data_2COJ
# 
_entry.id   2COJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2COJ         
RCSB  RCSB024451   
WWPDB D_1000024451 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2COG 'oxidized cytosolic branched-chain aminotransferase complexed with 4-methylvalerate' unspecified 
PDB 2COI 'oxidized cytosolic branched-chain aminotransferase complexed with gabapentin'       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2COJ 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-17 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Goto, M.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Structural determinants for branched-chain aminotransferase isozyme-specific inhibition by the anticonvulsant drug gabapentin' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            280 
_citation.page_first                37246 
_citation.page_last                 37256 
_citation.year                      2005 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16141215 
_citation.pdbx_database_id_DOI      10.1074/jbc.M506486200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Goto, M.'     1 
primary 'Miyahara, I.' 2 
primary 'Hirotsu, K.'  3 
primary 'Conway, M.'   4 
primary 'Yennawar, N.' 5 
primary 'Islam, M.M.'  6 
primary 'Hutson, S.M.' 7 
# 
_cell.entry_id           2COJ 
_cell.length_a           66.870 
_cell.length_b           106.630 
_cell.length_c           109.820 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2COJ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'branched chain aminotransferase 1, cytosolic' 43079.098 2   2.6.1.42 S379R ? ? 
2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"                       247.142   2   ?        ?     ? ? 
3 non-polymer syn '[1-(AMINOMETHYL)CYCLOHEXYL]ACETIC ACID'       171.237   2   ?        ?     ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                24.305    1   ?        ?     ? ? 
5 water       nat water                                          18.015    148 ?        ?     ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLS
LHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASL
YIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDN
GCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTAL
EGNRVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREERDWTIVLS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLS
LHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASL
YIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDN
GCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTAL
EGNRVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREERDWTIVLS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   ASP n 
1 4   CYS n 
1 5   SER n 
1 6   ASN n 
1 7   GLY n 
1 8   CYS n 
1 9   SER n 
1 10  ALA n 
1 11  GLU n 
1 12  CYS n 
1 13  THR n 
1 14  GLY n 
1 15  GLU n 
1 16  GLY n 
1 17  GLY n 
1 18  SER n 
1 19  LYS n 
1 20  GLU n 
1 21  VAL n 
1 22  VAL n 
1 23  GLY n 
1 24  THR n 
1 25  PHE n 
1 26  LYS n 
1 27  ALA n 
1 28  LYS n 
1 29  ASP n 
1 30  LEU n 
1 31  ILE n 
1 32  VAL n 
1 33  THR n 
1 34  PRO n 
1 35  ALA n 
1 36  THR n 
1 37  ILE n 
1 38  LEU n 
1 39  LYS n 
1 40  GLU n 
1 41  LYS n 
1 42  PRO n 
1 43  ASP n 
1 44  PRO n 
1 45  ASN n 
1 46  ASN n 
1 47  LEU n 
1 48  VAL n 
1 49  PHE n 
1 50  GLY n 
1 51  THR n 
1 52  VAL n 
1 53  PHE n 
1 54  THR n 
1 55  ASP n 
1 56  HIS n 
1 57  MET n 
1 58  LEU n 
1 59  THR n 
1 60  VAL n 
1 61  GLU n 
1 62  TRP n 
1 63  SER n 
1 64  SER n 
1 65  GLU n 
1 66  PHE n 
1 67  GLY n 
1 68  TRP n 
1 69  GLU n 
1 70  LYS n 
1 71  PRO n 
1 72  HIS n 
1 73  ILE n 
1 74  LYS n 
1 75  PRO n 
1 76  LEU n 
1 77  GLN n 
1 78  ASN n 
1 79  LEU n 
1 80  SER n 
1 81  LEU n 
1 82  HIS n 
1 83  PRO n 
1 84  GLY n 
1 85  SER n 
1 86  SER n 
1 87  ALA n 
1 88  LEU n 
1 89  HIS n 
1 90  TYR n 
1 91  ALA n 
1 92  VAL n 
1 93  GLU n 
1 94  LEU n 
1 95  PHE n 
1 96  GLU n 
1 97  GLY n 
1 98  LEU n 
1 99  LYS n 
1 100 ALA n 
1 101 PHE n 
1 102 ARG n 
1 103 GLY n 
1 104 VAL n 
1 105 ASP n 
1 106 ASN n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 LEU n 
1 111 PHE n 
1 112 GLN n 
1 113 PRO n 
1 114 ASN n 
1 115 LEU n 
1 116 ASN n 
1 117 MET n 
1 118 ASP n 
1 119 ARG n 
1 120 MET n 
1 121 TYR n 
1 122 ARG n 
1 123 SER n 
1 124 ALA n 
1 125 VAL n 
1 126 ARG n 
1 127 ALA n 
1 128 THR n 
1 129 LEU n 
1 130 PRO n 
1 131 VAL n 
1 132 PHE n 
1 133 ASP n 
1 134 LYS n 
1 135 GLU n 
1 136 GLU n 
1 137 LEU n 
1 138 LEU n 
1 139 GLU n 
1 140 CYS n 
1 141 ILE n 
1 142 GLN n 
1 143 GLN n 
1 144 LEU n 
1 145 VAL n 
1 146 LYS n 
1 147 LEU n 
1 148 ASP n 
1 149 GLN n 
1 150 GLU n 
1 151 TRP n 
1 152 VAL n 
1 153 PRO n 
1 154 TYR n 
1 155 SER n 
1 156 THR n 
1 157 SER n 
1 158 ALA n 
1 159 SER n 
1 160 LEU n 
1 161 TYR n 
1 162 ILE n 
1 163 ARG n 
1 164 PRO n 
1 165 THR n 
1 166 PHE n 
1 167 ILE n 
1 168 GLY n 
1 169 THR n 
1 170 GLU n 
1 171 PRO n 
1 172 SER n 
1 173 LEU n 
1 174 GLY n 
1 175 VAL n 
1 176 LYS n 
1 177 LYS n 
1 178 PRO n 
1 179 THR n 
1 180 LYS n 
1 181 ALA n 
1 182 LEU n 
1 183 LEU n 
1 184 PHE n 
1 185 VAL n 
1 186 LEU n 
1 187 LEU n 
1 188 SER n 
1 189 PRO n 
1 190 VAL n 
1 191 GLY n 
1 192 PRO n 
1 193 TYR n 
1 194 PHE n 
1 195 SER n 
1 196 SER n 
1 197 GLY n 
1 198 THR n 
1 199 PHE n 
1 200 ASN n 
1 201 PRO n 
1 202 VAL n 
1 203 SER n 
1 204 LEU n 
1 205 TRP n 
1 206 ALA n 
1 207 ASN n 
1 208 PRO n 
1 209 LYS n 
1 210 TYR n 
1 211 VAL n 
1 212 ARG n 
1 213 ALA n 
1 214 TRP n 
1 215 LYS n 
1 216 GLY n 
1 217 GLY n 
1 218 THR n 
1 219 GLY n 
1 220 ASP n 
1 221 CYS n 
1 222 LYS n 
1 223 MET n 
1 224 GLY n 
1 225 GLY n 
1 226 ASN n 
1 227 TYR n 
1 228 GLY n 
1 229 SER n 
1 230 SER n 
1 231 LEU n 
1 232 PHE n 
1 233 ALA n 
1 234 GLN n 
1 235 CYS n 
1 236 GLU n 
1 237 ALA n 
1 238 VAL n 
1 239 ASP n 
1 240 ASN n 
1 241 GLY n 
1 242 CYS n 
1 243 GLN n 
1 244 GLN n 
1 245 VAL n 
1 246 LEU n 
1 247 TRP n 
1 248 LEU n 
1 249 TYR n 
1 250 GLY n 
1 251 GLU n 
1 252 ASP n 
1 253 HIS n 
1 254 GLN n 
1 255 ILE n 
1 256 THR n 
1 257 GLU n 
1 258 VAL n 
1 259 GLY n 
1 260 THR n 
1 261 MET n 
1 262 ASN n 
1 263 LEU n 
1 264 PHE n 
1 265 LEU n 
1 266 TYR n 
1 267 TRP n 
1 268 ILE n 
1 269 ASN n 
1 270 GLU n 
1 271 ASP n 
1 272 GLY n 
1 273 GLU n 
1 274 GLU n 
1 275 GLU n 
1 276 LEU n 
1 277 ALA n 
1 278 THR n 
1 279 PRO n 
1 280 PRO n 
1 281 LEU n 
1 282 ASP n 
1 283 GLY n 
1 284 ILE n 
1 285 ILE n 
1 286 LEU n 
1 287 PRO n 
1 288 GLY n 
1 289 VAL n 
1 290 THR n 
1 291 ARG n 
1 292 ARG n 
1 293 CYS n 
1 294 ILE n 
1 295 LEU n 
1 296 ASP n 
1 297 LEU n 
1 298 ALA n 
1 299 HIS n 
1 300 GLN n 
1 301 TRP n 
1 302 GLY n 
1 303 GLU n 
1 304 PHE n 
1 305 LYS n 
1 306 VAL n 
1 307 SER n 
1 308 GLU n 
1 309 ARG n 
1 310 TYR n 
1 311 LEU n 
1 312 THR n 
1 313 MET n 
1 314 ASP n 
1 315 ASP n 
1 316 LEU n 
1 317 THR n 
1 318 THR n 
1 319 ALA n 
1 320 LEU n 
1 321 GLU n 
1 322 GLY n 
1 323 ASN n 
1 324 ARG n 
1 325 VAL n 
1 326 ARG n 
1 327 GLU n 
1 328 MET n 
1 329 PHE n 
1 330 GLY n 
1 331 SER n 
1 332 GLY n 
1 333 THR n 
1 334 ALA n 
1 335 CYS n 
1 336 VAL n 
1 337 VAL n 
1 338 CYS n 
1 339 PRO n 
1 340 VAL n 
1 341 SER n 
1 342 ASP n 
1 343 ILE n 
1 344 LEU n 
1 345 TYR n 
1 346 LYS n 
1 347 GLY n 
1 348 GLU n 
1 349 THR n 
1 350 ILE n 
1 351 HIS n 
1 352 ILE n 
1 353 PRO n 
1 354 THR n 
1 355 MET n 
1 356 GLU n 
1 357 ASN n 
1 358 GLY n 
1 359 PRO n 
1 360 LYS n 
1 361 LEU n 
1 362 ALA n 
1 363 SER n 
1 364 ARG n 
1 365 ILE n 
1 366 LEU n 
1 367 SER n 
1 368 LYS n 
1 369 LEU n 
1 370 THR n 
1 371 ASP n 
1 372 ILE n 
1 373 GLN n 
1 374 TYR n 
1 375 GLY n 
1 376 ARG n 
1 377 GLU n 
1 378 GLU n 
1 379 ARG n 
1 380 ASP n 
1 381 TRP n 
1 382 THR n 
1 383 ILE n 
1 384 VAL n 
1 385 LEU n 
1 386 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BCAT1_HUMAN 
_struct_ref.pdbx_db_accession          P54687 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLS
LHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASL
YIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDN
GCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTAL
EGNRVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2COJ A 1 ? 386 ? P54687 1 ? 386 ? 1 386 
2 1 2COJ B 1 ? 386 ? P54687 1 ? 386 ? 1 386 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2COJ ARG A 379 ? UNP P54687 SER 379 ENGINEERED 379 1 
2 2COJ ARG B 379 ? UNP P54687 SER 379 ENGINEERED 379 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ?                      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ?                      'C3 H7 N O2 S'   121.158 
GBN non-polymer         . '[1-(AMINOMETHYL)CYCLOHEXYL]ACETIC ACID' GABAPENTIN             'C9 H17 N O2'    171.237 
GLN 'L-peptide linking' y GLUTAMINE                                ?                      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?                      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                    ?                      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                      'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                               ?                      'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'                          ?                      'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE                            ?                      'C9 H11 N O2'    165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE"                 'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'  247.142 
PRO 'L-peptide linking' y PROLINE                                  ?                      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                   ?                      'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                ?                      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                 ?                      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                   ?                      'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2COJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   46.2 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'PEG4000, magnesium chloride, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-06-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NW12A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NW12A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2COJ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   28933 
_reflns.number_all                   31418 
_reflns.percent_possible_obs         92.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        34.2 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2COJ 
_refine.ls_number_reflns_obs                     28651 
_refine.ls_number_reflns_all                     31418 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               2689713.47 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             42.44 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    91.2 
_refine.ls_R_factor_obs                          0.213 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.213 
_refine.ls_R_factor_R_free                       0.272 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  2873 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.3 
_refine.aniso_B[1][1]                            -16.26 
_refine.aniso_B[2][2]                            10.01 
_refine.aniso_B[3][3]                            6.26 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.340746 
_refine.solvent_model_param_bsol                 30.6489 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2COJ 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.27 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.40 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5653 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         55 
_refine_hist.number_atoms_solvent             148 
_refine_hist.number_atoms_total               5856 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        42.44 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.92  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.35  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.11  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        20.13 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       18.62 2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_R_work             4594 
_refine_ls_shell.R_factor_R_work                  0.267 
_refine_ls_shell.percent_reflns_obs               98.1 
_refine_ls_shell.R_factor_R_free                  0.34 
_refine_ls_shell.R_factor_R_free_error            0.016 
_refine_ls_shell.percent_reflns_R_free            9.2 
_refine_ls_shell.number_reflns_R_free             468 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param   protein.top       'X-RAY DIFFRACTION' 
2 water_rep.param     water_rep.top     'X-RAY DIFFRACTION' 
3 CNS_LOCAL:param.plp CNS_LOCAL:top.plp 'X-RAY DIFFRACTION' 
4 CNS_LOCAL:param.etc CNS_LOCAL:top.etc 'X-RAY DIFFRACTION' 
5 gbp.par             gbp.top           'X-RAY DIFFRACTION' 
6 ion.param           ion.top           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2COJ 
_struct.title                     
'Crystal structure of reduced human cytosolic branched-chain aminotransferase complexed with gabapentin' 
_struct.pdbx_descriptor           'branched chain aminotransferase 1, cytosolic (E.C.2.6.1.42)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2COJ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'PLP-dependent enzyme, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 3 ? 
H N N 5 ? 
I N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 26  ? LEU A 30  ? LYS A 26  LEU A 30  5 ? 5  
HELX_P HELX_P2  2  SER A 85  ? TYR A 90  ? SER A 85  TYR A 90  1 ? 6  
HELX_P HELX_P3  3  GLN A 112 ? THR A 128 ? GLN A 112 THR A 128 1 ? 17 
HELX_P HELX_P4  4  ASP A 133 ? ASP A 148 ? ASP A 133 ASP A 148 1 ? 16 
HELX_P HELX_P5  5  GLN A 149 ? VAL A 152 ? GLN A 149 VAL A 152 5 ? 4  
HELX_P HELX_P6  6  GLY A 224 ? SER A 229 ? GLY A 224 SER A 229 1 ? 6  
HELX_P HELX_P7  7  SER A 230 ? ASN A 240 ? SER A 230 ASN A 240 1 ? 11 
HELX_P HELX_P8  8  GLY A 288 ? GLY A 302 ? GLY A 288 GLY A 302 1 ? 15 
HELX_P HELX_P9  9  THR A 312 ? GLU A 321 ? THR A 312 GLU A 321 1 ? 10 
HELX_P HELX_P10 10 THR A 354 ? GLY A 358 ? THR A 354 GLY A 358 5 ? 5  
HELX_P HELX_P11 11 PRO A 359 ? TYR A 374 ? PRO A 359 TYR A 374 1 ? 16 
HELX_P HELX_P12 12 LYS B 26  ? LEU B 30  ? LYS B 26  LEU B 30  5 ? 5  
HELX_P HELX_P13 13 SER B 85  ? TYR B 90  ? SER B 85  TYR B 90  1 ? 6  
HELX_P HELX_P14 14 GLN B 112 ? THR B 128 ? GLN B 112 THR B 128 1 ? 17 
HELX_P HELX_P15 15 ASP B 133 ? ASP B 148 ? ASP B 133 ASP B 148 1 ? 16 
HELX_P HELX_P16 16 GLN B 149 ? VAL B 152 ? GLN B 149 VAL B 152 5 ? 4  
HELX_P HELX_P17 17 MET B 223 ? TYR B 227 ? MET B 223 TYR B 227 5 ? 5  
HELX_P HELX_P18 18 SER B 230 ? ASP B 239 ? SER B 230 ASP B 239 1 ? 10 
HELX_P HELX_P19 19 GLY B 288 ? GLY B 302 ? GLY B 288 GLY B 302 1 ? 15 
HELX_P HELX_P20 20 THR B 312 ? GLU B 321 ? THR B 312 GLU B 321 1 ? 10 
HELX_P HELX_P21 21 THR B 354 ? GLY B 358 ? THR B 354 GLY B 358 5 ? 5  
HELX_P HELX_P22 22 PRO B 359 ? TYR B 374 ? PRO B 359 TYR B 374 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? C PLP . C4A ? ? ? 1_555 A LYS 222 NZ  ? ? A PLP 410 A LYS 222 1_555 ? ? ? ? ? ? ? 1.376 ? 
covale2 covale ? ? F PLP . C4A ? ? ? 1_555 B LYS 222 NZ  ? ? B PLP 410 B LYS 222 1_555 ? ? ? ? ? ? ? 1.379 ? 
metalc1 metalc ? ? E MG  . MG  ? ? ? 1_555 I HOH .   O   ? ? B MG  430 B HOH 433 1_555 ? ? ? ? ? ? ? 2.464 ? 
metalc2 metalc ? ? E MG  . MG  ? ? ? 1_555 I HOH .   O   ? ? B MG  430 B HOH 500 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc3 metalc ? ? E MG  . MG  ? ? ? 1_555 B ASP 133 OD1 ? ? B MG  430 B ASP 133 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc4 metalc ? ? E MG  . MG  ? ? ? 1_555 I HOH .   O   ? ? B MG  430 B HOH 442 1_555 ? ? ? ? ? ? ? 2.384 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 358 A . ? GLY 358 A PRO 359 A ? PRO 359 A 1 -0.03 
2 GLY 358 B . ? GLY 358 B PRO 359 B ? PRO 359 B 1 -0.15 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 7 ? 
C ? 2 ? 
D ? 8 ? 
E ? 6 ? 
F ? 6 ? 
G ? 7 ? 
H ? 8 ? 
I ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? parallel      
D 6 7 ? parallel      
D 7 8 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
H 5 6 ? parallel      
H 6 7 ? parallel      
H 7 8 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
I 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 31  ? VAL A 32  ? ILE A 31  VAL A 32  
A 2 HIS A 72  ? PRO A 75  ? HIS A 72  PRO A 75  
A 3 HIS A 56  ? SER A 63  ? HIS A 56  SER A 63  
A 4 LYS A 180 ? VAL A 190 ? LYS A 180 VAL A 190 
A 5 SER A 159 ? GLY A 168 ? SER A 159 GLY A 168 
A 6 GLU A 93  ? PHE A 95  ? GLU A 93  PHE A 95  
B 1 GLY A 67  ? TRP A 68  ? GLY A 67  TRP A 68  
B 2 HIS A 56  ? SER A 63  ? HIS A 56  SER A 63  
B 3 LYS A 180 ? VAL A 190 ? LYS A 180 VAL A 190 
B 4 SER A 159 ? GLY A 168 ? SER A 159 GLY A 168 
B 5 LEU A 98  ? ARG A 102 ? LEU A 98  ARG A 102 
B 6 ILE A 108 ? PHE A 111 ? ILE A 108 PHE A 111 
B 7 THR A 382 ? VAL A 384 ? THR A 382 VAL A 384 
C 1 LEU A 79  ? LEU A 81  ? LEU A 79  LEU A 81  
C 2 LEU B 79  ? LEU B 81  ? LEU B 79  LEU B 81  
D 1 LYS A 305 ? GLU A 308 ? LYS A 305 GLU A 308 
D 2 GLU A 274 ? THR A 278 ? GLU A 274 THR A 278 
D 3 MET A 261 ? ILE A 268 ? MET A 261 ILE A 268 
D 4 GLN A 254 ? VAL A 258 ? GLN A 254 VAL A 258 
D 5 GLN A 244 ? TYR A 249 ? GLN A 244 TYR A 249 
D 6 VAL A 202 ? ALA A 206 ? VAL A 202 ALA A 206 
D 7 VAL A 336 ? TYR A 345 ? VAL A 336 TYR A 345 
D 8 GLU A 348 ? HIS A 351 ? GLU A 348 HIS A 351 
E 1 LYS A 305 ? GLU A 308 ? LYS A 305 GLU A 308 
E 2 GLU A 274 ? THR A 278 ? GLU A 274 THR A 278 
E 3 MET A 261 ? ILE A 268 ? MET A 261 ILE A 268 
E 4 VAL A 325 ? GLY A 332 ? VAL A 325 GLY A 332 
E 5 VAL A 336 ? TYR A 345 ? VAL A 336 TYR A 345 
E 6 GLU A 348 ? HIS A 351 ? GLU A 348 HIS A 351 
F 1 ILE B 31  ? VAL B 32  ? ILE B 31  VAL B 32  
F 2 HIS B 72  ? PRO B 75  ? HIS B 72  PRO B 75  
F 3 HIS B 56  ? SER B 63  ? HIS B 56  SER B 63  
F 4 LYS B 180 ? VAL B 190 ? LYS B 180 VAL B 190 
F 5 SER B 159 ? GLY B 168 ? SER B 159 GLY B 168 
F 6 GLU B 93  ? PHE B 95  ? GLU B 93  PHE B 95  
G 1 GLY B 67  ? TRP B 68  ? GLY B 67  TRP B 68  
G 2 HIS B 56  ? SER B 63  ? HIS B 56  SER B 63  
G 3 LYS B 180 ? VAL B 190 ? LYS B 180 VAL B 190 
G 4 SER B 159 ? GLY B 168 ? SER B 159 GLY B 168 
G 5 LEU B 98  ? ARG B 102 ? LEU B 98  ARG B 102 
G 6 ILE B 108 ? PHE B 111 ? ILE B 108 PHE B 111 
G 7 THR B 382 ? VAL B 384 ? THR B 382 VAL B 384 
H 1 LYS B 305 ? GLU B 308 ? LYS B 305 GLU B 308 
H 2 GLU B 274 ? THR B 278 ? GLU B 274 THR B 278 
H 3 MET B 261 ? ILE B 268 ? MET B 261 ILE B 268 
H 4 GLN B 254 ? VAL B 258 ? GLN B 254 VAL B 258 
H 5 GLN B 244 ? TYR B 249 ? GLN B 244 TYR B 249 
H 6 VAL B 202 ? TRP B 205 ? VAL B 202 TRP B 205 
H 7 VAL B 336 ? LEU B 344 ? VAL B 336 LEU B 344 
H 8 THR B 349 ? HIS B 351 ? THR B 349 HIS B 351 
I 1 LYS B 305 ? GLU B 308 ? LYS B 305 GLU B 308 
I 2 GLU B 274 ? THR B 278 ? GLU B 274 THR B 278 
I 3 MET B 261 ? ILE B 268 ? MET B 261 ILE B 268 
I 4 VAL B 325 ? GLY B 332 ? VAL B 325 GLY B 332 
I 5 VAL B 336 ? LEU B 344 ? VAL B 336 LEU B 344 
I 6 THR B 349 ? HIS B 351 ? THR B 349 HIS B 351 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 31  ? N ILE A 31  O ILE A 73  ? O ILE A 73  
A 2 3 O LYS A 74  ? O LYS A 74  N MET A 57  ? N MET A 57  
A 3 4 N TRP A 62  ? N TRP A 62  O ALA A 181 ? O ALA A 181 
A 4 5 O VAL A 190 ? O VAL A 190 N SER A 159 ? N SER A 159 
A 5 6 O PHE A 166 ? O PHE A 166 N LEU A 94  ? N LEU A 94  
B 1 2 O GLY A 67  ? O GLY A 67  N SER A 63  ? N SER A 63  
B 2 3 N TRP A 62  ? N TRP A 62  O ALA A 181 ? O ALA A 181 
B 3 4 O VAL A 190 ? O VAL A 190 N SER A 159 ? N SER A 159 
B 4 5 O ILE A 162 ? O ILE A 162 N LEU A 98  ? N LEU A 98  
B 5 6 N PHE A 101 ? N PHE A 101 O ARG A 109 ? O ARG A 109 
B 6 7 N LEU A 110 ? N LEU A 110 O ILE A 383 ? O ILE A 383 
C 1 2 N LEU A 79  ? N LEU A 79  O LEU B 81  ? O LEU B 81  
D 1 2 O LYS A 305 ? O LYS A 305 N LEU A 276 ? N LEU A 276 
D 2 3 O GLU A 275 ? O GLU A 275 N TRP A 267 ? N TRP A 267 
D 3 4 O MET A 261 ? O MET A 261 N VAL A 258 ? N VAL A 258 
D 4 5 O GLN A 254 ? O GLN A 254 N TYR A 249 ? N TYR A 249 
D 5 6 O LEU A 246 ? O LEU A 246 N TRP A 205 ? N TRP A 205 
D 6 7 N LEU A 204 ? N LEU A 204 O LEU A 344 ? O LEU A 344 
D 7 8 N TYR A 345 ? N TYR A 345 O GLU A 348 ? O GLU A 348 
E 1 2 O LYS A 305 ? O LYS A 305 N LEU A 276 ? N LEU A 276 
E 2 3 O GLU A 275 ? O GLU A 275 N TRP A 267 ? N TRP A 267 
E 3 4 N PHE A 264 ? N PHE A 264 O PHE A 329 ? O PHE A 329 
E 4 5 N GLY A 330 ? N GLY A 330 O CYS A 338 ? O CYS A 338 
E 5 6 N TYR A 345 ? N TYR A 345 O GLU A 348 ? O GLU A 348 
F 1 2 N ILE B 31  ? N ILE B 31  O ILE B 73  ? O ILE B 73  
F 2 3 O HIS B 72  ? O HIS B 72  N THR B 59  ? N THR B 59  
F 3 4 N TRP B 62  ? N TRP B 62  O ALA B 181 ? O ALA B 181 
F 4 5 O PHE B 184 ? O PHE B 184 N THR B 165 ? N THR B 165 
F 5 6 O PHE B 166 ? O PHE B 166 N LEU B 94  ? N LEU B 94  
G 1 2 O GLY B 67  ? O GLY B 67  N SER B 63  ? N SER B 63  
G 2 3 N TRP B 62  ? N TRP B 62  O ALA B 181 ? O ALA B 181 
G 3 4 O PHE B 184 ? O PHE B 184 N THR B 165 ? N THR B 165 
G 4 5 O ILE B 162 ? O ILE B 162 N LEU B 98  ? N LEU B 98  
G 5 6 N PHE B 101 ? N PHE B 101 O ARG B 109 ? O ARG B 109 
G 6 7 N LEU B 110 ? N LEU B 110 O ILE B 383 ? O ILE B 383 
H 1 2 O SER B 307 ? O SER B 307 N LEU B 276 ? N LEU B 276 
H 2 3 O GLU B 275 ? O GLU B 275 N TRP B 267 ? N TRP B 267 
H 3 4 O MET B 261 ? O MET B 261 N VAL B 258 ? N VAL B 258 
H 4 5 O GLN B 254 ? O GLN B 254 N TYR B 249 ? N TYR B 249 
H 5 6 O GLN B 244 ? O GLN B 244 N TRP B 205 ? N TRP B 205 
H 6 7 N LEU B 204 ? N LEU B 204 O LEU B 344 ? O LEU B 344 
H 7 8 N ILE B 343 ? N ILE B 343 O ILE B 350 ? O ILE B 350 
I 1 2 O SER B 307 ? O SER B 307 N LEU B 276 ? N LEU B 276 
I 2 3 O GLU B 275 ? O GLU B 275 N TRP B 267 ? N TRP B 267 
I 3 4 N TYR B 266 ? N TYR B 266 O GLU B 327 ? O GLU B 327 
I 4 5 N GLY B 332 ? N GLY B 332 O VAL B 336 ? O VAL B 336 
I 5 6 N ILE B 343 ? N ILE B 343 O ILE B 350 ? O ILE B 350 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 430'  
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PLP A 410' 
AC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PLP B 410' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GBN A 420' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GBN B 420' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASP B 133 ? ASP B 133 . ? 1_555 ? 
