527  45.586  -32.257 1.00 62.49 ? 174  GLN B N   1 
ATOM   6243  C  CA  . GLN B  1  146 ? 22.767  45.383  -33.681 1.00 62.21 ? 174  GLN B CA  1 
ATOM   6244  C  C   . GLN B  1  146 ? 24.261  45.356  -33.970 1.00 62.09 ? 174  GLN B C   1 
ATOM   6245  O  O   . GLN B  1  146 ? 24.770  44.430  -34.611 1.00 61.55 ? 174  GLN B O   1 
ATOM   6246  C  CB  . GLN B  1  146 ? 22.096  46.499  -34.490 1.00 61.28 ? 174  GLN B CB  1 
ATOM   6247  C  CG  . GLN B  1  146 ? 22.327  46.419  -35.995 1.00 62.21 ? 174  GLN B CG  1 
ATOM   6248  C  CD  . GLN B  1  146 ? 21.877  45.093  -36.597 1.00 63.25 ? 174  GLN B CD  1 
ATOM   6249  O  OE1 . GLN B  1  146 ? 20.761  44.621  -36.343 1.00 63.51 ? 174  GLN B OE1 1 
ATOM   6250  N  NE2 . GLN B  1  146 ? 22.743  44.487  -37.410 1.00 61.81 ? 174  GLN B NE2 1 
ATOM   6251  N  N   . GLU B  1  147 ? 24.953  46.376  -33.475 1.00 62.40 ? 175  GLU B N   1 
ATOM   6252  C  CA  . GLU B  1  147 ? 26.387  46.523  -33.664 1.00 61.36 ? 175  GLU B CA  1 
ATOM   6253  C  C   . GLU B  1  147 ? 27.184  45.280  -33.262 1.00 60.41 ? 175  GLU B C   1 
ATOM   6254  O  O   . GLU B  1  147 ? 28.226  44.982  -33.846 1.00 60.81 ? 175  GLU B O   1 
ATOM   6255  C  CB  . GLU B  1  147 ? 26.874  47.739  -32.877 1.00 60.99 ? 175  GLU B CB  1 
ATOM   6256  C  CG  . GLU B  1  147 ? 28.203  48.288  -33.341 1.00 60.00 ? 175  GLU B CG  1 
ATOM   6257  C  CD  . GLU B  1  147 ? 28.503  49.642  -32.742 1.00 60.20 ? 175  GLU B CD  1 
ATOM   6258  O  OE1 . GLU B  1  147 ? 27.596  50.513  -32.760 1.00 60.09 ? 175  GLU B OE1 1 
ATOM   6259  O  OE2 . GLU B  1  147 ? 29.646  49.832  -32.265 1.00 59.58 ? 175  GLU B OE2 1 
ATOM   6260  N  N   . TYR B  1  148 ? 26.702  44.554  -32.263 1.00 60.71 ? 176  TYR B N   1 
ATOM   6261  C  CA  . TYR B  1  148 ? 27.397  43.350  -31.833 1.00 60.86 ? 176  TYR B CA  1 
ATOM   6262  C  C   . TYR B  1  148 ? 27.312  42.269  -32.910 1.00 61.39 ? 176  TYR B C   1 
ATOM   6263  O  O   . TYR B  1  148 ? 28.320  41.692  -33.303 1.00 62.03 ? 176  TYR B O   1 
ATOM   6264  C  CB  . TYR B  1  148 ? 26.817  42.841  -30.510 1.00 61.38 ? 176  TYR B CB  1 
ATOM   6265  C  CG  . TYR B  1  148 ? 27.282  43.603  -29.275 1.00 61.02 ? 176  TYR B CG  1 
ATOM   6266  C  CD1 . TYR B  1  148 ? 26.392  44.357  -28.512 1.00 61.53 ? 176  TYR B CD1 1 
ATOM   6267  C  CD2 . TYR B  1  148 ? 28.610  43.546  -28.858 1.00 61.45 ? 176  TYR B CD2 1 
ATOM   6268  C  CE1 . TYR B  1  148 ? 26.821  45.038  -27.362 1.00 61.90 ? 176  TYR B CE1 1 
ATOM   6269  C  CE2 . TYR B  1  148 ? 29.045  44.221  -27.713 1.00 61.60 ? 176  TYR B CE2 1 
ATOM   6270  C  CZ  . TYR B  1  148 ? 28.149  44.964  -26.973 1.00 60.63 ? 176  TYR B CZ  1 
ATOM   6271  O  OH  . TYR B  1  148 ? 28.593  45.642  -25.859 1.00 59.28 ? 176  TYR B OH  1 
ATOM   6272  N  N   . LEU B  1  149 ? 26.110  42.009  -33.405 1.00 61.46 ? 177  LEU B N   1 
ATOM   6273  C  CA  . LEU B  1  149 ? 25.924  41.004  -34.443 1.00 61.18 ? 177  LEU B CA  1 
ATOM   6274  C  C   . LEU B  1  149 ? 26.895  41.201  -35.593 1.00 61.27 ? 177  LEU B C   1 
ATOM   6275  O  O   . LEU B  1  149 ? 27.566  40.262  -36.014 1.00 61.40 ? 177  LEU B O   1 
ATOM   6276  C  CB  . LEU B  1  149 ? 24.500  41.069  -34.972 1.00 61.69 ? 177  LEU B CB  1 
ATOM   6277  C  CG  . LEU B  1  149 ? 23.450  41.074  -33.865 1.00 61.99 ? 177  LEU B CG  1 
ATOM   6278  C  CD1 . LEU B  1  149 ? 22.072  40.968  -34.476 1.00 61.49 ? 177  LEU B CD1 1 
ATOM   6279  C  CD2 . LEU B  1  149 ? 23.708  39.924  -32.907 1.00 62.26 ? 177  LEU B CD2 1 
ATOM   6280  N  N   . ASP B  1  150 ? 26.966  42.424  -36.103 1.00 61.30 ? 178  ASP B N   1 
ATOM   6281  C  CA  . ASP B  1  150 ? 27.868  42.725  -37.200 1.00 61.27 ? 178  ASP B CA  1 
ATOM   6282  C  C   . ASP B  1  150 ? 29.272  42.278  -36.860 1.00 61.82 ? 178  ASP B C   1 
ATOM   6283  O  O   . ASP B  1  150 ? 30.001  41.791  -37.718 1.00 62.97 ? 178  ASP B O   1 
ATOM   6284  C  CB  . ASP B  1  150 ? 27.885  44.214  -37.490 1.00 62.29 ? 178  ASP B CB  1 
ATOM   6285  C  CG  . ASP B  1  150 ? 26.549  44.727  -37.943 1.00 62.52 ? 178  ASP B CG  1 
ATOM   6286  O  OD1 . ASP B  1  150 ? 25.862  44.008  -38.693 1.00 62.32 ? 178  ASP B OD1 1 
ATOM   6287  O  OD2 . ASP B  1  150 ? 26.193  45.860  -37.561 1.00 64.67 ? 178  ASP B OD2 1 
ATOM   6288  N  N   . ILE B  1  151 ? 29.659  42.450  -35.605 1.00 61.80 ? 179  ILE B N   1 
ATOM   6289  C  CA  . ILE B  1  151 ? 30.985  42.037  -35.195 1.00 62.85 ? 179  ILE B CA  1 
ATOM   6290  C  C   . ILE B  1  151 ? 31.113  40.509  -35.271 1.00 62.30 ? 179  ILE B C   1 
ATOM   6291  O  O   . ILE B  1  151 ? 32.141  39.998  -35.689 1.00 62.34 ? 179  ILE B O   1 
ATOM   6292  C  CB  . ILE B  1  151 ? 31.311  42.562  -33.781 1.00 62.39 ? 179  ILE B CB  1 
ATOM   6293  C  CG1 . ILE B  1  151 ? 31.330  44.092  -33.807 1.00 60.57 ? 179  ILE B CG1 1 
ATOM   6294  C  CG2 . ILE B  1  151 ? 32.652  42.023  -33.310 1.00 61.88 ? 179  ILE B CG2 1 
ATOM   6295  C  CD1 . ILE B  1  151 ? 31.644  44.738  -32.486 1.00 60.86 ? 179  ILE B CD1 1 
ATOM   6296  N  N   . ASP B  1  152 ? 30.071  39.777  -34.894 1.00 62.16 ? 180  ASP B N   1 
ATOM   6297  C  CA  . ASP B  1  152 ? 30.131  38.319  -34.976 1.00 62.65 ? 180  ASP B CA  1 
ATOM   6298  C  C   . ASP B  1  152 ? 30.057  37.950  -36.441 1.00 63.58 ? 180  ASP B C   1 
ATOM   6299  O  O   . ASP B  1  152 ? 30.699  37.004  -36.908 1.00 64.37 ? 180  ASP B O   1 
ATOM   6300  C  CB  . ASP B  1  152 ? 28.953  37.687  -34.259 1.00 63.19 ? 180  ASP B CB  1 
ATOM   6301  C  CG  . ASP B  1  152 ? 28.757  38.247  -32.888 1.00 64.95 ? 180  ASP B CG  1 
ATOM   6302  O  OD1 . ASP B  1  152 ? 29.783  38.500  -32.213 1.00 65.00 ? 180  ASP B OD1 1 
ATOM   6303  O  OD2 . ASP B  1  152 ? 27.582  38.424  -32.488 1.00 65.57 ? 180  ASP B OD2 1 
ATOM   6304  N  N   . GLN B  1  153 ? 29.231  38.705  -37.151 1.00 63.90 ? 181  GLN B N   1 
ATOM   6305  C  CA  . GLN B  1  153 ? 29.030  38.545  -38.581 1.00 64.40 ? 181  GLN B CA  1 
ATOM   6306  C  C   . GLN B  1  153 ? 30.407  38.546  -39.223 1.00 63.88 ? 181  GLN B C   1 
ATOM   6307  O  O   . GLN B  1  153 ? 30.819  37.592  -39.882 1.00 63.33 ? 181  GLN B O   1 
ATOM   6308  C  CB  . GLN B  1  153 ? 28.219  39.739  -39.086 1.00 65.71 ? 181  GLN B CB  1 
ATOM   6309  C  CG  . GLN B  1  153 ? 28.222  39.972  -40.588 1.00 66.89 ? 181  GLN B CG  1 
ATOM   6310  C  CD  . GLN B  1  153 ? 27.258  39.060  -41.322 1.00 68.24 ? 181  GLN B CD  1 
ATOM   6311  O  OE1 . GLN B  1  153 ? 26.203  38.702  -40.788 1.00 69.31 ? 181  GLN B OE1 1 
ATOM   6312  N  NE2 . GLN B  1  153 ? 27.602  38.696  -42.564 1.00 69.43 ? 181  GLN B NE2 1 
ATOM   6313  N  N   . MET B  1  154 ? 31.113  39.644  -38.997 1.00 62.64 ? 182  MET B N   1 
ATOM   6314  C  CA  . MET B  1  154 ? 32.445  39.841  -39.520 1.00 62.57 ? 182  MET B CA  1 
ATOM   6315  C  C   . MET B  1  154 ? 33.420  38.799  -38.982 1.00 62.08 ? 182  MET B C   1 
ATOM   6316  O  O   . MET B  1  154 ? 34.381  38.427  -39.642 1.00 61.49 ? 182  MET B O   1 
ATOM   6317  C  CB  . MET B  1  154 ? 32.922  41.237  -39.133 1.00 62.90 ? 182  MET B CB  1 
ATOM   6318  C  CG  . MET B  1  154 ? 34.303  41.585  -39.628 1.00 62.89 ? 182  MET B CG  1 
ATOM   6319  S  SD  . MET B  1  154 ? 34.920  43.031  -38.794 1.00 61.95 ? 182  MET B SD  1 
ATOM   6320  C  CE  . MET B  1  154 ? 36.578  42.517  -38.408 1.00 62.44 ? 182  MET B CE  1 
ATOM   6321  N  N   . ILE B  1  155 ? 33.177  38.324  -37.776 1.00 61.75 ? 183  ILE B N   1 
ATOM   6322  C  CA  . ILE B  1  155 ? 34.083  37.356  -37.211 1.00 61.67 ? 183  ILE B CA  1 
ATOM   6323  C  C   . ILE B  1  155 ? 33.824  35.945  -37.690 1.00 62.23 ? 183  ILE B C   1 
ATOM   6324  O  O   . ILE B  1  155 ? 34.716  35.306  -38.245 1.00 63.46 ? 183  ILE B O   1 
ATOM   6325  C  CB  . ILE B  1  155 ? 34.051  37.403  -35.684 1.00 61.58 ? 183  ILE B CB  1 
ATOM   6326  C  CG1 . ILE B  1  155 ? 34.594  38.756  -35.207 1.00 61.83 ? 183  ILE B CG1 1 
ATOM   6327  C  CG2 . ILE B  1  155 ? 34.900  36.285  -35.123 1.00 62.20 ? 183  ILE B CG2 1 
ATOM   6328  C  CD1 . ILE B  1  155 ? 34.650  38.935  -33.710 1.00 61.19 ? 183  ILE B CD1 1 
ATOM   6329  N  N   . PHE B  1  156 ? 32.612  35.450  -37.498 1.00 60.98 ? 184  PHE B N   1 
ATOM   6330  C  CA  . PHE B  1  156 ? 32.327  34.095  -37.919 1.00 61.68 ? 184  PHE B CA  1 
ATOM   6331  C  C   . PHE B  1  156 ? 32.287  33.920  -39.418 1.00 62.31 ? 184  PHE B C   1 
ATOM   6332  O  O   . PHE B  1  156 ? 32.540  32.828  -39.923 1.00 62.64 ? 184  PHE B O   1 
ATOM   6333  C  CB  . PHE B  1  156 ? 31.021  33.627  -37.303 1.00 61.96 ? 184  PHE B CB  1 
ATOM   6334  C  CG  . PHE B  1  156 ? 31.122  33.372  -35.836 1.00 61.88 ? 184  PHE B CG  1 
ATOM   6335  C  CD1 . PHE B  1  156 ? 31.463  34.400  -34.965 1.00 61.43 ? 184  PHE B CD1 1 
ATOM   6336  C  CD2 . PHE B  1  156 ? 30.883  32.104  -35.320 1.00 62.05 ? 184  PHE B CD2 1 
ATOM   6337  C  CE1 . PHE B  1  156 ? 31.563  34.173  -33.606 1.00 61.43 ? 184  PHE B CE1 1 
ATOM   6338  C  CE2 . PHE B  1  156 ? 30.979  31.864  -33.961 1.00 62.49 ? 184  PHE B CE2 1 
ATOM   6339  C  CZ  . PHE B  1  156 ? 31.321  32.903  -33.099 1.00 62.85 ? 184  PHE B CZ  1 
ATOM   6340  N  N   . ASN B  1  157 ? 31.996  35.003  -40.128 1.00 61.46 ? 185  ASN B N   1 
ATOM   6341  C  CA  . ASN B  1  157 ? 31.902  34.957  -41.578 1.00 62.30 ? 185  ASN B CA  1 
ATOM   6342  C  C   . ASN B  1  157 ? 33.160  35.317  -42.352 1.00 63.13 ? 185  ASN B C   1 
ATOM   6343  O  O   . ASN B  1  157 ? 33.727  34.472  -43.032 1.00 63.36 ? 185  ASN B O   1 
ATOM   6344  C  CB  . ASN B  1  157 ? 30.751  35.837  -42.032 1.00 62.59 ? 185  ASN B CB  1 
ATOM   6345  C  CG  . ASN B  1  157 ? 29.426  35.336  -41.523 1.00 63.19 ? 185  ASN B CG  1 
ATOM   6346  O  OD1 . ASN B  1  157 ? 28.407  36.007  -41.649 1.00 63.36 ? 185  ASN B OD1 1 
ATOM   6347  N  ND2 . ASN B  1  157 ? 29.430  34.137  -40.946 1.00 63.43 ? 185  ASN B ND2 1 
ATOM   6348  N  N   . ARG B  1  158 ? 33.595  36.568  -42.268 1.00 64.31 ? 186  ARG B N   1 
ATOM   6349  C  CA  . ARG B  1  158 ? 34.799  36.986  -42.982 1.00 63.47 ? 186  ARG B CA  1 
ATOM   6350  C  C   . ARG B  1  158 ? 36.119  36.602  -42.279 1.00 64.26 ? 186  ARG B C   1 
ATOM   6351  O  O   . ARG B  1  158 ? 37.109  36.288  -42.943 1.00 64.56 ? 186  ARG B O   1 
ATOM   6352  C  CB  . ARG B  1  158 ? 34.785  38.511  -43.216 1.00 63.95 ? 186  ARG B CB  1 
ATOM   6353  C  CG  . ARG B  1  158 ? 33.574  39.060  -43.995 1.00 65.61 ? 186  ARG B CG  1 
ATOM   6354  C  CD  . ARG B  1  158 ? 33.790  40.534  -44.406 1.00 67.11 ? 186  ARG B CD  1 
ATOM   6355  N  NE  . ARG B  1  158 ? 34.006  41.428  -43.254 1.00 70.27 ? 186  ARG B NE  1 
ATOM   6356  C  CZ  . ARG B  1  158 ? 34.371  42.716  -43.332 1.00 70.38 ? 186  ARG B CZ  1 
ATOM   6357  N  NH1 . ARG B  1  158 ? 34.573  43.289  -44.519 1.00 70.46 ? 186  ARG B NH1 1 
ATOM   6358  N  NH2 . ARG B  1  158 ? 34.529  43.443  -42.221 1.00 68.01 ? 186  ARG B NH2 1 
ATOM   6359  N  N   . GLU B  1  159 ? 36.132  36.594  -40.948 1.00 63.72 ? 187  GLU B N   1 
ATOM   6360  C  CA  . GLU B  1  159 ? 37.362  36.325  -40.211 1.00 62.17 ? 187  GLU B CA  1 
ATOM   6361  C  C   . GLU B  1  159 ? 37.748  34.907  -39.832 1.00 60.91 ? 187  GLU B C   1 
ATOM   6362  O  O   . GLU B  1  159 ? 38.732  34.379  -40.332 1.00 61.89 ? 187  GLU B O   1 
ATOM   6363  C  CB  . GLU B  1  159 ? 37.393  37.198  -38.960 1.00 62.20 ? 187  GLU B CB  1 
ATOM   6364  C  CG  . GLU B  1  159 ? 37.466  38.692  -39.241 1.00 62.69 ? 187  GLU B CG  1 
ATOM   6365  C  CD  . GLU B  1  159 ? 38.560  39.064  -40.229 1.00 62.46 ? 187  GLU B CD  1 
ATOM   6366  O  OE1 . GLU B  1  159 ? 39.699  38.572  -40.081 1.00 62.12 ? 187  GLU B OE1 1 
ATOM   6367  O  OE2 . GLU B  1  159 ? 38.276  39.863  -41.149 1.00 62.80 ? 187  GLU B OE2 1 
ATOM   6368  N  N   . LEU B  1  160 ? 37.002  34.301  -38.925 1.00 60.71 ? 188  LEU B N   1 
ATOM   6369  C  CA  . LEU B  1  160 ? 37.307  32.947  -38.482 1.00 61.43 ? 188  LEU B CA  1 
ATOM   6370  C  C   . LEU B  1  160 ? 37.629  31.948  -39.591 1.00 61.80 ? 188  LEU B C   1 
ATOM   6371  O  O   . LEU B  1  160 ? 38.415  31.017  -39.395 1.00 60.95 ? 188  LEU B O   1 
ATOM   6372  C  CB  . LEU B  1  160 ? 36.156  32.411  -37.642 1.00 61.47 ? 188  LEU B CB  1 
ATOM   6373  C  CG  . LEU B  1  160 ? 35.919  33.214  -36.369 1.00 61.69 ? 188  LEU B CG  1 
ATOM   6374  C  CD1 . LEU B  1  160 ? 34.817  32.547  -35.557 1.00 62.39 ? 188  LEU B CD1 1 
ATOM   6375  C  CD2 . LEU B  1  160 ? 37.205  33.299  -35.566 1.00 61.16 ? 188  LEU B CD2 1 
ATOM   6376  N  N   . PRO B  1  161 ? 37.011  32.112  -40.769 1.00 62.32 ? 189  PRO B N   1 
ATOM   6377  C  CA  . PRO B  1  161 ? 37.292  31.178  -41.862 1.00 60.71 ? 189  PRO B CA  1 
ATOM   6378  C  C   . PRO B  1  161 ? 38.771  31.148  -42.258 1.00 60.62 ? 189  PRO B C   1 
ATOM   6379  O  O   . PRO B  1  161 ? 39.313  30.090  -42.552 1.00 60.26 ? 189  PRO B O   1 
ATOM   6380  C  CB  . PRO B  1  161 ? 36.407  31.698  -42.982 1.00 60.26 ? 189  PRO B CB  1 
ATOM   6381  C  CG  . PRO B  1  161 ? 35.244  32.259  -42.240 1.00 60.70 ? 189  PRO B CG  1 
ATOM   6382  C  CD  . PRO B  1  161 ? 35.900  33.012  -41.126 1.00 60.90 ? 189  PRO B CD  1 
ATOM   6383  N  N   . GLN B  1  162 ? 39.417  32.313  -42.257 1.00 60.72 ? 190  GLN B N   1 
ATOM   6384  C  CA  . GLN B  1  162 ? 40.827  32.428  -42.620 1.00 59.88 ? 190  GLN B CA  1 
ATOM   6385  C  C   . GLN B  1  162 ? 41.749  31.592  -41.756 1.00 60.95 ? 190  GLN B C   1 
ATOM   6386  O  O   . GLN B  1  162 ? 42.946  31.496  -42.023 1.00 59.50 ? 190  GLN B O   1 
ATOM   6387  C  CB  . GLN B  1  162 ? 41.271  33.878  -42.546 1.00 59.09 ? 190  GLN B CB  1 
ATOM   6388  C  CG  . GLN B  1  162 ? 40.612  34.758  -43.574 1.00 60.07 ? 190  GLN B CG  1 
ATOM   6389  C  CD  . GLN B  1  162 ? 41.365  36.059  -43.799 1.00 60.16 ? 190  GLN B CD  1 
ATOM   6390  O  OE1 . GLN B  1  162 ? 41.501  36.881  -42.892 1.00 59.73 ? 190  GLN B OE1 1 
ATOM   6391  N  NE2 . GLN B  1  162 ? 41.865  36.248  -45.019 1.00 60.08 ? 190  GLN B NE2 1 
ATOM   6392  N  N   . ALA B  1  163 ? 41.187  30.989  -40.719 1.00 61.44 ? 191  ALA B N   1 
ATOM   6393  C  CA  . ALA B  1  163 ? 41.960  30.162  -39.815 1.00 61.36 ? 191  ALA B CA  1 
ATOM   6394  C  C   . ALA B  1  163 ? 41.210  28.882  -39.493 1.00 61.21 ? 191  ALA B C   1 
ATOM   6395  O  O   . ALA B  1  163 ? 41.389  28.278  -38.436 1.00 60.33 ? 191  ALA B O   1 
ATOM   6396  C  CB  . ALA B  1  163 ? 42.249  30.925  -38.563 1.00 60.88 ? 191  ALA B CB  1 
ATOM   6397  N  N   . SER B  1  164 ? 40.367  28.468  -40.422 1.00 61.88 ? 192  SER B N   1 
ATOM   6398  C  CA  . SER B  1  164 ? 39.592  27.260  -40.234 1.00 63.66 ? 192  SER B CA  1 
ATOM   6399  C  C   . SER B  1  164 ? 40.491  26.064  -39.961 1.00 64.10 ? 192  SER B C   1 
ATOM   6400  O  O   . SER B  1  164 ? 40.145  25.206  -39.155 1.00 64.33 ? 192  SER B O   1 
ATOM   6401  C  CB  . SER B  1  164 ? 38.721  26.993  -41.463 1.00 64.03 ? 192  SER B CB  1 
ATOM   6402  O  OG  . SER B  1  164 ? 37.743  28.012  -41.614 1.00 65.84 ? 192  SER B OG  1 
ATOM   6403  N  N   . GLY B  1  165 ? 41.641  26.007  -40.628 1.00 64.32 ? 193  GLY B N   1 
ATOM   6404  C  CA  . GLY B  1  165 ? 42.551  24.894  -40.418 1.00 64.51 ? 193  GLY B CA  1 
ATOM   6405  C  C   . GLY B  1  165 ? 42.818  24.659  -38.945 1.00 64.84 ? 193  GLY B C   1 
ATOM   6406  O  O   . GLY B  1  165 ? 42.606  23.560  -38.428 1.00 64.91 ? 193  GLY B O   1 
ATOM   6407  N  N   . LEU B  1  166 ? 43.285  25.709  -38.274 1.00 65.12 ? 194  LEU B N   1 
ATOM   6408  C  CA  . LEU B  1  166 ? 43.598  25.674  -36.851 1.00 65.89 ? 194  LEU B CA  1 
ATOM   6409  C  C   . LEU B  1  166 ? 42.364  25.321  -36.057 1.00 66.87 ? 194  LEU B C   1 
ATOM   6410  O  O   . LEU B  1  166 ? 42.370  24.407  -35.234 1.00 65.85 ? 194  LEU B O   1 
ATOM   6411  C  CB  . LEU B  1  166 ? 44.118  27.039  -36.416 1.00 65.28 ? 194  LEU B CB  1 
ATOM   6412  C  CG  . LEU B  1  166 ? 44.129  27.399  -34.940 1.00 63.75 ? 194  LEU B CG  1 
ATOM   6413  C  CD1 . LEU B  1  166 ? 44.640  26.253  -34.116 1.00 64.96 ? 194  LEU B CD1 1 
ATOM   6414  C  CD2 . LEU B  1  166 ? 44.997  28.615  -34.758 1.00 64.20 ? 194  LEU B CD2 1 
ATOM   6415  N  N   . LEU B  1  167 ? 41.302  26.070  -36.321 1.00 68.92 ? 195  LEU B N   1 
ATOM   6416  C  CA  . LEU B  1  167 ? 40.025  25.865  -35.659 1.00 70.30 ? 195  LEU B CA  1 
ATOM   6417  C  C   . LEU B  1  167 ? 39.503  24.426  -35.837 1.00 70.47 ? 195  LEU B C   1 
ATOM   6418  O  O   . LEU B  1  167 ? 39.043  23.804  -34.877 1.00 69.56 ? 195  LEU B O   1 
ATOM   6419  C  CB  . LEU B  1  167 ? 39.021  26.888  -36.196 1.00 69.31 ? 195  LEU B CB  1 
ATOM   6420  C  CG  . LEU B  1  167 ? 39.384  28.354  -35.936 1.00 67.17 ? 195  LEU B CG  1 
ATOM   6421  C  CD1 . LEU B  1  167 ? 38.370  29.279  -36.595 1.00 67.25 ? 195  LEU B CD1 1 
ATOM   6422  C  CD2 . LEU B  1  167 ? 39.428  28.590  -34.447 1.00 65.48 ? 195  LEU B CD2 1 
ATOM   6423  N  N   . HIS B  1  168 ? 39.580  23.901  -37.060 1.00 72.00 ? 196  HIS B N   1 
ATOM   6424  C  CA  . HIS B  1  168 ? 39.141  22.535  -37.335 1.00 72.83 ? 196  HIS B CA  1 
ATOM   6425  C  C   . HIS B  1  168 ? 39.877  21.620  -36.392 1.00 72.74 ? 196  HIS B C   1 
ATOM   6426  O  O   . HIS B  1  168 ? 39.419  20.522  -36.088 1.00 73.00 ? 196  HIS B O   1 
ATOM   6427  C  CB  . HIS B  1  168 ? 39.473  22.112  -38.773 1.00 74.16 ? 196  HIS B CB  1 
ATOM   6428  C  CG  . HIS B  1  168 ? 38.349  22.323  -39.739 1.00 77.42 ? 196  HIS B CG  1 
ATOM   6429  N  ND1 . HIS B  1  168 ? 37.093  21.782  -39.551 1.00 78.17 ? 196  HIS B ND1 1 
ATOM   6430  C  CD2 . HIS B  1  168 ? 38.281  23.034  -40.892 1.00 78.23 ? 196  HIS B CD2 1 
ATOM   6431  C  CE1 . HIS B  1  168 ? 36.300  22.153  -40.542 1.00 78.64 ? 196  HIS B CE1 1 
ATOM   6432  N  NE2 . HIS B  1  168 ? 36.995  22.915  -41.369 1.00 79.33 ? 196  HIS B NE2 1 
ATOM   6433  N  N   . HIS B  1  169 ? 41.026  22.083  -35.922 1.00 72.86 ? 197  HIS B N   1 
ATOM   6434  C  CA  . HIS B  1  169 ? 41.819  21.273  -35.026 1.00 74.66 ? 197  HIS B CA  1 
ATOM   6435  C  C   . HIS B  1  169 ? 41.388  21.448  -33.565 1.00 74.87 ? 197  HIS B C   1 
ATOM   6436  O  O   . HIS B  1  169 ? 40.530  20.708  -33.071 1.00 74.78 ? 197  HIS B O   1 
ATOM   6437  C  CB  . HIS B  1  169 ? 43.310  21.591  -35.212 1.00 74.43 ? 197  HIS B CB  1 
ATOM   6438  C  CG  . HIS B  1  169 ? 44.209  20.495  -34.741 1.00 74.97 ? 197  HIS B CG  1 
ATOM   6439  N  ND1 . HIS B  1  169 ? 44.142  19.215  -35.252 1.00 74.95 ? 197  HIS B ND1 1 
ATOM   6440  C  CD2 . HIS B  1  169 ? 45.119  20.454  -33.737 1.00 75.27 ? 197  HIS B CD2 1 
ATOM   6441  C  CE1 . HIS B  1  169 ? 44.967  18.431  -34.579 1.00 76.29 ? 197  HIS B CE1 1 
ATOM   6442  N  NE2 . HIS B  1  169 ? 45.571  19.157  -33.653 1.00 76.86 ? 197  HIS B NE2 1 
ATOM   6443  N  N   . CYS B  1  170 ? 41.981  22.441  -32.900 1.00 75.04 ? 198  CYS B N   1 
ATOM   6444  C  CA  . CYS B  1  170 ? 41.732  22.779  -31.486 1.00 75.30 ? 198  CYS B CA  1 
ATOM   6445  C  C   . CYS B  1  170 ? 40.328  22.853  -30.918 1.00 75.63 ? 198  CYS B C   1 
ATOM   6446  O  O   . CYS B  1  170 ? 40.000  22.291  -29.862 1.00 74.30 ? 198  CYS B O   1 
ATOM   6447  C  CB  . CYS B  1  170 ? 42.309  24.160  -31.157 1.00 75.01 ? 198  CYS B CB  1 
ATOM   6448  S  SG  . CYS B  1  170 ? 41.426  25.595  -31.912 1.00 78.29 ? 198  CYS B SG  1 
ATOM   6449  N  N   . CYS B  1  171 ? 39.526  23.611  -31.643 1.00 76.01 ? 199  CYS B N   1 
ATOM   6450  C  CA  . CYS B  1  171 ? 38.214  24.002  -31.224 1.00 74.81 ? 199  CYS B CA  1 
ATOM   6451  C  C   . CYS B  1  171 ? 36.989  23.452  -31.962 1.00 75.28 ? 199  CYS B C   1 
ATOM   6452  O  O   . CYS B  1  171 ? 35.875  23.950  -31.796 1.00 75.31 ? 199  CYS B O   1 
ATOM   6453  C  CB  . CYS B  1  171 ? 38.291  25.519  -31.259 1.00 75.08 ? 199  CYS B CB  1 
ATOM   6454  S  SG  . CYS B  1  171 ? 39.919  26.195  -30.649 1.00 75.31 ? 199  CYS B SG  1 
ATOM   6455  N  N   . PHE B  1  172 ? 37.197  22.424  -32.774 1.00 75.89 ? 200  PHE B N   1 
ATOM   6456  C  CA  . PHE B  1  172 ? 36.106  21.785  -33.504 1.00 77.40 ? 200  PHE B CA  1 
ATOM   6457  C  C   . PHE B  1  172 ? 35.286  22.729  -34.380 1.00 77.74 ? 200  PHE B C   1 
ATOM   6458  O  O   . PHE B  1  172 ? 34.081  22.519  -34.552 1.00 77.26 ? 200  PHE B O   1 
ATOM   6459  C  CB  . PHE B  1  172 ? 35.168  21.088  -32.517 1.00 77.17 ? 200  PHE B CB  1 
ATOM   6460  C  CG  . PHE B  1  172 ? 35.881  20.264  -31.480 1.00 77.83 ? 200  PHE B CG  1 
ATOM   6461  C  CD1 . PHE B  1  172 ? 35.191  19.768  -30.381 1.00 77.49 ? 200  PHE B CD1 1 
ATOM   6462  C  CD2 . PHE B  1  172 ? 37.249  19.999  -31.586 1.00 77.81 ? 200  PHE B CD2 1 
ATOM   6463  C  CE1 . PHE B  1  172 ? 35.851  19.024  -29.400 1.00 77.28 ? 200  PHE B CE1 1 
ATOM   6464  C  CE2 . PHE B  1  172 ? 37.915  19.258  -30.614 1.00 77.72 ? 200  PHE B CE2 1 
ATOM   6465  C  CZ  . PHE B  1  172 ? 37.211  18.770  -29.516 1.00 77.47 ? 200  PHE B CZ  1 
ATOM   6466  N  N   . TYR B  1  173 ? 35.919  23.764  -34.931 1.00 78.17 ? 201  TYR B N   1 
ATOM   6467  C  CA  . TYR B  1  173 ? 35.193  24.685  -35.798 1.00 78.10 ? 201  TYR B CA  1 
ATOM   6468  C  C   . TYR B  1  173 ? 34.633  23.804  -36.887 1.00 78.34 ? 201  TYR B C   1 
ATOM   6469  O  O   . TYR B  1  173 ? 35.311  22.893  -37.354 1.00 78.36 ? 201  TYR B O   1 
ATOM   6470  C  CB  . TYR B  1  173 ? 36.123  25.728  -36.428 1.00 77.56 ? 201  TYR B CB  1 
ATOM   6471  C  CG  . TYR B  1  173 ? 35.401  26.861  -37.152 1.00 78.12 ? 201  TYR B CG  1 
ATOM   6472  C  CD1 . TYR B  1  173 ? 34.278  27.472  -36.580 1.00 78.85 ? 201  TYR B CD1 1 
ATOM   6473  C  CD2 . TYR B  1  173 ? 35.890  27.390  -38.360 1.00 77.90 ? 201  TYR B CD2 1 
ATOM   6474  C  CE1 . TYR B  1  173 ? 33.662  28.587  -37.178 1.00 79.41 ? 201  TYR B CE1 1 
ATOM   6475  C  CE2 . TYR B  1  173 ? 35.280  28.516  -38.971 1.00 77.71 ? 201  TYR B CE2 1 
ATOM   6476  C  CZ  . TYR B  1  173 ? 34.169  29.107  -38.369 1.00 79.13 ? 201  TYR B CZ  1 
ATOM   6477  O  OH  . TYR B  1  173 ? 33.574  30.223  -38.929 1.00 77.75 ? 201  TYR B OH  1 
ATOM   6478  N  N   . LYS B  1  174 ? 33.392  24.043  -37.277 1.00 79.16 ? 202  LYS B N   1 
ATOM   6479  C  CA  . LYS B  1  174 ? 32.823  23.226  -38.326 1.00 80.40 ? 202  LYS B CA  1 
ATOM   6480  C  C   . LYS B  1  174 ? 32.292  24.035  -39.490 1.00 81.74 ? 202  LYS B C   1 
ATOM   6481  O  O   . LYS B  1  174 ? 32.073  25.254  -39.384 1.00 81.19 ? 202  LYS B O   1 
ATOM   6482  C  CB  . LYS B  1  174 ? 31.755  22.288  -37.760 1.00 79.70 ? 202  LYS B CB  1 
ATOM   6483  C  CG  . LYS B  1  174 ? 32.383  21.198  -36.926 1.00 79.62 ? 202  LYS B CG  1 
ATOM   6484  C  CD  . LYS B  1  174 ? 31.411  20.144  -36.479 1.00 80.34 ? 202  LYS B CD  1 
ATOM   6485  C  CE  . LYS B  1  174 ? 32.143  19.134  -35.593 1.00 81.69 ? 202  LYS B CE  1 
ATOM   6486  N  NZ  . LYS B  1  174 ? 31.287  18.035  -35.045 1.00 80.99 ? 202  LYS B NZ  1 
ATOM   6487  N  N   . HIS B  1  175 ? 32.136  23.329  -40.610 1.00 81.93 ? 203  HIS B N   1 
ATOM   6488  C  CA  . HIS B  1  175 ? 31.652  23.873  -41.876 1.00 70.63 ? 203  HIS B CA  1 
ATOM   6489  C  C   . HIS B  1  175 ? 30.142  24.245  -41.793 1.00 82.50 ? 203  HIS B C   1 
ATOM   6490  O  O   . HIS B  1  175 ? 29.465  24.478  -42.814 1.00 81.26 ? 203  HIS B O   1 
ATOM   6491  C  CB  . HIS B  1  175 ? 31.953  22.833  -42.984 1.00 47.25 ? 203  HIS B CB  1 
ATOM   6492  C  CG  . HIS B  1  175 ? 31.249  21.514  -42.802 1.00 49.44 ? 203  HIS B CG  1 
ATOM   6493  N  ND1 . HIS B  1  175 ? 30.791  21.060  -41.570 1.00 29.57 ? 203  HIS B ND1 1 
ATOM   6494  C  CD2 . HIS B  1  175 ? 30.850  20.587  -43.719 1.00 30.03 ? 203  HIS B CD2 1 
ATOM   6495  C  CE1 . HIS B  1  175 ? 30.134  19.919  -41.743 1.00 20.99 ? 203  HIS B CE1 1 
ATOM   6496  N  NE2 . HIS B  1  175 ? 30.153  19.609  -43.036 1.00 22.86 ? 203  HIS B NE2 1 
ATOM   6497  N  N   . ARG B  1  176 ? 29.649  24.311  -40.547 1.00 82.59 ? 204  ARG B N   1 
ATOM   6498  C  CA  . ARG B  1  176 ? 28.261  24.659  -40.210 1.00 70.35 ? 204  ARG B CA  1 
ATOM   6499  C  C   . ARG B  1  176 ? 28.234  26.035  -39.498 1.00 81.93 ? 204  ARG B C   1 
ATOM   6500  O  O   . ARG B  1  176 ? 27.480  26.936  -39.893 1.00 82.16 ? 204  ARG B O   1 
ATOM   6501  C  CB  . ARG B  1  176 ? 27.661  23.534  -39.342 1.00 57.24 ? 204  ARG B CB  1 
ATOM   6502  C  CG  . ARG B  1  176 ? 27.824  22.134  -40.019 1.00 48.38 ? 204  ARG B CG  1 
ATOM   6503  C  CD  . ARG B  1  176 ? 27.057  20.987  -39.310 1.00 30.51 ? 204  ARG B CD  1 
ATOM   6504  N  NE  . ARG B  1  176 ? 26.650  19.908  -40.241 1.00 22.26 ? 204  ARG B NE  1 
ATOM   6505  C  CZ  . ARG B  1  176 ? 25.841  18.886  -39.911 1.00 23.41 ? 204  ARG B CZ  1 
ATOM   6506  N  NH1 . ARG B  1  176 ? 25.345  18.782  -38.660 1.00 18.89 ? 204  ARG B NH1 1 
ATOM   6507  N  NH2 . ARG B  1  176 ? 25.502  17.985  -40.844 1.00 18.55 ? 204  ARG B NH2 1 
ATOM   6508  N  N   . GLY B  1  177 ? 29.056  26.190  -38.456 1.00 81.96 ? 205  GLY B N   1 
ATOM   6509  C  CA  . GLY B  1  177 ? 29.163  27.472  -37.773 1.00 81.15 ? 205  GLY B CA  1 
ATOM   6510  C  C   . GLY B  1  177 ? 28.503  27.818  -36.442 1.00 80.85 ? 205  GLY B C   1 
ATOM   6511  O  O   . GLY B  1  177 ? 27.486  27.245  -36.021 1.00 79.02 ? 205  GLY B O   1 
ATOM   6512  N  N   . ARG B  1  178 ? 29.134  28.796  -35.788 1.00 80.62 ? 206  ARG B N   1 
ATOM   6513  C  CA  . ARG B  1  178 ? 28.694  29.357  -34.520 1.00 78.17 ? 206  ARG B CA  1 
ATOM   6514  C  C   . ARG B  1  178 ? 28.639  28.397  -33.320 1.00 77.15 ? 206  ARG B C   1 
ATOM   6515  O  O   . ARG B  1  178 ? 27.820  28.577  -32.417 1.00 77.59 ? 206  ARG B O   1 
ATOM   6516  C  CB  . ARG B  1  178 ? 27.334  30.040  -34.734 1.00 78.65 ? 206  ARG B CB  1 
ATOM   6517  C  CG  . ARG B  1  178 ? 27.241  30.828  -36.067 1.00 78.72 ? 206  ARG B CG  1 
ATOM   6518  C  CD  . ARG B  1  178 ? 27.958  32.180  -36.060 1.00 78.83 ? 206  ARG B CD  1 
ATOM   6519  N  NE  . ARG B  1  178 ? 27.124  33.240  -35.484 1.00 80.60 ? 206  ARG B NE  1 
ATOM   6520  C  CZ  . ARG B  1  178 ? 27.526  34.493  -35.262 1.00 81.44 ? 206  ARG B CZ  1 
ATOM   6521  N  NH1 . ARG B  1  178 ? 28.764  34.859  -35.558 1.00 82.18 ? 206  ARG B NH1 1 
ATOM   6522  N  NH2 . ARG B  1  178 ? 26.689  35.388  -34.745 1.00 81.70 ? 206  ARG B NH2 1 
ATOM   6523  N  N   . ASN B  1  179 ? 29.506  27.383  -33.303 1.00 76.05 ? 207  ASN B N   1 
ATOM   6524  C  CA  . ASN B  1  179 ? 29.537  26.461  -32.169 1.00 74.09 ? 207  ASN B CA  1 
ATOM   6525  C  C   . ASN B  1  179 ? 30.353  27.204  -31.126 1.00 72.06 ? 207  ASN B C   1 
ATOM   6526  O  O   . ASN B  1  179 ? 30.670  26.675  -30.066 1.00 70.90 ? 207  ASN B O   1 
ATOM   6527  C  CB  . ASN B  1  179 ? 30.218  25.129  -32.533 1.00 74.15 ? 207  ASN B CB  1 
ATOM   6528  C  CG  . ASN B  1  179 ? 31.730  25.234  -32.604 1.00 73.70 ? 207  ASN B CG  1 
ATOM   6529  O  OD1 . ASN B  1  179 ? 32.282  25.836  -33.525 1.00 73.77 ? 207  ASN B OD1 1 
ATOM   6530  N  ND2 . ASN B  1  179 ? 32.409  24.643  -31.626 1.00 72.59 ? 207  ASN B ND2 1 
ATOM   6531  N  N   . LEU B  1  180 ? 30.682  28.448  -31.473 1.00 71.08 ? 208  LEU B N   1 
ATOM   6532  C  CA  . LEU B  1  180 ? 31.454  29.348  -30.626 1.00 69.59 ? 208  LEU B CA  1 
ATOM   6533  C  C   . LEU B  1  180 ? 30.753  30.683  -30.498 1.00 68.49 ? 208  LEU B C   1 
ATOM   6534  O  O   . LEU B  1  180 ? 29.917  31.042  -31.321 1.00 68.71 ? 208  LEU B O   1 
ATOM   6535  C  CB  . LEU B  1  180 ? 32.844  29.595  -31.205 1.00 68.92 ? 208  LEU B CB  1 
ATOM   6536  C  CG  . LEU B  1  180 ? 33.766  28.388  -31.368 1.00 69.44 ? 208  LEU B CG  1 
ATOM   6537  C  CD1 . LEU B  1  180 ? 35.110  28.904  -31.811 1.00 69.23 ? 208  LEU B CD1 1 
ATOM   6538  C  CD2 . LEU B  1  180 ? 33.905  27.595  -30.069 1.00 68.96 ? 208  LEU B CD2 1 
ATOM   6539  N  N   . VAL B  1  181 ? 31.115  31.420  -29.459 1.00 67.89 ? 209  VAL B N   1 
ATOM   6540  C  CA  . VAL B  1  181 ? 30.529  32.714  -29.205 1.00 66.37 ? 209  VAL B CA  1 
ATOM   6541  C  C   . VAL B  1  181 ? 31.631  33.650  -28.789 1.00 65.54 ? 209  VAL B C   1 
ATOM   6542  O  O   . VAL B  1  181 ? 32.716  33.224  -28.401 1.00 64.31 ? 209  VAL B O   1 
ATOM   6543  C  CB  . VAL B  1  181 ? 29.524  32.643  -28.075 1.00 65.92 ? 209  VAL B CB  1 
ATOM   6544  C  CG1 . VAL B  1  181 ? 28.419  31.707  -28.439 1.00 66.07 ? 209  VAL B CG1 1 
ATOM   6545  C  CG2 . VAL B  1  181 ? 30.211  32.170  -26.815 1.00 66.06 ? 209  VAL B CG2 1 
ATOM   6546  N  N   . THR B  1  182 ? 31.336  34.935  -28.866 1.00 64.92 ? 210  THR B N   1 
ATOM   6547  C  CA  . THR B  1  182 ? 32.295  35.951  -28.496 1.00 64.80 ? 210  THR B CA  1 
ATOM   6548  C  C   . THR B  1  182 ? 31.760  36.704  -27.301 1.00 65.16 ? 210  THR B C   1 
ATOM   6549  O  O   . THR B  1  182 ? 30.565  36.660  -27.002 1.00 64.77 ? 210  THR B O   1 
ATOM   6550  C  CB  . THR B  1  182 ? 32.484  36.972  -29.603 1.00 64.42 ? 210  THR B CB  1 
ATOM   6551  O  OG1 . THR B  1  182 ? 31.280  37.731  -29.749 1.00 64.26 ? 210  THR B OG1 1 
ATOM   6552  C  CG2 . THR B  1  182 ? 32.781  36.282  -30.905 1.00 65.84 ? 210  THR B CG2 1 
ATOM   6553  N  N   . MET B  1  183 ? 32.660  37.396  -26.619 1.00 64.84 ? 211  MET B N   1 
ATOM   6554  C  CA  . MET B  1  183 ? 32.287  38.200  -25.473 1.00 63.13 ? 211  MET B CA  1 
ATOM   6555  C  C   . MET B  1  183 ? 33.112  39.476  -25.470 1.00 64.09 ? 211  MET B C   1 
ATOM   6556  O  O   . MET B  1  183 ? 34.353  39.448  -25.497 1.00 62.81 ? 211  MET B O   1 
ATOM   6557  C  CB  . MET B  1  183 ? 32.504  37.459  -24.162 1.00 62.74 ? 211  MET B CB  1 
ATOM   6558  C  CG  . MET B  1  183 ? 31.970  38.249  -22.982 1.00 63.38 ? 211  MET B CG  1 
ATOM   6559  S  SD  . MET B  1  183 ? 32.181  37.490  -21.364 1.00 63.50 ? 211  MET B SD  1 
ATOM   6560  C  CE  . MET B  1  183 ? 32.982  38.834  -20.461 1.00 65.07 ? 211  MET B CE  1 
ATOM   6561  N  N   . THR B  1  184 ? 32.390  40.591  -25.433 1.00 63.71 ? 212  THR B N   1 
ATOM   6562  C  CA  . THR B  1  184 ? 32.965  41.926  -25.436 1.00 61.45 ? 212  THR B CA  1 
ATOM   6563  C  C   . THR B  1  184 ? 33.693  42.241  -24.142 1.00 59.78 ? 212  THR B C   1 
ATOM   6564  O  O   . THR B  1  184 ? 33.601  41.506  -23.165 1.00 59.34 ? 212  THR B O   1 
ATOM   6565  C  CB  . THR B  1  184 ? 31.856  42.974  -25.641 1.00 61.17 ? 212  THR B CB  1 
ATOM   6566  O  OG1 . THR B  1  184 ? 32.418  44.287  -25.631 1.00 60.21 ? 212  THR B OG1 1 
ATOM   6567  C  CG2 . THR B  1  184 ? 30.831  42.863  -24.539 1.00 60.08 ? 212  THR B CG2 1 
ATOM   6568  N  N   . THR B  1  185 ? 34.433  43.338  -24.159 1.00 59.74 ? 213  THR B N   1 
ATOM   6569  C  CA  . THR B  1  185 ? 35.168  43.809  -22.993 1.00 59.72 ? 213  THR B CA  1 
ATOM   6570  C  C   . THR B  1  185 ? 35.257  45.330  -23.135 1.00 58.94 ? 213  THR B C   1 
ATOM   6571  O  O   . THR B  1  185 ? 34.928  45.880  -24.185 1.00 58.52 ? 213  THR B O   1 
ATOM   6572  C  CB  . THR B  1  185 ? 36.580  43.183  -22.911 1.00 57.98 ? 213  THR B CB  1 
ATOM   6573  O  OG1 . THR B  1  185 ? 37.255  43.360  -24.157 1.00 59.26 ? 213  THR B OG1 1 
ATOM   6574  C  CG2 . THR B  1  185 ? 36.491  41.699  -22.598 1.00 58.28 ? 213  THR B CG2 1 
ATOM   6575  N  N   . ALA B  1  186 ? 35.677  46.015  -22.081 1.00 57.84 ? 214  ALA B N   1 
ATOM   6576  C  CA  . ALA B  1  186 ? 35.763  47.462  -22.141 1.00 57.32 ? 214  ALA B CA  1 
ATOM   6577  C  C   . ALA B  1  186 ? 36.900  48.013  -21.297 1.00 57.42 ? 214  ALA B C   1 
ATOM   6578  O  O   . ALA B  1  186 ? 37.357  47.368  -20.352 1.00 56.93 ? 214  ALA B O   1 
ATOM   6579  C  CB  . ALA B  1  186 ? 34.443  48.071  -21.701 1.00 58.84 ? 214  ALA B CB  1 
ATOM   6580  N  N   . PRO B  1  187 ? 37.362  49.233  -21.620 1.00 58.46 ? 215  PRO B N   1 
ATOM   6581  C  CA  . PRO B  1  187 ? 36.867  50.091  -22.704 1.00 57.92 ? 215  PRO B CA  1 
ATOM   6582  C  C   . PRO B  1  187 ? 37.374  49.681  -24.090 1.00 58.59 ? 215  PRO B C   1 
ATOM   6583  O  O   . PRO B  1  187 ? 38.233  48.809  -24.225 1.00 60.12 ? 215  PRO B O   1 
ATOM   6584  C  CB  . PRO B  1  187 ? 37.382  51.456  -22.298 1.00 58.11 ? 215  PRO B CB  1 
ATOM   6585  C  CG  . PRO B  1  187 ? 38.747  51.104  -21.773 1.00 58.16 ? 215  PRO B CG  1 
ATOM   6586  C  CD  . PRO B  1  187 ? 38.480  49.884  -20.912 1.00 57.95 ? 215  PRO B CD  1 
ATOM   6587  N  N   . ARG B  1  188 ? 36.858  50.332  -25.123 1.00 59.09 ? 216  ARG B N   1 
ATOM   6588  C  CA  . ARG B  1  188 ? 37.258  50.017  -26.491 1.00 59.79 ? 216  ARG B CA  1 
ATOM   6589  C  C   . ARG B  1  188 ? 38.430  50.890  -26.957 1.00 60.38 ? 216  ARG B C   1 
ATOM   6590  O  O   . ARG B  1  188 ? 38.208  52.029  -27.369 1.00 59.98 ? 216  ARG B O   1 
ATOM   6591  C  CB  . ARG B  1  188 ? 36.079  50.249  -27.435 1.00 59.74 ? 216  ARG B CB  1 
ATOM   6592  C  CG  . ARG B  1  188 ? 34.717  50.106  -26.787 1.00 58.80 ? 216  ARG B CG  1 
ATOM   6593  C  CD  . ARG B  1  188 ? 34.316  48.662  -26.640 1.00 58.70 ? 216  ARG B CD  1 
ATOM   6594  N  NE  . ARG B  1  188 ? 32.977  48.520  -26.077 1.00 59.55 ? 216  ARG B NE  1 
ATOM   6595  C  CZ  . ARG B  1  188 ? 32.239  47.418  -26.174 1.00 59.27 ? 216  ARG B CZ  1 
ATOM   6596  N  NH1 . ARG B  1  188 ? 32.711  46.362  -26.821 1.00 58.91 ? 216  ARG B NH1 1 
ATOM   6597  N  NH2 . ARG B  1  188 ? 31.032  47.368  -25.624 1.00 60.03 ? 216  ARG B NH2 1 
ATOM   6598  N  N   . GLY B  1  189 ? 39.661  50.374  -26.901 1.00 60.70 ? 217  GLY B N   1 
ATOM   6599  C  CA  . GLY B  1  189 ? 40.801  51.167  -27.350 1.00 60.27 ? 217  GLY B CA  1 
ATOM   6600  C  C   . GLY B  1  189 ? 41.885  51.501  -26.335 1.00 60.96 ? 217  GLY B C   1 
ATOM   6601  O  O   . GLY B  1  189 ? 41.993  50.860  -25.286 1.00 61.93 ? 217  GLY B O   1 
ATOM   6602  N  N   . LEU B  1  190 ? 42.689  52.516  -26.645 1.00 60.55 ? 218  LEU B N   1 
ATOM   6603  C  CA  . LEU B  1  190 ? 43.790  52.921  -25.771 1.00 60.76 ? 218  LEU B CA  1 
ATOM   6604  C  C   . LEU B  1  190 ? 43.863  54.397  -25.465 1.00 60.93 ? 218  LEU B C   1 
ATOM   6605  O  O   . LEU B  1  190 ? 44.580  54.819  -24.556 1.00 60.83 ? 218  LEU B O   1 
ATOM   6606  C  CB  . LEU B  1  190 ? 45.115  52.508  -26.382 1.00 61.48 ? 218  LEU B CB  1 
ATOM   6607  C  CG  . LEU B  1  190 ? 45.476  51.043  -26.196 1.00 61.40 ? 218  LEU B CG  1 
ATOM   6608  C  CD1 . LEU B  1  190 ? 46.598  50.682  -27.149 1.00 61.52 ? 218  LEU B CD1 1 
ATOM   6609  C  CD2 . LEU B  1  190 ? 45.874  50.802  -24.750 1.00 59.99 ? 218  LEU B CD2 1 
ATOM   6610  N  N   . GLN B  1  191 ? 43.153  55.189  -26.251 1.00 61.42 ? 219  GLN B N   1 
ATOM   6611  C  CA  . GLN B  1  191 ? 43.132  56.623  -26.036 1.00 61.03 ? 219  GLN B CA  1 
ATOM   6612  C  C   . GLN B  1  191 ? 41.757  57.119  -26.419 1.00 60.98 ? 219  GLN B C   1 
ATOM   6613  O  O   . GLN B  1  191 ? 40.995  56.403  -27.069 1.00 60.90 ? 219  GLN B O   1 
ATOM   6614  C  CB  . GLN B  1  191 ? 44.214  57.316  -26.865 1.00 61.79 ? 219  GLN B CB  1 
ATOM   6615  C  CG  . GLN B  1  191 ? 44.004  57.321  -28.369 1.00 61.40 ? 219  GLN B CG  1 
ATOM   6616  C  CD  . GLN B  1  191 ? 45.292  57.645  -29.093 1.00 62.48 ? 219  GLN B CD  1 
ATOM   6617  O  OE1 . GLN B  1  191 ? 46.070  56.750  -29.458 1.00 63.93 ? 219  GLN B OE1 1 
ATOM   6618  N  NE2 . GLN B  1  191 ? 45.549  58.931  -29.275 1.00 63.53 ? 219  GLN B NE2 1 
ATOM   6619  N  N   . SER B  1  192 ? 41.433  58.339  -26.011 1.00 60.57 ? 220  SER B N   1 
ATOM   6620  C  CA  . SER B  1  192 ? 40.118  58.867  -26.300 1.00 60.55 ? 220  SER B CA  1 
ATOM   6621  C  C   . SER B  1  192 ? 39.896  58.961  -27.794 1.00 60.50 ? 220  SER B C   1 
ATOM   6622  O  O   . SER B  1  192 ? 40.775  59.388  -28.549 1.00 60.30 ? 220  SER B O   1 
ATOM   6623  C  CB  . SER B  1  192 ? 39.930  60.229  -25.639 1.00 61.78 ? 220  SER B CB  1 
ATOM   6624  O  OG  . SER B  1  192 ? 38.547  60.514  -25.503 1.00 62.03 ? 220  SER B OG  1 
ATOM   6625  N  N   . GLY B  1  193 ? 38.710  58.534  -28.211 1.00 60.44 ? 221  GLY B N   1 
ATOM   6626  C  CA  . GLY B  1  193 ? 38.372  58.550  -29.618 1.00 60.57 ? 221  GLY B CA  1 
ATOM   6627  C  C   . GLY B  1  193 ? 38.351  57.176  -30.273 1.00 60.15 ? 221  GLY B C   1 
ATOM   6628  O  O   . GLY B  1  193 ? 37.985  57.061  -31.442 1.00 60.39 ? 221  GLY B O   1 
ATOM   6629  N  N   . ASP B  1  194 ? 38.720  56.135  -29.528 1.00 59.89 ? 222  ASP B N   1 
ATOM   6630  C  CA  . ASP B  1  194 ? 38.761  54.785  -30.078 1.00 59.09 ? 222  ASP B CA  1 
ATOM   6631  C  C   . ASP B  1  194 ? 37.472  53.961  -29.902 1.00 58.86 ? 222  ASP B C   1 
ATOM   6632  O  O   . ASP B  1  194 ? 36.512  54.387  -29.248 1.00 57.44 ? 222  ASP B O   1 
ATOM   6633  C  CB  . ASP B  1  194 ? 39.945  54.010  -29.473 1.00 60.33 ? 222  ASP B CB  1 
ATOM   6634  C  CG  . ASP B  1  194 ? 41.305  54.652  -29.775 1.00 61.26 ? 222  ASP B CG  1 
ATOM   6635  O  OD1 . ASP B  1  194 ? 41.378  55.568  -30.621 1.00 61.16 ? 222  ASP B OD1 1 
ATOM   6636  O  OD2 . ASP B  1  194 ? 42.314  54.225  -29.166 1.00 62.95 ? 222  ASP B OD2 1 
ATOM   6637  N  N   . ARG B  1  195 ? 37.472  52.780  -30.523 1.00 59.22 ? 223  ARG B N   1 
ATOM   6638  C  CA  . ARG B  1  195 ? 36.367  51.822  -30.456 1.00 58.56 ? 223  ARG B CA  1 
ATOM   6639  C  C   . ARG B  1  195 ? 36.941  50.480  -30.900 1.00 57.53 ? 223  ARG B C   1 
ATOM   6640  O  O   . ARG B  1  195 ? 36.405  49.821  -31.784 1.00 56.53 ? 223  ARG B O   1 
ATOM   6641  C  CB  . ARG B  1  195 ? 35.218  52.222  -31.385 1.00 57.48 ? 223  ARG B CB  1 
ATOM   6642  C  CG  . ARG B  1  195 ? 33.814  51.803  -30.901 1.00 56.51 ? 223  ARG B CG  1 
ATOM   6643  C  CD  . ARG B  1  195 ? 33.047  53.021  -30.341 1.00 58.54 ? 223  ARG B CD  1 
ATOM   6644  N  NE  . ARG B  1  195 ? 31.647  52.773  -29.961 1.00 57.18 ? 223  ARG B NE  1 
ATOM   6645  C  CZ  . ARG B  1  195 ? 30.725  52.240  -30.758 1.00 55.29 ? 223  ARG B CZ  1 
ATOM   6646  N  NH1 . ARG B  1  195 ? 31.047  51.882  -31.997 1.00 53.71 ? 223  ARG B NH1 1 
ATOM   6647  N  NH2 . ARG B  1  195 ? 29.479  52.074  -30.316 1.00 53.17 ? 223  ARG B NH2 1 
ATOM   6648  N  N   . ALA B  1  196 ? 38.056  50.103  -30.283 1.00 57.80 ? 224  ALA B N   1 
ATOM   6649  C  CA  . ALA B  1  196 ? 38.737  48.847  -30.579 1.00 58.16 ? 224  ALA B CA  1 
ATOM   6650  C  C   . ALA B  1  196 ? 38.514  47.875  -29.424 1.00 57.34 ? 224  ALA B C   1 
ATOM   6651  O  O   . ALA B  1  196 ? 39.105  48.018  -28.348 1.00 57.42 ? 224  ALA B O   1 
ATOM   6652  C  CB  . ALA B  1  196 ? 40.231  49.098  -30.775 1.00 57.60 ? 224  ALA B CB  1 
ATOM   6653  N  N   . THR B  1  197 ? 37.670  46.878  -29.651 1.00 56.29 ? 225  THR B N   1 
ATOM   6654  C  CA  . THR B  1  197 ? 37.365  45.917  -28.606 1.00 55.67 ? 225  THR B CA  1 
ATOM   6655  C  C   . THR B  1  197 ? 38.004  44.554  -28.779 1.00 54.42 ? 225  THR B C   1 
ATOM   6656  O  O   . THR B  1  197 ? 38.077  44.028  -29.880 1.00 54.48 ? 225  THR B O   1 
ATOM   6657  C  CB  . THR B  1  197 ? 35.868  45.692  -28.504 1.00 55.35 ? 225  THR B CB  1 
ATOM   6658  O  OG1 . THR B  1  197 ? 35.191  46.948  -28.558 1.00 55.42 ? 225  THR B OG1 1 
ATOM   6659  C  CG2 . THR B  1  197 ? 35.536  44.983  -27.211 1.00 55.30 ? 225  THR B CG2 1 
ATOM   6660  N  N   . TRP B  1  198 ? 38.461  43.990  -27.670 1.00 53.70 ? 226  TRP B N   1 
ATOM   6661  C  CA  . TRP B  1  198 ? 39.053  42.661  -27.665 1.00 53.99 ? 226  TRP B CA  1 
ATOM   6662  C  C   . TRP B  1  198 ? 37.943  41.639  -27.377 1.00 54.11 ? 226  TRP B C   1 
ATOM   6663  O  O   . TRP B  1  198 ? 37.210  41.783  -26.406 1.00 54.95 ? 226  TRP B O   1 
ATOM   6664  C  CB  . TRP B  1  198 ? 40.099  42.554  -26.565 1.00 53.23 ? 226  TRP B CB  1 
ATOM   6665  C  CG  . TRP B  1  198 ? 41.463  42.988  -26.940 1.00 54.43 ? 226  TRP B CG  1 
ATOM   6666  C  CD1 . TRP B  1  198 ? 42.095  44.143  -26.572 1.00 55.38 ? 226  TRP B CD1 1 
ATOM   6667  C  CD2 . TRP B  1  198 ? 42.413  42.232  -27.688 1.00 55.20 ? 226  TRP B CD2 1 
ATOM   6668  N  NE1 . TRP B  1  198 ? 43.390  44.147  -27.036 1.00 53.51 ? 226  TRP B NE1 1 
ATOM   6669  C  CE2 . TRP B  1  198 ? 43.611  42.985  -27.726 1.00 54.48 ? 226  TRP B CE2 1 
ATOM   6670  C  CE3 . TRP B  1  198 ? 42.372  40.989  -28.331 1.00 54.45 ? 226  TRP B CE3 1 
ATOM   6671  C  CZ2 . TRP B  1  198 ? 44.753  42.533  -28.382 1.00 54.56 ? 226  TRP B CZ2 1 
ATOM   6672  C  CZ3 . TRP B  1  198 ? 43.506  40.541  -28.983 1.00 54.36 ? 226  TRP B CZ3 1 
ATOM   6673  C  CH2 . TRP B  1  198 ? 44.682  41.313  -29.004 1.00 54.69 ? 226  TRP B CH2 1 
ATOM   6674  N  N   . PHE B  1  199 ? 37.811  40.606  -28.200 1.00 53.47 ? 227  PHE B N   1 
ATOM   6675  C  CA  . PHE B  1  199 ? 36.777  39.607  -27.957 1.00 52.83 ? 227  PHE B CA  1 
ATOM   6676  C  C   . PHE B  1  199 ? 37.300  38.197  -27.777 1.00 52.69 ? 227  PHE B C   1 
ATOM   6677  O  O   . PHE B  1  199 ? 37.893  37.605  -28.680 1.00 52.23 ? 227  PHE B O   1 
ATOM   6678  C  CB  . PHE B  1  199 ? 35.761  39.592  -29.086 1.00 52.47 ? 227  PHE B CB  1 
ATOM   6679  C  CG  . PHE B  1  199 ? 35.032  40.884  -29.256 1.00 54.39 ? 227  PHE B CG  1 
ATOM   6680  C  CD1 . PHE B  1  199 ? 35.695  42.014  -29.726 1.00 53.64 ? 227  PHE B CD1 1 
ATOM   6681  C  CD2 . PHE B  1  199 ? 33.666  40.970  -28.974 1.00 54.17 ? 227  PHE B CD2 1 
ATOM   6682  C  CE1 . PHE B  1  199 ? 35.010  43.202  -29.918 1.00 53.28 ? 227  PHE B CE1 1 
ATOM   6683  C  CE2 . PHE B  1  199 ? 32.974  42.158  -29.163 1.00 53.03 ? 227  PHE B CE2 1 
ATOM   6684  C  CZ  . PHE B  1  199 ? 33.648  43.277  -29.639 1.00 53.41 ? 227  PHE B CZ  1 
ATOM   6685  N  N   . GLY B  1  200 ? 37.071  37.653  -26.596 1.00 53.37 ? 228  GLY B N   1 
ATOM   6686  C  CA  . GLY B  1  200 ? 37.503  36.296  -26.349 1.00 53.07 ? 228  GLY B CA  1 
ATOM   6687  C  C   . GLY B  1  200 ? 36.531  35.390  -27.078 1.00 53.00 ? 228  GLY B C   1 
ATOM   6688  O  O   . GLY B  1  200 ? 35.425  35.815  -27.431 1.00 53.10 ? 228  GLY B O   1 
ATOM   6689  N  N   . LEU B  1  201 ? 36.930  34.149  -27.324 1.00 52.47 ? 229  LEU B N   1 
ATOM   6690  C  CA  . LEU B  1  201 ? 36.046  33.222  -28.007 1.00 53.11 ? 229  LEU B CA  1 
ATOM   6691  C  C   . LEU B  1  201 ? 35.811  32.032  -27.114 1.00 52.81 ? 229  LEU B C   1 
ATOM   6692  O  O   . LEU B  1  201 ? 36.753  31.480  -26.534 1.00 52.01 ? 229  LEU B O   1 
ATOM   6693  C  CB  . LEU B  1  201 ? 36.636  32.797  -29.351 1.00 52.83 ? 229  LEU B CB  1 
ATOM   6694  C  CG  . LEU B  1  201 ? 36.869  33.972  -30.309 1.00 52.55 ? 229  LEU B CG  1 
ATOM   6695  C  CD1 . LEU B  1  201 ? 37.123  33.435  -31.690 1.00 53.21 ? 229  LEU B CD1 1 
ATOM   6696  C  CD2 . LEU B  1  201 ? 35.661  34.889  -30.334 1.00 52.61 ? 229  LEU B CD2 1 
ATOM   6697  N  N   . TYR B  1  202 ? 34.540  31.655  -26.997 1.00 52.59 ? 230  TYR B N   1 
ATOM   6698  C  CA  . TYR B  1  202 ? 34.153  30.559  -26.131 1.00 52.23 ? 230  TYR B CA  1 
ATOM   6699  C  C   . TYR B  1  202 ? 33.275  29.544  -26.798 1.00 52.71 ? 230  TYR B C   1 
ATOM   6700  O  O   . TYR B  1  202 ? 32.678  29.796  -27.837 1.00 53.75 ? 230  TYR B O   1 
ATOM   6701  C  CB  . TYR B  1  202 ? 33.391  31.085  -24.921 1.00 51.96 ? 230  TYR B CB  1 
ATOM   6702  C  CG  . TYR B  1  202 ? 34.045  32.239  -24.206 1.00 52.13 ? 230  TYR B CG  1 
ATOM   6703  C  CD1 . TYR B  1  202 ? 34.214  33.467  -24.835 1.00 50.00 ? 230  TYR B CD1 1 
ATOM   6704  C  CD2 . TYR B  1  202 ? 34.472  32.110  -22.882 1.00 52.03 ? 230  TYR B CD2 1 
ATOM   6705  C  CE1 . TYR B  1  202 ? 34.783  34.531  -24.172 1.00 49.91 ? 230  TYR B CE1 1 
ATOM   6706  C  CE2 . TYR B  1  202 ? 35.044  33.173  -22.208 1.00 50.18 ? 230  TYR B CE2 1 
ATOM   6707  C  CZ  . TYR B  1  202 ? 35.194  34.380  -22.858 1.00 50.29 ? 230  TYR B CZ  1 
ATOM   6708  O  OH  . TYR B  1  202 ? 35.735  35.447  -22.184 1.00 51.39 ? 230  TYR B OH  1 
ATOM   6709  N  N   . TYR B  1  203 ? 33.187  28.391  -26.156 1.00 53.89 ? 231  TYR B N   1 
ATOM   6710  C  CA  . TYR B  1  203 ? 32.361  27.305  -26.632 1.00 54.69 ? 231  TYR B CA  1 
ATOM   6711  C  C   . TYR B  1  203 ? 30.935  27.596  -26.239 1.00 55.59 ? 231  TYR B C   1 
ATOM   6712  O  O   . TYR B  1  203 ? 30.643  27.840  -25.078 1.00 56.13 ? 231  TYR B O   1 
ATOM   6713  C  CB  . TYR B  1  203 ? 32.781  26.006  -25.980 1.00 54.84 ? 231  TYR B CB  1 
ATOM   6714  C  CG  . TYR B  1  203 ? 34.026  25.403  -26.558 1.00 56.49 ? 231  TYR B CG  1 
ATOM   6715  C  CD1 . TYR B  1  203 ? 34.021  24.854  -27.835 1.00 57.66 ? 231  TYR B CD1 1 
ATOM   6716  C  CD2 . TYR B  1  203 ? 35.186  25.288  -25.794 1.00 56.81 ? 231  TYR B CD2 1 
ATOM   6717  C  CE1 . TYR B  1  203 ? 35.136  24.185  -28.335 1.00 58.07 ? 231  TYR B CE1 1 
ATOM   6718  C  CE2 . TYR B  1  203 ? 36.307  24.624  -26.278 1.00 56.50 ? 231  TYR B CE2 1 
ATOM   6719  C  CZ  . TYR B  1  203 ? 36.274  24.066  -27.547 1.00 57.67 ? 231  TYR B CZ  1 
ATOM   6720  O  OH  . TYR B  1  203 ? 37.350  23.335  -28.012 1.00 58.16 ? 231  TYR B OH  1 
ATOM   6721  N  N   . ASN B  1  204 ? 30.042  27.540  -27.208 1.00 56.73 ? 232  ASN B N   1 
ATOM   6722  C  CA  . ASN B  1  204 ? 28.637  27.802  -26.967 1.00 57.52 ? 232  ASN B CA  1 
ATOM   6723  C  C   . ASN B  1  204 ? 27.927  26.728  -26.122 1.00 57.99 ? 232  ASN B C   1 
ATOM   6724  O  O   . ASN B  1  204 ? 26.985  26.091  -26.590 1.00 58.40 ? 232  ASN B O   1 
ATOM   6725  C  CB  . ASN B  1  204 ? 27.952  27.943  -28.315 1.00 60.15 ? 232  ASN B CB  1 
ATOM   6726  C  CG  . ASN B  1  204 ? 26.716  28.779  -28.243 1.00 63.26 ? 232  ASN B CG  1 
ATOM   6727  O  OD1 . ASN B  1  204 ? 26.432  29.411  -27.211 1.00 61.24 ? 232  ASN B OD1 1 
ATOM   6728  N  ND2 . ASN B  1  204 ? 25.975  28.797  -29.347 1.00 66.13 ? 232  ASN B ND2 1 
ATOM   6729  N  N   . ILE B  1  205 ? 28.370  26.542  -24.878 1.00 58.98 ? 233  ILE B N   1 
ATOM   6730  C  CA  . ILE B  1  205 ? 27.788  25.549  -23.962 1.00 58.92 ? 233  ILE B CA  1 
ATOM   6731  C  C   . ILE B  1  205 ? 26.281  25.696  -23.744 1.00 59.60 ? 233  ILE B C   1 
ATOM   6732  O  O   . ILE B  1  205 ? 25.774  26.806  -23.564 1.00 59.79 ? 233  ILE B O   1 
ATOM   6733  C  CB  . ILE B  1  205 ? 28.445  25.617  -22.570 1.00 58.47 ? 233  ILE B CB  1 
ATOM   6734  C  CG1 . ILE B  1  205 ? 29.949  25.422  -22.700 1.00 59.21 ? 233  ILE B CG1 1 
ATOM   6735  C  CG2 . ILE B  1  205 ? 27.850  24.559  -21.663 1.00 58.65 ? 233  ILE B CG2 1 
ATOM   6736  C  CD1 . ILE B  1  205 ? 30.325  24.134  -23.398 1.00 60.14 ? 233  ILE B CD1 1 
ATOM   6737  N  N   . SER B  1  206 ? 25.574  24.569  -23.726 1.00 59.56 ? 234  SER B N   1 
ATOM   6738  C  CA  . SER B  1  206 ? 24.128  24.584  -23.520 1.00 58.92 ? 234  SER B CA  1 
ATOM   6739  C  C   . SER B  1  206 ? 23.744  24.503  -22.043 1.00 58.51 ? 234  SER B C   1 
ATOM   6740  O  O   . SER B  1  206 ? 24.258  23.662  -21.302 1.00 58.07 ? 234  SER B O   1 
ATOM   6741  C  CB  . SER B  1  206 ? 23.481  23.423  -24.275 1.00 59.87 ? 234  SER B CB  1 
ATOM   6742  O  OG  . SER B  1  206 ? 24.097  22.186  -23.935 1.00 60.95 ? 234  SER B OG  1 
ATOM   6743  N  N   . GLY B  1  207 ? 22.845  25.392  -21.627 1.00 57.41 ? 235  GLY B N   1 
ATOM   6744  C  CA  . GLY B  1  207 ? 22.365  25.405  -20.255 1.00 56.27 ? 235  GLY B CA  1 
ATOM   6745  C  C   . GLY B  1  207 ? 23.412  25.496  -19.168 1.00 55.74 ? 235  GLY B C   1 
ATOM   6746  O  O   . GLY B  1  207 ? 23.364  24.772  -18.171 1.00 55.44 ? 235  GLY B O   1 
ATOM   6747  N  N   . ALA B  1  208 ? 24.367  26.393  -19.361 1.00 54.87 ? 236  ALA B N   1 
ATOM   6748  C  CA  . ALA B  1  208 ? 25.429  26.601  -18.390 1.00 55.59 ? 236  ALA B CA  1 
ATOM   6749  C  C   . ALA B  1  208 ? 26.395  27.606  -18.988 1.00 54.87 ? 236  ALA B C   1 
ATOM   6750  O  O   . ALA B  1  208 ? 26.411  27.812  -20.207 1.00 53.37 ? 236  ALA B O   1 
ATOM   6751  C  CB  . ALA B  1  208 ? 26.149  25.285  -18.069 1.00 55.11 ? 236  ALA B CB  1 
ATOM   6752  N  N   . GLY B  1  209 ? 27.192  28.217  -18.114 1.00 54.64 ? 237  GLY B N   1 
ATOM   6753  C  CA  . GLY B  1  209 ? 28.148  29.234  -18.516 1.00 53.55 ? 237  GLY B CA  1 
ATOM   6754  C  C   . GLY B  1  209 ? 29.277  28.848  -19.446 1.00 53.74 ? 237  GLY B C   1 
ATOM   6755  O  O   . GLY B  1  209 ? 30.003  27.867  -19.244 1.00 53.16 ? 237  GLY B O   1 
ATOM   6756  N  N   . PHE B  1  210 ? 29.423  29.661  -20.478 1.00 52.13 ? 238  PHE B N   1 
ATOM   6757  C  CA  . PHE B  1  210 ? 30.454  29.455  -21.462 1.00 52.08 ? 238  PHE B CA  1 
ATOM   6758  C  C   . PHE B  1  210 ? 31.686  30.214  -20.985 1.00 53.38 ? 238  PHE B C   1 
ATOM   6759  O  O   . PHE B  1  210 ? 32.819  29.914  -21.369 1.00 52.62 ? 238  PHE B O   1 
ATOM   6760  C  CB  . PHE B  1  210 ? 29.970  29.998  -22.805 1.00 52.45 ? 238  PHE B CB  1 
ATOM   6761  C  CG  . PHE B  1  210 ? 29.852  31.517  -22.867 1.00 52.65 ? 238  PHE B CG  1 
ATOM   6762  C  CD1 . PHE B  1  210 ? 30.990  32.324  -22.949 1.00 52.76 ? 238  PHE B CD1 1 
ATOM   6763  C  CD2 . PHE B  1  210 ? 28.605  32.135  -22.897 1.00 52.18 ? 238  PHE B CD2 1 
ATOM   6764  C  CE1 . PHE B  1  210 ? 30.884  33.715  -23.063 1.00 52.05 ? 238  PHE B CE1 1 
ATOM   6765  C  CE2 . PHE B  1  210 ? 28.493  33.530  -23.012 1.00 51.48 ? 238  PHE B CE2 1 
ATOM   6766  C  CZ  . PHE B  1  210 ? 29.633  34.316  -23.095 1.00 51.33 ? 238  PHE B CZ  1 
ATOM   6767  N  N   . PHE B  1  211 ? 31.438  31.201  -20.131 1.00 53.06 ? 239  PHE B N   1 
ATOM   6768  C  CA  . PHE B  1  211 ? 32.474  32.063  -19.585 1.00 52.12 ? 239  PHE B CA  1 
ATOM   6769  C  C   . PHE B  1  211 ? 33.683  31.291  -19.092 1.00 52.52 ? 239  PHE B C   1 
ATOM   6770  O  O   . PHE B  1  211 ? 34.799  31.807  -19.101 1.00 52.50 ? 239  PHE B O   1 
ATOM   6771  C  CB  . PHE B  1  211 ? 31.909  32.894  -18.426 1.00 52.40 ? 239  PHE B CB  1 
ATOM   6772  C  CG  . PHE B  1  211 ? 30.492  33.361  -18.641 1.00 52.20 ? 239  PHE B CG  1 
ATOM   6773  C  CD1 . PHE B  1  211 ? 29.414  32.526  -18.342 1.00 52.18 ? 239  PHE B CD1 1 
ATOM   6774  C  CD2 . PHE B  1  211 ? 30.234  34.627  -19.154 1.00 51.62 ? 239  PHE B CD2 1 
ATOM   6775  C  CE1 . PHE B  1  211 ? 28.094  32.947  -18.550 1.00 52.41 ? 239  PHE B CE1 1 
ATOM   6776  C  CE2 . PHE B  1  211 ? 28.926  35.061  -19.368 1.00 52.04 ? 239  PHE B CE2 1 
ATOM   6777  C  CZ  . PHE B  1  211 ? 27.848  34.219  -19.064 1.00 52.18 ? 239  PHE B CZ  1 
ATOM   6778  N  N   . LEU B  1  212 ? 33.451  30.052  -18.672 1.00 51.37 ? 240  LEU B N   1 
ATOM   6779  C  CA  . LEU B  1  212 ? 34.502  29.194  -18.128 1.00 51.72 ? 240  LEU B CA  1 
ATOM   6780  C  C   . LEU B  1  212 ? 35.269  28.388  -19.173 1.00 53.15 ? 240  LEU B C   1 
ATOM   6781  O  O   . LEU B  1  212 ? 36.177  27.607  -18.836 1.00 52.37 ? 240  LEU B O   1 
ATOM   6782  C  CB  . LEU B  1  212 ? 33.880  28.220  -17.139 1.00 50.77 ? 240  LEU B CB  1 
ATOM   6783  C  CG  . LEU B  1  212 ? 32.959  28.824  -16.084 1.00 50.39 ? 240  LEU B CG  1 
ATOM   6784  C  CD1 . LEU B  1  212 ? 32.205  27.696  -15.400 1.00 50.48 ? 240  LEU B CD1 1 
ATOM   6785  C  CD2 . LEU B  1  212 ? 33.762  29.649  -15.082 1.00 49.47 ? 240  LEU B CD2 1 
ATOM   6786  N  N   . HIS B  1  213 ? 34.909  28.577  -20.437 1.00 52.50 ? 241  HIS B N   1 
ATOM   6787  C  CA  . HIS B  1  213 ? 35.539  27.830  -21.503 1.00 51.70 ? 241  HIS B CA  1 
ATOM   6788  C  C   . HIS B  1  213 ? 36.043  28.730  -22.606 1.00 52.53 ? 241  HIS B C   1 
ATOM   6789  O  O   . HIS B  1  213 ? 35.493  28.780  -23.712 1.00 52.25 ? 241  HIS B O   1 
ATOM   6790  C  CB  . HIS B  1  213 ? 34.540  26.799  -22.023 1.00 51.16 ? 241  HIS B CB  1 
ATOM   6791  C  CG  . HIS B  1  213 ? 33.883  26.026  -20.925 1.00 50.48 ? 241  HIS B CG  1 
ATOM   6792  N  ND1 . HIS B  1  213 ? 34.602  25.263  -20.030 1.00 50.25 ? 241  HIS B ND1 1 
ATOM   6793  C  CD2 . HIS B  1  213 ? 32.599  26.000  -20.495 1.00 50.87 ? 241  HIS B CD2 1 
ATOM   6794  C  CE1 . HIS B  1  213 ? 33.792  24.807  -19.092 1.00 50.08 ? 241  HIS B CE1 1 
ATOM   6795  N  NE2 . HIS B  1  213 ? 32.571  25.241  -19.350 1.00 50.03 ? 241  HIS B NE2 1 
ATOM   6796  N  N   . HIS B  1  214 ? 37.106  29.449  -22.284 1.00 51.34 ? 242  HIS B N   1 
ATOM   6797  C  CA  . HIS B  1  214 ? 37.721  30.343  -23.233 1.00 52.34 ? 242  HIS B CA  1 
ATOM   6798  C  C   . HIS B  1  214 ? 38.601  29.478  -24.132 1.00 54.05 ? 242  HIS B C   1 
ATOM   6799  O  O   . HIS B  1  214 ? 39.508  28.797  -23.631 1.00 54.70 ? 242  HIS B O   1 
ATOM   6800  C  CB  . HIS B  1  214 ? 38.556  31.354  -22.469 1.00 53.62 ? 242  HIS B CB  1 
ATOM   6801  C  CG  . HIS B  1  214 ? 39.145  32.418  -23.330 1.00 54.37 ? 242  HIS B CG  1 
ATOM   6802  N  ND1 . HIS B  1  214 ? 38.991  33.759  -23.059 1.00 55.39 ? 242  HIS B ND1 1 
ATOM   6803  C  CD2 . HIS B  1  214 ? 39.898  32.343  -24.451 1.00 55.93 ? 242  HIS B CD2 1 
ATOM   6804  C  CE1 . HIS B  1  214 ? 39.625  34.467  -23.978 1.00 56.47 ? 242  HIS B CE1 1 
ATOM   6805  N  NE2 . HIS B  1  214 ? 40.184  33.630  -24.835 1.00 56.84 ? 242  HIS B NE2 1 
ATOM   6806  N  N   . VAL B  1  215 ? 38.344  29.499  -25.446 1.00 54.44 ? 243  VAL B N   1 
ATOM   6807  C  CA  . VAL B  1  215 ? 39.114  28.679  -26.407 1.00 54.61 ? 243  VAL B CA  1 
ATOM   6808  C  C   . VAL B  1  215 ? 40.594  29.042  -26.568 1.00 54.17 ? 243  VAL B C   1 
ATOM   6809  O  O   . VAL B  1  215 ? 41.374  28.263  -27.135 1.00 54.47 ? 243  VAL B O   1 
ATOM   6810  C  CB  . VAL B  1  215 ? 38.469  28.677  -27.828 1.00 53.53 ? 243  VAL B CB  1 
ATOM   6811  C  CG1 . VAL B  1  215 ? 37.032  28.170  -27.755 1.00 53.05 ? 243  VAL B CG1 1 
ATOM   6812  C  CG2 . VAL B  1  215 ? 38.544  30.059  -28.441 1.00 52.69 ? 243  VAL B CG2 1 
ATOM   6813  N  N   . GLY B  1  216 ? 40.965  30.226  -26.081 1.00 53.62 ? 244  GLY B N   1 
ATOM   6814  C  CA  . GLY B  1  216 ? 42.342  30.677  -26.144 1.00 53.13 ? 244  GLY B CA  1 
ATOM   6815  C  C   . GLY B  1  216 ? 42.583  31.758  -27.168 1.00 52.51 ? 244  GLY B C   1 
ATOM   6816  O  O   . GLY B  1  216 ? 43.694  32.272  -27.275 1.00 54.02 ? 244  GLY B O   1 
ATOM   6817  N  N   . LEU B  1  217 ? 41.541  32.117  -27.906 1.00 50.92 ? 245  LEU B N   1 
ATOM   6818  C  CA  . LEU B  1  217 ? 41.661  33.124  -28.945 1.00 51.79 ? 245  LEU B CA  1 
ATOM   6819  C  C   . LEU B  1  217 ? 40.950  34.449  -28.639 1.00 51.92 ? 245  LEU B C   1 
ATOM   6820  O  O   . LEU B  1  217 ? 39.760  34.469  -28.359 1.00 52.40 ? 245  LEU B O   1 
ATOM   6821  C  CB  . LEU B  1  217 ? 41.118  32.548  -30.251 1.00 51.84 ? 245  LEU B CB  1 
ATOM   6822  C  CG  . LEU B  1  217 ? 41.238  33.436  -31.490 1.00 52.42 ? 245  LEU B CG  1 
ATOM   6823  C  CD1 . LEU B  1  217 ? 42.691  33.507  -31.906 1.00 53.13 ? 245  LEU B CD1 1 
ATOM   6824  C  CD2 . LEU B  1  217 ? 40.401  32.888  -32.621 1.00 51.31 ? 245  LEU B CD2 1 
ATOM   6825  N  N   . GLU B  1  218 ? 41.679  35.559  -28.703 1.00 51.37 ? 246  GLU B N   1 
ATOM   6826  C  CA  . GLU B  1  218 ? 41.085  36.871  -28.456 1.00 51.26 ? 246  GLU B CA  1 
ATOM   6827  C  C   . GLU B  1  218 ? 41.390  37.732  -29.664 1.00 51.37 ? 246  GLU B C   1 
ATOM   6828  O  O   . GLU B  1  218 ? 42.506  37.718  -30.161 1.00 52.91 ? 246  GLU B O   1 
ATOM   6829  C  CB  . GLU B  1  218 ? 41.685  37.504  -27.204 1.00 51.43 ? 246  GLU B CB  1 
ATOM   6830  C  CG  . GLU B  1  218 ? 41.608  36.608  -25.972 1.00 51.79 ? 246  GLU B CG  1 
ATOM   6831  C  CD  . GLU B  1  218 ? 42.063  37.303  -24.695 1.00 52.03 ? 246  GLU B CD  1 
ATOM   6832  O  OE1 . GLU B  1  218 ? 42.959  38.168  -24.789 1.00 53.69 ? 246  GLU B OE1 1 
ATOM   6833  O  OE2 . GLU B  1  218 ? 41.543  36.979  -23.598 1.00 51.29 ? 246  GLU B OE2 1 
ATOM   6834  N  N   . LEU B  1  219 ? 40.406  38.478  -30.144 1.00 50.39 ? 247  LEU B N   1 
ATOM   6835  C  CA  . LEU B  1  219 ? 40.619  39.307  -31.321 1.00 50.91 ? 247  LEU B CA  1 
ATOM   6836  C  C   . LEU B  1  219 ? 40.312  40.756  -31.012 1.00 51.94 ? 247  LEU B C   1 
ATOM   6837  O  O   . LEU B  1  219 ? 39.330  41.053  -30.343 1.00 53.13 ? 247  LEU B O   1 
ATOM   6838  C  CB  . LEU B  1  219 ? 39.712  38.854  -32.473 1.00 50.02 ? 247  LEU B CB  1 
ATOM   6839  C  CG  . LEU B  1  219 ? 39.398  37.367  -32.705 1.00 49.20 ? 247  LEU B CG  1 
ATOM   6840  C  CD1 . LEU B  1  219 ? 38.441  37.253  -33.872 1.00 48.30 ? 247  LEU B CD1 1 
ATOM   6841  C  CD2 . LEU B  1  219 ? 40.656  36.566  -32.972 1.00 48.01 ? 247  LEU B CD2 1 
ATOM   6842  N  N   . LEU B  1  220 ? 41.152  41.660  -31.505 1.00 53.99 ? 248  LEU B N   1 
ATOM   6843  C  CA  . LEU B  1  220 ? 40.956  43.097  -31.296 1.00 54.59 ? 248  LEU B CA  1 
ATOM   6844  C  C   . LEU B  1  220 ? 40.232  43.673  -32.501 1.00 54.13 ? 248  LEU B C   1 
ATOM   6845  O  O   . LEU B  1  220 ? 40.850  43.953  -33.526 1.00 54.82 ? 248  LEU B O   1 
ATOM   6846  C  CB  . LEU B  1  220 ? 42.300  43.815  -31.129 1.00 54.28 ? 248  LEU B CB  1 
ATOM   6847  C  CG  . LEU B  1  220 ? 42.248  45.330  -30.921 1.00 53.89 ? 248  LEU B CG  1 
ATOM   6848  C  CD1 . LEU B  1  220 ? 41.404  45.687  -29.693 1.00 54.64 ? 248  LEU B CD1 1 
ATOM   6849  C  CD2 . LEU B  1  220 ? 43.667  45.839  -30.764 1.00 54.36 ? 248  LEU B CD2 1 
ATOM   6850  N  N   . VAL B  1  221 ? 38.922  43.846  -32.372 1.00 54.88 ? 249  VAL B N   1 
ATOM   6851  C  CA  . VAL B  1  221 ? 38.106  44.380  -33.453 1.00 55.38 ? 249  VAL B CA  1 
ATOM   6852  C  C   . VAL B  1  221 ? 38.077  45.908  -33.488 1.00 54.84 ? 249  VAL B C   1 
ATOM   6853  O  O   . VAL B  1  221 ? 37.813  46.574  -32.488 1.00 54.49 ? 249  VAL B O   1 
ATOM   6854  C  CB  . VAL B  1  221 ? 36.663  43.849  -33.357 1.00 53.98 ? 249  VAL B CB  1 
ATOM   6855  C  CG1 . VAL B  1  221 ? 35.772  44.564  -34.348 1.00 53.30 ? 249  VAL B CG1 1 
ATOM   6856  C  CG2 . VAL B  1  221 ? 36.658  42.361  -33.615 1.00 53.69 ? 249  VAL B CG2 1 
ATOM   6857  N  N   . ASN B  1  222 ? 38.365  46.460  -34.653 1.00 53.18 ? 250  ASN B N   1 
ATOM   6858  C  CA  . ASN B  1  222 ? 38.347  47.888  -34.792 1.00 54.82 ? 250  ASN B CA  1 
ATOM   6859  C  C   . ASN B  1  222 ? 37.044  48.212  -35.471 1.00 54.98 ? 250  ASN B C   1 
ATOM   6860  O  O   . ASN B  1  222 ? 36.929  48.159  -36.694 1.00 54.83 ? 250  ASN B O   1 
ATOM   6861  C  CB  . ASN B  1  222 ? 39.510  48.368  -35.646 1.00 55.56 ? 250  ASN B CB  1 
ATOM   6862  C  CG  . ASN B  1  222 ? 39.799  49.839  -35.443 1.00 54.56 ? 250  ASN B CG  1 
ATOM   6863  O  OD1 . ASN B  1  222 ? 38.885  50.656  -35.270 1.00 53.81 ? 250  ASN B OD1 1 
ATOM   6864  N  ND2 . ASN B  1  222 ? 41.075  50.190  -35.469 1.00 55.46 ? 250  ASN B ND2 1 
ATOM   6865  N  N   . HIS B  1  223 ? 36.053  48.546  -34.669 1.00 55.22 ? 251  HIS B N   1 
ATOM   6866  C  CA  . HIS B  1  223 ? 34.751  48.853  -35.216 1.00 56.33 ? 251  HIS B CA  1 
ATOM   6867  C  C   . HIS B  1  223 ? 34.372  50.335  -35.140 1.00 58.24 ? 251  HIS B C   1 
ATOM   6868  O  O   . HIS B  1  223 ? 33.198  50.669  -34.930 1.00 58.90 ? 251  HIS B O   1 
ATOM   6869  C  CB  . HIS B  1  223 ? 33.692  47.968  -34.530 1.00 57.63 ? 251  HIS B CB  1 
ATOM   6870  C  CG  . HIS B  1  223 ? 33.804  47.903  -33.031 1.00 57.90 ? 251  HIS B CG  1 
ATOM   6871  N  ND1 . HIS B  1  223 ? 32.930  48.553  -32.184 1.00 57.74 ? 251  HIS B ND1 1 
ATOM   6872  C  CD2 . HIS B  1  223 ? 34.677  47.243  -32.230 1.00 57.78 ? 251  HIS B CD2 1 
ATOM   6873  C  CE1 . HIS B  1  223 ? 33.257  48.296  -30.931 1.00 57.67 ? 251  HIS B CE1 1 
ATOM   6874  N  NE2 . HIS B  1  223 ? 34.314  47.503  -30.930 1.00 57.35 ? 251  HIS B NE2 1 
ATOM   6875  N  N   . LYS B  1  224 ? 35.350  51.222  -35.345 1.00 57.56 ? 252  LYS B N   1 
ATOM   6876  C  CA  . LYS B  1  224 ? 35.084  52.662  -35.277 1.00 57.98 ? 252  LYS B CA  1 
ATOM   6877  C  C   . LYS B  1  224 ? 34.344  53.270  -36.488 1.00 59.48 ? 252  LYS B C   1 
ATOM   6878  O  O   . LYS B  1  224 ? 33.585  54.236  -36.330 1.00 59.91 ? 252  LYS B O   1 
ATOM   6879  C  CB  . LYS B  1  224 ? 36.386  53.446  -35.038 1.00 58.20 ? 252  LYS B CB  1 
ATOM   6880  C  CG  . LYS B  1  224 ? 36.133  54.916  -34.695 1.00 58.91 ? 252  LYS B CG  1 
ATOM   6881  C  CD  . LYS B  1  224 ? 37.392  55.765  -34.652 1.00 60.26 ? 252  LYS B CD  1 
ATOM   6882  C  CE  . LYS B  1  224 ? 37.046  57.213  -34.302 1.00 60.88 ? 252  LYS B CE  1 
ATOM   6883  N  NZ  . LYS B  1  224 ? 38.241  58.101  -34.364 1.00 63.23 ? 252  LYS B NZ  1 
ATOM   6884  N  N   . ALA B  1  225 ? 34.547  52.708  -37.682 1.00 59.32 ? 253  ALA B N   1 
ATOM   6885  C  CA  . ALA B  1  225 ? 33.916  53.230  -38.898 1.00 59.90 ? 253  ALA B CA  1 
ATOM   6886  C  C   . ALA B  1  225 ? 32.390  53.211  -38.901 1.00 60.74 ? 253  ALA B C   1 
ATOM   6887  O  O   . ALA B  1  225 ? 31.771  52.261  -38.406 1.00 61.49 ? 253  ALA B O   1 
ATOM   6888  C  CB  . ALA B  1  225 ? 34.438  52.473  -40.116 1.00 59.99 ? 253  ALA B CB  1 
ATOM   6889  N  N   . LEU B  1  226 ? 31.782  54.261  -39.454 1.00 60.57 ? 254  LEU B N   1 
ATOM   6890  C  CA  . LEU B  1  226 ? 30.322  54.324  -39.531 1.00 61.09 ? 254  LEU B CA  1 
ATOM   6891  C  C   . LEU B  1  226 ? 29.856  53.234  -40.494 1.00 61.32 ? 254  LEU B C   1 
ATOM   6892  O  O   . LEU B  1  226 ? 28.667  52.902  -40.567 1.00 59.43 ? 254  LEU B O   1 
ATOM   6893  C  CB  . LEU B  1  226 ? 29.865  55.687  -40.059 1.00 62.17 ? 254  LEU B CB  1 
ATOM   6894  C  CG  . LEU B  1  226 ? 30.081  56.963  -39.243 1.00 62.04 ? 254  LEU B CG  1 
ATOM   6895  C  CD1 . LEU B  1  226 ? 29.267  58.112  -39.862 1.00 61.79 ? 254  LEU B CD1 1 
ATOM   6896  C  CD2 . LEU B  1  226 ? 29.640  56.724  -37.806 1.00 62.38 ? 254  LEU B CD2 1 
ATOM   6897  N  N   . ASP B  1  227 ? 30.822  52.693  -41.236 1.00 62.34 ? 255  ASP B N   1 
ATOM   6898  C  CA  . ASP B  1  227 ? 30.580  51.646  -42.227 1.00 62.39 ? 255  ASP B CA  1 
ATOM   6899  C  C   . ASP B  1  227 ? 31.226  50.308  -41.863 1.00 61.84 ? 255  ASP B C   1 
ATOM   6900  O  O   . ASP B  1  227 ? 32.438  50.139  -41.994 1.00 62.22 ? 255  ASP B O   1 
ATOM   6901  C  CB  . ASP B  1  227 ? 31.116  52.083  -43.584 1.00 62.10 ? 255  ASP B CB  1 
ATOM   6902  C  CG  . ASP B  1  227 ? 30.876  51.047  -44.655 1.00 62.81 ? 255  ASP B CG  1 
ATOM   6903  O  OD1 . ASP B  1  227 ? 31.380  51.249  -45.782 1.00 63.89 ? 255  ASP B OD1 1 
ATOM   6904  O  OD2 . ASP B  1  227 ? 30.182  50.038  -44.375 1.00 61.44 ? 255  ASP B OD2 1 
ATOM   6905  N  N   . PRO B  1  228 ? 30.409  49.329  -41.445 1.00 61.26 ? 256  PRO B N   1 
ATOM   6906  C  CA  . PRO B  1  228 ? 30.801  47.975  -41.039 1.00 61.77 ? 256  PRO B CA  1 
ATOM   6907  C  C   . PRO B  1  228 ? 31.702  47.309  -42.066 1.00 61.96 ? 256  PRO B C   1 
ATOM   6908  O  O   . PRO B  1  228 ? 32.383  46.316  -41.787 1.00 61.11 ? 256  PRO B O   1 
ATOM   6909  C  CB  . PRO B  1  228 ? 29.463  47.255  -40.918 1.00 62.90 ? 256  PRO B CB  1 
ATOM   6910  C  CG  . PRO B  1  228 ? 28.513  48.354  -40.588 1.00 62.33 ? 256  PRO B CG  1 
ATOM   6911  C  CD  . PRO B  1  228 ? 28.944  49.431  -41.531 1.00 62.15 ? 256  PRO B CD  1 
ATOM   6912  N  N   . ALA B  1  229 ? 31.671  47.861  -43.269 1.00 61.72 ? 257  ALA B N   1 
ATOM   6913  C  CA  . ALA B  1  229 ? 32.485  47.356  -44.347 1.00 61.24 ? 257  ALA B CA  1 
ATOM   6914  C  C   . ALA B  1  229 ? 33.930  47.686  -44.019 1.00 62.73 ? 257  ALA B C   1 
ATOM   6915  O  O   . ALA B  1  229 ? 34.841  46.961  -44.410 1.00 64.37 ? 257  ALA B O   1 
ATOM   6916  C  CB  . ALA B  1  229 ? 32.084  48.012  -45.648 1.00 61.98 ? 257  ALA B CB  1 
ATOM   6917  N  N   . ARG B  1  230 ? 34.146  48.773  -43.286 1.00 61.73 ? 258  ARG B N   1 
ATOM   6918  C  CA  . ARG B  1  230 ? 35.503  49.160  -42.946 1.00 60.24 ? 258  ARG B CA  1 
ATOM   6919  C  C   . ARG B  1  230 ? 36.010  48.705  -41.583 1.00 61.09 ? 258  ARG B C   1 
ATOM   6920  O  O   . ARG B  1  230 ? 37.042  49.191  -41.124 1.00 61.57 ? 258  ARG B O   1 
ATOM   6921  C  CB  . ARG B  1  230 ? 35.659  50.671  -43.071 1.00 62.57 ? 258  ARG B CB  1 
ATOM   6922  C  CG  . ARG B  1  230 ? 35.313  51.201  -44.443 1.00 63.90 ? 258  ARG B CG  1 
ATOM   6923  C  CD  . ARG B  1  230 ? 36.001  52.521  -44.693 1.00 65.78 ? 258  ARG B CD  1 
ATOM   6924  N  NE  . ARG B  1  230 ? 35.377  53.244  -45.793 1.00 69.48 ? 258  ARG B NE  1 
ATOM   6925  C  CZ  . ARG B  1  230 ? 35.803  54.420  -46.251 1.00 71.44 ? 258  ARG B CZ  1 
ATOM   6926  N  NH1 . ARG B  1  230 ? 36.870  54.995  -45.699 1.00 71.74 ? 258  ARG B NH1 1 
ATOM   6927  N  NH2 . ARG B  1  230 ? 35.152  55.034  -47.243 1.00 72.31 ? 258  ARG B NH2 1 
ATOM   6928  N  N   . TRP B  1  231 ? 35.305  47.788  -40.924 1.00 60.65 ? 259  TRP B N   1 
ATOM   6929  C  CA  . TRP B  1  231 ? 35.785  47.299  -39.631 1.00 59.26 ? 259  TRP B CA  1 
ATOM   6930  C  C   . TRP B  1  231 ? 36.877  46.271  -39.875 1.00 58.87 ? 259  TRP B C   1 
ATOM   6931  O  O   . TRP B  1  231 ? 36.841  45.546  -40.868 1.00 58.85 ? 259  TRP B O   1 
ATOM   6932  C  CB  . TRP B  1  231 ? 34.669  46.668  -38.826 1.00 59.14 ? 259  TRP B CB  1 
ATOM   6933  C  CG  . TRP B  1  231 ? 33.649  47.627  -38.402 1.00 58.95 ? 259  TRP B CG  1 
ATOM   6934  C  CD1 . TRP B  1  231 ? 33.716  48.987  -38.476 1.00 59.29 ? 259  TRP B CD1 1 
ATOM   6935  C  CD2 . TRP B  1  231 ? 32.380  47.311  -37.839 1.00 59.92 ? 259  TRP B CD2 1 
ATOM   6936  N  NE1 . TRP B  1  231 ? 32.557  49.544  -37.995 1.00 59.24 ? 259  TRP B NE1 1 
ATOM   6937  C  CE2 . TRP B  1  231 ? 31.716  48.537  -37.595 1.00 60.09 ? 259  TRP B CE2 1 
ATOM   6938  C  CE3 . TRP B  1  231 ? 31.731  46.106  -37.516 1.00 58.94 ? 259  TRP B CE3 1 
ATOM   6939  C  CZ2 . TRP B  1  231 ? 30.425  48.596  -37.043 1.00 60.25 ? 259  TRP B CZ2 1 
ATOM   6940  C  CZ3 . TRP B  1  231 ? 30.450  46.160  -36.968 1.00 59.45 ? 259  TRP B CZ3 1 
ATOM   6941  C  CH2 . TRP B  1  231 ? 29.808  47.401  -36.737 1.00 59.65 ? 259  TRP B CH2 1 
ATOM   6942  N  N   . THR B  1  232 ? 37.830  46.190  -38.954 1.00 59.34 ? 260  THR B N   1 
ATOM   6943  C  CA  . THR B  1  232 ? 38.966  45.298  -39.120 1.00 57.29 ? 260  THR B CA  1 
ATOM   6944  C  C   . THR B  1  232 ? 39.468  44.623  -37.856 1.00 56.67 ? 260  THR B C   1 
ATOM   6945  O  O   . THR B  1  232 ? 39.010  44.907  -36.753 1.00 57.90 ? 260  THR B O   1 
ATOM   6946  C  CB  . THR B  1  232 ? 40.155  46.081  -39.713 1.00 57.51 ? 260  THR B CB  1 
ATOM   6947  O  OG1 . THR B  1  232 ? 40.615  47.059  -38.761 1.00 57.08 ? 260  THR B OG1 1 
ATOM   6948  C  CG2 . THR B  1  232 ? 39.731  46.795  -40.982 1.00 56.70 ? 260  THR B CG2 1 
ATOM   6949  N  N   . ILE B  1  233 ? 40.438  43.736  -38.048 1.00 55.61 ? 261  ILE B N   1 
ATOM   6950  C  CA  . ILE B  1  233 ? 41.081  43.007  -36.968 1.00 56.40 ? 261  ILE B CA  1 
ATOM   6951  C  C   . ILE B  1  233 ? 42.461  43.648  -36.816 1.00 56.66 ? 261  ILE B C   1 
ATOM   6952  O  O   . ILE B  1  233 ? 43.324  43.489  -37.690 1.00 56.49 ? 261  ILE B O   1 
ATOM   6953  C  CB  . ILE B  1  233 ? 41.267  41.501  -37.327 1.00 57.10 ? 261  ILE B CB  1 
ATOM   6954  C  CG1 . ILE B  1  233 ? 39.905  40.844  -37.601 1.00 56.52 ? 261  ILE B CG1 1 
ATOM   6955  C  CG2 . ILE B  1  233 ? 42.026  40.777  -36.205 1.00 56.17 ? 261  ILE B CG2 1 
ATOM   6956  C  CD1 . ILE B  1  233 ? 39.041  40.592  -36.372 1.00 56.05 ? 261  ILE B CD1 1 
ATOM   6957  N  N   . GLN B  1  234 ? 42.669  44.380  -35.724 1.00 55.21 ? 262  GLN B N   1 
ATOM   6958  C  CA  . GLN B  1  234 ? 43.957  45.021  -35.501 1.00 56.03 ? 262  GLN B CA  1 
ATOM   6959  C  C   . GLN B  1  234 ? 45.018  44.043  -35.015 1.00 56.91 ? 262  GLN B C   1 
ATOM   6960  O  O   . GLN B  1  234 ? 46.193  44.140  -35.396 1.00 56.33 ? 262  GLN B O   1 
ATOM   6961  C  CB  . GLN B  1  234 ? 43.817  46.171  -34.514 1.00 56.34 ? 262  GLN B CB  1 
ATOM   6962  C  CG  . GLN B  1  234 ? 43.087  47.347  -35.109 1.00 58.33 ? 262  GLN B CG  1 
ATOM   6963  C  CD  . GLN B  1  234 ? 43.344  48.628  -34.349 1.00 59.70 ? 262  GLN B CD  1 
ATOM   6964  O  OE1 . GLN B  1  234 ? 43.466  49.704  -34.947 1.00 60.78 ? 262  GLN B OE1 1 
ATOM   6965  N  NE2 . GLN B  1  234 ? 43.431  48.529  -33.023 1.00 60.84 ? 262  GLN B NE2 1 
ATOM   6966  N  N   . LYS B  1  235 ? 44.607  43.099  -34.175 1.00 55.59 ? 263  LYS B N   1 
ATOM   6967  C  CA  . LYS B  1  235 ? 45.545  42.110  -33.679 1.00 55.47 ? 263  LYS B CA  1 
ATOM   6968  C  C   . LYS B  1  235 ? 44.801  40.879  -33.166 1.00 54.21 ? 263  LYS B C   1 
ATOM   6969  O  O   . LYS B  1  235 ? 43.622  40.931  -32.829 1.00 53.06 ? 263  LYS B O   1 
ATOM   6970  C  CB  . LYS B  1  235 ? 46.424  42.719  -32.576 1.00 55.53 ? 263  LYS B CB  1 
ATOM   6971  C  CG  . LYS B  1  235 ? 47.801  42.055  -32.409 1.00 55.74 ? 263  LYS B CG  1 
ATOM   6972  C  CD  . LYS B  1  235 ? 48.937  42.924  -32.972 1.00 55.55 ? 263  LYS B CD  1 
ATOM   6973  C  CE  . LYS B  1  235 ? 50.307  42.276  -32.740 1.00 55.98 ? 263  LYS B CE  1 
ATOM   6974  N  NZ  . LYS B  1  235 ? 51.456  43.169  -33.071 1.00 55.23 ? 263  LYS B NZ  1 
ATOM   6975  N  N   . VAL B  1  236 ? 45.501  39.759  -33.143 1.00 54.87 ? 264  VAL B N   1 
ATOM   6976  C  CA  . VAL B  1  236 ? 44.923  38.517  -32.675 1.00 55.37 ? 264  VAL B CA  1 
ATOM   6977  C  C   . VAL B  1  236 ? 45.823  37.914  -31.643 1.00 55.03 ? 264  VAL B C   1 
ATOM   6978  O  O   . VAL B  1  236 ? 47.038  37.997  -31.749 1.00 55.69 ? 264  VAL B O   1 
ATOM   6979  C  CB  . VAL B  1  236 ? 44.771  37.492  -33.798 1.00 54.17 ? 264  VAL B CB  1 
ATOM   6980  C  CG1 . VAL B  1  236 ? 44.666  36.090  -33.220 1.00 52.67 ? 264  VAL B CG1 1 
ATOM   6981  C  CG2 . VAL B  1  236 ? 43.532  37.813  -34.595 1.00 55.30 ? 264  VAL B CG2 1 
ATOM   6982  N  N   . PHE B  1  237 ? 45.222  37.304  -30.638 1.00 54.09 ? 265  PHE B N   1 
ATOM   6983  C  CA  . PHE B  1  237 ? 46.001  36.672  -29.611 1.00 53.79 ? 265  PHE B CA  1 
ATOM   6984  C  C   . PHE B  1  237 ? 45.550  35.243  -29.493 1.00 53.63 ? 265  PHE B C   1 
ATOM   6985  O  O   . PHE B  1  237 ? 44.388  34.980  -29.194 1.00 53.53 ? 265  PHE B O   1 
ATOM   6986  C  CB  . PHE B  1  237 ? 45.803  37.352  -28.271 1.00 53.96 ? 265  PHE B CB  1 
ATOM   6987  C  CG  . PHE B  1  237 ? 46.579  36.706  -27.172 1.00 54.26 ? 265  PHE B CG  1 
ATOM   6988  C  CD1 . PHE B  1  237 ? 47.803  37.233  -26.767 1.00 53.02 ? 265  PHE B CD1 1 
ATOM   6989  C  CD2 . PHE B  1  237 ? 46.125  35.517  -26.590 1.00 53.90 ? 265  PHE B CD2 1 
ATOM   6990  C  CE1 . PHE B  1  237 ? 48.567  36.590  -25.806 1.00 52.05 ? 265  PHE B CE1 1 
ATOM   6991  C  CE2 . PHE B  1  237 ? 46.880  34.863  -25.627 1.00 52.45 ? 265  PHE B CE2 1 
ATOM   6992  C  CZ  . PHE B  1  237 ? 48.106  35.403  -25.235 1.00 52.61 ? 265  PHE B CZ  1 
ATOM   6993  N  N   . TYR B  1  238 ? 46.466  34.316  -29.722 1.00 52.98 ? 266  TYR B N   1 
ATOM   6994  C  CA  . TYR B  1  238 ? 46.105  32.932  -29.604 1.00 53.72 ? 266  TYR B CA  1 
ATOM   6995  C  C   . TYR B  1  238 ? 47.000  32.184  -28.677 1.00 54.64 ? 266  TYR B C   1 
ATOM   6996  O  O   . TYR B  1  238 ? 48.218  32.261  -28.789 1.00 55.48 ? 266  TYR B O   1 
ATOM   6997  C  CB  . TYR B  1  238 ? 46.145  32.219  -30.930 1.00 52.96 ? 266  TYR B CB  1 
ATOM   6998  C  CG  . TYR B  1  238 ? 45.695  30.800  -30.762 1.00 52.27 ? 266  TYR B CG  1 
ATOM   6999  C  CD1 . TYR B  1  238 ? 44.350  30.503  -30.584 1.00 52.27 ? 266  TYR B CD1 1 
ATOM   7000  C  CD2 . TYR B  1  238 ? 46.610  29.757  -30.735 1.00 51.90 ? 266  TYR B CD2 1 
ATOM   7001  C  CE1 . TYR B  1  238 ? 43.922  29.198  -30.386 1.00 53.02 ? 266  TYR B CE1 1 
ATOM   7002  C  CE2 . TYR B  1  238 ? 46.194  28.447  -30.538 1.00 52.48 ? 266  TYR B CE2 1 
ATOM   7003  C  CZ  . TYR B  1  238 ? 44.845  28.174  -30.365 1.00 52.09 ? 266  TYR B CZ  1 
ATOM   7004  O  OH  . TYR B  1  238 ? 44.408  26.881  -30.180 1.00 52.00 ? 266  TYR B OH  1 
ATOM   7005  N  N   . GLN B  1  239 ? 46.366  31.435  -27.783 1.00 55.98 ? 267  GLN B N   1 
ATOM   7006  C  CA  . GLN B  1  239 ? 47.045  30.606  -26.806 1.00 56.87 ? 267  GLN B CA  1 
ATOM   7007  C  C   . GLN B  1  239 ? 48.449  31.061  -26.432 1.00 56.42 ? 267  GLN B C   1 
ATOM   7008  O  O   . GLN B  1  239 ? 49.369  30.251  -26.371 1.00 57.07 ? 267  GLN B O   1 
ATOM   7009  C  CB  . GLN B  1  239 ? 47.070  29.142  -27.289 1.00 55.63 ? 267  GLN B CB  1 
ATOM   7010  C  CG  . GLN B  1  239 ? 45.752  28.403  -27.044 1.00 57.17 ? 267  GLN B CG  1 
ATOM   7011  C  CD  . GLN B  1  239 ? 45.806  26.934  -27.424 1.00 57.91 ? 267  GLN B CD  1 
ATOM   7012  O  OE1 . GLN B  1  239 ? 46.883  26.330  -27.441 1.00 58.67 ? 267  GLN B OE1 1 
ATOM   7013  N  NE2 . GLN B  1  239 ? 44.639  26.343  -27.713 1.00 56.93 ? 267  GLN B NE2 1 
ATOM   7014  N  N   . GLY B  1  240 ? 48.623  32.355  -26.197 1.00 56.00 ? 268  GLY B N   1 
ATOM   7015  C  CA  . GLY B  1  240 ? 49.929  32.828  -25.787 1.00 57.01 ? 268  GLY B CA  1 
ATOM   7016  C  C   . GLY B  1  240 ? 50.686  33.839  -26.624 1.00 58.51 ? 268  GLY B C   1 
ATOM   7017  O  O   . GLY B  1  240 ? 51.498  34.588  -26.089 1.00 58.44 ? 268  GLY B O   1 
ATOM   7018  N  N   . ARG B  1  241 ? 50.441  33.895  -27.924 1.00 58.67 ? 269  ARG B N   1 
ATOM   7019  C  CA  . ARG B  1  241 ? 51.202  34.823  -28.735 1.00 58.42 ? 269  ARG B CA  1 
ATOM   7020  C  C   . ARG B  1  241 ? 50.373  35.748  -29.585 1.00 58.85 ? 269  ARG B C   1 
ATOM   7021  O  O   . ARG B  1  241 ? 49.209  35.488  -29.856 1.00 61.00 ? 269  ARG B O   1 
ATOM   7022  C  CB  . ARG B  1  241 ? 52.175  34.034  -29.609 1.00 61.32 ? 269  ARG B CB  1 
ATOM   7023  C  CG  . ARG B  1  241 ? 52.956  33.033  -28.792 1.00 62.30 ? 269  ARG B CG  1 
ATOM   7024  C  CD  . ARG B  1  241 ? 54.200  32.545  -29.465 1.00 63.92 ? 269  ARG B CD  1 
ATOM   7025  N  NE  . ARG B  1  241 ? 55.138  32.078  -28.448 1.00 66.52 ? 269  ARG B NE  1 
ATOM   7026  C  CZ  . ARG B  1  241 ? 56.357  31.617  -28.707 1.00 68.63 ? 269  ARG B CZ  1 
ATOM   7027  N  NH1 . ARG B  1  241 ? 56.791  31.556  -29.966 1.00 68.85 ? 269  ARG B NH1 1 
ATOM   7028  N  NH2 . ARG B  1  241 ? 57.146  31.225  -27.709 1.00 68.35 ? 269  ARG B NH2 1 
ATOM   7029  N  N   . TYR B  1  242 ? 50.989  36.840  -30.005 1.00 59.01 ? 270  TYR B N   1 
ATOM   7030  C  CA  . TYR B  1  242 ? 50.312  37.815  -30.836 1.00 60.35 ? 270  TYR B CA  1 
ATOM   7031  C  C   . TYR B  1  242 ? 50.538  37.581  -32.328 1.00 60.47 ? 270  TYR B C   1 
ATOM   7032  O  O   . TYR B  1  242 ? 51.647  37.285  -32.773 1.00 60.87 ? 270  TYR B O   1 
ATOM   7033  C  CB  . TYR B  1  242 ? 50.768  39.228  -30.467 1.00 60.85 ? 270  TYR B CB  1 
ATOM   7034  C  CG  . TYR B  1  242 ? 50.351  39.679  -29.080 1.00 61.29 ? 270  TYR B CG  1 
ATOM   7035  C  CD1 . TYR B  1  242 ? 50.853  39.062  -27.935 1.00 61.19 ? 270  TYR B CD1 1 
ATOM   7036  C  CD2 . TYR B  1  242 ? 49.471  40.746  -28.912 1.00 62.18 ? 270  TYR B CD2 1 
ATOM   7037  C  CE1 . TYR B  1  242 ? 50.489  39.506  -26.655 1.00 60.70 ? 270  TYR B CE1 1 
ATOM   7038  C  CE2 . TYR B  1  242 ? 49.105  41.195  -27.637 1.00 61.65 ? 270  TYR B CE2 1 
ATOM   7039  C  CZ  . TYR B  1  242 ? 49.617  40.572  -26.519 1.00 60.64 ? 270  TYR B CZ  1 
ATOM   7040  O  OH  . TYR B  1  242 ? 49.252  41.020  -25.271 1.00 61.15 ? 270  TYR B OH  1 
ATOM   7041  N  N   . TYR B  1  243 ? 49.463  37.714  -33.094 1.00 61.07 ? 271  TYR B N   1 
ATOM   7042  C  CA  . TYR B  1  243 ? 49.505  37.546  -34.540 1.00 61.61 ? 271  TYR B CA  1 
ATOM   7043  C  C   . TYR B  1  243 ? 48.804  38.756  -35.159 1.00 61.72 ? 271  TYR B C   1 
ATOM   7044  O  O   . TYR B  1  243 ? 47.875  39.312  -34.563 1.00 62.18 ? 271  TYR B O   1 
ATOM   7045  C  CB  . TYR B  1  243 ? 48.811  36.237  -34.940 1.00 61.11 ? 271  TYR B CB  1 
ATOM   7046  C  CG  . TYR B  1  243 ? 49.345  35.050  -34.176 1.00 59.92 ? 271  TYR B CG  1 
ATOM   7047  C  CD1 . TYR B  1  243 ? 49.000  34.854  -32.842 1.00 59.50 ? 271  TYR B CD1 1 
ATOM   7048  C  CD2 . TYR B  1  243 ? 50.264  34.174  -34.756 1.00 60.73 ? 271  TYR B CD2 1 
ATOM   7049  C  CE1 . TYR B  1  243 ? 49.556  33.826  -32.099 1.00 60.38 ? 271  TYR B CE1 1 
ATOM   7050  C  CE2 . TYR B  1  243 ? 50.833  33.138  -34.015 1.00 60.57 ? 271  TYR B CE2 1 
ATOM   7051  C  CZ  . TYR B  1  243 ? 50.474  32.979  -32.683 1.00 60.41 ? 271  TYR B CZ  1 
ATOM   7052  O  OH  . TYR B  1  243 ? 51.059  32.015  -31.902 1.00 61.87 ? 271  TYR B OH  1 
ATOM   7053  N  N   . ASP B  1  244 ? 49.253  39.166  -36.342 1.00 60.90 ? 272  ASP B N   1 
ATOM   7054  C  CA  . ASP B  1  244 ? 48.687  40.328  -37.012 1.00 60.45 ? 272  ASP B CA  1 
ATOM   7055  C  C   . ASP B  1  244 ? 47.339  40.034  -37.634 1.00 60.59 ? 272  ASP B C   1 
ATOM   7056  O  O   . ASP B  1  244 ? 46.518  40.927  -37.818 1.00 61.56 ? 272  ASP B O   1 
ATOM   7057  C  CB  . ASP B  1  244 ? 49.655  40.822  -38.081 1.00 61.57 ? 272  ASP B CB  1 
ATOM   7058  C  CG  . ASP B  1  244 ? 51.036  41.106  -37.520 1.00 63.41 ? 272  ASP B CG  1 
ATOM   7059  O  OD1 . ASP B  1  244 ? 51.145  41.947  -36.599 1.00 63.80 ? 272  ASP B OD1 1 
ATOM   7060  O  OD2 . ASP B  1  244 ? 52.015  40.484  -37.992 1.00 63.73 ? 272  ASP B OD2 1 
ATOM   7061  N  N   . SER B  1  245 ? 47.100  38.770  -37.939 1.00 60.94 ? 273  SER B N   1 
ATOM   7062  C  CA  . SER B  1  245 ? 45.845  38.403  -38.553 1.00 60.04 ? 273  SER B CA  1 
ATOM   7063  C  C   . SER B  1  245 ? 45.592  36.943  -38.350 1.00 58.65 ? 273  SER B C   1 
ATOM   7064  O  O   . SER B  1  245 ? 46.509  36.181  -38.064 1.00 58.29 ? 273  SER B O   1 
ATOM   7065  C  CB  . SER B  1  245 ? 45.917  38.653  -40.041 1.00 60.44 ? 273  SER B CB  1 
ATOM   7066  O  OG  . SER B  1  245 ? 46.858  37.759  -40.602 1.00 58.82 ? 273  SER B OG  1 
ATOM   7067  N  N   . LEU B  1  246 ? 44.336  36.567  -38.536 1.00 58.89 ? 274  LEU B N   1 
ATOM   7068  C  CA  . LEU B  1  246 ? 43.914  35.188  -38.406 1.00 59.16 ? 274  LEU B CA  1 
ATOM   7069  C  C   . LEU B  1  246 ? 44.689  34.395  -39.429 1.00 59.14 ? 274  LEU B C   1 
ATOM   7070  O  O   . LEU B  1  246 ? 45.204  33.314  -39.156 1.00 60.49 ? 274  LEU B O   1 
ATOM   7071  C  CB  . LEU B  1  246 ? 42.432  35.070  -38.716 1.00 60.60 ? 274  LEU B CB  1 
ATOM   7072  C  CG  . LEU B  1  246 ? 41.546  36.000  -37.908 1.00 60.29 ? 274  LEU B CG  1 
ATOM   7073  C  CD1 . LEU B  1  246 ? 40.168  35.991  -38.477 1.00 60.91 ? 274  LEU B CD1 1 
ATOM   7074  C  CD2 . LEU B  1  246 ? 41.524  35.545  -36.479 1.00 60.94 ? 274  LEU B CD2 1 
ATOM   7075  N  N   . ALA B  1  247 ? 44.760  34.947  -40.626 1.00 59.59 ? 275  ALA B N   1 
ATOM   7076  C  CA  . ALA B  1  247 ? 45.472  34.303  -41.713 1.00 61.00 ? 275  ALA B CA  1 
ATOM   7077  C  C   . ALA B  1  247 ? 46.918  33.941  -41.324 1.00 61.29 ? 275  ALA B C   1 
ATOM   7078  O  O   . ALA B  1  247 ? 47.325  32.771  -41.411 1.00 59.84 ? 275  ALA B O   1 
ATOM   7079  C  CB  . ALA B  1  247 ? 45.465  35.219  -42.921 1.00 60.08 ? 275  ALA B CB  1 
ATOM   7080  N  N   . GLN B  1  248 ? 47.677  34.952  -40.897 1.00 59.94 ? 276  GLN B N   1 
ATOM   7081  C  CA  . GLN B  1  248 ? 49.060  34.770  -40.510 1.00 58.73 ? 276  GLN B CA  1 
ATOM   7082  C  C   . GLN B  1  248 ? 49.136  33.666  -39.490 1.00 59.52 ? 276  GLN B C   1 
ATOM   7083  O  O   . GLN B  1  248 ? 50.017  32.814  -39.544 1.00 59.63 ? 276  GLN B O   1 
ATOM   7084  C  CB  . GLN B  1  248 ? 49.608  36.045  -39.911 1.00 59.30 ? 276  GLN B CB  1 
ATOM   7085  C  CG  . GLN B  1  248 ? 51.099  36.020  -39.805 1.00 60.05 ? 276  GLN B CG  1 
ATOM   7086  C  CD  . GLN B  1  248 ? 51.591  36.812  -38.636 1.00 60.94 ? 276  GLN B CD  1 
ATOM   7087  O  OE1 . GLN B  1  248 ? 51.392  38.024  -38.564 1.00 61.89 ? 276  GLN B OE1 1 
ATOM   7088  N  NE2 . GLN B  1  248 ? 52.233  36.133  -37.690 1.00 61.08 ? 276  GLN B NE2 1 
ATOM   7089  N  N   . LEU B  1  249 ? 48.205  33.696  -38.549 1.00 59.97 ? 277  LEU B N   1 
ATOM   7090  C  CA  . LEU B  1  249 ? 48.136  32.673  -37.525 1.00 60.29 ? 277  LEU B CA  1 
ATOM   7091  C  C   . LEU B  1  249 ? 47.867  31.346  -38.218 1.00 60.46 ? 277  LEU B C   1 
ATOM   7092  O  O   . LEU B  1  249 ? 48.661  30.411  -38.119 1.00 60.70 ? 277  LEU B O   1 
ATOM   7093  C  CB  . LEU B  1  249 ? 47.004  32.985  -36.550 1.00 59.58 ? 277  LEU B CB  1 
ATOM   7094  C  CG  . LEU B  1  249 ? 46.620  31.883  -35.563 1.00 59.75 ? 277  LEU B CG  1 
ATOM   7095  C  CD1 . LEU B  1  249 ? 47.867  31.313  -34.891 1.00 60.92 ? 277  LEU B CD1 1 
ATOM   7096  C  CD2 . LEU B  1  249 ? 45.666  32.457  -34.536 1.00 58.22 ? 277  LEU B CD2 1 
ATOM   7097  N  N   . GLU B  1  250 ? 46.738  31.283  -38.919 1.00 60.16 ? 278  GLU B N   1 
ATOM   7098  C  CA  . GLU B  1  250 ? 46.342  30.091  -39.649 1.00 58.67 ? 278  GLU B CA  1 
ATOM   7099  C  C   . GLU B  1  250 ? 47.552  29.582  -40.380 1.00 59.39 ? 278  GLU B C   1 
ATOM   7100  O  O   . GLU B  1  250 ? 47.873  28.401  -40.324 1.00 59.68 ? 278  GLU B O   1 
ATOM   7101  C  CB  . GLU B  1  250 ? 45.258  30.418  -40.665 1.00 58.88 ? 278  GLU B CB  1 
ATOM   7102  C  CG  . GLU B  1  250 ? 44.793  29.211  -41.431 1.00 60.21 ? 278  GLU B CG  1 
ATOM   7103  C  CD  . GLU B  1  250 ? 44.613  27.998  -40.534 1.00 60.60 ? 278  GLU B CD  1 
ATOM   7104  O  OE1 . GLU B  1  250 ? 43.917  28.108  -39.507 1.00 60.71 ? 278  GLU B OE1 1 
ATOM   7105  O  OE2 . GLU B  1  250 ? 45.167  26.928  -40.854 1.00 61.07 ? 278  GLU B OE2 1 
ATOM   7106  N  N   . ALA B  1  251 ? 48.219  30.500  -41.067 1.00 60.08 ? 279  ALA B N   1 
ATOM   7107  C  CA  . ALA B  1  251 ? 49.421  30.195  -41.823 1.00 60.30 ? 279  ALA B CA  1 
ATOM   7108  C  C   . ALA B  1  251 ? 50.405  29.431  -40.956 1.00 59.84 ? 279  ALA B C   1 
ATOM   7109  O  O   . ALA B  1  251 ? 50.744  28.288  -41.239 1.00 59.47 ? 279  ALA B O   1 
ATOM   7110  C  CB  . ALA B  1  251 ? 50.061  31.480  -42.303 1.00 59.51 ? 279  ALA B CB  1 
ATOM   7111  N  N   . GLN B  1  252 ? 50.849  30.077  -39.886 1.00 60.16 ? 280  GLN B N   1 
ATOM   7112  C  CA  . GLN B  1  252 ? 51.809  29.482  -38.977 1.00 59.72 ? 280  GLN B CA  1 
ATOM   7113  C  C   . GLN B  1  252 ? 51.347  28.182  -38.341 1.00 59.60 ? 280  GLN B C   1 
ATOM   7114  O  O   . GLN B  1  252 ? 52.172  27.368  -37.945 1.00 59.64 ? 280  GLN B O   1 
ATOM   7115  C  CB  . GLN B  1  252 ? 52.182  30.498  -37.911 1.00 59.41 ? 280  GLN B CB  1 
ATOM   7116  C  CG  . GLN B  1  252 ? 52.483  31.847  -38.522 1.00 60.69 ? 280  GLN B CG  1 
ATOM   7117  C  CD  . GLN B  1  252 ? 53.565  32.598  -37.786 1.00 61.31 ? 280  GLN B CD  1 
ATOM   7118  O  OE1 . GLN B  1  252 ? 53.919  33.719  -38.157 1.00 62.34 ? 280  GLN B OE1 1 
ATOM   7119  N  NE2 . GLN B  1  252 ? 54.110  31.988  -36.740 1.00 60.13 ? 280  GLN B NE2 1 
ATOM   7120  N  N   . PHE B  1  253 ? 50.037  27.979  -38.243 1.00 60.72 ? 281  PHE B N   1 
ATOM   7121  C  CA  . PHE B  1  253 ? 49.517  26.744  -37.663 1.00 60.87 ? 281  PHE B CA  1 
ATOM   7122  C  C   . PHE B  1  253 ? 49.795  25.548  -38.568 1.00 61.11 ? 281  PHE B C   1 
ATOM   7123  O  O   . PHE B  1  253 ? 50.281  24.518  -38.113 1.00 60.81 ? 281  PHE B O   1 
ATOM   7124  C  CB  . PHE B  1  253 ? 48.010  26.817  -37.443 1.00 60.49 ? 281  PHE B CB  1 
ATOM   7125  C  CG  . PHE B  1  253 ? 47.379  25.464  -37.249 1.00 60.28 ? 281  PHE B CG  1 
ATOM   7126  C  CD1 . PHE B  1  253 ? 47.554  24.766  -36.064 1.00 60.17 ? 281  PHE B CD1 1 
ATOM   7127  C  CD2 . PHE B  1  253 ? 46.658  24.863  -38.272 1.00 60.37 ? 281  PHE B CD2 1 
ATOM   7128  C  CE1 . PHE B  1  253 ? 47.021  23.489  -35.898 1.00 60.32 ? 281  PHE B CE1 1 
ATOM   7129  C  CE2 . PHE B  1  253 ? 46.122  23.582  -38.112 1.00 60.67 ? 281  PHE B CE2 1 
ATOM   7130  C  CZ  . PHE B  1  253 ? 46.305  22.897  -36.922 1.00 60.14 ? 281  PHE B CZ  1 
ATOM   7131  N  N   . GLU B  1  254 ? 49.440  25.677  -39.842 1.00 60.78 ? 282  GLU B N   1 
ATOM   7132  C  CA  . GLU B  1  254 ? 49.667  24.613  -40.809 1.00 60.83 ? 282  GLU B CA  1 
ATOM   7133  C  C   . GLU B  1  254 ? 51.135  24.596  -41.229 1.00 62.95 ? 282  GLU B C   1 
ATOM   7134  O  O   . GLU B  1  254 ? 51.576  23.682  -41.930 1.00 62.34 ? 282  GLU B O   1 
ATOM   7135  C  CB  . GLU B  1  254 ? 48.770  24.818  -42.021 1.00 61.31 ? 282  GLU B CB  1 
ATOM   7136  C  CG  . GLU B  1  254 ? 48.275  26.233  -42.140 1.00 62.47 ? 282  GLU B CG  1 
ATOM   7137  C  CD  . GLU B  1  254 ? 47.287  26.420  -43.273 1.00 64.15 ? 282  GLU B CD  1 
ATOM   7138  O  OE1 . GLU B  1  254 ? 46.385  27.272  -43.135 1.00 64.06 ? 282  GLU B OE1 1 
ATOM   7139  O  OE2 . GLU B  1  254 ? 47.414  25.733  -44.305 1.00 64.21 ? 282  GLU B OE2 1 
ATOM   7140  N  N   . ALA B  1  255 ? 51.884  25.616  -40.799 1.00 63.44 ? 283  ALA B N   1 
ATOM   7141  C  CA  . ALA B  1  255 ? 53.320  25.723  -41.085 1.00 62.34 ? 283  ALA B CA  1 
ATOM   7142  C  C   . ALA B  1  255 ? 54.014  24.783  -40.108 1.00 62.57 ? 283  ALA B C   1 
ATOM   7143  O  O   . ALA B  1  255 ? 55.069  24.207  -40.401 1.00 62.03 ? 283  ALA B O   1 
ATOM   7144  C  CB  . ALA B  1  255 ? 53.802  27.153  -40.864 1.00 62.67 ? 283  ALA B CB  1 
ATOM   7145  N  N   . GLY B  1  256 ? 53.389  24.650  -38.939 1.00 64.10 ? 284  GLY B N   1 
ATOM   7146  C  CA  . GLY B  1  256 ? 53.877  23.774  -37.892 1.00 62.81 ? 284  GLY B CA  1 
ATOM   7147  C  C   . GLY B  1  256 ? 54.542  24.458  -36.713 1.00 63.91 ? 284  GLY B C   1 
ATOM   7148  O  O   . GLY B  1  256 ? 55.163  23.780  -35.898 1.00 64.79 ? 284  GLY B O   1 
ATOM   7149  N  N   . LEU B  1  257 ? 54.420  25.779  -36.593 1.00 64.72 ? 285  LEU B N   1 
ATOM   7150  C  CA  . LEU B  1  257 ? 55.080  26.468  -35.485 1.00 64.53 ? 285  LEU B CA  1 
ATOM   7151  C  C   . LEU B  1  257 ? 54.168  26.944  -34.372 1.00 65.31 ? 285  LEU B C   1 
ATOM   7152  O  O   . LEU B  1  257 ? 54.625  27.607  -33.442 1.00 66.81 ? 285  LEU B O   1 
ATOM   7153  C  CB  . LEU B  1  257 ? 55.882  27.668  -35.989 1.00 64.43 ? 285  LEU B CB  1 
ATOM   7154  C  CG  . LEU B  1  257 ? 56.941  28.109  -34.971 1.00 64.55 ? 285  LEU B CG  1 