2  AC1 5  GLU B 274 ? GLU B 274 . ? 4_455 ? 
3  AC1 5  HOH I .   ? HOH B 433 . ? 1_555 ? 
4  AC1 5  HOH I .   ? HOH B 442 . ? 1_555 ? 
5  AC1 5  HOH I .   ? HOH B 500 . ? 1_555 ? 
6  AC2 14 ARG A 119 ? ARG A 119 . ? 1_555 ? 
7  AC2 14 LYS A 222 ? LYS A 222 . ? 1_555 ? 
8  AC2 14 TYR A 227 ? TYR A 227 . ? 1_555 ? 
9  AC2 14 GLU A 257 ? GLU A 257 . ? 1_555 ? 
10 AC2 14 THR A 260 ? THR A 260 . ? 1_555 ? 
11 AC2 14 LEU A 286 ? LEU A 286 . ? 1_555 ? 
12 AC2 14 GLY A 288 ? GLY A 288 . ? 1_555 ? 
13 AC2 14 VAL A 289 ? VAL A 289 . ? 1_555 ? 
14 AC2 14 THR A 290 ? THR A 290 . ? 1_555 ? 
15 AC2 14 GLY A 332 ? GLY A 332 . ? 1_555 ? 
16 AC2 14 THR A 333 ? THR A 333 . ? 1_555 ? 
17 AC2 14 HOH H .   ? HOH A 421 . ? 1_555 ? 
18 AC2 14 HOH H .   ? HOH A 426 . ? 1_555 ? 
19 AC2 14 HOH H .   ? HOH A 466 . ? 1_555 ? 
20 AC3 14 ARG B 119 ? ARG B 119 . ? 1_555 ? 
21 AC3 14 ARG B 212 ? ARG B 212 . ? 1_555 ? 
22 AC3 14 LYS B 222 ? LYS B 222 . ? 1_555 ? 
23 AC3 14 TYR B 227 ? TYR B 227 . ? 1_555 ? 
24 AC3 14 GLU B 257 ? GLU B 257 . ? 1_555 ? 
25 AC3 14 THR B 260 ? THR B 260 . ? 1_555 ? 
26 AC3 14 LEU B 286 ? LEU B 286 . ? 1_555 ? 
27 AC3 14 GLY B 288 ? GLY B 288 . ? 1_555 ? 
28 AC3 14 VAL B 289 ? VAL B 289 . ? 1_555 ? 
29 AC3 14 THR B 290 ? THR B 290 . ? 1_555 ? 
30 AC3 14 THR B 333 ? THR B 333 . ? 1_555 ? 
31 AC3 14 HOH I .   ? HOH B 432 . ? 1_555 ? 
32 AC3 14 HOH I .   ? HOH B 434 . ? 1_555 ? 
33 AC3 14 HOH I .   ? HOH B 477 . ? 1_555 ? 
34 AC4 9  TYR A 161 ? TYR A 161 . ? 1_555 ? 
35 AC4 9  THR A 260 ? THR A 260 . ? 1_555 ? 
36 AC4 9  MET A 261 ? MET A 261 . ? 1_555 ? 
37 AC4 9  GLY A 332 ? GLY A 332 . ? 1_555 ? 
38 AC4 9  THR A 333 ? THR A 333 . ? 1_555 ? 
39 AC4 9  ALA A 334 ? ALA A 334 . ? 1_555 ? 
40 AC4 9  HOH H .   ? HOH A 469 . ? 1_555 ? 
41 AC4 9  TYR B 90  ? TYR B 90  . ? 1_555 ? 
42 AC4 9  VAL B 175 ? VAL B 175 . ? 1_555 ? 
43 AC5 9  TYR A 90  ? TYR A 90  . ? 1_555 ? 
44 AC5 9  TYR B 161 ? TYR B 161 . ? 1_555 ? 
45 AC5 9  ARG B 163 ? ARG B 163 . ? 1_555 ? 
46 AC5 9  THR B 260 ? THR B 260 . ? 1_555 ? 
47 AC5 9  MET B 261 ? MET B 261 . ? 1_555 ? 
48 AC5 9  GLY B 332 ? GLY B 332 . ? 1_555 ? 
49 AC5 9  THR B 333 ? THR B 333 . ? 1_555 ? 
50 AC5 9  ALA B 334 ? ALA B 334 . ? 1_555 ? 
51 AC5 9  HOH I .   ? HOH B 509 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2COJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2COJ 
_atom_sites.fract_transf_matrix[1][1]   0.014954 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009378 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009106 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 22  ? -9.628  -18.238 -16.592 1.00 61.07 ? 22  VAL A N   1 
ATOM   2    C  CA  . VAL A 1 22  ? -10.547 -18.273 -17.772 1.00 62.25 ? 22  VAL A CA  1 
ATOM   3    C  C   . VAL A 1 22  ? -11.341 -19.591 -17.848 1.00 61.26 ? 22  VAL A C   1 
ATOM   4    O  O   . VAL A 1 22  ? -10.981 -20.509 -18.595 1.00 62.53 ? 22  VAL A O   1 
ATOM   5    C  CB  . VAL A 1 22  ? -9.746  -18.050 -19.098 1.00 63.67 ? 22  VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 22  ? -8.610  -19.066 -19.212 1.00 64.71 ? 22  VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 22  ? -10.677 -18.140 -20.303 1.00 64.51 ? 22  VAL A CG2 1 
ATOM   8    N  N   . GLY A 1 23  ? -12.424 -19.672 -17.073 1.00 58.18 ? 23  GLY A N   1 
ATOM   9    C  CA  . GLY A 1 23  ? -13.249 -20.871 -17.057 1.00 53.63 ? 23  GLY A CA  1 
ATOM   10   C  C   . GLY A 1 23  ? -14.684 -20.626 -16.616 1.00 51.20 ? 23  GLY A C   1 
ATOM   11   O  O   . GLY A 1 23  ? -15.184 -19.507 -16.711 1.00 51.23 ? 23  GLY A O   1 
ATOM   12   N  N   . THR A 1 24  ? -15.348 -21.675 -16.133 1.00 48.25 ? 24  THR A N   1 
ATOM   13   C  CA  . THR A 1 24  ? -16.738 -21.575 -15.684 1.00 44.32 ? 24  THR A CA  1 
ATOM   14   C  C   . THR A 1 24  ? -17.059 -22.533 -14.545 1.00 42.59 ? 24  THR A C   1 
ATOM   15   O  O   . THR A 1 24  ? -16.261 -23.426 -14.231 1.00 41.74 ? 24  THR A O   1 
ATOM   16   C  CB  . THR A 1 24  ? -17.719 -21.890 -16.827 1.00 44.67 ? 24  THR A CB  1 
ATOM   17   O  OG1 . THR A 1 24  ? -19.056 -21.950 -16.312 1.00 41.13 ? 24  THR A OG1 1 
ATOM   18   C  CG2 . THR A 1 24  ? -17.377 -23.231 -17.467 1.00 45.85 ? 24  THR A CG2 1 
ATOM   19   N  N   . PHE A 1 25  ? -18.221 -22.330 -13.918 1.00 39.07 ? 25  PHE A N   1 
ATOM   20   C  CA  . PHE A 1 25  ? -18.683 -23.207 -12.841 1.00 36.62 ? 25  PHE A CA  1 
ATOM   21   C  C   . PHE A 1 25  ? -19.629 -24.213 -13.498 1.00 35.23 ? 25  PHE A C   1 
ATOM   22   O  O   . PHE A 1 25  ? -20.147 -23.954 -14.581 1.00 35.13 ? 25  PHE A O   1 
ATOM   23   C  CB  . PHE A 1 25  ? -19.400 -22.406 -11.737 1.00 34.35 ? 25  PHE A CB  1 
ATOM   24   C  CG  . PHE A 1 25  ? -20.478 -21.493 -12.243 1.00 31.13 ? 25  PHE A CG  1 
ATOM   25   C  CD1 . PHE A 1 25  ? -21.729 -21.992 -12.589 1.00 29.45 ? 25  PHE A CD1 1 
ATOM   26   C  CD2 . PHE A 1 25  ? -20.231 -20.133 -12.404 1.00 30.34 ? 25  PHE A CD2 1 
ATOM   27   C  CE1 . PHE A 1 25  ? -22.722 -21.151 -13.091 1.00 28.58 ? 25  PHE A CE1 1 
ATOM   28   C  CE2 . PHE A 1 25  ? -21.213 -19.286 -12.905 1.00 27.36 ? 25  PHE A CE2 1 
ATOM   29   C  CZ  . PHE A 1 25  ? -22.460 -19.794 -13.250 1.00 28.10 ? 25  PHE A CZ  1 
ATOM   30   N  N   . LYS A 1 26  ? -19.863 -25.354 -12.860 1.00 36.26 ? 26  LYS A N   1 
ATOM   31   C  CA  . LYS A 1 26  ? -20.724 -26.363 -13.472 1.00 36.39 ? 26  LYS A CA  1 
ATOM   32   C  C   . LYS A 1 26  ? -21.895 -26.869 -12.638 1.00 33.93 ? 26  LYS A C   1 
ATOM   33   O  O   . LYS A 1 26  ? -21.741 -27.237 -11.477 1.00 34.22 ? 26  LYS A O   1 
ATOM   34   C  CB  . LYS A 1 26  ? -19.855 -27.531 -13.944 1.00 37.33 ? 26  LYS A CB  1 
ATOM   35   C  CG  . LYS A 1 26  ? -18.977 -27.156 -15.121 1.00 39.28 ? 26  LYS A CG  1 
ATOM   36   C  CD  . LYS A 1 26  ? -17.858 -28.157 -15.363 1.00 43.63 ? 26  LYS A CD  1 
ATOM   37   C  CE  . LYS A 1 26  ? -16.782 -28.060 -14.288 1.00 46.53 ? 26  LYS A CE  1 
ATOM   38   N  NZ  . LYS A 1 26  ? -15.595 -28.930 -14.572 1.00 47.04 ? 26  LYS A NZ  1 
ATOM   39   N  N   . ALA A 1 27  ? -23.071 -26.883 -13.257 1.00 33.61 ? 27  ALA A N   1 
ATOM   40   C  CA  . ALA A 1 27  ? -24.293 -27.335 -12.608 1.00 34.31 ? 27  ALA A CA  1 
ATOM   41   C  C   . ALA A 1 27  ? -24.172 -28.744 -12.021 1.00 35.10 ? 27  ALA A C   1 
ATOM   42   O  O   . ALA A 1 27  ? -24.883 -29.094 -11.072 1.00 34.58 ? 27  ALA A O   1 
ATOM   43   C  CB  . ALA A 1 27  ? -25.456 -27.275 -13.597 1.00 33.69 ? 27  ALA A CB  1 
ATOM   44   N  N   . LYS A 1 28  ? -23.278 -29.553 -12.579 1.00 34.99 ? 28  LYS A N   1 
ATOM   45   C  CA  . LYS A 1 28  ? -23.092 -30.906 -12.072 1.00 36.53 ? 28  LYS A CA  1 
ATOM   46   C  C   . LYS A 1 28  ? -22.407 -30.885 -10.705 1.00 36.62 ? 28  LYS A C   1 
ATOM   47   O  O   . LYS A 1 28  ? -22.379 -31.896 -9.998  1.00 33.79 ? 28  LYS A O   1 
ATOM   48   C  CB  . LYS A 1 28  ? -22.263 -31.726 -13.053 1.00 36.02 ? 28  LYS A CB  1 
ATOM   49   N  N   . ASP A 1 29  ? -21.861 -29.733 -10.327 1.00 36.84 ? 29  ASP A N   1 
ATOM   50   C  CA  . ASP A 1 29  ? -21.161 -29.634 -9.053  1.00 38.20 ? 29  ASP A CA  1 
ATOM   51   C  C   . ASP A 1 29  ? -21.978 -28.952 -7.962  1.00 38.53 ? 29  ASP A C   1 
ATOM   52   O  O   . ASP A 1 29  ? -21.473 -28.702 -6.868  1.00 37.06 ? 29  ASP A O   1 
ATOM   53   C  CB  . ASP A 1 29  ? -19.824 -28.896 -9.231  1.00 38.05 ? 29  ASP A CB  1 
ATOM   54   C  CG  . ASP A 1 29  ? -18.903 -29.572 -10.235 1.00 37.29 ? 29  ASP A CG  1 
ATOM   55   O  OD1 . ASP A 1 29  ? -18.707 -30.799 -10.145 1.00 39.03 ? 29  ASP A OD1 1 
ATOM   56   O  OD2 . ASP A 1 29  ? -18.362 -28.873 -11.115 1.00 41.63 ? 29  ASP A OD2 1 
ATOM   57   N  N   . LEU A 1 30  ? -23.241 -28.665 -8.258  1.00 38.82 ? 30  LEU A N   1 
ATOM   58   C  CA  . LEU A 1 30  ? -24.123 -28.001 -7.303  1.00 39.01 ? 30  LEU A CA  1 
ATOM   59   C  C   . LEU A 1 30  ? -24.195 -28.671 -5.935  1.00 38.99 ? 30  LEU A C   1 
ATOM   60   O  O   . LEU A 1 30  ? -24.485 -29.859 -5.823  1.00 39.57 ? 30  LEU A O   1 
ATOM   61   C  CB  . LEU A 1 30  ? -25.542 -27.905 -7.871  1.00 39.95 ? 30  LEU A CB  1 
ATOM   62   C  CG  . LEU A 1 30  ? -25.841 -26.878 -8.967  1.00 41.86 ? 30  LEU A CG  1 
ATOM   63   C  CD1 . LEU A 1 30  ? -27.247 -27.107 -9.524  1.00 40.06 ? 30  LEU A CD1 1 
ATOM   64   C  CD2 . LEU A 1 30  ? -25.707 -25.469 -8.391  1.00 42.00 ? 30  LEU A CD2 1 
ATOM   65   N  N   . ILE A 1 31  ? -23.930 -27.896 -4.892  1.00 39.55 ? 31  ILE A N   1 
ATOM   66   C  CA  . ILE A 1 31  ? -24.011 -28.402 -3.530  1.00 39.62 ? 31  ILE A CA  1 
ATOM   67   C  C   . ILE A 1 31  ? -25.314 -27.825 -2.999  1.00 39.89 ? 31  ILE A C   1 
ATOM   68   O  O   . ILE A 1 31  ? -25.421 -26.617 -2.792  1.00 40.15 ? 31  ILE A O   1 
ATOM   69   C  CB  . ILE A 1 31  ? -22.828 -27.908 -2.654  1.00 40.19 ? 31  ILE A CB  1 
ATOM   70   C  CG1 . ILE A 1 31  ? -21.531 -28.605 -3.071  1.00 38.12 ? 31  ILE A CG1 1 
ATOM   71   C  CG2 . ILE A 1 31  ? -23.108 -28.174 -1.187  1.00 39.16 ? 31  ILE A CG2 1 
ATOM   72   C  CD1 . ILE A 1 31  ? -20.862 -27.994 -4.270  1.00 39.78 ? 31  ILE A CD1 1 
ATOM   73   N  N   . VAL A 1 32  ? -26.304 -28.691 -2.802  1.00 40.06 ? 32  VAL A N   1 
ATOM   74   C  CA  . VAL A 1 32  ? -27.620 -28.281 -2.321  1.00 38.83 ? 32  VAL A CA  1 
ATOM   75   C  C   . VAL A 1 32  ? -27.740 -28.350 -0.804  1.00 40.64 ? 32  VAL A C   1 
ATOM   76   O  O   . VAL A 1 32  ? -27.362 -29.343 -0.180  1.00 42.19 ? 32  VAL A O   1 
ATOM   77   C  CB  . VAL A 1 32  ? -28.718 -29.161 -2.932  1.00 38.47 ? 32  VAL A CB  1 
ATOM   78   C  CG1 . VAL A 1 32  ? -30.087 -28.669 -2.497  1.00 36.74 ? 32  VAL A CG1 1 
ATOM   79   C  CG2 . VAL A 1 32  ? -28.600 -29.154 -4.448  1.00 37.28 ? 32  VAL A CG2 1 
ATOM   80   N  N   . THR A 1 33  ? -28.284 -27.292 -0.217  1.00 40.00 ? 33  THR A N   1 
ATOM   81   C  CA  . THR A 1 33  ? -28.452 -27.223 1.222   1.00 39.56 ? 33  THR A CA  1 
ATOM   82   C  C   . THR A 1 33  ? -29.845 -26.696 1.556   1.00 41.13 ? 33  THR A C   1 
ATOM   83   O  O   . THR A 1 33  ? -30.067 -25.487 1.655   1.00 42.46 ? 33  THR A O   1 
ATOM   84   C  CB  . THR A 1 33  ? -27.389 -26.315 1.826   1.00 39.26 ? 33  THR A CB  1 
ATOM   85   O  OG1 . THR A 1 33  ? -26.105 -26.729 1.347   1.00 40.15 ? 33  THR A OG1 1 
ATOM   86   C  CG2 . THR A 1 33  ? -27.415 -26.395 3.347   1.00 37.93 ? 33  THR A CG2 1 
ATOM   87   N  N   . PRO A 1 34  ? -30.804 -27.608 1.742   1.00 41.54 ? 34  PRO A N   1 
ATOM   88   C  CA  . PRO A 1 34  ? -32.193 -27.276 2.060   1.00 42.74 ? 34  PRO A CA  1 
ATOM   89   C  C   . PRO A 1 34  ? -32.432 -26.573 3.391   1.00 43.14 ? 34  PRO A C   1 
ATOM   90   O  O   . PRO A 1 34  ? -31.810 -26.897 4.406   1.00 43.27 ? 34  PRO A O   1 
ATOM   91   C  CB  . PRO A 1 34  ? -32.890 -28.636 1.996   1.00 44.77 ? 34  PRO A CB  1 
ATOM   92   C  CG  . PRO A 1 34  ? -31.811 -29.576 2.457   1.00 44.66 ? 34  PRO A CG  1 
ATOM   93   C  CD  . PRO A 1 34  ? -30.611 -29.070 1.697   1.00 43.26 ? 34  PRO A CD  1 
ATOM   94   N  N   . ALA A 1 35  ? -33.346 -25.608 3.377   1.00 41.83 ? 35  ALA A N   1 
ATOM   95   C  CA  . ALA A 1 35  ? -33.692 -24.882 4.586   1.00 41.76 ? 35  ALA A CA  1 
ATOM   96   C  C   . ALA A 1 35  ? -34.547 -25.817 5.441   1.00 42.75 ? 35  ALA A C   1 
ATOM   97   O  O   . ALA A 1 35  ? -35.394 -26.545 4.921   1.00 41.17 ? 35  ALA A O   1 
ATOM   98   C  CB  . ALA A 1 35  ? -34.479 -23.624 4.233   1.00 38.51 ? 35  ALA A CB  1 
ATOM   99   N  N   . THR A 1 36  ? -34.321 -25.811 6.748   1.00 45.31 ? 36  THR A N   1 
ATOM   100  C  CA  . THR A 1 36  ? -35.101 -26.667 7.632   1.00 48.74 ? 36  THR A CA  1 
ATOM   101  C  C   . THR A 1 36  ? -36.411 -25.979 7.975   1.00 49.92 ? 36  THR A C   1 
ATOM   102  O  O   . THR A 1 36  ? -37.437 -26.634 8.165   1.00 51.44 ? 36  THR A O   1 
ATOM   103  C  CB  . THR A 1 36  ? -34.342 -26.971 8.918   1.00 49.79 ? 36  THR A CB  1 
ATOM   104  O  OG1 . THR A 1 36  ? -33.882 -25.741 9.491   1.00 52.40 ? 36  THR A OG1 1 
ATOM   105  C  CG2 . THR A 1 36  ? -33.156 -27.890 8.630   1.00 49.47 ? 36  THR A CG2 1 
ATOM   106  N  N   . ILE A 1 37  ? -36.366 -24.653 8.056   1.00 50.33 ? 37  ILE A N   1 
ATOM   107  C  CA  . ILE A 1 37  ? -37.550 -23.857 8.346   1.00 50.67 ? 37  ILE A CA  1 
ATOM   108  C  C   . ILE A 1 37  ? -37.974 -23.169 7.052   1.00 50.10 ? 37  ILE A C   1 
ATOM   109  O  O   . ILE A 1 37  ? -37.308 -22.246 6.581   1.00 50.20 ? 37  ILE A O   1 
ATOM   110  C  CB  . ILE A 1 37  ? -37.262 -22.792 9.436   1.00 52.60 ? 37  ILE A CB  1 
ATOM   111  C  CG1 . ILE A 1 37  ? -37.046 -23.481 10.785  1.00 53.31 ? 37  ILE A CG1 1 
ATOM   112  C  CG2 . ILE A 1 37  ? -38.416 -21.796 9.529   1.00 51.42 ? 37  ILE A CG2 1 
ATOM   113  C  CD1 . ILE A 1 37  ? -36.762 -22.522 11.932  1.00 53.71 ? 37  ILE A CD1 1 
ATOM   114  N  N   . LEU A 1 38  ? -39.080 -23.631 6.478   1.00 48.99 ? 38  LEU A N   1 
ATOM   115  C  CA  . LEU A 1 38  ? -39.588 -23.072 5.232   1.00 48.26 ? 38  LEU A CA  1 
ATOM   116  C  C   . LEU A 1 38  ? -40.702 -22.057 5.468   1.00 47.71 ? 38  LEU A C   1 
ATOM   117  O  O   . LEU A 1 38  ? -41.619 -22.301 6.250   1.00 48.41 ? 38  LEU A O   1 
ATOM   118  C  CB  . LEU A 1 38  ? -40.101 -24.193 4.324   1.00 48.87 ? 38  LEU A CB  1 
ATOM   119  C  CG  . LEU A 1 38  ? -39.100 -25.261 3.858   1.00 48.20 ? 38  LEU A CG  1 
ATOM   120  C  CD1 . LEU A 1 38  ? -37.976 -24.610 3.063   1.00 44.45 ? 38  LEU A CD1 1 
ATOM   121  C  CD2 . LEU A 1 38  ? -38.545 -26.012 5.060   1.00 47.72 ? 38  LEU A CD2 1 
ATOM   122  N  N   . LYS A 1 39  ? -40.616 -20.921 4.778   1.00 46.17 ? 39  LYS A N   1 
ATOM   123  C  CA  . LYS A 1 39  ? -41.608 -19.857 4.904   1.00 45.25 ? 39  LYS A CA  1 
ATOM   124  C  C   . LYS A 1 39  ? -42.913 -20.182 4.180   1.00 44.17 ? 39  LYS A C   1 
ATOM   125  O  O   . LYS A 1 39  ? -42.923 -20.930 3.202   1.00 44.40 ? 39  LYS A O   1 
ATOM   126  C  CB  . LYS A 1 39  ? -41.040 -18.538 4.355   1.00 45.32 ? 39  LYS A CB  1 
ATOM   127  C  CG  . LYS A 1 39  ? -39.826 -18.007 5.125   1.00 46.07 ? 39  LYS A CG  1 
ATOM   128  C  CD  . LYS A 1 39  ? -39.228 -16.754 4.488   1.00 44.28 ? 39  LYS A CD  1 
ATOM   129  C  CE  . LYS A 1 39  ? -38.673 -17.020 3.087   1.00 46.34 ? 39  LYS A CE  1 
ATOM   130  N  NZ  . LYS A 1 39  ? -38.062 -15.791 2.482   1.00 44.54 ? 39  LYS A NZ  1 
ATOM   131  N  N   . GLU A 1 40  ? -44.011 -19.613 4.672   1.00 42.49 ? 40  GLU A N   1 
ATOM   132  C  CA  . GLU A 1 40  ? -45.333 -19.801 4.079   1.00 40.11 ? 40  GLU A CA  1 
ATOM   133  C  C   . GLU A 1 40  ? -45.466 -18.914 2.843   1.00 39.05 ? 40  GLU A C   1 
ATOM   134  O  O   . GLU A 1 40  ? -45.119 -17.734 2.884   1.00 38.90 ? 40  GLU A O   1 
ATOM   135  C  CB  . GLU A 1 40  ? -46.421 -19.429 5.100   1.00 40.58 ? 40  GLU A CB  1 
ATOM   136  N  N   . LYS A 1 41  ? -45.964 -19.476 1.746   1.00 38.54 ? 41  LYS A N   1 
ATOM   137  C  CA  . LYS A 1 41  ? -46.139 -18.702 0.524   1.00 38.59 ? 41  LYS A CA  1 
ATOM   138  C  C   . LYS A 1 41  ? -47.138 -17.572 0.738   1.00 39.97 ? 41  LYS A C   1 
ATOM   139  O  O   . LYS A 1 41  ? -48.054 -17.680 1.549   1.00 40.22 ? 41  LYS A O   1 
ATOM   140  C  CB  . LYS A 1 41  ? -46.630 -19.588 -0.624  1.00 38.10 ? 41  LYS A CB  1 
ATOM   141  C  CG  . LYS A 1 41  ? -45.545 -20.385 -1.357  1.00 38.10 ? 41  LYS A CG  1 
ATOM   142  C  CD  . LYS A 1 41  ? -44.981 -21.511 -0.510  1.00 38.00 ? 41  LYS A CD  1 
ATOM   143  C  CE  . LYS A 1 41  ? -44.013 -22.364 -1.318  1.00 37.79 ? 41  LYS A CE  1 
ATOM   144  N  NZ  . LYS A 1 41  ? -43.445 -23.479 -0.500  1.00 37.00 ? 41  LYS A NZ  1 
ATOM   145  N  N   . PRO A 1 42  ? -46.980 -16.467 0.002   1.00 41.05 ? 42  PRO A N   1 
ATOM   146  C  CA  . PRO A 1 42  ? -47.905 -15.347 0.160   1.00 42.44 ? 42  PRO A CA  1 
ATOM   147  C  C   . PRO A 1 42  ? -49.195 -15.574 -0.614  1.00 43.87 ? 42  PRO A C   1 
ATOM   148  O  O   . PRO A 1 42  ? -49.411 -16.636 -1.194  1.00 44.57 ? 42  PRO A O   1 
ATOM   149  C  CB  . PRO A 1 42  ? -47.111 -14.181 -0.400  1.00 41.08 ? 42  PRO A CB  1 
ATOM   150  C  CG  . PRO A 1 42  ? -46.400 -14.831 -1.554  1.00 41.57 ? 42  PRO A CG  1 
ATOM   151  C  CD  . PRO A 1 42  ? -45.907 -16.131 -0.951  1.00 41.74 ? 42  PRO A CD  1 
ATOM   152  N  N   . ASP A 1 43  ? -50.045 -14.556 -0.618  1.00 45.67 ? 43  ASP A N   1 
ATOM   153  C  CA  . ASP A 1 43  ? -51.308 -14.603 -1.333  1.00 47.33 ? 43  ASP A CA  1 
ATOM   154  C  C   . ASP A 1 43  ? -51.007 -14.186 -2.770  1.00 48.24 ? 43  ASP A C   1 
ATOM   155  O  O   . ASP A 1 43  ? -50.444 -13.120 -3.002  1.00 48.24 ? 43  ASP A O   1 
ATOM   156  C  CB  . ASP A 1 43  ? -52.296 -13.622 -0.697  1.00 48.12 ? 43  ASP A CB  1 
ATOM   157  C  CG  . ASP A 1 43  ? -53.660 -13.656 -1.354  1.00 50.22 ? 43  ASP A CG  1 
ATOM   158  O  OD1 . ASP A 1 43  ? -53.733 -13.533 -2.597  1.00 50.95 ? 43  ASP A OD1 1 
ATOM   159  O  OD2 . ASP A 1 43  ? -54.663 -13.798 -0.623  1.00 52.00 ? 43  ASP A OD2 1 
ATOM   160  N  N   . PRO A 1 44  ? -51.368 -15.030 -3.750  1.00 49.84 ? 44  PRO A N   1 
ATOM   161  C  CA  . PRO A 1 44  ? -51.152 -14.784 -5.185  1.00 49.34 ? 44  PRO A CA  1 
ATOM   162  C  C   . PRO A 1 44  ? -51.768 -13.486 -5.709  1.00 49.72 ? 44  PRO A C   1 
ATOM   163  O  O   . PRO A 1 44  ? -51.602 -13.139 -6.882  1.00 50.37 ? 44  PRO A O   1 
ATOM   164  C  CB  . PRO A 1 44  ? -51.780 -16.010 -5.843  1.00 49.76 ? 44  PRO A CB  1 
ATOM   165  C  CG  . PRO A 1 44  ? -51.570 -17.085 -4.817  1.00 51.19 ? 44  PRO A CG  1 
ATOM   166  C  CD  . PRO A 1 44  ? -51.928 -16.376 -3.529  1.00 49.33 ? 44  PRO A CD  1 
ATOM   167  N  N   . ASN A 1 45  ? -52.489 -12.775 -4.849  1.00 49.25 ? 45  ASN A N   1 
ATOM   168  C  CA  . ASN A 1 45  ? -53.120 -11.521 -5.243  1.00 48.96 ? 45  ASN A CA  1 
ATOM   169  C  C   . ASN A 1 45  ? -52.755 -10.402 -4.275  1.00 48.75 ? 45  ASN A C   1 
ATOM   170  O  O   . ASN A 1 45  ? -52.872 -9.231  -4.680  1.00 49.07 ? 45  ASN A O   1 
ATOM   171  C  CB  . ASN A 1 45  ? -54.639 -11.692 -5.309  1.00 49.49 ? 45  ASN A CB  1 
ATOM   172  N  N   . LEU A 1 47  ? -49.748 -9.231  -3.933  1.00 32.72 ? 47  LEU A N   1 
ATOM   173  C  CA  . LEU A 1 47  ? -48.267 -9.259  -4.064  1.00 32.07 ? 47  LEU A CA  1 
ATOM   174  C  C   . LEU A 1 47  ? -47.668 -7.913  -4.475  1.00 34.18 ? 47  LEU A C   1 
ATOM   175  O  O   . LEU A 1 47  ? -48.190 -7.223  -5.344  1.00 35.19 ? 47  LEU A O   1 
ATOM   176  C  CB  . LEU A 1 47  ? -47.846 -10.322 -5.078  1.00 29.26 ? 47  LEU A CB  1 
ATOM   177  C  CG  . LEU A 1 47  ? -48.081 -11.793 -4.714  1.00 29.83 ? 47  LEU A CG  1 
ATOM   178  C  CD1 . LEU A 1 47  ? -47.592 -12.694 -5.856  1.00 27.60 ? 47  LEU A CD1 1 
ATOM   179  C  CD2 . LEU A 1 47  ? -47.342 -12.131 -3.421  1.00 26.81 ? 47  LEU A CD2 1 
ATOM   180  N  N   . VAL A 1 48  ? -46.563 -7.549  -3.835  1.00 35.11 ? 48  VAL A N   1 
ATOM   181  C  CA  . VAL A 1 48  ? -45.866 -6.311  -4.139  1.00 34.47 ? 48  VAL A CA  1 
ATOM   182  C  C   . VAL A 1 48  ? -44.553 -6.738  -4.796  1.00 34.49 ? 48  VAL A C   1 
ATOM   183  O  O   . VAL A 1 48  ? -43.775 -7.504  -4.223  1.00 35.86 ? 48  VAL A O   1 
ATOM   184  C  CB  . VAL A 1 48  ? -45.565 -5.505  -2.854  1.00 36.60 ? 48  VAL A CB  1 
ATOM   185  C  CG1 . VAL A 1 48  ? -45.167 -4.084  -3.210  1.00 36.15 ? 48  VAL A CG1 1 
ATOM   186  C  CG2 . VAL A 1 48  ? -46.774 -5.510  -1.937  1.00 35.90 ? 48  VAL A CG2 1 
ATOM   187  N  N   . PHE A 1 49  ? -44.315 -6.244  -6.005  1.00 33.54 ? 49  PHE A N   1 
ATOM   188  C  CA  . PHE A 1 49  ? -43.123 -6.590  -6.772  1.00 29.92 ? 49  PHE A CA  1 
ATOM   189  C  C   . PHE A 1 49  ? -41.783 -6.613  -6.020  1.00 30.08 ? 49  PHE A C   1 
ATOM   190  O  O   . PHE A 1 49  ? -41.348 -5.606  -5.458  1.00 28.65 ? 49  PHE A O   1 
ATOM   191  C  CB  . PHE A 1 49  ? -42.993 -5.646  -7.964  1.00 26.63 ? 49  PHE A CB  1 
ATOM   192  C  CG  . PHE A 1 49  ? -41.886 -6.014  -8.899  1.00 28.23 ? 49  PHE A CG  1 
ATOM   193  C  CD1 . PHE A 1 49  ? -42.154 -6.731  -10.062 1.00 27.50 ? 49  PHE A CD1 1 
ATOM   194  C  CD2 . PHE A 1 49  ? -40.571 -5.675  -8.603  1.00 25.89 ? 49  PHE A CD2 1 
ATOM   195  C  CE1 . PHE A 1 49  ? -41.133 -7.104  -10.913 1.00 30.10 ? 49  PHE A CE1 1 
ATOM   196  C  CE2 . PHE A 1 49  ? -39.538 -6.044  -9.449  1.00 29.64 ? 49  PHE A CE2 1 
ATOM   197  C  CZ  . PHE A 1 49  ? -39.817 -6.761  -10.609 1.00 30.86 ? 49  PHE A CZ  1 
ATOM   198  N  N   . GLY A 1 50  ? -41.127 -7.769  -6.038  1.00 27.25 ? 50  GLY A N   1 
ATOM   199  C  CA  . GLY A 1 50  ? -39.832 -7.899  -5.403  1.00 27.73 ? 50  GLY A CA  1 
ATOM   200  C  C   . GLY A 1 50  ? -39.812 -7.651  -3.917  1.00 27.88 ? 50  GLY A C   1 
ATOM   201  O  O   . GLY A 1 50  ? -38.780 -7.263  -3.354  1.00 26.40 ? 50  GLY A O   1 
ATOM   202  N  N   . THR A 1 51  ? -40.954 -7.883  -3.284  1.00 28.89 ? 51  THR A N   1 
ATOM   203  C  CA  . THR A 1 51  ? -41.096 -7.692  -1.853  1.00 31.18 ? 51  THR A CA  1 
ATOM   204  C  C   . THR A 1 51  ? -40.897 -8.994  -1.077  1.00 30.74 ? 51  THR A C   1 
ATOM   205  O  O   . THR A 1 51  ? -40.250 -9.010  -0.030  1.00 31.44 ? 51  THR A O   1 
ATOM   206  C  CB  . THR A 1 51  ? -42.484 -7.092  -1.534  1.00 33.36 ? 51  THR A CB  1 
ATOM   207  O  OG1 . THR A 1 51  ? -42.352 -5.675  -1.352  1.00 33.94 ? 51  THR A OG1 1 
ATOM   208  C  CG2 . THR A 1 51  ? -43.093 -7.740  -0.293  1.00 34.90 ? 51  THR A CG2 1 
ATOM   209  N  N   . VAL A 1 52  ? -41.445 -10.086 -1.592  1.00 28.92 ? 52  VAL A N   1 
ATOM   210  C  CA  . VAL A 1 52  ? -41.312 -11.372 -0.917  1.00 29.85 ? 52  VAL A CA  1 
ATOM   211  C  C   . VAL A 1 52  ? -40.298 -12.236 -1.638  1.00 28.63 ? 52  VAL A C   1 
ATOM   212  O  O   . VAL A 1 52  ? -40.249 -12.239 -2.862  1.00 27.45 ? 52  VAL A O   1 
ATOM   213  C  CB  . VAL A 1 52  ? -42.664 -12.124 -0.868  1.00 30.62 ? 52  VAL A CB  1 
ATOM   214  C  CG1 . VAL A 1 52  ? -42.464 -13.531 -0.335  1.00 32.75 ? 52  VAL A CG1 1 
ATOM   215  C  CG2 . VAL A 1 52  ? -43.647 -11.366 0.017   1.00 31.32 ? 52  VAL A CG2 1 
ATOM   216  N  N   . PHE A 1 53  ? -39.484 -12.960 -0.878  1.00 29.16 ? 53  PHE A N   1 
ATOM   217  C  CA  . PHE A 1 53  ? -38.481 -13.832 -1.471  1.00 31.10 ? 53  PHE A CA  1 
ATOM   218  C  C   . PHE A 1 53  ? -38.702 -15.277 -1.019  1.00 32.33 ? 53  PHE A C   1 
ATOM   219  O  O   . PHE A 1 53  ? -39.283 -15.521 0.039   1.00 32.24 ? 53  PHE A O   1 
ATOM   220  C  CB  . PHE A 1 53  ? -37.079 -13.352 -1.093  1.00 31.53 ? 53  PHE A CB  1 
ATOM   221  C  CG  . PHE A 1 53  ? -36.789 -11.936 -1.519  1.00 32.91 ? 53  PHE A CG  1 
ATOM   222  C  CD1 . PHE A 1 53  ? -37.115 -10.863 -0.696  1.00 32.52 ? 53  PHE A CD1 1 
ATOM   223  C  CD2 . PHE A 1 53  ? -36.203 -11.675 -2.755  1.00 33.45 ? 53  PHE A CD2 1 
ATOM   224  C  CE1 . PHE A 1 53  ? -36.859 -9.549  -1.097  1.00 33.17 ? 53  PHE A CE1 1 
ATOM   225  C  CE2 . PHE A 1 53  ? -35.945 -10.368 -3.165  1.00 34.20 ? 53  PHE A CE2 1 
ATOM   226  C  CZ  . PHE A 1 53  ? -36.274 -9.302  -2.332  1.00 33.51 ? 53  PHE A CZ  1 
ATOM   227  N  N   . THR A 1 54  ? -38.229 -16.228 -1.824  1.00 32.44 ? 54  THR A N   1 
ATOM   228  C  CA  . THR A 1 54  ? -38.393 -17.658 -1.541  1.00 32.03 ? 54  THR A CA  1 
ATOM   229  C  C   . THR A 1 54  ? -37.527 -18.229 -0.414  1.00 33.11 ? 54  THR A C   1 
ATOM   230  O  O   . THR A 1 54  ? -36.885 -17.486 0.321   1.00 33.18 ? 54  THR A O   1 
ATOM   231  C  CB  . THR A 1 54  ? -38.133 -18.483 -2.805  1.00 29.04 ? 54  THR A CB  1 
ATOM   232  O  OG1 . THR A 1 54  ? -36.774 -18.306 -3.217  1.00 30.95 ? 54  THR A OG1 1 
ATOM   233  C  CG2 . THR A 1 54  ? -39.055 -18.036 -3.916  1.00 27.68 ? 54  THR A CG2 1 
ATOM   234  N  N   . ASP A 1 55  ? -37.527 -19.559 -0.290  1.00 33.70 ? 55  ASP A N   1 
ATOM   235  C  CA  . ASP A 1 55  ? -36.762 -20.266 0.743   1.00 33.47 ? 55  ASP A CA  1 
ATOM   236  C  C   . ASP A 1 55  ? -35.270 -20.365 0.468   1.00 32.98 ? 55  ASP A C   1 
ATOM   237  O  O   . ASP A 1 55  ? -34.452 -20.242 1.390   1.00 31.96 ? 55  ASP A O   1 
ATOM   238  C  CB  . ASP A 1 55  ? -37.283 -21.697 0.924   1.00 34.55 ? 55  ASP A CB  1 
ATOM   239  C  CG  . ASP A 1 55  ? -38.640 -21.748 1.571   1.00 38.04 ? 55  ASP A CG  1 
ATOM   240  O  OD1 . ASP A 1 55  ? -38.751 -21.340 2.751   1.00 36.46 ? 55  ASP A OD1 1 
ATOM   241  O  OD2 . ASP A 1 55  ? -39.592 -22.199 0.893   1.00 38.80 ? 55  ASP A OD2 1 
ATOM   242  N  N   . HIS A 1 56  ? -34.921 -20.611 -0.792  1.00 31.42 ? 56  HIS A N   1 
ATOM   243  C  CA  . HIS A 1 56  ? -33.520 -20.763 -1.173  1.00 31.84 ? 56  HIS A CA  1 
ATOM   244  C  C   . HIS A 1 56  ? -33.029 -19.753 -2.196  1.00 31.52 ? 56  HIS A C   1 
ATOM   245  O  O   . HIS A 1 56  ? -33.816 -19.070 -2.852  1.00 30.59 ? 56  HIS A O   1 
ATOM   246  C  CB  . HIS A 1 56  ? -33.272 -22.180 -1.713  1.00 31.50 ? 56  HIS A CB  1 
ATOM   247  C  CG  . HIS A 1 56  ? -33.824 -23.259 -0.839  1.00 31.13 ? 56  HIS A CG  1 
ATOM   248  N  ND1 . HIS A 1 56  ? -35.167 -23.569 -0.802  1.00 33.21 ? 56  HIS A ND1 1 
ATOM   249  C  CD2 . HIS A 1 56  ? -33.227 -24.058 0.076   1.00 32.34 ? 56  HIS A CD2 1 
ATOM   250  C  CE1 . HIS A 1 56  ? -35.374 -24.511 0.101   1.00 33.22 ? 56  HIS A CE1 1 
ATOM   251  N  NE2 . HIS A 1 56  ? -34.213 -24.825 0.649   1.00 33.40 ? 56  HIS A NE2 1 
ATOM   252  N  N   . MET A 1 57  ? -31.707 -19.685 -2.318  1.00 31.19 ? 57  MET A N   1 
ATOM   253  C  CA  . MET A 1 57  ? -31.038 -18.786 -3.250  1.00 30.98 ? 57  MET A CA  1 
ATOM   254  C  C   . MET A 1 57  ? -29.835 -19.528 -3.825  1.00 30.50 ? 57  MET A C   1 
ATOM   255  O  O   . MET A 1 57  ? -29.454 -20.593 -3.328  1.00 30.22 ? 57  MET A O   1 
ATOM   256  C  CB  . MET A 1 57  ? -30.557 -17.538 -2.518  1.00 31.22 ? 57  MET A CB  1 
ATOM   257  C  CG  . MET A 1 57  ? -29.389 -17.793 -1.578  1.00 30.40 ? 57  MET A CG  1 
ATOM   258  S  SD  . MET A 1 57  ? -29.058 -16.363 -0.539  1.00 31.11 ? 57  MET A SD  1 
ATOM   259  C  CE  . MET A 1 57  ? -28.510 -15.193 -1.771  1.00 29.58 ? 57  MET A CE  1 
ATOM   260  N  N   . LEU A 1 58  ? -29.243 -18.964 -4.871  1.00 30.23 ? 58  LEU A N   1 
ATOM   261  C  CA  . LEU A 1 58  ? -28.074 -19.556 -5.521  1.00 28.04 ? 58  LEU A CA  1 
ATOM   262  C  C   . LEU A 1 58  ? -26.910 -18.588 -5.403  1.00 27.78 ? 58  LEU A C   1 
ATOM   263  O  O   . LEU A 1 58  ? -27.077 -17.399 -5.635  1.00 29.74 ? 58  LEU A O   1 
ATOM   264  C  CB  . LEU A 1 58  ? -28.363 -19.794 -6.998  1.00 23.59 ? 58  LEU A CB  1 
ATOM   265  C  CG  . LEU A 1 58  ? -27.170 -20.182 -7.875  1.00 25.95 ? 58  LEU A CG  1 
ATOM   266  C  CD1 . LEU A 1 58  ? -26.728 -21.596 -7.550  1.00 27.16 ? 58  LEU A CD1 1 
ATOM   267  C  CD2 . LEU A 1 58  ? -27.562 -20.084 -9.339  1.00 24.90 ? 58  LEU A CD2 1 
ATOM   268  N  N   . THR A 1 59  ? -25.734 -19.089 -5.045  1.00 29.04 ? 59  THR A N   1 
ATOM   269  C  CA  . THR A 1 59  ? -24.548 -18.243 -4.929  1.00 28.72 ? 59  THR A CA  1 
ATOM   270  C  C   . THR A 1 59  ? -23.343 -18.976 -5.500  1.00 28.54 ? 59  THR A C   1 
ATOM   271  O  O   . THR A 1 59  ? -23.254 -20.206 -5.427  1.00 28.92 ? 59  THR A O   1 
ATOM   272  C  CB  . THR A 1 59  ? -24.240 -17.857 -3.460  1.00 27.88 ? 59  THR A CB  1 
ATOM   273  O  OG1 . THR A 1 59  ? -23.884 -19.030 -2.722  1.00 33.39 ? 59  THR A OG1 1 
ATOM   274  C  CG2 . THR A 1 59  ? -25.449 -17.212 -2.814  1.00 26.78 ? 59  THR A CG2 1 
ATOM   275  N  N   . VAL A 1 60  ? -22.424 -18.216 -6.082  1.00 28.45 ? 60  VAL A N   1 
ATOM   276  C  CA  . VAL A 1 60  ? -21.220 -18.780 -6.669  1.00 28.08 ? 60  VAL A CA  1 
ATOM   277  C  C   . VAL A 1 60  ? -20.086 -17.787 -6.506  1.00 28.19 ? 60  VAL A C   1 
ATOM   278  O  O   . VAL A 1 60  ? -20.141 -16.682 -7.038  1.00 28.87 ? 60  VAL A O   1 
ATOM   279  C  CB  . VAL A 1 60  ? -21.405 -19.069 -8.169  1.00 28.95 ? 60  VAL A CB  1 
ATOM   280  C  CG1 . VAL A 1 60  ? -20.239 -19.897 -8.680  1.00 27.64 ? 60  VAL A CG1 1 
ATOM   281  C  CG2 . VAL A 1 60  ? -22.714 -19.799 -8.402  1.00 27.94 ? 60  VAL A CG2 1 
ATOM   282  N  N   . GLU A 1 61  ? -19.061 -18.193 -5.765  1.00 29.99 ? 61  GLU A N   1 
ATOM   283  C  CA  . GLU A 1 61  ? -17.903 -17.354 -5.504  1.00 30.33 ? 61  GLU A CA  1 
ATOM   284  C  C   . GLU A 1 61  ? -16.883 -17.416 -6.632  1.00 30.96 ? 61  GLU A C   1 
ATOM   285  O  O   . GLU A 1 61  ? -16.752 -18.439 -7.304  1.00 31.99 ? 61  GLU A O   1 
ATOM   286  C  CB  . GLU A 1 61  ? -17.243 -17.781 -4.190  1.00 30.44 ? 61  GLU A CB  1 
ATOM   287  C  CG  . GLU A 1 61  ? -18.040 -17.442 -2.926  1.00 31.48 ? 61  GLU A CG  1 
ATOM   288  C  CD  . GLU A 1 61  ? -18.059 -15.943 -2.641  1.00 35.78 ? 61  GLU A CD  1 
ATOM   289  O  OE1 . GLU A 1 61  ? -18.575 -15.531 -1.578  1.00 35.29 ? 61  GLU A OE1 1 
ATOM   290  O  OE2 . GLU A 1 61  ? -17.555 -15.174 -3.486  1.00 38.08 ? 61  GLU A OE2 1 
ATOM   291  N  N   . TRP A 1 62  ? -16.176 -16.308 -6.850  1.00 30.99 ? 62  TRP A N   1 
ATOM   292  C  CA  . TRP A 1 62  ? -15.145 -16.245 -7.885  1.00 31.74 ? 62  TRP A CA  1 
ATOM   293  C  C   . TRP A 1 62  ? -13.952 -15.432 -7.422  1.00 31.54 ? 62  TRP A C   1 
ATOM   294  O  O   . TRP A 1 62  ? -14.104 -14.370 -6.829  1.00 33.85 ? 62  TRP A O   1 
ATOM   295  C  CB  . TRP A 1 62  ? -15.670 -15.615 -9.179  1.00 30.04 ? 62  TRP A CB  1 
ATOM   296  C  CG  . TRP A 1 62  ? -14.607 -15.526 -10.265 1.00 29.58 ? 62  TRP A CG  1 
ATOM   297  C  CD1 . TRP A 1 62  ? -14.311 -16.478 -11.206 1.00 29.70 ? 62  TRP A CD1 1 
ATOM   298  C  CD2 . TRP A 1 62  ? -13.714 -14.425 -10.518 1.00 28.85 ? 62  TRP A CD2 1 
ATOM   299  N  NE1 . TRP A 1 62  ? -13.296 -16.035 -12.030 1.00 28.85 ? 62  TRP A NE1 1 