ATOM   7155  C  CD1 . LEU B  1  257 ? 58.217  27.273  -35.149 1.00 64.18 ? 285  LEU B CD1 1 
ATOM   7156  C  CD2 . LEU B  1  257 ? 57.232  29.587  -35.148 1.00 65.10 ? 285  LEU B CD2 1 
ATOM   7157  N  N   . VAL B  1  258 ? 52.885  26.617  -34.458 1.00 66.17 ? 286  VAL B N   1 
ATOM   7158  C  CA  . VAL B  1  258 ? 51.935  27.033  -33.431 1.00 66.66 ? 286  VAL B CA  1 
ATOM   7159  C  C   . VAL B  1  258 ? 51.441  25.827  -32.639 1.00 67.17 ? 286  VAL B C   1 
ATOM   7160  O  O   . VAL B  1  258 ? 50.562  25.102  -33.104 1.00 67.87 ? 286  VAL B O   1 
ATOM   7161  C  CB  . VAL B  1  258 ? 50.716  27.748  -34.057 1.00 66.05 ? 286  VAL B CB  1 
ATOM   7162  C  CG1 . VAL B  1  258 ? 49.706  28.115  -32.975 1.00 66.14 ? 286  VAL B CG1 1 
ATOM   7163  C  CG2 . VAL B  1  258 ? 51.172  28.985  -34.798 1.00 66.25 ? 286  VAL B CG2 1 
ATOM   7164  N  N   . ASN B  1  259 ? 51.992  25.605  -31.446 1.00 67.54 ? 287  ASN B N   1 
ATOM   7165  C  CA  . ASN B  1  259 ? 51.546  24.468  -30.663 1.00 67.54 ? 287  ASN B CA  1 
ATOM   7166  C  C   . ASN B  1  259 ? 50.175  24.692  -30.051 1.00 68.80 ? 287  ASN B C   1 
ATOM   7167  O  O   . ASN B  1  259 ? 49.927  25.699  -29.371 1.00 69.31 ? 287  ASN B O   1 
ATOM   7168  C  CB  . ASN B  1  259 ? 52.526  24.128  -29.556 1.00 68.91 ? 287  ASN B CB  1 
ATOM   7169  C  CG  . ASN B  1  259 ? 52.116  22.860  -28.819 1.00 71.02 ? 287  ASN B CG  1 
ATOM   7170  O  OD1 . ASN B  1  259 ? 51.910  21.813  -29.445 1.00 71.65 ? 287  ASN B OD1 1 
ATOM   7171  N  ND2 . ASN B  1  259 ? 51.979  22.946  -27.495 1.00 70.29 ? 287  ASN B ND2 1 
ATOM   7172  N  N   . VAL B  1  260 ? 49.286  23.735  -30.278 1.00 68.16 ? 288  VAL B N   1 
ATOM   7173  C  CA  . VAL B  1  260 ? 47.943  23.857  -29.760 1.00 69.63 ? 288  VAL B CA  1 
ATOM   7174  C  C   . VAL B  1  260 ? 47.584  22.899  -28.636 1.00 70.72 ? 288  VAL B C   1 
ATOM   7175  O  O   . VAL B  1  260 ? 47.833  21.688  -28.710 1.00 69.44 ? 288  VAL B O   1 
ATOM   7176  C  CB  . VAL B  1  260 ? 46.905  23.716  -30.893 1.00 70.33 ? 288  VAL B CB  1 
ATOM   7177  C  CG1 . VAL B  1  260 ? 45.497  23.612  -30.319 1.00 70.94 ? 288  VAL B CG1 1 
ATOM   7178  C  CG2 . VAL B  1  260 ? 46.990  24.923  -31.806 1.00 70.07 ? 288  VAL B CG2 1 
ATOM   7179  N  N   . VAL B  1  261 ? 46.994  23.491  -27.595 1.00 71.58 ? 289  VAL B N   1 
ATOM   7180  C  CA  . VAL B  1  261 ? 46.515  22.796  -26.407 1.00 71.03 ? 289  VAL B CA  1 
ATOM   7181  C  C   . VAL B  1  261 ? 45.047  22.549  -26.691 1.00 70.80 ? 289  VAL B C   1 
ATOM   7182  O  O   . VAL B  1  261 ? 44.251  23.492  -26.754 1.00 71.26 ? 289  VAL B O   1 
ATOM   7183  C  CB  . VAL B  1  261 ? 46.626  23.691  -25.174 1.00 70.26 ? 289  VAL B CB  1 
ATOM   7184  C  CG1 . VAL B  1  261 ? 45.997  23.009  -23.981 1.00 70.96 ? 289  VAL B CG1 1 
ATOM   7185  C  CG2 . VAL B  1  261 ? 48.080  24.023  -24.913 1.00 70.20 ? 289  VAL B CG2 1 
ATOM   7186  N  N   . LEU B  1  262 ? 44.686  21.287  -26.879 1.00 70.41 ? 290  LEU B N   1 
ATOM   7187  C  CA  . LEU B  1  262 ? 43.305  20.962  -27.197 1.00 72.01 ? 290  LEU B CA  1 
ATOM   7188  C  C   . LEU B  1  262 ? 42.375  21.247  -26.037 1.00 71.91 ? 290  LEU B C   1 
ATOM   7189  O  O   . LEU B  1  262 ? 42.588  20.780  -24.923 1.00 71.21 ? 290  LEU B O   1 
ATOM   7190  C  CB  . LEU B  1  262 ? 43.193  19.500  -27.631 1.00 72.56 ? 290  LEU B CB  1 
ATOM   7191  C  CG  . LEU B  1  262 ? 43.979  19.159  -28.909 1.00 73.16 ? 290  LEU B CG  1 
ATOM   7192  C  CD1 . LEU B  1  262 ? 44.064  17.650  -29.084 1.00 73.35 ? 290  LEU B CD1 1 
ATOM   7193  C  CD2 . LEU B  1  262 ? 43.316  19.803  -30.123 1.00 72.89 ? 290  LEU B CD2 1 
ATOM   7194  N  N   . ILE B  1  263 ? 41.342  22.034  -26.311 1.00 72.73 ? 291  ILE B N   1 
ATOM   7195  C  CA  . ILE B  1  263 ? 40.373  22.401  -25.292 1.00 72.90 ? 291  ILE B CA  1 
ATOM   7196  C  C   . ILE B  1  263 ? 39.123  21.525  -25.422 1.00 73.30 ? 291  ILE B C   1 
ATOM   7197  O  O   . ILE B  1  263 ? 38.441  21.547  -26.449 1.00 73.30 ? 291  ILE B O   1 
ATOM   7198  C  CB  . ILE B  1  263 ? 39.972  23.888  -25.437 1.00 72.34 ? 291  ILE B CB  1 
ATOM   7199  C  CG1 . ILE B  1  263 ? 41.225  24.756  -25.583 1.00 71.93 ? 291  ILE B CG1 1 
ATOM   7200  C  CG2 . ILE B  1  263 ? 39.155  24.329  -24.232 1.00 72.77 ? 291  ILE B CG2 1 
ATOM   7201  C  CD1 . ILE B  1  263 ? 42.136  24.726  -24.381 1.00 71.74 ? 291  ILE B CD1 1 
ATOM   7202  N  N   . PRO B  1  264 ? 38.817  20.727  -24.388 1.00 72.95 ? 292  PRO B N   1 
ATOM   7203  C  CA  . PRO B  1  264 ? 37.631  19.868  -24.452 1.00 72.75 ? 292  PRO B CA  1 
ATOM   7204  C  C   . PRO B  1  264 ? 36.379  20.712  -24.634 1.00 72.68 ? 292  PRO B C   1 
ATOM   7205  O  O   . PRO B  1  264 ? 36.276  21.785  -24.059 1.00 73.24 ? 292  PRO B O   1 
ATOM   7206  C  CB  . PRO B  1  264 ? 37.664  19.140  -23.115 1.00 73.65 ? 292  PRO B CB  1 
ATOM   7207  C  CG  . PRO B  1  264 ? 38.387  20.122  -22.207 1.00 73.70 ? 292  PRO B CG  1 
ATOM   7208  C  CD  . PRO B  1  264 ? 39.493  20.615  -23.083 1.00 72.91 ? 292  PRO B CD  1 
ATOM   7209  N  N   . ASP B  1  265 ? 35.433  20.242  -25.438 1.00 73.71 ? 293  ASP B N   1 
ATOM   7210  C  CA  . ASP B  1  265 ? 34.211  21.004  -25.674 1.00 73.28 ? 293  ASP B CA  1 
ATOM   7211  C  C   . ASP B  1  265 ? 33.051  20.578  -24.770 1.00 74.22 ? 293  ASP B C   1 
ATOM   7212  O  O   . ASP B  1  265 ? 31.953  21.133  -24.867 1.00 74.50 ? 293  ASP B O   1 
ATOM   7213  C  CB  . ASP B  1  265 ? 33.802  20.915  -27.159 1.00 73.42 ? 293  ASP B CB  1 
ATOM   7214  C  CG  . ASP B  1  265 ? 33.352  19.511  -27.581 1.00 74.42 ? 293  ASP B CG  1 
ATOM   7215  O  OD1 . ASP B  1  265 ? 34.023  18.505  -27.236 1.00 73.83 ? 293  ASP B OD1 1 
ATOM   7216  O  OD2 . ASP B  1  265 ? 32.323  19.418  -28.286 1.00 73.50 ? 293  ASP B OD2 1 
ATOM   7217  N  N   . ASN B  1  266 ? 33.300  19.608  -23.886 1.00 74.19 ? 294  ASN B N   1 
ATOM   7218  C  CA  . ASN B  1  266 ? 32.278  19.116  -22.955 1.00 73.87 ? 294  ASN B CA  1 
ATOM   7219  C  C   . ASN B  1  266 ? 32.921  18.443  -21.737 1.00 73.89 ? 294  ASN B C   1 
ATOM   7220  O  O   . ASN B  1  266 ? 34.117  18.150  -21.743 1.00 73.95 ? 294  ASN B O   1 
ATOM   7221  C  CB  . ASN B  1  266 ? 31.342  18.129  -23.669 1.00 76.38 ? 294  ASN B CB  1 
ATOM   7222  C  CG  . ASN B  1  266 ? 30.088  17.800  -22.853 1.00 79.21 ? 294  ASN B CG  1 
ATOM   7223  O  OD1 . ASN B  1  266 ? 29.436  18.696  -22.306 1.00 78.93 ? 294  ASN B OD1 1 
ATOM   7224  N  ND2 . ASN B  1  266 ? 29.751  16.513  -22.790 1.00 82.20 ? 294  ASN B ND2 1 
ATOM   7225  N  N   . GLY B  1  267 ? 32.121  18.213  -20.696 1.00 73.76 ? 295  GLY B N   1 
ATOM   7226  C  CA  . GLY B  1  267 ? 32.624  17.579  -19.487 1.00 73.22 ? 295  GLY B CA  1 
ATOM   7227  C  C   . GLY B  1  267 ? 31.575  17.426  -18.394 1.00 72.73 ? 295  GLY B C   1 
ATOM   7228  O  O   . GLY B  1  267 ? 30.370  17.429  -18.671 1.00 72.88 ? 295  GLY B O   1 
ATOM   7229  N  N   . THR B  1  268 ? 32.034  17.293  -17.148 1.00 72.07 ? 296  THR B N   1 
ATOM   7230  C  CA  . THR B  1  268 ? 31.136  17.136  -16.004 1.00 71.57 ? 296  THR B CA  1 
ATOM   7231  C  C   . THR B  1  268 ? 31.485  17.998  -14.795 1.00 71.67 ? 296  THR B C   1 
ATOM   7232  O  O   . THR B  1  268 ? 32.636  18.390  -14.588 1.00 71.38 ? 296  THR B O   1 
ATOM   7233  C  CB  . THR B  1  268 ? 31.103  15.697  -15.522 1.00 70.64 ? 296  THR B CB  1 
ATOM   7234  O  OG1 . THR B  1  268 ? 30.790  14.841  -16.620 1.00 71.96 ? 296  THR B OG1 1 
ATOM   7235  C  CG2 . THR B  1  268 ? 30.051  15.529  -14.452 1.00 71.76 ? 296  THR B CG2 1 
ATOM   7236  N  N   . GLY B  1  269 ? 30.475  18.273  -13.982 1.00 71.47 ? 297  GLY B N   1 
ATOM   7237  C  CA  . GLY B  1  269 ? 30.700  19.077  -12.805 1.00 70.54 ? 297  GLY B CA  1 
ATOM   7238  C  C   . GLY B  1  269 ? 30.277  20.502  -13.047 1.00 69.56 ? 297  GLY B C   1 
ATOM   7239  O  O   . GLY B  1  269 ? 29.671  20.822  -14.075 1.00 69.01 ? 297  GLY B O   1 
ATOM   7240  N  N   . GLY B  1  270 ? 30.618  21.358  -12.091 1.00 69.58 ? 298  GLY B N   1 
ATOM   7241  C  CA  . GLY B  1  270 ? 30.260  22.764  -12.164 1.00 70.43 ? 298  GLY B CA  1 
ATOM   7242  C  C   . GLY B  1  270 ? 30.831  23.511  -13.349 1.00 70.08 ? 298  GLY B C   1 
ATOM   7243  O  O   . GLY B  1  270 ? 30.160  24.382  -13.935 1.00 69.99 ? 298  GLY B O   1 
ATOM   7244  N  N   . SER B  1  271 ? 32.073  23.177  -13.696 1.00 70.02 ? 299  SER B N   1 
ATOM   7245  C  CA  . SER B  1  271 ? 32.739  23.813  -14.821 1.00 69.57 ? 299  SER B CA  1 
ATOM   7246  C  C   . SER B  1  271 ? 31.895  23.595  -16.067 1.00 69.24 ? 299  SER B C   1 
ATOM   7247  O  O   . SER B  1  271 ? 32.045  24.310  -17.055 1.00 69.11 ? 299  SER B O   1 
ATOM   7248  C  CB  . SER B  1  271 ? 34.146  23.227  -15.015 1.00 68.29 ? 299  SER B CB  1 
ATOM   7249  O  OG  . SER B  1  271 ? 34.113  21.812  -15.037 1.00 68.36 ? 299  SER B OG  1 
ATOM   7250  N  N   . TRP B  1  272 ? 30.972  22.636  -15.995 1.00 69.33 ? 300  TRP B N   1 
ATOM   7251  C  CA  . TRP B  1  272 ? 30.138  22.312  -17.139 1.00 68.41 ? 300  TRP B CA  1 
ATOM   7252  C  C   . TRP B  1  272 ? 28.635  22.460  -17.010 1.00 68.32 ? 300  TRP B C   1 
ATOM   7253  O  O   . TRP B  1  272 ? 27.973  22.737  -18.002 1.00 69.08 ? 300  TRP B O   1 
ATOM   7254  C  CB  . TRP B  1  272 ? 30.475  20.900  -17.618 1.00 69.25 ? 300  TRP B CB  1 
ATOM   7255  C  CG  . TRP B  1  272 ? 31.910  20.788  -18.046 1.00 70.22 ? 300  TRP B CG  1 
ATOM   7256  C  CD1 . TRP B  1  272 ? 32.964  20.272  -17.324 1.00 70.23 ? 300  TRP B CD1 1 
ATOM   7257  C  CD2 . TRP B  1  272 ? 32.469  21.296  -19.256 1.00 69.08 ? 300  TRP B CD2 1 
ATOM   7258  N  NE1 . TRP B  1  272 ? 34.142  20.438  -18.018 1.00 69.52 ? 300  TRP B NE1 1 
ATOM   7259  C  CE2 . TRP B  1  272 ? 33.865  21.064  -19.206 1.00 69.52 ? 300  TRP B CE2 1 
ATOM   7260  C  CE3 . TRP B  1  272 ? 31.926  21.932  -20.379 1.00 69.26 ? 300  TRP B CE3 1 
ATOM   7261  C  CZ2 . TRP B  1  272 ? 34.718  21.447  -20.238 1.00 70.39 ? 300  TRP B CZ2 1 
ATOM   7262  C  CZ3 . TRP B  1  272 ? 32.775  22.313  -21.403 1.00 69.13 ? 300  TRP B CZ3 1 
ATOM   7263  C  CH2 . TRP B  1  272 ? 34.156  22.070  -21.327 1.00 69.91 ? 300  TRP B CH2 1 
ATOM   7264  N  N   . SER B  1  273 ? 28.072  22.274  -15.826 1.00 67.15 ? 301  SER B N   1 
ATOM   7265  C  CA  . SER B  1  273 ? 26.627  22.420  -15.719 1.00 67.98 ? 301  SER B CA  1 
ATOM   7266  C  C   . SER B  1  273 ? 26.202  23.096  -14.440 1.00 68.30 ? 301  SER B C   1 
ATOM   7267  O  O   . SER B  1  273 ? 26.990  23.226  -13.513 1.00 68.52 ? 301  SER B O   1 
ATOM   7268  C  CB  . SER B  1  273 ? 25.940  21.058  -15.824 1.00 68.39 ? 301  SER B CB  1 
ATOM   7269  O  OG  . SER B  1  273 ? 26.264  20.237  -14.721 1.00 69.21 ? 301  SER B OG  1 
ATOM   7270  N  N   . LEU B  1  274 ? 24.951  23.540  -14.401 1.00 68.32 ? 302  LEU B N   1 
ATOM   7271  C  CA  . LEU B  1  274 ? 24.413  24.191  -13.216 1.00 68.87 ? 302  LEU B CA  1 
ATOM   7272  C  C   . LEU B  1  274 ? 23.406  23.271  -12.548 1.00 69.72 ? 302  LEU B C   1 
ATOM   7273  O  O   . LEU B  1  274 ? 22.985  23.506  -11.414 1.00 69.49 ? 302  LEU B O   1 
ATOM   7274  C  CB  . LEU B  1  274 ? 23.733  25.515  -13.579 1.00 68.88 ? 302  LEU B CB  1 
ATOM   7275  C  CG  . LEU B  1  274 ? 24.613  26.749  -13.780 1.00 67.91 ? 302  LEU B CG  1 
ATOM   7276  C  CD1 . LEU B  1  274 ? 23.777  27.899  -14.292 1.00 67.96 ? 302  LEU B CD1 1 
ATOM   7277  C  CD2 . LEU B  1  274 ? 25.271  27.123  -12.473 1.00 68.14 ? 302  LEU B CD2 1 
ATOM   7278  N  N   . LYS B  1  275 ? 23.023  22.215  -13.256 1.00 69.82 ? 303  LYS B N   1 
ATOM   7279  C  CA  . LYS B  1  275 ? 22.058  21.274  -12.717 1.00 70.17 ? 303  LYS B CA  1 
ATOM   7280  C  C   . LYS B  1  275 ? 22.732  20.389  -11.679 1.00 70.24 ? 303  LYS B C   1 
ATOM   7281  O  O   . LYS B  1  275 ? 23.675  19.667  -11.993 1.00 69.31 ? 303  LYS B O   1 
ATOM   7282  C  CB  . LYS B  1  275 ? 21.476  20.419  -13.842 1.00 70.57 ? 303  LYS B CB  1 
ATOM   7283  C  CG  . LYS B  1  275 ? 20.257  19.610  -13.427 1.00 72.15 ? 303  LYS B CG  1 
ATOM   7284  C  CD  . LYS B  1  275 ? 19.737  18.754  -14.573 1.00 73.56 ? 303  LYS B CD  1 
ATOM   7285  C  CE  . LYS B  1  275 ? 18.625  17.814  -14.112 1.00 73.53 ? 303  LYS B CE  1 
ATOM   7286  N  NZ  . LYS B  1  275 ? 18.234  16.848  -15.183 1.00 74.35 ? 303  LYS B NZ  1 
ATOM   7287  N  N   . SER B  1  276 ? 22.255  20.462  -10.439 1.00 70.68 ? 304  SER B N   1 
ATOM   7288  C  CA  . SER B  1  276 ? 22.809  19.654  -9.359  1.00 70.92 ? 304  SER B CA  1 
ATOM   7289  C  C   . SER B  1  276 ? 22.499  18.174  -9.587  1.00 72.44 ? 304  SER B C   1 
ATOM   7290  O  O   . SER B  1  276 ? 21.349  17.806  -9.833  1.00 72.21 ? 304  SER B O   1 
ATOM   7291  C  CB  . SER B  1  276 ? 22.225  20.085  -8.018  1.00 70.67 ? 304  SER B CB  1 
ATOM   7292  O  OG  . SER B  1  276 ? 22.611  19.190  -6.990  1.00 69.78 ? 304  SER B OG  1 
ATOM   7293  N  N   . PRO B  1  277 ? 23.525  17.302  -9.504  1.00 73.99 ? 305  PRO B N   1 
ATOM   7294  C  CA  . PRO B  1  277 ? 23.367  15.851  -9.702  1.00 72.17 ? 305  PRO B CA  1 
ATOM   7295  C  C   . PRO B  1  277 ? 22.548  15.132  -8.620  1.00 72.65 ? 305  PRO B C   1 
ATOM   7296  O  O   . PRO B  1  277 ? 21.964  14.071  -8.861  1.00 72.13 ? 305  PRO B O   1 
ATOM   7297  C  CB  . PRO B  1  277 ? 24.810  15.359  -9.747  1.00 71.00 ? 305  PRO B CB  1 
ATOM   7298  C  CG  . PRO B  1  277 ? 25.513  16.308  -8.823  1.00 70.87 ? 305  PRO B CG  1 
ATOM   7299  C  CD  . PRO B  1  277 ? 24.938  17.641  -9.240  1.00 71.85 ? 305  PRO B CD  1 
ATOM   7300  N  N   . VAL B  1  278 ? 22.507  15.726  -7.433  1.00 73.32 ? 306  VAL B N   1 
ATOM   7301  C  CA  . VAL B  1  278 ? 21.796  15.160  -6.291  1.00 72.97 ? 306  VAL B CA  1 
ATOM   7302  C  C   . VAL B  1  278 ? 20.299  15.469  -6.238  1.00 73.14 ? 306  VAL B C   1 
ATOM   7303  O  O   . VAL B  1  278 ? 19.873  16.603  -6.473  1.00 73.63 ? 306  VAL B O   1 
ATOM   7304  C  CB  . VAL B  1  278 ? 22.429  15.651  -4.969  1.00 73.55 ? 306  VAL B CB  1 
ATOM   7305  C  CG1 . VAL B  1  278 ? 21.664  15.091  -3.782  1.00 73.79 ? 306  VAL B CG1 1 
ATOM   7306  C  CG2 . VAL B  1  278 ? 23.903  15.249  -4.913  1.00 73.62 ? 306  VAL B CG2 1 
ATOM   7307  N  N   . PRO B  1  279 ? 19.481  14.453  -5.913  1.00 73.58 ? 307  PRO B N   1 
ATOM   7308  C  CA  . PRO B  1  279 ? 18.028  14.616  -5.821  1.00 73.13 ? 307  PRO B CA  1 
ATOM   7309  C  C   . PRO B  1  279 ? 17.655  15.217  -4.464  1.00 73.63 ? 307  PRO B C   1 
ATOM   7310  O  O   . PRO B  1  279 ? 18.309  14.948  -3.447  1.00 73.10 ? 307  PRO B O   1 
ATOM   7311  C  CB  . PRO B  1  279 ? 17.521  13.191  -5.970  1.00 73.30 ? 307  PRO B CB  1 
ATOM   7312  C  CG  . PRO B  1  279 ? 18.566  12.410  -5.211  1.00 73.12 ? 307  PRO B CG  1 
ATOM   7313  C  CD  . PRO B  1  279 ? 19.861  13.039  -5.717  1.00 73.64 ? 307  PRO B CD  1 
ATOM   7314  N  N   . PRO B  1  280 ? 16.594  16.036  -4.432  1.00 72.96 ? 308  PRO B N   1 
ATOM   7315  C  CA  . PRO B  1  280 ? 16.142  16.671  -3.193  1.00 72.49 ? 308  PRO B CA  1 
ATOM   7316  C  C   . PRO B  1  280 ? 16.064  15.745  -1.989  1.00 71.74 ? 308  PRO B C   1 
ATOM   7317  O  O   . PRO B  1  280 ? 16.138  14.517  -2.098  1.00 71.78 ? 308  PRO B O   1 
ATOM   7318  C  CB  . PRO B  1  280 ? 14.776  17.224  -3.574  1.00 72.09 ? 308  PRO B CB  1 
ATOM   7319  C  CG  . PRO B  1  280 ? 14.993  17.635  -4.989  1.00 73.15 ? 308  PRO B CG  1 
ATOM   7320  C  CD  . PRO B  1  280 ? 15.752  16.451  -5.567  1.00 72.63 ? 308  PRO B CD  1 
ATOM   7321  N  N   . GLY B  1  281 ? 15.935  16.370  -0.831  1.00 71.40 ? 309  GLY B N   1 
ATOM   7322  C  CA  . GLY B  1  281 ? 15.811  15.644  0.411   1.00 70.58 ? 309  GLY B CA  1 
ATOM   7323  C  C   . GLY B  1  281 ? 14.694  16.386  1.106   1.00 70.64 ? 309  GLY B C   1 
ATOM   7324  O  O   . GLY B  1  281 ? 13.729  16.799  0.450   1.00 70.20 ? 309  GLY B O   1 
ATOM   7325  N  N   . PRO B  1  282 ? 14.788  16.580  2.425   1.00 69.53 ? 310  PRO B N   1 
ATOM   7326  C  CA  . PRO B  1  282 ? 13.749  17.295  3.173   1.00 69.21 ? 310  PRO B CA  1 
ATOM   7327  C  C   . PRO B  1  282 ? 13.744  18.768  2.789   1.00 68.95 ? 310  PRO B C   1 
ATOM   7328  O  O   . PRO B  1  282 ? 14.800  19.364  2.590   1.00 68.98 ? 310  PRO B O   1 
ATOM   7329  C  CB  . PRO B  1  282 ? 14.154  17.074  4.625   1.00 69.78 ? 310  PRO B CB  1 
ATOM   7330  C  CG  . PRO B  1  282 ? 14.841  15.735  4.574   1.00 70.16 ? 310  PRO B CG  1 
ATOM   7331  C  CD  . PRO B  1  282 ? 15.698  15.873  3.339   1.00 69.86 ? 310  PRO B CD  1 
ATOM   7332  N  N   . ALA B  1  283 ? 12.553  19.346  2.680   1.00 68.48 ? 311  ALA B N   1 
ATOM   7333  C  CA  . ALA B  1  283 ? 12.414  20.745  2.302   1.00 68.29 ? 311  ALA B CA  1 
ATOM   7334  C  C   . ALA B  1  283 ? 13.067  21.679  3.314   1.00 69.50 ? 311  ALA B C   1 
ATOM   7335  O  O   . ALA B  1  283 ? 12.905  21.516  4.536   1.00 68.83 ? 311  ALA B O   1 
ATOM   7336  C  CB  . ALA B  1  283 ? 10.949  21.097  2.139   1.00 68.82 ? 311  ALA B CB  1 
ATOM   7337  N  N   . PRO B  1  284 ? 13.813  22.680  2.809   1.00 68.99 ? 312  PRO B N   1 
ATOM   7338  C  CA  . PRO B  1  284 ? 14.510  23.664  3.638   1.00 68.44 ? 312  PRO B CA  1 
ATOM   7339  C  C   . PRO B  1  284 ? 13.532  24.564  4.364   1.00 67.56 ? 312  PRO B C   1 
ATOM   7340  O  O   . PRO B  1  284 ? 12.489  24.930  3.819   1.00 67.64 ? 312  PRO B O   1 
ATOM   7341  C  CB  . PRO B  1  284 ? 15.366  24.417  2.626   1.00 68.36 ? 312  PRO B CB  1 
ATOM   7342  C  CG  . PRO B  1  284 ? 14.515  24.404  1.414   1.00 68.13 ? 312  PRO B CG  1 
ATOM   7343  C  CD  . PRO B  1  284 ? 14.019  22.976  1.379   1.00 67.82 ? 312  PRO B CD  1 
ATOM   7344  N  N   . PRO B  1  285 ? 13.861  24.938  5.605   1.00 66.84 ? 313  PRO B N   1 
ATOM   7345  C  CA  . PRO B  1  285 ? 12.951  25.803  6.345   1.00 67.80 ? 313  PRO B CA  1 
ATOM   7346  C  C   . PRO B  1  285 ? 12.334  26.813  5.410   1.00 67.47 ? 313  PRO B C   1 
ATOM   7347  O  O   . PRO B  1  285 ? 13.002  27.352  4.520   1.00 67.11 ? 313  PRO B O   1 
ATOM   7348  C  CB  . PRO B  1  285 ? 13.853  26.437  7.401   1.00 68.30 ? 313  PRO B CB  1 
ATOM   7349  C  CG  . PRO B  1  285 ? 15.191  26.401  6.766   1.00 68.61 ? 313  PRO B CG  1 
ATOM   7350  C  CD  . PRO B  1  285 ? 15.210  25.021  6.176   1.00 67.43 ? 313  PRO B CD  1 
ATOM   7351  N  N   . LEU B  1  286 ? 11.045  27.040  5.612   1.00 67.73 ? 314  LEU B N   1 
ATOM   7352  C  CA  . LEU B  1  286 ? 10.292  27.959  4.794   1.00 67.87 ? 314  LEU B CA  1 
ATOM   7353  C  C   . LEU B  1  286 ? 9.774   29.137  5.609   1.00 68.59 ? 314  LEU B C   1 
ATOM   7354  O  O   . LEU B  1  286 ? 9.319   28.981  6.744   1.00 68.32 ? 314  LEU B O   1 
ATOM   7355  C  CB  . LEU B  1  286 ? 9.126   27.221  4.161   1.00 68.37 ? 314  LEU B CB  1 
ATOM   7356  C  CG  . LEU B  1  286 ? 8.341   28.079  3.180   1.00 69.33 ? 314  LEU B CG  1 
ATOM   7357  C  CD1 . LEU B  1  286 ? 9.177   28.274  1.927   1.00 69.44 ? 314  LEU B CD1 1 
ATOM   7358  C  CD2 . LEU B  1  286 ? 7.010   27.416  2.858   1.00 69.18 ? 314  LEU B CD2 1 
ATOM   7359  N  N   . GLN B  1  287 ? 9.848   30.319  5.016   1.00 68.44 ? 315  GLN B N   1 
ATOM   7360  C  CA  . GLN B  1  287 ? 9.392   31.537  5.670   1.00 69.25 ? 315  GLN B CA  1 
ATOM   7361  C  C   . GLN B  1  287 ? 7.932   31.807  5.303   1.00 68.71 ? 315  GLN B C   1 
ATOM   7362  O  O   . GLN B  1  287 ? 7.541   31.596  4.160   1.00 69.11 ? 315  GLN B O   1 
ATOM   7363  C  CB  . GLN B  1  287 ? 10.259  32.716  5.200   1.00 70.51 ? 315  GLN B CB  1 
ATOM   7364  C  CG  . GLN B  1  287 ? 11.583  32.918  5.937   1.00 70.13 ? 315  GLN B CG  1 
ATOM   7365  C  CD  . GLN B  1  287 ? 11.428  33.771  7.190   1.00 70.10 ? 315  GLN B CD  1 
ATOM   7366  O  OE1 . GLN B  1  287 ? 10.663  34.744  7.200   1.00 69.87 ? 315  GLN B OE1 1 
ATOM   7367  N  NE2 . GLN B  1  287 ? 12.165  33.427  8.247   1.00 68.70 ? 315  GLN B NE2 1 
ATOM   7368  N  N   . PHE B  1  288 ? 7.122   32.269  6.251   1.00 67.89 ? 316  PHE B N   1 
ATOM   7369  C  CA  . PHE B  1  288 ? 5.737   32.585  5.912   1.00 68.34 ? 316  PHE B CA  1 
ATOM   7370  C  C   . PHE B  1  288 ? 5.088   33.606  6.855   1.00 68.19 ? 316  PHE B C   1 
ATOM   7371  O  O   . PHE B  1  288 ? 5.444   33.687  8.029   1.00 67.85 ? 316  PHE B O   1 
ATOM   7372  C  CB  . PHE B  1  288 ? 4.908   31.286  5.812   1.00 69.02 ? 316  PHE B CB  1 
ATOM   7373  C  CG  . PHE B  1  288 ? 4.194   30.899  7.079   1.00 69.23 ? 316  PHE B CG  1 
ATOM   7374  C  CD1 . PHE B  1  288 ? 2.988   31.502  7.437   1.00 69.57 ? 316  PHE B CD1 1 
ATOM   7375  C  CD2 . PHE B  1  288 ? 4.733   29.937  7.926   1.00 69.57 ? 316  PHE B CD2 1 
ATOM   7376  C  CE1 . PHE B  1  288 ? 2.331   31.149  8.628   1.00 68.91 ? 316  PHE B CE1 1 
ATOM   7377  C  CE2 . PHE B  1  288 ? 4.084   29.580  9.115   1.00 69.66 ? 316  PHE B CE2 1 
ATOM   7378  C  CZ  . PHE B  1  288 ? 2.882   30.188  9.465   1.00 68.63 ? 316  PHE B CZ  1 
ATOM   7379  N  N   . TYR B  1  289 ? 4.166   34.411  6.321   1.00 69.04 ? 317  TYR B N   1 
ATOM   7380  C  CA  . TYR B  1  289 ? 3.460   35.415  7.118   1.00 68.63 ? 317  TYR B CA  1 
ATOM   7381  C  C   . TYR B  1  289 ? 2.209   34.732  7.625   1.00 68.67 ? 317  TYR B C   1 
ATOM   7382  O  O   . TYR B  1  289 ? 1.316   34.410  6.840   1.00 68.04 ? 317  TYR B O   1 
ATOM   7383  C  CB  . TYR B  1  289 ? 3.002   36.608  6.282   1.00 69.12 ? 317  TYR B CB  1 
ATOM   7384  C  CG  . TYR B  1  289 ? 4.023   37.212  5.365   1.00 67.87 ? 317  TYR B CG  1 
ATOM   7385  C  CD1 . TYR B  1  289 ? 5.201   37.768  5.852   1.00 68.15 ? 317  TYR B CD1 1 
ATOM   7386  C  CD2 . TYR B  1  289 ? 3.783   37.266  4.001   1.00 68.71 ? 317  TYR B CD2 1 
ATOM   7387  C  CE1 . TYR B  1  289 ? 6.115   38.367  4.988   1.00 69.35 ? 317  TYR B CE1 1 
ATOM   7388  C  CE2 . TYR B  1  289 ? 4.684   37.859  3.131   1.00 69.86 ? 317  TYR B CE2 1 
ATOM   7389  C  CZ  . TYR B  1  289 ? 5.844   38.407  3.620   1.00 69.34 ? 317  TYR B CZ  1 
ATOM   7390  O  OH  . TYR B  1  289 ? 6.715   38.979  2.718   1.00 69.45 ? 317  TYR B OH  1 
ATOM   7391  N  N   . PRO B  1  290 ? 2.116   34.516  8.944   1.00 69.24 ? 318  PRO B N   1 
ATOM   7392  C  CA  . PRO B  1  290 ? 0.959   33.859  9.559   1.00 68.59 ? 318  PRO B CA  1 
ATOM   7393  C  C   . PRO B  1  290 ? -0.382  34.566  9.350   1.00 68.39 ? 318  PRO B C   1 
ATOM   7394  O  O   . PRO B  1  290 ? -1.419  33.910  9.217   1.00 67.56 ? 318  PRO B O   1 
ATOM   7395  C  CB  . PRO B  1  290 ? 1.372   33.754  11.026  1.00 67.65 ? 318  PRO B CB  1 
ATOM   7396  C  CG  . PRO B  1  290 ? 2.260   34.942  11.215  1.00 67.64 ? 318  PRO B CG  1 
ATOM   7397  C  CD  . PRO B  1  290 ? 3.094   34.930  9.966   1.00 68.50 ? 318  PRO B CD  1 
ATOM   7398  N  N   . GLN B  1  291 ? -0.361  35.897  9.310   1.00 68.99 ? 319  GLN B N   1 
ATOM   7399  C  CA  . GLN B  1  291 ? -1.586  36.664  9.114   1.00 68.12 ? 319  GLN B CA  1 
ATOM   7400  C  C   . GLN B  1  291 ? -1.559  37.445  7.819   1.00 67.72 ? 319  GLN B C   1 
ATOM   7401  O  O   . GLN B  1  291 ? -2.394  38.321  7.601   1.00 67.40 ? 319  GLN B O   1 
ATOM   7402  C  CB  . GLN B  1  291 ? -1.820  37.622  10.280  1.00 67.85 ? 319  GLN B CB  1 
ATOM   7403  C  CG  . GLN B  1  291 ? -1.898  36.917  11.618  1.00 68.72 ? 319  GLN B CG  1 
ATOM   7404  C  CD  . GLN B  1  291 ? -2.268  37.842  12.769  1.00 70.26 ? 319  GLN B CD  1 
ATOM   7405  O  OE1 . GLN B  1  291 ? -2.269  37.428  13.930  1.00 71.00 ? 319  GLN B OE1 1 
ATOM   7406  N  NE2 . GLN B  1  291 ? -2.592  39.097  12.454  1.00 70.78 ? 319  GLN B NE2 1 
ATOM   7407  N  N   . GLY B  1  292 ? -0.595  37.120  6.960   1.00 67.89 ? 320  GLY B N   1 
ATOM   7408  C  CA  . GLY B  1  292 ? -0.487  37.796  5.679   1.00 67.86 ? 320  GLY B CA  1 
ATOM   7409  C  C   . GLY B  1  292 ? 0.613   38.838  5.644   1.00 68.04 ? 320  GLY B C   1 
ATOM   7410  O  O   . GLY B  1  292 ? 1.266   39.092  6.660   1.00 67.85 ? 320  GLY B O   1 
ATOM   7411  N  N   . PRO B  1  293 ? 0.844   39.464  4.481   1.00 67.53 ? 321  PRO B N   1 
ATOM   7412  C  CA  . PRO B  1  293 ? 1.890   40.482  4.372   1.00 66.84 ? 321  PRO B CA  1 
ATOM   7413  C  C   . PRO B  1  293 ? 1.531   41.679  5.226   1.00 66.05 ? 321  PRO B C   1 
ATOM   7414  O  O   . PRO B  1  293 ? 0.357   42.034  5.339   1.00 65.61 ? 321  PRO B O   1 
ATOM   7415  C  CB  . PRO B  1  293 ? 1.885   40.809  2.889   1.00 66.63 ? 321  PRO B CB  1 
ATOM   7416  C  CG  . PRO B  1  293 ? 0.433   40.645  2.534   1.00 66.72 ? 321  PRO B CG  1 
ATOM   7417  C  CD  . PRO B  1  293 ? 0.072   39.361  3.230   1.00 66.14 ? 321  PRO B CD  1 
ATOM   7418  N  N   . ARG B  1  294 ? 2.530   42.303  5.834   1.00 65.01 ? 322  ARG B N   1 
ATOM   7419  C  CA  . ARG B  1  294 ? 2.249   43.452  6.669   1.00 64.91 ? 322  ARG B CA  1 
ATOM   7420  C  C   . ARG B  1  294 ? 2.662   44.750  5.993   1.00 65.28 ? 322  ARG B C   1 
ATOM   7421  O  O   . ARG B  1  294 ? 2.701   45.811  6.615   1.00 65.35 ? 322  ARG B O   1 
ATOM   7422  C  CB  . ARG B  1  294 ? 2.940   43.280  8.012   1.00 64.39 ? 322  ARG B CB  1 
ATOM   7423  C  CG  . ARG B  1  294 ? 2.544   41.987  8.674   1.00 64.50 ? 322  ARG B CG  1 
ATOM   7424  C  CD  . ARG B  1  294 ? 3.029   41.892  10.099  1.00 64.11 ? 322  ARG B CD  1 
ATOM   7425  N  NE  . ARG B  1  294 ? 4.475   42.039  10.182  1.00 64.09 ? 322  ARG B NE  1 
ATOM   7426  C  CZ  . ARG B  1  294 ? 5.184   41.867  11.294  1.00 64.98 ? 322  ARG B CZ  1 
ATOM   7427  N  NH1 . ARG B  1  294 ? 4.579   41.538  12.430  1.00 64.13 ? 322  ARG B NH1 1 
ATOM   7428  N  NH2 . ARG B  1  294 ? 6.502   42.028  11.270  1.00 66.14 ? 322  ARG B NH2 1 
ATOM   7429  N  N   . PHE B  1  295 ? 2.960   44.651  4.704   1.00 63.82 ? 323  PHE B N   1 
ATOM   7430  C  CA  . PHE B  1  295 ? 3.352   45.801  3.912   1.00 64.07 ? 323  PHE B CA  1 
ATOM   7431  C  C   . PHE B  1  295 ? 2.464   45.823  2.685   1.00 64.45 ? 323  PHE B C   1 
ATOM   7432  O  O   . PHE B  1  295 ? 1.669   44.912  2.474   1.00 63.67 ? 323  PHE B O   1 
ATOM   7433  C  CB  . PHE B  1  295 ? 4.821   45.694  3.503   1.00 64.62 ? 323  PHE B CB  1 
ATOM   7434  C  CG  . PHE B  1  295 ? 5.140   44.482  2.652   1.00 66.41 ? 323  PHE B CG  1 
ATOM   7435  C  CD1 . PHE B  1  295 ? 5.107   44.555  1.259   1.00 65.15 ? 323  PHE B CD1 1 
ATOM   7436  C  CD2 . PHE B  1  295 ? 5.493   43.267  3.247   1.00 65.85 ? 323  PHE B CD2 1 
ATOM   7437  C  CE1 . PHE B  1  295 ? 5.423   43.438  0.476   1.00 64.22 ? 323  PHE B CE1 1 
ATOM   7438  C  CE2 . PHE B  1  295 ? 5.808   42.148  2.469   1.00 64.61 ? 323  PHE B CE2 1 
ATOM   7439  C  CZ  . PHE B  1  295 ? 5.774   42.236  1.084   1.00 63.75 ? 323  PHE B CZ  1 
ATOM   7440  N  N   . SER B  1  296 ? 2.603   46.854  1.864   1.00 65.27 ? 324  SER B N   1 
ATOM   7441  C  CA  . SER B  1  296 ? 1.767   46.956  0.680   1.00 65.35 ? 324  SER B CA  1 
ATOM   7442  C  C   . SER B  1  296 ? 2.395   47.725  -0.481  1.00 65.77 ? 324  SER B C   1 
ATOM   7443  O  O   . SER B  1  296 ? 2.484   48.959  -0.455  1.00 65.52 ? 324  SER B O   1 
ATOM   7444  C  CB  . SER B  1  296 ? 0.446   47.618  1.056   1.00 65.14 ? 324  SER B CB  1 
ATOM   7445  O  OG  . SER B  1  296 ? 0.654   48.981  1.383   1.00 64.29 ? 324  SER B OG  1 
ATOM   7446  N  N   . VAL B  1  297 ? 2.817   46.991  -1.506  1.00 65.95 ? 325  VAL B N   1 
ATOM   7447  C  CA  . VAL B  1  297 ? 3.404   47.608  -2.680  1.00 65.11 ? 325  VAL B CA  1 
ATOM   7448  C  C   . VAL B  1  297 ? 2.247   48.123  -3.513  1.00 65.31 ? 325  VAL B C   1 
ATOM   7449  O  O   . VAL B  1  297 ? 1.514   47.356  -4.128  1.00 65.13 ? 325  VAL B O   1 
ATOM   7450  C  CB  . VAL B  1  297 ? 4.202   46.606  -3.503  1.00 63.80 ? 325  VAL B CB  1 
ATOM   7451  C  CG1 . VAL B  1  297 ? 5.064   47.342  -4.494  1.00 64.44 ? 325  VAL B CG1 1 
ATOM   7452  C  CG2 . VAL B  1  297 ? 5.051   45.763  -2.594  1.00 65.07 ? 325  VAL B CG2 1 
ATOM   7453  N  N   . GLN B  1  298 ? 2.078   49.433  -3.507  1.00 65.10 ? 326  GLN B N   1 
ATOM   7454  C  CA  . GLN B  1  298 ? 1.004   50.058  -4.246  1.00 65.57 ? 326  GLN B CA  1 
ATOM   7455  C  C   . GLN B  1  298 ? 1.644   50.798  -5.408  1.00 66.19 ? 326  GLN B C   1 
ATOM   7456  O  O   . GLN B  1  298 ? 1.770   52.020  -5.385  1.00 67.00 ? 326  GLN B O   1 
ATOM   7457  C  CB  . GLN B  1  298 ? 0.266   51.033  -3.323  1.00 67.73 ? 326  GLN B CB  1 
ATOM   7458  C  CG  . GLN B  1  298 ? -1.260  50.965  -3.389  1.00 68.98 ? 326  GLN B CG  1 
ATOM   7459  C  CD  . GLN B  1  298 ? -1.833  51.580  -4.663  1.00 70.97 ? 326  GLN B CD  1 
ATOM   7460  O  OE1 . GLN B  1  298 ? -1.797  52.809  -4.855  1.00 71.28 ? 326  GLN B OE1 1 
ATOM   7461  N  NE2 . GLN B  1  298 ? -2.365  50.724  -5.547  1.00 70.42 ? 326  GLN B NE2 1 
ATOM   7462  N  N   . GLY B  1  299 ? 2.052   50.053  -6.427  1.00 65.50 ? 327  GLY B N   1 
ATOM   7463  C  CA  . GLY B  1  299 ? 2.699   50.673  -7.569  1.00 66.43 ? 327  GLY B CA  1 
ATOM   7464  C  C   . GLY B  1  299 ? 4.198   50.732  -7.318  1.00 67.64 ? 327  GLY B C   1 
ATOM   7465  O  O   . GLY B  1  299 ? 4.843   49.689  -7.176  1.00 67.36 ? 327  GLY B O   1 
ATOM   7466  N  N   . SER B  1  300 ? 4.760   51.941  -7.267  1.00 67.51 ? 328  SER B N   1 
ATOM   7467  C  CA  . SER B  1  300 ? 6.186   52.103  -7.000  1.00 65.85 ? 328  SER B CA  1 
ATOM   7468  C  C   . SER B  1  300 ? 6.374   52.351  -5.515  1.00 65.78 ? 328  SER B C   1 
ATOM   7469  O  O   . SER B  1  300 ? 7.473   52.200  -4.997  1.00 67.46 ? 328  SER B O   1 
ATOM   7470  C  CB  . SER B  1  300 ? 6.773   53.282  -7.784  1.00 66.62 ? 328  SER B CB  1 
ATOM   7471  O  OG  . SER B  1  300 ? 6.691   53.069  -9.183  1.00 67.42 ? 328  SER B OG  1 
ATOM   7472  N  N   . ARG B  1  301 ? 5.300   52.725  -4.827  1.00 64.89 ? 329  ARG B N   1 
ATOM   7473  C  CA  . ARG B  1  301 ? 5.394   52.991  -3.403  1.00 64.96 ? 329  ARG B CA  1 
ATOM   7474  C  C   . ARG B  1  301 ? 5.012   51.836  -2.508  1.00 64.50 ? 329  ARG B C   1 
ATOM   7475  O  O   . ARG B  1  301 ? 3.910   51.296  -2.591  1.00 64.54 ? 329  ARG B O   1 
ATOM   7476  C  CB  . ARG B  1  301 ? 4.560   54.213  -3.011  1.00 67.70 ? 329  ARG B CB  1 
ATOM   7477  C  CG  . ARG B  1  301 ? 5.157   55.551  -3.463  1.00 70.47 ? 329  ARG B CG  1 
ATOM   7478  C  CD  . ARG B  1  301 ? 4.942   56.689  -2.437  1.00 71.19 ? 329  ARG B CD  1 
ATOM   7479  N  NE  . ARG B  1  301 ? 5.649   56.457  -1.173  1.00 73.01 ? 329  ARG B NE  1 
ATOM   7480  C  CZ  . ARG B  1  301 ? 5.894   57.398  -0.261  1.00 73.80 ? 329  ARG B CZ  1 
ATOM   7481  N  NH1 . ARG B  1  301 ? 5.488   58.642  -0.474  1.00 74.02 ? 329  ARG B NH1 1 
ATOM   7482  N  NH2 . ARG B  1  301 ? 6.544   57.100  0.864   1.00 73.80 ? 329  ARG B NH2 1 
ATOM   7483  N  N   . VAL B  1  302 ? 5.955   51.474  -1.648  1.00 64.38 ? 330  VAL B N   1 
ATOM   7484  C  CA  . VAL B  1  302 ? 5.773   50.415  -0.677  1.00 62.91 ? 330  VAL B CA  1 
ATOM   7485  C  C   . VAL B  1  302 ? 5.442   51.114  0.617   1.00 62.28 ? 330  VAL B C   1 
ATOM   7486  O  O   . VAL B  1  302 ? 6.028   52.142  0.939   1.00 62.39 ? 330  VAL B O   1 
ATOM   7487  C  CB  . VAL B  1  302 ? 7.055   49.625  -0.458  1.00 61.51 ? 330  VAL B CB  1 
ATOM   7488  C  CG1 . VAL B  1  302 ? 6.844   48.584  0.623   1.00 62.07 ? 330  VAL B CG1 1 
ATOM   7489  C  CG2 . VAL B  1  302 ? 7.467   48.978  -1.740  1.00 63.15 ? 330  VAL B CG2 1 
ATOM   7490  N  N   . ALA B  1  303 ? 4.497   50.569  1.362   1.00 62.25 ? 331  ALA B N   1 
ATOM   7491  C  CA  . ALA B  1  303 ? 4.132   51.180  2.622   1.00 61.62 ? 331  ALA B CA  1 
ATOM   7492  C  C   . ALA B  1  303 ? 3.873   50.121  3.670   1.00 61.03 ? 331  ALA B C   1 
ATOM   7493  O  O   . ALA B  1  303 ? 3.128   49.164  3.444   1.00 61.65 ? 331  ALA B O   1 
ATOM   7494  C  CB  . ALA B  1  303 ? 2.915   52.047  2.446   1.00 61.49 ? 331  ALA B CB  1 
ATOM   7495  N  N   . SER B  1  304 ? 4.520   50.292  4.815   1.00 59.93 ? 332  SER B N   1 
ATOM   7496  C  CA  . SER B  1  304 ? 4.361   49.376  5.925   1.00 58.75 ? 332  SER B CA  1 
ATOM   7497  C  C   . SER B  1  304 ? 4.091   50.179  7.189   1.00 58.85 ? 332  SER B C   1 
ATOM   7498  O  O   . SER B  1  304 ? 3.872   51.397  7.168   1.00 59.04 ? 332  SER B O   1 
ATOM   7499  C  CB  . SER B  1  304 ? 5.619   48.520  6.123   1.00 59.09 ? 332  SER B CB  1 
ATOM   7500  O  OG  . SER B  1  304 ? 6.595   49.189  6.911   1.00 59.27 ? 332  SER B OG  1 
ATOM   7501  N  N   . SER B  1  305 ? 4.110   49.477  8.302   1.00 58.80 ? 333  SER B N   1 
ATOM   7502  C  CA  . SER B  1  305 ? 3.869   50.099  9.582   1.00 57.16 ? 333  SER B CA  1 
ATOM   7503  C  C   . SER B  1  305 ? 4.892   51.203  9.894   1.00 55.99 ? 333  SER B C   1 
ATOM   7504  O  O   . SER B  1  305 ? 4.527   52.289  10.332  1.00 56.48 ? 333  SER B O   1 
ATOM   7505  C  CB  . SER B  1  305 ? 3.900   49.002  10.654  1.00 57.67 ? 333  SER B CB  1 
ATOM   7506  O  OG  . SER B  1  305 ? 4.112   47.718  10.060  1.00 56.88 ? 333  SER B OG  1 
ATOM   7507  N  N   . LEU B  1  306 ? 6.166   50.927  9.625   1.00 55.02 ? 334  LEU B N   1 
ATOM   7508  C  CA  . LEU B  1  306 ? 7.251   51.850  9.933   1.00 52.89 ? 334  LEU B CA  1 
ATOM   7509  C  C   . LEU B  1  306 ? 7.798   52.663  8.784   1.00 54.01 ? 334  LEU B C   1 
ATOM   7510  O  O   . LEU B  1  306 ? 8.127   53.837  8.936   1.00 53.18 ? 334  LEU B O   1 
ATOM   7511  C  CB  . LEU B  1  306 ? 8.409   51.063  10.512  1.00 53.58 ? 334  LEU B CB  1 
ATOM   7512  C  CG  . LEU B  1  306 ? 8.090   50.127  11.661  1.00 53.00 ? 334  LEU B CG  1 
ATOM   7513  C  CD1 . LEU B  1  306 ? 9.323   49.340  12.029  1.00 53.53 ? 334  LEU B CD1 1 
ATOM   7514  C  CD2 . LEU B  1  306 ? 7.599   50.941  12.836  1.00 54.53 ? 334  LEU B CD2 1 
ATOM   7515  N  N   . TRP B  1  307 ? 7.925   52.018  7.637   1.00 53.80 ? 335  TRP B N   1 
ATOM   7516  C  CA  . TRP B  1  307 ? 8.492   52.666  6.475   1.00 52.50 ? 335  TRP B CA  1 
ATOM   7517  C  C   . TRP B  1  307 ? 7.497   52.945  5.348   1.00 53.24 ? 335  TRP B C   1 
ATOM   7518  O  O   . TRP B  1  307 ? 6.408   52.373  5.303   1.00 53.07 ? 335  TRP B O   1 
ATOM   7519  C  CB  . TRP B  1  307 ? 9.637   51.799  5.935   1.00 52.94 ? 335  TRP B CB  1 
ATOM   7520  C  CG  . TRP B  1  307 ? 10.712  51.479  6.942   1.00 52.70 ? 335  TRP B CG  1 
ATOM   7521  C  CD1 . TRP B  1  307 ? 10.792  50.375  7.747   1.00 51.22 ? 335  TRP B CD1 1 
ATOM   7522  C  CD2 . TRP B  1  307 ? 11.848  52.290  7.256   1.00 52.55 ? 335  TRP B CD2 1 
ATOM   7523  N  NE1 . TRP B  1  307 ? 11.910  50.452  8.544   1.00 50.39 ? 335  TRP B NE1 1 
ATOM   7524  C  CE2 . TRP B  1  307 ? 12.576  51.618  8.261   1.00 51.98 ? 335  TRP B CE2 1 
ATOM   7525  C  CE3 . TRP B  1  307 ? 12.322  53.524  6.784   1.00 50.56 ? 335  TRP B CE3 1 
ATOM   7526  C  CZ2 . TRP B  1  307 ? 13.756  52.140  8.804   1.00 51.89 ? 335  TRP B CZ2 1 
ATOM   7527  C  CZ3 . TRP B  1  307 ? 13.490  54.039  7.322   1.00 51.01 ? 335  TRP B CZ3 1 
ATOM   7528  C  CH2 . TRP B  1  307 ? 14.195  53.349  8.322   1.00 51.08 ? 335  TRP B CH2 1 
ATOM   7529  N  N   . THR B  1  308 ? 7.893   53.854  4.457   1.00 54.16 ? 336  THR B N   1 
ATOM   7530  C  CA  . THR B  1  308 ? 7.138   54.238  3.258   1.00 52.68 ? 336  THR B CA  1 
ATOM   7531  C  C   . THR B  1  308 ? 8.179   54.804  2.299   1.00 51.85 ? 336  THR B C   1 
ATOM   7532  O  O   . THR B  1  308 ? 9.070   55.553  2.702   1.00 51.10 ? 336  THR B O   1 
ATOM   7533  C  CB  . THR B  1  308 ? 6.014   55.312  3.516   1.00 53.26 ? 336  THR B CB  1 
ATOM   7534  O  OG1 . THR B  1  308 ? 6.458   56.297  4.459   1.00 54.02 ? 336  THR B OG1 1 
ATOM   7535  C  CG2 . THR B  1  308 ? 4.743   54.641  4.019   1.00 52.81 ? 336  THR B CG2 1 
ATOM   7536  N  N   . PHE B  1  309 ? 8.081   54.421  1.032   1.00 52.18 ? 337  PHE B N   1 
ATOM   7537  C  CA  . PHE B  1  309 ? 9.033   54.872  0.032   1.00 51.63 ? 337  PHE B CA  1 
ATOM   7538  C  C   . PHE B  1  309 ? 8.609   54.421  -1.354  1.00 50.72 ? 337  PHE B C   1 
ATOM   7539  O  O   . PHE B  1  309 ? 7.761   53.546  -1.507  1.00 50.44 ? 337  PHE B O   1 
ATOM   7540  C  CB  . PHE B  1  309 ? 10.433  54.313  0.351   1.00 51.00 ? 337  PHE B CB  1 
ATOM   7541  C  CG  . PHE B  1  309 ? 10.496  52.803  0.397   1.00 50.75 ? 337  PHE B CG  1 
ATOM   7542  C  CD1 . PHE B  1  309 ? 10.318  52.039  -0.762  1.00 51.44 ? 337  PHE B CD1 1 
ATOM   7543  C  CD2 . PHE B  1  309 ? 10.707  52.141  1.604   1.00 50.27 ? 337  PHE B CD2 1 
ATOM   7544  C  CE1 . PHE B  1  309 ? 10.345  50.645  -0.716  1.00 50.17 ? 337  PHE B CE1 1 
ATOM   7545  C  CE2 . PHE B  1  309 ? 10.735  50.742  1.657   1.00 50.46 ? 337  PHE B CE2 1 
ATOM   7546  C  CZ  . PHE B  1  309 ? 10.553  49.996  0.495   1.00 49.94 ? 337  PHE B CZ  1 
ATOM   7547  N  N   . SER B  1  310 ? 9.207   55.038  -2.361  1.00 50.37 ? 338  SER B N   1 
ATOM   7548  C  CA  . SER B  1  310 ? 8.927   54.698  -3.736  1.00 50.43 ? 338  SER B CA  1 
ATOM   7549  C  C   . SER B  1  310 ? 10.231  54.071  -4.204  1.00 51.49 ? 338  SER B C   1 
ATOM   7550  O  O   . SER B  1  310 ? 11.304  54.379  -3.669  1.00 51.65 ? 338  SER B O   1 
ATOM   7551  C  CB  . SER B  1  310 ? 8.602   55.968  -4.539  1.00 51.59 ? 338  SER B CB  1 
ATOM   7552  O  OG  . SER B  1  310 ? 8.104   55.674  -5.840  1.00 53.20 ? 338  SER B OG  1 
ATOM   7553  N  N   . PHE B  1  311 ? 10.145  53.170  -5.175  1.00 51.85 ? 339  PHE B N   1 
ATOM   7554  C  CA  . PHE B  1  311 ? 11.340  52.528  -5.693  1.00 52.26 ? 339  PHE B CA  1 
ATOM   7555  C  C   . PHE B  1  311 ? 11.351  52.533  -7.214  1.00 50.94 ? 339  PHE B C   1 
ATOM   7556  O  O   . PHE B  1  311 ? 10.361  52.869  -7.864  1.00 50.21 ? 339  PHE B O   1 
ATOM   7557  C  CB  . PHE B  1  311 ? 11.468  51.101  -5.149  1.00 50.89 ? 339  PHE B CB  1 
ATOM   7558  C  CG  . PHE B  1  311 ? 10.335  50.206  -5.527  1.00 50.78 ? 339  PHE B CG  1 
ATOM   7559  C  CD1 . PHE B  1  311 ? 10.191  49.753  -6.832  1.00 51.68 ? 339  PHE B CD1 1 
ATOM   7560  C  CD2 . PHE B  1  311 ? 9.395   49.829  -4.583  1.00 50.65 ? 339  PHE B CD2 1 
ATOM   7561  C  CE1 . PHE B  1  311 ? 9.121   48.934  -7.194  1.00 51.16 ? 339  PHE B CE1 1 
ATOM   7562  C  CE2 . PHE B  1  311 ? 8.325   49.012  -4.935  1.00 50.57 ? 339  PHE B CE2 1 
ATOM   7563  C  CZ  . PHE B  1  311 ? 8.190   48.565  -6.242  1.00 50.62 ? 339  PHE B CZ  1 
ATOM   7564  N  N   . GLY B  1  312 ? 12.496  52.175  -7.774  1.00 51.38 ? 340  GLY B N   1 
ATOM   7565  C  CA  . GLY B  1  312 ? 12.628  52.162  -9.210  1.00 52.84 ? 340  GLY B CA  1 
ATOM   7566  C  C   . GLY B  1  312 ? 13.930  51.549  -9.669  1.00 51.95 ? 340  GLY B C   1 
ATOM   7567  O  O   . GLY B  1  312 ? 14.678  50.958  -8.890  1.00 51.43 ? 340  GLY B O   1 
ATOM   7568  N  N   . LEU B  1  313 ? 14.203  51.709  -10.952 1.00 51.22 ? 341  LEU B N   1 
ATOM   7569  C  CA  . LEU B  1  313 ? 15.404  51.154  -11.534 1.00 52.66 ? 341  LEU B CA  1 
ATOM   7570  C  C   . LEU B  1  313 ? 15.887  52.100  -12.628 1.00 52.52 ? 341  LEU B C   1 
ATOM   7571  O  O   . LEU B  1  313 ? 15.131  52.465  -13.532 1.00 53.39 ? 341  LEU B O   1 
ATOM   7572  C  CB  . LEU B  1  313 ? 15.075  49.775  -12.118 1.00 52.88 ? 341  LEU B CB  1 
ATOM   7573  C  CG  . LEU B  1  313 ? 16.135  48.709  -12.368 1.00 51.06 ? 341  LEU B CG  1 
ATOM   7574  C  CD1 . LEU B  1  313 ? 16.687  48.201  -11.055 1.00 50.90 ? 341  LEU B CD1 1 
ATOM   7575  C  CD2 . LEU B  1  313 ? 15.497  47.570  -13.136 1.00 51.40 ? 341  LEU B CD2 1 
ATOM   7576  N  N   . GLY B  1  314 ? 17.138  52.525  -12.524 1.00 51.62 ? 342  GLY B N   1 
ATOM   7577  C  CA  . GLY B  1  314 ? 17.682  53.404  -13.532 1.00 51.47 ? 342  GLY B CA  1 
ATOM   7578  C  C   . GLY B  1  314 ? 18.063  52.489  -14.663 1.00 51.82 ? 342  GLY B C   1 
ATOM   7579  O  O   . GLY B  1  314 ? 18.674  51.447  -14.440 1.00 53.19 ? 342  GLY B O   1 
ATOM   7580  N  N   . ALA B  1  315 ? 17.684  52.847  -15.878 1.00 52.32 ? 343  ALA B N   1 
ATOM   7581  C  CA  . ALA B  1  315 ? 18.019  52.019  -17.020 1.00 52.63 ? 343  ALA B CA  1 
ATOM   7582  C  C   . ALA B  1  315 ? 19.512  51.701  -16.973 1.00 52.71 ? 343  ALA B C   1 
ATOM   7583  O  O   . ALA B  1  315 ? 19.946  50.586  -17.277 1.00 50.85 ? 343  ALA B O   1 
ATOM   7584  C  CB  . ALA B  1  315 ? 17.679  52.757  -18.287 1.00 52.24 ? 343  ALA B CB  1 
ATOM   7585  N  N   . PHE B  1  316 ? 20.290  52.700  -16.572 1.00 54.40 ? 344  PHE B N   1 
ATOM   7586  C  CA  . PHE B  1  316 ? 21.727  52.544  -16.485 1.00 53.10 ? 344  PHE B CA  1 
ATOM   7587  C  C   . PHE B  1  316 ? 22.255  52.582  -15.068 1.00 53.98 ? 344  PHE B C   1 
ATOM   7588  O  O   . PHE B  1  316 ? 23.091  51.758  -14.697 1.00 55.23 ? 344  PHE B O   1 
ATOM   7589  C  CB  . PHE B  1  316 ? 22.427  53.626  -17.289 1.00 51.52 ? 344  PHE B CB  1 
ATOM   7590  C  CG  . PHE B  1  316 ? 21.967  53.713  -18.696 1.00 51.32 ? 344  PHE B CG  1 
ATOM   7591  C  CD1 . PHE B  1  316 ? 21.011  54.644  -19.063 1.00 51.16 ? 344  PHE B CD1 1 
ATOM   7592  C  CD2 . PHE B  1  316 ? 22.468  52.846  -19.657 1.00 51.75 ? 344  PHE B CD2 1 
ATOM   7593  C  CE1 . PHE B  1  316 ? 20.556  54.713  -20.371 1.00 50.72 ? 344  PHE B CE1 1 
ATOM   7594  C  CE2 . PHE B  1  316 ? 22.020  52.905  -20.965 1.00 51.61 ? 344  PHE B CE2 1 
ATOM   7595  C  CZ  . PHE B  1  316 ? 21.060  53.844  -21.322 1.00 51.42 ? 344  PHE B CZ  1 
ATOM   7596  N  N   . SER B  1  317 ? 21.784  53.534  -14.270 1.00 52.63 ? 345  SER B N   1 
ATOM   7597  C  CA  . SER B  1  317 ? 22.286  53.632  -12.910 1.00 52.72 ? 345  SER B CA  1 
ATOM   7598  C  C   . SER B  1  317 ? 21.964  52.398  -12.069 1.00 52.60 ? 345  SER B C   1 
ATOM   7599  O  O   . SER B  1  317 ? 22.820  51.907  -11.336 1.00 54.06 ? 345  SER B O   1 
ATOM   7600  C  CB  . SER B  1  317 ? 21.755  54.897  -12.222 1.00 53.56 ? 345  SER B CB  1 
ATOM   7601  O  OG  . SER B  1  317 ? 20.410  54.753  -11.793 1.00 55.57 ? 345  SER B OG  1 
ATOM   7602  N  N   . GLY B  1  318 ? 20.741  51.890  -12.179 1.00 52.98 ? 346  GLY B N   1 
ATOM   7603  C  CA  . GLY B  1  318 ? 20.355  50.725  -11.399 1.00 52.72 ? 346  GLY B CA  1 
ATOM   7604  C  C   . GLY B  1  318 ? 19.372  51.032  -10.279 1.00 52.77 ? 346  GLY B C   1 
ATOM   7605  O  O   . GLY B  1  318 ? 18.839  52.141  -10.208 1.00 52.84 ? 346  GLY B O   1 
ATOM   7606  N  N   . PRO B  1  319 ? 19.109  50.067  -9.377  1.00 54.53 ? 347  PRO B N   1 
ATOM   7607  C  CA  . PRO B  1  319 ? 18.167  50.298  -8.272  1.00 54.69 ? 347  PRO B CA  1 
ATOM   7608  C  C   . PRO B  1  319 ? 18.285  51.674  -7.584  1.00 52.64 ? 347  PRO B C   1 
ATOM   7609  O  O   . PRO B  1  319 ? 19.385  52.196  -7.377  1.00 51.98 ? 347  PRO B O   1 
ATOM   7610  C  CB  . PRO B  1  319 ? 18.456  49.118  -7.338  1.00 54.08 ? 347  PRO B CB  1 
ATOM   7611  C  CG  . PRO B  1  319 ? 18.748  48.002  -8.319  1.00 51.62 ? 347  PRO B CG  1 
ATOM   7612  C  CD  . PRO B  1  319 ? 19.663  48.696  -9.315  1.00 52.84 ? 347  PRO B CD  1 
ATOM   7613  N  N   . ARG B  1  320 ? 17.136  52.248  -7.241  1.00 51.62 ? 348  ARG B N   1 
ATOM   7614  C  CA  . ARG B  1  320 ? 17.083  53.553  -6.597  1.00 52.20 ? 348  ARG B CA  1 
ATOM   7615  C  C   . ARG B  1  320 ? 15.830  53.695  -5.757  1.00 52.36 ? 348  ARG B C   1 
ATOM   7616  O  O   . ARG B  1  320 ? 14.769  53.224  -6.140  1.00 52.81 ? 348  ARG B O   1 
ATOM   7617  C  CB  . ARG B  1  320 ? 17.066  54.646  -7.654  1.00 52.42 ? 348  ARG B CB  1 
ATOM   7618  C  CG  . ARG B  1  320 ? 15.860  54.573  -8.568  1.00 50.62 ? 348  ARG B CG  1 
ATOM   7619  C  CD  . ARG B  1  320 ? 15.984  55.559  -9.701  1.00 49.83 ? 348  ARG B CD  1 
ATOM   7620  N  NE  . ARG B  1  320 ? 15.014  55.269  -10.750 1.00 50.35 ? 348  ARG B NE  1 
ATOM   7621  C  CZ  . ARG B  1  320 ? 15.137  55.678  -12.011 1.00 51.63 ? 348  ARG B CZ  1 
ATOM   7622  N  NH1 . ARG B  1  320 ? 16.197  56.400  -12.374 1.00 52.06 ? 348  ARG B NH1 1 
ATOM   7623  N  NH2 . ARG B  1  320 ? 14.215  55.353  -12.913 1.00 50.00 ? 348  ARG B NH2 1 
ATOM   7624  N  N   . ILE B  1  321 ? 15.948  54.357  -4.616  1.00 52.49 ? 349  ILE B N   1 
ATOM   7625  C  CA  . ILE B  1  321 ? 14.796  54.562  -3.759  1.00 52.43 ? 349  ILE B CA  1 
ATOM   7626  C  C   . ILE B  1  321 ? 14.723  56.020  -3.331  1.00 54.08 ? 349  ILE B C   1 
ATOM   7627  O  O   . ILE B  1  321 ? 15.740  56.634  -2.981  1.00 52.43 ? 349  ILE B O   1 
ATOM   7628  C  CB  . ILE B  1  321 ? 14.856  53.668  -2.522  1.00 52.69 ? 349  ILE B CB  1 
ATOM   7629  C  CG1 . ILE B  1  321 ? 14.730  52.204  -2.935  1.00 54.01 ? 349  ILE B CG1 1 
ATOM   7630  C  CG2 . ILE B  1  321 ? 13.718  53.998  -1.597  1.00 54.25 ? 349  ILE B CG2 1 
ATOM   7631  C  CD1 . ILE B  1  321 ? 14.800  51.229  -1.771  1.00 53.49 ? 349  ILE B CD1 1 
ATOM   7632  N  N   . PHE B  1  322 ? 13.509  56.569  -3.366  1.00 54.40 ? 350  PHE B N   1 
ATOM   7633  C  CA  . PHE B  1  322 ? 13.283  57.962  -2.998  1.00 53.76 ? 350  PHE B CA  1 
ATOM   7634  C  C   . PHE B  1  322 ? 12.249  58.157  -1.906  1.00 53.96 ? 350  PHE B C   1 
ATOM   7635  O  O   . PHE B  1  322 ? 11.394  57.302  -1.685  1.00 53.88 ? 350  PHE B O   1 
ATOM   7636  C  CB  . PHE B  1  322 ? 12.796  58.758  -4.196  1.00 54.34 ? 350  PHE B CB  1 
ATOM   7637  C  CG  . PHE B  1  322 ? 13.641  58.609  -5.405  1.00 53.79 ? 350  PHE B CG  1 
ATOM   7638  C  CD1 . PHE B  1  322 ? 13.535  57.485  -6.204  1.00 53.89 ? 350  PHE B CD1 1 
ATOM   7639  C  CD2 . PHE B  1  322 ? 14.529  59.604  -5.760  1.00 52.94 ? 350  PHE B CD2 1 
ATOM   7640  C  CE1 . PHE B  1  322 ? 14.302  57.360  -7.344  1.00 54.20 ? 350  PHE B CE1 1 
ATOM   7641  C  CE2 . PHE B  1  322 ? 15.297  59.485  -6.895  1.00 53.21 ? 350  PHE B CE2 1 
ATOM   7642  C  CZ  . PHE B  1  322 ? 15.185  58.364  -7.690  1.00 53.64 ? 350  PHE B CZ  1 
ATOM   7643  N  N   . ASP B  1  323 ? 12.325  59.311  -1.250  1.00 53.49 ? 351  ASP B N   1 
ATOM   7644  C  CA  . ASP B  1  323 ? 11.379  59.674  -0.209  1.00 53.33 ? 351  ASP B CA  1 
ATOM   7645  C  C   . ASP B  1  323 ? 11.174  58.550  0.779   1.00 54.17 ? 351  ASP B C   1 
ATOM   7646  O  O   . ASP B  1  323 ? 10.125  57.916  0.814   1.00 55.41 ? 351  ASP B O   1 
ATOM   7647  C  CB  . ASP B  1  323 ? 10.038  60.060  -0.847  1.00 54.13 ? 351  ASP B CB  1 
ATOM   7648  C  CG  . ASP B  1  323 ? 8.973   60.421  0.182   1.00 54.73 ? 351  ASP B CG  1 
ATOM   7649  O  OD1 . ASP B  1  323 ? 7.869   60.847  -0.225  1.00 53.88 ? 351  ASP B OD1 1 
ATOM   7650  O  OD2 . ASP B  1  323 ? 9.234   60.276  1.395   1.00 55.08 ? 351  ASP B OD2 1 
ATOM   7651  N  N   . VAL B  1  324 ? 12.187  58.306  1.590   1.00 54.84 ? 352  VAL B N   1 
ATOM   7652  C  CA  . VAL B  1  324 ? 12.108  57.256  2.584   1.00 55.52 ? 352  VAL B CA  1 
ATOM   7653  C  C   . VAL B  1  324 ? 11.638  57.881  3.902   1.00 55.70 ? 352  VAL B C   1 
ATOM   7654  O  O   . VAL B  1  324 ? 12.376  58.636  4.537   1.00 56.48 ? 352  VAL B O   1 
ATOM   7655  C  CB  . VAL B  1  324 ? 13.492  56.590  2.756   1.00 53.63 ? 352  VAL B CB  1 
ATOM   7656  C  CG1 . VAL B  1  324 ? 13.412  55.454  3.749   1.00 54.32 ? 352  VAL B CG1 1 
ATOM   7657  C  CG2 . VAL B  1  324 ? 13.989  56.102  1.413   1.00 52.23 ? 352  VAL B CG2 1 
ATOM   7658  N  N   . ARG B  1  325 ? 10.405  57.580  4.303   1.00 54.64 ? 353  ARG B N   1 
ATOM   7659  C  CA  . ARG B  1  325 ? 9.862   58.119  5.544   1.00 54.22 ? 353  ARG B CA  1 
ATOM   7660  C  C   . ARG B  1  325 ? 9.730   57.034  6.594   1.00 54.74 ? 353  ARG B C   1 
ATOM   7661  O  O   . ARG B  1  325 ? 9.103   56.002  6.357   1.00 54.34 ? 353  ARG B O   1 
ATOM   7662  C  CB  . ARG B  1  325 ? 8.483   58.725  5.309   1.00 54.28 ? 353  ARG B CB  1 
ATOM   7663  C  CG  . ARG B  1  325 ? 8.427   59.794  4.245   1.00 56.80 ? 353  ARG B CG  1 
ATOM   7664  C  CD  . ARG B  1  325 ? 7.103   59.690  3.491   1.00 59.11 ? 353  ARG B CD  1 
ATOM   7665  N  NE  . ARG B  1  325 ? 6.881   60.754  2.505   1.00 60.48 ? 353  ARG B NE  1 
ATOM   7666  C  CZ  . ARG B  1  325 ? 6.635   62.028  2.809   1.00 61.28 ? 353  ARG B CZ  1 
ATOM   7667  N  NH1 . ARG B  1  325 ? 6.583   62.414  4.085   1.00 60.63 ? 353  ARG B NH1 1 
ATOM   7668  N  NH2 . ARG B  1  325 ? 6.422   62.913  1.836   1.00 59.89 ? 353  ARG B NH2 1 
ATOM   7669  N  N   . PHE B  1  326 ? 10.325  57.261  7.758   1.00 54.66 ? 354  PHE B N   1 
ATOM   7670  C  CA  . PHE B  1  326 ? 10.208  56.293  8.830   1.00 54.17 ? 354  PHE B CA  1 
ATOM   7671  C  C   . PHE B  1  326 ? 9.168   56.834  9.781   1.00 52.89 ? 354  PHE B C   1 
ATOM   7672  O  O   . PHE B  1  326 ? 9.373   57.868  10.407  1.00 52.62 ? 354  PHE B O   1 
ATOM   7673  C  CB  . PHE B  1  326 ? 11.536  56.104  9.553   1.00 53.63 ? 354  PHE B CB  1 
ATOM   7674  C  CG  . PHE B  1  326 ? 11.483  55.090  10.663  1.00 52.17 ? 354  PHE B CG  1 
ATOM   7675  C  CD1 . PHE B  1  326 ? 10.990  53.814  10.437  1.00 51.90 ? 354  PHE B CD1 1 
ATOM   7676  C  CD2 . PHE B  1  326 ? 11.935  55.411  11.935  1.00 52.21 ? 354  PHE B CD2 1 
ATOM   7677  C  CE1 . PHE B  1  326 ? 10.949  52.874  11.465  1.00 51.81 ? 354  PHE B CE1 1 
ATOM   7678  C  CE2 . PHE B  1  326 ? 11.896  54.476  12.968  1.00 52.36 ? 354  PHE B CE2 1 
ATOM   7679  C  CZ  . PHE B  1  326 ? 11.402  53.206  12.729  1.00 51.08 ? 354  PHE B CZ  1 
ATOM   7680  N  N   . GLN B  1  327 ? 8.041   56.136  9.866   1.00 54.85 ? 355  GLN B N   1 
ATOM   7681  C  CA  . GLN B  1  327 ? 6.942   56.538  10.731  1.00 54.54 ? 355  GLN B CA  1 
ATOM   7682  C  C   . GLN B  1  327 ? 6.513   57.939  10.369  1.00 53.44 ? 355  GLN B C   1 
ATOM   7683  O  O   . GLN B  1  327 ? 6.270   58.762  11.237  1.00 52.71 ? 355  GLN B O   1 
ATOM   7684  C  CB  . GLN B  1  327 ? 7.366   56.513  12.197  1.00 55.12 ? 355  GLN B CB  1 
ATOM   7685  C  CG  . GLN B  1  327 ? 8.082   55.248  12.608  1.00 57.17 ? 355  GLN B CG  1 
ATOM   7686  C  CD  . GLN B  1  327 ? 7.952   54.958  14.090  1.00 58.09 ? 355  GLN B CD  1 
ATOM   7687  O  OE1 . GLN B  1  327 ? 6.899   54.520  14.557  1.00 60.01 ? 355  GLN B OE1 1 
ATOM   7688  N  NE2 . GLN B  1  327 ? 9.019   55.204  14.839  1.00 58.67 ? 355  GLN B NE2 1 
ATOM   7689  N  N   . GLY B  1  328 ? 6.436   58.213  9.078   1.00 54.37 ? 356  GLY B N   1 
ATOM   7690  C  CA  . GLY B  1  328 ? 6.028   59.533  8.651   1.00 54.65 ? 356  GLY B CA  1 
ATOM   7691  C  C   . GLY B  1  328 ? 7.156   60.512  8.353   1.00 55.46 ? 356  GLY B C   1 
ATOM   7692  O  O   . GLY B  1  328 ? 7.051   61.283  7.394   1.00 56.91 ? 356  GLY B O   1 
ATOM   7693  N  N   . GLU B  1  329 ? 8.230   60.498  9.144   1.00 54.18 ? 357  GLU B N   1 
ATOM   7694  C  CA  . GLU B  1  329 ? 9.334   61.435  8.912   1.00 55.47 ? 357  GLU B CA  1 
ATOM   7695  C  C   . GLU B  1  329 ? 10.351  61.016  7.842   1.00 56.08 ? 357  GLU B C   1 
ATOM   7696  O  O   . GLU B  1  329 ? 10.972  59.949  7.923   1.00 56.33 ? 357  GLU B O   1 
ATOM   7697  C  CB  . GLU B  1  329 ? 10.053  61.743  10.234  1.00 55.26 ? 357  GLU B CB  1 
ATOM   7698  C  CG  . GLU B  1  329 ? 11.387  62.480  10.070  1.00 56.22 ? 357  GLU B CG  1 
ATOM   7699  C  CD  . GLU B  1  329 ? 11.827  63.249  11.321  1.00 56.65 ? 357  GLU B CD  1 
ATOM   7700  O  OE1 . GLU B  1  329 ? 11.635  62.741  12.454  1.00 54.69 ? 357  GLU B OE1 1 
ATOM   7701  O  OE2 . GLU B  1  329 ? 12.384  64.365  11.164  1.00 57.25 ? 357  GLU B OE2 1 
ATOM   7702  N  N   . ARG B  1  330 ? 10.517  61.877  6.840   1.00 55.55 ? 358  ARG B N   1 
ATOM   7703  C  CA  . ARG B  1  330 ? 11.444  61.615  5.750   1.00 55.16 ? 358  ARG B CA  1 
ATOM   7704  C  C   . ARG B  1  330 ? 12.897  61.793  6.184   1.00 55.85 ? 358  ARG B C   1 
ATOM   7705  O  O   . ARG B  1  330 ? 13.300  62.857  6.675   1.00 56.01 ? 358  ARG B O   1 
ATOM   7706  C  CB  . ARG B  1  330 ? 11.123  62.523  4.558   1.00 55.58 ? 358  ARG B CB  1 
ATOM   7707  C  CG  . ARG B  1  330 ? 11.997  62.271  3.333   1.00 56.71 ? 358  ARG B CG  1 
ATOM   7708  C  CD  . ARG B  1  330 ? 11.316  62.664  2.007   1.00 57.81 ? 358  ARG B CD  1 
ATOM   7709  N  NE  . ARG B  1  330 ? 10.999  64.088  1.895   1.00 60.05 ? 358  ARG B NE  1 
ATOM   7710  C  CZ  . ARG B  1  330 ? 9.818   64.632  2.183   1.00 60.63 ? 358  ARG B CZ  1 
ATOM   7711  N  NH1 . ARG B  1  330 ? 8.809   63.887  2.602   1.00 61.34 ? 358  ARG B NH1 1 
ATOM   7712  N  NH2 . ARG B  1  330 ? 9.645   65.937  2.055   1.00 61.88 ? 358  ARG B NH2 1 
ATOM   7713  N  N   . LEU B  1  331 ? 13.674  60.727  6.000   1.00 55.62 ? 359  LEU B N   1 
ATOM   7714  C  CA  . LEU B  1  331 ? 15.092  60.698  6.357   1.00 54.56 ? 359  LEU B CA  1 
ATOM   7715  C  C   . LEU B  1  331 ? 15.940  60.953  5.137   1.00 54.50 ? 359  LEU B C   1 
ATOM   7716  O  O   . LEU B  1  331 ? 16.894  61.736  5.159   1.00 54.21 ? 359  LEU B O   1 
ATOM   7717  C  CB  . LEU B  1  331 ? 15.472  59.321  6.876   1.00 54.10 ? 359  LEU B CB  1 
ATOM   7718  C  CG  . LEU B  1  331 ? 14.638  58.760  8.015   1.00 55.59 ? 359  LEU B CG  1 
ATOM   7719  C  CD1 . LEU B  1  331 ? 14.988  57.296  8.237   1.00 56.51 ? 359  LEU B CD1 1 
ATOM   7720  C  CD2 . LEU B  1  331 ? 14.912  59.571  9.262   1.00 56.58 ? 359  LEU B CD2 1 
ATOM   7721  N  N   . VAL B  1  332 ? 15.571  60.255  4.073   1.00 54.40 ? 360  VAL B N   1 
ATOM   7722  C  CA  . VAL B  1  332 ? 16.278  60.312  2.817   1.00 53.64 ? 360  VAL B CA  1 
ATOM   7723  C  C   . VAL B  1  332 ? 15.382  60.744  1.658   1.00 52.96 ? 360  VAL B C   1 
ATOM   7724  O  O   . VAL B  1  332 ? 14.227  60.332  1.566   1.00 52.73 ? 360  VAL B O   1 
ATOM   7725  C  CB  . VAL B  1  332 ? 16.860  58.928  2.511   1.00 51.95 ? 360  VAL B CB  1 
ATOM   7726  C  CG1 . VAL B  1  332 ? 17.677  58.989  1.262   1.00 53.68 ? 360  VAL B CG1 1 
ATOM   7727  C  CG2 . VAL B  1  332 ? 17.678  58.434  3.698   1.00 50.35 ? 360  VAL B CG2 1 
ATOM   7728  N  N   . TYR B  1  333 ? 15.915  61.590  0.783   1.00 52.97 ? 361  TYR B N   1 
ATOM   7729  C  CA  . TYR B  1  333 ? 15.175  62.025  -0.391  1.00 52.15 ? 361  TYR B CA  1 
ATOM   7730  C  C   . TYR B  1  333 ? 15.516  61.018  -1.493  1.00 51.56 ? 361  TYR B C   1 
ATOM   7731  O  O   . TYR B  1  333 ? 14.688  60.674  -2.330  1.00 50.86 ? 361  TYR B O   1 
ATOM   7732  C  CB  . TYR B  1  333 ? 15.611  63.425  -0.816  1.00 50.01 ? 361  TYR B CB  1 
ATOM   7733  C  CG  . TYR B  1  333 ? 15.036  63.850  -2.142  1.00 49.25 ? 361  TYR B CG  1 
ATOM   7734  C  CD1 . TYR B  1  333 ? 13.774  64.432  -2.231  1.00 50.02 ? 361  TYR B CD1 1 
ATOM   7735  C  CD2 . TYR B  1  333 ? 15.744  63.634  -3.317  1.00 51.06 ? 361  TYR B CD2 1 
ATOM   7736  C  CE1 . TYR B  1  333 ? 13.226  64.791  -3.468  1.00 49.94 ? 361  TYR B CE1 1 
ATOM   7737  C  CE2 . TYR B  1  333 ? 15.213  63.982  -4.554  1.00 51.42 ? 361  TYR B CE2 1 
ATOM   7738  C  CZ  . TYR B  1  333 ? 13.953  64.559  -4.623  1.00 50.87 ? 361  TYR B CZ  1 
ATOM   7739  O  OH  . TYR B  1  333 ? 13.431  64.873  -5.855  1.00 49.49 ? 361  TYR B OH  1 
ATOM   7740  N  N   . GLU B  1  334 ? 16.743  60.521  -1.469  1.00 51.04 ? 362  GLU B N   1 
ATOM   7741  C  CA  . GLU B  1  334 ? 17.165  59.570  -2.474  1.00 50.67 ? 362  GLU B CA  1 
ATOM   7742  C  C   . GLU B  1  334 ? 18.376  58.752  -2.060  1.00 49.49 ? 362  GLU B C   1 
ATOM   7743  O  O   . GLU B  1  334 ? 19.315  59.271  -1.473  1.00 50.05 ? 362  GLU B O   1 
ATOM   7744  C  CB  . GLU B  1  334 ? 17.483  60.329  -3.756  1.00 50.62 ? 362  GLU B CB  1 
ATOM   7745  C  CG  . GLU B  1  334 ? 18.208  59.521  -4.816  1.00 51.15 ? 362  GLU B CG  1 
ATOM   7746  C  CD  . GLU B  1  334 ? 18.792  60.393  -5.925  1.00 51.06 ? 362  GLU B CD  1 
ATOM   7747  O  OE1 . GLU B  1  334 ? 19.395  59.823  -6.860  1.00 50.38 ? 362  GLU B OE1 1 
ATOM   7748  O  OE2 . GLU B  1  334 ? 18.658  61.642  -5.862  1.00 51.44 ? 362  GLU B OE2 1 
ATOM   7749  N  N   . ILE B  1  335 ? 18.330  57.462  -2.353  1.00 49.26 ? 363  ILE B N   1 
ATOM   7750  C  CA  . ILE B  1  335 ? 19.446  56.552  -2.096  1.00 50.64 ? 363  ILE B CA  1 
ATOM   7751  C  C   . ILE B  1  335 ? 19.491  55.712  -3.364  1.00 51.92 ? 363  ILE B C   1 
ATOM   7752  O  O   . ILE B  1  335 ? 18.750  54.734  -3.514  1.00 52.20 ? 363  ILE B O   1 
ATOM   7753  C  CB  . ILE B  1  335 ? 19.212  55.626  -0.907  1.00 48.95 ? 363  ILE B CB  1 
ATOM   7754  C  CG1 . ILE B  1  335 ? 19.055  56.446  0.354   1.00 48.86 ? 363  ILE B CG1 1 
ATOM   7755  C  CG2 . ILE B  1  335 ? 20.393  54.689  -0.749  1.00 49.30 ? 363  ILE B CG2 1 
ATOM   7756  C  CD1 . ILE B  1  335 ? 18.884  55.626  1.574   1.00 48.93 ? 363  ILE B CD1 1 
ATOM   7757  N  N   . SER B  1  336 ? 20.360  56.102  -4.285  1.00 51.01 ? 364  SER B N   1 
ATOM   7758  C  CA  . SER B  1  336 ? 20.441  55.421  -5.561  1.00 50.39 ? 364  SER B CA  1 
ATOM   7759  C  C   . SER B  1  336 ? 21.795  54.851  -5.959  1.00 50.23 ? 364  SER B C   1 
ATOM   7760  O  O   . SER B  1  336 ? 22.846  55.400  -5.620  1.00 50.36 ? 364  SER B O   1 
ATOM   7761  C  CB  . SER B  1  336 ? 19.970  56.390  -6.633  1.00 49.78 ? 364  SER B CB  1 
ATOM   7762  O  OG  . SER B  1  336 ? 20.551  57.664  -6.416  1.00 49.02 ? 364  SER B OG  1 
ATOM   7763  N  N   . LEU B  1  337 ? 21.763  53.732  -6.676  1.00 49.49 ? 365  LEU B N   1 
ATOM   7764  C  CA  . LEU B  1  337 ? 23.000  53.152  -7.156  1.00 49.39 ? 365  LEU B CA  1 
ATOM   7765  C  C   . LEU B  1  337 ? 23.426  54.090  -8.275  1.00 49.87 ? 365  LEU B C   1 
ATOM   7766  O  O   . LEU B  1  337 ? 22.586  54.583  -9.036  1.00 50.88 ? 365  LEU B O   1 
ATOM   7767  C  CB  . LEU B  1  337 ? 22.784  51.757  -7.726  1.00 49.42 ? 365  LEU B CB  1 
ATOM   7768  C  CG  . LEU B  1  337 ? 24.081  51.196  -8.310  1.00 48.32 ? 365  LEU B CG  1 
ATOM   7769  C  CD1 . LEU B  1  337 ? 25.117  50.997  -7.211  1.00 47.70 ? 365  LEU B CD1 1 
ATOM   7770  C  CD2 . LEU B  1  337 ? 23.778  49.897  -9.003  1.00 48.48 ? 365  LEU B CD2 1 
ATOM   7771  N  N   . GLN B  1  338 ? 24.723  54.339  -8.378  1.00 48.96 ? 366  GLN B N   1 
ATOM   7772  C  CA  . GLN B  1  338 ? 25.223  55.239  -9.394  1.00 47.67 ? 366  GLN B CA  1 
ATOM   7773  C  C   . GLN B  1  338 ? 26.017  54.531  -10.467 1.00 47.48 ? 366  GLN B C   1 
ATOM   7774  O  O   . GLN B  1  338 ? 25.803  54.751  -11.657 1.00 48.49 ? 366  GLN B O   1 
ATOM   7775  C  CB  . GLN B  1  338 ? 26.089  56.316  -8.738  1.00 48.19 ? 366  GLN B CB  1 
ATOM   7776  C  CG  . GLN B  1  338 ? 25.289  57.351  -7.990  1.00 48.40 ? 366  GLN B CG  1 
ATOM   7777  C  CD  . GLN B  1  338 ? 24.307  58.061  -8.899  1.00 47.55 ? 366  GLN B CD  1 
ATOM   7778  O  OE1 . GLN B  1  338 ? 24.670  58.492  -9.995  1.00 47.43 ? 366  GLN B OE1 1 
ATOM   7779  N  NE2 . GLN B  1  338 ? 23.063  58.191  -8.453  1.00 46.99 ? 366  GLN B NE2 1 
ATOM   7780  N  N   . GLU B  1  339 ? 26.929  53.665  -10.042 1.00 48.47 ? 367  GLU B N   1 
ATOM   7781  C  CA  . GLU B  1  339 ? 27.793  52.966  -10.984 1.00 47.67 ? 367  GLU B CA  1 
ATOM   7782  C  C   . GLU B  1  339 ? 28.368  51.667  -10.429 1.00 47.38 ? 367  GLU B C   1 
ATOM   7783  O  O   . GLU B  1  339 ? 28.266  51.382  -9.231  1.00 46.93 ? 367  GLU B O   1 
ATOM   7784  C  CB  . GLU B  1  339 ? 28.947  53.897  -11.398 1.00 47.80 ? 367  GLU B CB  1 
ATOM   7785  C  CG  . GLU B  1  339 ? 29.753  53.410  -12.584 1.00 49.06 ? 367  GLU B CG  1 
ATOM   7786  C  CD  . GLU B  1  339 ? 28.868  53.106  -13.776 1.00 50.20 ? 367  GLU B CD  1 
ATOM   7787  O  OE1 . GLU B  1  339 ? 28.242  54.051  -14.313 1.00 50.55 ? 367  GLU B OE1 1 
ATOM   7788  O  OE2 . GLU B  1  339 ? 28.787  51.918  -14.166 1.00 50.34 ? 367  GLU B OE2 1 
ATOM   7789  N  N   . ALA B  1  340 ? 28.972  50.889  -11.323 1.00 46.25 ? 368  ALA B N   1 
ATOM   7790  C  CA  . ALA B  1  340 ? 29.601  49.627  -10.975 1.00 45.24 ? 368  ALA B CA  1 
ATOM   7791  C  C   . ALA B  1  340 ? 30.815  49.505  -11.852 1.00 45.32 ? 368  ALA B C   1 
ATOM   7792  O  O   . ALA B  1  340 ? 30.742  49.682  -13.061 1.00 45.14 ? 368  ALA B O   1 
ATOM   7793  C  CB  . ALA B  1  340 ? 28.664  48.461  -11.229 1.00 45.42 ? 368  ALA B CB  1 
ATOM   7794  N  N   . LEU B  1  341 ? 31.937  49.211  -11.224 1.00 46.75 ? 369  LEU B N   1 
ATOM   7795  C  CA  . LEU B  1  341 ? 33.197  49.053  -11.919 1.00 47.33 ? 369  LEU B CA  1 
ATOM   7796  C  C   . LEU B  1  341 ? 33.718  47.647  -11.637 1.00 46.50 ? 369  LEU B C   1 
ATOM   7797  O  O   . LEU B  1  341 ? 33.210  46.939  -10.771 1.00 45.46 ? 369  LEU B O   1 
ATOM   7798  C  CB  . LEU B  1  341 ? 34.175  50.124  -11.426 1.00 47.11 ? 369  LEU B CB  1 
ATOM   7799  C  CG  . LEU B  1  341 ? 35.686  50.073  -11.649 1.00 46.39 ? 369  LEU B CG  1 
ATOM   7800  C  CD1 . LEU B  1  341 ? 36.049  49.963  -13.119 1.00 45.25 ? 369  LEU B CD1 1 
ATOM   7801  C  CD2 . LEU B  1  341 ? 36.260  51.342  -11.037 1.00 45.67 ? 369  LEU B CD2 1 
ATOM   7802  N  N   . ALA B  1  342 ? 34.726  47.247  -12.393 1.00 47.15 ? 370  ALA B N   1 
ATOM   7803  C  CA  . ALA B  1  342 ? 35.332  45.931  -12.256 1.00 47.41 ? 370  ALA B CA  1 
ATOM   7804  C  C   . ALA B  1  342 ? 36.606  45.983  -13.077 1.00 46.71 ? 370  ALA B C   1 
ATOM   7805  O  O   . ALA B  1  342 ? 36.577  45.900  -14.303 1.00 48.08 ? 370  ALA B O   1 
ATOM   7806  C  CB  . ALA B  1  342 ? 34.392  44.854  -12.796 1.00 47.21 ? 370  ALA B CB  1 
ATOM   7807  N  N   . ILE B  1  343 ? 37.728  46.136  -12.396 1.00 46.30 ? 371  ILE B N   1 
ATOM   7808  C  CA  . ILE B  1  343 ? 39.004  46.220  -13.075 1.00 48.31 ? 371  ILE B CA  1 
ATOM   7809  C  C   . ILE B  1  343 ? 39.758  44.892  -13.058 1.00 47.99 ? 371  ILE B C   1 
ATOM   7810  O  O   . ILE B  1  343 ? 39.986  44.297  -12.006 1.00 46.94 ? 371  ILE B O   1 
ATOM   7811  C  CB  . ILE B  1  343 ? 39.820  47.348  -12.445 1.00 48.78 ? 371  ILE B CB  1 
ATOM   7812  C  CG1 . ILE B  1  343 ? 39.121  48.669  -12.767 1.00 47.25 ? 371  ILE B CG1 1 
ATOM   7813  C  CG2 . ILE B  1  343 ? 41.273  47.310  -12.931 1.00 48.05 ? 371  ILE B CG2 1 
ATOM   7814  C  CD1 . ILE B  1  343 ? 39.478  49.771  -11.835 1.00 49.12 ? 371  ILE B CD1 1 
ATOM   7815  N  N   . TYR B  1  344 ? 40.149  44.435  -14.241 1.00 47.91 ? 372  TYR B N   1 
ATOM   7816  C  CA  . TYR B  1  344 ? 40.825  43.159  -14.345 1.00 50.93 ? 372  TYR B CA  1 
ATOM   7817  C  C   . TYR B  1  344 ? 42.317  43.142  -14.539 1.00 49.36 ? 372  TYR B C   1 
ATOM   7818  O  O   . TYR B  1  344 ? 42.923  44.034  -15.133 1.00 49.07 ? 372  TYR B O   1 
ATOM   7819  C  CB  . TYR B  1  344 ? 40.203  42.303  -15.458 1.00 50.73 ? 372  TYR B CB  1 
ATOM   7820  C  CG  . TYR B  1  344 ? 38.838  41.761  -15.131 1.00 50.64 ? 372  TYR B CG  1 
ATOM   7821  C  CD1 . TYR B  1  344 ? 37.722  42.602  -15.085 1.00 51.23 ? 372  TYR B CD1 1 
ATOM   7822  C  CD2 . TYR B  1  344 ? 38.660  40.409  -14.860 1.00 51.07 ? 372  TYR B CD2 1 
ATOM   7823  C  CE1 . TYR B  1  344 ? 36.456  42.107  -14.777 1.00 51.50 ? 372  TYR B CE1 1 
ATOM   7824  C  CE2 . TYR B  1  344 ? 37.401  39.895  -14.548 1.00 52.24 ? 372  TYR B CE2 1 
ATOM   7825  C  CZ  . TYR B  1  344 ? 36.301  40.746  -14.509 1.00 53.26 ? 372  TYR B CZ  1 
ATOM   7826  O  OH  . TYR B  1  344 ? 35.049  40.231  -14.215 1.00 54.04 ? 372  TYR B OH  1 
ATOM   7827  N  N   . GLY B  1  345 ? 42.895  42.078  -14.010 1.00 50.58 ? 373  GLY B N   1 
ATOM   7828  C  CA  . GLY B  1  345 ? 44.313  41.844  -14.134 1.00 52.95 ? 373  GLY B CA  1 
ATOM   7829  C  C   . GLY B  1  345 ? 44.256  40.666  -15.061 1.00 51.05 ? 373  GLY B C   1 
ATOM   7830  O  O   . GLY B  1  345 ? 43.263  39.947  -15.054 1.00 51.46 ? 373  GLY B O   1 
ATOM   7831  N  N   . GLY B  1  346 ? 45.282  40.447  -15.860 1.00 52.74 ? 374  GLY B N   1 
ATOM   7832  C  CA  . GLY B  1  346 ? 45.175  39.329  -16.757 1.00 54.70 ? 374  GLY B CA  1 
ATOM   7833  C  C   . GLY B  1  346 ? 46.419  38.652  -17.258 1.00 55.15 ? 374  GLY B C   1 
ATOM   7834  O  O   . GLY B  1  346 ? 47.548  39.112  -17.101 1.00 55.39 ? 374  GLY B O   1 
ATOM   7835  N  N   . ASN B  1  347 ? 46.156  37.531  -17.905 1.00 56.54 ? 375  ASN B N   1 
ATOM   7836  C  CA  . ASN B  1  347 ? 47.158  36.665  -18.493 1.00 56.78 ? 375  ASN B CA  1 
ATOM   7837  C  C   . ASN B  1  347 ? 47.221  37.018  -19.976 1.00 56.89 ? 375  ASN B C   1 
ATOM   7838  O  O   . ASN B  1  347 ? 48.296  37.124  -20.573 1.00 56.54 ? 375  ASN B O   1 
ATOM   7839  C  CB  . ASN B  1  347 ? 46.676  35.225  -18.286 1.00 58.06 ? 375  ASN B CB  1 
ATOM   7840  C  CG  . ASN B  1  347 ? 47.589  34.200  -18.894 1.00 58.77 ? 375  ASN B CG  1 
ATOM   7841  O  OD1 . ASN B  1  347 ? 48.812  34.401  -18.976 1.00 59.91 ? 375  ASN B OD1 1 
ATOM   7842  N  ND2 . ASN B  1  347 ? 47.006  33.067  -19.305 1.00 57.32 ? 375  ASN B ND2 1 
ATOM   7843  N  N   . SER B  1  348 ? 46.041  37.228  -20.544 1.00 57.19 ? 376  SER B N   1 
ATOM   7844  C  CA  . SER B  1  348 ? 45.888  37.546  -21.951 1.00 56.04 ? 376  SER B CA  1 
ATOM   7845  C  C   . SER B  1  348 ? 45.461  39.004  -22.090 1.00 55.27 ? 376  SER B C   1 
ATOM   7846  O  O   . SER B  1  348 ? 45.106  39.637  -21.105 1.00 54.09 ? 376  SER B O   1 
ATOM   7847  C  CB  . SER B  1  348 ? 44.831  36.609  -22.526 1.00 56.96 ? 376  SER B CB  1 
ATOM   7848  O  OG  . SER B  1  348 ? 44.776  35.417  -21.751 1.00 58.04 ? 376  SER B OG  1 
ATOM   7849  N  N   . PRO B  1  349 ? 45.491  39.549  -23.318 1.00 55.85 ? 377  PRO B N   1 
ATOM   7850  C  CA  . PRO B  1  349 ? 45.118  40.931  -23.657 1.00 56.39 ? 377  PRO B CA  1 
ATOM   7851  C  C   . PRO B  1  349 ? 43.729  41.367  -23.190 1.00 57.01 ? 377  PRO B C   1 
ATOM   7852  O  O   . PRO B  1  349 ? 43.533  42.517  -22.796 1.00 56.53 ? 377  PRO B O   1 
ATOM   7853  C  CB  . PRO B  1  349 ? 45.228  40.951  -25.179 1.00 55.46 ? 377  PRO B CB  1 
ATOM   7854  C  CG  . PRO B  1  349 ? 46.310  39.988  -25.441 1.00 55.74 ? 377  PRO B CG  1 
ATOM   7855  C  CD  . PRO B  1  349 ? 45.967  38.847  -24.521 1.00 55.36 ? 377  PRO B CD  1 
ATOM   7856  N  N   . ALA B  1  350 ? 42.763  40.454  -23.255 1.00 57.37 ? 378  ALA B N   1 
ATOM   7857  C  CA  . ALA B  1  350 ? 41.399  40.758  -22.841 1.00 56.84 ? 378  ALA B CA  1 
ATOM   7858  C  C   . ALA B  1  350 ? 41.379  41.065  -21.360 1.00 57.50 ? 378  ALA B C   1 
ATOM   7859  O  O   . ALA B  1  350 ? 41.238  42.223  -20.959 1.00 58.16 ? 378  ALA B O   1 
ATOM   7860  C  CB  . ALA B  1  350 ? 40.496  39.592  -23.128 1.00 56.67 ? 378  ALA B CB  1 
ATOM   7861  N  N   . ALA B  1  351 ? 41.510  40.023  -20.548 1.00 56.45 ? 379  ALA B N   1 
ATOM   7862  C  CA  . ALA B  1  351 ? 41.528  40.206  -19.107 1.00 57.05 ? 379  ALA B CA  1 
ATOM   7863  C  C   . ALA B  1  351 ? 42.348  41.468  -18.812 1.00 57.15 ? 379  ALA B C   1 
ATOM   7864  O  O   . ALA B  1  351 ? 41.844  42.466  -18.297 1.00 56.86 ? 379  ALA B O   1 
ATOM   7865  C  CB  . ALA B  1  351 ? 42.176  38.990  -18.455 1.00 57.56 ? 379  ALA B CB  1 
ATOM   7866  N  N   . MET B  1  352 ? 43.617  41.382  -19.190 1.00 56.97 ? 380  MET B N   1 
ATOM   7867  C  CA  . MET B  1  352 ? 44.643  42.412  -19.045 1.00 57.19 ? 380  MET B CA  1 
ATOM   7868  C  C   . MET B  1  352 ? 44.229  43.878  -19.184 1.00 55.20 ? 380  MET B C   1 
ATOM   7869  O  O   . MET B  1  352 ? 44.845  44.753  -18.567 1.00 54.25 ? 380  MET B O   1 
ATOM   7870  C  CB  . MET B  1  352 ? 45.744  42.102  -20.060 1.00 58.22 ? 380  MET B CB  1 
ATOM   7871  C  CG  . MET B  1  352 ? 47.101  42.735  -19.823 1.00 57.16 ? 380  MET B CG  1 
ATOM   7872  S  SD  . MET B  1  352 ? 48.190  42.320  -21.222 1.00 56.90 ? 380  MET B SD  1 
ATOM   7873  C  CE  . MET B  1  352 ? 48.743  40.617  -20.780 1.00 56.12 ? 380  MET B CE  1 
ATOM   7874  N  N   . THR B  1  353 ? 43.216  44.154  -20.004 1.00 54.76 ? 381  THR B N   1 
ATOM   7875  C  CA  . THR B  1  353 ? 42.767  45.537  -20.203 1.00 56.49 ? 381  THR B CA  1 
ATOM   7876  C  C   . THR B  1  353 ? 41.297  45.779  -19.899 1.00 54.66 ? 381  THR B C   1 
ATOM   7877  O  O   . THR B  1  353 ? 40.790  46.888  -20.093 1.00 55.24 ? 381  THR B O   1 
ATOM   7878  C  CB  . THR B  1  353 ? 43.007  46.032  -21.645 1.00 57.05 ? 381  THR B CB  1 
ATOM   7879  O  OG1 . THR B  1  353 ? 44.299  45.612  -22.090 1.00 57.83 ? 381  THR B OG1 1 
ATOM   7880  C  CG2 . THR B  1  353 ? 42.955  47.569  -21.694 1.00 57.44 ? 381  THR B CG2 1 
ATOM   7881  N  N   . THR B  1  354 ? 40.604  44.756  -19.428 1.00 52.78 ? 382  THR B N   1 
ATOM   7882  C  CA  . THR B  1  354 ? 39.208  44.947  -19.116 1.00 51.96 ? 382  THR B CA  1 
ATOM   7883  C  C   . THR B  1  354 ? 38.998  45.760  -17.848 1.00 53.02 ? 382  THR B C   1 
ATOM   7884  O  O   . THR B  1  354 ? 39.498  45.412  -16.778 1.00 52.09 ? 382  THR B O   1 
ATOM   7885  C  CB  . THR B  1  354 ? 38.490  43.634  -18.938 1.00 51.94 ? 382  THR B CB  1 
ATOM   7886  O  OG1 . THR B  1  354 ? 38.521  42.908  -20.165 1.00 53.47 ? 382  THR B OG1 1 
ATOM   7887  C  CG2 . THR B  1  354 ? 37.059  43.886  -18.554 1.00 51.88 ? 382  THR B CG2 1 
ATOM   7888  N  N   . ARG B  1  355 ? 38.265  46.857  -17.993 1.00 52.62 ? 383  ARG B N   1 
ATOM   7889  C  CA  . ARG B  1  355 ? 37.909  47.729  -16.888 1.00 51.19 ? 383  ARG B CA  1 
ATOM   7890  C  C   . ARG B  1  355 ? 36.444  48.075  -17.131 1.00 51.05 ? 383  ARG B C   1 
ATOM   7891  O  O   . ARG B  1  355 ? 36.112  49.197  -17.505 1.00 51.07 ? 383  ARG B O   1 
ATOM   7892  C  CB  . ARG B  1  355 ? 38.756  49.008  -16.875 1.00 49.98 ? 383  ARG B CB  1 
ATOM   7893  C  CG  . ARG B  1  355 ? 40.172  48.850  -16.346 1.00 49.02 ? 383  ARG B CG  1 
ATOM   7894  C  CD  . ARG B  1  355 ? 41.108  48.330  -17.415 1.00 49.84 ? 383  ARG B CD  1 
ATOM   7895  N  NE  . ARG B  1  355 ? 42.499  48.215  -16.966 1.00 49.28 ? 383  ARG B NE  1 
ATOM   7896  C  CZ  . ARG B  1  355 ? 42.958  47.254  -16.170 1.00 48.40 ? 383  ARG B CZ  1 
ATOM   7897  N  NH1 . ARG B  1  355 ? 42.140  46.317  -15.724 1.00 49.61 ? 383  ARG B NH1 1 
ATOM   7898  N  NH2 . ARG B  1  355 ? 44.238  47.212  -15.836 1.00 47.48 ? 383  ARG B NH2 1 
ATOM   7899  N  N   . TYR B  1  356 ? 35.572  47.090  -16.938 1.00 51.21 ? 384  TYR B N   1 
ATOM   7900  C  CA  . TYR B  1  356 ? 34.141  47.282  -17.143 1.00 51.83 ? 384  TYR B CA  1 
ATOM   7901  C  C   . TYR B  1  356 ? 33.576  48.395  -16.279 1.00 52.49 ? 384  TYR B C   1 
ATOM   7902  O  O   . TYR B  1  356 ? 33.958  48.551  -15.119 1.00 52.87 ? 384  TYR B O   1 
ATOM   7903  C  CB  . TYR B  1  356 ? 33.358  46.006  -16.823 1.00 53.06 ? 384  TYR B CB  1 
ATOM   7904  C  CG  . TYR B  1  356 ? 33.590  44.846  -17.767 1.00 55.02 ? 384  TYR B CG  1 
ATOM   7905  C  CD1 . TYR B  1  356 ? 33.342  44.969  -19.136 1.00 54.08 ? 384  TYR B CD1 1 
ATOM   7906  C  CD2 . TYR B  1  356 ? 34.044  43.611  -17.283 1.00 55.82 ? 384  TYR B CD2 1 
ATOM   7907  C  CE1 . TYR B  1  356 ? 33.545  43.891  -20.000 1.00 55.52 ? 384  TYR B CE1 1 
ATOM   7908  C  CE2 . TYR B  1  356 ? 34.247  42.527  -18.135 1.00 55.36 ? 384  TYR B CE2 1 
ATOM   7909  C  CZ  . TYR B  1  356 ? 34.001  42.671  -19.491 1.00 55.48 ? 384  TYR B CZ  1 
ATOM   7910  O  OH  . TYR B  1  356 ? 34.228  41.604  -20.334 1.00 55.46 ? 384  TYR B OH  1 
ATOM   7911  N  N   . VAL B  1  357 ? 32.657  49.162  -16.858 1.00 52.59 ? 385  VAL B N   1 
ATOM   7912  C  CA  . VAL B  1  357 ? 31.977  50.256  -16.169 1.00 52.06 ? 385  VAL B CA  1 
ATOM   7913  C  C   . VAL B  1  357 ? 30.515  49.988  -16.476 1.00 52.27 ? 385  VAL B C   1 
ATOM   7914  O  O   . VAL B  1  357 ? 29.857  50.751  -17.180 1.00 52.94 ? 385  VAL B O   1 
ATOM   7915  C  CB  . VAL B  1  357 ? 32.396  51.629  -16.731 1.00 51.06 ? 385  VAL B CB  1 
ATOM   7916  C  CG1 . VAL B  1  357 ? 31.625  52.741  -16.029 1.00 50.40 ? 385  VAL B CG1 1 
ATOM   7917  C  CG2 . VAL B  1  357 ? 33.897  51.827  -16.550 1.00 49.80 ? 385  VAL B CG2 1 
ATOM   7918  N  N   . ASP B  1  358 ? 30.044  48.867  -15.934 1.00 53.60 ? 386  ASP B N   1 
ATOM   7919  C  CA  . ASP B  1  358 ? 28.696  48.328  -16.112 1.00 53.13 ? 386  ASP B CA  1 
ATOM   7920  C  C   . ASP B  1  358 ? 27.525  49.267  -16.383 1.00 53.08 ? 386  ASP B C   1 
ATOM   7921  O  O   . ASP B  1  358 ? 26.562  48.866  -17.037 1.00 53.17 ? 386  ASP B O   1 
ATOM   7922  C  CB  . ASP B  1  358 ? 28.391  47.403  -14.942 1.00 53.17 ? 386  ASP B CB  1 
ATOM   7923  C  CG  . ASP B  1  358 ? 29.544  46.439  -14.658 1.00 54.47 ? 386  ASP B CG  1 
ATOM   7924  O  OD1 . ASP B  1  358 ? 30.286  46.102  -15.612 1.00 52.23 ? 386  ASP B OD1 1 
ATOM   7925  O  OD2 . ASP B  1  358 ? 29.706  46.013  -13.492 1.00 55.98 ? 386  ASP B OD2 1 
ATOM   7926  N  N   . GLY B  1  359 ? 27.592  50.502  -15.893 1.00 53.42 ? 387  GLY B N   1 
ATOM   7927  C  CA  . GLY B  1  359 ? 26.523  51.458  -16.153 1.00 53.55 ? 387  GLY B CA  1 
ATOM   7928  C  C   . GLY B  1  359 ? 26.553  51.834  -17.629 1.00 54.68 ? 387  GLY B C   1 
ATOM   7929  O  O   . GLY B  1  359 ? 25.592  52.389  -18.173 1.00 53.48 ? 387  GLY B O   1 
ATOM   7930  N  N   . GLY B  1  360 ? 27.684  51.540  -18.271 1.00 54.90 ? 388  GLY B N   1 
ATOM   7931  C  CA  . GLY B  1  360 ? 27.845  51.809  -19.687 1.00 54.50 ? 388  GLY B CA  1 
ATOM   7932  C  C   . GLY B  1  360 ? 26.950  50.839  -20.427 1.00 54.46 ? 388  GLY B C   1 
ATOM   7933  O  O   . GLY B  1  360 ? 26.625  51.046  -21.590 1.00 54.87 ? 388  GLY B O   1 
ATOM   7934  N  N   . PHE B  1  361 ? 26.565  49.771  -19.731 1.00 55.01 ? 389  PHE B N   1 
ATOM   7935  C  CA  . PHE B  1  361 ? 25.663  48.750  -20.258 1.00 55.16 ? 389  PHE B CA  1 
ATOM   7936  C  C   . PHE B  1  361 ? 24.291  49.046  -19.676 1.00 55.51 ? 389  PHE B C   1 
ATOM   7937  O  O   . PHE B  1  361 ? 23.283  48.935  -20.366 1.00 55.59 ? 389  PHE B O   1 
ATOM   7938  C  CB  . PHE B  1  361 ? 26.089  47.359  -19.808 1.00 55.21 ? 389  PHE B CB  1 
ATOM   7939  C  CG  . PHE B  1  361 ? 27.379  46.908  -20.399 1.00 55.75 ? 389  PHE B CG  1 
ATOM   7940  C  CD1 . PHE B  1  361 ? 28.538  47.654  -20.221 1.00 56.56 ? 389  PHE B CD1 1 
ATOM   7941  C  CD2 . PHE B  1  361 ? 27.441  45.739  -21.142 1.00 56.15 ? 389  PHE B CD2 1 
ATOM   7942  C  CE1 . PHE B  1  361 ? 29.745  47.241  -20.776 1.00 57.11 ? 389  PHE B CE1 1 
ATOM   7943  C  CE2 . PHE B  1  361 ? 28.638  45.316  -21.704 1.00 57.24 ? 389  PHE B CE2 1 
ATOM   7944  C  CZ  . PHE B  1  361 ? 29.796  46.070  -21.520 1.00 57.59 ? 389  PHE B CZ  1 
ATOM   7945  N  N   . GLY B  1  362 ? 24.270  49.414  -18.394 1.00 55.98 ? 390  GLY B N   1 
ATOM   7946  C  CA  . GLY B  1  362 ? 23.028  49.750  -17.717 1.00 55.03 ? 390  GLY B CA  1 
ATOM   7947  C  C   . GLY B  1  362 ? 22.527  48.679  -16.773 1.00 55.70 ? 390  GLY B C   1 
ATOM   7948  O  O   . GLY B  1  362 ? 22.165  47.587  -17.210 1.00 56.71 ? 390  GLY B O   1 
ATOM   7949  N  N   . MET B  1  363 ? 22.497  48.980  -15.479 1.00 55.34 ? 391  MET B N   1 
ATOM   7950  C  CA  . MET B  1  363 ? 22.022  48.009  -14.499 1.00 55.03 ? 391  MET B CA  1 
ATOM   7951  C  C   . MET B  1  363 ? 20.519  47.801  -14.579 1.00 54.41 ? 391  MET B C   1 
ATOM   7952  O  O   . MET B  1  363 ? 20.012  46.732  -14.235 1.00 55.07 ? 391  MET B O   1 
ATOM   7953  C  CB  . MET B  1  363 ? 22.408  48.427  -13.082 1.00 55.19 ? 391  MET B CB  1 
ATOM   7954  C  CG  . MET B  1  363 ? 23.816  48.011  -12.661 1.00 55.65 ? 391  MET B CG  1 
ATOM   7955  S  SD  . MET B  1  363 ? 25.134  48.842  -13.571 1.00 56.39 ? 391  MET B SD  1 
ATOM   7956  C  CE  . MET B  1  363 ? 25.216  50.422  -12.695 1.00 54.90 ? 391  MET B CE  1 
ATOM   7957  N  N   . GLY B  1  364 ? 19.799  48.822  -15.016 1.00 53.99 ? 392  GLY B N   1 
ATOM   7958  C  CA  . GLY B  1  364 ? 18.368  48.659  -15.138 1.00 55.29 ? 392  GLY B CA  1 
ATOM   7959  C  C   . GLY B  1  364 ? 18.123  47.675  -16.263 1.00 55.51 ? 392  GLY B C   1 
ATOM   7960  O  O   . GLY B  1  364 ? 17.470  46.641  -16.084 1.00 55.03 ? 392  GLY B O   1 
ATOM   7961  N  N   . LYS B  1  365 ? 18.682  48.013  -17.423 1.00 56.16 ? 393  LYS B N   1 
ATOM   7962  C  CA  . LYS B  1  365 ? 18.587  47.225  -18.654 1.00 55.79 ? 393  LYS B CA  1 
ATOM   7963  C  C   . LYS B  1  365 ? 18.896  45.717  -18.475 1.00 56.09 ? 393  LYS B C   1 
ATOM   7964  O  O   . LYS B  1  365 ? 18.120  44.860  -18.908 1.00 54.77 ? 393  LYS B O   1 
ATOM   7965  C  CB  . LYS B  1  365 ? 19.526  47.847  -19.708 1.00 55.45 ? 393  LYS B CB  1 
ATOM   7966  C  CG  . LYS B  1  365 ? 19.417  47.266  -21.127 1.00 56.51 ? 393  LYS B CG  1 
ATOM   7967  C  CD  . LYS B  1  365 ? 20.467  47.859  -22.103 1.00 57.03 ? 393  LYS B CD  1 
ATOM   7968  C  CE  . LYS B  1  365 ? 19.884  48.837  -23.154 1.00 56.21 ? 393  LYS B CE  1 
ATOM   7969  N  NZ  . LYS B  1  365 ? 20.905  49.370  -24.138 1.00 54.93 ? 393  LYS B NZ  1 
ATOM   7970  N  N   . TYR B  1  366 ? 20.016  45.396  -17.827 1.00 55.73 ? 394  TYR B N   1 
ATOM   7971  C  CA  . TYR B  1  366 ? 20.413  44.000  -17.617 1.00 54.31 ? 394  TYR B CA  1 
ATOM   7972  C  C   . TYR B  1  366 ? 19.827  43.347  -16.361 1.00 54.68 ? 394  TYR B C   1 
ATOM   7973  O  O   . TYR B  1  366 ? 20.390  42.377  -15.833 1.00 53.35 ? 394  TYR B O   1 
ATOM   7974  C  CB  . TYR B  1  366 ? 21.943  43.899  -17.596 1.00 54.91 ? 394  TYR B CB  1 
ATOM   7975  C  CG  . TYR B  1  366 ? 22.584  44.210  -18.938 1.00 55.84 ? 394  TYR B CG  1 
ATOM   7976  C  CD1 . TYR B  1  366 ? 22.377  45.439  -19.571 1.00 55.04 ? 394  TYR B CD1 1 
ATOM   7977  C  CD2 . TYR B  1  366 ? 23.367  43.260  -19.596 1.00 55.97 ? 394  TYR B CD2 1 
ATOM   7978  C  CE1 . TYR B  1  366 ? 22.924  45.704  -20.821 1.00 54.56 ? 394  TYR B CE1 1 
ATOM   7979  C  CE2 . TYR B  1  366 ? 23.920  43.522  -20.850 1.00 54.93 ? 394  TYR B CE2 1 
ATOM   7980  C  CZ  . TYR B  1  366 ? 23.688  44.743  -21.453 1.00 54.20 ? 394  TYR B CZ  1 
ATOM   7981  O  OH  . TYR B  1  366 ? 24.188  44.989  -22.706 1.00 53.15 ? 394  TYR B OH  1 
ATOM   7982  N  N   . THR B  1  367 ? 18.698  43.882  -15.888 1.00 54.68 ? 395  THR B N   1 
ATOM   7983  C  CA  . THR B  1  367 ? 18.019  43.346  -14.708 1.00 54.43 ? 395  THR B CA  1 
ATOM   7984  C  C   . THR B  1  367 ? 17.228  42.089  -15.050 1.00 54.77 ? 395  THR B C   1 
ATOM   7985  O  O   . THR B  1  367 ? 16.178  42.150  -15.681 1.00 55.63 ? 395  THR B O   1 
ATOM   7986  C  CB  . THR B  1  367 ? 17.060  44.380  -14.079 1.00 53.72 ? 395  THR B CB  1 
ATOM   7987  O  OG1 . THR B  1  367 ? 17.799  45.209  -13.173 1.00 55.04 ? 395  THR B OG1 1 
ATOM   7988  C  CG2 . THR B  1  367 ? 15.934  43.686  -13.313 1.00 54.03 ? 395  THR B CG2 1 
ATOM   7989  N  N   . THR B  1  368 ? 17.738  40.946  -14.624 1.00 53.37 ? 396  THR B N   1 
ATOM   7990  C  CA  . THR B  1  368 ? 17.080  39.690  -14.899 1.00 51.90 ? 396  THR B CA  1 
ATOM   7991  C  C   . THR B  1  368 ? 15.901  39.450  -13.981 1.00 52.56 ? 396  THR B C   1 
ATOM   7992  O  O   . THR B  1  368 ? 15.922  39.817  -12.809 1.00 51.99 ? 396  THR B O   1 
ATOM   7993  C  CB  . THR B  1  368 ? 18.041  38.526  -14.716 1.00 53.19 ? 396  THR B CB  1 
ATOM   7994  O  OG1 . THR B  1  368 ? 18.498  38.497  -13.359 1.00 52.56 ? 396  THR B OG1 1 
ATOM   7995  C  CG2 . THR B  1  368 ? 19.220  38.677  -15.628 1.00 53.25 ? 396  THR B CG2 1 
ATOM   7996  N  N   . PRO B  1  369 ? 14.845  38.826  -14.511 1.00 54.06 ? 397  PRO B N   1 
ATOM   7997  C  CA  . PRO B  1  369 ? 13.656  38.533  -13.708 1.00 54.41 ? 397  PRO B CA  1 
ATOM   7998  C  C   . PRO B  1  369 ? 14.017  37.662  -12.509 1.00 54.03 ? 397  PRO B C   1 
ATOM   7999  O  O   . PRO B  1  369 ? 14.865  36.765  -12.601 1.00 54.58 ? 397  PRO B O   1 
ATOM   8000  C  CB  . PRO B  1  369 ? 12.726  37.836  -14.704 1.00 53.18 ? 397  PRO B CB  1 
ATOM   8001  C  CG  . PRO B  1  369 ? 13.659  37.329  -15.776 1.00 53.63 ? 397  PRO B CG  1 
ATOM   8002  C  CD  . PRO B  1  369 ? 14.638  38.442  -15.917 1.00 53.57 ? 397  PRO B CD  1 
ATOM   8003  N  N   . LEU B  1  370 ? 13.380  37.939  -11.378 1.00 54.21 ? 398  LEU B N   1 
ATOM   8004  C  CA  . LEU B  1  370 ? 13.664  37.193  -10.164 1.00 55.05 ? 398  LEU B CA  1 
ATOM   8005  C  C   . LEU B  1  370 ? 12.918  35.867  -10.100 1.00 55.67 ? 398  LEU B C   1 
ATOM   8006  O  O   . LEU B  1  370 ? 11.716  35.783  -10.367 1.00 54.91 ? 398  LEU B O   1 
ATOM   8007  C  CB  . LEU B  1  370 ? 13.360  38.053  -8.933  1.00 54.15 ? 398  LEU B CB  1 
ATOM   8008  C  CG  . LEU B  1  370 ? 14.235  39.302  -8.775  1.00 53.10 ? 398  LEU B CG  1 
ATOM   8009  C  CD1 . LEU B  1  370 ? 13.713  40.170  -7.661  1.00 54.35 ? 398  LEU B CD1 1 
ATOM   8010  C  CD2 . LEU B  1  370 ? 15.646  38.896  -8.486  1.00 52.98 ? 398  LEU B CD2 1 
ATOM   8011  N  N   . THR B  1  371 ? 13.670  34.826  -9.754  1.00 57.20 ? 399  THR B N   1 
ATOM   8012  C  CA  . THR B  1  371 ? 13.154  33.471  -9.653  1.00 55.95 ? 399  THR B CA  1 
ATOM   8013  C  C   . THR B  1  371 ? 12.542  33.255  -8.273  1.00 56.45 ? 399  THR B C   1 
ATOM   8014  O  O   . THR B  1  371 ? 13.239  33.250  -7.253  1.00 56.27 ? 399  THR B O   1 
ATOM   8015  C  CB  . THR B  1  371 ? 14.284  32.435  -9.916  1.00 55.42 ? 399  THR B CB  1 
ATOM   8016  O  OG1 . THR B  1  371 ? 14.802  32.609  -11.244 1.00 54.84 ? 399  THR B OG1 1 
ATOM   8017  C  CG2 . THR B  1  371 ? 13.760  31.029  -9.782  1.00 55.66 ? 399  THR B CG2 1 
ATOM   8018  N  N   . ARG B  1  372 ? 11.224  33.080  -8.267  1.00 57.81 ? 400  ARG B N   1 
ATOM   8019  C  CA  . ARG B  1  372 ? 10.451  32.886  -7.047  1.00 57.02 ? 400  ARG B CA  1 
ATOM   8020  C  C   . ARG B  1  372 ? 10.911  31.652  -6.303  1.00 56.45 ? 400  ARG B C   1 
ATOM   8021  O  O   . ARG B  1  372 ? 10.828  30.548  -6.834  1.00 56.31 ? 400  ARG B O   1 
ATOM   8022  C  CB  . ARG B  1  372 ? 8.968   32.760  -7.403  1.00 55.63 ? 400  ARG B CB  1 
ATOM   8023  C  CG  . ARG B  1  372 ? 8.604   33.570  -8.648  1.00 56.56 ? 400  ARG B CG  1 
ATOM   8024  C  CD  . ARG B  1  372 ? 7.118   33.541  -8.946  1.00 55.80 ? 400  ARG B CD  1 
ATOM   8025  N  NE  . ARG B  1  372 ? 6.322   34.274  -7.961  1.00 54.02 ? 400  ARG B NE  1 
ATOM   8026  C  CZ  . ARG B  1  372 ? 5.695   35.423  -8.211  1.00 53.33 ? 400  ARG B CZ  1 
ATOM   8027  N  NH1 . ARG B  1  372 ? 5.771   35.974  -9.418  1.00 50.96 ? 400  ARG B NH1 1 
ATOM   8028  N  NH2 . ARG B  1  372 ? 4.986   36.020  -7.256  1.00 53.68 ? 400  ARG B NH2 1 
ATOM   8029  N  N   . GLY B  1  373 ? 11.409  31.846  -5.083  1.00 56.03 ? 401  GLY B N   1 
ATOM   8030  C  CA  . GLY B  1  373 ? 11.862  30.722  -4.279  1.00 56.31 ? 401  GLY B CA  1 
ATOM   8031  C  C   . GLY B  1  373 ? 13.362  30.596  -4.113  1.00 55.82 ? 401  GLY B C   1 
ATOM   8032  O  O   . GLY B  1  373 ? 13.838  29.948  -3.177  1.00 54.15 ? 401  GLY B O   1 
ATOM   8033  N  N   . VAL B  1  374 ? 14.100  31.203  -5.041  1.00 57.26 ? 402  VAL B N   1 
ATOM   8034  C  CA  . VAL B  1  374 ? 15.565  31.196  -5.022  1.00 57.10 ? 402  VAL B CA  1 
ATOM   8035  C  C   . VAL B  1  374 ? 16.099  32.613  -4.821  1.00 56.95 ? 402  VAL B C   1 
ATOM   8036  O  O   . VAL B  1  374 ? 16.847  32.879  -3.875  1.00 55.34 ? 402  VAL B O   1 
ATOM   8037  C  CB  . VAL B  1  374 ? 16.139  30.662  -6.337  1.00 55.82 ? 402  VAL B CB  1 
ATOM   8038  C  CG1 . VAL B  1  374 ? 17.654  30.698  -6.283  1.00 56.24 ? 402  VAL B CG1 1 
ATOM   8039  C  CG2 . VAL B  1  374 ? 15.636  29.261  -6.585  1.00 56.08 ? 402  VAL B CG2 1 
ATOM   8040  N  N   . ASP B  1  375 ? 15.695  33.507  -5.726  1.00 57.55 ? 403  ASP B N   1 
ATOM   8041  C  CA  . ASP B  1  375 ? 16.090  34.912  -5.700  1.00 57.25 ? 403  ASP B CA  1 
ATOM   8042  C  C   . ASP B  1  375 ? 15.424  35.686  -4.579  1.00 57.39 ? 403  ASP B C   1 
ATOM   8043  O  O   . ASP B  1  375 ? 15.980  36.658  -4.081  1.00 56.78 ? 403  ASP B O   1 
ATOM   8044  C  CB  . ASP B  1  375 ? 15.753  35.586  -7.030  1.00 56.43 ? 403  ASP B CB  1 
ATOM   8045  C  CG  . ASP B  1  375 ? 16.656  35.130  -8.148  1.00 56.97 ? 403  ASP B CG  1 
ATOM   8046  O  OD1 . ASP B  1  375 ? 17.800  34.746  -7.841  1.00 58.32 ? 403  ASP B OD1 1 
ATOM   8047  O  OD2 . ASP B  1  375 ? 16.243  35.166  -9.326  1.00 56.78 ? 403  ASP B OD2 1 
ATOM   8048  N  N   . CYS B  1  376 ? 14.229  35.250  -4.193  1.00 58.74 ? 404  CYS B N   1 
ATOM   8049  C  CA  . CYS B  1  376 ? 13.466  35.891  -3.123  1.00 59.87 ? 404  CYS B CA  1 
ATOM   8050  C  C   . CYS B  1  376 ? 12.573  34.846  -2.450  1.00 59.54 ? 404  CYS B C   1 
ATOM   8051  O  O   . CYS B  1  376 ? 12.154  33.883  -3.095  1.00 60.10 ? 404  CYS B O   1 
ATOM   8052  C  CB  . CYS B  1  376 ? 12.581  37.011  -3.698  1.00 59.47 ? 404  CYS B CB  1 
ATOM   8053  S  SG  . CYS B  1  376 ? 13.456  38.369  -4.544  1.00 59.86 ? 404  CYS B SG  1 
ATOM   8054  N  N   . PRO B  1  377 ? 12.279  35.019  -1.148  1.00 58.77 ? 405  PRO B N   1 
ATOM   8055  C  CA  . PRO B  1  377 ? 11.425  34.070  -0.429  1.00 61.01 ? 405  PRO B CA  1 
ATOM   8056  C  C   . PRO B  1  377 ? 10.168  33.750  -1.240  1.00 61.46 ? 405  PRO B C   1 
ATOM   8057  O  O   . PRO B  1  377 ? 9.512   34.641  -1.773  1.00 60.42 ? 405  PRO B O   1 
ATOM   8058  C  CB  . PRO B  1  377 ? 11.136  34.802  0.871   1.00 61.07 ? 405  PRO B CB  1 
ATOM   8059  C  CG  . PRO B  1  377 ? 12.440  35.484  1.134   1.00 60.57 ? 405  PRO B CG  1 
ATOM   8060  C  CD  . PRO B  1  377 ? 12.783  36.057  -0.231  1.00 59.96 ? 405  PRO B CD  1 
ATOM   8061  N  N   . TYR B  1  378 ? 9.846   32.465  -1.321  1.00 62.72 ? 406  TYR B N   1 
ATOM   8062  C  CA  . TYR B  1  378 ? 8.718   31.989  -2.107  1.00 63.87 ? 406  TYR B CA  1 
ATOM   8063  C  C   . TYR B  1  378 ? 7.395   32.742  -1.980  1.00 63.83 ? 406  TYR B C   1 
ATOM   8064  O  O   . TYR B  1  378 ? 6.525   32.648  -2.855  1.00 62.05 ? 406  TYR B O   1 
ATOM   8065  C  CB  . TYR B  1  378 ? 8.493   30.501  -1.823  1.00 64.72 ? 406  TYR B CB  1 
ATOM   8066  C  CG  . TYR B  1  378 ? 8.478   29.653  -3.082  1.00 66.81 ? 406  TYR B CG  1 