ATOM   300  C  CE2 . TRP A 1 62  ? -12.913 -14.780 -11.630 1.00 29.53 ? 62  TRP A CE2 1 
ATOM   301  C  CE3 . TRP A 1 62  ? -13.517 -13.175 -9.917  1.00 28.09 ? 62  TRP A CE3 1 
ATOM   302  C  CZ2 . TRP A 1 62  ? -11.930 -13.923 -12.154 1.00 31.20 ? 62  TRP A CZ2 1 
ATOM   303  C  CZ3 . TRP A 1 62  ? -12.539 -12.324 -10.439 1.00 27.73 ? 62  TRP A CZ3 1 
ATOM   304  C  CH2 . TRP A 1 62  ? -11.760 -12.704 -11.547 1.00 30.14 ? 62  TRP A CH2 1 
ATOM   305  N  N   . SER A 1 63  ? -12.766 -15.942 -7.708  1.00 31.23 ? 63  SER A N   1 
ATOM   306  C  CA  . SER A 1 63  ? -11.528 -15.263 -7.360  1.00 32.43 ? 63  SER A CA  1 
ATOM   307  C  C   . SER A 1 63  ? -10.670 -15.398 -8.600  1.00 31.83 ? 63  SER A C   1 
ATOM   308  O  O   . SER A 1 63  ? -10.722 -16.422 -9.279  1.00 29.32 ? 63  SER A O   1 
ATOM   309  C  CB  . SER A 1 63  ? -10.843 -15.951 -6.179  1.00 32.50 ? 63  SER A CB  1 
ATOM   310  O  OG  . SER A 1 63  ? -10.428 -17.256 -6.536  1.00 33.87 ? 63  SER A OG  1 
ATOM   311  N  N   . SER A 1 64  ? -9.897  -14.367 -8.908  1.00 32.75 ? 64  SER A N   1 
ATOM   312  C  CA  . SER A 1 64  ? -9.041  -14.405 -10.086 1.00 34.69 ? 64  SER A CA  1 
ATOM   313  C  C   . SER A 1 64  ? -7.893  -15.391 -9.888  1.00 35.36 ? 64  SER A C   1 
ATOM   314  O  O   . SER A 1 64  ? -7.244  -15.802 -10.843 1.00 37.28 ? 64  SER A O   1 
ATOM   315  C  CB  . SER A 1 64  ? -8.473  -13.016 -10.363 1.00 35.63 ? 64  SER A CB  1 
ATOM   316  O  OG  . SER A 1 64  ? -7.561  -12.633 -9.350  1.00 39.37 ? 64  SER A OG  1 
ATOM   317  N  N   . GLU A 1 65  ? -7.651  -15.767 -8.640  1.00 37.47 ? 65  GLU A N   1 
ATOM   318  C  CA  . GLU A 1 65  ? -6.575  -16.692 -8.319  1.00 38.82 ? 65  GLU A CA  1 
ATOM   319  C  C   . GLU A 1 65  ? -6.945  -18.152 -8.550  1.00 37.07 ? 65  GLU A C   1 
ATOM   320  O  O   . GLU A 1 65  ? -6.122  -18.929 -9.021  1.00 37.94 ? 65  GLU A O   1 
ATOM   321  C  CB  . GLU A 1 65  ? -6.142  -16.508 -6.862  1.00 41.87 ? 65  GLU A CB  1 
ATOM   322  C  CG  . GLU A 1 65  ? -4.949  -17.358 -6.465  1.00 47.36 ? 65  GLU A CG  1 
ATOM   323  C  CD  . GLU A 1 65  ? -4.661  -17.297 -4.979  1.00 51.43 ? 65  GLU A CD  1 
ATOM   324  O  OE1 . GLU A 1 65  ? -3.561  -17.731 -4.568  1.00 52.77 ? 65  GLU A OE1 1 
ATOM   325  O  OE2 . GLU A 1 65  ? -5.540  -16.822 -4.224  1.00 52.65 ? 65  GLU A OE2 1 
ATOM   326  N  N   . PHE A 1 66  ? -8.176  -18.525 -8.219  1.00 35.49 ? 66  PHE A N   1 
ATOM   327  C  CA  . PHE A 1 66  ? -8.622  -19.907 -8.379  1.00 34.80 ? 66  PHE A CA  1 
ATOM   328  C  C   . PHE A 1 66  ? -9.855  -20.062 -9.281  1.00 34.34 ? 66  PHE A C   1 
ATOM   329  O  O   . PHE A 1 66  ? -10.341 -21.174 -9.496  1.00 33.42 ? 66  PHE A O   1 
ATOM   330  C  CB  . PHE A 1 66  ? -8.914  -20.499 -7.004  1.00 34.97 ? 66  PHE A CB  1 
ATOM   331  C  CG  . PHE A 1 66  ? -7.750  -20.426 -6.054  1.00 38.14 ? 66  PHE A CG  1 
ATOM   332  C  CD1 . PHE A 1 66  ? -7.909  -19.892 -4.777  1.00 39.80 ? 66  PHE A CD1 1 
ATOM   333  C  CD2 . PHE A 1 66  ? -6.500  -20.917 -6.421  1.00 38.28 ? 66  PHE A CD2 1 
ATOM   334  C  CE1 . PHE A 1 66  ? -6.834  -19.851 -3.874  1.00 41.03 ? 66  PHE A CE1 1 
ATOM   335  C  CE2 . PHE A 1 66  ? -5.421  -20.880 -5.529  1.00 40.21 ? 66  PHE A CE2 1 
ATOM   336  C  CZ  . PHE A 1 66  ? -5.590  -20.348 -4.253  1.00 39.57 ? 66  PHE A CZ  1 
ATOM   337  N  N   . GLY A 1 67  ? -10.357 -18.945 -9.799  1.00 33.57 ? 67  GLY A N   1 
ATOM   338  C  CA  . GLY A 1 67  ? -11.524 -18.979 -10.671 1.00 33.68 ? 67  GLY A CA  1 
ATOM   339  C  C   . GLY A 1 67  ? -12.867 -19.203 -9.984  1.00 32.62 ? 67  GLY A C   1 
ATOM   340  O  O   . GLY A 1 67  ? -13.061 -18.862 -8.813  1.00 32.51 ? 67  GLY A O   1 
ATOM   341  N  N   . TRP A 1 68  ? -13.810 -19.773 -10.725 1.00 32.25 ? 68  TRP A N   1 
ATOM   342  C  CA  . TRP A 1 68  ? -15.128 -20.051 -10.178 1.00 32.50 ? 68  TRP A CA  1 
ATOM   343  C  C   . TRP A 1 68  ? -15.098 -21.197 -9.180  1.00 35.04 ? 68  TRP A C   1 
ATOM   344  O  O   . TRP A 1 68  ? -14.457 -22.222 -9.417  1.00 36.55 ? 68  TRP A O   1 
ATOM   345  C  CB  . TRP A 1 68  ? -16.106 -20.413 -11.288 1.00 30.56 ? 68  TRP A CB  1 
ATOM   346  C  CG  . TRP A 1 68  ? -16.469 -19.275 -12.157 1.00 30.83 ? 68  TRP A CG  1 
ATOM   347  C  CD1 . TRP A 1 68  ? -16.018 -19.030 -13.420 1.00 29.02 ? 68  TRP A CD1 1 
ATOM   348  C  CD2 . TRP A 1 68  ? -17.383 -18.222 -11.840 1.00 30.11 ? 68  TRP A CD2 1 
ATOM   349  N  NE1 . TRP A 1 68  ? -16.602 -17.888 -13.912 1.00 29.53 ? 68  TRP A NE1 1 
ATOM   350  C  CE2 . TRP A 1 68  ? -17.444 -17.372 -12.963 1.00 28.60 ? 68  TRP A CE2 1 
ATOM   351  C  CE3 . TRP A 1 68  ? -18.159 -17.916 -10.714 1.00 32.13 ? 68  TRP A CE3 1 
ATOM   352  C  CZ2 . TRP A 1 68  ? -18.249 -16.237 -12.998 1.00 28.45 ? 68  TRP A CZ2 1 
ATOM   353  C  CZ3 . TRP A 1 68  ? -18.962 -16.787 -10.747 1.00 31.25 ? 68  TRP A CZ3 1 
ATOM   354  C  CH2 . TRP A 1 68  ? -19.000 -15.960 -11.885 1.00 32.91 ? 68  TRP A CH2 1 
ATOM   355  N  N   . GLU A 1 69  ? -15.786 -21.010 -8.058  1.00 35.86 ? 69  GLU A N   1 
ATOM   356  C  CA  . GLU A 1 69  ? -15.886 -22.039 -7.039  1.00 35.94 ? 69  GLU A CA  1 
ATOM   357  C  C   . GLU A 1 69  ? -17.083 -22.877 -7.464  1.00 35.60 ? 69  GLU A C   1 
ATOM   358  O  O   . GLU A 1 69  ? -17.650 -22.656 -8.536  1.00 35.06 ? 69  GLU A O   1 
ATOM   359  C  CB  . GLU A 1 69  ? -16.165 -21.427 -5.661  1.00 36.34 ? 69  GLU A CB  1 
ATOM   360  C  CG  . GLU A 1 69  ? -15.031 -20.600 -5.067  1.00 36.68 ? 69  GLU A CG  1 
ATOM   361  C  CD  . GLU A 1 69  ? -13.751 -21.394 -4.892  1.00 39.57 ? 69  GLU A CD  1 
ATOM   362  O  OE1 . GLU A 1 69  ? -13.833 -22.590 -4.528  1.00 36.66 ? 69  GLU A OE1 1 
ATOM   363  O  OE2 . GLU A 1 69  ? -12.662 -20.816 -5.105  1.00 41.48 ? 69  GLU A OE2 1 
ATOM   364  N  N   . LYS A 1 70  ? -17.470 -23.834 -6.633  1.00 34.90 ? 70  LYS A N   1 
ATOM   365  C  CA  . LYS A 1 70  ? -18.619 -24.664 -6.956  1.00 34.62 ? 70  LYS A CA  1 
ATOM   366  C  C   . LYS A 1 70  ? -19.891 -23.944 -6.511  1.00 33.57 ? 70  LYS A C   1 
ATOM   367  O  O   . LYS A 1 70  ? -19.937 -23.346 -5.430  1.00 33.80 ? 70  LYS A O   1 
ATOM   368  C  CB  . LYS A 1 70  ? -18.511 -26.026 -6.265  1.00 35.58 ? 70  LYS A CB  1 
ATOM   369  C  CG  . LYS A 1 70  ? -17.325 -26.874 -6.711  1.00 35.57 ? 70  LYS A CG  1 
ATOM   370  C  CD  . LYS A 1 70  ? -17.322 -28.205 -5.958  1.00 38.60 ? 70  LYS A CD  1 
ATOM   371  C  CE  . LYS A 1 70  ? -16.089 -29.052 -6.259  1.00 37.89 ? 70  LYS A CE  1 
ATOM   372  N  NZ  . LYS A 1 70  ? -14.869 -28.562 -5.555  1.00 37.73 ? 70  LYS A NZ  1 
ATOM   373  N  N   . PRO A 1 71  ? -20.939 -23.987 -7.343  1.00 31.38 ? 71  PRO A N   1 
ATOM   374  C  CA  . PRO A 1 71  ? -22.219 -23.340 -7.045  1.00 31.92 ? 71  PRO A CA  1 
ATOM   375  C  C   . PRO A 1 71  ? -23.010 -23.971 -5.895  1.00 32.27 ? 71  PRO A C   1 
ATOM   376  O  O   . PRO A 1 71  ? -23.054 -25.196 -5.745  1.00 33.30 ? 71  PRO A O   1 
ATOM   377  C  CB  . PRO A 1 71  ? -22.958 -23.416 -8.379  1.00 33.28 ? 71  PRO A CB  1 
ATOM   378  C  CG  . PRO A 1 71  ? -22.440 -24.696 -8.967  1.00 33.85 ? 71  PRO A CG  1 
ATOM   379  C  CD  . PRO A 1 71  ? -20.964 -24.620 -8.673  1.00 31.84 ? 71  PRO A CD  1 
ATOM   380  N  N   . HIS A 1 72  ? -23.642 -23.117 -5.096  1.00 31.46 ? 72  HIS A N   1 
ATOM   381  C  CA  . HIS A 1 72  ? -24.434 -23.551 -3.955  1.00 32.24 ? 72  HIS A CA  1 
ATOM   382  C  C   . HIS A 1 72  ? -25.892 -23.107 -4.043  1.00 33.92 ? 72  HIS A C   1 
ATOM   383  O  O   . HIS A 1 72  ? -26.208 -22.077 -4.643  1.00 35.41 ? 72  HIS A O   1 
ATOM   384  C  CB  . HIS A 1 72  ? -23.859 -22.976 -2.661  1.00 34.18 ? 72  HIS A CB  1 
ATOM   385  C  CG  . HIS A 1 72  ? -22.526 -23.533 -2.277  1.00 35.93 ? 72  HIS A CG  1 
ATOM   386  N  ND1 . HIS A 1 72  ? -22.340 -24.298 -1.142  1.00 36.36 ? 72  HIS A ND1 1 
ATOM   387  C  CD2 . HIS A 1 72  ? -21.307 -23.411 -2.852  1.00 37.80 ? 72  HIS A CD2 1 
ATOM   388  C  CE1 . HIS A 1 72  ? -21.064 -24.620 -1.036  1.00 37.52 ? 72  HIS A CE1 1 
ATOM   389  N  NE2 . HIS A 1 72  ? -20.414 -24.094 -2.060  1.00 40.24 ? 72  HIS A NE2 1 
ATOM   390  N  N   . ILE A 1 73  ? -26.774 -23.899 -3.440  1.00 33.79 ? 73  ILE A N   1 
ATOM   391  C  CA  . ILE A 1 73  ? -28.193 -23.577 -3.363  1.00 32.87 ? 73  ILE A CA  1 
ATOM   392  C  C   . ILE A 1 73  ? -28.499 -23.731 -1.877  1.00 34.08 ? 73  ILE A C   1 
ATOM   393  O  O   . ILE A 1 73  ? -28.730 -24.835 -1.378  1.00 34.12 ? 73  ILE A O   1 
ATOM   394  C  CB  . ILE A 1 73  ? -29.070 -24.525 -4.214  1.00 33.87 ? 73  ILE A CB  1 
ATOM   395  C  CG1 . ILE A 1 73  ? -28.994 -24.108 -5.689  1.00 32.98 ? 73  ILE A CG1 1 
ATOM   396  C  CG2 . ILE A 1 73  ? -30.528 -24.448 -3.755  1.00 33.34 ? 73  ILE A CG2 1 
ATOM   397  C  CD1 . ILE A 1 73  ? -29.794 -24.992 -6.646  1.00 29.53 ? 73  ILE A CD1 1 
ATOM   398  N  N   . LYS A 1 74  ? -28.466 -22.605 -1.171  1.00 32.77 ? 74  LYS A N   1 
ATOM   399  C  CA  . LYS A 1 74  ? -28.684 -22.595 0.266   1.00 31.10 ? 74  LYS A CA  1 
ATOM   400  C  C   . LYS A 1 74  ? -29.870 -21.730 0.663   1.00 28.90 ? 74  LYS A C   1 
ATOM   401  O  O   . LYS A 1 74  ? -30.464 -21.060 -0.170  1.00 30.58 ? 74  LYS A O   1 
ATOM   402  C  CB  . LYS A 1 74  ? -27.412 -22.092 0.957   1.00 31.76 ? 74  LYS A CB  1 
ATOM   403  C  CG  . LYS A 1 74  ? -26.976 -20.717 0.491   1.00 28.53 ? 74  LYS A CG  1 
ATOM   404  C  CD  . LYS A 1 74  ? -25.604 -20.352 1.025   1.00 29.97 ? 74  LYS A CD  1 
ATOM   405  C  CE  . LYS A 1 74  ? -25.142 -19.009 0.453   1.00 29.38 ? 74  LYS A CE  1 
ATOM   406  N  NZ  . LYS A 1 74  ? -23.713 -18.697 0.763   1.00 30.25 ? 74  LYS A NZ  1 
ATOM   407  N  N   . PRO A 1 75  ? -30.235 -21.745 1.952   1.00 28.40 ? 75  PRO A N   1 
ATOM   408  C  CA  . PRO A 1 75  ? -31.364 -20.934 2.408   1.00 28.52 ? 75  PRO A CA  1 
ATOM   409  C  C   . PRO A 1 75  ? -31.091 -19.469 2.129   1.00 28.74 ? 75  PRO A C   1 
ATOM   410  O  O   . PRO A 1 75  ? -29.934 -19.042 2.105   1.00 28.76 ? 75  PRO A O   1 
ATOM   411  C  CB  . PRO A 1 75  ? -31.401 -21.205 3.909   1.00 27.97 ? 75  PRO A CB  1 
ATOM   412  C  CG  . PRO A 1 75  ? -30.855 -22.595 4.011   1.00 29.22 ? 75  PRO A CG  1 
ATOM   413  C  CD  . PRO A 1 75  ? -29.692 -22.552 3.059   1.00 27.12 ? 75  PRO A CD  1 
ATOM   414  N  N   . LEU A 1 76  ? -32.150 -18.705 1.904   1.00 28.01 ? 76  LEU A N   1 
ATOM   415  C  CA  . LEU A 1 76  ? -31.983 -17.284 1.683   1.00 29.91 ? 76  LEU A CA  1 
ATOM   416  C  C   . LEU A 1 76  ? -31.258 -16.756 2.917   1.00 31.80 ? 76  LEU A C   1 
ATOM   417  O  O   . LEU A 1 76  ? -31.473 -17.242 4.037   1.00 31.72 ? 76  LEU A O   1 
ATOM   418  C  CB  . LEU A 1 76  ? -33.338 -16.600 1.564   1.00 29.55 ? 76  LEU A CB  1 
ATOM   419  C  CG  . LEU A 1 76  ? -33.287 -15.083 1.370   1.00 28.18 ? 76  LEU A CG  1 
ATOM   420  C  CD1 . LEU A 1 76  ? -32.821 -14.753 -0.045  1.00 26.08 ? 76  LEU A CD1 1 
ATOM   421  C  CD2 . LEU A 1 76  ? -34.671 -14.510 1.615   1.00 27.34 ? 76  LEU A CD2 1 
ATOM   422  N  N   . GLN A 1 77  ? -30.389 -15.775 2.712   1.00 32.40 ? 77  GLN A N   1 
ATOM   423  C  CA  . GLN A 1 77  ? -29.640 -15.187 3.816   1.00 31.48 ? 77  GLN A CA  1 
ATOM   424  C  C   . GLN A 1 77  ? -28.902 -13.951 3.341   1.00 30.16 ? 77  GLN A C   1 
ATOM   425  O  O   . GLN A 1 77  ? -28.660 -13.772 2.144   1.00 27.16 ? 77  GLN A O   1 
ATOM   426  C  CB  . GLN A 1 77  ? -28.618 -16.185 4.376   1.00 33.00 ? 77  GLN A CB  1 
ATOM   427  C  CG  . GLN A 1 77  ? -27.653 -16.735 3.326   1.00 36.06 ? 77  GLN A CG  1 
ATOM   428  C  CD  . GLN A 1 77  ? -26.420 -17.378 3.940   1.00 38.50 ? 77  GLN A CD  1 
ATOM   429  O  OE1 . GLN A 1 77  ? -26.524 -18.161 4.885   1.00 40.04 ? 77  GLN A OE1 1 
ATOM   430  N  NE2 . GLN A 1 77  ? -25.245 -17.055 3.401   1.00 38.58 ? 77  GLN A NE2 1 
ATOM   431  N  N   . ASN A 1 78  ? -28.544 -13.095 4.287   1.00 29.61 ? 78  ASN A N   1 
ATOM   432  C  CA  . ASN A 1 78  ? -27.807 -11.887 3.959   1.00 31.65 ? 78  ASN A CA  1 
ATOM   433  C  C   . ASN A 1 78  ? -26.517 -12.254 3.239   1.00 31.49 ? 78  ASN A C   1 
ATOM   434  O  O   . ASN A 1 78  ? -26.135 -13.423 3.171   1.00 34.11 ? 78  ASN A O   1 
ATOM   435  C  CB  . ASN A 1 78  ? -27.460 -11.118 5.238   1.00 29.58 ? 78  ASN A CB  1 
ATOM   436  C  CG  . ASN A 1 78  ? -28.610 -10.282 5.740   1.00 29.09 ? 78  ASN A CG  1 
ATOM   437  O  OD1 . ASN A 1 78  ? -29.730 -10.390 5.243   1.00 28.11 ? 78  ASN A OD1 1 
ATOM   438  N  ND2 . ASN A 1 78  ? -28.342 -9.437  6.730   1.00 30.28 ? 78  ASN A ND2 1 
ATOM   439  N  N   . LEU A 1 79  ? -25.855 -11.245 2.694   1.00 29.52 ? 79  LEU A N   1 
ATOM   440  C  CA  . LEU A 1 79  ? -24.580 -11.447 2.035   1.00 27.00 ? 79  LEU A CA  1 
ATOM   441  C  C   . LEU A 1 79  ? -23.549 -10.921 3.022   1.00 27.62 ? 79  LEU A C   1 
ATOM   442  O  O   . LEU A 1 79  ? -23.788 -9.917  3.704   1.00 25.73 ? 79  LEU A O   1 
ATOM   443  C  CB  . LEU A 1 79  ? -24.513 -10.652 0.728   1.00 23.68 ? 79  LEU A CB  1 
ATOM   444  C  CG  . LEU A 1 79  ? -25.477 -11.149 -0.352  1.00 22.53 ? 79  LEU A CG  1 
ATOM   445  C  CD1 . LEU A 1 79  ? -25.301 -10.364 -1.640  1.00 18.33 ? 79  LEU A CD1 1 
ATOM   446  C  CD2 . LEU A 1 79  ? -25.203 -12.629 -0.591  1.00 21.32 ? 79  LEU A CD2 1 
ATOM   447  N  N   . SER A 1 80  ? -22.422 -11.615 3.127   1.00 27.66 ? 80  SER A N   1 
ATOM   448  C  CA  . SER A 1 80  ? -21.353 -11.193 4.026   1.00 28.49 ? 80  SER A CA  1 
ATOM   449  C  C   . SER A 1 80  ? -20.291 -10.571 3.141   1.00 26.81 ? 80  SER A C   1 
ATOM   450  O  O   . SER A 1 80  ? -19.449 -11.273 2.602   1.00 28.11 ? 80  SER A O   1 
ATOM   451  C  CB  . SER A 1 80  ? -20.778 -12.397 4.790   1.00 28.14 ? 80  SER A CB  1 
ATOM   452  O  OG  . SER A 1 80  ? -19.748 -12.003 5.684   1.00 29.00 ? 80  SER A OG  1 
ATOM   453  N  N   . LEU A 1 81  ? -20.333 -9.250  2.993   1.00 27.55 ? 81  LEU A N   1 
ATOM   454  C  CA  . LEU A 1 81  ? -19.388 -8.556  2.133   1.00 26.32 ? 81  LEU A CA  1 
ATOM   455  C  C   . LEU A 1 81  ? -18.407 -7.643  2.853   1.00 28.51 ? 81  LEU A C   1 
ATOM   456  O  O   . LEU A 1 81  ? -18.751 -6.971  3.828   1.00 29.38 ? 81  LEU A O   1 
ATOM   457  C  CB  . LEU A 1 81  ? -20.156 -7.733  1.103   1.00 28.07 ? 81  LEU A CB  1 
ATOM   458  C  CG  . LEU A 1 81  ? -21.260 -8.485  0.350   1.00 29.50 ? 81  LEU A CG  1 
ATOM   459  C  CD1 . LEU A 1 81  ? -22.019 -7.517  -0.541  1.00 29.59 ? 81  LEU A CD1 1 
ATOM   460  C  CD2 . LEU A 1 81  ? -20.652 -9.620  -0.471  1.00 28.08 ? 81  LEU A CD2 1 
ATOM   461  N  N   . HIS A 1 82  ? -17.174 -7.622  2.357   1.00 28.45 ? 82  HIS A N   1 
ATOM   462  C  CA  . HIS A 1 82  ? -16.139 -6.761  2.910   1.00 27.48 ? 82  HIS A CA  1 
ATOM   463  C  C   . HIS A 1 82  ? -16.623 -5.328  2.641   1.00 26.08 ? 82  HIS A C   1 
ATOM   464  O  O   . HIS A 1 82  ? -17.172 -5.049  1.578   1.00 21.10 ? 82  HIS A O   1 
ATOM   465  C  CB  . HIS A 1 82  ? -14.813 -7.024  2.197   1.00 28.25 ? 82  HIS A CB  1 
ATOM   466  C  CG  . HIS A 1 82  ? -13.648 -6.322  2.817   1.00 33.59 ? 82  HIS A CG  1 
ATOM   467  N  ND1 . HIS A 1 82  ? -13.535 -4.947  2.843   1.00 33.40 ? 82  HIS A ND1 1 
ATOM   468  C  CD2 . HIS A 1 82  ? -12.553 -6.802  3.454   1.00 31.56 ? 82  HIS A CD2 1 
ATOM   469  C  CE1 . HIS A 1 82  ? -12.422 -4.611  3.470   1.00 32.55 ? 82  HIS A CE1 1 
ATOM   470  N  NE2 . HIS A 1 82  ? -11.809 -5.718  3.851   1.00 33.17 ? 82  HIS A NE2 1 
ATOM   471  N  N   . PRO A 1 83  ? -16.421 -4.407  3.600   1.00 26.23 ? 83  PRO A N   1 
ATOM   472  C  CA  . PRO A 1 83  ? -16.856 -3.011  3.449   1.00 25.98 ? 83  PRO A CA  1 
ATOM   473  C  C   . PRO A 1 83  ? -16.288 -2.323  2.214   1.00 26.17 ? 83  PRO A C   1 
ATOM   474  O  O   . PRO A 1 83  ? -16.894 -1.399  1.675   1.00 26.86 ? 83  PRO A O   1 
ATOM   475  C  CB  . PRO A 1 83  ? -16.370 -2.348  4.739   1.00 25.97 ? 83  PRO A CB  1 
ATOM   476  C  CG  . PRO A 1 83  ? -16.277 -3.488  5.706   1.00 27.65 ? 83  PRO A CG  1 
ATOM   477  C  CD  . PRO A 1 83  ? -15.709 -4.596  4.875   1.00 23.85 ? 83  PRO A CD  1 
ATOM   478  N  N   . GLY A 1 84  ? -15.125 -2.782  1.770   1.00 25.57 ? 84  GLY A N   1 
ATOM   479  C  CA  . GLY A 1 84  ? -14.491 -2.182  0.613   1.00 24.65 ? 84  GLY A CA  1 
ATOM   480  C  C   . GLY A 1 84  ? -14.957 -2.714  -0.727  1.00 24.82 ? 84  GLY A C   1 
ATOM   481  O  O   . GLY A 1 84  ? -14.562 -2.186  -1.766  1.00 22.27 ? 84  GLY A O   1 
ATOM   482  N  N   . SER A 1 85  ? -15.799 -3.747  -0.707  1.00 24.18 ? 85  SER A N   1 
ATOM   483  C  CA  . SER A 1 85  ? -16.309 -4.357  -1.934  1.00 23.82 ? 85  SER A CA  1 
ATOM   484  C  C   . SER A 1 85  ? -16.580 -3.308  -3.000  1.00 23.64 ? 85  SER A C   1 
ATOM   485  O  O   . SER A 1 85  ? -17.252 -2.313  -2.742  1.00 24.25 ? 85  SER A O   1 
ATOM   486  C  CB  . SER A 1 85  ? -17.578 -5.158  -1.634  1.00 24.80 ? 85  SER A CB  1 
ATOM   487  O  OG  . SER A 1 85  ? -17.308 -6.194  -0.701  1.00 22.66 ? 85  SER A OG  1 
ATOM   488  N  N   . SER A 1 86  ? -16.061 -3.539  -4.203  1.00 24.34 ? 86  SER A N   1 
ATOM   489  C  CA  . SER A 1 86  ? -16.208 -2.580  -5.294  1.00 24.70 ? 86  SER A CA  1 
ATOM   490  C  C   . SER A 1 86  ? -17.636 -2.361  -5.815  1.00 26.10 ? 86  SER A C   1 
ATOM   491  O  O   . SER A 1 86  ? -17.897 -1.389  -6.536  1.00 22.58 ? 86  SER A O   1 
ATOM   492  C  CB  . SER A 1 86  ? -15.275 -2.966  -6.447  1.00 23.83 ? 86  SER A CB  1 
ATOM   493  O  OG  . SER A 1 86  ? -15.575 -4.263  -6.930  1.00 28.31 ? 86  SER A OG  1 
ATOM   494  N  N   . ALA A 1 87  ? -18.563 -3.249  -5.460  1.00 24.94 ? 87  ALA A N   1 
ATOM   495  C  CA  . ALA A 1 87  ? -19.947 -3.092  -5.905  1.00 22.96 ? 87  ALA A CA  1 
ATOM   496  C  C   . ALA A 1 87  ? -20.646 -1.994  -5.090  1.00 23.56 ? 87  ALA A C   1 
ATOM   497  O  O   . ALA A 1 87  ? -21.647 -1.423  -5.520  1.00 21.67 ? 87  ALA A O   1 
ATOM   498  C  CB  . ALA A 1 87  ? -20.695 -4.408  -5.756  1.00 24.73 ? 87  ALA A CB  1 
ATOM   499  N  N   . LEU A 1 88  ? -20.100 -1.698  -3.914  1.00 21.92 ? 88  LEU A N   1 
ATOM   500  C  CA  . LEU A 1 88  ? -20.667 -0.688  -3.031  1.00 23.20 ? 88  LEU A CA  1 
ATOM   501  C  C   . LEU A 1 88  ? -20.024 0.690   -3.233  1.00 24.43 ? 88  LEU A C   1 
ATOM   502  O  O   . LEU A 1 88  ? -20.581 1.702   -2.824  1.00 24.30 ? 88  LEU A O   1 
ATOM   503  C  CB  . LEU A 1 88  ? -20.476 -1.122  -1.569  1.00 21.23 ? 88  LEU A CB  1 
ATOM   504  C  CG  . LEU A 1 88  ? -20.992 -2.496  -1.138  1.00 21.94 ? 88  LEU A CG  1 
ATOM   505  C  CD1 . LEU A 1 88  ? -20.339 -2.901  0.170   1.00 19.71 ? 88  LEU A CD1 1 
ATOM   506  C  CD2 . LEU A 1 88  ? -22.504 -2.462  -1.005  1.00 19.97 ? 88  LEU A CD2 1 
ATOM   507  N  N   . HIS A 1 89  ? -18.850 0.719   -3.857  1.00 24.84 ? 89  HIS A N   1 
ATOM   508  C  CA  . HIS A 1 89  ? -18.128 1.966   -4.072  1.00 24.22 ? 89  HIS A CA  1 
ATOM   509  C  C   . HIS A 1 89  ? -18.131 2.460   -5.515  1.00 24.98 ? 89  HIS A C   1 
ATOM   510  O  O   . HIS A 1 89  ? -18.341 3.652   -5.776  1.00 26.38 ? 89  HIS A O   1 
ATOM   511  C  CB  . HIS A 1 89  ? -16.683 1.799   -3.591  1.00 25.44 ? 89  HIS A CB  1 
ATOM   512  C  CG  . HIS A 1 89  ? -16.566 1.480   -2.132  1.00 25.88 ? 89  HIS A CG  1 
ATOM   513  N  ND1 . HIS A 1 89  ? -16.347 2.445   -1.172  1.00 23.70 ? 89  HIS A ND1 1 
ATOM   514  C  CD2 . HIS A 1 89  ? -16.688 0.307   -1.465  1.00 26.63 ? 89  HIS A CD2 1 
ATOM   515  C  CE1 . HIS A 1 89  ? -16.340 1.881   0.023   1.00 25.01 ? 89  HIS A CE1 1 
ATOM   516  N  NE2 . HIS A 1 89  ? -16.546 0.585   -0.126  1.00 24.88 ? 89  HIS A NE2 1 
ATOM   517  N  N   . TYR A 1 90  ? -17.902 1.550   -6.454  1.00 22.54 ? 90  TYR A N   1 
ATOM   518  C  CA  . TYR A 1 90  ? -17.862 1.923   -7.862  1.00 22.20 ? 90  TYR A CA  1 
ATOM   519  C  C   . TYR A 1 90  ? -18.890 1.196   -8.726  1.00 21.98 ? 90  TYR A C   1 
ATOM   520  O  O   . TYR A 1 90  ? -18.678 0.989   -9.905  1.00 22.58 ? 90  TYR A O   1 
ATOM   521  C  CB  . TYR A 1 90  ? -16.445 1.701   -8.396  1.00 20.36 ? 90  TYR A CB  1 
ATOM   522  C  CG  . TYR A 1 90  ? -15.398 2.247   -7.455  1.00 18.60 ? 90  TYR A CG  1 
ATOM   523  C  CD1 . TYR A 1 90  ? -14.409 1.419   -6.917  1.00 18.15 ? 90  TYR A CD1 1 
ATOM   524  C  CD2 . TYR A 1 90  ? -15.442 3.572   -7.041  1.00 14.77 ? 90  TYR A CD2 1 
ATOM   525  C  CE1 . TYR A 1 90  ? -13.497 1.896   -5.982  1.00 18.78 ? 90  TYR A CE1 1 
ATOM   526  C  CE2 . TYR A 1 90  ? -14.535 4.066   -6.103  1.00 21.57 ? 90  TYR A CE2 1 
ATOM   527  C  CZ  . TYR A 1 90  ? -13.568 3.225   -5.569  1.00 21.94 ? 90  TYR A CZ  1 
ATOM   528  O  OH  . TYR A 1 90  ? -12.714 3.704   -4.594  1.00 18.87 ? 90  TYR A OH  1 
ATOM   529  N  N   . ALA A 1 91  ? -20.006 0.812   -8.122  1.00 23.25 ? 91  ALA A N   1 
ATOM   530  C  CA  . ALA A 1 91  ? -21.083 0.138   -8.835  1.00 23.50 ? 91  ALA A CA  1 
ATOM   531  C  C   . ALA A 1 91  ? -20.639 -0.983  -9.773  1.00 24.40 ? 91  ALA A C   1 
ATOM   532  O  O   . ALA A 1 91  ? -21.184 -1.136  -10.865 1.00 24.76 ? 91  ALA A O   1 
ATOM   533  C  CB  . ALA A 1 91  ? -21.898 1.163   -9.613  1.00 19.31 ? 91  ALA A CB  1 
ATOM   534  N  N   . VAL A 1 92  ? -19.647 -1.762  -9.366  1.00 24.18 ? 92  VAL A N   1 
ATOM   535  C  CA  . VAL A 1 92  ? -19.208 -2.868  -10.204 1.00 26.56 ? 92  VAL A CA  1 
ATOM   536  C  C   . VAL A 1 92  ? -20.291 -3.931  -10.065 1.00 26.38 ? 92  VAL A C   1 
ATOM   537  O  O   . VAL A 1 92  ? -20.160 -4.875  -9.282  1.00 27.58 ? 92  VAL A O   1 
ATOM   538  C  CB  . VAL A 1 92  ? -17.861 -3.428  -9.726  1.00 28.24 ? 92  VAL A CB  1 
ATOM   539  C  CG1 . VAL A 1 92  ? -17.426 -4.570  -10.628 1.00 29.54 ? 92  VAL A CG1 1 
ATOM   540  C  CG2 . VAL A 1 92  ? -16.822 -2.321  -9.727  1.00 30.69 ? 92  VAL A CG2 1 
ATOM   541  N  N   . GLU A 1 93  ? -21.368 -3.766  -10.825 1.00 25.38 ? 93  GLU A N   1 
ATOM   542  C  CA  . GLU A 1 93  ? -22.487 -4.686  -10.738 1.00 23.67 ? 93  GLU A CA  1 
ATOM   543  C  C   . GLU A 1 93  ? -23.330 -4.738  -12.004 1.00 23.51 ? 93  GLU A C   1 
ATOM   544  O  O   . GLU A 1 93  ? -23.241 -3.862  -12.869 1.00 24.71 ? 93  GLU A O   1 
ATOM   545  C  CB  . GLU A 1 93  ? -23.377 -4.268  -9.567  1.00 24.04 ? 93  GLU A CB  1 
ATOM   546  C  CG  . GLU A 1 93  ? -24.085 -2.918  -9.790  1.00 21.52 ? 93  GLU A CG  1 
ATOM   547  C  CD  . GLU A 1 93  ? -24.771 -2.393  -8.541  1.00 20.32 ? 93  GLU A CD  1 
ATOM   548  O  OE1 . GLU A 1 93  ? -25.871 -1.818  -8.651  1.00 19.95 ? 93  GLU A OE1 1 
ATOM   549  O  OE2 . GLU A 1 93  ? -24.204 -2.554  -7.443  1.00 22.53 ? 93  GLU A OE2 1 
ATOM   550  N  N   . LEU A 1 94  ? -24.159 -5.769  -12.091 1.00 22.23 ? 94  LEU A N   1 
ATOM   551  C  CA  . LEU A 1 94  ? -25.063 -5.944  -13.221 1.00 25.10 ? 94  LEU A CA  1 
ATOM   552  C  C   . LEU A 1 94  ? -26.122 -6.959  -12.799 1.00 25.00 ? 94  LEU A C   1 
ATOM   553  O  O   . LEU A 1 94  ? -25.897 -7.759  -11.883 1.00 25.14 ? 94  LEU A O   1 
ATOM   554  C  CB  . LEU A 1 94  ? -24.294 -6.422  -14.459 1.00 23.69 ? 94  LEU A CB  1 
ATOM   555  C  CG  . LEU A 1 94  ? -23.702 -7.830  -14.414 1.00 28.67 ? 94  LEU A CG  1 
ATOM   556  C  CD1 . LEU A 1 94  ? -24.764 -8.813  -14.856 1.00 27.19 ? 94  LEU A CD1 1 
ATOM   557  C  CD2 . LEU A 1 94  ? -22.498 -7.942  -15.330 1.00 25.84 ? 94  LEU A CD2 1 
ATOM   558  N  N   . PHE A 1 95  ? -27.280 -6.930  -13.449 1.00 23.95 ? 95  PHE A N   1 
ATOM   559  C  CA  . PHE A 1 95  ? -28.343 -7.858  -13.084 1.00 23.41 ? 95  PHE A CA  1 
ATOM   560  C  C   . PHE A 1 95  ? -29.205 -8.301  -14.263 1.00 23.55 ? 95  PHE A C   1 
ATOM   561  O  O   . PHE A 1 95  ? -29.017 -7.860  -15.387 1.00 23.43 ? 95  PHE A O   1 
ATOM   562  C  CB  . PHE A 1 95  ? -29.235 -7.213  -12.016 1.00 23.70 ? 95  PHE A CB  1 
ATOM   563  C  CG  . PHE A 1 95  ? -30.092 -6.096  -12.538 1.00 24.94 ? 95  PHE A CG  1 
ATOM   564  C  CD1 . PHE A 1 95  ? -31.336 -6.362  -13.098 1.00 25.58 ? 95  PHE A CD1 1 
ATOM   565  C  CD2 . PHE A 1 95  ? -29.639 -4.779  -12.508 1.00 27.18 ? 95  PHE A CD2 1 
ATOM   566  C  CE1 . PHE A 1 95  ? -32.117 -5.328  -13.622 1.00 27.74 ? 95  PHE A CE1 1 
ATOM   567  C  CE2 . PHE A 1 95  ? -30.411 -3.734  -13.031 1.00 25.92 ? 95  PHE A CE2 1 
ATOM   568  C  CZ  . PHE A 1 95  ? -31.653 -4.010  -13.589 1.00 27.21 ? 95  PHE A CZ  1 
ATOM   569  N  N   . GLU A 1 96  ? -30.153 -9.186  -13.988 1.00 24.83 ? 96  GLU A N   1 
ATOM   570  C  CA  . GLU A 1 96  ? -31.071 -9.670  -15.006 1.00 25.11 ? 96  GLU A CA  1 
ATOM   571  C  C   . GLU A 1 96  ? -32.455 -9.846  -14.391 1.00 25.06 ? 96  GLU A C   1 
ATOM   572  O  O   . GLU A 1 96  ? -32.622 -9.812  -13.169 1.00 23.41 ? 96  GLU A O   1 
ATOM   573  C  CB  . GLU A 1 96  ? -30.594 -11.001 -15.584 1.00 25.49 ? 96  GLU A CB  1 
ATOM   574  C  CG  . GLU A 1 96  ? -29.785 -10.890 -16.874 1.00 25.22 ? 96  GLU A CG  1 
ATOM   575  C  CD  . GLU A 1 96  ? -30.525 -10.157 -17.979 1.00 24.87 ? 96  GLU A CD  1 
ATOM   576  O  OE1 . GLU A 1 96  ? -31.767 -10.267 -18.046 1.00 25.04 ? 96  GLU A OE1 1 
ATOM   577  O  OE2 . GLU A 1 96  ? -29.863 -9.481  -18.790 1.00 22.15 ? 96  GLU A OE2 1 
ATOM   578  N  N   . GLY A 1 97  ? -33.453 -10.033 -15.243 1.00 25.88 ? 97  GLY A N   1 
ATOM   579  C  CA  . GLY A 1 97  ? -34.799 -10.205 -14.743 1.00 25.79 ? 97  GLY A CA  1 
ATOM   580  C  C   . GLY A 1 97  ? -35.651 -11.035 -15.676 1.00 28.40 ? 97  GLY A C   1 
ATOM   581  O  O   . GLY A 1 97  ? -35.974 -10.601 -16.787 1.00 25.97 ? 97  GLY A O   1 
ATOM   582  N  N   . LEU A 1 98  ? -36.000 -12.240 -15.232 1.00 28.18 ? 98  LEU A N   1 
ATOM   583  C  CA  . LEU A 1 98  ? -36.843 -13.120 -16.021 1.00 29.51 ? 98  LEU A CA  1 
ATOM   584  C  C   . LEU A 1 98  ? -37.879 -13.762 -15.111 1.00 31.24 ? 98  LEU A C   1 
ATOM   585  O  O   . LEU A 1 98  ? -37.890 -13.507 -13.906 1.00 32.16 ? 98  LEU A O   1 
ATOM   586  C  CB  . LEU A 1 98  ? -36.012 -14.189 -16.735 1.00 28.39 ? 98  LEU A CB  1 
ATOM   587  C  CG  . LEU A 1 98  ? -35.123 -15.134 -15.933 1.00 27.86 ? 98  LEU A CG  1 
ATOM   588  C  CD1 . LEU A 1 98  ? -34.674 -16.264 -16.846 1.00 28.26 ? 98  LEU A CD1 1 
ATOM   589  C  CD2 . LEU A 1 98  ? -33.928 -14.386 -15.367 1.00 24.67 ? 98  LEU A CD2 1 
ATOM   590  N  N   . LYS A 1 99  ? -38.751 -14.586 -15.684 1.00 31.67 ? 99  LYS A N   1 
ATOM   591  C  CA  . LYS A 1 99  ? -39.802 -15.222 -14.904 1.00 32.76 ? 99  LYS A CA  1 
ATOM   592  C  C   . LYS A 1 99  ? -40.071 -16.682 -15.248 1.00 34.00 ? 99  LYS A C   1 
ATOM   593  O  O   . LYS A 1 99  ? -39.720 -17.168 -16.324 1.00 33.52 ? 99  LYS A O   1 
ATOM   594  C  CB  . LYS A 1 99  ? -41.113 -14.452 -15.079 1.00 33.92 ? 99  LYS A CB  1 
ATOM   595  C  CG  . LYS A 1 99  ? -41.104 -13.009 -14.590 1.00 33.45 ? 99  LYS A CG  1 
ATOM   596  C  CD  . LYS A 1 99  ? -42.435 -12.355 -14.934 1.00 33.19 ? 99  LYS A CD  1 
ATOM   597  C  CE  . LYS A 1 99  ? -42.671 -11.084 -14.134 1.00 34.84 ? 99  LYS A CE  1 
ATOM   598  N  NZ  . LYS A 1 99  ? -43.898 -10.369 -14.581 1.00 33.39 ? 99  LYS A NZ  1 
ATOM   599  N  N   . ALA A 1 100 ? -40.712 -17.366 -14.308 1.00 34.74 ? 100 ALA A N   1 
ATOM   600  C  CA  . ALA A 1 100 ? -41.112 -18.756 -14.472 1.00 33.90 ? 100 ALA A CA  1 
ATOM   601  C  C   . ALA A 1 100 ? -42.624 -18.704 -14.316 1.00 34.14 ? 100 ALA A C   1 
ATOM   602  O  O   . ALA A 1 100 ? -43.132 -18.025 -13.422 1.00 34.15 ? 100 ALA A O   1 
ATOM   603  C  CB  . ALA A 1 100 ? -40.501 -19.620 -13.385 1.00 33.45 ? 100 ALA A CB  1 
ATOM   604  N  N   . PHE A 1 101 ? -43.348 -19.404 -15.179 1.00 35.48 ? 101 PHE A N   1 
ATOM   605  C  CA  . PHE A 1 101 ? -44.802 -19.389 -15.104 1.00 36.39 ? 101 PHE A CA  1 
ATOM   606  C  C   . PHE A 1 101 ? -45.386 -20.787 -14.938 1.00 39.65 ? 101 PHE A C   1 
ATOM   607  O  O   . PHE A 1 101 ? -44.848 -21.766 -15.469 1.00 40.22 ? 101 PHE A O   1 
ATOM   608  C  CB  . PHE A 1 101 ? -45.392 -18.756 -16.368 1.00 35.32 ? 101 PHE A CB  1 
ATOM   609  C  CG  . PHE A 1 101 ? -44.741 -17.459 -16.772 1.00 34.52 ? 101 PHE A CG  1 
ATOM   610  C  CD1 . PHE A 1 101 ? -43.551 -17.456 -17.493 1.00 33.84 ? 101 PHE A CD1 1 
ATOM   611  C  CD2 . PHE A 1 101 ? -45.328 -16.239 -16.444 1.00 33.99 ? 101 PHE A CD2 1 
ATOM   612  C  CE1 . PHE A 1 101 ? -42.956 -16.255 -17.888 1.00 35.70 ? 101 PHE A CE1 1 
ATOM   613  C  CE2 . PHE A 1 101 ? -44.745 -15.035 -16.830 1.00 33.39 ? 101 PHE A CE2 1 
ATOM   614  C  CZ  . PHE A 1 101 ? -43.558 -15.038 -17.554 1.00 34.78 ? 101 PHE A CZ  1 
ATOM   615  N  N   . ARG A 1 102 ? -46.479 -20.881 -14.185 1.00 42.18 ? 102 ARG A N   1 
ATOM   616  C  CA  . ARG A 1 102 ? -47.150 -22.162 -13.997 1.00 42.78 ? 102 ARG A CA  1 
ATOM   617  C  C   . ARG A 1 102 ? -48.218 -22.201 -15.085 1.00 43.60 ? 102 ARG A C   1 
ATOM   618  O  O   . ARG A 1 102 ? -49.170 -21.423 -15.051 1.00 43.94 ? 102 ARG A O   1 
ATOM   619  C  CB  . ARG A 1 102 ? -47.806 -22.253 -12.614 1.00 40.84 ? 102 ARG A CB  1 
ATOM   620  C  CG  . ARG A 1 102 ? -48.407 -23.631 -12.314 1.00 41.36 ? 102 ARG A CG  1 
ATOM   621  C  CD  . ARG A 1 102 ? -49.200 -23.643 -11.004 1.00 40.49 ? 102 ARG A CD  1 
ATOM   622  N  NE  . ARG A 1 102 ? -48.364 -23.392 -9.834  1.00 38.20 ? 102 ARG A NE  1 
ATOM   623  C  CZ  . ARG A 1 102 ? -47.478 -24.252 -9.346  1.00 39.26 ? 102 ARG A CZ  1 
ATOM   624  N  NH1 . ARG A 1 102 ? -47.300 -25.436 -9.919  1.00 39.71 ? 102 ARG A NH1 1 
ATOM   625  N  NH2 . ARG A 1 102 ? -46.763 -23.923 -8.281  1.00 40.97 ? 102 ARG A NH2 1 
ATOM   626  N  N   . GLY A 1 103 ? -48.048 -23.088 -16.059 1.00 44.63 ? 103 GLY A N   1 