ATOM   8067  C  CD1 . TYR B  1  378 ? 9.478   28.692  -3.328  1.00 66.10 ? 406  TYR B CD1 1 
ATOM   8068  C  CD2 . TYR B  1  378 ? 7.466   29.823  -4.045  1.00 67.86 ? 406  TYR B CD2 1 
ATOM   8069  C  CE1 . TYR B  1  378 ? 9.469   27.915  -4.514  1.00 67.44 ? 406  TYR B CE1 1 
ATOM   8070  C  CE2 . TYR B  1  378 ? 7.440   29.055  -5.233  1.00 68.89 ? 406  TYR B CE2 1 
ATOM   8071  C  CZ  . TYR B  1  378 ? 8.440   28.102  -5.467  1.00 69.45 ? 406  TYR B CZ  1 
ATOM   8072  O  OH  . TYR B  1  378 ? 8.392   27.336  -6.631  1.00 68.10 ? 406  TYR B OH  1 
ATOM   8073  N  N   . LEU B  1  379 ? 7.241   33.492  -0.900  1.00 64.38 ? 407  LEU B N   1 
ATOM   8074  C  CA  . LEU B  1  379 ? 6.007   34.232  -0.680  1.00 64.23 ? 407  LEU B CA  1 
ATOM   8075  C  C   . LEU B  1  379 ? 6.275   35.723  -0.556  1.00 63.53 ? 407  LEU B C   1 
ATOM   8076  O  O   . LEU B  1  379 ? 5.731   36.404  0.310   1.00 63.91 ? 407  LEU B O   1 
ATOM   8077  C  CB  . LEU B  1  379 ? 5.299   33.687  0.573   1.00 65.41 ? 407  LEU B CB  1 
ATOM   8078  C  CG  . LEU B  1  379 ? 4.932   32.189  0.470   1.00 65.66 ? 407  LEU B CG  1 
ATOM   8079  C  CD1 . LEU B  1  379 ? 4.611   31.609  1.852   1.00 64.56 ? 407  LEU B CD1 1 
ATOM   8080  C  CD2 . LEU B  1  379 ? 3.761   32.015  -0.501  1.00 64.31 ? 407  LEU B CD2 1 
ATOM   8081  N  N   . ALA B  1  380 ? 7.136   36.219  -1.431  1.00 63.23 ? 408  ALA B N   1 
ATOM   8082  C  CA  . ALA B  1  380 ? 7.469   37.631  -1.451  1.00 63.38 ? 408  ALA B CA  1 
ATOM   8083  C  C   . ALA B  1  380 ? 6.615   38.243  -2.539  1.00 63.08 ? 408  ALA B C   1 
ATOM   8084  O  O   . ALA B  1  380 ? 6.044   37.530  -3.358  1.00 63.38 ? 408  ALA B O   1 
ATOM   8085  C  CB  . ALA B  1  380 ? 8.949   37.830  -1.783  1.00 62.08 ? 408  ALA B CB  1 
ATOM   8086  N  N   . THR B  1  381 ? 6.513   39.563  -2.537  1.00 63.29 ? 409  THR B N   1 
ATOM   8087  C  CA  . THR B  1  381 ? 5.755   40.260  -3.567  1.00 63.64 ? 409  THR B CA  1 
ATOM   8088  C  C   . THR B  1  381 ? 6.752   40.500  -4.703  1.00 63.93 ? 409  THR B C   1 
ATOM   8089  O  O   . THR B  1  381 ? 7.927   40.754  -4.437  1.00 64.74 ? 409  THR B O   1 
ATOM   8090  C  CB  . THR B  1  381 ? 5.228   41.618  -3.053  1.00 62.93 ? 409  THR B CB  1 
ATOM   8091  O  OG1 . THR B  1  381 ? 4.281   41.396  -2.001  1.00 62.65 ? 409  THR B OG1 1 
ATOM   8092  C  CG2 . THR B  1  381 ? 4.562   42.397  -4.175  1.00 62.62 ? 409  THR B CG2 1 
ATOM   8093  N  N   . TYR B  1  382 ? 6.302   40.400  -5.954  1.00 62.84 ? 410  TYR B N   1 
ATOM   8094  C  CA  . TYR B  1  382 ? 7.186   40.614  -7.094  1.00 62.13 ? 410  TYR B CA  1 
ATOM   8095  C  C   . TYR B  1  382 ? 6.619   41.658  -8.042  1.00 63.55 ? 410  TYR B C   1 
ATOM   8096  O  O   . TYR B  1  382 ? 5.457   41.579  -8.445  1.00 64.20 ? 410  TYR B O   1 
ATOM   8097  C  CB  . TYR B  1  382 ? 7.416   39.304  -7.844  1.00 61.35 ? 410  TYR B CB  1 
ATOM   8098  C  CG  . TYR B  1  382 ? 8.142   38.249  -7.033  1.00 60.57 ? 410  TYR B CG  1 
ATOM   8099  C  CD1 . TYR B  1  382 ? 7.510   37.593  -5.976  1.00 60.16 ? 410  TYR B CD1 1 
ATOM   8100  C  CD2 . TYR B  1  382 ? 9.464   37.909  -7.320  1.00 59.87 ? 410  TYR B CD2 1 
ATOM   8101  C  CE1 . TYR B  1  382 ? 8.173   36.630  -5.229  1.00 59.76 ? 410  TYR B CE1 1 
ATOM   8102  C  CE2 . TYR B  1  382 ? 10.135  36.946  -6.577  1.00 59.54 ? 410  TYR B CE2 1 
ATOM   8103  C  CZ  . TYR B  1  382 ? 9.486   36.309  -5.533  1.00 59.97 ? 410  TYR B CZ  1 
ATOM   8104  O  OH  . TYR B  1  382 ? 10.145  35.351  -4.792  1.00 60.65 ? 410  TYR B OH  1 
ATOM   8105  N  N   . VAL B  1  383 ? 7.454   42.628  -8.406  1.00 63.90 ? 411  VAL B N   1 
ATOM   8106  C  CA  . VAL B  1  383 ? 7.039   43.718  -9.283  1.00 63.98 ? 411  VAL B CA  1 
ATOM   8107  C  C   . VAL B  1  383 ? 7.700   43.689  -10.660 1.00 63.66 ? 411  VAL B C   1 
ATOM   8108  O  O   . VAL B  1  383 ? 8.820   43.207  -10.809 1.00 63.89 ? 411  VAL B O   1 
ATOM   8109  C  CB  . VAL B  1  383 ? 7.331   45.065  -8.601  1.00 63.17 ? 411  VAL B CB  1 
ATOM   8110  C  CG1 . VAL B  1  383 ? 6.915   46.221  -9.488  1.00 64.27 ? 411  VAL B CG1 1 
ATOM   8111  C  CG2 . VAL B  1  383 ? 6.593   45.124  -7.290  1.00 62.51 ? 411  VAL B CG2 1 
ATOM   8112  N  N   . ASP B  1  384 ? 6.996   44.217  -11.659 1.00 64.01 ? 412  ASP B N   1 
ATOM   8113  C  CA  . ASP B  1  384 ? 7.492   44.262  -13.033 1.00 64.33 ? 412  ASP B CA  1 
ATOM   8114  C  C   . ASP B  1  384 ? 8.219   45.576  -13.363 1.00 65.05 ? 412  ASP B C   1 
ATOM   8115  O  O   . ASP B  1  384 ? 8.124   46.556  -12.621 1.00 65.27 ? 412  ASP B O   1 
ATOM   8116  C  CB  . ASP B  1  384 ? 6.327   44.056  -14.020 1.00 66.52 ? 412  ASP B CB  1 
ATOM   8117  C  CG  . ASP B  1  384 ? 5.623   42.692  -13.844 1.00 68.28 ? 412  ASP B CG  1 
ATOM   8118  O  OD1 . ASP B  1  384 ? 6.320   41.663  -13.648 1.00 66.92 ? 412  ASP B OD1 1 
ATOM   8119  O  OD2 . ASP B  1  384 ? 4.369   42.650  -13.922 1.00 67.64 ? 412  ASP B OD2 1 
ATOM   8120  N  N   . TRP B  1  385 ? 8.952   45.588  -14.477 1.00 65.74 ? 413  TRP B N   1 
ATOM   8121  C  CA  . TRP B  1  385 ? 9.685   46.780  -14.908 1.00 65.34 ? 413  TRP B CA  1 
ATOM   8122  C  C   . TRP B  1  385 ? 9.611   46.989  -16.413 1.00 65.48 ? 413  TRP B C   1 
ATOM   8123  O  O   . TRP B  1  385 ? 10.180  46.219  -17.188 1.00 64.84 ? 413  TRP B O   1 
ATOM   8124  C  CB  . TRP B  1  385 ? 11.155  46.707  -14.506 1.00 64.53 ? 413  TRP B CB  1 
ATOM   8125  C  CG  . TRP B  1  385 ? 11.871  48.012  -14.728 1.00 64.61 ? 413  TRP B CG  1 
ATOM   8126  C  CD1 . TRP B  1  385 ? 11.555  49.222  -14.171 1.00 63.85 ? 413  TRP B CD1 1 
ATOM   8127  C  CD2 . TRP B  1  385 ? 13.046  48.233  -15.525 1.00 64.34 ? 413  TRP B CD2 1 
ATOM   8128  N  NE1 . TRP B  1  385 ? 12.461  50.176  -14.564 1.00 63.80 ? 413  TRP B NE1 1 
ATOM   8129  C  CE2 . TRP B  1  385 ? 13.388  49.598  -15.394 1.00 64.23 ? 413  TRP B CE2 1 
ATOM   8130  C  CE3 . TRP B  1  385 ? 13.843  47.412  -16.334 1.00 63.88 ? 413  TRP B CE3 1 
ATOM   8131  C  CZ2 . TRP B  1  385 ? 14.503  50.162  -16.044 1.00 63.97 ? 413  TRP B CZ2 1 
ATOM   8132  C  CZ3 . TRP B  1  385 ? 14.950  47.976  -16.980 1.00 64.30 ? 413  TRP B CZ3 1 
ATOM   8133  C  CH2 . TRP B  1  385 ? 15.267  49.337  -16.828 1.00 62.96 ? 413  TRP B CH2 1 
ATOM   8134  N  N   . HIS B  1  386 ? 8.924   48.054  -16.810 1.00 66.55 ? 414  HIS B N   1 
ATOM   8135  C  CA  . HIS B  1  386 ? 8.743   48.398  -18.214 1.00 66.34 ? 414  HIS B CA  1 
ATOM   8136  C  C   . HIS B  1  386 ? 9.894   49.265  -18.691 1.00 66.13 ? 414  HIS B C   1 
ATOM   8137  O  O   . HIS B  1  386 ? 10.262  50.232  -18.025 1.00 66.65 ? 414  HIS B O   1 
ATOM   8138  C  CB  . HIS B  1  386 ? 7.426   49.144  -18.373 1.00 68.80 ? 414  HIS B CB  1 
ATOM   8139  C  CG  . HIS B  1  386 ? 6.308   48.541  -17.586 1.00 71.17 ? 414  HIS B CG  1 
ATOM   8140  N  ND1 . HIS B  1  386 ? 5.719   47.345  -17.930 1.00 70.81 ? 414  HIS B ND1 1 
ATOM   8141  C  CD2 . HIS B  1  386 ? 5.712   48.940  -16.438 1.00 71.48 ? 414  HIS B CD2 1 
ATOM   8142  C  CE1 . HIS B  1  386 ? 4.808   47.032  -17.028 1.00 71.82 ? 414  HIS B CE1 1 
ATOM   8143  N  NE2 . HIS B  1  386 ? 4.785   47.984  -16.113 1.00 72.51 ? 414  HIS B NE2 1 
ATOM   8144  N  N   . PHE B  1  387 ? 10.450  48.929  -19.849 1.00 65.24 ? 415  PHE B N   1 
ATOM   8145  C  CA  . PHE B  1  387 ? 11.573  49.682  -20.378 1.00 65.46 ? 415  PHE B CA  1 
ATOM   8146  C  C   . PHE B  1  387 ? 11.501  49.900  -21.882 1.00 64.83 ? 415  PHE B C   1 
ATOM   8147  O  O   . PHE B  1  387 ? 10.834  49.161  -22.595 1.00 64.91 ? 415  PHE B O   1 
ATOM   8148  C  CB  . PHE B  1  387 ? 12.867  48.956  -20.032 1.00 65.73 ? 415  PHE B CB  1 
ATOM   8149  C  CG  . PHE B  1  387 ? 13.035  47.662  -20.756 1.00 64.77 ? 415  PHE B CG  1 
ATOM   8150  C  CD1 . PHE B  1  387 ? 13.610  47.630  -22.022 1.00 64.84 ? 415  PHE B CD1 1 
ATOM   8151  C  CD2 . PHE B  1  387 ? 12.589  46.476  -20.189 1.00 65.38 ? 415  PHE B CD2 1 
ATOM   8152  C  CE1 . PHE B  1  387 ? 13.738  46.435  -22.716 1.00 64.74 ? 415  PHE B CE1 1 
ATOM   8153  C  CE2 . PHE B  1  387 ? 12.711  45.270  -20.875 1.00 65.29 ? 415  PHE B CE2 1 
ATOM   8154  C  CZ  . PHE B  1  387 ? 13.288  45.252  -22.144 1.00 64.89 ? 415  PHE B CZ  1 
ATOM   8155  N  N   . LEU B  1  388 ? 12.210  50.921  -22.351 1.00 65.46 ? 416  LEU B N   1 
ATOM   8156  C  CA  . LEU B  1  388 ? 12.252  51.262  -23.769 1.00 66.25 ? 416  LEU B CA  1 
ATOM   8157  C  C   . LEU B  1  388 ? 13.694  51.613  -24.105 1.00 65.97 ? 416  LEU B C   1 
ATOM   8158  O  O   . LEU B  1  388 ? 14.072  52.785  -24.119 1.00 65.61 ? 416  LEU B O   1 
ATOM   8159  C  CB  . LEU B  1  388 ? 11.339  52.457  -24.043 1.00 66.69 ? 416  LEU B CB  1 
ATOM   8160  C  CG  . LEU B  1  388 ? 11.082  52.869  -25.492 1.00 65.72 ? 416  LEU B CG  1 
ATOM   8161  C  CD1 . LEU B  1  388 ? 10.540  51.705  -26.283 1.00 65.90 ? 416  LEU B CD1 1 
ATOM   8162  C  CD2 . LEU B  1  388 ? 10.096  54.013  -25.508 1.00 65.53 ? 416  LEU B CD2 1 
ATOM   8163  N  N   . LEU B  1  389 ? 14.487  50.577  -24.374 1.00 66.95 ? 417  LEU B N   1 
ATOM   8164  C  CA  . LEU B  1  389 ? 15.913  50.715  -24.669 1.00 66.66 ? 417  LEU B CA  1 
ATOM   8165  C  C   . LEU B  1  389 ? 16.275  49.873  -25.887 1.00 66.78 ? 417  LEU B C   1 
ATOM   8166  O  O   . LEU B  1  389 ? 15.998  48.668  -25.921 1.00 65.51 ? 417  LEU B O   1 
ATOM   8167  C  CB  . LEU B  1  389 ? 16.713  50.229  -23.463 1.00 66.46 ? 417  LEU B CB  1 
ATOM   8168  C  CG  . LEU B  1  389 ? 16.031  50.549  -22.131 1.00 65.42 ? 417  LEU B CG  1 
ATOM   8169  C  CD1 . LEU B  1  389 ? 16.512  49.624  -21.026 1.00 64.03 ? 417  LEU B CD1 1 
ATOM   8170  C  CD2 . LEU B  1  389 ? 16.279  52.009  -21.808 1.00 65.97 ? 417  LEU B CD2 1 
ATOM   8171  N  N   . GLU B  1  390 ? 16.918  50.502  -26.869 1.00 67.09 ? 418  GLU B N   1 
ATOM   8172  C  CA  . GLU B  1  390 ? 17.288  49.814  -28.102 1.00 68.02 ? 418  GLU B CA  1 
ATOM   8173  C  C   . GLU B  1  390 ? 16.079  49.011  -28.588 1.00 68.24 ? 418  GLU B C   1 
ATOM   8174  O  O   . GLU B  1  390 ? 16.100  47.779  -28.586 1.00 68.20 ? 418  GLU B O   1 
ATOM   8175  C  CB  . GLU B  1  390 ? 18.463  48.865  -27.870 1.00 67.15 ? 418  GLU B CB  1 
ATOM   8176  C  CG  . GLU B  1  390 ? 19.749  49.534  -27.473 1.00 66.91 ? 418  GLU B CG  1 
ATOM   8177  C  CD  . GLU B  1  390 ? 20.931  48.650  -27.771 1.00 67.23 ? 418  GLU B CD  1 
ATOM   8178  O  OE1 . GLU B  1  390 ? 21.855  48.560  -26.930 1.00 66.79 ? 418  GLU B OE1 1 
ATOM   8179  O  OE2 . GLU B  1  390 ? 20.927  48.044  -28.863 1.00 67.16 ? 418  GLU B OE2 1 
ATOM   8180  N  N   . SER B  1  391 ? 15.034  49.725  -28.998 1.00 67.93 ? 419  SER B N   1 
ATOM   8181  C  CA  . SER B  1  391 ? 13.791  49.123  -29.462 1.00 67.73 ? 419  SER B CA  1 
ATOM   8182  C  C   . SER B  1  391 ? 12.896  50.333  -29.689 1.00 67.76 ? 419  SER B C   1 
ATOM   8183  O  O   . SER B  1  391 ? 13.326  51.459  -29.427 1.00 67.74 ? 419  SER B O   1 
ATOM   8184  C  CB  . SER B  1  391 ? 13.209  48.220  -28.359 1.00 68.09 ? 419  SER B CB  1 
ATOM   8185  O  OG  . SER B  1  391 ? 12.130  47.423  -28.823 1.00 68.45 ? 419  SER B OG  1 
ATOM   8186  N  N   . GLN B  1  392 ? 11.674  50.111  -30.178 1.00 68.37 ? 420  GLN B N   1 
ATOM   8187  C  CA  . GLN B  1  392 ? 10.715  51.199  -30.422 1.00 68.24 ? 420  GLN B CA  1 
ATOM   8188  C  C   . GLN B  1  392 ? 9.356   50.971  -29.756 1.00 67.36 ? 420  GLN B C   1 
ATOM   8189  O  O   . GLN B  1  392 ? 8.472   51.839  -29.781 1.00 67.33 ? 420  GLN B O   1 
ATOM   8190  C  CB  . GLN B  1  392 ? 10.537  51.440  -31.931 1.00 68.25 ? 420  GLN B CB  1 
ATOM   8191  C  CG  . GLN B  1  392 ? 11.478  52.521  -32.465 1.00 68.64 ? 420  GLN B CG  1 
ATOM   8192  C  CD  . GLN B  1  392 ? 11.300  52.792  -33.940 1.00 68.73 ? 420  GLN B CD  1 
ATOM   8193  O  OE1 . GLN B  1  392 ? 11.942  53.685  -34.506 1.00 70.42 ? 420  GLN B OE1 1 
ATOM   8194  N  NE2 . GLN B  1  392 ? 10.428  52.023  -34.580 1.00 68.17 ? 420  GLN B NE2 1 
ATOM   8195  N  N   . ALA B  1  393 ? 9.208   49.800  -29.150 1.00 65.85 ? 421  ALA B N   1 
ATOM   8196  C  CA  . ALA B  1  393 ? 7.992   49.440  -28.453 1.00 65.35 ? 421  ALA B CA  1 
ATOM   8197  C  C   . ALA B  1  393 ? 8.410   48.978  -27.071 1.00 65.67 ? 421  ALA B C   1 
ATOM   8198  O  O   . ALA B  1  393 ? 9.353   48.197  -26.937 1.00 66.41 ? 421  ALA B O   1 
ATOM   8199  C  CB  . ALA B  1  393 ? 7.282   48.320  -29.187 1.00 67.06 ? 421  ALA B CB  1 
ATOM   8200  N  N   . PRO B  1  394 ? 7.723   49.460  -26.020 1.00 66.02 ? 422  PRO B N   1 
ATOM   8201  C  CA  . PRO B  1  394 ? 8.036   49.086  -24.636 1.00 66.38 ? 422  PRO B CA  1 
ATOM   8202  C  C   . PRO B  1  394 ? 7.904   47.593  -24.286 1.00 65.99 ? 422  PRO B C   1 
ATOM   8203  O  O   . PRO B  1  394 ? 6.906   46.936  -24.620 1.00 65.53 ? 422  PRO B O   1 
ATOM   8204  C  CB  . PRO B  1  394 ? 7.086   49.972  -23.818 1.00 65.97 ? 422  PRO B CB  1 
ATOM   8205  C  CG  . PRO B  1  394 ? 5.924   50.182  -24.741 1.00 65.98 ? 422  PRO B CG  1 
ATOM   8206  C  CD  . PRO B  1  394 ? 6.627   50.446  -26.054 1.00 66.33 ? 422  PRO B CD  1 
ATOM   8207  N  N   . LYS B  1  395 ? 8.931   47.073  -23.616 1.00 64.81 ? 423  LYS B N   1 
ATOM   8208  C  CA  . LYS B  1  395 ? 8.961   45.682  -23.188 1.00 64.64 ? 423  LYS B CA  1 
ATOM   8209  C  C   . LYS B  1  395 ? 8.959   45.661  -21.670 1.00 63.73 ? 423  LYS B C   1 
ATOM   8210  O  O   . LYS B  1  395 ? 9.180   46.685  -21.031 1.00 62.66 ? 423  LYS B O   1 
ATOM   8211  C  CB  . LYS B  1  395 ? 10.213  44.983  -23.710 1.00 65.51 ? 423  LYS B CB  1 
ATOM   8212  C  CG  . LYS B  1  395 ? 10.331  44.980  -25.215 1.00 67.09 ? 423  LYS B CG  1 
ATOM   8213  C  CD  . LYS B  1  395 ? 11.592  44.266  -25.671 1.00 67.74 ? 423  LYS B CD  1 
ATOM   8214  C  CE  . LYS B  1  395 ? 11.679  44.282  -27.184 1.00 68.46 ? 423  LYS B CE  1 
ATOM   8215  N  NZ  . LYS B  1  395 ? 10.411  43.795  -27.799 1.00 69.36 ? 423  LYS B NZ  1 
ATOM   8216  N  N   . THR B  1  396 ? 8.730   44.489  -21.093 1.00 63.99 ? 424  THR B N   1 
ATOM   8217  C  CA  . THR B  1  396 ? 8.670   44.369  -19.645 1.00 63.89 ? 424  THR B CA  1 
ATOM   8218  C  C   . THR B  1  396 ? 9.545   43.255  -19.089 1.00 63.92 ? 424  THR B C   1 
ATOM   8219  O  O   . THR B  1  396 ? 9.722   42.225  -19.733 1.00 64.40 ? 424  THR B O   1 
ATOM   8220  C  CB  . THR B  1  396 ? 7.214   44.077  -19.187 1.00 63.65 ? 424  THR B CB  1 
ATOM   8221  O  OG1 . THR B  1  396 ? 6.312   44.947  -19.883 1.00 65.07 ? 424  THR B OG1 1 
ATOM   8222  C  CG2 . THR B  1  396 ? 7.060   44.288  -17.677 1.00 63.42 ? 424  THR B CG2 1 
ATOM   8223  N  N   . ILE B  1  397 ? 10.105  43.479  -17.901 1.00 63.89 ? 425  ILE B N   1 
ATOM   8224  C  CA  . ILE B  1  397 ? 10.883  42.457  -17.215 1.00 63.72 ? 425  ILE B CA  1 
ATOM   8225  C  C   . ILE B  1  397 ? 9.988   42.061  -16.049 1.00 63.70 ? 425  ILE B C   1 
ATOM   8226  O  O   . ILE B  1  397 ? 9.712   42.878  -15.181 1.00 64.30 ? 425  ILE B O   1 
ATOM   8227  C  CB  . ILE B  1  397 ? 12.185  42.987  -16.622 1.00 63.30 ? 425  ILE B CB  1 
ATOM   8228  C  CG1 . ILE B  1  397 ? 13.108  43.466  -17.738 1.00 63.65 ? 425  ILE B CG1 1 
ATOM   8229  C  CG2 . ILE B  1  397 ? 12.844  41.895  -15.775 1.00 61.51 ? 425  ILE B CG2 1 
ATOM   8230  C  CD1 . ILE B  1  397 ? 14.422  44.051  -17.230 1.00 64.08 ? 425  ILE B CD1 1 
ATOM   8231  N  N   . ARG B  1  398 ? 9.507   40.828  -16.033 1.00 64.04 ? 426  ARG B N   1 
ATOM   8232  C  CA  . ARG B  1  398 ? 8.657   40.393  -14.936 1.00 64.75 ? 426  ARG B CA  1 
ATOM   8233  C  C   . ARG B  1  398 ? 9.511   40.081  -13.703 1.00 65.82 ? 426  ARG B C   1 
ATOM   8234  O  O   . ARG B  1  398 ? 10.600  39.504  -13.813 1.00 65.58 ? 426  ARG B O   1 
ATOM   8235  C  CB  . ARG B  1  398 ? 7.871   39.137  -15.326 1.00 66.64 ? 426  ARG B CB  1 
ATOM   8236  C  CG  . ARG B  1  398 ? 6.770   39.344  -16.344 1.00 68.17 ? 426  ARG B CG  1 
ATOM   8237  C  CD  . ARG B  1  398 ? 6.106   38.013  -16.677 1.00 69.77 ? 426  ARG B CD  1 
ATOM   8238  N  NE  . ARG B  1  398 ? 5.005   38.171  -17.627 1.00 73.52 ? 426  ARG B NE  1 
ATOM   8239  C  CZ  . ARG B  1  398 ? 4.367   37.159  -18.219 1.00 75.41 ? 426  ARG B CZ  1 
ATOM   8240  N  NH1 . ARG B  1  398 ? 4.724   35.901  -17.957 1.00 75.03 ? 426  ARG B NH1 1 
ATOM   8241  N  NH2 . ARG B  1  398 ? 3.368   37.402  -19.074 1.00 75.67 ? 426  ARG B NH2 1 
ATOM   8242  N  N   . ASP B  1  399 ? 9.015   40.477  -12.533 1.00 65.75 ? 427  ASP B N   1 
ATOM   8243  C  CA  . ASP B  1  399 ? 9.699   40.213  -11.272 1.00 64.23 ? 427  ASP B CA  1 
ATOM   8244  C  C   . ASP B  1  399 ? 11.086  40.844  -11.193 1.00 63.27 ? 427  ASP B C   1 
ATOM   8245  O  O   . ASP B  1  399 ? 12.026  40.237  -10.682 1.00 63.70 ? 427  ASP B O   1 
ATOM   8246  C  CB  . ASP B  1  399 ? 9.770   38.699  -11.067 1.00 63.85 ? 427  ASP B CB  1 
ATOM   8247  C  CG  . ASP B  1  399 ? 8.440   38.017  -11.372 1.00 64.50 ? 427  ASP B CG  1 
ATOM   8248  O  OD1 . ASP B  1  399 ? 7.737   37.577  -10.433 1.00 64.60 ? 427  ASP B OD1 1 
ATOM   8249  O  OD2 . ASP B  1  399 ? 8.067   37.928  -12.563 1.00 63.90 ? 427  ASP B OD2 1 
ATOM   8250  N  N   . ALA B  1  400 ? 11.190  42.072  -11.698 1.00 62.26 ? 428  ALA B N   1 
ATOM   8251  C  CA  . ALA B  1  400 ? 12.433  42.830  -11.692 1.00 62.94 ? 428  ALA B CA  1 
ATOM   8252  C  C   . ALA B  1  400 ? 12.817  43.090  -10.242 1.00 62.93 ? 428  ALA B C   1 
ATOM   8253  O  O   . ALA B  1  400 ? 13.996  42.996  -9.871  1.00 62.92 ? 428  ALA B O   1 
ATOM   8254  C  CB  . ALA B  1  400 ? 12.239  44.142  -12.432 1.00 62.73 ? 428  ALA B CB  1 
ATOM   8255  N  N   . PHE B  1  401 ? 11.808  43.433  -9.438  1.00 61.92 ? 429  PHE B N   1 
ATOM   8256  C  CA  . PHE B  1  401 ? 11.989  43.680  -8.009  1.00 61.03 ? 429  PHE B CA  1 
ATOM   8257  C  C   . PHE B  1  401 ? 11.104  42.752  -7.201  1.00 60.35 ? 429  PHE B C   1 
ATOM   8258  O  O   . PHE B  1  401 ? 10.100  42.242  -7.691  1.00 60.80 ? 429  PHE B O   1 
ATOM   8259  C  CB  . PHE B  1  401 ? 11.558  45.079  -7.576  1.00 60.99 ? 429  PHE B CB  1 
ATOM   8260  C  CG  . PHE B  1  401 ? 11.903  46.156  -8.522  1.00 60.57 ? 429  PHE B CG  1 
ATOM   8261  C  CD1 . PHE B  1  401 ? 11.085  46.417  -9.608  1.00 60.88 ? 429  PHE B CD1 1 
ATOM   8262  C  CD2 . PHE B  1  401 ? 13.015  46.963  -8.291  1.00 61.29 ? 429  PHE B CD2 1 
ATOM   8263  C  CE1 . PHE B  1  401 ? 11.364  47.476  -10.455 1.00 62.58 ? 429  PHE B CE1 1 
ATOM   8264  C  CE2 . PHE B  1  401 ? 13.310  48.027  -9.127  1.00 61.39 ? 429  PHE B CE2 1 
ATOM   8265  C  CZ  . PHE B  1  401 ? 12.484  48.289  -10.214 1.00 62.31 ? 429  PHE B CZ  1 
ATOM   8266  N  N   . CYS B  1  402 ? 11.468  42.580  -5.939  1.00 58.85 ? 430  CYS B N   1 
ATOM   8267  C  CA  . CYS B  1  402 ? 10.695  41.772  -5.025  1.00 58.65 ? 430  CYS B CA  1 
ATOM   8268  C  C   . CYS B  1  402 ? 10.809  42.436  -3.667  1.00 58.72 ? 430  CYS B C   1 
ATOM   8269  O  O   . CYS B  1  402 ? 11.900  42.791  -3.234  1.00 59.70 ? 430  CYS B O   1 
ATOM   8270  C  CB  . CYS B  1  402 ? 11.224  40.340  -4.958  1.00 59.42 ? 430  CYS B CB  1 
ATOM   8271  S  SG  . CYS B  1  402 ? 12.602  40.051  -3.811  1.00 57.88 ? 430  CYS B SG  1 
ATOM   8272  N  N   . VAL B  1  403 ? 9.676   42.629  -3.008  1.00 57.96 ? 431  VAL B N   1 
ATOM   8273  C  CA  . VAL B  1  403 ? 9.666   43.246  -1.701  1.00 57.66 ? 431  VAL B CA  1 
ATOM   8274  C  C   . VAL B  1  403 ? 9.091   42.221  -0.741  1.00 57.39 ? 431  VAL B C   1 
ATOM   8275  O  O   . VAL B  1  403 ? 8.131   41.541  -1.067  1.00 57.91 ? 431  VAL B O   1 
ATOM   8276  C  CB  . VAL B  1  403 ? 8.822   44.522  -1.724  1.00 56.55 ? 431  VAL B CB  1 
ATOM   8277  C  CG1 . VAL B  1  403 ? 8.741   45.118  -0.351  1.00 56.98 ? 431  VAL B CG1 1 
ATOM   8278  C  CG2 . VAL B  1  403 ? 9.442   45.517  -2.673  1.00 55.48 ? 431  VAL B CG2 1 
ATOM   8279  N  N   . PHE B  1  404 ? 9.689   42.092  0.436   1.00 57.65 ? 432  PHE B N   1 
ATOM   8280  C  CA  . PHE B  1  404 ? 9.217   41.110  1.403   1.00 58.08 ? 432  PHE B CA  1 
ATOM   8281  C  C   . PHE B  1  404 ? 9.761   41.362  2.814   1.00 58.76 ? 432  PHE B C   1 
ATOM   8282  O  O   . PHE B  1  404 ? 10.631  42.207  3.013   1.00 58.78 ? 432  PHE B O   1 
ATOM   8283  C  CB  . PHE B  1  404 ? 9.651   39.728  0.941   1.00 58.44 ? 432  PHE B CB  1 
ATOM   8284  C  CG  . PHE B  1  404 ? 11.138  39.548  0.931   1.00 58.91 ? 432  PHE B CG  1 
ATOM   8285  C  CD1 . PHE B  1  404 ? 11.805  39.121  2.073   1.00 59.23 ? 432  PHE B CD1 1 
ATOM   8286  C  CD2 . PHE B  1  404 ? 11.881  39.868  -0.197  1.00 59.04 ? 432  PHE B CD2 1 
ATOM   8287  C  CE1 . PHE B  1  404 ? 13.189  39.018  2.094   1.00 59.79 ? 432  PHE B CE1 1 
ATOM   8288  C  CE2 . PHE B  1  404 ? 13.268  39.770  -0.188  1.00 59.01 ? 432  PHE B CE2 1 
ATOM   8289  C  CZ  . PHE B  1  404 ? 13.923  39.345  0.959   1.00 59.70 ? 432  PHE B CZ  1 
ATOM   8290  N  N   . GLU B  1  405 ? 9.239   40.611  3.781   1.00 58.26 ? 433  GLU B N   1 
ATOM   8291  C  CA  . GLU B  1  405 ? 9.656   40.701  5.179   1.00 58.13 ? 433  GLU B CA  1 
ATOM   8292  C  C   . GLU B  1  405 ? 10.404  39.439  5.558   1.00 58.73 ? 433  GLU B C   1 
ATOM   8293  O  O   . GLU B  1  405 ? 9.899   38.331  5.391   1.00 59.24 ? 433  GLU B O   1 
ATOM   8294  C  CB  . GLU B  1  405 ? 8.456   40.827  6.101   1.00 59.65 ? 433  GLU B CB  1 
ATOM   8295  C  CG  . GLU B  1  405 ? 7.882   42.211  6.236   1.00 61.22 ? 433  GLU B CG  1 
ATOM   8296  C  CD  . GLU B  1  405 ? 6.879   42.275  7.372   1.00 63.38 ? 433  GLU B CD  1 
ATOM   8297  O  OE1 . GLU B  1  405 ? 5.804   41.628  7.242   1.00 64.78 ? 433  GLU B OE1 1 
ATOM   8298  O  OE2 . GLU B  1  405 ? 7.177   42.956  8.392   1.00 63.07 ? 433  GLU B OE2 1 
ATOM   8299  N  N   . GLN B  1  406 ? 11.602  39.607  6.097   1.00 59.39 ? 434  GLN B N   1 
ATOM   8300  C  CA  . GLN B  1  406 ? 12.418  38.463  6.464   1.00 59.60 ? 434  GLN B CA  1 
ATOM   8301  C  C   . GLN B  1  406 ? 12.718  38.443  7.962   1.00 58.97 ? 434  GLN B C   1 
ATOM   8302  O  O   . GLN B  1  406 ? 13.304  39.378  8.517   1.00 58.95 ? 434  GLN B O   1 
ATOM   8303  C  CB  . GLN B  1  406 ? 13.716  38.484  5.634   1.00 58.69 ? 434  GLN B CB  1 
ATOM   8304  C  CG  . GLN B  1  406 ? 14.670  37.305  5.825   1.00 59.93 ? 434  GLN B CG  1 
ATOM   8305  C  CD  . GLN B  1  406 ? 14.106  35.973  5.341   1.00 61.23 ? 434  GLN B CD  1 
ATOM   8306  O  OE1 . GLN B  1  406 ? 13.408  35.914  4.326   1.00 61.75 ? 434  GLN B OE1 1 
ATOM   8307  N  NE2 . GLN B  1  406 ? 14.430  34.890  6.057   1.00 60.67 ? 434  GLN B NE2 1 
ATOM   8308  N  N   . ASN B  1  407 ? 12.277  37.381  8.624   1.00 58.76 ? 435  ASN B N   1 
ATOM   8309  C  CA  . ASN B  1  407 ? 12.533  37.239  10.040  1.00 57.82 ? 435  ASN B CA  1 
ATOM   8310  C  C   . ASN B  1  407 ? 13.961  36.713  10.139  1.00 58.95 ? 435  ASN B C   1 
ATOM   8311  O  O   . ASN B  1  407 ? 14.249  35.560  9.801   1.00 59.23 ? 435  ASN B O   1 
ATOM   8312  C  CB  . ASN B  1  407 ? 11.566  36.250  10.653  1.00 57.31 ? 435  ASN B CB  1 
ATOM   8313  C  CG  . ASN B  1  407 ? 11.495  36.391  12.136  1.00 57.75 ? 435  ASN B CG  1 
ATOM   8314  O  OD1 . ASN B  1  407 ? 12.521  36.372  12.829  1.00 57.75 ? 435  ASN B OD1 1 
ATOM   8315  N  ND2 . ASN B  1  407 ? 10.282  36.547  12.647  1.00 57.21 ? 435  ASN B ND2 1 
ATOM   8316  N  N   . GLN B  1  408 ? 14.851  37.577  10.606  1.00 57.50 ? 436  GLN B N   1 
ATOM   8317  C  CA  . GLN B  1  408 ? 16.274  37.277  10.714  1.00 56.50 ? 436  GLN B CA  1 
ATOM   8318  C  C   . GLN B  1  408 ? 16.723  36.069  11.525  1.00 56.32 ? 436  GLN B C   1 
ATOM   8319  O  O   . GLN B  1  408 ? 17.775  35.489  11.247  1.00 55.45 ? 436  GLN B O   1 
ATOM   8320  C  CB  . GLN B  1  408 ? 16.972  38.516  11.252  1.00 57.95 ? 436  GLN B CB  1 
ATOM   8321  C  CG  . GLN B  1  408 ? 16.585  39.762  10.503  1.00 57.18 ? 436  GLN B CG  1 
ATOM   8322  C  CD  . GLN B  1  408 ? 17.234  39.823  9.145   1.00 57.35 ? 436  GLN B CD  1 
ATOM   8323  O  OE1 . GLN B  1  408 ? 17.245  38.845  8.391   1.00 59.09 ? 436  GLN B OE1 1 
ATOM   8324  N  NE2 . GLN B  1  408 ? 17.786  40.979  8.816   1.00 57.96 ? 436  GLN B NE2 1 
ATOM   8325  N  N   . GLY B  1  409 ? 15.940  35.708  12.537  1.00 57.06 ? 437  GLY B N   1 
ATOM   8326  C  CA  . GLY B  1  409 ? 16.297  34.588  13.395  1.00 56.10 ? 437  GLY B CA  1 
ATOM   8327  C  C   . GLY B  1  409 ? 17.022  35.128  14.610  1.00 54.97 ? 437  GLY B C   1 
ATOM   8328  O  O   . GLY B  1  409 ? 17.066  34.508  15.673  1.00 55.50 ? 437  GLY B O   1 
ATOM   8329  N  N   . LEU B  1  410 ? 17.574  36.322  14.416  1.00 54.94 ? 438  LEU B N   1 
ATOM   8330  C  CA  . LEU B  1  410 ? 18.323  37.076  15.413  1.00 53.33 ? 438  LEU B CA  1 
ATOM   8331  C  C   . LEU B  1  410 ? 17.401  38.138  16.045  1.00 53.37 ? 438  LEU B C   1 
ATOM   8332  O  O   . LEU B  1  410 ? 16.503  38.660  15.387  1.00 54.24 ? 438  LEU B O   1 
ATOM   8333  C  CB  . LEU B  1  410 ? 19.488  37.761  14.702  1.00 54.25 ? 438  LEU B CB  1 
ATOM   8334  C  CG  . LEU B  1  410 ? 20.520  38.558  15.488  1.00 54.80 ? 438  LEU B CG  1 
ATOM   8335  C  CD1 . LEU B  1  410 ? 21.456  37.592  16.202  1.00 54.95 ? 438  LEU B CD1 1 
ATOM   8336  C  CD2 . LEU B  1  410 ? 21.292  39.463  14.536  1.00 54.34 ? 438  LEU B CD2 1 
ATOM   8337  N  N   . PRO B  1  411 ? 17.603  38.461  17.331  1.00 52.37 ? 439  PRO B N   1 
ATOM   8338  C  CA  . PRO B  1  411 ? 16.781  39.462  18.018  1.00 51.91 ? 439  PRO B CA  1 
ATOM   8339  C  C   . PRO B  1  411 ? 17.272  40.878  17.782  1.00 52.94 ? 439  PRO B C   1 
ATOM   8340  O  O   . PRO B  1  411 ? 18.471  41.103  17.635  1.00 53.30 ? 439  PRO B O   1 
ATOM   8341  C  CB  . PRO B  1  411 ? 16.933  39.077  19.470  1.00 52.23 ? 439  PRO B CB  1 
ATOM   8342  C  CG  . PRO B  1  411 ? 18.343  38.628  19.519  1.00 52.17 ? 439  PRO B CG  1 
ATOM   8343  C  CD  . PRO B  1  411 ? 18.441  37.739  18.303  1.00 52.57 ? 439  PRO B CD  1 
ATOM   8344  N  N   . LEU B  1  412 ? 16.347  41.831  17.753  1.00 52.75 ? 440  LEU B N   1 
ATOM   8345  C  CA  . LEU B  1  412 ? 16.710  43.230  17.558  1.00 53.18 ? 440  LEU B CA  1 
ATOM   8346  C  C   . LEU B  1  412 ? 17.371  43.706  18.842  1.00 54.27 ? 440  LEU B C   1 
ATOM   8347  O  O   . LEU B  1  412 ? 18.523  44.156  18.826  1.00 53.95 ? 440  LEU B O   1 
ATOM   8348  C  CB  . LEU B  1  412 ? 15.469  44.077  17.270  1.00 53.40 ? 440  LEU B CB  1 
ATOM   8349  C  CG  . LEU B  1  412 ? 15.698  45.581  17.082  1.00 53.47 ? 440  LEU B CG  1 
ATOM   8350  C  CD1 . LEU B  1  412 ? 16.730  45.830  15.991  1.00 52.96 ? 440  LEU B CD1 1 
ATOM   8351  C  CD2 . LEU B  1  412 ? 14.382  46.254  16.736  1.00 53.52 ? 440  LEU B CD2 1 
ATOM   8352  N  N   . ARG B  1  413 ? 16.624  43.601  19.946  1.00 54.81 ? 441  ARG B N   1 
ATOM   8353  C  CA  . ARG B  1  413 ? 17.091  43.981  21.289  1.00 55.17 ? 441  ARG B CA  1 
ATOM   8354  C  C   . ARG B  1  413 ? 16.797  42.820  22.260  1.00 54.85 ? 441  ARG B C   1 
ATOM   8355  O  O   . ARG B  1  413 ? 15.912  42.008  22.007  1.00 54.95 ? 441  ARG B O   1 
ATOM   8356  C  CB  . ARG B  1  413 ? 16.408  45.291  21.768  1.00 54.74 ? 441  ARG B CB  1 
ATOM   8357  C  CG  . ARG B  1  413 ? 14.872  45.290  21.838  1.00 53.25 ? 441  ARG B CG  1 
ATOM   8358  C  CD  . ARG B  1  413 ? 14.401  45.876  23.168  1.00 53.66 ? 441  ARG B CD  1 
ATOM   8359  N  NE  . ARG B  1  413 ? 12.958  45.776  23.374  1.00 51.93 ? 441  ARG B NE  1 
ATOM   8360  C  CZ  . ARG B  1  413 ? 12.065  46.371  22.594  1.00 52.29 ? 441  ARG B CZ  1 
ATOM   8361  N  NH1 . ARG B  1  413 ? 12.485  47.096  21.571  1.00 52.25 ? 441  ARG B NH1 1 
ATOM   8362  N  NH2 . ARG B  1  413 ? 10.764  46.259  22.837  1.00 53.01 ? 441  ARG B NH2 1 
ATOM   8363  N  N   . ARG B  1  414 ? 17.531  42.728  23.365  1.00 56.73 ? 442  ARG B N   1 
ATOM   8364  C  CA  . ARG B  1  414 ? 17.301  41.621  24.293  1.00 57.48 ? 442  ARG B CA  1 
ATOM   8365  C  C   . ARG B  1  414 ? 18.046  41.718  25.626  1.00 57.57 ? 442  ARG B C   1 
ATOM   8366  O  O   . ARG B  1  414 ? 19.237  42.033  25.669  1.00 58.07 ? 442  ARG B O   1 
ATOM   8367  C  CB  . ARG B  1  414 ? 17.676  40.322  23.588  1.00 56.72 ? 442  ARG B CB  1 
ATOM   8368  C  CG  . ARG B  1  414 ? 17.389  39.079  24.359  1.00 55.87 ? 442  ARG B CG  1 
ATOM   8369  C  CD  . ARG B  1  414 ? 18.527  38.689  25.258  1.00 54.40 ? 442  ARG B CD  1 
ATOM   8370  N  NE  . ARG B  1  414 ? 18.260  37.374  25.825  1.00 53.68 ? 442  ARG B NE  1 
ATOM   8371  C  CZ  . ARG B  1  414 ? 18.991  36.795  26.768  1.00 54.03 ? 442  ARG B CZ  1 
ATOM   8372  N  NH1 . ARG B  1  414 ? 20.055  37.417  27.264  1.00 55.22 ? 442  ARG B NH1 1 
ATOM   8373  N  NH2 . ARG B  1  414 ? 18.650  35.593  27.220  1.00 53.79 ? 442  ARG B NH2 1 
ATOM   8374  N  N   . HIS B  1  415 ? 17.338  41.429  26.714  1.00 58.41 ? 443  HIS B N   1 
ATOM   8375  C  CA  . HIS B  1  415 ? 17.936  41.480  28.045  1.00 59.87 ? 443  HIS B CA  1 
ATOM   8376  C  C   . HIS B  1  415 ? 17.253  40.578  29.066  1.00 59.69 ? 443  HIS B C   1 
ATOM   8377  O  O   . HIS B  1  415 ? 16.092  40.789  29.420  1.00 58.48 ? 443  HIS B O   1 
ATOM   8378  C  CB  . HIS B  1  415 ? 17.943  42.910  28.592  1.00 59.05 ? 443  HIS B CB  1 
ATOM   8379  C  CG  . HIS B  1  415 ? 18.616  43.029  29.923  1.00 58.11 ? 443  HIS B CG  1 
ATOM   8380  N  ND1 . HIS B  1  415 ? 19.918  42.628  30.134  1.00 58.62 ? 443  HIS B ND1 1 
ATOM   8381  C  CD2 . HIS B  1  415 ? 18.161  43.469  31.117  1.00 57.82 ? 443  HIS B CD2 1 
ATOM   8382  C  CE1 . HIS B  1  415 ? 20.234  42.816  31.402  1.00 57.92 ? 443  HIS B CE1 1 
ATOM   8383  N  NE2 . HIS B  1  415 ? 19.186  43.326  32.020  1.00 57.05 ? 443  HIS B NE2 1 
ATOM   8384  N  N   . HIS B  1  416 ? 17.997  39.581  29.541  1.00 60.11 ? 444  HIS B N   1 
ATOM   8385  C  CA  . HIS B  1  416 ? 17.492  38.642  30.533  1.00 60.55 ? 444  HIS B CA  1 
ATOM   8386  C  C   . HIS B  1  416 ? 18.050  39.047  31.888  1.00 61.99 ? 444  HIS B C   1 
ATOM   8387  O  O   . HIS B  1  416 ? 19.267  38.989  32.106  1.00 61.34 ? 444  HIS B O   1 
ATOM   8388  C  CB  . HIS B  1  416 ? 17.940  37.216  30.216  1.00 60.57 ? 444  HIS B CB  1 
ATOM   8389  C  CG  . HIS B  1  416 ? 17.102  36.163  30.874  1.00 61.75 ? 444  HIS B CG  1 
ATOM   8390  N  ND1 . HIS B  1  416 ? 15.967  35.641  30.288  1.00 61.81 ? 444  HIS B ND1 1 
ATOM   8391  C  CD2 . HIS B  1  416 ? 17.213  35.559  32.082  1.00 61.70 ? 444  HIS B CD2 1 
ATOM   8392  C  CE1 . HIS B  1  416 ? 15.416  34.761  31.106  1.00 61.79 ? 444  HIS B CE1 1 
ATOM   8393  N  NE2 . HIS B  1  416 ? 16.152  34.694  32.201  1.00 60.79 ? 444  HIS B NE2 1 
ATOM   8394  N  N   . SER B  1  417 ? 17.157  39.450  32.793  1.00 62.20 ? 445  SER B N   1 
ATOM   8395  C  CA  . SER B  1  417 ? 17.558  39.880  34.122  1.00 61.17 ? 445  SER B CA  1 
ATOM   8396  C  C   . SER B  1  417 ? 17.189  38.903  35.228  1.00 62.27 ? 445  SER B C   1 
ATOM   8397  O  O   . SER B  1  417 ? 16.034  38.491  35.347  1.00 62.00 ? 445  SER B O   1 
ATOM   8398  C  CB  . SER B  1  417 ? 16.950  41.244  34.432  1.00 60.87 ? 445  SER B CB  1 
ATOM   8399  O  OG  . SER B  1  417 ? 17.543  41.806  35.593  1.00 62.19 ? 445  SER B OG  1 
ATOM   8400  N  N   . ASP B  1  418 ? 18.195  38.541  36.026  1.00 64.32 ? 446  ASP B N   1 
ATOM   8401  C  CA  . ASP B  1  418 ? 18.056  37.631  37.173  1.00 64.14 ? 446  ASP B CA  1 
ATOM   8402  C  C   . ASP B  1  418 ? 18.595  38.370  38.407  1.00 64.44 ? 446  ASP B C   1 
ATOM   8403  O  O   . ASP B  1  418 ? 18.445  37.912  39.550  1.00 65.11 ? 446  ASP B O   1 
ATOM   8404  C  CB  . ASP B  1  418 ? 18.879  36.338  36.975  1.00 63.66 ? 446  ASP B CB  1 
ATOM   8405  C  CG  . ASP B  1  418 ? 18.528  35.599  35.694  1.00 64.23 ? 446  ASP B CG  1 
ATOM   8406  O  OD1 . ASP B  1  418 ? 17.326  35.421  35.418  1.00 65.24 ? 446  ASP B OD1 1 
ATOM   8407  O  OD2 . ASP B  1  418 ? 19.455  35.187  34.965  1.00 63.82 ? 446  ASP B OD2 1 
ATOM   8408  N  N   . LEU B  1  419 ? 19.221  39.522  38.150  1.00 64.78 ? 447  LEU B N   1 
ATOM   8409  C  CA  . LEU B  1  419 ? 19.833  40.367  39.178  1.00 63.43 ? 447  LEU B CA  1 
ATOM   8410  C  C   . LEU B  1  419 ? 18.905  41.452  39.713  1.00 63.97 ? 447  LEU B C   1 
ATOM   8411  O  O   . LEU B  1  419 ? 18.443  42.313  38.954  1.00 63.46 ? 447  LEU B O   1 
ATOM   8412  C  CB  . LEU B  1  419 ? 21.088  41.025  38.603  1.00 63.37 ? 447  LEU B CB  1 
ATOM   8413  C  CG  . LEU B  1  419 ? 21.875  42.015  39.458  1.00 63.41 ? 447  LEU B CG  1 
ATOM   8414  C  CD1 . LEU B  1  419 ? 22.527  41.289  40.621  1.00 64.34 ? 447  LEU B CD1 1 
ATOM   8415  C  CD2 . LEU B  1  419 ? 22.920  42.701  38.594  1.00 62.76 ? 447  LEU B CD2 1 
ATOM   8416  N  N   . TYR B  1  420 ? 18.646  41.399  41.021  1.00 64.30 ? 448  TYR B N   1 
ATOM   8417  C  CA  . TYR B  1  420 ? 17.798  42.374  41.728  1.00 64.70 ? 448  TYR B CA  1 
ATOM   8418  C  C   . TYR B  1  420 ? 16.300  42.316  41.412  1.00 64.31 ? 448  TYR B C   1 
ATOM   8419  O  O   . TYR B  1  420 ? 15.464  42.437  42.309  1.00 64.16 ? 448  TYR B O   1 
ATOM   8420  C  CB  . TYR B  1  420 ? 18.322  43.802  41.480  1.00 64.11 ? 448  TYR B CB  1 
ATOM   8421  C  CG  . TYR B  1  420 ? 19.694  44.075  42.080  1.00 64.31 ? 448  TYR B CG  1 
ATOM   8422  C  CD1 . TYR B  1  420 ? 20.555  45.018  41.510  1.00 64.34 ? 448  TYR B CD1 1 
ATOM   8423  C  CD2 . TYR B  1  420 ? 20.127  43.396  43.224  1.00 64.21 ? 448  TYR B CD2 1 
ATOM   8424  C  CE1 . TYR B  1  420 ? 21.819  45.278  42.066  1.00 65.29 ? 448  TYR B CE1 1 
ATOM   8425  C  CE2 . TYR B  1  420 ? 21.381  43.646  43.789  1.00 64.78 ? 448  TYR B CE2 1 
ATOM   8426  C  CZ  . TYR B  1  420 ? 22.226  44.587  43.212  1.00 65.70 ? 448  TYR B CZ  1 
ATOM   8427  O  OH  . TYR B  1  420 ? 23.458  44.842  43.794  1.00 65.41 ? 448  TYR B OH  1 
ATOM   8428  N  N   . SER B  1  421 ? 15.971  42.135  40.138  1.00 63.98 ? 449  SER B N   1 
ATOM   8429  C  CA  . SER B  1  421 ? 14.589  42.072  39.701  1.00 62.88 ? 449  SER B CA  1 
ATOM   8430  C  C   . SER B  1  421 ? 14.532  41.173  38.472  1.00 63.58 ? 449  SER B C   1 
ATOM   8431  O  O   . SER B  1  421 ? 15.075  41.526  37.429  1.00 62.77 ? 449  SER B O   1 
ATOM   8432  C  CB  . SER B  1  421 ? 14.102  43.480  39.354  1.00 62.65 ? 449  SER B CB  1 
ATOM   8433  O  OG  . SER B  1  421 ? 12.731  43.495  39.008  1.00 62.78 ? 449  SER B OG  1 
ATOM   8434  N  N   . HIS B  1  422 ? 13.893  40.008  38.602  1.00 64.97 ? 450  HIS B N   1 
ATOM   8435  C  CA  . HIS B  1  422 ? 13.772  39.063  37.490  1.00 63.91 ? 450  HIS B CA  1 
ATOM   8436  C  C   . HIS B  1  422 ? 12.724  39.499  36.466  1.00 63.18 ? 450  HIS B C   1 
ATOM   8437  O  O   . HIS B  1  422 ? 11.562  39.730  36.801  1.00 62.99 ? 450  HIS B O   1 
ATOM   8438  C  CB  . HIS B  1  422 ? 13.424  37.660  37.999  1.00 63.83 ? 450  HIS B CB  1 
ATOM   8439  C  CG  . HIS B  1  422 ? 14.510  37.019  38.807  1.00 64.98 ? 450  HIS B CG  1 
ATOM   8440  N  ND1 . HIS B  1  422 ? 14.935  35.724  38.585  1.00 66.14 ? 450  HIS B ND1 1 
ATOM   8441  C  CD2 . HIS B  1  422 ? 15.233  37.476  39.859  1.00 64.41 ? 450  HIS B CD2 1 
ATOM   8442  C  CE1 . HIS B  1  422 ? 15.871  35.412  39.465  1.00 66.80 ? 450  HIS B CE1 1 
ATOM   8443  N  NE2 . HIS B  1  422 ? 16.070  36.458  40.250  1.00 66.26 ? 450  HIS B NE2 1 
ATOM   8444  N  N   . TYR B  1  423 ? 13.152  39.602  35.214  1.00 61.88 ? 451  TYR B N   1 
ATOM   8445  C  CA  . TYR B  1  423 ? 12.280  40.018  34.123  1.00 61.40 ? 451  TYR B CA  1 
ATOM   8446  C  C   . TYR B  1  423 ? 13.011  39.814  32.801  1.00 62.69 ? 451  TYR B C   1 
ATOM   8447  O  O   . TYR B  1  423 ? 14.240  39.661  32.774  1.00 62.93 ? 451  TYR B O   1 
ATOM   8448  C  CB  . TYR B  1  423 ? 11.919  41.506  34.264  1.00 60.25 ? 451  TYR B CB  1 
ATOM   8449  C  CG  . TYR B  1  423 ? 13.115  42.448  34.173  1.00 59.74 ? 451  TYR B CG  1 
ATOM   8450  C  CD1 . TYR B  1  423 ? 13.646  42.843  32.940  1.00 58.76 ? 451  TYR B CD1 1 
ATOM   8451  C  CD2 . TYR B  1  423 ? 13.740  42.909  35.326  1.00 60.08 ? 451  TYR B CD2 1 
ATOM   8452  C  CE1 . TYR B  1  423 ? 14.772  43.670  32.866  1.00 58.31 ? 451  TYR B CE1 1 
ATOM   8453  C  CE2 . TYR B  1  423 ? 14.862  43.734  35.262  1.00 60.40 ? 451  TYR B CE2 1 
ATOM   8454  C  CZ  . TYR B  1  423 ? 15.375  44.109  34.034  1.00 59.37 ? 451  TYR B CZ  1 
ATOM   8455  O  OH  . TYR B  1  423 ? 16.499  44.911  33.998  1.00 58.60 ? 451  TYR B OH  1 
ATOM   8456  N  N   . PHE B  1  424 ? 12.252  39.807  31.708  1.00 62.53 ? 452  PHE B N   1 
ATOM   8457  C  CA  . PHE B  1  424 ? 12.825  39.678  30.373  1.00 62.05 ? 452  PHE B CA  1 
ATOM   8458  C  C   . PHE B  1  424 ? 12.073  40.547  29.371  1.00 61.39 ? 452  PHE B C   1 
ATOM   8459  O  O   . PHE B  1  424 ? 10.843  40.537  29.331  1.00 62.11 ? 452  PHE B O   1 
ATOM   8460  C  CB  . PHE B  1  424 ? 12.786  38.246  29.857  1.00 61.21 ? 452  PHE B CB  1 
ATOM   8461  C  CG  . PHE B  1  424 ? 13.217  38.138  28.425  1.00 60.82 ? 452  PHE B CG  1 
ATOM   8462  C  CD1 . PHE B  1  424 ? 14.565  38.174  28.092  1.00 59.94 ? 452  PHE B CD1 1 
ATOM   8463  C  CD2 . PHE B  1  424 ? 12.272  38.110  27.403  1.00 60.75 ? 452  PHE B CD2 1 
ATOM   8464  C  CE1 . PHE B  1  424 ? 14.966  38.188  26.769  1.00 60.83 ? 452  PHE B CE1 1 
ATOM   8465  C  CE2 . PHE B  1  424 ? 12.662  38.125  26.075  1.00 60.41 ? 452  PHE B CE2 1 
ATOM   8466  C  CZ  . PHE B  1  424 ? 14.013  38.164  25.755  1.00 60.73 ? 452  PHE B CZ  1 
ATOM   8467  N  N   . GLY B  1  425 ? 12.813  41.282  28.553  1.00 59.74 ? 453  GLY B N   1 
ATOM   8468  C  CA  . GLY B  1  425 ? 12.172  42.125  27.567  1.00 60.07 ? 453  GLY B CA  1 
ATOM   8469  C  C   . GLY B  1  425 ? 12.994  42.119  26.306  1.00 60.19 ? 453  GLY B C   1 
ATOM   8470  O  O   . GLY B  1  425 ? 14.213  42.279  26.367  1.00 61.32 ? 453  GLY B O   1 
ATOM   8471  N  N   . GLY B  1  426 ? 12.345  41.935  25.163  1.00 58.82 ? 454  GLY B N   1 
ATOM   8472  C  CA  . GLY B  1  426 ? 13.092  41.914  23.923  1.00 59.06 ? 454  GLY B CA  1 
ATOM   8473  C  C   . GLY B  1  426 ? 12.236  41.931  22.680  1.00 57.86 ? 454  GLY B C   1 
ATOM   8474  O  O   . GLY B  1  426 ? 11.015  42.000  22.762  1.00 58.94 ? 454  GLY B O   1 
ATOM   8475  N  N   . LEU B  1  427 ? 12.887  41.853  21.524  1.00 57.40 ? 455  LEU B N   1 
ATOM   8476  C  CA  . LEU B  1  427 ? 12.194  41.878  20.247  1.00 57.38 ? 455  LEU B CA  1 
ATOM   8477  C  C   . LEU B  1  427 ? 12.963  41.172  19.138  1.00 56.60 ? 455  LEU B C   1 
ATOM   8478  O  O   . LEU B  1  427 ? 14.079  41.560  18.793  1.00 57.13 ? 455  LEU B O   1 
ATOM   8479  C  CB  . LEU B  1  427 ? 11.931  43.326  19.836  1.00 57.46 ? 455  LEU B CB  1 
ATOM   8480  C  CG  . LEU B  1  427 ? 11.413  43.544  18.417  1.00 56.71 ? 455  LEU B CG  1 
ATOM   8481  C  CD1 . LEU B  1  427 ? 10.100  42.807  18.231  1.00 56.90 ? 455  LEU B CD1 1 
ATOM   8482  C  CD2 . LEU B  1  427 ? 11.239  45.031  18.169  1.00 57.37 ? 455  LEU B CD2 1 
ATOM   8483  N  N   . ALA B  1  428 ? 12.359  40.128  18.586  1.00 56.09 ? 456  ALA B N   1 
ATOM   8484  C  CA  . ALA B  1  428 ? 12.978  39.390  17.497  1.00 56.24 ? 456  ALA B CA  1 
ATOM   8485  C  C   . ALA B  1  428 ? 12.867  40.285  16.260  1.00 56.39 ? 456  ALA B C   1 
ATOM   8486  O  O   . ALA B  1  428 ? 11.793  40.819  15.952  1.00 56.23 ? 456  ALA B O   1 
ATOM   8487  C  CB  . ALA B  1  428 ? 12.251  38.063  17.279  1.00 56.48 ? 456  ALA B CB  1 
ATOM   8488  N  N   . GLU B  1  429 ? 13.973  40.451  15.547  1.00 55.41 ? 457  GLU B N   1 
ATOM   8489  C  CA  . GLU B  1  429 ? 13.967  41.322  14.384  1.00 54.07 ? 457  GLU B CA  1 
ATOM   8490  C  C   . GLU B  1  429 ? 13.457  40.749  13.072  1.00 53.16 ? 457  GLU B C   1 
ATOM   8491  O  O   . GLU B  1  429 ? 13.891  39.688  12.597  1.00 52.45 ? 457  GLU B O   1 
ATOM   8492  C  CB  . GLU B  1  429 ? 15.362  41.917  14.175  1.00 54.18 ? 457  GLU B CB  1 
ATOM   8493  C  CG  . GLU B  1  429 ? 15.526  42.620  12.852  1.00 54.37 ? 457  GLU B CG  1 
ATOM   8494  C  CD  . GLU B  1  429 ? 16.891  43.218  12.686  1.00 55.02 ? 457  GLU B CD  1 
ATOM   8495  O  OE1 . GLU B  1  429 ? 17.875  42.607  13.175  1.00 56.91 ? 457  GLU B OE1 1 
ATOM   8496  O  OE2 . GLU B  1  429 ? 16.973  44.295  12.058  1.00 55.69 ? 457  GLU B OE2 1 
ATOM   8497  N  N   . THR B  1  430 ? 12.516  41.494  12.503  1.00 51.66 ? 458  THR B N   1 
ATOM   8498  C  CA  . THR B  1  430 ? 11.908  41.180  11.222  1.00 52.08 ? 458  THR B CA  1 
ATOM   8499  C  C   . THR B  1  430 ? 12.185  42.437  10.397  1.00 51.65 ? 458  THR B C   1 
ATOM   8500  O  O   . THR B  1  430 ? 11.853  43.548  10.830  1.00 50.92 ? 458  THR B O   1 
ATOM   8501  C  CB  . THR B  1  430 ? 10.372  40.959  11.357  1.00 51.92 ? 458  THR B CB  1 
ATOM   8502  O  OG1 . THR B  1  430 ? 10.121  39.799  12.159  1.00 51.57 ? 458  THR B OG1 1 
ATOM   8503  C  CG2 . THR B  1  430 ? 9.727   40.765  9.994   1.00 51.30 ? 458  THR B CG2 1 
ATOM   8504  N  N   . VAL B  1  431 ? 12.825  42.260  9.236   1.00 52.18 ? 459  VAL B N   1 
ATOM   8505  C  CA  . VAL B  1  431 ? 13.168  43.378  8.343   1.00 51.21 ? 459  VAL B CA  1 
ATOM   8506  C  C   . VAL B  1  431 ? 12.316  43.436  7.083   1.00 50.44 ? 459  VAL B C   1 
ATOM   8507  O  O   . VAL B  1  431 ? 11.536  42.530  6.790   1.00 50.14 ? 459  VAL B O   1 
ATOM   8508  C  CB  . VAL B  1  431 ? 14.661  43.347  7.887   1.00 48.02 ? 459  VAL B CB  1 
ATOM   8509  C  CG1 . VAL B  1  431 ? 15.562  43.714  9.032   1.00 49.48 ? 459  VAL B CG1 1 
ATOM   8510  C  CG2 . VAL B  1  431 ? 15.020  41.983  7.357   1.00 48.16 ? 459  VAL B CG2 1 
ATOM   8511  N  N   . LEU B  1  432 ? 12.482  44.522  6.344   1.00 48.75 ? 460  LEU B N   1 
ATOM   8512  C  CA  . LEU B  1  432 ? 11.753  44.731  5.118   1.00 48.16 ? 460  LEU B CA  1 
ATOM   8513  C  C   . LEU B  1  432 ? 12.782  44.905  4.005   1.00 48.83 ? 460  LEU B C   1 
ATOM   8514  O  O   . LEU B  1  432 ? 13.524  45.885  3.989   1.00 49.07 ? 460  LEU B O   1 
ATOM   8515  C  CB  . LEU B  1  432 ? 10.900  45.980  5.251   1.00 48.43 ? 460  LEU B CB  1 
ATOM   8516  C  CG  . LEU B  1  432 ? 10.097  46.268  4.001   1.00 48.82 ? 460  LEU B CG  1 
ATOM   8517  C  CD1 . LEU B  1  432 ? 8.980   45.249  3.900   1.00 49.24 ? 460  LEU B CD1 1 
ATOM   8518  C  CD2 . LEU B  1  432 ? 9.559   47.677  4.061   1.00 49.74 ? 460  LEU B CD2 1 
ATOM   8519  N  N   . VAL B  1  433 ? 12.819  43.959  3.073   1.00 48.78 ? 461  VAL B N   1 
ATOM   8520  C  CA  . VAL B  1  433 ? 13.781  44.000  1.978   1.00 47.27 ? 461  VAL B CA  1 
ATOM   8521  C  C   . VAL B  1  433 ? 13.181  44.308  0.634   1.00 46.29 ? 461  VAL B C   1 
ATOM   8522  O  O   . VAL B  1  433 ? 12.052  43.935  0.363   1.00 47.63 ? 461  VAL B O   1 