ATOM   627  C  CA  . GLY A 1 103 ? -49.010 -23.174 -17.144 1.00 46.32 ? 103 GLY A CA  1 
ATOM   628  C  C   . GLY A 1 103 ? -50.394 -23.634 -16.725 1.00 47.03 ? 103 GLY A C   1 
ATOM   629  O  O   . GLY A 1 103 ? -50.605 -24.052 -15.588 1.00 46.83 ? 103 GLY A O   1 
ATOM   630  N  N   . VAL A 1 104 ? -51.347 -23.548 -17.647 1.00 48.19 ? 104 VAL A N   1 
ATOM   631  C  CA  . VAL A 1 104 ? -52.708 -23.984 -17.369 1.00 49.30 ? 104 VAL A CA  1 
ATOM   632  C  C   . VAL A 1 104 ? -52.723 -25.510 -17.318 1.00 49.74 ? 104 VAL A C   1 
ATOM   633  O  O   . VAL A 1 104 ? -53.781 -26.133 -17.218 1.00 51.21 ? 104 VAL A O   1 
ATOM   634  C  CB  . VAL A 1 104 ? -53.693 -23.496 -18.453 1.00 48.70 ? 104 VAL A CB  1 
ATOM   635  C  CG1 . VAL A 1 104 ? -53.888 -21.988 -18.342 1.00 48.33 ? 104 VAL A CG1 1 
ATOM   636  C  CG2 . VAL A 1 104 ? -53.161 -23.859 -19.832 1.00 49.19 ? 104 VAL A CG2 1 
ATOM   637  N  N   . ASP A 1 105 ? -51.535 -26.102 -17.396 1.00 49.85 ? 105 ASP A N   1 
ATOM   638  C  CA  . ASP A 1 105 ? -51.375 -27.552 -17.334 1.00 50.93 ? 105 ASP A CA  1 
ATOM   639  C  C   . ASP A 1 105 ? -50.546 -27.884 -16.097 1.00 50.24 ? 105 ASP A C   1 
ATOM   640  O  O   . ASP A 1 105 ? -50.165 -29.033 -15.869 1.00 49.47 ? 105 ASP A O   1 
ATOM   641  C  CB  . ASP A 1 105 ? -50.668 -28.065 -18.590 1.00 52.02 ? 105 ASP A CB  1 
ATOM   642  C  CG  . ASP A 1 105 ? -49.449 -27.241 -18.944 1.00 54.85 ? 105 ASP A CG  1 
ATOM   643  O  OD1 . ASP A 1 105 ? -48.559 -27.094 -18.083 1.00 55.04 ? 105 ASP A OD1 1 
ATOM   644  O  OD2 . ASP A 1 105 ? -49.384 -26.735 -20.084 1.00 56.69 ? 105 ASP A OD2 1 
ATOM   645  N  N   . ASN A 1 106 ? -50.277 -26.851 -15.306 1.00 50.19 ? 106 ASN A N   1 
ATOM   646  C  CA  . ASN A 1 106 ? -49.507 -26.961 -14.075 1.00 50.32 ? 106 ASN A CA  1 
ATOM   647  C  C   . ASN A 1 106 ? -48.023 -27.194 -14.315 1.00 50.17 ? 106 ASN A C   1 
ATOM   648  O  O   . ASN A 1 106 ? -47.272 -27.418 -13.368 1.00 52.06 ? 106 ASN A O   1 
ATOM   649  C  CB  . ASN A 1 106 ? -50.045 -28.083 -13.186 1.00 50.39 ? 106 ASN A CB  1 
ATOM   650  C  CG  . ASN A 1 106 ? -49.580 -27.951 -11.748 1.00 49.98 ? 106 ASN A CG  1 
ATOM   651  O  OD1 . ASN A 1 106 ? -49.471 -28.939 -11.022 1.00 49.99 ? 106 ASN A OD1 1 
ATOM   652  N  ND2 . ASN A 1 106 ? -49.319 -26.721 -11.324 1.00 49.76 ? 106 ASN A ND2 1 
ATOM   653  N  N   . LYS A 1 107 ? -47.597 -27.159 -15.574 1.00 49.71 ? 107 LYS A N   1 
ATOM   654  C  CA  . LYS A 1 107 ? -46.182 -27.343 -15.884 1.00 49.42 ? 107 LYS A CA  1 
ATOM   655  C  C   . LYS A 1 107 ? -45.522 -25.968 -15.807 1.00 48.69 ? 107 LYS A C   1 
ATOM   656  O  O   . LYS A 1 107 ? -46.028 -24.994 -16.365 1.00 49.34 ? 107 LYS A O   1 
ATOM   657  C  CB  . LYS A 1 107 ? -46.003 -27.962 -17.279 1.00 50.83 ? 107 LYS A CB  1 
ATOM   658  C  CG  . LYS A 1 107 ? -46.746 -29.286 -17.453 1.00 52.63 ? 107 LYS A CG  1 
ATOM   659  C  CD  . LYS A 1 107 ? -46.495 -30.205 -16.252 1.00 55.42 ? 107 LYS A CD  1 
ATOM   660  C  CE  . LYS A 1 107 ? -47.555 -31.299 -16.133 1.00 56.89 ? 107 LYS A CE  1 
ATOM   661  N  NZ  . LYS A 1 107 ? -47.453 -32.043 -14.839 1.00 55.54 ? 107 LYS A NZ  1 
ATOM   662  N  N   . ILE A 1 108 ? -44.407 -25.890 -15.090 1.00 46.72 ? 108 ILE A N   1 
ATOM   663  C  CA  . ILE A 1 108 ? -43.692 -24.633 -14.914 1.00 44.06 ? 108 ILE A CA  1 
ATOM   664  C  C   . ILE A 1 108 ? -42.868 -24.301 -16.148 1.00 41.29 ? 108 ILE A C   1 
ATOM   665  O  O   . ILE A 1 108 ? -42.169 -25.154 -16.676 1.00 42.34 ? 108 ILE A O   1 
ATOM   666  C  CB  . ILE A 1 108 ? -42.784 -24.712 -13.671 1.00 44.14 ? 108 ILE A CB  1 
ATOM   667  C  CG1 . ILE A 1 108 ? -43.650 -24.971 -12.439 1.00 44.22 ? 108 ILE A CG1 1 
ATOM   668  C  CG2 . ILE A 1 108 ? -42.011 -23.419 -13.497 1.00 43.74 ? 108 ILE A CG2 1 
ATOM   669  C  CD1 . ILE A 1 108 ? -42.871 -25.161 -11.164 1.00 45.99 ? 108 ILE A CD1 1 
ATOM   670  N  N   . ARG A 1 109 ? -42.943 -23.057 -16.603 1.00 39.72 ? 109 ARG A N   1 
ATOM   671  C  CA  . ARG A 1 109 ? -42.210 -22.660 -17.797 1.00 39.57 ? 109 ARG A CA  1 
ATOM   672  C  C   . ARG A 1 109 ? -41.338 -21.421 -17.671 1.00 38.82 ? 109 ARG A C   1 
ATOM   673  O  O   . ARG A 1 109 ? -41.671 -20.488 -16.948 1.00 38.59 ? 109 ARG A O   1 
ATOM   674  C  CB  . ARG A 1 109 ? -43.186 -22.428 -18.955 1.00 41.09 ? 109 ARG A CB  1 
ATOM   675  C  CG  . ARG A 1 109 ? -43.973 -23.652 -19.366 1.00 42.85 ? 109 ARG A CG  1 
ATOM   676  C  CD  . ARG A 1 109 ? -44.788 -23.407 -20.630 1.00 43.99 ? 109 ARG A CD  1 
ATOM   677  N  NE  . ARG A 1 109 ? -45.477 -24.628 -21.034 1.00 43.62 ? 109 ARG A NE  1 
ATOM   678  C  CZ  . ARG A 1 109 ? -46.415 -25.223 -20.306 1.00 44.07 ? 109 ARG A CZ  1 
ATOM   679  N  NH1 . ARG A 1 109 ? -46.786 -24.702 -19.143 1.00 44.30 ? 109 ARG A NH1 1 
ATOM   680  N  NH2 . ARG A 1 109 ? -46.958 -26.358 -20.725 1.00 44.64 ? 109 ARG A NH2 1 
ATOM   681  N  N   . LEU A 1 110 ? -40.221 -21.427 -18.393 1.00 38.13 ? 110 LEU A N   1 
ATOM   682  C  CA  . LEU A 1 110 ? -39.313 -20.290 -18.447 1.00 36.64 ? 110 LEU A CA  1 
ATOM   683  C  C   . LEU A 1 110 ? -39.552 -19.690 -19.835 1.00 36.70 ? 110 LEU A C   1 
ATOM   684  O  O   . LEU A 1 110 ? -39.950 -20.408 -20.757 1.00 38.34 ? 110 LEU A O   1 
ATOM   685  C  CB  . LEU A 1 110 ? -37.862 -20.744 -18.294 1.00 36.45 ? 110 LEU A CB  1 
ATOM   686  C  CG  . LEU A 1 110 ? -37.419 -21.147 -16.886 1.00 37.46 ? 110 LEU A CG  1 
ATOM   687  C  CD1 . LEU A 1 110 ? -35.974 -21.609 -16.908 1.00 37.36 ? 110 LEU A CD1 1 
ATOM   688  C  CD2 . LEU A 1 110 ? -37.571 -19.970 -15.949 1.00 36.98 ? 110 LEU A CD2 1 
ATOM   689  N  N   . PHE A 1 111 ? -39.308 -18.390 -19.988 1.00 36.23 ? 111 PHE A N   1 
ATOM   690  C  CA  . PHE A 1 111 ? -39.549 -17.695 -21.256 1.00 37.01 ? 111 PHE A CA  1 
ATOM   691  C  C   . PHE A 1 111 ? -38.307 -17.002 -21.815 1.00 37.81 ? 111 PHE A C   1 
ATOM   692  O  O   . PHE A 1 111 ? -37.775 -16.084 -21.196 1.00 39.40 ? 111 PHE A O   1 
ATOM   693  C  CB  . PHE A 1 111 ? -40.665 -16.662 -21.043 1.00 37.66 ? 111 PHE A CB  1 
ATOM   694  C  CG  . PHE A 1 111 ? -41.004 -15.842 -22.267 1.00 38.22 ? 111 PHE A CG  1 
ATOM   695  C  CD1 . PHE A 1 111 ? -41.745 -16.391 -23.313 1.00 37.39 ? 111 PHE A CD1 1 
ATOM   696  C  CD2 . PHE A 1 111 ? -40.603 -14.509 -22.357 1.00 35.41 ? 111 PHE A CD2 1 
ATOM   697  C  CE1 . PHE A 1 111 ? -42.082 -15.628 -24.429 1.00 36.30 ? 111 PHE A CE1 1 
ATOM   698  C  CE2 . PHE A 1 111 ? -40.932 -13.736 -23.464 1.00 34.18 ? 111 PHE A CE2 1 
ATOM   699  C  CZ  . PHE A 1 111 ? -41.675 -14.296 -24.505 1.00 38.32 ? 111 PHE A CZ  1 
ATOM   700  N  N   . GLN A 1 112 ? -37.855 -17.441 -22.989 1.00 38.31 ? 112 GLN A N   1 
ATOM   701  C  CA  . GLN A 1 112 ? -36.677 -16.860 -23.641 1.00 37.96 ? 112 GLN A CA  1 
ATOM   702  C  C   . GLN A 1 112 ? -35.458 -16.743 -22.720 1.00 36.86 ? 112 GLN A C   1 
ATOM   703  O  O   . GLN A 1 112 ? -34.654 -15.827 -22.875 1.00 35.18 ? 112 GLN A O   1 
ATOM   704  C  CB  . GLN A 1 112 ? -37.005 -15.461 -24.175 1.00 37.02 ? 112 GLN A CB  1 
ATOM   705  C  CG  . GLN A 1 112 ? -37.980 -15.407 -25.336 1.00 36.46 ? 112 GLN A CG  1 
ATOM   706  C  CD  . GLN A 1 112 ? -37.340 -15.767 -26.661 1.00 38.58 ? 112 GLN A CD  1 
ATOM   707  O  OE1 . GLN A 1 112 ? -37.806 -15.339 -27.724 1.00 37.93 ? 112 GLN A OE1 1 
ATOM   708  N  NE2 . GLN A 1 112 ? -36.272 -16.563 -26.611 1.00 38.79 ? 112 GLN A NE2 1 
ATOM   709  N  N   . PRO A 1 113 ? -35.286 -17.684 -21.777 1.00 36.56 ? 113 PRO A N   1 
ATOM   710  C  CA  . PRO A 1 113 ? -34.150 -17.627 -20.854 1.00 36.30 ? 113 PRO A CA  1 
ATOM   711  C  C   . PRO A 1 113 ? -32.807 -17.382 -21.535 1.00 36.20 ? 113 PRO A C   1 
ATOM   712  O  O   . PRO A 1 113 ? -32.035 -16.521 -21.107 1.00 36.41 ? 113 PRO A O   1 
ATOM   713  C  CB  . PRO A 1 113 ? -34.194 -18.988 -20.161 1.00 36.87 ? 113 PRO A CB  1 
ATOM   714  C  CG  . PRO A 1 113 ? -35.618 -19.384 -20.258 1.00 38.66 ? 113 PRO A CG  1 
ATOM   715  C  CD  . PRO A 1 113 ? -35.970 -18.981 -21.660 1.00 37.48 ? 113 PRO A CD  1 
ATOM   716  N  N   . ASN A 1 114 ? -32.541 -18.144 -22.591 1.00 34.93 ? 114 ASN A N   1 
ATOM   717  C  CA  . ASN A 1 114 ? -31.292 -18.038 -23.333 1.00 35.84 ? 114 ASN A CA  1 
ATOM   718  C  C   . ASN A 1 114 ? -30.889 -16.619 -23.713 1.00 35.32 ? 114 ASN A C   1 
ATOM   719  O  O   . ASN A 1 114 ? -29.700 -16.317 -23.808 1.00 35.96 ? 114 ASN A O   1 
ATOM   720  C  CB  . ASN A 1 114 ? -31.366 -18.909 -24.580 1.00 39.38 ? 114 ASN A CB  1 
ATOM   721  C  CG  . ASN A 1 114 ? -31.542 -20.371 -24.239 1.00 45.11 ? 114 ASN A CG  1 
ATOM   722  O  OD1 . ASN A 1 114 ? -30.744 -20.946 -23.491 1.00 45.66 ? 114 ASN A OD1 1 
ATOM   723  N  ND2 . ASN A 1 114 ? -32.597 -20.983 -24.775 1.00 46.89 ? 114 ASN A ND2 1 
ATOM   724  N  N   . LEU A 1 115 ? -31.867 -15.748 -23.937 1.00 33.53 ? 115 LEU A N   1 
ATOM   725  C  CA  . LEU A 1 115 ? -31.555 -14.370 -24.281 1.00 34.30 ? 115 LEU A CA  1 
ATOM   726  C  C   . LEU A 1 115 ? -31.053 -13.639 -23.033 1.00 34.30 ? 115 LEU A C   1 
ATOM   727  O  O   . LEU A 1 115 ? -30.071 -12.904 -23.093 1.00 34.63 ? 115 LEU A O   1 
ATOM   728  C  CB  . LEU A 1 115 ? -32.788 -13.674 -24.856 1.00 34.49 ? 115 LEU A CB  1 
ATOM   729  C  CG  . LEU A 1 115 ? -33.272 -14.241 -26.196 1.00 34.38 ? 115 LEU A CG  1 
ATOM   730  C  CD1 . LEU A 1 115 ? -34.458 -13.432 -26.706 1.00 34.98 ? 115 LEU A CD1 1 
ATOM   731  C  CD2 . LEU A 1 115 ? -32.125 -14.207 -27.205 1.00 33.77 ? 115 LEU A CD2 1 
ATOM   732  N  N   . ASN A 1 116 ? -31.715 -13.863 -21.901 1.00 33.96 ? 116 ASN A N   1 
ATOM   733  C  CA  . ASN A 1 116 ? -31.311 -13.233 -20.647 1.00 32.68 ? 116 ASN A CA  1 
ATOM   734  C  C   . ASN A 1 116 ? -29.868 -13.616 -20.329 1.00 31.97 ? 116 ASN A C   1 
ATOM   735  O  O   . ASN A 1 116 ? -29.077 -12.785 -19.877 1.00 30.62 ? 116 ASN A O   1 
ATOM   736  C  CB  . ASN A 1 116 ? -32.221 -13.686 -19.503 1.00 34.32 ? 116 ASN A CB  1 
ATOM   737  C  CG  . ASN A 1 116 ? -33.617 -13.103 -19.594 1.00 35.14 ? 116 ASN A CG  1 
ATOM   738  O  OD1 . ASN A 1 116 ? -33.822 -11.904 -19.380 1.00 31.75 ? 116 ASN A OD1 1 
ATOM   739  N  ND2 . ASN A 1 116 ? -34.590 -13.951 -19.913 1.00 37.19 ? 116 ASN A ND2 1 
ATOM   740  N  N   . MET A 1 117 ? -29.532 -14.883 -20.563 1.00 30.17 ? 117 MET A N   1 
ATOM   741  C  CA  . MET A 1 117 ? -28.183 -15.365 -20.304 1.00 27.05 ? 117 MET A CA  1 
ATOM   742  C  C   . MET A 1 117 ? -27.185 -14.659 -21.224 1.00 26.73 ? 117 MET A C   1 
ATOM   743  O  O   . MET A 1 117 ? -26.084 -14.309 -20.796 1.00 23.22 ? 117 MET A O   1 
ATOM   744  C  CB  . MET A 1 117 ? -28.104 -16.878 -20.523 1.00 27.01 ? 117 MET A CB  1 
ATOM   745  C  CG  . MET A 1 117 ? -29.001 -17.708 -19.605 1.00 28.68 ? 117 MET A CG  1 
ATOM   746  S  SD  . MET A 1 117 ? -28.559 -17.656 -17.846 1.00 31.88 ? 117 MET A SD  1 
ATOM   747  C  CE  . MET A 1 117 ? -29.499 -16.226 -17.305 1.00 29.63 ? 117 MET A CE  1 
ATOM   748  N  N   . ASP A 1 118 ? -27.570 -14.452 -22.483 1.00 25.92 ? 118 ASP A N   1 
ATOM   749  C  CA  . ASP A 1 118 ? -26.695 -13.786 -23.444 1.00 26.78 ? 118 ASP A CA  1 
ATOM   750  C  C   . ASP A 1 118 ? -26.466 -12.324 -23.070 1.00 26.66 ? 118 ASP A C   1 
ATOM   751  O  O   . ASP A 1 118 ? -25.367 -11.799 -23.223 1.00 26.84 ? 118 ASP A O   1 
ATOM   752  C  CB  . ASP A 1 118 ? -27.284 -13.836 -24.859 1.00 26.87 ? 118 ASP A CB  1 
ATOM   753  C  CG  . ASP A 1 118 ? -27.450 -15.247 -25.371 1.00 28.36 ? 118 ASP A CG  1 
ATOM   754  O  OD1 . ASP A 1 118 ? -26.618 -16.110 -25.034 1.00 28.08 ? 118 ASP A OD1 1 
ATOM   755  O  OD2 . ASP A 1 118 ? -28.410 -15.490 -26.126 1.00 32.87 ? 118 ASP A OD2 1 
ATOM   756  N  N   . ARG A 1 119 ? -27.512 -11.666 -22.591 1.00 26.26 ? 119 ARG A N   1 
ATOM   757  C  CA  . ARG A 1 119 ? -27.408 -10.268 -22.212 1.00 27.61 ? 119 ARG A CA  1 
ATOM   758  C  C   . ARG A 1 119 ? -26.563 -10.126 -20.951 1.00 26.50 ? 119 ARG A C   1 
ATOM   759  O  O   . ARG A 1 119 ? -25.716 -9.239  -20.856 1.00 26.26 ? 119 ARG A O   1 
ATOM   760  C  CB  . ARG A 1 119 ? -28.805 -9.691  -21.983 1.00 29.94 ? 119 ARG A CB  1 
ATOM   761  C  CG  . ARG A 1 119 ? -28.839 -8.198  -21.751 1.00 28.80 ? 119 ARG A CG  1 
ATOM   762  C  CD  . ARG A 1 119 ? -30.262 -7.709  -21.923 1.00 30.02 ? 119 ARG A CD  1 
ATOM   763  N  NE  . ARG A 1 119 ? -31.155 -8.126  -20.841 1.00 27.22 ? 119 ARG A NE  1 
ATOM   764  C  CZ  . ARG A 1 119 ? -32.481 -8.060  -20.920 1.00 24.63 ? 119 ARG A CZ  1 
ATOM   765  N  NH1 . ARG A 1 119 ? -33.049 -7.607  -22.026 1.00 20.24 ? 119 ARG A NH1 1 
ATOM   766  N  NH2 . ARG A 1 119 ? -33.241 -8.426  -19.896 1.00 23.37 ? 119 ARG A NH2 1 
ATOM   767  N  N   . MET A 1 120 ? -26.780 -11.019 -19.993 1.00 24.89 ? 120 MET A N   1 
ATOM   768  C  CA  . MET A 1 120 ? -26.030 -10.976 -18.744 1.00 26.24 ? 120 MET A CA  1 
ATOM   769  C  C   . MET A 1 120 ? -24.554 -11.174 -19.059 1.00 26.14 ? 120 MET A C   1 
ATOM   770  O  O   . MET A 1 120 ? -23.686 -10.511 -18.495 1.00 26.65 ? 120 MET A O   1 
ATOM   771  C  CB  . MET A 1 120 ? -26.516 -12.079 -17.811 1.00 26.14 ? 120 MET A CB  1 
ATOM   772  C  CG  . MET A 1 120 ? -26.306 -11.774 -16.359 1.00 25.66 ? 120 MET A CG  1 
ATOM   773  S  SD  . MET A 1 120 ? -26.778 -13.166 -15.363 1.00 29.74 ? 120 MET A SD  1 
ATOM   774  C  CE  . MET A 1 120 ? -25.290 -13.434 -14.447 1.00 27.37 ? 120 MET A CE  1 
ATOM   775  N  N   . TYR A 1 121 ? -24.288 -12.101 -19.972 1.00 26.77 ? 121 TYR A N   1 
ATOM   776  C  CA  . TYR A 1 121 ? -22.934 -12.410 -20.402 1.00 26.16 ? 121 TYR A CA  1 
ATOM   777  C  C   . TYR A 1 121 ? -22.294 -11.149 -20.975 1.00 23.70 ? 121 TYR A C   1 
ATOM   778  O  O   . TYR A 1 121 ? -21.276 -10.688 -20.475 1.00 21.07 ? 121 TYR A O   1 
ATOM   779  C  CB  . TYR A 1 121 ? -22.961 -13.496 -21.480 1.00 27.34 ? 121 TYR A CB  1 
ATOM   780  C  CG  . TYR A 1 121 ? -21.592 -13.977 -21.891 1.00 29.19 ? 121 TYR A CG  1 
ATOM   781  C  CD1 . TYR A 1 121 ? -21.086 -15.180 -21.411 1.00 29.47 ? 121 TYR A CD1 1 
ATOM   782  C  CD2 . TYR A 1 121 ? -20.786 -13.215 -22.740 1.00 31.16 ? 121 TYR A CD2 1 
ATOM   783  C  CE1 . TYR A 1 121 ? -19.815 -15.618 -21.760 1.00 30.92 ? 121 TYR A CE1 1 
ATOM   784  C  CE2 . TYR A 1 121 ? -19.505 -13.643 -23.094 1.00 30.93 ? 121 TYR A CE2 1 
ATOM   785  C  CZ  . TYR A 1 121 ? -19.031 -14.847 -22.594 1.00 31.43 ? 121 TYR A CZ  1 
ATOM   786  O  OH  . TYR A 1 121 ? -17.762 -15.273 -22.899 1.00 36.09 ? 121 TYR A OH  1 
ATOM   787  N  N   . ARG A 1 122 ? -22.892 -10.609 -22.035 1.00 22.86 ? 122 ARG A N   1 
ATOM   788  C  CA  . ARG A 1 122 ? -22.373 -9.393  -22.672 1.00 25.25 ? 122 ARG A CA  1 
ATOM   789  C  C   . ARG A 1 122 ? -22.155 -8.311  -21.620 1.00 23.66 ? 122 ARG A C   1 
ATOM   790  O  O   . ARG A 1 122 ? -21.214 -7.537  -21.710 1.00 24.67 ? 122 ARG A O   1 
ATOM   791  C  CB  . ARG A 1 122 ? -23.349 -8.885  -23.762 1.00 22.78 ? 122 ARG A CB  1 
ATOM   792  N  N   . SER A 1 123 ? -23.030 -8.275  -20.621 1.00 24.70 ? 123 SER A N   1 
ATOM   793  C  CA  . SER A 1 123 ? -22.933 -7.294  -19.548 1.00 26.94 ? 123 SER A CA  1 
ATOM   794  C  C   . SER A 1 123 ? -21.697 -7.496  -18.689 1.00 26.88 ? 123 SER A C   1 
ATOM   795  O  O   . SER A 1 123 ? -20.957 -6.552  -18.430 1.00 29.44 ? 123 SER A O   1 
ATOM   796  C  CB  . SER A 1 123 ? -24.178 -7.346  -18.655 1.00 26.04 ? 123 SER A CB  1 
ATOM   797  O  OG  . SER A 1 123 ? -25.268 -6.693  -19.272 1.00 27.53 ? 123 SER A OG  1 
ATOM   798  N  N   . ALA A 1 124 ? -21.482 -8.726  -18.237 1.00 28.12 ? 124 ALA A N   1 
ATOM   799  C  CA  . ALA A 1 124 ? -20.329 -9.031  -17.400 1.00 28.45 ? 124 ALA A CA  1 
ATOM   800  C  C   . ALA A 1 124 ? -19.062 -8.546  -18.082 1.00 29.64 ? 124 ALA A C   1 
ATOM   801  O  O   . ALA A 1 124 ? -18.211 -7.904  -17.460 1.00 30.93 ? 124 ALA A O   1 
ATOM   802  C  CB  . ALA A 1 124 ? -20.249 -10.527 -17.147 1.00 27.74 ? 124 ALA A CB  1 
ATOM   803  N  N   . VAL A 1 125 ? -18.947 -8.854  -19.371 1.00 29.50 ? 125 VAL A N   1 
ATOM   804  C  CA  . VAL A 1 125 ? -17.789 -8.451  -20.156 1.00 26.81 ? 125 VAL A CA  1 
ATOM   805  C  C   . VAL A 1 125 ? -17.663 -6.941  -20.196 1.00 25.07 ? 125 VAL A C   1 
ATOM   806  O  O   . VAL A 1 125 ? -16.568 -6.400  -20.104 1.00 25.34 ? 125 VAL A O   1 
ATOM   807  C  CB  . VAL A 1 125 ? -17.890 -8.955  -21.606 1.00 29.25 ? 125 VAL A CB  1 
ATOM   808  C  CG1 . VAL A 1 125 ? -16.765 -8.354  -22.444 1.00 29.09 ? 125 VAL A CG1 1 
ATOM   809  C  CG2 . VAL A 1 125 ? -17.827 -10.474 -21.634 1.00 27.31 ? 125 VAL A CG2 1 
ATOM   810  N  N   . ARG A 1 126 ? -18.786 -6.255  -20.338 1.00 24.09 ? 126 ARG A N   1 
ATOM   811  C  CA  . ARG A 1 126 ? -18.746 -4.802  -20.397 1.00 26.99 ? 126 ARG A CA  1 
ATOM   812  C  C   . ARG A 1 126 ? -18.466 -4.206  -19.019 1.00 26.75 ? 126 ARG A C   1 
ATOM   813  O  O   . ARG A 1 126 ? -18.120 -3.037  -18.898 1.00 27.86 ? 126 ARG A O   1 
ATOM   814  C  CB  . ARG A 1 126 ? -20.067 -4.260  -20.962 1.00 29.92 ? 126 ARG A CB  1 
ATOM   815  C  CG  . ARG A 1 126 ? -20.048 -2.772  -21.219 1.00 33.63 ? 126 ARG A CG  1 
ATOM   816  C  CD  . ARG A 1 126 ? -18.858 -2.401  -22.072 1.00 37.72 ? 126 ARG A CD  1 
ATOM   817  N  NE  . ARG A 1 126 ? -18.399 -1.048  -21.784 1.00 42.61 ? 126 ARG A NE  1 
ATOM   818  C  CZ  . ARG A 1 126 ? -19.080 0.051   -22.081 1.00 43.54 ? 126 ARG A CZ  1 
ATOM   819  N  NH1 . ARG A 1 126 ? -20.260 -0.041  -22.682 1.00 45.79 ? 126 ARG A NH1 1 
ATOM   820  N  NH2 . ARG A 1 126 ? -18.582 1.242   -21.770 1.00 42.78 ? 126 ARG A NH2 1 
ATOM   821  N  N   . ALA A 1 127 ? -18.607 -5.020  -17.977 1.00 27.03 ? 127 ALA A N   1 
ATOM   822  C  CA  . ALA A 1 127 ? -18.359 -4.555  -16.615 1.00 26.47 ? 127 ALA A CA  1 
ATOM   823  C  C   . ALA A 1 127 ? -16.955 -4.958  -16.148 1.00 26.66 ? 127 ALA A C   1 
ATOM   824  O  O   . ALA A 1 127 ? -16.466 -4.479  -15.120 1.00 27.20 ? 127 ALA A O   1 
ATOM   825  C  CB  . ALA A 1 127 ? -19.416 -5.132  -15.664 1.00 24.68 ? 127 ALA A CB  1 
ATOM   826  N  N   . THR A 1 128 ? -16.316 -5.818  -16.936 1.00 25.23 ? 128 THR A N   1 
ATOM   827  C  CA  . THR A 1 128 ? -14.986 -6.360  -16.656 1.00 24.24 ? 128 THR A CA  1 
ATOM   828  C  C   . THR A 1 128 ? -15.102 -7.422  -15.572 1.00 24.94 ? 128 THR A C   1 
ATOM   829  O  O   . THR A 1 128 ? -14.128 -7.751  -14.895 1.00 25.49 ? 128 THR A O   1 
ATOM   830  C  CB  . THR A 1 128 ? -13.955 -5.289  -16.214 1.00 24.90 ? 128 THR A CB  1 
ATOM   831  O  OG1 . THR A 1 128 ? -14.179 -4.918  -14.846 1.00 24.23 ? 128 THR A OG1 1 
ATOM   832  C  CG2 . THR A 1 128 ? -14.043 -4.069  -17.112 1.00 23.45 ? 128 THR A CG2 1 
ATOM   833  N  N   . LEU A 1 129 ? -16.316 -7.936  -15.397 1.00 23.96 ? 129 LEU A N   1 
ATOM   834  C  CA  . LEU A 1 129 ? -16.562 -9.004  -14.446 1.00 25.96 ? 129 LEU A CA  1 
ATOM   835  C  C   . LEU A 1 129 ? -16.302 -10.300 -15.242 1.00 27.19 ? 129 LEU A C   1 
ATOM   836  O  O   . LEU A 1 129 ? -16.440 -10.322 -16.463 1.00 28.21 ? 129 LEU A O   1 
ATOM   837  C  CB  . LEU A 1 129 ? -17.998 -8.923  -13.923 1.00 24.02 ? 129 LEU A CB  1 
ATOM   838  C  CG  . LEU A 1 129 ? -18.202 -7.839  -12.851 1.00 23.13 ? 129 LEU A CG  1 
ATOM   839  C  CD1 . LEU A 1 129 ? -19.685 -7.582  -12.583 1.00 16.49 ? 129 LEU A CD1 1 
ATOM   840  C  CD2 . LEU A 1 129 ? -17.503 -8.280  -11.576 1.00 21.97 ? 129 LEU A CD2 1 
ATOM   841  N  N   . PRO A 1 130 ? -15.924 -11.388 -14.560 1.00 27.26 ? 130 PRO A N   1 
ATOM   842  C  CA  . PRO A 1 130 ? -15.630 -12.679 -15.198 1.00 27.55 ? 130 PRO A CA  1 
ATOM   843  C  C   . PRO A 1 130 ? -16.732 -13.393 -15.989 1.00 28.21 ? 130 PRO A C   1 
ATOM   844  O  O   . PRO A 1 130 ? -17.884 -13.485 -15.557 1.00 26.61 ? 130 PRO A O   1 
ATOM   845  C  CB  . PRO A 1 130 ? -15.101 -13.516 -14.032 1.00 29.30 ? 130 PRO A CB  1 
ATOM   846  C  CG  . PRO A 1 130 ? -15.874 -12.994 -12.869 1.00 28.44 ? 130 PRO A CG  1 
ATOM   847  C  CD  . PRO A 1 130 ? -15.864 -11.498 -13.091 1.00 28.08 ? 130 PRO A CD  1 
ATOM   848  N  N   . VAL A 1 131 ? -16.363 -13.903 -17.159 1.00 29.17 ? 131 VAL A N   1 
ATOM   849  C  CA  . VAL A 1 131 ? -17.313 -14.620 -18.007 1.00 30.68 ? 131 VAL A CA  1 
ATOM   850  C  C   . VAL A 1 131 ? -17.644 -15.990 -17.406 1.00 31.20 ? 131 VAL A C   1 
ATOM   851  O  O   . VAL A 1 131 ? -16.932 -16.489 -16.541 1.00 30.70 ? 131 VAL A O   1 
ATOM   852  C  CB  . VAL A 1 131 ? -16.751 -14.831 -19.439 1.00 32.40 ? 131 VAL A CB  1 
ATOM   853  C  CG1 . VAL A 1 131 ? -16.318 -13.499 -20.038 1.00 31.29 ? 131 VAL A CG1 1 
ATOM   854  C  CG2 . VAL A 1 131 ? -15.590 -15.795 -19.405 1.00 32.02 ? 131 VAL A CG2 1 
ATOM   855  N  N   . PHE A 1 132 ? -18.725 -16.593 -17.880 1.00 32.24 ? 132 PHE A N   1 
ATOM   856  C  CA  . PHE A 1 132 ? -19.158 -17.897 -17.397 1.00 32.48 ? 132 PHE A CA  1 
ATOM   857  C  C   . PHE A 1 132 ? -19.874 -18.645 -18.529 1.00 32.69 ? 132 PHE A C   1 
ATOM   858  O  O   . PHE A 1 132 ? -20.182 -18.064 -19.570 1.00 31.10 ? 132 PHE A O   1 
ATOM   859  C  CB  . PHE A 1 132 ? -20.110 -17.709 -16.212 1.00 33.92 ? 132 PHE A CB  1 
ATOM   860  C  CG  . PHE A 1 132 ? -21.308 -16.857 -16.530 1.00 36.12 ? 132 PHE A CG  1 
ATOM   861  C  CD1 . PHE A 1 132 ? -22.351 -17.357 -17.312 1.00 36.37 ? 132 PHE A CD1 1 
ATOM   862  C  CD2 . PHE A 1 132 ? -21.370 -15.534 -16.096 1.00 35.72 ? 132 PHE A CD2 1 
ATOM   863  C  CE1 . PHE A 1 132 ? -23.439 -16.546 -17.660 1.00 37.55 ? 132 PHE A CE1 1 
ATOM   864  C  CE2 . PHE A 1 132 ? -22.451 -14.714 -16.438 1.00 35.94 ? 132 PHE A CE2 1 
ATOM   865  C  CZ  . PHE A 1 132 ? -23.487 -15.218 -17.221 1.00 36.20 ? 132 PHE A CZ  1 
ATOM   866  N  N   . ASP A 1 133 ? -20.129 -19.934 -18.328 1.00 32.33 ? 133 ASP A N   1 
ATOM   867  C  CA  . ASP A 1 133 ? -20.834 -20.723 -19.332 1.00 30.84 ? 133 ASP A CA  1 
ATOM   868  C  C   . ASP A 1 133 ? -22.323 -20.459 -19.117 1.00 30.24 ? 133 ASP A C   1 
ATOM   869  O  O   . ASP A 1 133 ? -22.882 -20.800 -18.067 1.00 28.97 ? 133 ASP A O   1 
ATOM   870  C  CB  . ASP A 1 133 ? -20.525 -22.217 -19.158 1.00 31.57 ? 133 ASP A CB  1 
ATOM   871  C  CG  . ASP A 1 133 ? -21.120 -23.069 -20.263 1.00 30.52 ? 133 ASP A CG  1 
ATOM   872  O  OD1 . ASP A 1 133 ? -20.340 -23.698 -21.006 1.00 30.63 ? 133 ASP A OD1 1 
ATOM   873  O  OD2 . ASP A 1 133 ? -22.364 -23.108 -20.397 1.00 31.69 ? 133 ASP A OD2 1 
ATOM   874  N  N   . LYS A 1 134 ? -22.956 -19.846 -20.113 1.00 30.51 ? 134 LYS A N   1 
ATOM   875  C  CA  . LYS A 1 134 ? -24.368 -19.502 -20.043 1.00 30.03 ? 134 LYS A CA  1 
ATOM   876  C  C   . LYS A 1 134 ? -25.300 -20.691 -19.834 1.00 32.33 ? 134 LYS A C   1 
ATOM   877  O  O   . LYS A 1 134 ? -26.352 -20.562 -19.190 1.00 29.77 ? 134 LYS A O   1 
ATOM   878  C  CB  . LYS A 1 134 ? -24.763 -18.733 -21.300 1.00 30.32 ? 134 LYS A CB  1 
ATOM   879  C  CG  . LYS A 1 134 ? -24.087 -17.370 -21.406 1.00 28.67 ? 134 LYS A CG  1 
ATOM   880  C  CD  . LYS A 1 134 ? -24.412 -16.704 -22.722 1.00 28.86 ? 134 LYS A CD  1 
ATOM   881  C  CE  . LYS A 1 134 ? -24.025 -17.602 -23.888 1.00 29.97 ? 134 LYS A CE  1 
ATOM   882  N  NZ  . LYS A 1 134 ? -24.285 -16.960 -25.199 1.00 30.04 ? 134 LYS A NZ  1 
ATOM   883  N  N   . GLU A 1 135 ? -24.913 -21.844 -20.372 1.00 33.33 ? 135 GLU A N   1 
ATOM   884  C  CA  . GLU A 1 135 ? -25.712 -23.059 -20.233 1.00 33.32 ? 135 GLU A CA  1 
ATOM   885  C  C   . GLU A 1 135 ? -25.691 -23.563 -18.795 1.00 31.12 ? 135 GLU A C   1 
ATOM   886  O  O   . GLU A 1 135 ? -26.707 -23.994 -18.260 1.00 31.55 ? 135 GLU A O   1 
ATOM   887  C  CB  . GLU A 1 135 ? -25.179 -24.159 -21.163 1.00 38.67 ? 135 GLU A CB  1 
ATOM   888  C  CG  . GLU A 1 135 ? -25.490 -23.960 -22.642 1.00 40.52 ? 135 GLU A CG  1 
ATOM   889  C  CD  . GLU A 1 135 ? -26.983 -23.868 -22.910 1.00 44.26 ? 135 GLU A CD  1 
ATOM   890  O  OE1 . GLU A 1 135 ? -27.748 -24.652 -22.304 1.00 45.15 ? 135 GLU A OE1 1 
ATOM   891  O  OE2 . GLU A 1 135 ? -27.393 -23.019 -23.734 1.00 46.56 ? 135 GLU A OE2 1 
ATOM   892  N  N   . GLU A 1 136 ? -24.521 -23.520 -18.176 1.00 30.19 ? 136 GLU A N   1 
ATOM   893  C  CA  . GLU A 1 136 ? -24.378 -23.968 -16.798 1.00 31.29 ? 136 GLU A CA  1 
ATOM   894  C  C   . GLU A 1 136 ? -25.203 -23.108 -15.845 1.00 31.00 ? 136 GLU A C   1 
ATOM   895  O  O   . GLU A 1 136 ? -25.850 -23.617 -14.925 1.00 30.20 ? 136 GLU A O   1 
ATOM   896  C  CB  . GLU A 1 136 ? -22.909 -23.920 -16.392 1.00 32.42 ? 136 GLU A CB  1 
ATOM   897  C  CG  . GLU A 1 136 ? -22.030 -24.801 -17.252 1.00 33.67 ? 136 GLU A CG  1 
ATOM   898  C  CD  . GLU A 1 136 ? -22.317 -26.275 -17.049 1.00 36.28 ? 136 GLU A CD  1 
ATOM   899  O  OE1 . GLU A 1 136 ? -21.879 -27.079 -17.901 1.00 37.63 ? 136 GLU A OE1 1 
ATOM   900  O  OE2 . GLU A 1 136 ? -22.967 -26.628 -16.037 1.00 33.39 ? 136 GLU A OE2 1 
ATOM   901  N  N   . LEU A 1 137 ? -25.178 -21.800 -16.072 1.00 30.59 ? 137 LEU A N   1 
ATOM   902  C  CA  . LEU A 1 137 ? -25.912 -20.882 -15.225 1.00 29.89 ? 137 LEU A CA  1 
ATOM   903  C  C   . LEU A 1 137 ? -27.401 -21.156 -15.339 1.00 31.39 ? 137 LEU A C   1 
ATOM   904  O  O   . LEU A 1 137 ? -28.118 -21.192 -14.332 1.00 31.73 ? 137 LEU A O   1 
ATOM   905  C  CB  . LEU A 1 137 ? -25.645 -19.439 -15.646 1.00 30.38 ? 137 LEU A CB  1 
ATOM   906  C  CG  . LEU A 1 137 ? -25.752 -18.367 -14.556 1.00 31.55 ? 137 LEU A CG  1 
ATOM   907  C  CD1 . LEU A 1 137 ? -25.858 -16.999 -15.211 1.00 32.40 ? 137 LEU A CD1 1 
ATOM   908  C  CD2 . LEU A 1 137 ? -26.963 -18.608 -13.677 1.00 30.30 ? 137 LEU A CD2 1 
ATOM   909  N  N   . LEU A 1 138 ? -27.862 -21.342 -16.574 1.00 31.04 ? 138 LEU A N   1 
ATOM   910  C  CA  . LEU A 1 138 ? -29.275 -21.580 -16.831 1.00 30.63 ? 138 LEU A CA  1 
ATOM   911  C  C   . LEU A 1 138 ? -29.749 -22.836 -16.139 1.00 32.25 ? 138 LEU A C   1 
ATOM   912  O  O   . LEU A 1 138 ? -30.835 -22.854 -15.560 1.00 33.48 ? 138 LEU A O   1 
ATOM   913  C  CB  . LEU A 1 138 ? -29.540 -21.693 -18.332 1.00 28.91 ? 138 LEU A CB  1 
ATOM   914  C  CG  . LEU A 1 138 ? -30.992 -21.982 -18.717 1.00 28.25 ? 138 LEU A CG  1 
ATOM   915  C  CD1 . LEU A 1 138 ? -31.900 -20.923 -18.123 1.00 27.43 ? 138 LEU A CD1 1 
ATOM   916  C  CD2 . LEU A 1 138 ? -31.125 -22.017 -20.230 1.00 26.61 ? 138 LEU A CD2 1 
ATOM   917  N  N   . GLU A 1 139 ? -28.935 -23.886 -16.199 1.00 34.11 ? 139 GLU A N   1 
ATOM   918  C  CA  . GLU A 1 139 ? -29.291 -25.147 -15.563 1.00 34.65 ? 139 GLU A CA  1 
ATOM   919  C  C   . GLU A 1 139 ? -29.313 -24.917 -14.054 1.00 34.94 ? 139 GLU A C   1 
ATOM   920  O  O   . GLU A 1 139 ? -30.231 -25.369 -13.357 1.00 34.77 ? 139 GLU A O   1 
ATOM   921  C  CB  . GLU A 1 139 ? -28.288 -26.248 -15.940 1.00 35.12 ? 139 GLU A CB  1 
ATOM   922  C  CG  . GLU A 1 139 ? -28.562 -27.590 -15.260 1.00 38.97 ? 139 GLU A CG  1 
ATOM   923  C  CD  . GLU A 1 139 ? -29.990 -28.078 -15.463 1.00 40.71 ? 139 GLU A CD  1 
ATOM   924  O  OE1 . GLU A 1 139 ? -30.445 -28.943 -14.685 1.00 39.98 ? 139 GLU A OE1 1 
ATOM   925  O  OE2 . GLU A 1 139 ? -30.663 -27.601 -16.401 1.00 45.97 ? 139 GLU A OE2 1 
ATOM   926  N  N   . CYS A 1 140 ? -28.311 -24.200 -13.555 1.00 32.84 ? 140 CYS A N   1 
ATOM   927  C  CA  . CYS A 1 140 ? -28.251 -23.893 -12.136 1.00 33.95 ? 140 CYS A CA  1 
ATOM   928  C  C   . CYS A 1 140 ? -29.499 -23.125 -11.712 1.00 34.10 ? 140 CYS A C   1 
ATOM   929  O  O   . CYS A 1 140 ? -29.936 -23.234 -10.570 1.00 35.98 ? 140 CYS A O   1 
ATOM   930  C  CB  . CYS A 1 140 ? -27.014 -23.059 -11.813 1.00 34.38 ? 140 CYS A CB  1 
ATOM   931  S  SG  . CYS A 1 140 ? -25.512 -24.015 -11.678 1.00 34.28 ? 140 CYS A SG  1 
ATOM   932  N  N   . ILE A 1 141 ? -30.073 -22.346 -12.626 1.00 32.97 ? 141 ILE A N   1 
ATOM   933  C  CA  . ILE A 1 141 ? -31.274 -21.588 -12.292 1.00 32.88 ? 141 ILE A CA  1 
ATOM   934  C  C   . ILE A 1 141 ? -32.506 -22.492 -12.310 1.00 34.08 ? 141 ILE A C   1 
ATOM   935  O  O   . ILE A 1 141 ? -33.408 -22.342 -11.483 1.00 33.72 ? 141 ILE A O   1 
ATOM   936  C  CB  . ILE A 1 141 ? -31.484 -20.397 -13.253 1.00 30.17 ? 141 ILE A CB  1 
ATOM   937  C  CG1 . ILE A 1 141 ? -30.346 -19.384 -13.063 1.00 29.69 ? 141 ILE A CG1 1 
ATOM   938  C  CG2 . ILE A 1 141 ? -32.842 -19.737 -12.977 1.00 27.55 ? 141 ILE A CG2 1 
ATOM   939  C  CD1 . ILE A 1 141 ? -30.434 -18.154 -13.947 1.00 25.40 ? 141 ILE A CD1 1 
ATOM   940  N  N   . GLN A 1 142 ? -32.536 -23.432 -13.249 1.00 33.77 ? 142 GLN A N   1 
ATOM   941  C  CA  . GLN A 1 142 ? -33.645 -24.374 -13.341 1.00 35.21 ? 142 GLN A CA  1 
ATOM   942  C  C   . GLN A 1 142 ? -33.683 -25.170 -12.033 1.00 35.74 ? 142 GLN A C   1 
ATOM   943  O  O   . GLN A 1 142 ? -34.758 -25.444 -11.488 1.00 35.87 ? 142 GLN A O   1 
ATOM   944  C  CB  . GLN A 1 142 ? -33.434 -25.348 -14.503 1.00 36.53 ? 142 GLN A CB  1 
ATOM   945  C  CG  . GLN A 1 142 ? -32.909 -24.731 -15.791 1.00 38.17 ? 142 GLN A CG  1 
ATOM   946  C  CD  . GLN A 1 142 ? -33.944 -24.702 -16.892 1.00 40.44 ? 142 GLN A CD  1 
ATOM   947  O  OE1 . GLN A 1 142 ? -33.612 -24.757 -18.079 1.00 41.51 ? 142 GLN A OE1 1 
ATOM   948  N  NE2 . GLN A 1 142 ? -35.209 -24.606 -16.507 1.00 43.07 ? 142 GLN A NE2 1 
ATOM   949  N  N   . GLN A 1 143 ? -32.500 -25.537 -11.538 1.00 36.06 ? 143 GLN A N   1 
ATOM   950  C  CA  . GLN A 1 143 ? -32.381 -26.300 -10.292 1.00 37.54 ? 143 GLN A CA  1 
ATOM   951  C  C   . GLN A 1 143 ? -32.880 -25.507 -9.090  1.00 35.77 ? 143 GLN A C   1 
ATOM   952  O  O   . GLN A 1 143 ? -33.486 -26.073 -8.183  1.00 35.41 ? 143 GLN A O   1 
ATOM   953  C  CB  . GLN A 1 143 ? -30.927 -26.698 -10.046 1.00 40.21 ? 143 GLN A CB  1 
ATOM   954  C  CG  . GLN A 1 143 ? -30.306 -27.524 -11.154 1.00 43.78 ? 143 GLN A CG  1 