ATOM   8523  C  CB  . VAL B  1  433 ? 14.513  42.664  1.844   1.00 46.44 ? 461  VAL B CB  1 
ATOM   8524  C  CG1 . VAL B  1  433 ? 15.383  42.671  0.610   1.00 46.25 ? 461  VAL B CG1 1 
ATOM   8525  C  CG2 . VAL B  1  433 ? 15.340  42.411  3.081   1.00 46.28 ? 461  VAL B CG2 1 
ATOM   8526  N  N   . VAL B  1  434 ? 13.957  44.997  -0.197  1.00 46.65 ? 462  VAL B N   1 
ATOM   8527  C  CA  . VAL B  1  434 ? 13.567  45.346  -1.562  1.00 47.74 ? 462  VAL B CA  1 
ATOM   8528  C  C   . VAL B  1  434 ? 14.753  44.896  -2.415  1.00 48.17 ? 462  VAL B C   1 
ATOM   8529  O  O   . VAL B  1  434 ? 15.848  45.467  -2.336  1.00 47.97 ? 462  VAL B O   1 
ATOM   8530  C  CB  . VAL B  1  434 ? 13.345  46.864  -1.736  1.00 46.18 ? 462  VAL B CB  1 
ATOM   8531  C  CG1 . VAL B  1  434 ? 13.096  47.183  -3.187  1.00 45.52 ? 462  VAL B CG1 1 
ATOM   8532  C  CG2 . VAL B  1  434 ? 12.163  47.310  -0.915  1.00 46.32 ? 462  VAL B CG2 1 
ATOM   8533  N  N   . ARG B  1  435 ? 14.534  43.871  -3.228  1.00 45.76 ? 463  ARG B N   1 
ATOM   8534  C  CA  . ARG B  1  435 ? 15.613  43.314  -4.023  1.00 46.71 ? 463  ARG B CA  1 
ATOM   8535  C  C   . ARG B  1  435 ? 15.446  43.408  -5.520  1.00 48.67 ? 463  ARG B C   1 
ATOM   8536  O  O   . ARG B  1  435 ? 14.339  43.513  -6.029  1.00 49.76 ? 463  ARG B O   1 
ATOM   8537  C  CB  . ARG B  1  435 ? 15.805  41.858  -3.631  1.00 45.04 ? 463  ARG B CB  1 
ATOM   8538  C  CG  . ARG B  1  435 ? 16.970  41.160  -4.272  1.00 43.32 ? 463  ARG B CG  1 
ATOM   8539  C  CD  . ARG B  1  435 ? 17.075  39.794  -3.650  1.00 42.03 ? 463  ARG B CD  1 
ATOM   8540  N  NE  . ARG B  1  435 ? 17.034  39.911  -2.193  1.00 42.12 ? 463  ARG B NE  1 
ATOM   8541  C  CZ  . ARG B  1  435 ? 16.995  38.887  -1.343  1.00 40.60 ? 463  ARG B CZ  1 
ATOM   8542  N  NH1 . ARG B  1  435 ? 16.988  37.644  -1.791  1.00 41.91 ? 463  ARG B NH1 1 
ATOM   8543  N  NH2 . ARG B  1  435 ? 16.967  39.107  -0.038  1.00 40.34 ? 463  ARG B NH2 1 
ATOM   8544  N  N   . SER B  1  436 ? 16.567  43.361  -6.223  1.00 48.65 ? 464  SER B N   1 
ATOM   8545  C  CA  . SER B  1  436 ? 16.571  43.427  -7.672  1.00 48.81 ? 464  SER B CA  1 
ATOM   8546  C  C   . SER B  1  436 ? 17.919  42.879  -8.115  1.00 51.29 ? 464  SER B C   1 
ATOM   8547  O  O   . SER B  1  436 ? 18.915  43.043  -7.409  1.00 50.99 ? 464  SER B O   1 
ATOM   8548  C  CB  . SER B  1  436 ? 16.410  44.869  -8.138  1.00 48.53 ? 464  SER B CB  1 
ATOM   8549  O  OG  . SER B  1  436 ? 16.543  44.927  -9.544  1.00 50.84 ? 464  SER B OG  1 
ATOM   8550  N  N   . MET B  1  437 ? 17.964  42.226  -9.270  1.00 52.24 ? 465  MET B N   1 
ATOM   8551  C  CA  . MET B  1  437 ? 19.224  41.668  -9.731  1.00 51.09 ? 465  MET B CA  1 
ATOM   8552  C  C   . MET B  1  437 ? 19.592  42.062  -11.127 1.00 51.10 ? 465  MET B C   1 
ATOM   8553  O  O   . MET B  1  437 ? 18.777  42.021  -12.038 1.00 52.80 ? 465  MET B O   1 
ATOM   8554  C  CB  . MET B  1  437 ? 19.198  40.160  -9.607  1.00 51.08 ? 465  MET B CB  1 
ATOM   8555  C  CG  . MET B  1  437 ? 19.026  39.733  -8.174  1.00 51.20 ? 465  MET B CG  1 
ATOM   8556  S  SD  . MET B  1  437 ? 19.142  37.973  -7.990  1.00 53.29 ? 465  MET B SD  1 
ATOM   8557  C  CE  . MET B  1  437 ? 18.561  37.777  -6.297  1.00 51.51 ? 465  MET B CE  1 
ATOM   8558  N  N   . SER B  1  438 ? 20.847  42.440  -11.281 1.00 52.30 ? 466  SER B N   1 
ATOM   8559  C  CA  . SER B  1  438 ? 21.370  42.887  -12.557 1.00 54.91 ? 466  SER B CA  1 
ATOM   8560  C  C   . SER B  1  438 ? 22.410  41.893  -13.080 1.00 56.11 ? 466  SER B C   1 
ATOM   8561  O  O   . SER B  1  438 ? 23.488  41.749  -12.493 1.00 56.55 ? 466  SER B O   1 
ATOM   8562  C  CB  . SER B  1  438 ? 21.987  44.277  -12.366 1.00 52.66 ? 466  SER B CB  1 
ATOM   8563  O  OG  . SER B  1  438 ? 22.811  44.623  -13.456 1.00 53.60 ? 466  SER B OG  1 
ATOM   8564  N  N   . THR B  1  439 ? 22.097  41.204  -14.177 1.00 55.42 ? 467  THR B N   1 
ATOM   8565  C  CA  . THR B  1  439 ? 23.038  40.229  -14.720 1.00 56.35 ? 467  THR B CA  1 
ATOM   8566  C  C   . THR B  1  439 ? 23.782  40.743  -15.938 1.00 56.41 ? 467  THR B C   1 
ATOM   8567  O  O   . THR B  1  439 ? 23.338  40.569  -17.070 1.00 56.39 ? 467  THR B O   1 
ATOM   8568  C  CB  . THR B  1  439 ? 22.335  38.903  -15.088 1.00 56.72 ? 467  THR B CB  1 
ATOM   8569  O  OG1 . THR B  1  439 ? 21.664  38.384  -13.932 1.00 56.25 ? 467  THR B OG1 1 
ATOM   8570  C  CG2 . THR B  1  439 ? 23.351  37.870  -15.587 1.00 55.90 ? 467  THR B CG2 1 
ATOM   8571  N  N   . LEU B  1  440 ? 24.923  41.373  -15.692 1.00 56.37 ? 468  LEU B N   1 
ATOM   8572  C  CA  . LEU B  1  440 ? 25.746  41.907  -16.764 1.00 56.88 ? 468  LEU B CA  1 
ATOM   8573  C  C   . LEU B  1  440 ? 26.683  40.817  -17.259 1.00 57.15 ? 468  LEU B C   1 
ATOM   8574  O  O   . LEU B  1  440 ? 27.684  40.486  -16.630 1.00 57.21 ? 468  LEU B O   1 
ATOM   8575  C  CB  . LEU B  1  440 ? 26.550  43.104  -16.264 1.00 57.45 ? 468  LEU B CB  1 
ATOM   8576  C  CG  . LEU B  1  440 ? 25.717  44.276  -15.754 1.00 58.18 ? 468  LEU B CG  1 
ATOM   8577  C  CD1 . LEU B  1  440 ? 26.371  44.830  -14.517 1.00 58.57 ? 468  LEU B CD1 1 
ATOM   8578  C  CD2 . LEU B  1  440 ? 25.573  45.340  -16.820 1.00 57.55 ? 468  LEU B CD2 1 
ATOM   8579  N  N   . LEU B  1  441 ? 26.334  40.250  -18.399 1.00 58.43 ? 469  LEU B N   1 
ATOM   8580  C  CA  . LEU B  1  441 ? 27.124  39.195  -18.996 1.00 57.98 ? 469  LEU B CA  1 
ATOM   8581  C  C   . LEU B  1  441 ? 27.271  37.975  -18.107 1.00 58.18 ? 469  LEU B C   1 
ATOM   8582  O  O   . LEU B  1  441 ? 26.359  37.142  -18.015 1.00 57.59 ? 469  LEU B O   1 
ATOM   8583  C  CB  . LEU B  1  441 ? 28.514  39.715  -19.383 1.00 57.68 ? 469  LEU B CB  1 
ATOM   8584  C  CG  . LEU B  1  441 ? 28.590  40.747  -20.519 1.00 58.68 ? 469  LEU B CG  1 
ATOM   8585  C  CD1 . LEU B  1  441 ? 29.983  40.740  -21.097 1.00 57.91 ? 469  LEU B CD1 1 
ATOM   8586  C  CD2 . LEU B  1  441 ? 27.604  40.414  -21.631 1.00 58.62 ? 469  LEU B CD2 1 
ATOM   8587  N  N   . ASN B  1  442 ? 28.427  37.884  -17.452 1.00 58.69 ? 470  ASN B N   1 
ATOM   8588  C  CA  . ASN B  1  442 ? 28.755  36.746  -16.595 1.00 57.59 ? 470  ASN B CA  1 
ATOM   8589  C  C   . ASN B  1  442 ? 28.218  36.718  -15.168 1.00 57.18 ? 470  ASN B C   1 
ATOM   8590  O  O   . ASN B  1  442 ? 27.659  35.704  -14.747 1.00 57.28 ? 470  ASN B O   1 
ATOM   8591  C  CB  . ASN B  1  442 ? 30.279  36.529  -16.571 1.00 56.05 ? 470  ASN B CB  1 
ATOM   8592  C  CG  . ASN B  1  442 ? 31.050  37.787  -16.227 1.00 57.76 ? 470  ASN B CG  1 
ATOM   8593  O  OD1 . ASN B  1  442 ? 31.058  38.765  -16.988 1.00 58.73 ? 470  ASN B OD1 1 
ATOM   8594  N  ND2 . ASN B  1  442 ? 31.711  37.771  -15.075 1.00 56.34 ? 470  ASN B ND2 1 
HETATM 8595  N  N   . PAQ B  1  443 ? 28.381  37.790  -14.404 1.00 55.74 ? 471  PAQ B N   1 
HETATM 8596  C  CA  . PAQ B  1  443 ? 27.859  37.729  -13.009 1.00 57.15 ? 471  PAQ B CA  1 
HETATM 8597  C  CB  . PAQ B  1  443 ? 28.857  38.257  -11.982 1.00 59.93 ? 471  PAQ B CB  1 
HETATM 8598  C  CG  . PAQ B  1  443 ? 29.669  39.417  -12.510 1.00 59.98 ? 471  PAQ B CG  1 
HETATM 8599  C  CD1 . PAQ B  1  443 ? 31.132  39.483  -12.248 1.00 59.76 ? 471  PAQ B CD1 1 
HETATM 8600  O  O2  . PAQ B  1  443 ? 31.687  38.688  -11.458 1.00 60.79 ? 471  PAQ B O2  1 
HETATM 8601  C  CD2 . PAQ B  1  443 ? 29.079  40.402  -13.297 1.00 58.25 ? 471  PAQ B CD2 1 
HETATM 8602  C  CE1 . PAQ B  1  443 ? 31.874  40.479  -12.874 1.00 58.22 ? 471  PAQ B CE1 1 
HETATM 8603  C  CE2 . PAQ B  1  443 ? 29.869  41.369  -13.910 1.00 59.86 ? 471  PAQ B CE2 1 
HETATM 8604  C  CZ  . PAQ B  1  443 ? 31.247  41.404  -13.705 1.00 60.10 ? 471  PAQ B CZ  1 
HETATM 8605  O  OH  . PAQ B  1  443 ? 32.015  42.327  -14.350 1.00 61.08 ? 471  PAQ B OH  1 
HETATM 8606  N  N1  . PAQ B  1  443 ? 29.248  42.299  -14.678 1.00 61.23 ? 471  PAQ B N1  1 
HETATM 8607  N  N2  . PAQ B  1  443 ? 29.914  43.272  -15.272 1.00 61.87 ? 471  PAQ B N2  1 
HETATM 8608  C  C1  . PAQ B  1  443 ? 30.042  43.273  -16.617 1.00 60.99 ? 471  PAQ B C1  1 
HETATM 8609  C  C2  . PAQ B  1  443 ? 30.777  42.269  -17.241 1.00 59.13 ? 471  PAQ B C2  1 
HETATM 8610  C  C3  . PAQ B  1  443 ? 30.885  42.286  -18.628 1.00 60.68 ? 471  PAQ B C3  1 
HETATM 8611  C  C4  . PAQ B  1  443 ? 30.263  43.294  -19.360 1.00 59.53 ? 471  PAQ B C4  1 
HETATM 8612  C  C5  . PAQ B  1  443 ? 29.541  44.270  -18.681 1.00 59.78 ? 471  PAQ B C5  1 
HETATM 8613  N  N3  . PAQ B  1  443 ? 29.453  44.230  -17.344 1.00 61.36 ? 471  PAQ B N3  1 
HETATM 8614  C  C   . PAQ B  1  443 ? 26.561  38.470  -12.893 1.00 56.25 ? 471  PAQ B C   1 
HETATM 8615  O  O   . PAQ B  1  443 ? 26.252  39.275  -13.774 1.00 55.15 ? 471  PAQ B O   1 
ATOM   8616  N  N   . ASP B  1  444 ? 25.853  38.185  -11.805 1.00 56.63 ? 472  ASP B N   1 
ATOM   8617  C  CA  . ASP B  1  444 ? 24.571  38.761  -11.476 1.00 54.67 ? 472  ASP B CA  1 
ATOM   8618  C  C   . ASP B  1  444 ? 24.774  39.567  -10.199 1.00 53.98 ? 472  ASP B C   1 
ATOM   8619  O  O   . ASP B  1  444 ? 25.353  39.074  -9.235  1.00 53.03 ? 472  ASP B O   1 
ATOM   8620  C  CB  . ASP B  1  444 ? 23.572  37.624  -11.238 1.00 55.29 ? 472  ASP B CB  1 
ATOM   8621  C  CG  . ASP B  1  444 ? 23.688  36.518  -12.289 1.00 56.31 ? 472  ASP B CG  1 
ATOM   8622  O  OD1 . ASP B  1  444 ? 22.864  36.487  -13.227 1.00 55.68 ? 472  ASP B OD1 1 
ATOM   8623  O  OD2 . ASP B  1  444 ? 24.619  35.684  -12.186 1.00 56.13 ? 472  ASP B OD2 1 
ATOM   8624  N  N   . TYR B  1  445 ? 24.325  40.815  -10.205 1.00 54.08 ? 473  TYR B N   1 
ATOM   8625  C  CA  . TYR B  1  445 ? 24.438  41.659  -9.027  1.00 52.91 ? 473  TYR B CA  1 
ATOM   8626  C  C   . TYR B  1  445 ? 23.155  41.587  -8.228  1.00 53.60 ? 473  TYR B C   1 
ATOM   8627  O  O   . TYR B  1  445 ? 22.067  41.540  -8.800  1.00 55.05 ? 473  TYR B O   1 
ATOM   8628  C  CB  . TYR B  1  445 ? 24.659  43.095  -9.419  1.00 53.03 ? 473  TYR B CB  1 
ATOM   8629  C  CG  . TYR B  1  445 ? 26.029  43.379  -9.940  1.00 53.52 ? 473  TYR B CG  1 
ATOM   8630  C  CD1 . TYR B  1  445 ? 26.268  43.468  -11.312 1.00 53.90 ? 473  TYR B CD1 1 
ATOM   8631  C  CD2 . TYR B  1  445 ? 27.088  43.606  -9.058  1.00 52.75 ? 473  TYR B CD2 1 
ATOM   8632  C  CE1 . TYR B  1  445 ? 27.537  43.788  -11.803 1.00 54.86 ? 473  TYR B CE1 1 
ATOM   8633  C  CE2 . TYR B  1  445 ? 28.360  43.922  -9.528  1.00 54.27 ? 473  TYR B CE2 1 
ATOM   8634  C  CZ  . TYR B  1  445 ? 28.584  44.015  -10.906 1.00 56.22 ? 473  TYR B CZ  1 
ATOM   8635  O  OH  . TYR B  1  445 ? 29.847  44.340  -11.384 1.00 56.80 ? 473  TYR B OH  1 
ATOM   8636  N  N   . VAL B  1  446 ? 23.281  41.604  -6.907  1.00 53.43 ? 474  VAL B N   1 
ATOM   8637  C  CA  . VAL B  1  446 ? 22.122  41.520  -6.027  1.00 52.91 ? 474  VAL B CA  1 
ATOM   8638  C  C   . VAL B  1  446 ? 21.995  42.800  -5.209  1.00 53.05 ? 474  VAL B C   1 
ATOM   8639  O  O   . VAL B  1  446 ? 22.725  42.992  -4.236  1.00 52.75 ? 474  VAL B O   1 
ATOM   8640  C  CB  . VAL B  1  446 ? 22.258  40.317  -5.079  1.00 52.41 ? 474  VAL B CB  1 
ATOM   8641  C  CG1 . VAL B  1  446 ? 20.953  40.088  -4.335  1.00 51.73 ? 474  VAL B CG1 1 
ATOM   8642  C  CG2 . VAL B  1  446 ? 22.667  39.087  -5.871  1.00 51.51 ? 474  VAL B CG2 1 
ATOM   8643  N  N   . TRP B  1  447 ? 21.047  43.653  -5.597  1.00 52.82 ? 475  TRP B N   1 
ATOM   8644  C  CA  . TRP B  1  447 ? 20.836  44.946  -4.952  1.00 52.81 ? 475  TRP B CA  1 
ATOM   8645  C  C   . TRP B  1  447 ? 19.810  44.943  -3.848  1.00 52.69 ? 475  TRP B C   1 
ATOM   8646  O  O   . TRP B  1  447 ? 18.615  45.118  -4.070  1.00 53.28 ? 475  TRP B O   1 
ATOM   8647  C  CB  . TRP B  1  447 ? 20.481  45.974  -6.016  1.00 53.74 ? 475  TRP B CB  1 
ATOM   8648  C  CG  . TRP B  1  447 ? 21.403  45.845  -7.205  1.00 55.72 ? 475  TRP B CG  1 
ATOM   8649  C  CD1 . TRP B  1  447 ? 21.123  45.251  -8.414  1.00 55.27 ? 475  TRP B CD1 1 
ATOM   8650  C  CD2 . TRP B  1  447 ? 22.784  46.254  -7.270  1.00 56.52 ? 475  TRP B CD2 1 
ATOM   8651  N  NE1 . TRP B  1  447 ? 22.243  45.266  -9.222  1.00 56.58 ? 475  TRP B NE1 1 
ATOM   8652  C  CE2 . TRP B  1  447 ? 23.274  45.875  -8.545  1.00 56.79 ? 475  TRP B CE2 1 
ATOM   8653  C  CE3 . TRP B  1  447 ? 23.653  46.904  -6.375  1.00 54.79 ? 475  TRP B CE3 1 
ATOM   8654  C  CZ2 . TRP B  1  447 ? 24.600  46.131  -8.945  1.00 55.48 ? 475  TRP B CZ2 1 
ATOM   8655  C  CZ3 . TRP B  1  447 ? 24.967  47.153  -6.775  1.00 53.76 ? 475  TRP B CZ3 1 
ATOM   8656  C  CH2 . TRP B  1  447 ? 25.424  46.768  -8.048  1.00 54.17 ? 475  TRP B CH2 1 
ATOM   8657  N  N   . ASP B  1  448 ? 20.323  44.776  -2.641  1.00 52.10 ? 476  ASP B N   1 
ATOM   8658  C  CA  . ASP B  1  448 ? 19.521  44.703  -1.445  1.00 51.38 ? 476  ASP B CA  1 
ATOM   8659  C  C   . ASP B  1  448 ? 19.379  45.943  -0.610  1.00 53.53 ? 476  ASP B C   1 
ATOM   8660  O  O   . ASP B  1  448 ? 20.369  46.526  -0.166  1.00 54.16 ? 476  ASP B O   1 
ATOM   8661  C  CB  . ASP B  1  448 ? 20.073  43.621  -0.552  1.00 52.79 ? 476  ASP B CB  1 
ATOM   8662  C  CG  . ASP B  1  448 ? 19.245  42.391  -0.594  1.00 53.70 ? 476  ASP B CG  1 
ATOM   8663  O  OD1 . ASP B  1  448 ? 18.769  42.059  -1.706  1.00 52.87 ? 476  ASP B OD1 1 
ATOM   8664  O  OD2 . ASP B  1  448 ? 19.075  41.767  0.476   1.00 53.12 ? 476  ASP B OD2 1 
ATOM   8665  N  N   . THR B  1  449 ? 18.134  46.315  -0.352  1.00 53.51 ? 477  THR B N   1 
ATOM   8666  C  CA  . THR B  1  449 ? 17.864  47.472  0.473   1.00 51.99 ? 477  THR B CA  1 
ATOM   8667  C  C   . THR B  1  449 ? 17.004  47.026  1.641   1.00 52.36 ? 477  THR B C   1 
ATOM   8668  O  O   . THR B  1  449 ? 15.797  46.814  1.509   1.00 51.81 ? 477  THR B O   1 
ATOM   8669  C  CB  . THR B  1  449 ? 17.159  48.545  -0.317  1.00 53.21 ? 477  THR B CB  1 
ATOM   8670  O  OG1 . THR B  1  449 ? 17.911  48.812  -1.510  1.00 53.85 ? 477  THR B OG1 1 
ATOM   8671  C  CG2 . THR B  1  449 ? 17.047  49.808  0.517   1.00 52.34 ? 477  THR B CG2 1 
ATOM   8672  N  N   . VAL B  1  450 ? 17.664  46.886  2.785   1.00 51.49 ? 478  VAL B N   1 
ATOM   8673  C  CA  . VAL B  1  450 ? 17.050  46.438  4.021   1.00 50.85 ? 478  VAL B CA  1 
ATOM   8674  C  C   . VAL B  1  450 ? 16.577  47.588  4.932   1.00 51.36 ? 478  VAL B C   1 
ATOM   8675  O  O   . VAL B  1  450 ? 17.335  48.502  5.260   1.00 50.87 ? 478  VAL B O   1 
ATOM   8676  C  CB  . VAL B  1  450 ? 18.053  45.544  4.778   1.00 50.30 ? 478  VAL B CB  1 
ATOM   8677  C  CG1 . VAL B  1  450 ? 17.376  44.819  5.908   1.00 50.89 ? 478  VAL B CG1 1 
ATOM   8678  C  CG2 . VAL B  1  450 ? 18.685  44.568  3.813   1.00 50.03 ? 478  VAL B CG2 1 
ATOM   8679  N  N   . PHE B  1  451 ? 15.309  47.530  5.327   1.00 51.15 ? 479  PHE B N   1 
ATOM   8680  C  CA  . PHE B  1  451 ? 14.721  48.525  6.204   1.00 49.58 ? 479  PHE B CA  1 
ATOM   8681  C  C   . PHE B  1  451 ? 14.482  47.962  7.579   1.00 50.99 ? 479  PHE B C   1 
ATOM   8682  O  O   . PHE B  1  451 ? 13.549  47.184  7.790   1.00 50.46 ? 479  PHE B O   1 
ATOM   8683  C  CB  . PHE B  1  451 ? 13.413  49.015  5.632   1.00 49.21 ? 479  PHE B CB  1 
ATOM   8684  C  CG  . PHE B  1  451 ? 13.599  49.885  4.467   1.00 50.26 ? 479  PHE B CG  1 
ATOM   8685  C  CD1 . PHE B  1  451 ? 13.681  49.343  3.192   1.00 50.99 ? 479  PHE B CD1 1 
ATOM   8686  C  CD2 . PHE B  1  451 ? 13.784  51.250  4.640   1.00 49.01 ? 479  PHE B CD2 1 
ATOM   8687  C  CE1 . PHE B  1  451 ? 13.951  50.154  2.090   1.00 50.55 ? 479  PHE B CE1 1 
ATOM   8688  C  CE2 . PHE B  1  451 ? 14.054  52.071  3.558   1.00 49.17 ? 479  PHE B CE2 1 
ATOM   8689  C  CZ  . PHE B  1  451 ? 14.139  51.524  2.275   1.00 50.15 ? 479  PHE B CZ  1 
ATOM   8690  N  N   . HIS B  1  452 ? 15.310  48.394  8.523   1.00 49.77 ? 480  HIS B N   1 
ATOM   8691  C  CA  . HIS B  1  452 ? 15.229  47.901  9.879   1.00 49.32 ? 480  HIS B CA  1 
ATOM   8692  C  C   . HIS B  1  452 ? 14.207  48.527  10.788  1.00 50.44 ? 480  HIS B C   1 
ATOM   8693  O  O   . HIS B  1  452 ? 13.880  49.707  10.669  1.00 49.41 ? 480  HIS B O   1 
ATOM   8694  C  CB  . HIS B  1  452 ? 16.604  47.976  10.512  1.00 48.57 ? 480  HIS B CB  1 
ATOM   8695  C  CG  . HIS B  1  452 ? 17.596  47.077  9.850   1.00 48.82 ? 480  HIS B CG  1 
ATOM   8696  N  ND1 . HIS B  1  452 ? 17.762  45.759  10.214  1.00 48.57 ? 480  HIS B ND1 1 
ATOM   8697  C  CD2 . HIS B  1  452 ? 18.398  47.274  8.776   1.00 49.03 ? 480  HIS B CD2 1 
ATOM   8698  C  CE1 . HIS B  1  452 ? 18.621  45.182  9.392   1.00 49.69 ? 480  HIS B CE1 1 
ATOM   8699  N  NE2 . HIS B  1  452 ? 19.021  46.080  8.508   1.00 49.34 ? 480  HIS B NE2 1 
ATOM   8700  N  N   . PRO B  1  453 ? 13.663  47.713  11.706  1.00 50.62 ? 481  PRO B N   1 
ATOM   8701  C  CA  . PRO B  1  453 ? 12.667  48.186  12.658  1.00 49.27 ? 481  PRO B CA  1 
ATOM   8702  C  C   . PRO B  1  453 ? 13.269  49.288  13.525  1.00 49.06 ? 481  PRO B C   1 
ATOM   8703  O  O   . PRO B  1  453 ? 12.550  50.133  14.055  1.00 49.71 ? 481  PRO B O   1 
ATOM   8704  C  CB  . PRO B  1  453 ? 12.327  46.920  13.451  1.00 48.75 ? 481  PRO B CB  1 
ATOM   8705  C  CG  . PRO B  1  453 ? 13.568  46.094  13.356  1.00 48.03 ? 481  PRO B CG  1 
ATOM   8706  C  CD  . PRO B  1  453 ? 13.943  46.280  11.916  1.00 48.77 ? 481  PRO B CD  1 
ATOM   8707  N  N   . SER B  1  454 ? 14.597  49.281  13.645  1.00 49.27 ? 482  SER B N   1 
ATOM   8708  C  CA  . SER B  1  454 ? 15.312  50.266  14.452  1.00 48.25 ? 482  SER B CA  1 
ATOM   8709  C  C   . SER B  1  454 ? 15.435  51.633  13.766  1.00 48.27 ? 482  SER B C   1 
ATOM   8710  O  O   . SER B  1  454 ? 16.040  52.553  14.308  1.00 48.05 ? 482  SER B O   1 
ATOM   8711  C  CB  . SER B  1  454 ? 16.709  49.744  14.790  1.00 46.54 ? 482  SER B CB  1 
ATOM   8712  O  OG  . SER B  1  454 ? 17.572  49.802  13.669  1.00 44.68 ? 482  SER B OG  1 
ATOM   8713  N  N   . GLY B  1  455 ? 14.849  51.771  12.583  1.00 48.74 ? 483  GLY B N   1 
ATOM   8714  C  CA  . GLY B  1  455 ? 14.942  53.029  11.868  1.00 47.92 ? 483  GLY B CA  1 
ATOM   8715  C  C   . GLY B  1  455 ? 16.250  53.095  11.105  1.00 49.21 ? 483  GLY B C   1 
ATOM   8716  O  O   . GLY B  1  455 ? 16.576  54.112  10.497  1.00 50.21 ? 483  GLY B O   1 
ATOM   8717  N  N   . ALA B  1  456 ? 17.012  52.005  11.149  1.00 49.83 ? 484  ALA B N   1 
ATOM   8718  C  CA  . ALA B  1  456 ? 18.287  51.928  10.452  1.00 48.97 ? 484  ALA B CA  1 
ATOM   8719  C  C   . ALA B  1  456 ? 18.022  51.374  9.070   1.00 49.51 ? 484  ALA B C   1 
ATOM   8720  O  O   . ALA B  1  456 ? 17.139  50.534  8.894   1.00 49.52 ? 484  ALA B O   1 
ATOM   8721  C  CB  . ALA B  1  456 ? 19.248  51.016  11.201  1.00 49.08 ? 484  ALA B CB  1 
ATOM   8722  N  N   . ILE B  1  457 ? 18.777  51.867  8.091   1.00 51.69 ? 485  ILE B N   1 
ATOM   8723  C  CA  . ILE B  1  457 ? 18.657  51.427  6.702   1.00 51.81 ? 485  ILE B CA  1 
ATOM   8724  C  C   . ILE B  1  457 ? 19.946  50.755  6.268   1.00 51.41 ? 485  ILE B C   1 
ATOM   8725  O  O   . ILE B  1  457 ? 21.042  51.288  6.471   1.00 51.34 ? 485  ILE B O   1 
ATOM   8726  C  CB  . ILE B  1  457 ? 18.403  52.599  5.747   1.00 50.28 ? 485  ILE B CB  1 
ATOM   8727  C  CG1 . ILE B  1  457 ? 17.110  53.307  6.133   1.00 51.05 ? 485  ILE B CG1 1 
ATOM   8728  C  CG2 . ILE B  1  457 ? 18.335  52.092  4.321   1.00 49.85 ? 485  ILE B CG2 1 
ATOM   8729  C  CD1 . ILE B  1  457 ? 16.745  54.430  5.219   1.00 51.63 ? 485  ILE B CD1 1 
ATOM   8730  N  N   . GLU B  1  458 ? 19.811  49.576  5.676   1.00 51.88 ? 486  GLU B N   1 
ATOM   8731  C  CA  . GLU B  1  458 ? 20.969  48.842  5.209   1.00 53.33 ? 486  GLU B CA  1 
ATOM   8732  C  C   . GLU B  1  458 ? 20.956  48.712  3.690   1.00 53.91 ? 486  GLU B C   1 
ATOM   8733  O  O   . GLU B  1  458 ? 19.910  48.502  3.078   1.00 53.62 ? 486  GLU B O   1 
ATOM   8734  C  CB  . GLU B  1  458 ? 21.020  47.468  5.853   1.00 51.65 ? 486  GLU B CB  1 
ATOM   8735  C  CG  . GLU B  1  458 ? 22.103  46.597  5.283   1.00 52.34 ? 486  GLU B CG  1 
ATOM   8736  C  CD  . GLU B  1  458 ? 22.200  45.270  5.992   1.00 53.09 ? 486  GLU B CD  1 
ATOM   8737  O  OE1 . GLU B  1  458 ? 21.227  44.902  6.683   1.00 54.42 ? 486  GLU B OE1 1 
ATOM   8738  O  OE2 . GLU B  1  458 ? 23.238  44.588  5.857   1.00 50.69 ? 486  GLU B OE2 1 
ATOM   8739  N  N   . ILE B  1  459 ? 22.133  48.862  3.096   1.00 53.96 ? 487  ILE B N   1 
ATOM   8740  C  CA  . ILE B  1  459 ? 22.307  48.782  1.655   1.00 54.57 ? 487  ILE B CA  1 
ATOM   8741  C  C   . ILE B  1  459 ? 23.388  47.759  1.409   1.00 55.50 ? 487  ILE B C   1 
ATOM   8742  O  O   . ILE B  1  459 ? 24.505  47.896  1.894   1.00 56.52 ? 487  ILE B O   1 
ATOM   8743  C  CB  . ILE B  1  459 ? 22.789  50.115  1.070   1.00 53.64 ? 487  ILE B CB  1 
ATOM   8744  C  CG1 . ILE B  1  459 ? 21.766  51.216  1.327   1.00 53.63 ? 487  ILE B CG1 1 
ATOM   8745  C  CG2 . ILE B  1  459 ? 23.048  49.961  -0.392  1.00 52.82 ? 487  ILE B CG2 1 
ATOM   8746  C  CD1 . ILE B  1  459 ? 20.444  50.982  0.687   1.00 54.08 ? 487  ILE B CD1 1 
ATOM   8747  N  N   . ARG B  1  460 ? 23.068  46.726  0.655   1.00 56.08 ? 488  ARG B N   1 
ATOM   8748  C  CA  . ARG B  1  460 ? 24.056  45.703  0.385   1.00 56.78 ? 488  ARG B CA  1 
ATOM   8749  C  C   . ARG B  1  460 ? 23.969  45.303  -1.063  1.00 58.57 ? 488  ARG B C   1 
ATOM   8750  O  O   . ARG B  1  460 ? 22.933  45.480  -1.708  1.00 59.98 ? 488  ARG B O   1 
ATOM   8751  C  CB  . ARG B  1  460 ? 23.788  44.496  1.262   1.00 57.79 ? 488  ARG B CB  1 
ATOM   8752  C  CG  . ARG B  1  460 ? 23.687  44.872  2.704   1.00 61.81 ? 488  ARG B CG  1 
ATOM   8753  C  CD  . ARG B  1  460 ? 25.053  44.846  3.363   1.00 64.62 ? 488  ARG B CD  1 
ATOM   8754  N  NE  . ARG B  1  460 ? 25.466  43.461  3.585   1.00 67.00 ? 488  ARG B NE  1 
ATOM   8755  C  CZ  . ARG B  1  460 ? 26.066  43.024  4.688   1.00 66.73 ? 488  ARG B CZ  1 
ATOM   8756  N  NH1 . ARG B  1  460 ? 26.339  43.869  5.679   1.00 66.12 ? 488  ARG B NH1 1 
ATOM   8757  N  NH2 . ARG B  1  460 ? 26.345  41.730  4.816   1.00 66.56 ? 488  ARG B NH2 1 
ATOM   8758  N  N   . PHE B  1  461 ? 25.067  44.774  -1.581  1.00 58.87 ? 489  PHE B N   1 
ATOM   8759  C  CA  . PHE B  1  461 ? 25.102  44.313  -2.958  1.00 59.97 ? 489  PHE B CA  1 
ATOM   8760  C  C   . PHE B  1  461 ? 26.059  43.128  -2.969  1.00 60.42 ? 489  PHE B C   1 
ATOM   8761  O  O   . PHE B  1  461 ? 27.072  43.132  -2.259  1.00 59.64 ? 489  PHE B O   1 
ATOM   8762  C  CB  . PHE B  1  461 ? 25.552  45.451  -3.888  1.00 60.51 ? 489  PHE B CB  1 
ATOM   8763  C  CG  . PHE B  1  461 ? 26.971  45.348  -4.355  1.00 61.84 ? 489  PHE B CG  1 
ATOM   8764  C  CD1 . PHE B  1  461 ? 27.308  44.509  -5.417  1.00 61.94 ? 489  PHE B CD1 1 
ATOM   8765  C  CD2 . PHE B  1  461 ? 27.973  46.100  -3.738  1.00 62.01 ? 489  PHE B CD2 1 
ATOM   8766  C  CE1 . PHE B  1  461 ? 28.631  44.418  -5.861  1.00 62.97 ? 489  PHE B CE1 1 
ATOM   8767  C  CE2 . PHE B  1  461 ? 29.301  46.023  -4.167  1.00 62.40 ? 489  PHE B CE2 1 
ATOM   8768  C  CZ  . PHE B  1  461 ? 29.634  45.181  -5.232  1.00 63.36 ? 489  PHE B CZ  1 
ATOM   8769  N  N   . TYR B  1  462 ? 25.712  42.095  -3.733  1.00 59.13 ? 490  TYR B N   1 
ATOM   8770  C  CA  . TYR B  1  462 ? 26.551  40.909  -3.804  1.00 58.93 ? 490  TYR B CA  1 
ATOM   8771  C  C   . TYR B  1  462 ? 26.903  40.625  -5.259  1.00 59.63 ? 490  TYR B C   1 
ATOM   8772  O  O   . TYR B  1  462 ? 26.115  40.912  -6.170  1.00 60.05 ? 490  TYR B O   1 
ATOM   8773  C  CB  . TYR B  1  462 ? 25.821  39.699  -3.206  1.00 59.45 ? 490  TYR B CB  1 
ATOM   8774  C  CG  . TYR B  1  462 ? 25.192  39.922  -1.839  1.00 59.39 ? 490  TYR B CG  1 
ATOM   8775  C  CD1 . TYR B  1  462 ? 24.193  40.877  -1.660  1.00 59.55 ? 490  TYR B CD1 1 
ATOM   8776  C  CD2 . TYR B  1  462 ? 25.572  39.155  -0.731  1.00 59.17 ? 490  TYR B CD2 1 
ATOM   8777  C  CE1 . TYR B  1  462 ? 23.585  41.067  -0.422  1.00 59.12 ? 490  TYR B CE1 1 
ATOM   8778  C  CE2 . TYR B  1  462 ? 24.967  39.337  0.515   1.00 58.36 ? 490  TYR B CE2 1 
ATOM   8779  C  CZ  . TYR B  1  462 ? 23.976  40.299  0.657   1.00 59.34 ? 490  TYR B CZ  1 
ATOM   8780  O  OH  . TYR B  1  462 ? 23.371  40.523  1.871   1.00 60.21 ? 490  TYR B OH  1 
ATOM   8781  N  N   . ALA B  1  463 ? 28.098  40.085  -5.478  1.00 58.71 ? 491  ALA B N   1 
ATOM   8782  C  CA  . ALA B  1  463 ? 28.535  39.741  -6.823  1.00 58.34 ? 491  ALA B CA  1 
ATOM   8783  C  C   . ALA B  1  463 ? 28.516  38.226  -6.851  1.00 58.20 ? 491  ALA B C   1 
ATOM   8784  O  O   . ALA B  1  463 ? 29.281  37.582  -6.134  1.00 59.47 ? 491  ALA B O   1 
ATOM   8785  C  CB  . ALA B  1  463 ? 29.943  40.265  -7.080  1.00 58.42 ? 491  ALA B CB  1 
ATOM   8786  N  N   . THR B  1  464 ? 27.617  37.661  -7.653  1.00 58.24 ? 492  THR B N   1 
ATOM   8787  C  CA  . THR B  1  464 ? 27.480  36.208  -7.767  1.00 57.51 ? 492  THR B CA  1 
ATOM   8788  C  C   . THR B  1  464 ? 27.301  35.779  -9.227  1.00 57.77 ? 492  THR B C   1 
ATOM   8789  O  O   . THR B  1  464 ? 27.252  36.616  -10.131 1.00 56.88 ? 492  THR B O   1 
ATOM   8790  C  CB  . THR B  1  464 ? 26.276  35.684  -6.944  1.00 56.35 ? 492  THR B CB  1 
ATOM   8791  O  OG1 . THR B  1  464 ? 26.189  34.260  -7.076  1.00 55.50 ? 492  THR B OG1 1 
ATOM   8792  C  CG2 . THR B  1  464 ? 24.976  36.314  -7.436  1.00 56.63 ? 492  THR B CG2 1 
ATOM   8793  N  N   . GLY B  1  465 ? 27.195  34.472  -9.450  1.00 57.08 ? 493  GLY B N   1 
ATOM   8794  C  CA  . GLY B  1  465 ? 27.048  33.965  -10.801 1.00 55.18 ? 493  GLY B CA  1 
ATOM   8795  C  C   . GLY B  1  465 ? 28.381  33.473  -11.342 1.00 55.11 ? 493  GLY B C   1 
ATOM   8796  O  O   . GLY B  1  465 ? 29.170  32.845  -10.628 1.00 52.83 ? 493  GLY B O   1 
ATOM   8797  N  N   . TYR B  1  466 ? 28.635  33.774  -12.612 1.00 55.16 ? 494  TYR B N   1 
ATOM   8798  C  CA  . TYR B  1  466 ? 29.866  33.353  -13.264 1.00 55.22 ? 494  TYR B CA  1 
ATOM   8799  C  C   . TYR B  1  466 ? 30.988  34.389  -13.279 1.00 55.53 ? 494  TYR B C   1 
ATOM   8800  O  O   . TYR B  1  466 ? 30.773  35.577  -13.515 1.00 54.71 ? 494  TYR B O   1 
ATOM   8801  C  CB  . TYR B  1  466 ? 29.574  32.915  -14.699 1.00 54.22 ? 494  TYR B CB  1 
ATOM   8802  C  CG  . TYR B  1  466 ? 28.980  31.534  -14.806 1.00 54.34 ? 494  TYR B CG  1 
ATOM   8803  C  CD1 . TYR B  1  466 ? 27.639  31.348  -15.148 1.00 54.59 ? 494  TYR B CD1 1 
ATOM   8804  C  CD2 . TYR B  1  466 ? 29.767  30.406  -14.585 1.00 55.01 ? 494  TYR B CD2 1 
ATOM   8805  C  CE1 . TYR B  1  466 ? 27.089  30.055  -15.275 1.00 55.65 ? 494  TYR B CE1 1 
ATOM   8806  C  CE2 . TYR B  1  466 ? 29.236  29.110  -14.707 1.00 56.57 ? 494  TYR B CE2 1 
ATOM   8807  C  CZ  . TYR B  1  466 ? 27.897  28.932  -15.057 1.00 56.97 ? 494  TYR B CZ  1 
ATOM   8808  O  OH  . TYR B  1  466 ? 27.405  27.637  -15.218 1.00 56.39 ? 494  TYR B OH  1 
ATOM   8809  N  N   . ILE B  1  467 ? 32.198  33.914  -13.026 1.00 54.37 ? 495  ILE B N   1 
ATOM   8810  C  CA  . ILE B  1  467 ? 33.353  34.779  -13.029 1.00 53.90 ? 495  ILE B CA  1 
ATOM   8811  C  C   . ILE B  1  467 ? 33.871  34.760  -14.440 1.00 55.46 ? 495  ILE B C   1 
ATOM   8812  O  O   . ILE B  1  467 ? 33.520  33.867  -15.214 1.00 53.77 ? 495  ILE B O   1 
ATOM   8813  C  CB  . ILE B  1  467 ? 34.459  34.236  -12.155 1.00 55.26 ? 495  ILE B CB  1 
ATOM   8814  C  CG1 . ILE B  1  467 ? 34.660  32.759  -12.492 1.00 54.70 ? 495  ILE B CG1 1 
ATOM   8815  C  CG2 . ILE B  1  467 ? 34.152  34.497  -10.681 1.00 54.89 ? 495  ILE B CG2 1 
ATOM   8816  C  CD1 . ILE B  1  467 ? 35.960  32.185  -11.966 1.00 56.12 ? 495  ILE B CD1 1 
ATOM   8817  N  N   . SER B  1  468 ? 34.712  35.743  -14.765 1.00 56.80 ? 496  SER B N   1 
ATOM   8818  C  CA  . SER B  1  468 ? 35.310  35.840  -16.093 1.00 55.82 ? 496  SER B CA  1 
ATOM   8819  C  C   . SER B  1  468 ? 36.644  35.097  -16.053 1.00 56.41 ? 496  SER B C   1 
ATOM   8820  O  O   . SER B  1  468 ? 37.507  35.410  -15.223 1.00 57.07 ? 496  SER B O   1 
ATOM   8821  C  CB  . SER B  1  468 ? 35.527  37.310  -16.470 1.00 56.00 ? 496  SER B CB  1 
ATOM   8822  O  OG  . SER B  1  468 ? 34.287  38.004  -16.556 1.00 56.93 ? 496  SER B OG  1 
ATOM   8823  N  N   . SER B  1  469 ? 36.788  34.097  -16.928 1.00 56.78 ? 497  SER B N   1 
ATOM   8824  C  CA  . SER B  1  469 ? 38.009  33.284  -17.010 1.00 56.48 ? 497  SER B CA  1 
ATOM   8825  C  C   . SER B  1  469 ? 38.697  33.421  -18.370 1.00 56.58 ? 497  SER B C   1 
ATOM   8826  O  O   . SER B  1  469 ? 38.059  33.754  -19.363 1.00 56.47 ? 497  SER B O   1 
ATOM   8827  C  CB  . SER B  1  469 ? 37.688  31.804  -16.754 1.00 55.97 ? 497  SER B CB  1 
ATOM   8828  O  OG  . SER B  1  469 ? 36.878  31.247  -17.773 1.00 53.56 ? 497  SER B OG  1 
ATOM   8829  N  N   . ALA B  1  470 ? 40.001  33.174  -18.412 1.00 57.22 ? 498  ALA B N   1 
ATOM   8830  C  CA  . ALA B  1  470 ? 40.741  33.264  -19.666 1.00 58.07 ? 498  ALA B CA  1 
ATOM   8831  C  C   . ALA B  1  470 ? 41.500  31.968  -19.898 1.00 58.06 ? 498  ALA B C   1 
ATOM   8832  O  O   . ALA B  1  470 ? 41.450  31.055  -19.072 1.00 57.73 ? 498  ALA B O   1 
ATOM   8833  C  CB  . ALA B  1  470 ? 41.709  34.444  -19.634 1.00 57.69 ? 498  ALA B CB  1 
ATOM   8834  N  N   . PHE B  1  471 ? 42.195  31.871  -21.024 1.00 58.38 ? 499  PHE B N   1 
ATOM   8835  C  CA  . PHE B  1  471 ? 42.939  30.655  -21.273 1.00 60.09 ? 499  PHE B CA  1 
ATOM   8836  C  C   . PHE B  1  471 ? 44.177  30.590  -20.389 1.00 60.63 ? 499  PHE B C   1 
ATOM   8837  O  O   . PHE B  1  471 ? 44.929  31.565  -20.235 1.00 59.13 ? 499  PHE B O   1 
ATOM   8838  C  CB  . PHE B  1  471 ? 43.369  30.534  -22.733 1.00 61.55 ? 499  PHE B CB  1 
ATOM   8839  C  CG  . PHE B  1  471 ? 44.199  29.299  -23.008 1.00 61.68 ? 499  PHE B CG  1 
ATOM   8840  C  CD1 . PHE B  1  471 ? 43.635  28.023  -22.887 1.00 61.62 ? 499  PHE B CD1 1 
ATOM   8841  C  CD2 . PHE B  1  471 ? 45.556  29.407  -23.328 1.00 60.67 ? 499  PHE B CD2 1 
ATOM   8842  C  CE1 . PHE B  1  471 ? 44.418  26.868  -23.079 1.00 61.12 ? 499  PHE B CE1 1 
ATOM   8843  C  CE2 . PHE B  1  471 ? 46.344  28.267  -23.520 1.00 61.04 ? 499  PHE B CE2 1 
ATOM   8844  C  CZ  . PHE B  1  471 ? 45.774  26.994  -23.395 1.00 61.32 ? 499  PHE B CZ  1 
ATOM   8845  N  N   . LEU B  1  472 ? 44.386  29.413  -19.820 1.00 60.62 ? 500  LEU B N   1 
ATOM   8846  C  CA  . LEU B  1  472 ? 45.512  29.205  -18.953 1.00 60.63 ? 500  LEU B CA  1 
ATOM   8847  C  C   . LEU B  1  472 ? 46.740  28.744  -19.699 1.00 61.21 ? 500  LEU B C   1 
ATOM   8848  O  O   . LEU B  1  472 ? 46.752  27.691  -20.335 1.00 61.48 ? 500  LEU B O   1 
ATOM   8849  C  CB  . LEU B  1  472 ? 45.163  28.193  -17.875 1.00 59.91 ? 500  LEU B CB  1 
ATOM   8850  C  CG  . LEU B  1  472 ? 46.290  27.953  -16.878 1.00 60.30 ? 500  LEU B CG  1 
ATOM   8851  C  CD1 . LEU B  1  472 ? 46.990  29.257  -16.508 1.00 59.84 ? 500  LEU B CD1 1 
ATOM   8852  C  CD2 . LEU B  1  472 ? 45.703  27.291  -15.658 1.00 61.23 ? 500  LEU B CD2 1 
ATOM   8853  N  N   . PHE B  1  473 ? 47.774  29.563  -19.617 1.00 61.09 ? 501  PHE B N   1 
ATOM   8854  C  CA  . PHE B  1  473 ? 49.049  29.261  -20.232 1.00 61.76 ? 501  PHE B CA  1 
ATOM   8855  C  C   . PHE B  1  473 ? 50.084  29.997  -19.388 1.00 63.48 ? 501  PHE B C   1 
ATOM   8856  O  O   . PHE B  1  473 ? 49.878  31.149  -18.984 1.00 62.38 ? 501  PHE B O   1 
ATOM   8857  C  CB  . PHE B  1  473 ? 49.099  29.758  -21.678 1.00 60.95 ? 501  PHE B CB  1 
ATOM   8858  C  CG  . PHE B  1  473 ? 49.061  31.252  -21.804 1.00 61.66 ? 501  PHE B CG  1 
ATOM   8859  C  CD1 . PHE B  1  473 ? 47.850  31.924  -21.931 1.00 61.79 ? 501  PHE B CD1 1 
ATOM   8860  C  CD2 . PHE B  1  473 ? 50.240  31.996  -21.764 1.00 61.25 ? 501  PHE B CD2 1 
ATOM   8861  C  CE1 . PHE B  1  473 ? 47.815  33.320  -22.017 1.00 61.86 ? 501  PHE B CE1 1 
ATOM   8862  C  CE2 . PHE B  1  473 ? 50.217  33.387  -21.847 1.00 59.75 ? 501  PHE B CE2 1 
ATOM   8863  C  CZ  . PHE B  1  473 ? 49.006  34.051  -21.973 1.00 60.37 ? 501  PHE B CZ  1 
ATOM   8864  N  N   . GLY B  1  474 ? 51.189  29.325  -19.096 1.00 64.26 ? 502  GLY B N   1 
ATOM   8865  C  CA  . GLY B  1  474 ? 52.224  29.961  -18.300 1.00 64.50 ? 502  GLY B CA  1 
ATOM   8866  C  C   . GLY B  1  474 ? 52.096  29.797  -16.789 1.00 64.66 ? 502  GLY B C   1 
ATOM   8867  O  O   . GLY B  1  474 ? 51.185  29.128  -16.279 1.00 62.46 ? 502  GLY B O   1 
ATOM   8868  N  N   . ALA B  1  475 ? 53.030  30.421  -16.072 1.00 65.16 ? 503  ALA B N   1 
ATOM   8869  C  CA  . ALA B  1  475 ? 53.061  30.363  -14.616 1.00 65.76 ? 503  ALA B CA  1 
ATOM   8870  C  C   . ALA B  1  475 ? 51.873  31.113  -14.011 1.00 67.73 ? 503  ALA B C   1 
ATOM   8871  O  O   . ALA B  1  475 ? 51.732  32.346  -14.166 1.00 67.43 ? 503  ALA B O   1 
ATOM   8872  C  CB  . ALA B  1  475 ? 54.385  30.952  -14.092 1.00 66.12 ? 503  ALA B CB  1 
ATOM   8873  N  N   . THR B  1  476 ? 51.004  30.358  -13.346 1.00 66.58 ? 504  THR B N   1 
ATOM   8874  C  CA  . THR B  1  476 ? 49.844  30.945  -12.692 1.00 67.87 ? 504  THR B CA  1 
ATOM   8875  C  C   . THR B  1  476 ? 50.372  31.600  -11.415 1.00 67.04 ? 504  THR B C   1 
ATOM   8876  O  O   . THR B  1  476 ? 50.383  31.005  -10.330 1.00 66.46 ? 504  THR B O   1 
ATOM   8877  C  CB  . THR B  1  476 ? 48.781  29.857  -12.381 1.00 67.85 ? 504  THR B CB  1 
ATOM   8878  O  OG1 . THR B  1  476 ? 48.107  29.505  -13.599 1.00 67.85 ? 504  THR B OG1 1 
ATOM   8879  C  CG2 . THR B  1  476 ? 47.761  30.351  -11.344 1.00 65.95 ? 504  THR B CG2 1 
ATOM   8880  N  N   . GLY B  1  477 ? 50.852  32.827  -11.569 1.00 66.13 ? 505  GLY B N   1 
ATOM   8881  C  CA  . GLY B  1  477 ? 51.381  33.527  -10.431 1.00 63.79 ? 505  GLY B CA  1 
ATOM   8882  C  C   . GLY B  1  477 ? 50.585  34.765  -10.106 1.00 64.45 ? 505  GLY B C   1 
ATOM   8883  O  O   . GLY B  1  477 ? 49.706  34.766  -9.236  1.00 65.02 ? 505  GLY B O   1 
ATOM   8884  N  N   . LYS B  1  478 ? 50.873  35.820  -10.852 1.00 63.40 ? 506  LYS B N   1 
ATOM   8885  C  CA  . LYS B  1  478 ? 50.260  37.111  -10.605 1.00 62.11 ? 506  LYS B CA  1 
ATOM   8886  C  C   . LYS B  1  478 ? 49.002  37.539  -11.346 1.00 61.81 ? 506  LYS B C   1 
ATOM   8887  O  O   . LYS B  1  478 ? 48.806  38.738  -11.564 1.00 62.15 ? 506  LYS B O   1 
ATOM   8888  C  CB  . LYS B  1  478 ? 51.336  38.179  -10.771 1.00 62.43 ? 506  LYS B CB  1 
ATOM   8889  C  CG  . LYS B  1  478 ? 52.412  37.761  -11.744 1.00 63.74 ? 506  LYS B CG  1 
ATOM   8890  C  CD  . LYS B  1  478 ? 53.666  38.575  -11.550 1.00 65.42 ? 506  LYS B CD  1 
ATOM   8891  C  CE  . LYS B  1  478 ? 54.783  38.070  -12.449 1.00 67.01 ? 506  LYS B CE  1 
ATOM   8892  N  NZ  . LYS B  1  478 ? 55.983  38.940  -12.311 1.00 67.25 ? 506  LYS B NZ  1 
ATOM   8893  N  N   . TYR B  1  479 ? 48.132  36.602  -11.711 1.00 60.00 ? 507  TYR B N   1 
ATOM   8894  C  CA  . TYR B  1  479 ? 46.914  37.004  -12.407 1.00 59.11 ? 507  TYR B CA  1 
ATOM   8895  C  C   . TYR B  1  479 ? 45.719  36.200  -11.947 1.00 59.21 ? 507  TYR B C   1 
ATOM   8896  O  O   . TYR B  1  479 ? 44.578  36.480  -12.323 1.00 58.67 ? 507  TYR B O   1 
ATOM   8897  C  CB  . TYR B  1  479 ? 47.121  36.879  -13.914 1.00 59.75 ? 507  TYR B CB  1 
ATOM   8898  C  CG  . TYR B  1  479 ? 48.335  37.660  -14.367 1.00 60.42 ? 507  TYR B CG  1 
ATOM   8899  C  CD1 . TYR B  1  479 ? 48.310  39.055  -14.416 1.00 60.24 ? 507  TYR B CD1 1 
ATOM   8900  C  CD2 . TYR B  1  479 ? 49.542  37.012  -14.650 1.00 59.48 ? 507  TYR B CD2 1 
ATOM   8901  C  CE1 . TYR B  1  479 ? 49.455  39.781  -14.728 1.00 59.86 ? 507  TYR B CE1 1 
ATOM   8902  C  CE2 . TYR B  1  479 ? 50.690  37.730  -14.961 1.00 58.43 ? 507  TYR B CE2 1 
ATOM   8903  C  CZ  . TYR B  1  479 ? 50.641  39.111  -14.996 1.00 59.55 ? 507  TYR B CZ  1 
ATOM   8904  O  OH  . TYR B  1  479 ? 51.783  39.831  -15.277 1.00 60.41 ? 507  TYR B OH  1 
ATOM   8905  N  N   . GLY B  1  480 ? 45.986  35.206  -11.110 1.00 59.69 ? 508  GLY B N   1 
ATOM   8906  C  CA  . GLY B  1  480 ? 44.912  34.381  -10.602 1.00 57.84 ? 508  GLY B CA  1 
ATOM   8907  C  C   . GLY B  1  480 ? 45.350  32.975  -10.266 1.00 57.62 ? 508  GLY B C   1 
ATOM   8908  O  O   . GLY B  1  480 ? 46.544  32.691  -10.129 1.00 57.19 ? 508  GLY B O   1 
ATOM   8909  N  N   . ASN B  1  481 ? 44.359  32.099  -10.129 1.00 57.64 ? 509  ASN B N   1 
ATOM   8910  C  CA  . ASN B  1  481 ? 44.575  30.690  -9.809  1.00 57.22 ? 509  ASN B CA  1 
ATOM   8911  C  C   . ASN B  1  481 ? 43.894  29.845  -10.892 1.00 55.30 ? 509  ASN B C   1 
ATOM   8912  O  O   . ASN B  1  481 ? 43.007  30.329  -11.586 1.00 54.90 ? 509  ASN B O   1 
ATOM   8913  C  CB  . ASN B  1  481 ? 43.928  30.338  -8.455  1.00 55.29 ? 509  ASN B CB  1 
ATOM   8914  C  CG  . ASN B  1  481 ? 44.263  31.325  -7.352  1.00 54.74 ? 509  ASN B CG  1 
ATOM   8915  O  OD1 . ASN B  1  481 ? 45.402  31.409  -6.894  1.00 55.21 ? 509  ASN B OD1 1 
ATOM   8916  N  ND2 . ASN B  1  481 ? 43.258  32.071  -6.910  1.00 54.18 ? 509  ASN B ND2 1 
ATOM   8917  N  N   . GLN B  1  482 ? 44.311  28.595  -11.058 1.00 55.86 ? 510  GLN B N   1 
ATOM   8918  C  CA  . GLN B  1  482 ? 43.629  27.752  -12.020 1.00 55.84 ? 510  GLN B CA  1 
ATOM   8919  C  C   . GLN B  1  482 ? 42.443  27.187  -11.243 1.00 57.36 ? 510  GLN B C   1 
ATOM   8920  O  O   . GLN B  1  482 ? 42.608  26.594  -10.166 1.00 55.04 ? 510  GLN B O   1 
ATOM   8921  C  CB  . GLN B  1  482 ? 44.511  26.615  -12.517 1.00 54.85 ? 510  GLN B CB  1 
ATOM   8922  C  CG  . GLN B  1  482 ? 43.741  25.633  -13.389 1.00 54.98 ? 510  GLN B CG  1 
ATOM   8923  C  CD  . GLN B  1  482 ? 44.631  24.575  -13.993 1.00 55.17 ? 510  GLN B CD  1 
ATOM   8924  O  OE1 . GLN B  1  482 ? 45.527  24.059  -13.326 1.00 55.31 ? 510  GLN B OE1 1 
ATOM   8925  N  NE2 . GLN B  1  482 ? 44.387  24.235  -15.257 1.00 54.57 ? 510  GLN B NE2 1 
ATOM   8926  N  N   . VAL B  1  483 ? 41.249  27.397  -11.791 1.00 57.56 ? 511  VAL B N   1 
ATOM   8927  C  CA  . VAL B  1  483 ? 40.004  26.952  -11.175 1.00 56.81 ? 511  VAL B CA  1 
ATOM   8928  C  C   . VAL B  1  483 ? 39.460  25.707  -11.872 1.00 58.04 ? 511  VAL B C   1 
ATOM   8929  O  O   . VAL B  1  483 ? 38.586  25.013  -11.342 1.00 57.62 ? 511  VAL B O   1 
ATOM   8930  C  CB  . VAL B  1  483 ? 38.956  28.078  -11.240 1.00 56.76 ? 511  VAL B CB  1 
ATOM   8931  C  CG1 . VAL B  1  483 ? 39.553  29.357  -10.681 1.00 57.01 ? 511  VAL B CG1 1 
ATOM   8932  C  CG2 . VAL B  1  483 ? 38.509  28.309  -12.673 1.00 57.20 ? 511  VAL B CG2 1 
ATOM   8933  N  N   . SER B  1  484 ? 39.982  25.458  -13.074 1.00 59.55 ? 512  SER B N   1 
ATOM   8934  C  CA  . SER B  1  484 ? 39.633  24.303  -13.902 1.00 60.16 ? 512  SER B CA  1 
ATOM   8935  C  C   . SER B  1  484 ? 40.668  24.220  -15.032 1.00 60.21 ? 512  SER B C   1 
ATOM   8936  O  O   . SER B  1  484 ? 41.306  25.224  -15.370 1.00 60.98 ? 512  SER B O   1 
ATOM   8937  C  CB  . SER B  1  484 ? 38.186  24.404  -14.454 1.00 59.21 ? 512  SER B CB  1 
ATOM   8938  O  OG  . SER B  1  484 ? 38.014  25.421  -15.425 1.00 59.80 ? 512  SER B OG  1 
ATOM   8939  N  N   . GLU B  1  485 ? 40.842  23.028  -15.600 1.00 60.98 ? 513  GLU B N   1 
ATOM   8940  C  CA  . GLU B  1  485 ? 41.828  22.819  -16.659 1.00 62.50 ? 513  GLU B CA  1 
ATOM   8941  C  C   . GLU B  1  485 ? 41.822  23.913  -17.714 1.00 62.45 ? 513  GLU B C   1 
ATOM   8942  O  O   . GLU B  1  485 ? 40.776  24.280  -18.261 1.00 60.84 ? 513  GLU B O   1 
ATOM   8943  C  CB  . GLU B  1  485 ? 41.641  21.464  -17.360 1.00 61.16 ? 513  GLU B CB  1 
ATOM   8944  C  CG  . GLU B  1  485 ? 40.661  20.527  -16.704 1.00 63.86 ? 513  GLU B CG  1 
ATOM   8945  C  CD  . GLU B  1  485 ? 39.241  21.072  -16.725 1.00 66.25 ? 513  GLU B CD  1 
ATOM   8946  O  OE1 . GLU B  1  485 ? 38.753  21.404  -17.833 1.00 66.40 ? 513  GLU B OE1 1 
ATOM   8947  O  OE2 . GLU B  1  485 ? 38.613  21.165  -15.638 1.00 66.66 ? 513  GLU B OE2 1 
ATOM   8948  N  N   . HIS B  1  486 ? 43.013  24.443  -17.970 1.00 61.78 ? 514  HIS B N   1 
ATOM   8949  C  CA  . HIS B  1  486 ? 43.201  25.466  -18.979 1.00 62.22 ? 514  HIS B CA  1 
ATOM   8950  C  C   . HIS B  1  486 ? 42.389  26.730  -18.711 1.00 62.08 ? 514  HIS B C   1 
ATOM   8951  O  O   . HIS B  1  486 ? 42.370  27.660  -19.528 1.00 62.35 ? 514  HIS B O   1 
ATOM   8952  C  CB  . HIS B  1  486 ? 42.844  24.874  -20.348 1.00 63.70 ? 514  HIS B CB  1 
ATOM   8953  C  CG  . HIS B  1  486 ? 43.450  23.524  -20.592 1.00 64.57 ? 514  HIS B CG  1 
ATOM   8954  N  ND1 . HIS B  1  486 ? 44.798  23.271  -20.428 1.00 65.68 ? 514  HIS B ND1 1 
ATOM   8955  C  CD2 . HIS B  1  486 ? 42.892  22.349  -20.967 1.00 63.82 ? 514  HIS B CD2 1 
ATOM   8956  C  CE1 . HIS B  1  486 ? 45.044  21.998  -20.690 1.00 64.40 ? 514  HIS B CE1 1 
ATOM   8957  N  NE2 . HIS B  1  486 ? 43.904  21.418  -21.019 1.00 65.35 ? 514  HIS B NE2 1 
ATOM   8958  N  N   . THR B  1  487 ? 41.715  26.775  -17.570 1.00 59.42 ? 515  THR B N   1 
ATOM   8959  C  CA  . THR B  1  487 ? 40.940  27.954  -17.268 1.00 59.33 ? 515  THR B CA  1 
ATOM   8960  C  C   . THR B  1  487 ? 41.527  28.631  -16.053 1.00 58.78 ? 515  THR B C   1 
ATOM   8961  O  O   . THR B  1  487 ? 41.806  27.994  -15.037 1.00 58.17 ? 515  THR B O   1 
ATOM   8962  C  CB  . THR B  1  487 ? 39.475  27.618  -17.025 1.00 61.72 ? 515  THR B CB  1 
ATOM   8963  O  OG1 . THR B  1  487 ? 39.149  26.392  -17.698 1.00 63.55 ? 515  THR B OG1 1 
ATOM   8964  C  CG2 . THR B  1  487 ? 38.591  28.736  -17.579 1.00 60.65 ? 515  THR B CG2 1 
ATOM   8965  N  N   . LEU B  1  488 ? 41.721  29.938  -16.188 1.00 59.19 ? 516  LEU B N   1 
ATOM   8966  C  CA  . LEU B  1  488 ? 42.304  30.778  -15.144 1.00 58.27 ? 516  LEU B CA  1 
ATOM   8967  C  C   . LEU B  1  488 ? 41.359  31.837  -14.561 1.00 58.57 ? 516  LEU B C   1 
ATOM   8968  O  O   . LEU B  1  488 ? 40.759  32.643  -15.292 1.00 56.68 ? 516  LEU B O   1 
ATOM   8969  C  CB  . LEU B  1  488 ? 43.542  31.491  -15.692 1.00 57.38 ? 516  LEU B CB  1 
ATOM   8970  C  CG  . LEU B  1  488 ? 43.974  32.759  -14.952 1.00 57.25 ? 516  LEU B CG  1 
ATOM   8971  C  CD1 . LEU B  1  488 ? 44.932  32.414  -13.819 1.00 57.56 ? 516  LEU B CD1 1 
ATOM   8972  C  CD2 . LEU B  1  488 ? 44.631  33.702  -15.940 1.00 57.65 ? 516  LEU B CD2 1 
ATOM   8973  N  N   . GLY B  1  489 ? 41.247  31.829  -13.235 1.00 56.59 ? 517  GLY B N   1 
ATOM   8974  C  CA  . GLY B  1  489 ? 40.422  32.805  -12.563 1.00 54.60 ? 517  GLY B CA  1 
ATOM   8975  C  C   . GLY B  1  489 ? 41.216  34.090  -12.595 1.00 54.22 ? 517  GLY B C   1 
ATOM   8976  O  O   . GLY B  1  489 ? 42.281  34.198  -11.977 1.00 52.73 ? 517  GLY B O   1 
ATOM   8977  N  N   . THR B  1  490 ? 40.711  35.060  -13.343 1.00 52.81 ? 518  THR B N   1 
ATOM   8978  C  CA  . THR B  1  490 ? 41.385  36.332  -13.453 1.00 51.58 ? 518  THR B CA  1 
ATOM   8979  C  C   . THR B  1  490 ? 41.064  37.208  -12.271 1.00 52.41 ? 518  THR B C   1 
ATOM   8980  O  O   . THR B  1  490 ? 39.899  37.340  -11.876 1.00 51.85 ? 518  THR B O   1 
ATOM   8981  C  CB  . THR B  1  490 ? 40.970  37.077  -14.707 1.00 52.51 ? 518  THR B CB  1 
ATOM   8982  O  OG1 . THR B  1  490 ? 39.543  37.015  -14.844 1.00 53.00 ? 518  THR B OG1 1 
ATOM   8983  C  CG2 . THR B  1  490 ? 41.650  36.480  -15.918 1.00 53.10 ? 518  THR B CG2 1 
ATOM   8984  N  N   . VAL B  1  491 ? 42.116  37.794  -11.710 1.00 51.17 ? 519  VAL B N   1 
ATOM   8985  C  CA  . VAL B  1  491 ? 41.995  38.695  -10.581 1.00 50.08 ? 519  VAL B CA  1 
ATOM   8986  C  C   . VAL B  1  491 ? 41.283  39.967  -11.058 1.00 48.83 ? 519  VAL B C   1 
ATOM   8987  O  O   . VAL B  1  491 ? 41.397  40.359  -12.216 1.00 48.53 ? 519  VAL B O   1 
ATOM   8988  C  CB  . VAL B  1  491 ? 43.399  39.021  -10.002 1.00 49.04 ? 519  VAL B CB  1 
ATOM   8989  C  CG1 . VAL B  1  491 ? 44.406  39.190  -11.118 1.00 48.77 ? 519  VAL B CG1 1 
ATOM   8990  C  CG2 . VAL B  1  491 ? 43.341  40.278  -9.171  1.00 50.47 ? 519  VAL B CG2 1 
ATOM   8991  N  N   . HIS B  1  492 ? 40.537  40.603  -10.166 1.00 48.36 ? 520  HIS B N   1 
ATOM   8992  C  CA  . HIS B  1  492 ? 39.801  41.807  -10.520 1.00 47.87 ? 520  HIS B CA  1 
ATOM   8993  C  C   . HIS B  1  492 ? 39.193  42.434  -9.279  1.00 48.51 ? 520  HIS B C   1 
ATOM   8994  O  O   . HIS B  1  492 ? 39.031  41.773  -8.256  1.00 48.90 ? 520  HIS B O   1 
ATOM   8995  C  CB  . HIS B  1  492 ? 38.668  41.462  -11.481 1.00 49.95 ? 520  HIS B CB  1 
ATOM   8996  C  CG  . HIS B  1  492 ? 37.737  40.411  -10.959 1.00 51.22 ? 520  HIS B CG  1 
ATOM   8997  N  ND1 . HIS B  1  492 ? 37.972  39.061  -11.119 1.00 52.51 ? 520  HIS B ND1 1 
ATOM   8998  C  CD2 . HIS B  1  492 ? 36.591  40.510  -10.244 1.00 50.75 ? 520  HIS B CD2 1 
ATOM   8999  C  CE1 . HIS B  1  492 ? 37.010  38.375  -10.528 1.00 52.96 ? 520  HIS B CE1 1 
ATOM   9000  N  NE2 . HIS B  1  492 ? 36.161  39.230  -9.988  1.00 52.21 ? 520  HIS B NE2 1 
ATOM   9001  N  N   . THR B  1  493 ? 38.846  43.713  -9.371  1.00 48.68 ? 521  THR B N   1 
ATOM   9002  C  CA  . THR B  1  493 ? 38.226  44.394  -8.247  1.00 47.60 ? 521  THR B CA  1 
ATOM   9003  C  C   . THR B  1  493 ? 36.800  44.751  -8.632  1.00 48.13 ? 521  THR B C   1 
ATOM   9004  O  O   . THR B  1  493 ? 36.518  45.020  -9.801  1.00 48.22 ? 521  THR B O   1 
ATOM   9005  C  CB  . THR B  1  493 ? 38.977  45.694  -7.871  1.00 46.35 ? 521  THR B CB  1 
ATOM   9006  O  OG1 . THR B  1  493 ? 38.892  46.636  -8.942  1.00 46.69 ? 521  THR B OG1 1 
ATOM   9007  C  CG2 . THR B  1  493 ? 40.426  45.402  -7.595  1.00 46.50 ? 521  THR B CG2 1 
ATOM   9008  N  N   . HIS B  1  494 ? 35.899  44.712  -7.655  1.00 47.64 ? 522  HIS B N   1 
ATOM   9009  C  CA  . HIS B  1  494 ? 34.498  45.086  -7.860  1.00 47.25 ? 522  HIS B CA  1 
ATOM   9010  C  C   . HIS B  1  494 ? 34.348  46.358  -7.018  1.00 47.17 ? 522  HIS B C   1 
ATOM   9011  O  O   . HIS B  1  494 ? 34.993  46.480  -5.971  1.00 47.58 ? 522  HIS B O   1 
ATOM   9012  C  CB  . HIS B  1  494 ? 33.540  44.025  -7.299  1.00 50.02 ? 522  HIS B CB  1 
ATOM   9013  C  CG  . HIS B  1  494 ? 33.650  42.674  -7.940  1.00 50.10 ? 522  HIS B CG  1 
ATOM   9014  N  ND1 . HIS B  1  494 ? 32.950  42.331  -9.078  1.00 49.93 ? 522  HIS B ND1 1 
ATOM   9015  C  CD2 . HIS B  1  494 ? 34.306  41.554  -7.549  1.00 48.77 ? 522  HIS B CD2 1 
ATOM   9016  C  CE1 . HIS B  1  494 ? 33.164  41.056  -9.351  1.00 50.33 ? 522  HIS B CE1 1 
ATOM   9017  N  NE2 . HIS B  1  494 ? 33.982  40.562  -8.438  1.00 49.52 ? 522  HIS B NE2 1 
ATOM   9018  N  N   . SER B  1  495 ? 33.521  47.301  -7.465  1.00 47.30 ? 523  SER B N   1 
ATOM   9019  C  CA  . SER B  1  495 ? 33.306  48.552  -6.727  1.00 46.62 ? 523  SER B CA  1 
ATOM   9020  C  C   . SER B  1  495 ? 32.009  49.162  -7.222  1.00 46.54 ? 523  SER B C   1 
ATOM   9021  O  O   . SER B  1  495 ? 31.804  49.268  -8.425  1.00 47.37 ? 523  SER B O   1 
ATOM   9022  C  CB  . SER B  1  495 ? 34.436  49.575  -6.980  1.00 46.63 ? 523  SER B CB  1 
ATOM   9023  O  OG  . SER B  1  495 ? 35.739  49.010  -6.935  1.00 45.74 ? 523  SER B OG  1 
ATOM   9024  N  N   . ALA B  1  496 ? 31.138  49.562  -6.303  1.00 47.15 ? 524  ALA B N   1 
ATOM   9025  C  CA  . ALA B  1  496 ? 29.865  50.186  -6.660  1.00 45.82 ? 524  ALA B CA  1 
ATOM   9026  C  C   . ALA B  1  496 ? 29.826  51.548  -5.983  1.00 46.94 ? 524  ALA B C   1 
ATOM   9027  O  O   . ALA B  1  496 ? 30.465  51.750  -4.950  1.00 47.23 ? 524  ALA B O   1 
ATOM   9028  C  CB  . ALA B  1  496 ? 28.691  49.329  -6.186  1.00 45.61 ? 524  ALA B CB  1 
ATOM   9029  N  N   . HIS B  1  497 ? 29.086  52.485  -6.561  1.00 47.24 ? 525  HIS B N   1 
ATOM   9030  C  CA  . HIS B  1  497 ? 29.002  53.815  -5.984  1.00 45.82 ? 525  HIS B CA  1 
ATOM   9031  C  C   . HIS B  1  497 ? 27.556  54.087  -5.691  1.00 45.23 ? 525  HIS B C   1 
ATOM   9032  O  O   . HIS B  1  497 ? 26.695  53.737  -6.485  1.00 45.87 ? 525  HIS B O   1 
ATOM   9033  C  CB  . HIS B  1  497 ? 29.512  54.864  -6.968  1.00 45.34 ? 525  HIS B CB  1 
ATOM   9034  C  CG  . HIS B  1  497 ? 29.878  56.162  -6.322  1.00 47.17 ? 525  HIS B CG  1 
ATOM   9035  N  ND1 . HIS B  1  497 ? 29.899  57.357  -7.009  1.00 46.72 ? 525  HIS B ND1 1 
ATOM   9036  C  CD2 . HIS B  1  497 ? 30.268  56.448  -5.055  1.00 47.17 ? 525  HIS B CD2 1 
ATOM   9037  C  CE1 . HIS B  1  497 ? 30.285  58.323  -6.194  1.00 46.77 ? 525  HIS B CE1 1 
ATOM   9038  N  NE2 . HIS B  1  497 ? 30.516  57.797  -5.003  1.00 47.08 ? 525  HIS B NE2 1 
ATOM   9039  N  N   . PHE B  1  498 ? 27.280  54.696  -4.549  1.00 45.62 ? 526  PHE B N   1 
ATOM   9040  C  CA  . PHE B  1  498 ? 25.902  55.012  -4.218  1.00 45.93 ? 526  PHE B CA  1 
ATOM   9041  C  C   . PHE B  1  498 ? 25.743  56.469  -3.835  1.00 46.77 ? 526  PHE B C   1 
ATOM   9042  O  O   . PHE B  1  498 ? 26.624  57.069  -3.213  1.00 46.41 ? 526  PHE B O   1 
ATOM   9043  C  CB  . PHE B  1  498 ? 25.396  54.148  -3.072  1.00 43.79 ? 526  PHE B CB  1 
ATOM   9044  C  CG  . PHE B  1  498 ? 25.512  52.680  -3.325  1.00 45.29 ? 526  PHE B CG  1 
ATOM   9045  C  CD1 . PHE B  1  498 ? 26.732  52.021  -3.147  1.00 45.80 ? 526  PHE B CD1 1 
ATOM   9046  C  CD2 . PHE B  1  498 ? 24.398  51.938  -3.706  1.00 44.96 ? 526  PHE B CD2 1 
ATOM   9047  C  CE1 . PHE B  1  498 ? 26.839  50.636  -3.339  1.00 44.76 ? 526  PHE B CE1 1 
ATOM   9048  C  CE2 . PHE B  1  498 ? 24.491  50.558  -3.902  1.00 44.71 ? 526  PHE B CE2 1 
ATOM   9049  C  CZ  . PHE B  1  498 ? 25.713  49.904  -3.716  1.00 44.46 ? 526  PHE B CZ  1 
ATOM   9050  N  N   . LYS B  1  499 ? 24.609  57.033  -4.227  1.00 45.45 ? 527  LYS B N   1 
ATOM   9051  C  CA  . LYS B  1  499 ? 24.280  58.411  -3.911  1.00 45.48 ? 527  LYS B CA  1 
ATOM   9052  C  C   . LYS B  1  499 ? 23.351  58.266  -2.729  1.00 46.91 ? 527  LYS B C   1 
ATOM   9053  O  O   . LYS B  1  499 ? 22.368  57.542  -2.816  1.00 49.12 ? 527  LYS B O   1 
ATOM   9054  C  CB  . LYS B  1  499 ? 23.543  59.060  -5.086  1.00 47.39 ? 527  LYS B CB  1 
ATOM   9055  C  CG  . LYS B  1  499 ? 22.990  60.458  -4.836  1.00 46.64 ? 527  LYS B CG  1 
ATOM   9056  C  CD  . LYS B  1  499 ? 22.586  61.129  -6.156  1.00 46.87 ? 527  LYS B CD  1 
ATOM   9057  C  CE  . LYS B  1  499 ? 21.887  62.459  -5.930  1.00 45.82 ? 527  LYS B CE  1 
ATOM   9058  N  NZ  . LYS B  1  499 ? 21.896  63.288  -7.151  1.00 46.66 ? 527  LYS B NZ  1 
ATOM   9059  N  N   . VAL B  1  500 ? 23.667  58.917  -1.616  1.00 48.23 ? 528  VAL B N   1 
ATOM   9060  C  CA  . VAL B  1  500 ? 22.824  58.823  -0.435  1.00 45.62 ? 528  VAL B CA  1 
ATOM   9061  C  C   . VAL B  1  500 ? 22.391  60.227  -0.085  1.00 46.32 ? 528  VAL B C   1 
ATOM   9062  O  O   . VAL B  1  500 ? 23.025  60.901  0.719   1.00 45.64 ? 528  VAL B O   1 
ATOM   9063  C  CB  . VAL B  1  500 ? 23.585  58.222  0.742   1.00 45.33 ? 528  VAL B CB  1 
ATOM   9064  C  CG1 . VAL B  1  500 ? 22.643  57.405  1.579   1.00 47.61 ? 528  VAL B CG1 1 
ATOM   9065  C  CG2 . VAL B  1  500 ? 24.732  57.361  0.248   1.00 46.21 ? 528  VAL B CG2 1 
ATOM   9066  N  N   . ASP B  1  501 ? 21.307  60.668  -0.707  1.00 46.00 ? 529  ASP B N   1 
ATOM   9067  C  CA  . ASP B  1  501 ? 20.819  62.012  -0.473  1.00 48.55 ? 529  ASP B CA  1 
ATOM   9068  C  C   . ASP B  1  501 ? 19.987  62.196  0.783   1.00 48.93 ? 529  ASP B C   1 
ATOM   9069  O  O   . ASP B  1  501 ? 18.785  62.459  0.730   1.00 48.25 ? 529  ASP B O   1 
ATOM   9070  C  CB  . ASP B  1  501 ? 20.030  62.506  -1.671  1.00 47.22 ? 529  ASP B CB  1 
ATOM   9071  C  CG  . ASP B  1  501 ? 19.579  63.923  -1.496  1.00 48.44 ? 529  ASP B CG  1 
ATOM   9072  O  OD1 . ASP B  1  501 ? 20.280  64.679  -0.780  1.00 49.77 ? 529  ASP B OD1 1 
ATOM   9073  O  OD2 . ASP B  1  501 ? 18.535  64.283  -2.069  1.00 49.41 ? 529  ASP B OD2 1 
ATOM   9074  N  N   . LEU B  1  502 ? 20.648  62.070  1.920   1.00 49.00 ? 530  LEU B N   1 
ATOM   9075  C  CA  . LEU B  1  502 ? 19.991  62.226  3.192   1.00 48.02 ? 530  LEU B CA  1 
ATOM   9076  C  C   . LEU B  1  502 ? 19.510  63.636  3.407   1.00 48.87 ? 530  LEU B C   1 
ATOM   9077  O  O   . LEU B  1  502 ? 20.144  64.610  2.984   1.00 49.39 ? 530  LEU B O   1 
ATOM   9078  C  CB  . LEU B  1  502 ? 20.950  61.864  4.318   1.00 48.15 ? 530  LEU B CB  1 
ATOM   9079  C  CG  . LEU B  1  502 ? 21.014  60.390  4.716   1.00 49.08 ? 530  LEU B CG  1 
ATOM   9080  C  CD1 . LEU B  1  502 ? 22.288  60.103  5.483   1.00 47.78 ? 530  LEU B CD1 1 
ATOM   9081  C  CD2 . LEU B  1  502 ? 19.794  60.058  5.561   1.00 48.49 ? 530  LEU B CD2 1 
ATOM   9082  N  N   . ASP B  1  503 ? 18.361  63.723  4.056   1.00 49.00 ? 531  ASP B N   1 
ATOM   9083  C  CA  . ASP B  1  503 ? 17.761  64.989  4.445   1.00 50.29 ? 531  ASP B CA  1 
ATOM   9084  C  C   . ASP B  1  503 ? 17.341  64.715  5.879   1.00 50.40 ? 531  ASP B C   1 
ATOM   9085  O  O   . ASP B  1  503 ? 16.144  64.568  6.182   1.00 48.86 ? 531  ASP B O   1 
ATOM   9086  C  CB  . ASP B  1  503 ? 16.556  65.330  3.581   1.00 48.77 ? 531  ASP B CB  1 
ATOM   9087  C  CG  . ASP B  1  503 ? 16.955  65.741  2.196   1.00 48.24 ? 531  ASP B CG  1 
ATOM   9088  O  OD1 . ASP B  1  503 ? 18.125  66.136  2.010   1.00 48.21 ? 531  ASP B OD1 1 
ATOM   9089  O  OD2 . ASP B  1  503 ? 16.100  65.680  1.297   1.00 48.92 ? 531  ASP B OD2 1 
ATOM   9090  N  N   . VAL B  1  504 ? 18.359  64.609  6.738   1.00 49.55 ? 532  VAL B N   1 
ATOM   9091  C  CA  . VAL B  1  504 ? 18.181  64.314  8.152   1.00 49.08 ? 532  VAL B CA  1 
ATOM   9092  C  C   . VAL B  1  504 ? 17.397  65.418  8.818   1.00 48.53 ? 532  VAL B C   1 
ATOM   9093  O  O   . VAL B  1  504 ? 17.878  66.538  8.924   1.00 50.07 ? 532  VAL B O   1 
ATOM   9094  C  CB  . VAL B  1  504 ? 19.532  64.185  8.883   1.00 47.29 ? 532  VAL B CB  1 
ATOM   9095  C  CG1 . VAL B  1  504 ? 19.359  63.358  10.148  1.00 46.56 ? 532  VAL B CG1 1 
ATOM   9096  C  CG2 . VAL B  1  504 ? 20.568  63.597  7.962   1.00 46.40 ? 532  VAL B CG2 1 
ATOM   9097  N  N   . ALA B  1  505 ? 16.185  65.107  9.256   1.00 49.14 ? 533  ALA B N   1 
ATOM   9098  C  CA  . ALA B  1  505 ? 15.360  66.104  9.918   1.00 50.10 ? 533  ALA B CA  1 
ATOM   9099  C  C   . ALA B  1  505 ? 15.289  67.381  9.088   1.00 49.35 ? 533  ALA B C   1 
ATOM   9100  O  O   . ALA B  1  505 ? 15.194  68.473  9.644   1.00 49.68 ? 533  ALA B O   1 
ATOM   9101  C  CB  . ALA B  1  505 ? 15.942  66.411  11.288  1.00 49.74 ? 533  ALA B CB  1 
ATOM   9102  N  N   . GLY B  1  506 ? 15.345  67.240  7.765   1.00 49.74 ? 534  GLY B N   1 
ATOM   9103  C  CA  . GLY B  1  506 ? 15.299  68.401  6.897   1.00 50.38 ? 534  GLY B CA  1 
ATOM   9104  C  C   . GLY B  1  506 ? 16.409  68.489  5.859   1.00 49.89 ? 534  GLY B C   1 
ATOM   9105  O  O   . GLY B  1  506 ? 17.213  67.569  5.687   1.00 48.41 ? 534  GLY B O   1 
ATOM   9106  N  N   . LEU B  1  507 ? 16.466  69.625  5.177   1.00 48.35 ? 535  LEU B N   1 
ATOM   9107  C  CA  . LEU B  1  507 ? 17.447  69.820  4.131   1.00 47.98 ? 535  LEU B CA  1 
ATOM   9108  C  C   . LEU B  1  507 ? 18.853  70.223  4.527   1.00 48.75 ? 535  LEU B C   1 
ATOM   9109  O  O   . LEU B  1  507 ? 19.821  69.700  3.970   1.00 50.16 ? 535  LEU B O   1 
ATOM   9110  C  CB  . LEU B  1  507 ? 16.921  70.825  3.117   1.00 49.97 ? 535  LEU B CB  1 
ATOM   9111  C  CG  . LEU B  1  507 ? 16.157  70.229  1.938   1.00 50.41 ? 535  LEU B CG  1 
ATOM   9112  C  CD1 . LEU B  1  507 ? 15.604  71.343  1.033   1.00 50.36 ? 535  LEU B CD1 1 
ATOM   9113  C  CD2 . LEU B  1  507 ? 17.096  69.312  1.176   1.00 48.39 ? 535  LEU B CD2 1 
ATOM   9114  N  N   . GLU B  1  508 ? 18.985  71.153  5.464   1.00 47.28 ? 536  GLU B N   1 
ATOM   9115  C  CA  . GLU B  1  508 ? 20.314  71.606  5.860   1.00 47.96 ? 536  GLU B CA  1 
ATOM   9116  C  C   . GLU B  1  508 ? 20.951  70.693  6.894   1.00 46.55 ? 536  GLU B C   1 
ATOM   9117  O  O   . GLU B  1  508 ? 20.489  70.608  8.018   1.00 47.52 ? 536  GLU B O   1 
ATOM   9118  C  CB  . GLU B  1  508 ? 20.248  73.042  6.394   1.00 49.76 ? 536  GLU B CB  1 
ATOM   9119  C  CG  . GLU B  1  508 ? 19.819  74.105  5.371   1.00 53.10 ? 536  GLU B CG  1 
ATOM   9120  C  CD  . GLU B  1  508 ? 18.309  74.401  5.387   1.00 54.93 ? 536  GLU B CD  1 
ATOM   9121  O  OE1 . GLU B  1  508 ? 17.764  74.684  6.480   1.00 55.46 ? 536  GLU B OE1 1 
ATOM   9122  O  OE2 . GLU B  1  508 ? 17.667  74.370  4.306   1.00 56.79 ? 536  GLU B OE2 1 
ATOM   9123  N  N   . ASN B  1  509 ? 22.027  70.019  6.514   1.00 46.32 ? 537  ASN B N   1 
ATOM   9124  C  CA  . ASN B  1  509 ? 22.687  69.102  7.426   1.00 47.37 ? 537  ASN B CA  1 
ATOM   9125  C  C   . ASN B  1  509 ? 24.175  69.387  7.539   1.00 45.73 ? 537  ASN B C   1 
ATOM   9126  O  O   . ASN B  1  509 ? 24.752  70.015  6.663   1.00 45.64 ? 537  ASN B O   1 
ATOM   9127  C  CB  . ASN B  1  509 ? 22.466  67.652  6.961   1.00 46.46 ? 537  ASN B CB  1 
ATOM   9128  C  CG  . ASN B  1  509 ? 20.990  67.328  6.701   1.00 47.09 ? 537  ASN B CG  1 
ATOM   9129  O  OD1 . ASN B  1  509 ? 20.547  67.242  5.550   1.00 48.17 ? 537  ASN B OD1 1 
ATOM   9130  N  ND2 . ASN B  1  509 ? 20.227  67.153  7.769   1.00 46.52 ? 537  ASN B ND2 1 
ATOM   9131  N  N   . TRP B  1  510 ? 24.785  68.930  8.628   1.00 45.00 ? 538  TRP B N   1 
ATOM   9132  C  CA  . TRP B  1  510 ? 26.217  69.115  8.853   1.00 46.92 ? 538  TRP B CA  1 
ATOM   9133  C  C   . TRP B  1  510 ? 26.902  67.778  9.019   1.00 46.94 ? 538  TRP B C   1 
ATOM   9134  O  O   . TRP B  1  510 ? 26.289  66.798  9.452   1.00 44.75 ? 538  TRP B O   1 
ATOM   9135  C  CB  . TRP B  1  510 ? 26.474  69.884  10.130  1.00 47.33 ? 538  TRP B CB  1 
ATOM   9136  C  CG  . TRP B  1  510 ? 26.212  71.318  10.057  1.00 47.60 ? 538  TRP B CG  1 
ATOM   9137  C  CD1 . TRP B  1  510 ? 27.139  72.313  10.083  1.00 47.80 ? 538  TRP B CD1 1 
ATOM   9138  C  CD2 . TRP B  1  510 ? 24.932  71.956  10.028  1.00 48.25 ? 538  TRP B CD2 1 
ATOM   9139  N  NE1 . TRP B  1  510 ? 26.516  73.543  10.082  1.00 48.23 ? 538  TRP B NE1 1 
ATOM   9140  C  CE2 . TRP B  1  510 ? 25.161  73.353  10.049  1.00 47.83 ? 538  TRP B CE2 1 
ATOM   9141  C  CE3 . TRP B  1  510 ? 23.613  71.486  9.988   1.00 47.05 ? 538  TRP B CE3 1 
ATOM   9142  C  CZ2 . TRP B  1  510 ? 24.116  74.287  10.035  1.00 47.44 ? 538  TRP B CZ2 1 
ATOM   9143  C  CZ3 . TRP B  1  510 ? 22.574  72.415  9.972   1.00 46.33 ? 538  TRP B CZ3 1 
ATOM   9144  C  CH2 . TRP B  1  510 ? 22.833  73.800  9.997   1.00 46.98 ? 538  TRP B CH2 1 
ATOM   9145  N  N   . VAL B  1  511 ? 28.187  67.739  8.708   1.00 45.91 ? 539  VAL B N   1 
ATOM   9146  C  CA  . VAL B  1  511 ? 28.897  66.488  8.879   1.00 47.44 ? 539  VAL B CA  1 
ATOM   9147  C  C   . VAL B  1  511 ? 29.753  66.557  10.125  1.00 48.47 ? 539  VAL B C   1 
ATOM   9148  O  O   . VAL B  1  511 ? 30.568  67.475  10.280  1.00 47.85 ? 539  VAL B O   1 
ATOM   9149  C  CB  . VAL B  1  511 ? 29.821  66.170  7.720   1.00 47.43 ? 539  VAL B CB  1 
ATOM   9150  C  CG1 . VAL B  1  511 ? 30.403  64.789  7.922   1.00 46.27 ? 539  VAL B CG1 1 
ATOM   9151  C  CG2 . VAL B  1  511 ? 29.080  66.259  6.422   1.00 46.94 ? 539  VAL B CG2 1 
ATOM   9152  N  N   . TRP B  1  512 ? 29.561  65.577  11.003  1.00 48.51 ? 540  TRP B N   1 
ATOM   9153  C  CA  . TRP B  1  512 ? 30.303  65.499  12.251  1.00 48.19 ? 540  TRP B CA  1 
ATOM   9154  C  C   . TRP B  1  512 ? 31.155  64.268  12.242  1.00 47.61 ? 540  TRP B C   1 
ATOM   9155  O  O   . TRP B  1  512 ? 30.786  63.245  11.673  1.00 47.38 ? 540  TRP B O   1 
ATOM   9156  C  CB  . TRP B  1  512 ? 29.371  65.410  13.456  1.00 49.06 ? 540  TRP B CB  1 
ATOM   9157  C  CG  . TRP B  1  512 ? 28.568  66.627  13.716  1.00 49.81 ? 540  TRP B CG  1 
ATOM   9158  C  CD1 . TRP B  1  512 ? 27.237  66.810  13.457  1.00 50.66 ? 540  TRP B CD1 1 
ATOM   9159  C  CD2 . TRP B  1  512 ? 29.032  67.835  14.313  1.00 49.75 ? 540  TRP B CD2 1 
ATOM   9160  N  NE1 . TRP B  1  512 ? 26.842  68.064  13.865  1.00 50.33 ? 540  TRP B NE1 1 
ATOM   9161  C  CE2 . TRP B  1  512 ? 27.928  68.714  14.395  1.00 51.09 ? 540  TRP B CE2 1 
ATOM   9162  C  CE3 . TRP B  1  512 ? 30.277  68.264  14.791  1.00 50.96 ? 540  TRP B CE3 1 
ATOM   9163  C  CZ2 . TRP B  1  512 ? 28.033  70.005  14.940  1.00 51.84 ? 540  TRP B CZ2 1 
ATOM   9164  C  CZ3 . TRP B  1  512 ? 30.381  69.545  15.332  1.00 50.76 ? 540  TRP B CZ3 1 
ATOM   9165  C  CH2 . TRP B  1  512 ? 29.264  70.400  15.401  1.00 50.32 ? 540  TRP B CH2 1 
ATOM   9166  N  N   . ALA B  1  513 ? 32.291  64.371  12.906  1.00 47.90 ? 541  ALA B N   1 
ATOM   9167  C  CA  . ALA B  1  513 ? 33.211  63.266  12.988  1.00 48.85 ? 541  ALA B CA  1 
ATOM   9168  C  C   . ALA B  1  513 ? 33.621  63.048  14.433  1.00 49.86 ? 541  ALA B C   1 
ATOM   9169  O  O   . ALA B  1  513 ? 34.460  63.782  14.960  1.00 49.80 ? 541  ALA B O   1 
ATOM   9170  C  CB  . ALA B  1  513 ? 34.427  63.557  12.145  1.00 48.86 ? 541  ALA B CB  1 
ATOM   9171  N  N   . GLU B  1  514 ? 33.015  62.057  15.079  1.00 49.53 ? 542  GLU B N   1 
ATOM   9172  C  CA  . GLU B  1  514 ? 33.374  61.739  16.452  1.00 50.59 ? 542  GLU B CA  1 
ATOM   9173  C  C   . GLU B  1  514 ? 34.216  60.457  16.483  1.00 51.74 ? 542  GLU B C   1 
ATOM   9174  O  O   . GLU B  1  514 ? 34.052  59.554  15.657  1.00 51.31 ? 542  GLU B O   1 
ATOM   9175  C  CB  . GLU B  1  514 ? 32.139  61.536  17.310  1.00 50.18 ? 542  GLU B CB  1 
ATOM   9176  C  CG  . GLU B  1  514 ? 31.126  62.632  17.243  1.00 52.72 ? 542  GLU B CG  1 
ATOM   9177  C  CD  . GLU B  1  514 ? 29.975  62.355  18.192  1.00 55.02 ? 542  GLU B CD  1 
ATOM   9178  O  OE1 . GLU B  1  514 ? 29.740  61.161  18.476  1.00 55.39 ? 542  GLU B OE1 1 
ATOM   9179  O  OE2 . GLU B  1  514 ? 29.300  63.307  18.649  1.00 56.31 ? 542  GLU B OE2 1 
ATOM   9180  N  N   . ASP B  1  515 ? 35.123  60.382  17.446  1.00 51.97 ? 543  ASP B N   1 
ATOM   9181  C  CA  . ASP B  1  515 ? 35.978  59.221  17.571  1.00 51.95 ? 543  ASP B CA  1 
ATOM   9182  C  C   . ASP B  1  515 ? 36.401  59.035  19.026  1.00 53.23 ? 543  ASP B C   1 
ATOM   9183  O  O   . ASP B  1  515 ? 35.648  59.352  19.945  1.00 53.56 ? 543  ASP B O   1 
ATOM   9184  C  CB  . ASP B  1  515 ? 37.204  59.389  16.684  1.00 52.26 ? 543  ASP B CB  1 
ATOM   9185  C  CG  . ASP B  1  515 ? 37.810  58.062  16.267  1.00 53.95 ? 543  ASP B CG  1 
ATOM   9186  O  OD1 . ASP B  1  515 ? 38.038  57.195  17.145  1.00 53.16 ? 543  ASP B OD1 1 
ATOM   9187  O  OD2 . ASP B  1  515 ? 38.066  57.891  15.053  1.00 54.44 ? 543  ASP B OD2 1 
ATOM   9188  N  N   . MET B  1  516 ? 37.605  58.527  19.241  1.00 53.90 ? 544  MET B N   1 
ATOM   9189  C  CA  . MET B  1  516 ? 38.077  58.298  20.593  1.00 55.49 ? 544  MET B CA  1 
ATOM   9190  C  C   . MET B  1  516 ? 39.538  58.703  20.773  1.00 56.35 ? 544  MET B C   1 
ATOM   9191  O  O   . MET B  1  516 ? 40.207  59.112  19.823  1.00 55.57 ? 544  MET B O   1 
ATOM   9192  C  CB  . MET B  1  516 ? 37.899  56.819  20.955  1.00 55.69 ? 544  MET B CB  1 
ATOM   9193  C  CG  . MET B  1  516 ? 38.855  55.868  20.233  1.00 55.25 ? 544  MET B CG  1 
ATOM   9194  S  SD  . MET B  1  516 ? 38.668  54.141  20.760  1.00 56.18 ? 544  MET B SD  1 
ATOM   9195  C  CE  . MET B  1  516 ? 39.469  54.204  22.338  1.00 54.78 ? 544  MET B CE  1 
ATOM   9196  N  N   . VAL B  1  517 ? 40.017  58.582  22.008  1.00 58.30 ? 545  VAL B N   1 
ATOM   9197  C  CA  . VAL B  1  517 ? 41.397  58.918  22.364  1.00 59.32 ? 545  VAL B CA  1 
ATOM   9198  C  C   . VAL B  1  517 ? 41.682  58.686  23.857  1.00 60.87 ? 545  VAL B C   1 
ATOM   9199  O  O   . VAL B  1  517 ? 40.787  58.835  24.705  1.00 61.20 ? 545  VAL B O   1 
ATOM   9200  C  CB  . VAL B  1  517 ? 41.708  60.391  22.054  1.00 58.58 ? 545  VAL B CB  1 
ATOM   9201  C  CG1 . VAL B  1  517 ? 40.760  61.301  22.839  1.00 57.37 ? 545  VAL B CG1 1 
ATOM   9202  C  CG2 . VAL B  1  517 ? 43.159  60.686  22.395  1.00 58.13 ? 545  VAL B CG2 1 
ATOM   9203  N  N   . PHE B  1  518 ? 42.924  58.322  24.178  1.00 61.34 ? 546  PHE B N   1 
ATOM   9204  C  CA  . PHE B  1  518 ? 43.311  58.100  25.571  1.00 61.52 ? 546  PHE B CA  1 
ATOM   9205  C  C   . PHE B  1  518 ? 44.245  59.197  26.078  1.00 62.22 ? 546  PHE B C   1 
ATOM   9206  O  O   . PHE B  1  518 ? 45.378  59.333  25.615  1.00 62.17 ? 546  PHE B O   1 
ATOM   9207  C  CB  . PHE B  1  518 ? 43.972  56.732  25.730  1.00 60.61 ? 546  PHE B CB  1 
ATOM   9208  C  CG  . PHE B  1  518 ? 42.992  55.591  25.780  1.00 61.45 ? 546  PHE B CG  1 
ATOM   9209  C  CD1 . PHE B  1  518 ? 42.955  54.635  24.773  1.00 61.01 ? 546  PHE B CD1 1 
ATOM   9210  C  CD2 . PHE B  1  518 ? 42.119  55.456  26.857  1.00 60.84 ? 546  PHE B CD2 1 
ATOM   9211  C  CE1 . PHE B  1  518 ? 42.069  53.561  24.841  1.00 59.57 ? 546  PHE B CE1 1 
ATOM   9212  C  CE2 . PHE B  1  518 ? 41.235  54.387  26.926  1.00 59.45 ? 546  PHE B CE2 1 
ATOM   9213  C  CZ  . PHE B  1  518 ? 41.214  53.441  25.917  1.00 59.79 ? 546  PHE B CZ  1 
ATOM   9214  N  N   . VAL B  1  519 ? 43.750  59.985  27.027  1.00 62.91 ? 547  VAL B N   1 
ATOM   9215  C  CA  . VAL B  1  519 ? 44.519  61.077  27.613  1.00 63.80 ? 547  VAL B CA  1 
ATOM   9216  C  C   . VAL B  1  519 ? 45.170  60.643  28.922  1.00 65.30 ? 547  VAL B C   1 
ATOM   9217  O  O   . VAL B  1  519 ? 44.470  60.365  29.904  1.00 65.69 ? 547  VAL B O   1 
ATOM   9218  C  CB  . VAL B  1  519 ? 43.617  62.274  27.936  1.00 62.92 ? 547  VAL B CB  1 
ATOM   9219  C  CG1 . VAL B  1  519 ? 44.447  63.434  28.455  1.00 62.37 ? 547  VAL B CG1 1 
ATOM   9220  C  CG2 . VAL B  1  519 ? 42.842  62.660  26.723  1.00 63.24 ? 547  VAL B CG2 1 
ATOM   9221  N  N   . PRO B  1  520 ? 46.513  60.564  28.958  1.00 65.72 ? 548  PRO B N   1 
ATOM   9222  C  CA  . PRO B  1  520 ? 47.127  60.156  30.223  1.00 66.14 ? 548  PRO B CA  1 
ATOM   9223  C  C   . PRO B  1  520 ? 46.970  61.282  31.234  1.00 66.15 ? 548  PRO B C   1 
ATOM   9224  O  O   . PRO B  1  520 ? 47.219  62.438  30.907  1.00 66.28 ? 548  PRO B O   1 
ATOM   9225  C  CB  . PRO B  1  520 ? 48.588  59.927  29.844  1.00 65.02 ? 548  PRO B CB  1 
ATOM   9226  C  CG  . PRO B  1  520 ? 48.504  59.495  28.413  1.00 65.21 ? 548  PRO B CG  1 
ATOM   9227  C  CD  . PRO B  1  520 ? 47.492  60.485  27.860  1.00 65.97 ? 548  PRO B CD  1 
ATOM   9228  N  N   . MET B  1  521 ? 46.521  60.937  32.438  1.00 66.78 ? 549  MET B N   1 
ATOM   9229  C  CA  . MET B  1  521 ? 46.349  61.895  33.531  1.00 67.28 ? 549  MET B CA  1 
ATOM   9230  C  C   . MET B  1  521 ? 46.282  61.175  34.885  1.00 67.40 ? 549  MET B C   1 
ATOM   9231  O  O   . MET B  1  521 ? 45.946  59.987  34.964  1.00 66.39 ? 549  MET B O   1 
ATOM   9232  C  CB  . MET B  1  521 ? 45.105  62.784  33.318  1.00 66.67 ? 549  MET B CB  1 
ATOM   9233  C  CG  . MET B  1  521 ? 43.845  62.083  32.858  1.00 66.37 ? 549  MET B CG  1 
ATOM   9234  S  SD  . MET B  1  521 ? 42.400  63.150  33.000  1.00 65.97 ? 549  MET B SD  1 
ATOM   9235  C  CE  . MET B  1  521 ? 42.818  64.465  31.874  1.00 65.84 ? 549  MET B CE  1 
ATOM   9236  N  N   . ALA B  1  522 ? 46.621  61.897  35.948  1.00 67.38 ? 550  ALA B N   1 
ATOM   9237  C  CA  . ALA B  1  522 ? 46.627  61.326  37.291  1.00 67.54 ? 550  ALA B CA  1 
ATOM   9238  C  C   . ALA B  1  522 ? 45.248  60.961  37.835  1.00 67.28 ? 550  ALA B C   1 
ATOM   9239  O  O   . ALA B  1  522 ? 44.235  61.552  37.457  1.00 67.30 ? 550  ALA B O   1 
ATOM   9240  C  CB  . ALA B  1  522 ? 47.318  62.278  38.244  1.00 67.62 ? 550  ALA B CB  1 
ATOM   9241  N  N   . VAL B  1  523 ? 45.225  59.981  38.731  1.00 67.19 ? 551  VAL B N   1 
ATOM   9242  C  CA  . VAL B  1  523 ? 43.987  59.525  39.348  1.00 67.75 ? 551  VAL B CA  1 
ATOM   9243  C  C   . VAL B  1  523 ? 43.501  60.555  40.364  1.00 68.57 ? 551  VAL B C   1 
ATOM   9244  O  O   . VAL B  1  523 ? 44.165  60.796  41.371  1.00 68.47 ? 551  VAL B O   1 
ATOM   9245  C  CB  . VAL B  1  523 ? 44.200  58.200  40.082  1.00 67.07 ? 551  VAL B CB  1 
ATOM   9246  C  CG1 . VAL B  1  523 ? 42.875  57.692  40.611  1.00 67.24 ? 551  VAL B CG1 1 
ATOM   9247  C  CG2 . VAL B  1  523 ? 44.846  57.195  39.163  1.00 66.47 ? 551  VAL B CG2 1 
ATOM   9248  N  N   . PRO B  1  524 ? 42.333  61.173  40.119  1.00 68.72 ? 552  PRO B N   1 
ATOM   9249  C  CA  . PRO B  1  524 ? 41.815  62.173  41.054  1.00 68.73 ? 552  PRO B CA  1 
ATOM   9250  C  C   . PRO B  1  524 ? 41.932  61.798  42.535  1.00 69.72 ? 552  PRO B C   1 
ATOM   9251  O  O   . PRO B  1  524 ? 42.134  62.672  43.381  1.00 70.13 ? 552  PRO B O   1 
ATOM   9252  C  CB  . PRO B  1  524 ? 40.374  62.345  40.592  1.00 68.85 ? 552  PRO B CB  1 
ATOM   9253  C  CG  . PRO B  1  524 ? 40.515  62.239  39.110  1.00 68.24 ? 552  PRO B CG  1 
ATOM   9254  C  CD  . PRO B  1  524 ? 41.440  61.043  38.953  1.00 68.82 ? 552  PRO B CD  1 
ATOM   9255  N  N   . TRP B  1  525 ? 41.828  60.508  42.851  1.00 69.59 ? 553  TRP B N   1 
ATOM   9256  C  CA  . TRP B  1  525 ? 41.917  60.065  44.245  1.00 69.99 ? 553  TRP B CA  1 
ATOM   9257  C  C   . TRP B  1  525 ? 43.198  59.294  44.562  1.00 69.43 ? 553  TRP B C   1 
ATOM   9258  O  O   . TRP B  1  525 ? 43.202  58.380  45.380  1.00 70.44 ? 553  TRP B O   1 
ATOM   9259  C  CB  . TRP B  1  525 ? 40.699  59.205  44.599  1.00 69.64 ? 553  TRP B CB  1 
ATOM   9260  C  CG  . TRP B  1  525 ? 40.577  57.966  43.762  1.00 70.18 ? 553  TRP B CG  1 
ATOM   9261  C  CD1 . TRP B  1  525 ? 41.129  56.728  44.008  1.00 69.76 ? 553  TRP B CD1 1 
ATOM   9262  C  CD2 . TRP B  1  525 ? 39.882  57.853  42.523  1.00 69.90 ? 553  TRP B CD2 1 
ATOM   9263  N  NE1 . TRP B  1  525 ? 40.813  55.857  42.991  1.00 69.23 ? 553  TRP B NE1 1 
ATOM   9264  C  CE2 . TRP B  1  525 ? 40.049  56.522  42.066  1.00 70.69 ? 553  TRP B CE2 1 
ATOM   9265  C  CE3 . TRP B  1  525 ? 39.132  58.749  41.749  1.00 69.13 ? 553  TRP B CE3 1 
ATOM   9266  C  CZ2 . TRP B  1  525 ? 39.488  56.069  40.869  1.00 70.41 ? 553  TRP B CZ2 1 
ATOM   9267  C  CZ3 . TRP B  1  525 ? 38.575  58.302  40.564  1.00 69.58 ? 553  TRP B CZ3 1 
ATOM   9268  C  CH2 . TRP B  1  525 ? 38.755  56.973  40.133  1.00 70.12 ? 553  TRP B CH2 1 
ATOM   9269  N  N   . SER B  1  526 ? 44.291  59.670  43.924  1.00 69.48 ? 554  SER B N   1 
ATOM   9270  C  CA  . SER B  1  526 ? 45.557  58.998  44.153  1.00 69.92 ? 554  SER B CA  1 
ATOM   9271  C  C   . SER B  1  526 ? 46.529  59.545  43.119  1.00 71.27 ? 554  SER B C   1 
ATOM   9272  O  O   . SER B  1  526 ? 47.008  58.803  42.257  1.00 71.07 ? 554  SER B O   1 
ATOM   9273  C  CB  . SER B  1  526 ? 45.378  57.487  43.972  1.00 70.12 ? 554  SER B CB  1 
ATOM   9274  O  OG  . SER B  1  526 ? 46.600  56.789  44.101  1.00 69.82 ? 554  SER B OG  1 
ATOM   9275  N  N   . PRO B  1  527 ? 46.812  60.864  43.172  1.00 71.40 ? 555  PRO B N   1 
ATOM   9276  C  CA  . PRO B  1  527 ? 47.729  61.522  42.235  1.00 71.63 ? 555  PRO B CA  1 
ATOM   9277  C  C   . PRO B  1  527 ? 49.109  60.865  42.143  1.00 72.36 ? 555  PRO B C   1 
ATOM   9278  O  O   . PRO B  1  527 ? 49.976  61.311  41.378  1.00 71.83 ? 555  PRO B O   1 
ATOM   9279  C  CB  . PRO B  1  527 ? 47.771  62.952  42.757  1.00 71.37 ? 555  PRO B CB  1 
ATOM   9280  C  CG  . PRO B  1  527 ? 46.374  63.147  43.229  1.00 70.97 ? 555  PRO B CG  1 
ATOM   9281  C  CD  . PRO B  1  527 ? 46.132  61.872  44.006  1.00 71.00 ? 555  PRO B CD  1 
ATOM   9282  N  N   . GLU B  1  528 ? 49.298  59.807  42.933  1.00 72.66 ? 556  GLU B N   1 
ATOM   9283  C  CA  . GLU B  1  528 ? 50.542  59.031  42.937  1.00 72.42 ? 556  GLU B CA  1 
ATOM   9284  C  C   . GLU B  1  528 ? 50.480  58.070  41.738  1.00 71.93 ? 556  GLU B C   1 
ATOM   9285  O  O   . GLU B  1  528 ? 51.505  57.632  41.203  1.00 71.24 ? 556  GLU B O   1 
ATOM   9286  C  CB  . GLU B  1  528 ? 50.683  58.223  44.252  1.00 72.89 ? 556  GLU B CB  1 
ATOM   9287  C  CG  . GLU B  1  528 ? 49.408  57.458  44.705  1.00 74.20 ? 556  GLU B CG  1 
ATOM   9288  C  CD  . GLU B  1  528 ? 49.676  56.114  45.430  1.00 74.47 ? 556  GLU B CD  1 
ATOM   9289  O  OE1 . GLU B  1  528 ? 48.734  55.585  46.068  1.00 73.87 ? 556  GLU B OE1 1 
ATOM   9290  O  OE2 . GLU B  1  528 ? 50.807  55.573  45.351  1.00 74.54 ? 556  GLU B OE2 1 
ATOM   9291  N  N   . HIS B  1  529 ? 49.257  57.754  41.324  1.00 71.33 ? 557  HIS B N   1 
ATOM   9292  C  CA  . HIS B  1  529 ? 49.048  56.858  40.211  1.00 70.32 ? 557  HIS B CA  1 
ATOM   9293  C  C   . HIS B  1  529 ? 48.585  57.567  38.960  1.00 69.98 ? 557  HIS B C   1 
ATOM   9294  O  O   . HIS B  1  529 ? 48.131  58.709  38.993  1.00 68.99 ? 557  HIS B O   1 
ATOM   9295  C  CB  . HIS B  1  529 ? 48.059  55.764  40.593  1.00 70.90 ? 557  HIS B CB  1 
ATOM   9296  C  CG  . HIS B  1  529 ? 48.631  54.745  41.519  1.00 71.18 ? 557  HIS B CG  1 
ATOM   9297  N  ND1 . HIS B  1  529 ? 48.746  54.956  42.877  1.00 71.85 ? 557  HIS B ND1 1 
ATOM   9298  C  CD2 . HIS B  1  529 ? 49.164  53.525  41.281  1.00 71.91 ? 557  HIS B CD2 1 
ATOM   9299  C  CE1 . HIS B  1  529 ? 49.326  53.904  43.435  1.00 72.41 ? 557  HIS B CE1 1 
ATOM   9300  N  NE2 . HIS B  1  529 ? 49.589  53.024  42.487  1.00 73.56 ? 557  HIS B NE2 1 
ATOM   9301  N  N   . GLN B  1  530 ? 48.696  56.839  37.858  1.00 70.44 ? 558  GLN B N   1 
ATOM   9302  C  CA  . GLN B  1  530 ? 48.359  57.314  36.525  1.00 69.15 ? 558  GLN B CA  1 
ATOM   9303  C  C   . GLN B  1  530 ? 47.139  56.582  35.924  1.00 68.86 ? 558  GLN B C   1 
ATOM   9304  O  O   . GLN B  1  530 ? 46.876  55.421  36.260  1.00 69.27 ? 558  GLN B O   1 
ATOM   9305  C  CB  . GLN B  1  530 ? 49.595  57.089  35.634  1.00 69.45 ? 558  GLN B CB  1 
ATOM   9306  C  CG  . GLN B  1  530 ? 49.425  57.460  34.175  1.00 70.69 ? 558  GLN B CG  1 
ATOM   9307  C  CD  . GLN B  1  530 ? 49.558  58.953  33.943  1.00 71.38 ? 558  GLN B CD  1 
ATOM   9308  O  OE1 . GLN B  1  530 ? 49.228  59.762  34.823  1.00 71.71 ? 558  GLN B OE1 1 
ATOM   9309  N  NE2 . GLN B  1  530 ? 50.033  59.332  32.752  1.00 71.44 ? 558  GLN B NE2 1 
ATOM   9310  N  N   . LEU B  1  531 ? 46.395  57.264  35.050  1.00 66.76 ? 559  LEU B N   1 
ATOM   9311  C  CA  . LEU B  1  531 ? 45.263  56.642  34.369  1.00 65.73 ? 559  LEU B CA  1 
ATOM   9312  C  C   . LEU B  1  531 ? 45.177  57.145  32.923  1.00 66.89 ? 559  LEU B C   1 
ATOM   9313  O  O   . LEU B  1  531 ? 45.586  58.270  32.620  1.00 66.36 ? 559  LEU B O   1 
ATOM   9314  C  CB  . LEU B  1  531 ? 43.936  56.899  35.114  1.00 64.55 ? 559  LEU B CB  1 
ATOM   9315  C  CG  . LEU B  1  531 ? 43.182  58.235  35.158  1.00 64.98 ? 559  LEU B CG  1 
ATOM   9316  C  CD1 . LEU B  1  531 ? 42.629  58.620  33.800  1.00 65.51 ? 559  LEU B CD1 1 
ATOM   9317  C  CD2 . LEU B  1  531 ? 42.026  58.085  36.120  1.00 64.67 ? 559  LEU B CD2 1 
ATOM   9318  N  N   . GLN B  1  532 ? 44.682  56.290  32.029  1.00 67.09 ? 560  GLN B N   1 
ATOM   9319  C  CA  . GLN B  1  532 ? 44.509  56.639  30.622  1.00 64.12 ? 560  GLN B CA  1 
ATOM   9320  C  C   . GLN B  1  532 ? 43.041  57.009  30.495  1.00 63.04 ? 560  GLN B C   1 
ATOM   9321  O  O   . GLN B  1  532 ? 42.178  56.143  30.367  1.00 63.38 ? 560  GLN B O   1 
ATOM   9322  C  CB  . GLN B  1  532 ? 44.841  55.440  29.731  1.00 64.59 ? 560  GLN B CB  1 
ATOM   9323  C  CG  . GLN B  1  532 ? 46.297  54.973  29.832  1.00 67.18 ? 560  GLN B CG  1 
ATOM   9324  C  CD  . GLN B  1  532 ? 47.295  55.970  29.228  1.00 68.46 ? 560  GLN B CD  1 
ATOM   9325  O  OE1 . GLN B  1  532 ? 48.513  55.854  29.421  1.00 68.51 ? 560  GLN B OE1 1 
ATOM   9326  N  NE2 . GLN B  1  532 ? 46.779  56.947  28.487  1.00 68.60 ? 560  GLN B NE2 1 
ATOM   9327  N  N   . ARG B  1  533 ? 42.761  58.304  30.570  1.00 62.62 ? 561  ARG B N   1 
ATOM   9328  C  CA  . ARG B  1  533 ? 41.392  58.787  30.484  1.00 63.22 ? 561  ARG B CA  1 
ATOM   9329  C  C   . ARG B  1  533 ? 40.876  58.742  29.046  1.00 63.68 ? 561  ARG B C   1 
ATOM   9330  O  O   . ARG B  1  533 ? 41.388  59.430  28.153  1.00 62.27 ? 561  ARG B O   1 
ATOM   9331  C  CB  . ARG B  1  533 ? 41.298  60.215  31.044  1.00 63.21 ? 561  ARG B CB  1 
ATOM   9332  C  CG  . ARG B  1  533 ? 39.876  60.776  31.191  1.00 62.64 ? 561  ARG B CG  1 
ATOM   9333  C  CD  . ARG B  1  533 ? 39.020  59.920  32.116  1.00 63.18 ? 561  ARG B CD  1 
ATOM   9334  N  NE  . ARG B  1  533 ? 37.796  60.598  32.555  1.00 62.99 ? 561  ARG B NE  1 
ATOM   9335  C  CZ  . ARG B  1  533 ? 37.779  61.757  33.212  1.00 61.22 ? 561  ARG B CZ  1 
ATOM   9336  N  NH1 . ARG B  1  533 ? 38.918  62.370  33.496  1.00 60.72 ? 561  ARG B NH1 1 
ATOM   9337  N  NH2 . ARG B  1  533 ? 36.631  62.290  33.613  1.00 58.79 ? 561  ARG B NH2 1 
ATOM   9338  N  N   . LEU B  1  534 ? 39.859  57.906  28.841  1.00 64.41 ? 562  LEU B N   1 
ATOM   9339  C  CA  . LEU B  1  534 ? 39.225  57.736  27.536  1.00 62.97 ? 562  LEU B CA  1 
ATOM   9340  C  C   . LEU B  1  534 ? 38.287  58.914  27.310  1.00 62.35 ? 562  LEU B C   1 
ATOM   9341  O  O   . LEU B  1  534 ? 37.463  59.238  28.173  1.00 62.70 ? 562  LEU B O   1 
ATOM   9342  C  CB  . LEU B  1  534 ? 38.421  56.430  27.499  1.00 62.55 ? 562  LEU B CB  1 
ATOM   9343  C  CG  . LEU B  1  534 ? 37.764  56.068  26.170  1.00 61.00 ? 562  LEU B CG  1 
ATOM   9344  C  CD1 . LEU B  1  534 ? 38.844  55.931  25.130  1.00 60.95 ? 562  LEU B CD1 1 
ATOM   9345  C  CD2 . LEU B  1  534 ? 36.981  54.777  26.297  1.00 60.91 ? 562  LEU B CD2 1 
ATOM   9346  N  N   . GLN B  1  535 ? 38.421  59.554  26.156  1.00 59.80 ? 563  GLN B N   1 
ATOM   9347  C  CA  . GLN B  1  535 ? 37.585  60.686  25.839  1.00 59.35 ? 563  GLN B CA  1 
ATOM   9348  C  C   . GLN B  1  535 ? 37.096  60.553  24.425  1.00 60.57 ? 563  GLN B C   1 
ATOM   9349  O  O   . GLN B  1  535 ? 37.635  59.766  23.649  1.00 60.08 ? 563  GLN B O   1 
ATOM   9350  C  CB  . GLN B  1  535 ? 38.371  61.978  25.951  1.00 60.53 ? 563  GLN B CB  1 
ATOM   9351  C  CG  . GLN B  1  535 ? 39.138  62.139  27.234  1.00 61.51 ? 563  GLN B CG  1 
ATOM   9352  C  CD  . GLN B  1  535 ? 39.745  63.520  27.342  1.00 61.99 ? 563  GLN B CD  1 
ATOM   9353  O  OE1 . GLN B  1  535 ? 40.340  64.010  26.388  1.00 62.54 ? 563  GLN B OE1 1 
ATOM   9354  N  NE2 . GLN B  1  535 ? 39.598  64.156  28.502  1.00 62.03 ? 563  GLN B NE2 1 
ATOM   9355  N  N   . VAL B  1  536 ? 36.071  61.335  24.099  1.00 60.91 ? 564  VAL B N   1 
ATOM   9356  C  CA  . VAL B  1  536 ? 35.501  61.349  22.758  1.00 60.31 ? 564  VAL B CA  1 
ATOM   9357  C  C   . VAL B  1  536 ? 36.146  62.511  22.007  1.00 59.60 ? 564  VAL B C   1 
ATOM   9358  O  O   . VAL B  1  536 ? 36.468  63.537  22.606  1.00 59.26 ? 564  VAL B O   1 
ATOM   9359  C  CB  . VAL B  1  536 ? 33.963  61.561  22.796  1.00 58.57 ? 564  VAL B CB  1 
ATOM   9360  C  CG1 . VAL B  1  536 ? 33.421  61.727  21.386  1.00 57.92 ? 564  VAL B CG1 1 
ATOM   9361  C  CG2 . VAL B  1  536 ? 33.295  60.386  23.484  1.00 58.73 ? 564  VAL B CG2 1 
ATOM   9362  N  N   . THR B  1  537 ? 36.358  62.335  20.707  1.00 58.87 ? 565  THR B N   1 
ATOM   9363  C  CA  . THR B  1  537 ? 36.943  63.379  19.879  1.00 57.62 ? 565  THR B CA  1 
ATOM   9364  C  C   . THR B  1  537 ? 35.919  63.722  18.826  1.00 57.25 ? 565  THR B C   1 
ATOM   9365  O  O   . THR B  1  537 ? 35.604  62.916  17.964  1.00 58.54 ? 565  THR B O   1 
ATOM   9366  C  CB  . THR B  1  537 ? 38.244  62.917  19.175  1.00 58.54 ? 565  THR B CB  1 
ATOM   9367  O  OG1 . THR B  1  537 ? 37.970  61.805  18.317  1.00 57.54 ? 565  THR B OG1 1 
ATOM   9368  C  CG2 . THR B  1  537 ? 39.285  62.507  20.194  1.00 58.82 ? 565  THR B CG2 1 
ATOM   9369  N  N   . ARG B  1  538 ? 35.391  64.928  18.904  1.00 58.77 ? 566  ARG B N   1 
ATOM   9370  C  CA  . ARG B  1  538 ? 34.388  65.380  17.954  1.00 59.23 ? 566  ARG B CA  1 
ATOM   9371  C  C   . ARG B  1  538 ? 34.923  66.538  17.107  1.00 59.23 ? 566  ARG B C   1 
ATOM   9372  O  O   . ARG B  1  538 ? 35.540  67.469  17.630  1.00 58.59 ? 566  ARG B O   1 
ATOM   9373  C  CB  . ARG B  1  538 ? 33.151  65.808  18.729  1.00 57.64 ? 566  ARG B CB  1 
ATOM   9374  C  CG  . ARG B  1  538 ? 32.106  66.538  17.939  1.00 59.91 ? 566  ARG B CG  1 
ATOM   9375  C  CD  . ARG B  1  538 ? 30.979  66.995  18.865  1.00 61.85 ? 566  ARG B CD  1 
ATOM   9376  N  NE  . ARG B  1  538 ? 30.391  65.885  19.629  1.00 64.44 ? 566  ARG B NE  1 
ATOM   9377  C  CZ  . ARG B  1  538 ? 30.870  65.383  20.774  1.00 64.64 ? 566  ARG B CZ  1 
ATOM   9378  N  NH1 . ARG B  1  538 ? 31.971  65.881  21.344  1.00 64.36 ? 566  ARG B NH1 1 
ATOM   9379  N  NH2 . ARG B  1  538 ? 30.239  64.362  21.352  1.00 63.78 ? 566  ARG B NH2 1 
ATOM   9380  N  N   . LYS B  1  539 ? 34.703  66.470  15.799  1.00 58.74 ? 567  LYS B N   1 
ATOM   9381  C  CA  . LYS B  1  539 ? 35.164  67.521  14.910  1.00 58.70 ? 567  LYS B CA  1 
ATOM   9382  C  C   . LYS B  1  539 ? 34.114  67.824  13.873  1.00 58.49 ? 567  LYS B C   1 
ATOM   9383  O  O   . LYS B  1  539 ? 33.386  66.933  13.443  1.00 59.18 ? 567  LYS B O   1 
ATOM   9384  C  CB  . LYS B  1  539 ? 36.460  67.111  14.219  1.00 59.67 ? 567  LYS B CB  1 
ATOM   9385  C  CG  . LYS B  1  539 ? 36.988  68.147  13.238  1.00 61.24 ? 567  LYS B CG  1 
ATOM   9386  C  CD  . LYS B  1  539 ? 38.493  67.982  13.034  1.00 62.95 ? 567  LYS B CD  1 
ATOM   9387  C  CE  . LYS B  1  539 ? 39.074  68.977  12.022  1.00 63.75 ? 567  LYS B CE  1 
ATOM   9388  N  NZ  . LYS B  1  539 ? 38.636  68.711  10.617  1.00 63.87 ? 567  LYS B NZ  1 
ATOM   9389  N  N   . LEU B  1  540 ? 34.026  69.089  13.486  1.00 57.78 ? 568  LEU B N   1 
ATOM   9390  C  CA  . LEU B  1  540 ? 33.063  69.491  12.472  1.00 59.27 ? 568  LEU B CA  1 
ATOM   9391  C  C   . LEU B  1  540 ? 33.762  69.535  11.117  1.00 60.16 ? 568  LEU B C   1 
ATOM   9392  O  O   . LEU B  1  540 ? 34.871  70.071  10.995  1.00 60.72 ? 568  LEU B O   1 
ATOM   9393  C  CB  . LEU B  1  540 ? 32.474  70.870  12.796  1.00 59.02 ? 568  LEU B CB  1 
ATOM   9394  C  CG  . LEU B  1  540 ? 31.458  71.493  11.822  1.00 58.50 ? 568  LEU B CG  1 
ATOM   9395  C  CD1 . LEU B  1  540 ? 30.202  70.644  11.740  1.00 59.74 ? 568  LEU B CD1 1 
ATOM   9396  C  CD2 . LEU B  1  540 ? 31.100  72.885  12.290  1.00 59.27 ? 568  LEU B CD2 1 
ATOM   9397  N  N   . LEU B  1  541 ? 33.119  68.957  10.105  1.00 59.56 ? 569  LEU B N   1 
ATOM   9398  C  CA  . LEU B  1  541 ? 33.673  68.948  8.760   1.00 58.55 ? 569  LEU B CA  1 
ATOM   9399  C  C   . LEU B  1  541 ? 32.962  70.023  7.960   1.00 59.06 ? 569  LEU B C   1 
ATOM   9400  O  O   . LEU B  1  541 ? 31.760  69.927  7.681   1.00 59.04 ? 569  LEU B O   1 
ATOM   9401  C  CB  . LEU B  1  541 ? 33.478  67.578  8.144   1.00 57.47 ? 569  LEU B CB  1 
ATOM   9402  C  CG  . LEU B  1  541 ? 34.041  66.505  9.070   1.00 56.44 ? 569  LEU B CG  1 
ATOM   9403  C  CD1 . LEU B  1  541 ? 34.005  65.176  8.358   1.00 57.07 ? 569  LEU B CD1 1 
ATOM   9404  C  CD2 . LEU B  1  541 ? 35.460  66.851  9.470   1.00 55.50 ? 569  LEU B CD2 1 
ATOM   9405  N  N   . GLU B  1  542 ? 33.723  71.049  7.597   1.00 59.03 ? 570  GLU B N   1 
ATOM   9406  C  CA  . GLU B  1  542 ? 33.184  72.199  6.889   1.00 59.84 ? 570  GLU B CA  1 
ATOM   9407  C  C   . GLU B  1  542 ? 33.472  72.278  5.407   1.00 60.79 ? 570  GLU B C   1 
ATOM   9408  O  O   . GLU B  1  542 ? 32.657  72.803  4.638   1.00 60.38 ? 570  GLU B O   1 
ATOM   9409  C  CB  . GLU B  1  542 ? 33.701  73.460  7.558   1.00 61.27 ? 570  GLU B CB  1 
ATOM   9410  C  CG  . GLU B  1  542 ? 33.472  73.447  9.052   1.00 63.66 ? 570  GLU B CG  1 
ATOM   9411  C  CD  . GLU B  1  542 ? 34.014  74.677  9.741   1.00 63.42 ? 570  GLU B CD  1 
ATOM   9412  O  OE1 . GLU B  1  542 ? 33.751  75.796  9.247   1.00 63.84 ? 570  GLU B OE1 1 
ATOM   9413  O  OE2 . GLU B  1  542 ? 34.691  74.520  10.780  1.00 63.64 ? 570  GLU B OE2 1 
ATOM   9414  N  N   . MET B  1  543 ? 34.636  71.777  5.009   1.00 60.54 ? 571  MET B N   1 
ATOM   9415  C  CA  . MET B  1  543 ? 35.022  71.802  3.608   1.00 60.92 ? 571  MET B CA  1 
ATOM   9416  C  C   . MET B  1  543 ? 34.883  70.416  2.994   1.00 60.09 ? 571  MET B C   1 
ATOM   9417  O  O   . MET B  1  543 ? 35.294  69.416  3.590   1.00 59.98 ? 571  MET B O   1 
ATOM   9418  C  CB  . MET B  1  543 ? 36.460  72.314  3.477   1.00 61.27 ? 571  MET B CB  1 
ATOM   9419  C  CG  . MET B  1  543 ? 36.687  73.651  4.172   1.00 61.75 ? 571  MET B CG  1 
ATOM   9420  S  SD  . MET B  1  543 ? 35.430  74.882  3.724   1.00 62.27 ? 571  MET B SD  1 
ATOM   9421  C  CE  . MET B  1  543 ? 35.991  75.345  2.062   1.00 62.72 ? 571  MET B CE  1 
ATOM   9422  N  N   . GLU B  1  544 ? 34.291  70.367  1.804   1.00 59.55 ? 572  GLU B N   1 
ATOM   9423  C  CA  . GLU B  1  544 ? 34.083  69.110  1.099   1.00 60.02 ? 572  GLU B CA  1 
ATOM   9424  C  C   . GLU B  1  544 ? 35.292  68.179  1.177   1.00 59.93 ? 572  GLU B C   1 
ATOM   9425  O  O   . GLU B  1  544 ? 35.141  66.961  1.312   1.00 60.45 ? 572  GLU B O   1 
ATOM   9426  C  CB  . GLU B  1  544 ? 33.728  69.384  -0.369  1.00 58.16 ? 572  GLU B CB  1 
ATOM   9427  C  CG  . GLU B  1  544 ? 32.277  69.787  -0.579  1.00 59.66 ? 572  GLU B CG  1 
ATOM   9428  C  CD  . GLU B  1  544 ? 31.924  70.047  -2.038  1.00 60.47 ? 572  GLU B CD  1 
ATOM   9429  O  OE1 . GLU B  1  544 ? 30.722  70.241  -2.341  1.00 59.36 ? 572  GLU B OE1 1 
ATOM   9430  O  OE2 . GLU B  1  544 ? 32.848  70.061  -2.880  1.00 59.85 ? 572  GLU B OE2 1 
ATOM   9431  N  N   . GLU B  1  545 ? 36.485  68.765  1.120   1.00 59.69 ? 573  GLU B N   1 
ATOM   9432  C  CA  . GLU B  1  545 ? 37.735  68.010  1.139   1.00 59.51 ? 573  GLU B CA  1 
ATOM   9433  C  C   . GLU B  1  545 ? 38.026  67.246  2.409   1.00 58.58 ? 573  GLU B C   1 
ATOM   9434  O  O   . GLU B  1  545 ? 38.445  66.088  2.354   1.00 58.12 ? 573  GLU B O   1 
ATOM   9435  C  CB  . GLU B  1  545 ? 38.917  68.936  0.839   1.00 60.50 ? 573  GLU B CB  1 
ATOM   9436  C  CG  . GLU B  1  545 ? 39.054  69.329  -0.636  1.00 61.33 ? 573  GLU B CG  1 
ATOM   9437  C  CD  . GLU B  1  545 ? 38.208  70.527  -1.043  1.00 61.43 ? 573  GLU B CD  1 
ATOM   9438  O  OE1 . GLU B  1  545 ? 38.177  70.818  -2.262  1.00 60.95 ? 573  GLU B OE1 1 
ATOM   9439  O  OE2 . GLU B  1  545 ? 37.589  71.175  -0.158  1.00 62.20 ? 573  GLU B OE2 1 
ATOM   9440  N  N   . GLN B  1  546 ? 37.827  67.896  3.550   1.00 58.28 ? 574  GLN B N   1 
ATOM   9441  C  CA  . GLN B  1  546 ? 38.086  67.248  4.821   1.00 58.35 ? 574  GLN B CA  1 
ATOM   9442  C  C   . GLN B  1  546 ? 36.995  66.234  5.125   1.00 57.69 ? 574  GLN B C   1 
ATOM   9443  O  O   . GLN B  1  546 ? 37.012  65.591  6.173   1.00 57.01 ? 574  GLN B O   1 
ATOM   9444  C  CB  . GLN B  1  546 ? 38.217  68.292  5.948   1.00 58.21 ? 574  GLN B CB  1 
ATOM   9445  C  CG  . GLN B  1  546 ? 37.172  69.421  5.961   1.00 58.08 ? 574  GLN B CG  1 
ATOM   9446  C  CD  . GLN B  1  546 ? 37.375  70.408  7.124   1.00 58.35 ? 574  GLN B CD  1 
ATOM   9447  O  OE1 . GLN B  1  546 ? 36.588  71.341  7.318   1.00 58.18 ? 574  GLN B OE1 1 
ATOM   9448  N  NE2 . GLN B  1  546 ? 38.436  70.201  7.896   1.00 57.49 ? 574  GLN B NE2 1 
ATOM   9449  N  N   . ALA B  1  547 ? 36.060  66.093  4.185   1.00 57.68 ? 575  ALA B N   1 
ATOM   9450  C  CA  . ALA B  1  547 ? 34.947  65.153  4.303   1.00 56.90 ? 575  ALA B CA  1 
ATOM   9451  C  C   . ALA B  1  547 ? 34.995  64.147  3.156   1.00 57.33 ? 575  ALA B C   1 
ATOM   9452  O  O   . ALA B  1  547 ? 34.045  63.403  2.922   1.00 58.41 ? 575  ALA B O   1 
ATOM   9453  C  CB  . ALA B  1  547 ? 33.626  65.894  4.280   1.00 56.44 ? 575  ALA B CB  1 
ATOM   9454  N  N   . ALA B  1  548 ? 36.098  64.145  2.424   1.00 56.51 ? 576  ALA B N   1 
ATOM   9455  C  CA  . ALA B  1  548 ? 36.265  63.214  1.329   1.00 55.72 ? 576  ALA B CA  1 
ATOM   9456  C  C   . ALA B  1  548 ? 37.349  62.288  1.818   1.00 55.46 ? 576  ALA B C   1 
ATOM   9457  O  O   . ALA B  1  548 ? 38.444  62.735  2.146   1.00 55.71 ? 576  ALA B O   1 
ATOM   9458  C  CB  . ALA B  1  548 ? 36.710  63.941  0.090   1.00 56.22 ? 576  ALA B CB  1 
ATOM   9459  N  N   . PHE B  1  549 ? 37.046  61.001  1.895   1.00 55.59 ? 577  PHE B N   1 
ATOM   9460  C  CA  . PHE B  1  549 ? 38.034  60.051  2.381   1.00 56.84 ? 577  PHE B CA  1 
ATOM   9461  C  C   . PHE B  1  549 ? 38.446  59.047  1.343   1.00 56.10 ? 577  PHE B C   1 
ATOM   9462  O  O   . PHE B  1  549 ? 37.659  58.204  0.916   1.00 56.02 ? 577  PHE B O   1 
ATOM   9463  C  CB  . PHE B  1  549 ? 37.514  59.318  3.614   1.00 57.48 ? 577  PHE B CB  1 
ATOM   9464  C  CG  . PHE B  1  549 ? 37.153  60.234  4.744   1.00 57.39 ? 577  PHE B CG  1 
ATOM   9465  C  CD1 . PHE B  1  549 ? 36.004  61.023  4.679   1.00 57.30 ? 577  PHE B CD1 1 
ATOM   9466  C  CD2 . PHE B  1  549 ? 37.975  60.337  5.860   1.00 57.48 ? 577  PHE B CD2 1 
ATOM   9467  C  CE1 . PHE B  1  549 ? 35.682  61.903  5.712   1.00 57.18 ? 577  PHE B CE1 1 
ATOM   9468  C  CE2 . PHE B  1  549 ? 37.661  61.215  6.899   1.00 57.97 ? 577  PHE B CE2 1 
ATOM   9469  C  CZ  . PHE B  1  549 ? 36.510  62.000  6.823   1.00 56.92 ? 577  PHE B CZ  1 
ATOM   9470  N  N   . LEU B  1  550 ? 39.705  59.142  0.953   1.00 56.65 ? 578  LEU B N   1 
ATOM   9471  C  CA  . LEU B  1  550 ? 40.269  58.257  -0.047  1.00 58.47 ? 578  LEU B CA  1 
ATOM   9472  C  C   . LEU B  1  550 ? 40.302  56.804  0.410   1.00 58.42 ? 578  LEU B C   1 
ATOM   9473  O  O   . LEU B  1  550 ? 40.309  56.519  1.608   1.00 57.30 ? 578  LEU B O   1 
ATOM   9474  C  CB  . LEU B  1  550 ? 41.684  58.725  -0.397  1.00 57.34 ? 578  LEU B CB  1 
ATOM   9475  C  CG  . LEU B  1  550 ? 41.740  59.995  -1.240  1.00 56.92 ? 578  LEU B CG  1 
ATOM   9476  C  CD1 . LEU B  1  550 ? 43.133  60.587  -1.203  1.00 57.47 ? 578  LEU B CD1 1 
ATOM   9477  C  CD2 . LEU B  1  550 ? 41.315  59.658  -2.658  1.00 56.37 ? 578  LEU B CD2 1 
ATOM   9478  N  N   . VAL B  1  551 ? 40.302  55.884  -0.551  1.00 58.35 ? 579  VAL B N   1 
ATOM   9479  C  CA  . VAL B  1  551 ? 40.374  54.471  -0.215  1.00 59.08 ? 579  VAL B CA  1 
ATOM   9480  C  C   . VAL B  1  551 ? 41.763  54.275  0.377   1.00 59.67 ? 579  VAL B C   1 
ATOM   9481  O  O   . VAL B  1  551 ? 42.754  54.745  -0.188  1.00 59.97 ? 579  VAL B O   1 
ATOM   9482  C  CB  . VAL B  1  551 ? 40.237  53.552  -1.464  1.00 59.56 ? 579  VAL B CB  1 
ATOM   9483  C  CG1 . VAL B  1  551 ? 40.563  52.099  -1.079  1.00 57.93 ? 579  VAL B CG1 1 
ATOM   9484  C  CG2 . VAL B  1  551 ? 38.819  53.633  -2.036  1.00 59.45 ? 579  VAL B CG2 1 
ATOM   9485  N  N   . GLY B  1  552 ? 41.835  53.596  1.516   1.00 59.22 ? 580  GLY B N   1 
ATOM   9486  C  CA  . GLY B  1  552 ? 43.121  53.365  2.140   1.00 58.70 ? 580  GLY B CA  1 
ATOM   9487  C  C   . GLY B  1  552 ? 43.311  54.072  3.468   1.00 59.50 ? 580  GLY B C   1 
ATOM   9488  O  O   . GLY B  1  552 ? 43.651  53.429  4.459   1.00 60.02 ? 580  GLY B O   1 
ATOM   9489  N  N   . SER B  1  553 ? 43.102  55.386  3.501   1.00 59.44 ? 581  SER B N   1 
ATOM   9490  C  CA  . SER B  1  553 ? 43.278  56.138  4.737   1.00 59.08 ? 581  SER B CA  1 
ATOM   9491  C  C   . SER B  1  553 ? 42.152  55.880  5.745   1.00 59.14 ? 581  SER B C   1 
ATOM   9492  O  O   . SER B  1  553 ? 41.034  55.541  5.362   1.00 58.85 ? 581  SER B O   1 
ATOM   9493  C  CB  . SER B  1  553 ? 43.411  57.643  4.428   1.00 59.69 ? 581  SER B CB  1 
ATOM   9494  O  OG  . SER B  1  553 ? 42.344  58.129  3.629   1.00 60.77 ? 581  SER B OG  1 
ATOM   9495  N  N   . ALA B  1  554 ? 42.464  56.035  7.033   1.00 59.57 ? 582  ALA B N   1 
ATOM   9496  C  CA  . ALA B  1  554 ? 41.502  55.826  8.121   1.00 58.47 ? 582  ALA B CA  1 
ATOM   9497  C  C   . ALA B  1  554 ? 40.395  56.867  8.160   1.00 58.77 ? 582  ALA B C   1 
ATOM   9498  O  O   . ALA B  1  554 ? 40.584  58.030  7.771   1.00 58.50 ? 582  ALA B O   1 
ATOM   9499  C  CB  . ALA B  1  554 ? 42.215  55.823  9.455   1.00 59.17 ? 582  ALA B CB  1 
ATOM   9500  N  N   . THR B  1  555 ? 39.245  56.441  8.665   1.00 57.80 ? 583  THR B N   1 
ATOM   9501  C  CA  . THR B  1  555 ? 38.087  57.308  8.758   1.00 57.35 ? 583  THR B CA  1 
ATOM   9502  C  C   . THR B  1  555 ? 37.603  57.378  10.201  1.00 56.76 ? 583  THR B C   1 
ATOM   9503  O  O   . THR B  1  555 ? 37.925  56.505  11.007  1.00 56.33 ? 583  THR B O   1 
ATOM   9504  C  CB  . THR B  1  555 ? 36.968  56.775  7.856   1.00 57.25 ? 583  THR B CB  1 
ATOM   9505  O  OG1 . THR B  1  555 ? 36.748  55.394  8.150   1.00 57.20 ? 583  THR B OG1 1 
ATOM   9506  C  CG2 . THR B  1  555 ? 37.365  56.903  6.392   1.00 57.41 ? 583  THR B CG2 1 
ATOM   9507  N  N   . PRO B  1  556 ? 36.843  58.432  10.555  1.00 55.82 ? 584  PRO B N   1 
ATOM   9508  C  CA  . PRO B  1  556 ? 36.354  58.535  11.932  1.00 55.32 ? 584  PRO B CA  1 
ATOM   9509  C  C   . PRO B  1  556 ? 35.425  57.367  12.274  1.00 54.85 ? 584  PRO B C   1 
ATOM   9510  O  O   . PRO B  1  556 ? 34.579  56.971  11.466  1.00 55.32 ? 584  PRO B O   1 
ATOM   9511  C  CB  . PRO B  1  556 ? 35.646  59.896  11.946  1.00 54.24 ? 584  PRO B CB  1 
ATOM   9512  C  CG  . PRO B  1  556 ? 35.184  60.052  10.551  1.00 54.77 ? 584  PRO B CG  1 
ATOM   9513  C  CD  . PRO B  1  556 ? 36.379  59.578  9.756   1.00 54.57 ? 584  PRO B CD  1 
ATOM   9514  N  N   . ARG B  1  557 ? 35.589  56.812  13.469  1.00 52.95 ? 585  ARG B N   1 
ATOM   9515  C  CA  . ARG B  1  557 ? 34.768  55.689  13.887  1.00 53.60 ? 585  ARG B CA  1 
ATOM   9516  C  C   . ARG B  1  557 ? 33.285  56.024  13.864  1.00 53.60 ? 585  ARG B C   1 
ATOM   9517  O  O   . ARG B  1  557 ? 32.443  55.155  13.635  1.00 54.41 ? 585  ARG B O   1 
ATOM   9518  C  CB  . ARG B  1  557 ? 35.189  55.223  15.275  1.00 52.23 ? 585  ARG B CB  1 
ATOM   9519  C  CG  . ARG B  1  557 ? 36.577  54.644  15.295  1.00 49.25 ? 585  ARG B CG  1 
ATOM   9520  C  CD  . ARG B  1  557 ? 36.735  53.667  16.430  1.00 49.19 ? 585  ARG B CD  1 
ATOM   9521  N  NE  . ARG B  1  557 ? 38.013  52.972  16.346  1.00 47.58 ? 585  ARG B NE  1 
ATOM   9522  C  CZ  . ARG B  1  557 ? 39.203  53.569  16.415  1.00 46.79 ? 585  ARG B CZ  1 
ATOM   9523  N  NH1 . ARG B  1  557 ? 39.285  54.884  16.574  1.00 46.34 ? 585  ARG B NH1 1 
ATOM   9524  N  NH2 . ARG B  1  557 ? 40.318  52.853  16.323  1.00 46.16 ? 585  ARG B NH2 1 
ATOM   9525  N  N   . TYR B  1  558 ? 32.973  57.286  14.117  1.00 52.63 ? 586  TYR B N   1 
ATOM   9526  C  CA  . TYR B  1  558 ? 31.601  57.748  14.090  1.00 52.10 ? 586  TYR B CA  1 
ATOM   9527  C  C   . TYR B  1  558 ? 31.583  58.916  13.137  1.00 52.63 ? 586  TYR B C   1 
ATOM   9528  O  O   . TYR B  1  558 ? 32.207  59.944  13.382  1.00 53.77 ? 586  TYR B O   1 
ATOM   9529  C  CB  . TYR B  1  558 ? 31.152  58.193  15.476  1.00 52.33 ? 586  TYR B CB  1 
ATOM   9530  C  CG  . TYR B  1  558 ? 30.449  57.119  16.271  1.00 52.61 ? 586  TYR B CG  1 
ATOM   9531  C  CD1 . TYR B  1  558 ? 29.056  57.070  16.328  1.00 52.55 ? 586  TYR B CD1 1 
ATOM   9532  C  CD2 . TYR B  1  558 ? 31.172  56.129  16.936  1.00 52.04 ? 586  TYR B CD2 1 
ATOM   9533  C  CE1 . TYR B  1  558 ? 28.395  56.057  17.024  1.00 53.73 ? 586  TYR B CE1 1 
ATOM   9534  C  CE2 . TYR B  1  558 ? 30.525  55.109  17.637  1.00 53.36 ? 586  TYR B CE2 1 
ATOM   9535  C  CZ  . TYR B  1  558 ? 29.133  55.073  17.678  1.00 54.28 ? 586  TYR B CZ  1 
ATOM   9536  O  OH  . TYR B  1  558 ? 28.476  54.048  18.350  1.00 53.63 ? 586  TYR B OH  1 
ATOM   9537  N  N   . LEU B  1  559 ? 30.908  58.742  12.015  1.00 54.27 ? 587  LEU B N   1 
ATOM   9538  C  CA  . LEU B  1  559 ? 30.808  59.814  11.042  1.00 53.75 ? 587  LEU B CA  1 
ATOM   9539  C  C   . LEU B  1  559 ? 29.346  59.916  10.675  1.00 52.60 ? 587  LEU B C   1 
ATOM   9540  O  O   . LEU B  1  559 ? 28.690  58.903  10.432  1.00 52.62 ? 587  LEU B O   1 
ATOM   9541  C  CB  . LEU B  1  559 ? 31.645  59.507  9.804   1.00 52.95 ? 587  LEU B CB  1 
ATOM   9542  C  CG  . LEU B  1  559 ? 31.614  60.591  8.725   1.00 52.30 ? 587  LEU B CG  1 
ATOM   9543  C  CD1 . LEU B  1  559 ? 32.078  61.918  9.294   1.00 52.40 ? 587  LEU B CD1 1 
ATOM   9544  C  CD2 . LEU B  1  559 ? 32.500  60.185  7.578   1.00 52.01 ? 587  LEU B CD2 1 
ATOM   9545  N  N   . TYR B  1  560 ? 28.829  61.133  10.628  1.00 52.08 ? 588  TYR B N   1 
ATOM   9546  C  CA  . TYR B  1  560 ? 27.425  61.281  10.322  1.00 52.93 ? 588  TYR B CA  1 
ATOM   9547  C  C   . TYR B  1  560 ? 26.988  62.675  9.940   1.00 52.49 ? 588  TYR B C   1 
ATOM   9548  O  O   . TYR B  1  560 ? 27.632  63.665  10.270  1.00 52.62 ? 588  TYR B O   1 
ATOM   9549  C  CB  . TYR B  1  560 ? 26.633  60.852  11.532  1.00 53.85 ? 588  TYR B CB  1 
ATOM   9550  C  CG  . TYR B  1  560 ? 26.944  61.705  12.737  1.00 54.27 ? 588  TYR B CG  1 
ATOM   9551  C  CD1 . TYR B  1  560 ? 26.221  62.881  12.990  1.00 53.52 ? 588  TYR B CD1 1 
ATOM   9552  C  CD2 . TYR B  1  560 ? 27.960  61.341  13.630  1.00 53.07 ? 588  TYR B CD2 1 
ATOM   9553  C  CE1 . TYR B  1  560 ? 26.497  63.673  14.108  1.00 53.36 ? 588  TYR B CE1 1 
ATOM   9554  C  CE2 . TYR B  1  560 ? 28.247  62.125  14.752  1.00 53.47 ? 588  TYR B CE2 1 
ATOM   9555  C  CZ  . TYR B  1  560 ? 27.512  63.289  14.988  1.00 54.13 ? 588  TYR B CZ  1 
ATOM   9556  O  OH  . TYR B  1  560 ? 27.788  64.059  16.104  1.00 53.16 ? 588  TYR B OH  1 
ATOM   9557  N  N   . LEU B  1  561 ? 25.866  62.732  9.242   1.00 53.39 ? 589  LEU B N   1 
ATOM   9558  C  CA  . LEU B  1  561 ? 25.291  64.000  8.834   1.00 54.51 ? 589  LEU B CA  1 
ATOM   9559  C  C   . LEU B  1  561 ? 24.198  64.203  9.839   1.00 53.85 ? 589  LEU B C   1 
ATOM   9560  O  O   . LEU B  1  561 ? 23.502  63.259  10.203  1.00 53.74 ? 589  LEU B O   1 
ATOM   9561  C  CB  . LEU B  1  561 ? 24.661  63.913  7.450   1.00 53.60 ? 589  LEU B CB  1 
ATOM   9562  C  CG  . LEU B  1  561 ? 25.437  63.160  6.378   1.00 51.70 ? 589  LEU B CG  1 
ATOM   9563  C  CD1 . LEU B  1  561 ? 24.756  63.388  5.057   1.00 51.51 ? 589  LEU B CD1 1 
ATOM   9564  C  CD2 . LEU B  1  561 ? 26.863  63.640  6.331   1.00 51.70 ? 589  LEU B CD2 1 
ATOM   9565  N  N   . ALA B  1  562 ? 24.033  65.429  10.290  1.00 54.88 ? 590  ALA B N   1 
ATOM   9566  C  CA  . ALA B  1  562 ? 23.016  65.681  11.278  1.00 56.37 ? 590  ALA B CA  1 
ATOM   9567  C  C   . ALA B  1  562 ? 22.346  67.005  11.030  1.00 55.95 ? 590  ALA B C   1 
ATOM   9568  O  O   . ALA B  1  562 ? 22.827  67.834  10.263  1.00 56.38 ? 590  ALA B O   1 
ATOM   9569  C  CB  . ALA B  1  562 ? 23.640  65.653  12.675  1.00 56.95 ? 590  ALA B CB  1 
ATOM   9570  N  N   . SER B  1  563 ? 21.222  67.194  11.692  1.00 56.55 ? 591  SER B N   1 
ATOM   9571  C  CA  . SER B  1  563 ? 20.482  68.421  11.559  1.00 58.35 ? 591  SER B CA  1 
ATOM   9572  C  C   . SER B  1  563 ? 21.115  69.486  12.437  1.00 60.00 ? 591  SER B C   1 
ATOM   9573  O  O   . SER B  1  563 ? 22.076  69.244  13.180  1.00 59.34 ? 591  SER B O   1 
ATOM   9574  C  CB  . SER B  1  563 ? 19.019  68.214  11.971  1.00 58.54 ? 591  SER B CB  1 
ATOM   9575  O  OG  . SER B  1  563 ? 18.241  69.383  11.753  1.00 56.59 ? 591  SER B OG  1 
ATOM   9576  N  N   . ASN B  1  564 ? 20.536  70.671  12.319  1.00 62.18 ? 592  ASN B N   1 
ATOM   9577  C  CA  . ASN B  1  564 ? 20.918  71.877  13.035  1.00 61.81 ? 592  ASN B CA  1 
ATOM   9578  C  C   . ASN B  1  564 ? 20.204  71.796  14.384  1.00 62.28 ? 592  ASN B C   1 
ATOM   9579  O  O   . ASN B  1  564 ? 20.718  72.267  15.397  1.00 62.20 ? 592  ASN B O   1 
ATOM   9580  C  CB  . ASN B  1  564 ? 20.423  73.056  12.184  1.00 65.79 ? 592  ASN B CB  1 
ATOM   9581  C  CG  . ASN B  1  564 ? 20.599  74.395  12.838  1.00 69.45 ? 592  ASN B CG  1 
ATOM   9582  O  OD1 . ASN B  1  564 ? 21.535  74.608  13.608  1.00 66.96 ? 592  ASN B OD1 1 
ATOM   9583  N  ND2 . ASN B  1  564 ? 19.698  75.314  12.490  1.00 75.60 ? 592  ASN B ND2 1 
ATOM   9584  N  N   . HIS B  1  565 ? 19.032  71.147  14.370  1.00 63.62 ? 593  HIS B N   1 
ATOM   9585  C  CA  . HIS B  1  565 ? 18.155  70.968  15.535  1.00 63.10 ? 593  HIS B CA  1 
ATOM   9586  C  C   . HIS B  1  565 ? 18.513  69.777  16.435  1.00 62.49 ? 593  HIS B C   1 
ATOM   9587  O  O   . HIS B  1  565 ? 18.992  68.741  15.963  1.00 62.34 ? 593  HIS B O   1 
ATOM   9588  C  CB  . HIS B  1  565 ? 16.708  70.827  15.054  1.00 62.74 ? 593  HIS B CB  1 
ATOM   9589  C  CG  . HIS B  1  565 ? 16.318  71.833  14.014  1.00 63.56 ? 593  HIS B CG  1 
ATOM   9590  N  ND1 . HIS B  1  565 ? 16.267  73.188  14.268  1.00 65.22 ? 593  HIS B ND1 1 
ATOM   9591  C  CD2 . HIS B  1  565 ? 15.968  71.683  12.713  1.00 65.27 ? 593  HIS B CD2 1 
ATOM   9592  C  CE1 . HIS B  1  565 ? 15.902  73.829  13.169  1.00 66.63 ? 593  HIS B CE1 1 
ATOM   9593  N  NE2 . HIS B  1  565 ? 15.713  72.939  12.210  1.00 66.58 ? 593  HIS B NE2 1 
ATOM   9594  N  N   . SER B  1  566 ? 18.255  69.931  17.731  1.00 62.20 ? 594  SER B N   1 
ATOM   9595  C  CA  . SER B  1  566 ? 18.562  68.894  18.705  1.00 61.89 ? 594  SER B CA  1 
ATOM   9596  C  C   . SER B  1  566 ? 17.400  67.997  19.081  1.00 62.52 ? 594  SER B C   1 
ATOM   9597  O  O   . SER B  1  566 ? 16.234  68.392  19.011  1.00 62.47 ? 594  SER B O   1 
ATOM   9598  C  CB  . SER B  1  566 ? 19.112  69.517  19.986  1.00 62.21 ? 594  SER B CB  1 
ATOM   9599  O  OG  . SER B  1  566 ? 20.434  69.981  19.797  1.00 62.78 ? 594  SER B OG  1 
ATOM   9600  N  N   . ASN B  1  567 ? 17.737  66.778  19.485  1.00 61.50 ? 595  ASN B N   1 
ATOM   9601  C  CA  . ASN B  1  567 ? 16.734  65.828  19.920  1.00 62.08 ? 595  ASN B CA  1 
ATOM   9602  C  C   . ASN B  1  567 ? 16.616  65.998  21.438  1.00 62.95 ? 595  ASN B C   1 
ATOM   9603  O  O   . ASN B  1  567 ? 17.606  66.250  22.126  1.00 62.24 ? 595  ASN B O   1 
ATOM   9604  C  CB  . ASN B  1  567 ? 17.149  64.395  19.574  1.00 60.89 ? 595  ASN B CB  1 
ATOM   9605  C  CG  . ASN B  1  567 ? 17.963  63.743  20.664  1.00 60.16 ? 595  ASN B CG  1 
ATOM   9606  O  OD1 . ASN B  1  567 ? 19.042  64.200  21.009  1.00 61.00 ? 595  ASN B OD1 1 
ATOM   9607  N  ND2 . ASN B  1  567 ? 17.444  62.664  21.212  1.00 60.21 ? 595  ASN B ND2 1 
ATOM   9608  N  N   . LYS B  1  568 ? 15.390  65.883  21.935  1.00 62.46 ? 596  LYS B N   1 
ATOM   9609  C  CA  . LYS B  1  568 ? 15.054  66.019  23.349  1.00 61.49 ? 596  LYS B CA  1 
ATOM   9610  C  C   . LYS B  1  568 ? 16.169  66.131  24.394  1.00 60.55 ? 596  LYS B C   1 
ATOM   9611  O  O   . LYS B  1  568 ? 16.048  66.906  25.337  1.00 60.26 ? 596  LYS B O   1 
ATOM   9612  C  CB  . LYS B  1  568 ? 14.133  64.875  23.749  1.00 61.97 ? 596  LYS B CB  1 
ATOM   9613  C  CG  . LYS B  1  568 ? 13.582  65.010  25.138  1.00 62.92 ? 596  LYS B CG  1 
ATOM   9614  C  CD  . LYS B  1  568 ? 13.012  63.693  25.615  1.00 63.08 ? 596  LYS B CD  1 
ATOM   9615  C  CE  . LYS B  1  568 ? 12.204  63.902  26.874  1.00 62.90 ? 596  LYS B CE  1 
ATOM   9616  N  NZ  . LYS B  1  568 ? 11.095  64.863  26.606  1.00 63.15 ? 596  LYS B NZ  1 
ATOM   9617  N  N   . TRP B  1  569 ? 17.237  65.357  24.254  1.00 60.26 ? 597  TRP B N   1 
ATOM   9618  C  CA  . TRP B  1  569 ? 18.315  65.406  25.235  1.00 61.12 ? 597  TRP B CA  1 
ATOM   9619  C  C   . TRP B  1  569 ? 19.386  66.403  24.842  1.00 61.35 ? 597  TRP B C   1 
ATOM   9620  O  O   . TRP B  1  569 ? 20.496  66.381  25.371  1.00 60.83 ? 597  TRP B O   1 
ATOM   9621  C  CB  . TRP B  1  569 ? 18.906  64.011  25.434  1.00 61.51 ? 597  TRP B CB  1 
ATOM   9622  C  CG  . TRP B  1  569 ? 17.822  62.995  25.602  1.00 62.01 ? 597  TRP B CG  1 
ATOM   9623  C  CD1 . TRP B  1  569 ? 17.439  62.039  24.700  1.00 62.08 ? 597  TRP B CD1 1 
ATOM   9624  C  CD2 . TRP B  1  569 ? 16.878  62.932  26.671  1.00 62.43 ? 597  TRP B CD2 1 
ATOM   9625  N  NE1 . TRP B  1  569 ? 16.306  61.392  25.137  1.00 61.12 ? 597  TRP B NE1 1 
ATOM   9626  C  CE2 . TRP B  1  569 ? 15.939  61.921  26.346  1.00 62.19 ? 597  TRP B CE2 1 
ATOM   9627  C  CE3 . TRP B  1  569 ? 16.726  63.635  27.870  1.00 61.52 ? 597  TRP B CE3 1 
ATOM   9628  C  CZ2 . TRP B  1  569 ? 14.866  61.600  27.178  1.00 61.63 ? 597  TRP B CZ2 1 
ATOM   9629  C  CZ3 . TRP B  1  569 ? 15.656  63.315  28.695  1.00 61.73 ? 597  TRP B CZ3 1 
ATOM   9630  C  CH2 . TRP B  1  569 ? 14.742  62.306  28.344  1.00 61.47 ? 597  TRP B CH2 1 
ATOM   9631  N  N   . GLY B  1  570 ? 19.030  67.277  23.906  1.00 61.62 ? 598  GLY B N   1 
ATOM   9632  C  CA  . GLY B  1  570 ? 19.929  68.324  23.456  1.00 61.34 ? 598  GLY B CA  1 
ATOM   9633  C  C   . GLY B  1  570 ? 21.094  67.952  22.568  1.00 61.17 ? 598  GLY B C   1 
ATOM   9634  O  O   . GLY B  1  570 ? 22.171  68.518  22.700  1.00 61.27 ? 598  GLY B O   1 
ATOM   9635  N  N   . HIS B  1  571 ? 20.891  67.011  21.657  1.00 62.08 ? 599  HIS B N   1 
ATOM   9636  C  CA  . HIS B  1  571 ? 21.954  66.601  20.749  1.00 61.55 ? 599  HIS B CA  1 
ATOM   9637  C  C   . HIS B  1  571 ? 21.511  66.786  19.309  1.00 62.21 ? 599  HIS B C   1 
ATOM   9638  O  O   . HIS B  1  571 ? 20.339  66.596  18.980  1.00 62.69 ? 599  HIS B O   1 
ATOM   9639  C  CB  . HIS B  1  571 ? 22.315  65.131  20.971  1.00 62.62 ? 599  HIS B CB  1 
ATOM   9640  C  CG  . HIS B  1  571 ? 23.133  64.891  22.198  1.00 64.09 ? 599  HIS B CG  1 
ATOM   9641  N  ND1 . HIS B  1  571 ? 24.481  65.165  22.254  1.00 64.56 ? 599  HIS B ND1 1 
ATOM   9642  C  CD2 . HIS B  1  571 ? 22.793  64.422  23.422  1.00 65.02 ? 599  HIS B CD2 1 
ATOM   9643  C  CE1 . HIS B  1  571 ? 24.937  64.876  23.461  1.00 65.06 ? 599  HIS B CE1 1 
ATOM   9644  N  NE2 . HIS B  1  571 ? 23.933  64.422  24.189  1.00 65.17 ? 599  HIS B NE2 1 
ATOM   9645  N  N   . PRO B  1  572 ? 22.438  67.182  18.428  1.00 62.31 ? 600  PRO B N   1 
ATOM   9646  C  CA  . PRO B  1  572 ? 22.018  67.355  17.037  1.00 61.14 ? 600  PRO B CA  1 
ATOM   9647  C  C   . PRO B  1  572 ? 21.552  66.005  16.507  1.00 60.92 ? 600  PRO B C   1 
ATOM   9648  O  O   . PRO B  1  572 ? 22.262  64.996  16.618  1.00 61.37 ? 600  PRO B O   1 
ATOM   9649  C  CB  . PRO B  1  572 ? 23.283  67.862  16.355  1.00 61.32 ? 600  PRO B CB  1 
ATOM   9650  C  CG  . PRO B  1  572 ? 24.395  67.300  17.220  1.00 62.29 ? 600  PRO B CG  1 
ATOM   9651  C  CD  . PRO B  1  572 ? 23.863  67.505  18.602  1.00 62.09 ? 600  PRO B CD  1 
ATOM   9652  N  N   . ARG B  1  573 ? 20.342  65.988  15.962  1.00 60.38 ? 601  ARG B N   1 
ATOM   9653  C  CA  . ARG B  1  573 ? 19.762  64.765  15.429  1.00 60.10 ? 601  ARG B CA  1 
ATOM   9654  C  C   . ARG B  1  573 ? 20.466  64.358  14.142  1.00 60.52 ? 601  ARG B C   1 
ATOM   9655  O  O   . ARG B  1  573 ? 20.305  65.012  13.106  1.00 61.61 ? 601  ARG B O   1 
ATOM   9656  C  CB  . ARG B  1  573 ? 18.282  64.977  15.142  1.00 59.85 ? 601  ARG B CB  1 
ATOM   9657  C  CG  . ARG B  1  573 ? 17.510  65.503  16.310  1.00 61.12 ? 601  ARG B CG  1 
ATOM   9658  C  CD  . ARG B  1  573 ? 16.104  65.805  15.870  1.00 63.10 ? 601  ARG B CD  1 
ATOM   9659  N  NE  . ARG B  1  573 ? 15.403  64.594  15.470  1.00 63.85 ? 601  ARG B NE  1 
ATOM   9660  C  CZ  . ARG B  1  573 ? 14.372  64.583  14.635  1.00 64.47 ? 601  ARG B CZ  1 
ATOM   9661  N  NH1 . ARG B  1  573 ? 13.932  65.720  14.113  1.00 65.06 ? 601  ARG B NH1 1 
ATOM   9662  N  NH2 . ARG B  1  573 ? 13.779  63.438  14.330  1.00 65.66 ? 601  ARG B NH2 1 
ATOM   9663  N  N   . GLY B  1  574 ? 21.238  63.276  14.193  1.00 58.91 ? 602  GLY B N   1 
ATOM   9664  C  CA  . GLY B  1  574 ? 21.932  62.853  12.993  1.00 57.83 ? 602  GLY B CA  1 
ATOM   9665  C  C   . GLY B  1  574 ? 21.726  61.405  12.615  1.00 57.63 ? 602  GLY B C   1 
ATOM   9666  O  O   . GLY B  1  574 ? 21.050  60.638  13.314  1.00 56.97 ? 602  GLY B O   1 
ATOM   9667  N  N   . TYR B  1  575 ? 22.297  61.044  11.474  1.00 56.22 ? 603  TYR B N   1 
ATOM   9668  C  CA  . TYR B  1  575 ? 22.240  59.684  11.004  1.00 55.13 ? 603  TYR B CA  1 
ATOM   9669  C  C   . TYR B  1  575 ? 23.655  59.327  10.622  1.00 55.40 ? 603  TYR B C   1 
ATOM   9670  O  O   . TYR B  1  575 ? 24.282  59.993  9.800   1.00 54.82 ? 603  TYR B O   1 
ATOM   9671  C  CB  . TYR B  1  575 ? 21.295  59.551  9.824   1.00 54.57 ? 603  TYR B CB  1 
ATOM   9672  C  CG  . TYR B  1  575 ? 20.057  58.751  10.169  1.00 55.67 ? 603  TYR B CG  1 
ATOM   9673  C  CD1 . TYR B  1  575 ? 18.975  59.339  10.820  1.00 55.37 ? 603  TYR B CD1 1 
ATOM   9674  C  CD2 . TYR B  1  575 ? 19.974  57.391  9.859   1.00 55.70 ? 603  TYR B CD2 1 
ATOM   9675  C  CE1 . TYR B  1  575 ? 17.844  58.595  11.148  1.00 53.85 ? 603  TYR B CE1 1 
ATOM   9676  C  CE2 . TYR B  1  575 ? 18.847  56.641  10.186  1.00 54.70 ? 603  TYR B CE2 1 
ATOM   9677  C  CZ  . TYR B  1  575 ? 17.792  57.252  10.826  1.00 54.28 ? 603  TYR B CZ  1 
ATOM   9678  O  OH  . TYR B  1  575 ? 16.685  56.516  11.132  1.00 54.44 ? 603  TYR B OH  1 
ATOM   9679  N  N   . ARG B  1  576 ? 24.156  58.281  11.261  1.00 55.23 ? 604  ARG B N   1 
ATOM   9680  C  CA  . ARG B  1  576 ? 25.516  57.804  11.064  1.00 55.95 ? 604  ARG B CA  1 
ATOM   9681  C  C   . ARG B  1  576 ? 25.681  56.955  9.825   1.00 54.89 ? 604  ARG B C   1 
ATOM   9682  O  O   . ARG B  1  576 ? 24.767  56.254  9.425   1.00 55.83 ? 604  ARG B O   1 
ATOM   9683  C  CB  . ARG B  1  576 ? 25.934  56.996  12.286  1.00 54.50 ? 604  ARG B CB  1 
ATOM   9684  C  CG  . ARG B  1  576 ? 27.317  56.422  12.231  1.00 53.98 ? 604  ARG B CG  1 
ATOM   9685  C  CD  . ARG B  1  576 ? 27.419  55.300  13.231  1.00 52.74 ? 604  ARG B CD  1 
ATOM   9686  N  NE  . ARG B  1  576 ? 28.800  54.935  13.503  1.00 52.15 ? 604  ARG B NE  1 
ATOM   9687  C  CZ  . ARG B  1  576 ? 29.150  53.921  14.281  1.00 51.55 ? 604  ARG B CZ  1 
ATOM   9688  N  NH1 . ARG B  1  576 ? 28.216  53.172  14.845  1.00 51.81 ? 604  ARG B NH1 1 
ATOM   9689  N  NH2 . ARG B  1  576 ? 30.430  53.680  14.524  1.00 51.92 ? 604  ARG B NH2 1 
ATOM   9690  N  N   . ILE B  1  577 ? 26.860  57.020  9.223   1.00 55.98 ? 605  ILE B N   1 
ATOM   9691  C  CA  . ILE B  1  577 ? 27.153  56.233  8.035   1.00 56.87 ? 605  ILE B CA  1 
ATOM   9692  C  C   . ILE B  1  577 ? 28.247  55.238  8.329   1.00 57.73 ? 605  ILE B C   1 
ATOM   9693  O  O   . ILE B  1  577 ? 29.414  55.607  8.475   1.00 57.47 ? 605  ILE B O   1 
ATOM   9694  C  CB  . ILE B  1  577 ? 27.639  57.091  6.887   1.00 55.74 ? 605  ILE B CB  1 
ATOM   9695  C  CG1 . ILE B  1  577 ? 26.524  58.020  6.422   1.00 55.49 ? 605  ILE B CG1 1 
ATOM   9696  C  CG2 . ILE B  1  577 ? 28.094  56.198  5.756   1.00 56.77 ? 605  ILE B CG2 1 
ATOM   9697  C  CD1 . ILE B  1  577 ? 26.939  58.944  5.310   1.00 54.08 ? 605  ILE B CD1 1 
ATOM   9698  N  N   . GLN B  1  578 ? 27.866  53.974  8.404   1.00 57.78 ? 606  GLN B N   1 
ATOM   9699  C  CA  . GLN B  1  578 ? 28.810  52.920  8.687   1.00 58.41 ? 606  GLN B CA  1 
ATOM   9700  C  C   . GLN B  1  578 ? 28.984  52.107  7.422   1.00 59.77 ? 606  GLN B C   1 
ATOM   9701  O  O   . GLN B  1  578 ? 28.001  51.674  6.835   1.00 60.09 ? 606  GLN B O   1 
ATOM   9702  C  CB  . GLN B  1  578 ? 28.257  52.062  9.809   1.00 59.43 ? 606  GLN B CB  1 
ATOM   9703  C  CG  . GLN B  1  578 ? 29.159  50.946  10.242  1.00 60.80 ? 606  GLN B CG  1 
ATOM   9704  C  CD  . GLN B  1  578 ? 28.625  50.230  11.471  1.00 62.61 ? 606  GLN B CD  1 
ATOM   9705  O  OE1 . GLN B  1  578 ? 27.444  49.856  11.529  1.00 62.75 ? 606  GLN B OE1 1 
ATOM   9706  N  NE2 . GLN B  1  578 ? 29.493  50.025  12.463  1.00 62.13 ? 606  GLN B NE2 1 
ATOM   9707  N  N   . MET B  1  579 ? 30.234  51.903  7.009   1.00 62.32 ? 607  MET B N   1 
ATOM   9708  C  CA  . MET B  1  579 ? 30.549  51.154  5.787   1.00 62.73 ? 607  MET B CA  1 
ATOM   9709  C  C   . MET B  1  579 ? 31.083  49.748  6.026   1.00 63.54 ? 607  MET B C   1 
ATOM   9710  O  O   . MET B  1  579 ? 31.558  49.426  7.110   1.00 63.75 ? 607  MET B O   1 
ATOM   9711  C  CB  . MET B  1  579 ? 31.576  51.913  4.951   1.00 63.82 ? 607  MET B CB  1 
ATOM   9712  C  CG  . MET B  1  579 ? 31.159  53.317  4.540   1.00 64.19 ? 607  MET B CG  1 
ATOM   9713  S  SD  . MET B  1  579 ? 32.613  54.315  4.122   1.00 63.92 ? 607  MET B SD  1 
ATOM   9714  C  CE  . MET B  1  579 ? 33.252  54.626  5.781   1.00 62.16 ? 607  MET B CE  1 
ATOM   9715  N  N   . LEU B  1  580 ? 31.028  48.923  4.983   1.00 65.81 ? 608  LEU B N   1 
ATOM   9716  C  CA  . LEU B  1  580 ? 31.487  47.534  5.050   1.00 66.61 ? 608  LEU B CA  1 
ATOM   9717  C  C   . LEU B  1  580 ? 32.280  47.251  3.783   1.00 66.81 ? 608  LEU B C   1 
ATOM   9718  O  O   . LEU B  1  580 ? 31.898  46.406  2.979   1.00 66.97 ? 608  LEU B O   1 
ATOM   9719  C  CB  . LEU B  1  580 ? 30.275  46.604  5.103   1.00 67.43 ? 608  LEU B CB  1 
ATOM   9720  C  CG  . LEU B  1  580 ? 29.055  47.116  5.883   1.00 68.02 ? 608  LEU B CG  1 
ATOM   9721  C  CD1 . LEU B  1  580 ? 27.879  46.177  5.638   1.00 67.85 ? 608  LEU B CD1 1 
ATOM   9722  C  CD2 . LEU B  1  580 ? 29.379  47.228  7.377   1.00 66.69 ? 608  LEU B CD2 1 
ATOM   9723  N  N   . SER B  1  581 ? 33.386  47.960  3.610   1.00 67.35 ? 609  SER B N   1 
ATOM   9724  C  CA  . SER B  1  581 ? 34.191  47.796  2.412   1.00 68.38 ? 609  SER B CA  1 
ATOM   9725  C  C   . SER B  1  581 ? 35.593  47.232  2.638   1.00 68.90 ? 609  SER B C   1 
ATOM   9726  O  O   . SER B  1  581 ? 36.222  47.466  3.672   1.00 69.59 ? 609  SER B O   1 
ATOM   9727  C  CB  . SER B  1  581 ? 34.277  49.141  1.682   1.00 68.77 ? 609  SER B CB  1 
ATOM   9728  O  OG  . SER B  1  581 ? 35.118  49.072  0.546   1.00 68.86 ? 609  SER B OG  1 
ATOM   9729  N  N   . PHE B  1  582 ? 36.061  46.476  1.649   1.00 68.17 ? 610  PHE B N   1 
ATOM   9730  C  CA  . PHE B  1  582 ? 37.384  45.865  1.656   1.00 69.27 ? 610  PHE B CA  1 
ATOM   9731  C  C   . PHE B  1  582 ? 37.970  46.282  0.305   1.00 70.55 ? 610  PHE B C   1 
ATOM   9732  O  O   . PHE B  1  582 ? 38.911  45.668  -0.211  1.00 70.83 ? 610  PHE B O   1 
ATOM   9733  C  CB  . PHE B  1  582 ? 37.278  44.333  1.701   1.00 71.37 ? 610  PHE B CB  1 
ATOM   9734  C  CG  . PHE B  1  582 ? 36.210  43.803  2.637   1.00 72.23 ? 610  PHE B CG  1 
ATOM   9735  C  CD1 . PHE B  1  582 ? 35.350  42.778  2.210   1.00 71.48 ? 610  PHE B CD1 1 
ATOM   9736  C  CD2 . PHE B  1  582 ? 36.075  44.300  3.940   1.00 71.30 ? 610  PHE B CD2 1 
ATOM   9737  C  CE1 . PHE B  1  582 ? 34.372  42.252  3.059   1.00 72.09 ? 610  PHE B CE1 1 
ATOM   9738  C  CE2 . PHE B  1  582 ? 35.102  43.785  4.804   1.00 71.97 ? 610  PHE B CE2 1 
ATOM   9739  C  CZ  . PHE B  1  582 ? 34.246  42.755  4.362   1.00 73.05 ? 610  PHE B CZ  1 
ATOM   9740  N  N   . ALA B  1  583 ? 37.374  47.330  -0.261  1.00 70.35 ? 611  ALA B N   1 
ATOM   9741  C  CA  . ALA B  1  583 ? 37.748  47.874  -1.562  1.00 69.16 ? 611  ALA B CA  1 
ATOM   9742  C  C   . ALA B  1  583 ? 39.220  47.761  -1.912  1.00 69.26 ? 611  ALA B C   1 
ATOM   9743  O  O   . ALA B  1  583 ? 40.091  48.115  -1.114  1.00 69.11 ? 611  ALA B O   1 
ATOM   9744  C  CB  . ALA B  1  583 ? 37.310  49.332  -1.654  1.00 69.58 ? 611  ALA B CB  1 
ATOM   9745  N  N   . GLY B  1  584 ? 39.484  47.256  -3.114  1.00 69.86 ? 612  GLY B N   1 
ATOM   9746  C  CA  . GLY B  1  584 ? 40.851  47.128  -3.579  1.00 69.62 ? 612  GLY B CA  1 
ATOM   9747  C  C   . GLY B  1  584 ? 41.360  48.528  -3.853  1.00 69.03 ? 612  GLY B C   1 
ATOM   9748  O  O   . GLY B  1  584 ? 40.653  49.503  -3.604  1.00 67.96 ? 612  GLY B O   1 
ATOM   9749  N  N   . GLU B  1  585 ? 42.579  48.643  -4.359  1.00 68.46 ? 613  GLU B N   1 
ATOM   9750  C  CA  . GLU B  1  585 ? 43.135  49.955  -4.644  1.00 69.03 ? 613  GLU B CA  1 
ATOM   9751  C  C   . GLU B  1  585 ? 42.675  50.434  -6.000  1.00 69.85 ? 613  GLU B C   1 
ATOM   9752  O  O   . GLU B  1  585 ? 42.718  49.687  -6.978  1.00 70.51 ? 613  GLU B O   1 
ATOM   9753  C  CB  . GLU B  1  585 ? 44.657  49.909  -4.618  1.00 70.52 ? 613  GLU B CB  1 
ATOM   9754  C  CG  . GLU B  1  585 ? 45.220  49.631  -3.244  1.00 72.57 ? 613  GLU B CG  1 
ATOM   9755  C  CD  . GLU B  1  585 ? 46.574  48.935  -3.291  1.00 73.59 ? 613  GLU B CD  1 
ATOM   9756  O  OE1 . GLU B  1  585 ? 47.115  48.664  -2.191  1.00 73.81 ? 613  GLU B OE1 1 
ATOM   9757  O  OE2 . GLU B  1  585 ? 47.088  48.659  -4.410  1.00 72.56 ? 613  GLU B OE2 1 
ATOM   9758  N  N   . PRO B  1  586 ? 42.214  51.692  -6.076  1.00 69.82 ? 614  PRO B N   1 
ATOM   9759  C  CA  . PRO B  1  586 ? 41.747  52.252  -7.346  1.00 70.59 ? 614  PRO B CA  1 
ATOM   9760  C  C   . PRO B  1  586 ? 42.891  52.374  -8.346  1.00 69.83 ? 614  PRO B C   1 
ATOM   9761  O  O   . PRO B  1  586 ? 44.041  52.549  -7.949  1.00 69.23 ? 614  PRO B O   1 
ATOM   9762  C  CB  . PRO B  1  586 ? 41.168  53.606  -6.931  1.00 70.61 ? 614  PRO B CB  1 
ATOM   9763  C  CG  . PRO B  1  586 ? 41.954  53.953  -5.690  1.00 69.93 ? 614  PRO B CG  1 
ATOM   9764  C  CD  . PRO B  1  586 ? 42.017  52.646  -4.971  1.00 69.38 ? 614  PRO B CD  1 
ATOM   9765  N  N   . LEU B  1  587 ? 42.586  52.254  -9.634  1.00 68.93 ? 615  LEU B N   1 
ATOM   9766  C  CA  . LEU B  1  587 ? 43.625  52.370  -10.644 1.00 69.08 ? 615  LEU B CA  1 
ATOM   9767  C  C   . LEU B  1  587 ? 44.467  53.573  -10.270 1.00 70.15 ? 615  LEU B C   1 
ATOM   9768  O  O   . LEU B  1  587 ? 43.926  54.599  -9.854  1.00 70.34 ? 615  LEU B O   1 
ATOM   9769  C  CB  . LEU B  1  587 ? 43.028  52.617  -12.029 1.00 70.05 ? 615  LEU B CB  1 
ATOM   9770  C  CG  . LEU B  1  587 ? 42.762  51.487  -13.021 1.00 69.94 ? 615  LEU B CG  1 
ATOM   9771  C  CD1 . LEU B  1  587 ? 42.432  52.123  -14.370 1.00 69.71 ? 615  LEU B CD1 1 
ATOM   9772  C  CD2 . LEU B  1  587 ? 43.974  50.579  -13.156 1.00 70.09 ? 615  LEU B CD2 1 
ATOM   9773  N  N   . PRO B  1  588 ? 45.800  53.471  -10.408 1.00 70.12 ? 616  PRO B N   1 
ATOM   9774  C  CA  . PRO B  1  588 ? 46.650  54.614  -10.061 1.00 70.02 ? 616  PRO B CA  1 
ATOM   9775  C  C   . PRO B  1  588 ? 46.155  55.846  -10.803 1.00 70.40 ? 616  PRO B C   1 
ATOM   9776  O  O   . PRO B  1  588 ? 45.490  55.725  -11.829 1.00 70.77 ? 616  PRO B O   1 
ATOM   9777  C  CB  . PRO B  1  588 ? 48.031  54.170  -10.527 1.00 69.29 ? 616  PRO B CB  1 
ATOM   9778  C  CG  . PRO B  1  588 ? 47.977  52.681  -10.352 1.00 69.34 ? 616  PRO B CG  1 
ATOM   9779  C  CD  . PRO B  1  588 ? 46.609  52.338  -10.886 1.00 69.52 ? 616  PRO B CD  1 
ATOM   9780  N  N   . GLN B  1  589 ? 46.460  57.029  -10.286 1.00 71.35 ? 617  GLN B N   1 
ATOM   9781  C  CA  . GLN B  1  589 ? 46.023  58.254  -10.945 1.00 71.26 ? 617  GLN B CA  1 
ATOM   9782  C  C   . GLN B  1  589 ? 46.729  58.467  -12.288 1.00 71.48 ? 617  GLN B C   1 
ATOM   9783  O  O   . GLN B  1  589 ? 46.173  59.081  -13.208 1.00 72.13 ? 617  GLN B O   1 
ATOM   9784  C  CB  . GLN B  1  589 ? 46.267  59.464  -10.046 1.00 71.83 ? 617  GLN B CB  1 
ATOM   9785  C  CG  . GLN B  1  589 ? 45.174  59.721  -9.023  1.00 73.06 ? 617  GLN B CG  1 
ATOM   9786  C  CD  . GLN B  1  589 ? 45.293  61.113  -8.391  1.00 74.84 ? 617  GLN B CD  1 
ATOM   9787  O  OE1 . GLN B  1  589 ? 46.325  61.452  -7.798  1.00 74.98 ? 617  GLN B OE1 1 
ATOM   9788  N  NE2 . GLN B  1  589 ? 44.237  61.924  -8.520  1.00 73.91 ? 617  GLN B NE2 1 
ATOM   9789  N  N   . ASN B  1  590 ? 47.953  57.961  -12.404 1.00 70.16 ? 618  ASN B N   1 
ATOM   9790  C  CA  . ASN B  1  590 ? 48.702  58.113  -13.641 1.00 70.04 ? 618  ASN B CA  1 
ATOM   9791  C  C   . ASN B  1  590 ? 47.995  57.455  -14.834 1.00 70.06 ? 618  ASN B C   1 
ATOM   9792  O  O   . ASN B  1  590 ? 48.422  57.609  -15.980 1.00 70.35 ? 618  ASN B O   1 
ATOM   9793  C  CB  . ASN B  1  590 ? 50.120  57.553  -13.475 1.00 70.80 ? 618  ASN B CB  1 
ATOM   9794  C  CG  . ASN B  1  590 ? 51.046  58.513  -12.733 1.00 71.26 ? 618  ASN B CG  1 
ATOM   9795  O  OD1 . ASN B  1  590 ? 50.854  58.795  -11.543 1.00 70.75 ? 618  ASN B OD1 1 
ATOM   9796  N  ND2 . ASN B  1  590 ? 52.055  59.026  -13.442 1.00 70.67 ? 618  ASN B ND2 1 
ATOM   9797  N  N   . SER B  1  591 ? 46.916  56.723  -14.567 1.00 69.10 ? 619  SER B N   1 
ATOM   9798  C  CA  . SER B  1  591 ? 46.159  56.087  -15.636 1.00 68.67 ? 619  SER B CA  1 
ATOM   9799  C  C   . SER B  1  591 ? 45.197  57.132  -16.212 1.00 68.43 ? 619  SER B C   1 
ATOM   9800  O  O   . SER B  1  591 ? 44.425  57.758  -15.482 1.00 67.03 ? 619  SER B O   1 
ATOM   9801  C  CB  . SER B  1  591 ? 45.386  54.878  -15.102 1.00 68.88 ? 619  SER B CB  1 
ATOM   9802  O  OG  . SER B  1  591 ? 44.705  54.211  -16.154 1.00 69.54 ? 619  SER B OG  1 
ATOM   9803  N  N   . SER B  1  592 ? 45.265  57.322  -17.525 1.00 68.19 ? 620  SER B N   1 
ATOM   9804  C  CA  . SER B  1  592 ? 44.434  58.299  -18.213 1.00 67.09 ? 620  SER B CA  1 
ATOM   9805  C  C   . SER B  1  592 ? 42.939  57.988  -18.182 1.00 68.08 ? 620  SER B C   1 
ATOM   9806  O  O   . SER B  1  592 ? 42.106  58.878  -18.403 1.00 67.88 ? 620  SER B O   1 
ATOM   9807  C  CB  . SER B  1  592 ? 44.910  58.456  -19.660 1.00 66.61 ? 620  SER B CB  1 
ATOM   9808  O  OG  . SER B  1  592 ? 45.102  57.200  -20.282 1.00 68.07 ? 620  SER B OG  1 
ATOM   9809  N  N   . MET B  1  593 ? 42.591  56.732  -17.913 1.00 67.77 ? 621  MET B N   1 
ATOM   9810  C  CA  . MET B  1  593 ? 41.182  56.366  -17.854 1.00 67.26 ? 621  MET B CA  1 
ATOM   9811  C  C   . MET B  1  593 ? 40.703  56.434  -16.418 1.00 66.91 ? 621  MET B C   1 
ATOM   9812  O  O   . MET B  1  593 ? 39.504  56.419  -16.151 1.00 67.94 ? 621  MET B O   1 
ATOM   9813  C  CB  . MET B  1  593 ? 40.943  54.961  -18.423 1.00 67.07 ? 621  MET B CB  1 
ATOM   9814  C  CG  . MET B  1  593 ? 41.726  53.841  -17.768 1.00 66.97 ? 621  MET B CG  1 
ATOM   9815  S  SD  . MET B  1  593 ? 41.029  52.238  -18.230 1.00 64.18 ? 621  MET B SD  1 
ATOM   9816  C  CE  . MET B  1  593 ? 41.859  51.881  -19.783 1.00 65.65 ? 621  MET B CE  1 
ATOM   9817  N  N   . ALA B  1  594 ? 41.652  56.527  -15.495 1.00 67.16 ? 622  ALA B N   1 
ATOM   9818  C  CA  . ALA B  1  594 ? 41.342  56.594  -14.075 1.00 66.61 ? 622  ALA B CA  1 
ATOM   9819  C  C   . ALA B  1  594 ? 40.309  57.673  -13.768 1.00 66.15 ? 622  ALA B C   1 
ATOM   9820  O  O   . ALA B  1  594 ? 39.675  57.656  -12.713 1.00 66.22 ? 622  ALA B O   1 
ATOM   9821  C  CB  . ALA B  1  594 ? 42.616  56.852  -13.288 1.00 67.22 ? 622  ALA B CB  1 
ATOM   9822  N  N   . ARG B  1  595 ? 40.148  58.612  -14.692 1.00 66.02 ? 623  ARG B N   1 
ATOM   9823  C  CA  . ARG B  1  595 ? 39.196  59.701  -14.520 1.00 65.71 ? 623  ARG B CA  1 
ATOM   9824  C  C   . ARG B  1  595 ? 37.784  59.264  -14.890 1.00 65.65 ? 623  ARG B C   1 
ATOM   9825  O  O   . ARG B  1  595 ? 36.807  59.863  -14.440 1.00 66.62 ? 623  ARG B O   1 
ATOM   9826  C  CB  . ARG B  1  595 ? 39.615  60.898  -15.378 1.00 67.64 ? 623  ARG B CB  1 
ATOM   9827  C  CG  . ARG B  1  595 ? 40.898  61.572  -14.908 1.00 68.86 ? 623  ARG B CG  1 
ATOM   9828  C  CD  . ARG B  1  595 ? 40.667  62.433  -13.658 1.00 69.78 ? 623  ARG B CD  1 
ATOM   9829  N  NE  . ARG B  1  595 ? 40.193  63.778  -14.001 1.00 72.26 ? 623  ARG B NE  1 
ATOM   9830  C  CZ  . ARG B  1  595 ? 39.979  64.768  -13.126 1.00 73.22 ? 623  ARG B CZ  1 
ATOM   9831  N  NH1 . ARG B  1  595 ? 40.192  64.579  -11.821 1.00 72.78 ? 623  ARG B NH1 1 
ATOM   9832  N  NH2 . ARG B  1  595 ? 39.555  65.958  -13.558 1.00 72.29 ? 623  ARG B NH2 1 
ATOM   9833  N  N   . GLY B  1  596 ? 37.683  58.220  -15.708 1.00 64.56 ? 624  GLY B N   1 
ATOM   9834  C  CA  . GLY B  1  596 ? 36.383  57.720  -16.117 1.00 62.43 ? 624  GLY B CA  1 
ATOM   9835  C  C   . GLY B  1  596 ? 35.609  57.176  -14.936 1.00 61.91 ? 624  GLY B C   1 
ATOM   9836  O  O   . GLY B  1  596 ? 34.392  56.980  -14.989 1.00 62.53 ? 624  GLY B O   1 
ATOM   9837  N  N   . PHE B  1  597 ? 36.323  56.922  -13.854 1.00 60.18 ? 625  PHE B N   1 
ATOM   9838  C  CA  . PHE B  1  597 ? 35.685  56.416  -12.660 1.00 60.30 ? 625  PHE B CA  1 
ATOM   9839  C  C   . PHE B  1  597 ? 36.428  56.879  -11.424 1.00 59.51 ? 625  PHE B C   1 
ATOM   9840  O  O   . PHE B  1  597 ? 36.874  56.078  -10.616 1.00 60.43 ? 625  PHE B O   1 
ATOM   9841  C  CB  . PHE B  1  597 ? 35.589  54.887  -12.723 1.00 61.00 ? 625  PHE B CB  1 
ATOM   9842  C  CG  . PHE B  1  597 ? 36.719  54.220  -13.474 1.00 59.65 ? 625  PHE B CG  1 
ATOM   9843  C  CD1 . PHE B  1  597 ? 37.918  53.921  -12.842 1.00 59.37 ? 625  PHE B CD1 1 
ATOM   9844  C  CD2 . PHE B  1  597 ? 36.562  53.851  -14.806 1.00 59.59 ? 625  PHE B CD2 1 
ATOM   9845  C  CE1 . PHE B  1  597 ? 38.941  53.259  -13.519 1.00 58.09 ? 625  PHE B CE1 1 
ATOM   9846  C  CE2 . PHE B  1  597 ? 37.581  53.189  -15.491 1.00 58.67 ? 625  PHE B CE2 1 
ATOM   9847  C  CZ  . PHE B  1  597 ? 38.771  52.893  -14.842 1.00 58.15 ? 625  PHE B CZ  1 
ATOM   9848  N  N   . SER B  1  598 ? 36.534  58.196  -11.289 1.00 60.17 ? 626  SER B N   1 
ATOM   9849  C  CA  . SER B  1  598 ? 37.227  58.841  -10.178 1.00 59.81 ? 626  SER B CA  1 
ATOM   9850  C  C   . SER B  1  598 ? 36.632  58.548  -8.799  1.00 60.15 ? 626  SER B C   1 
ATOM   9851  O  O   . SER B  1  598 ? 37.338  58.626  -7.788  1.00 59.04 ? 626  SER B O   1 
ATOM   9852  C  CB  . SER B  1  598 ? 37.248  60.346  -10.418 1.00 60.53 ? 626  SER B CB  1 
ATOM   9853  O  OG  . SER B  1  598 ? 35.944  60.796  -10.739 1.00 60.76 ? 626  SER B OG  1 
ATOM   9854  N  N   . TRP B  1  599 ? 35.337  58.221  -8.764  1.00 61.18 ? 627  TRP B N   1 
ATOM   9855  C  CA  . TRP B  1  599 ? 34.637  57.901  -7.518  1.00 58.78 ? 627  TRP B CA  1 
ATOM   9856  C  C   . TRP B  1  599 ? 35.244  56.689  -6.814  1.00 58.80 ? 627  TRP B C   1 
ATOM   9857  O  O   . TRP B  1  599 ? 35.207  56.608  -5.591  1.00 59.11 ? 627  TRP B O   1 
ATOM   9858  C  CB  . TRP B  1  599 ? 33.153  57.627  -7.786  1.00 58.87 ? 627  TRP B CB  1 
ATOM   9859  C  CG  . TRP B  1  599 ? 32.917  56.584  -8.840  1.00 59.49 ? 627  TRP B CG  1 
ATOM   9860  C  CD1 . TRP B  1  599 ? 32.780  56.794  -10.184 1.00 59.41 ? 627  TRP B CD1 1 
ATOM   9861  C  CD2 . TRP B  1  599 ? 32.872  55.160  -8.649  1.00 59.57 ? 627  TRP B CD2 1 
ATOM   9862  N  NE1 . TRP B  1  599 ? 32.659  55.592  -10.842 1.00 60.10 ? 627  TRP B NE1 1 
ATOM   9863  C  CE2 . TRP B  1  599 ? 32.714  54.574  -9.924  1.00 59.52 ? 627  TRP B CE2 1 
ATOM   9864  C  CE3 . TRP B  1  599 ? 32.955  54.323  -7.525  1.00 60.59 ? 627  TRP B CE3 1 
ATOM   9865  C  CZ2 . TRP B  1  599 ? 32.638  53.186  -10.107 1.00 59.74 ? 627  TRP B CZ2 1 
ATOM   9866  C  CZ3 . TRP B  1  599 ? 32.881  52.942  -7.706  1.00 59.20 ? 627  TRP B CZ3 1 
ATOM   9867  C  CH2 . TRP B  1  599 ? 32.725  52.391  -8.988  1.00 59.84 ? 627  TRP B CH2 1 
ATOM   9868  N  N   . GLU B  1  600 ? 35.803  55.752  -7.582  1.00 58.80 ? 628  GLU B N   1 
ATOM   9869  C  CA  . GLU B  1  600 ? 36.400  54.554  -7.000  1.00 58.43 ? 628  GLU B CA  1 
ATOM   9870  C  C   . GLU B  1  600 ? 37.544  54.839  -6.033  1.00 59.54 ? 628  GLU B C   1 
ATOM   9871  O  O   . GLU B  1  600 ? 37.814  54.030  -5.143  1.00 60.60 ? 628  GLU B O   1 
ATOM   9872  C  CB  . GLU B  1  600 ? 36.917  53.603  -8.082  1.00 59.41 ? 628  GLU B CB  1 
ATOM   9873  C  CG  . GLU B  1  600 ? 37.617  52.378  -7.474  1.00 60.23 ? 628  GLU B CG  1 
ATOM   9874  C  CD  . GLU B  1  600 ? 38.595  51.683  -8.407  1.00 59.79 ? 628  GLU B CD  1 
ATOM   9875  O  OE1 . GLU B  1  600 ? 39.410  52.375  -9.066  1.00 60.05 ? 628  GLU B OE1 1 
ATOM   9876  O  OE2 . GLU B  1  600 ? 38.562  50.435  -8.454  1.00 59.73 ? 628  GLU B OE2 1 
ATOM   9877  N  N   . ARG B  1  601 ? 38.218  55.974  -6.202  1.00 58.85 ? 629  ARG B N   1 
ATOM   9878  C  CA  . ARG B  1  601 ? 39.344  56.330  -5.336  1.00 58.23 ? 629  ARG B CA  1 
ATOM   9879  C  C   . ARG B  1  601 ? 38.974  56.739  -3.912  1.00 57.81 ? 629  ARG B C   1 
ATOM   9880  O  O   . ARG B  1  601 ? 39.854  56.960  -3.084  1.00 56.45 ? 629  ARG B O   1 
ATOM   9881  C  CB  . ARG B  1  601 ? 40.178  57.439  -5.981  1.00 58.89 ? 629  ARG B CB  1 
ATOM   9882  C  CG  . ARG B  1  601 ? 41.164  56.926  -7.027  1.00 60.74 ? 629  ARG B CG  1 
ATOM   9883  C  CD  . ARG B  1  601 ? 42.041  58.038  -7.586  1.00 62.54 ? 629  ARG B CD  1 
ATOM   9884  N  NE  . ARG B  1  601 ? 42.465  58.954  -6.534  1.00 63.50 ? 629  ARG B NE  1 
ATOM   9885  C  CZ  . ARG B  1  601 ? 42.034  60.208  -6.397  1.00 64.68 ? 629  ARG B CZ  1 
ATOM   9886  N  NH1 . ARG B  1  601 ? 42.486  60.940  -5.391  1.00 65.48 ? 629  ARG B NH1 1 
ATOM   9887  N  NH2 . ARG B  1  601 ? 41.175  60.745  -7.262  1.00 64.22 ? 629  ARG B NH2 1 
ATOM   9888  N  N   . TYR B  1  602 ? 37.675  56.834  -3.635  1.00 57.71 ? 630  TYR B N   1 
ATOM   9889  C  CA  . TYR B  1  602 ? 37.196  57.199  -2.305  1.00 56.17 ? 630  TYR B CA  1 
ATOM   9890  C  C   . TYR B  1  602 ? 36.361  56.113  -1.645  1.00 55.61 ? 630  TYR B C   1 
AT