ATOM   955  C  CD  . GLN A 1 143 ? -30.616 -28.998 -11.027 1.00 46.30 ? 143 GLN A CD  1 
ATOM   956  O  OE1 . GLN A 1 143 ? -31.782 -29.408 -11.045 1.00 45.57 ? 143 GLN A OE1 1 
ATOM   957  N  NE2 . GLN A 1 143 ? -29.566 -29.811 -10.894 1.00 46.09 ? 143 GLN A NE2 1 
ATOM   958  N  N   . LEU A 1 144 ? -32.619 -24.202 -9.083  1.00 34.10 ? 144 LEU A N   1 
ATOM   959  C  CA  . LEU A 1 144 ? -33.051 -23.334 -7.986  1.00 33.38 ? 144 LEU A CA  1 
ATOM   960  C  C   . LEU A 1 144 ? -34.580 -23.232 -8.005  1.00 33.66 ? 144 LEU A C   1 
ATOM   961  O  O   . LEU A 1 144 ? -35.245 -23.370 -6.970  1.00 32.73 ? 144 LEU A O   1 
ATOM   962  C  CB  . LEU A 1 144 ? -32.440 -21.932 -8.140  1.00 32.53 ? 144 LEU A CB  1 
ATOM   963  C  CG  . LEU A 1 144 ? -32.180 -21.052 -6.905  1.00 32.74 ? 144 LEU A CG  1 
ATOM   964  C  CD1 . LEU A 1 144 ? -32.503 -19.611 -7.256  1.00 28.94 ? 144 LEU A CD1 1 
ATOM   965  C  CD2 . LEU A 1 144 ? -33.011 -21.502 -5.704  1.00 31.61 ? 144 LEU A CD2 1 
ATOM   966  N  N   . VAL A 1 145 ? -35.139 -22.983 -9.185  1.00 33.17 ? 145 VAL A N   1 
ATOM   967  C  CA  . VAL A 1 145 ? -36.586 -22.882 -9.311  1.00 34.59 ? 145 VAL A CA  1 
ATOM   968  C  C   . VAL A 1 145 ? -37.211 -24.241 -8.993  1.00 34.83 ? 145 VAL A C   1 
ATOM   969  O  O   . VAL A 1 145 ? -38.167 -24.322 -8.224  1.00 35.47 ? 145 VAL A O   1 
ATOM   970  C  CB  . VAL A 1 145 ? -37.010 -22.456 -10.739 1.00 34.49 ? 145 VAL A CB  1 
ATOM   971  C  CG1 . VAL A 1 145 ? -38.529 -22.344 -10.817 1.00 32.88 ? 145 VAL A CG1 1 
ATOM   972  C  CG2 . VAL A 1 145 ? -36.362 -21.128 -11.103 1.00 34.19 ? 145 VAL A CG2 1 
ATOM   973  N  N   . LYS A 1 146 ? -36.659 -25.301 -9.580  1.00 35.03 ? 146 LYS A N   1 
ATOM   974  C  CA  . LYS A 1 146 ? -37.157 -26.657 -9.362  1.00 37.22 ? 146 LYS A CA  1 
ATOM   975  C  C   . LYS A 1 146 ? -37.354 -26.889 -7.869  1.00 36.52 ? 146 LYS A C   1 
ATOM   976  O  O   . LYS A 1 146 ? -38.406 -27.366 -7.434  1.00 37.18 ? 146 LYS A O   1 
ATOM   977  C  CB  . LYS A 1 146 ? -36.159 -27.677 -9.914  1.00 40.31 ? 146 LYS A CB  1 
ATOM   978  C  CG  . LYS A 1 146 ? -36.755 -29.032 -10.288 1.00 43.05 ? 146 LYS A CG  1 
ATOM   979  C  CD  . LYS A 1 146 ? -35.656 -30.010 -10.718 1.00 46.01 ? 146 LYS A CD  1 
ATOM   980  C  CE  . LYS A 1 146 ? -36.192 -31.164 -11.572 1.00 48.90 ? 146 LYS A CE  1 
ATOM   981  N  NZ  . LYS A 1 146 ? -36.531 -30.732 -12.971 1.00 51.69 ? 146 LYS A NZ  1 
ATOM   982  N  N   . LEU A 1 147 ? -36.338 -26.531 -7.090  1.00 35.79 ? 147 LEU A N   1 
ATOM   983  C  CA  . LEU A 1 147 ? -36.375 -26.686 -5.639  1.00 34.71 ? 147 LEU A CA  1 
ATOM   984  C  C   . LEU A 1 147 ? -37.524 -25.881 -5.045  1.00 34.91 ? 147 LEU A C   1 
ATOM   985  O  O   . LEU A 1 147 ? -38.308 -26.401 -4.254  1.00 35.51 ? 147 LEU A O   1 
ATOM   986  C  CB  . LEU A 1 147 ? -35.061 -26.202 -5.013  1.00 33.75 ? 147 LEU A CB  1 
ATOM   987  C  CG  . LEU A 1 147 ? -34.279 -27.057 -4.005  1.00 36.22 ? 147 LEU A CG  1 
ATOM   988  C  CD1 . LEU A 1 147 ? -33.693 -26.120 -2.945  1.00 32.42 ? 147 LEU A CD1 1 
ATOM   989  C  CD2 . LEU A 1 147 ? -35.173 -28.117 -3.342  1.00 34.72 ? 147 LEU A CD2 1 
ATOM   990  N  N   . ASP A 1 148 ? -37.619 -24.610 -5.435  1.00 36.11 ? 148 ASP A N   1 
ATOM   991  C  CA  . ASP A 1 148 ? -38.659 -23.715 -4.927  1.00 37.08 ? 148 ASP A CA  1 
ATOM   992  C  C   . ASP A 1 148 ? -39.861 -23.535 -5.855  1.00 37.89 ? 148 ASP A C   1 
ATOM   993  O  O   . ASP A 1 148 ? -40.463 -22.456 -5.881  1.00 39.89 ? 148 ASP A O   1 
ATOM   994  C  CB  . ASP A 1 148 ? -38.058 -22.336 -4.634  1.00 38.93 ? 148 ASP A CB  1 
ATOM   995  C  CG  . ASP A 1 148 ? -37.232 -22.313 -3.365  1.00 40.50 ? 148 ASP A CG  1 
ATOM   996  O  OD1 . ASP A 1 148 ? -36.649 -21.252 -3.062  1.00 39.95 ? 148 ASP A OD1 1 
ATOM   997  O  OD2 . ASP A 1 148 ? -37.167 -23.350 -2.670  1.00 42.71 ? 148 ASP A OD2 1 
ATOM   998  N  N   . GLN A 1 149 ? -40.229 -24.584 -6.587  1.00 36.51 ? 149 GLN A N   1 
ATOM   999  C  CA  . GLN A 1 149 ? -41.342 -24.501 -7.529  1.00 36.37 ? 149 GLN A CA  1 
ATOM   1000 C  C   . GLN A 1 149 ? -42.710 -24.205 -6.923  1.00 36.26 ? 149 GLN A C   1 
ATOM   1001 O  O   . GLN A 1 149 ? -43.571 -23.611 -7.579  1.00 34.48 ? 149 GLN A O   1 
ATOM   1002 C  CB  . GLN A 1 149 ? -41.426 -25.781 -8.368  1.00 38.12 ? 149 GLN A CB  1 
ATOM   1003 C  CG  . GLN A 1 149 ? -41.820 -27.043 -7.619  1.00 37.74 ? 149 GLN A CG  1 
ATOM   1004 C  CD  . GLN A 1 149 ? -42.014 -28.221 -8.567  1.00 38.95 ? 149 GLN A CD  1 
ATOM   1005 O  OE1 . GLN A 1 149 ? -43.010 -28.300 -9.295  1.00 37.89 ? 149 GLN A OE1 1 
ATOM   1006 N  NE2 . GLN A 1 149 ? -41.048 -29.128 -8.579  1.00 36.86 ? 149 GLN A NE2 1 
ATOM   1007 N  N   . GLU A 1 150 ? -42.926 -24.616 -5.679  1.00 36.66 ? 150 GLU A N   1 
ATOM   1008 C  CA  . GLU A 1 150 ? -44.209 -24.357 -5.047  1.00 36.48 ? 150 GLU A CA  1 
ATOM   1009 C  C   . GLU A 1 150 ? -44.452 -22.864 -4.839  1.00 36.13 ? 150 GLU A C   1 
ATOM   1010 O  O   . GLU A 1 150 ? -45.576 -22.449 -4.559  1.00 37.61 ? 150 GLU A O   1 
ATOM   1011 C  CB  . GLU A 1 150 ? -44.314 -25.116 -3.722  1.00 37.05 ? 150 GLU A CB  1 
ATOM   1012 C  CG  . GLU A 1 150 ? -44.658 -26.579 -3.921  1.00 38.57 ? 150 GLU A CG  1 
ATOM   1013 C  CD  . GLU A 1 150 ? -45.848 -26.759 -4.856  1.00 39.76 ? 150 GLU A CD  1 
ATOM   1014 O  OE1 . GLU A 1 150 ? -46.962 -26.316 -4.501  1.00 41.25 ? 150 GLU A OE1 1 
ATOM   1015 O  OE2 . GLU A 1 150 ? -45.666 -27.331 -5.952  1.00 40.60 ? 150 GLU A OE2 1 
ATOM   1016 N  N   . TRP A 1 151 ? -43.397 -22.063 -4.977  1.00 36.48 ? 151 TRP A N   1 
ATOM   1017 C  CA  . TRP A 1 151 ? -43.512 -20.613 -4.833  1.00 36.10 ? 151 TRP A CA  1 
ATOM   1018 C  C   . TRP A 1 151 ? -44.052 -20.025 -6.133  1.00 36.92 ? 151 TRP A C   1 
ATOM   1019 O  O   . TRP A 1 151 ? -44.658 -18.949 -6.129  1.00 37.18 ? 151 TRP A O   1 
ATOM   1020 C  CB  . TRP A 1 151 ? -42.159 -19.965 -4.518  1.00 34.50 ? 151 TRP A CB  1 
ATOM   1021 C  CG  . TRP A 1 151 ? -41.651 -20.253 -3.150  1.00 34.15 ? 151 TRP A CG  1 
ATOM   1022 C  CD1 . TRP A 1 151 ? -40.985 -21.369 -2.742  1.00 34.06 ? 151 TRP A CD1 1 
ATOM   1023 C  CD2 . TRP A 1 151 ? -41.804 -19.427 -1.990  1.00 33.94 ? 151 TRP A CD2 1 
ATOM   1024 N  NE1 . TRP A 1 151 ? -40.712 -21.293 -1.397  1.00 34.23 ? 151 TRP A NE1 1 
ATOM   1025 C  CE2 . TRP A 1 151 ? -41.203 -20.111 -0.909  1.00 34.47 ? 151 TRP A CE2 1 
ATOM   1026 C  CE3 . TRP A 1 151 ? -42.391 -18.174 -1.757  1.00 32.37 ? 151 TRP A CE3 1 
ATOM   1027 C  CZ2 . TRP A 1 151 ? -41.171 -19.585 0.390   1.00 35.30 ? 151 TRP A CZ2 1 
ATOM   1028 C  CZ3 . TRP A 1 151 ? -42.361 -17.651 -0.466  1.00 31.36 ? 151 TRP A CZ3 1 
ATOM   1029 C  CH2 . TRP A 1 151 ? -41.754 -18.357 0.590   1.00 33.54 ? 151 TRP A CH2 1 
ATOM   1030 N  N   . VAL A 1 152 ? -43.811 -20.722 -7.243  1.00 35.71 ? 152 VAL A N   1 
ATOM   1031 C  CA  . VAL A 1 152 ? -44.306 -20.269 -8.534  1.00 36.62 ? 152 VAL A CA  1 
ATOM   1032 C  C   . VAL A 1 152 ? -45.811 -20.227 -8.326  1.00 38.83 ? 152 VAL A C   1 
ATOM   1033 O  O   . VAL A 1 152 ? -46.476 -21.261 -8.308  1.00 39.29 ? 152 VAL A O   1 
ATOM   1034 C  CB  . VAL A 1 152 ? -43.948 -21.258 -9.663  1.00 36.52 ? 152 VAL A CB  1 
ATOM   1035 C  CG1 . VAL A 1 152 ? -44.501 -20.758 -10.994 1.00 35.20 ? 152 VAL A CG1 1 
ATOM   1036 C  CG2 . VAL A 1 152 ? -42.436 -21.415 -9.747  1.00 34.09 ? 152 VAL A CG2 1 
ATOM   1037 N  N   . PRO A 1 153 ? -46.361 -19.018 -8.153  1.00 40.62 ? 153 PRO A N   1 
ATOM   1038 C  CA  . PRO A 1 153 ? -47.780 -18.742 -7.921  1.00 40.95 ? 153 PRO A CA  1 
ATOM   1039 C  C   . PRO A 1 153 ? -48.782 -19.651 -8.622  1.00 42.00 ? 153 PRO A C   1 
ATOM   1040 O  O   . PRO A 1 153 ? -48.641 -19.965 -9.804  1.00 42.81 ? 153 PRO A O   1 
ATOM   1041 C  CB  . PRO A 1 153 ? -47.919 -17.288 -8.366  1.00 41.11 ? 153 PRO A CB  1 
ATOM   1042 C  CG  . PRO A 1 153 ? -46.584 -16.708 -8.009  1.00 40.66 ? 153 PRO A CG  1 
ATOM   1043 C  CD  . PRO A 1 153 ? -45.652 -17.775 -8.519  1.00 40.71 ? 153 PRO A CD  1 
ATOM   1044 N  N   . TYR A 1 154 ? -49.794 -20.077 -7.873  1.00 42.38 ? 154 TYR A N   1 
ATOM   1045 C  CA  . TYR A 1 154 ? -50.861 -20.900 -8.423  1.00 42.39 ? 154 TYR A CA  1 
ATOM   1046 C  C   . TYR A 1 154 ? -51.904 -19.888 -8.888  1.00 42.38 ? 154 TYR A C   1 
ATOM   1047 O  O   . TYR A 1 154 ? -53.024 -19.834 -8.383  1.00 43.32 ? 154 TYR A O   1 
ATOM   1048 C  CB  . TYR A 1 154 ? -51.440 -21.824 -7.345  1.00 41.31 ? 154 TYR A CB  1 
ATOM   1049 C  CG  . TYR A 1 154 ? -50.641 -23.093 -7.130  1.00 40.66 ? 154 TYR A CG  1 
ATOM   1050 C  CD1 . TYR A 1 154 ? -50.843 -24.214 -7.942  1.00 40.87 ? 154 TYR A CD1 1 
ATOM   1051 C  CD2 . TYR A 1 154 ? -49.666 -23.168 -6.135  1.00 39.54 ? 154 TYR A CD2 1 
ATOM   1052 C  CE1 . TYR A 1 154 ? -50.092 -25.378 -7.768  1.00 39.96 ? 154 TYR A CE1 1 
ATOM   1053 C  CE2 . TYR A 1 154 ? -48.910 -24.326 -5.952  1.00 41.08 ? 154 TYR A CE2 1 
ATOM   1054 C  CZ  . TYR A 1 154 ? -49.127 -25.424 -6.774  1.00 40.68 ? 154 TYR A CZ  1 
ATOM   1055 O  OH  . TYR A 1 154 ? -48.367 -26.554 -6.613  1.00 39.21 ? 154 TYR A OH  1 
ATOM   1056 N  N   . SER A 1 155 ? -51.500 -19.062 -9.841  1.00 42.38 ? 155 SER A N   1 
ATOM   1057 C  CA  . SER A 1 155 ? -52.358 -18.026 -10.396 1.00 43.36 ? 155 SER A CA  1 
ATOM   1058 C  C   . SER A 1 155 ? -52.018 -17.910 -11.870 1.00 44.11 ? 155 SER A C   1 
ATOM   1059 O  O   . SER A 1 155 ? -50.976 -18.397 -12.307 1.00 46.29 ? 155 SER A O   1 
ATOM   1060 C  CB  . SER A 1 155 ? -52.089 -16.693 -9.694  1.00 42.02 ? 155 SER A CB  1 
ATOM   1061 O  OG  . SER A 1 155 ? -52.759 -15.621 -10.332 1.00 42.63 ? 155 SER A OG  1 
ATOM   1062 N  N   . THR A 1 156 ? -52.892 -17.278 -12.642 1.00 42.87 ? 156 THR A N   1 
ATOM   1063 C  CA  . THR A 1 156 ? -52.628 -17.121 -14.059 1.00 43.22 ? 156 THR A CA  1 
ATOM   1064 C  C   . THR A 1 156 ? -52.228 -15.678 -14.340 1.00 43.12 ? 156 THR A C   1 
ATOM   1065 O  O   . THR A 1 156 ? -51.891 -15.317 -15.470 1.00 43.24 ? 156 THR A O   1 
ATOM   1066 C  CB  . THR A 1 156 ? -53.857 -17.481 -14.901 1.00 44.24 ? 156 THR A CB  1 
ATOM   1067 O  OG1 . THR A 1 156 ? -53.508 -17.419 -16.288 1.00 46.14 ? 156 THR A OG1 1 
ATOM   1068 C  CG2 . THR A 1 156 ? -55.000 -16.513 -14.624 1.00 44.85 ? 156 THR A CG2 1 
ATOM   1069 N  N   . SER A 1 157 ? -52.261 -14.861 -13.296 1.00 41.93 ? 157 SER A N   1 
ATOM   1070 C  CA  . SER A 1 157 ? -51.898 -13.456 -13.410 1.00 43.63 ? 157 SER A CA  1 
ATOM   1071 C  C   . SER A 1 157 ? -50.754 -13.155 -12.450 1.00 43.92 ? 157 SER A C   1 
ATOM   1072 O  O   . SER A 1 157 ? -50.552 -12.013 -12.041 1.00 44.64 ? 157 SER A O   1 
ATOM   1073 C  CB  . SER A 1 157 ? -53.099 -12.582 -13.066 1.00 42.79 ? 157 SER A CB  1 
ATOM   1074 O  OG  . SER A 1 157 ? -53.632 -12.975 -11.816 1.00 44.05 ? 157 SER A OG  1 
ATOM   1075 N  N   . ALA A 1 158 ? -50.011 -14.194 -12.086 1.00 43.51 ? 158 ALA A N   1 
ATOM   1076 C  CA  . ALA A 1 158 ? -48.888 -14.046 -11.178 1.00 42.13 ? 158 ALA A CA  1 
ATOM   1077 C  C   . ALA A 1 158 ? -47.799 -15.023 -11.574 1.00 42.15 ? 158 ALA A C   1 
ATOM   1078 O  O   . ALA A 1 158 ? -48.078 -16.071 -12.154 1.00 43.12 ? 158 ALA A O   1 
ATOM   1079 C  CB  . ALA A 1 158 ? -49.330 -14.305 -9.746  1.00 41.99 ? 158 ALA A CB  1 
ATOM   1080 N  N   . SER A 1 159 ? -46.557 -14.673 -11.254 1.00 41.45 ? 159 SER A N   1 
ATOM   1081 C  CA  . SER A 1 159 ? -45.412 -15.504 -11.586 1.00 39.31 ? 159 SER A CA  1 
ATOM   1082 C  C   . SER A 1 159 ? -44.301 -15.371 -10.545 1.00 38.17 ? 159 SER A C   1 
ATOM   1083 O  O   . SER A 1 159 ? -44.489 -14.764 -9.491  1.00 37.90 ? 159 SER A O   1 
ATOM   1084 C  CB  . SER A 1 159 ? -44.876 -15.113 -12.965 1.00 38.58 ? 159 SER A CB  1 
ATOM   1085 O  OG  . SER A 1 159 ? -44.562 -13.730 -13.016 1.00 38.62 ? 159 SER A OG  1 
ATOM   1086 N  N   . LEU A 1 160 ? -43.146 -15.951 -10.851 1.00 35.51 ? 160 LEU A N   1 
ATOM   1087 C  CA  . LEU A 1 160 ? -42.000 -15.900 -9.956  1.00 34.81 ? 160 LEU A CA  1 
ATOM   1088 C  C   . LEU A 1 160 ? -40.884 -15.138 -10.662 1.00 33.01 ? 160 LEU A C   1 
ATOM   1089 O  O   . LEU A 1 160 ? -40.404 -15.563 -11.719 1.00 34.03 ? 160 LEU A O   1 
ATOM   1090 C  CB  . LEU A 1 160 ? -41.531 -17.320 -9.610  1.00 33.43 ? 160 LEU A CB  1 
ATOM   1091 C  CG  . LEU A 1 160 ? -40.390 -17.414 -8.593  1.00 33.52 ? 160 LEU A CG  1 
ATOM   1092 C  CD1 . LEU A 1 160 ? -40.897 -17.007 -7.220  1.00 34.18 ? 160 LEU A CD1 1 
ATOM   1093 C  CD2 . LEU A 1 160 ? -39.846 -18.832 -8.545  1.00 35.79 ? 160 LEU A CD2 1 
ATOM   1094 N  N   . TYR A 1 161 ? -40.480 -14.009 -10.090 1.00 30.06 ? 161 TYR A N   1 
ATOM   1095 C  CA  . TYR A 1 161 ? -39.428 -13.201 -10.688 1.00 28.05 ? 161 TYR A CA  1 
ATOM   1096 C  C   . TYR A 1 161 ? -38.064 -13.773 -10.326 1.00 28.18 ? 161 TYR A C   1 
ATOM   1097 O  O   . TYR A 1 161 ? -37.768 -14.039 -9.160  1.00 27.06 ? 161 TYR A O   1 
ATOM   1098 C  CB  . TYR A 1 161 ? -39.539 -11.753 -10.212 1.00 27.48 ? 161 TYR A CB  1 
ATOM   1099 C  CG  . TYR A 1 161 ? -38.601 -10.783 -10.907 1.00 26.33 ? 161 TYR A CG  1 
ATOM   1100 C  CD1 . TYR A 1 161 ? -38.786 -10.432 -12.246 1.00 26.06 ? 161 TYR A CD1 1 
ATOM   1101 C  CD2 . TYR A 1 161 ? -37.554 -10.181 -10.212 1.00 23.06 ? 161 TYR A CD2 1 
ATOM   1102 C  CE1 . TYR A 1 161 ? -37.953 -9.496  -12.868 1.00 23.34 ? 161 TYR A CE1 1 
ATOM   1103 C  CE2 . TYR A 1 161 ? -36.717 -9.246  -10.824 1.00 23.55 ? 161 TYR A CE2 1 
ATOM   1104 C  CZ  . TYR A 1 161 ? -36.924 -8.903  -12.147 1.00 24.36 ? 161 TYR A CZ  1 
ATOM   1105 O  OH  . TYR A 1 161 ? -36.130 -7.932  -12.730 1.00 26.06 ? 161 TYR A OH  1 
ATOM   1106 N  N   . ILE A 1 162 ? -37.238 -13.969 -11.345 1.00 29.68 ? 162 ILE A N   1 
ATOM   1107 C  CA  . ILE A 1 162 ? -35.904 -14.517 -11.167 1.00 28.23 ? 162 ILE A CA  1 
ATOM   1108 C  C   . ILE A 1 162 ? -34.898 -13.392 -11.344 1.00 28.54 ? 162 ILE A C   1 
ATOM   1109 O  O   . ILE A 1 162 ? -34.773 -12.827 -12.432 1.00 26.36 ? 162 ILE A O   1 
ATOM   1110 C  CB  . ILE A 1 162 ? -35.637 -15.622 -12.208 1.00 28.80 ? 162 ILE A CB  1 
ATOM   1111 C  CG1 . ILE A 1 162 ? -36.727 -16.696 -12.101 1.00 30.00 ? 162 ILE A CG1 1 
ATOM   1112 C  CG2 . ILE A 1 162 ? -34.276 -16.224 -11.982 1.00 27.59 ? 162 ILE A CG2 1 
ATOM   1113 C  CD1 . ILE A 1 162 ? -36.707 -17.722 -13.208 1.00 30.12 ? 162 ILE A CD1 1 
ATOM   1114 N  N   . ARG A 1 163 ? -34.189 -13.066 -10.268 1.00 28.32 ? 163 ARG A N   1 
ATOM   1115 C  CA  . ARG A 1 163 ? -33.208 -11.990 -10.315 1.00 27.38 ? 163 ARG A CA  1 
ATOM   1116 C  C   . ARG A 1 163 ? -31.762 -12.445 -10.199 1.00 26.77 ? 163 ARG A C   1 
ATOM   1117 O  O   . ARG A 1 163 ? -31.257 -12.629 -9.091  1.00 26.16 ? 163 ARG A O   1 
ATOM   1118 C  CB  . ARG A 1 163 ? -33.494 -10.959 -9.211  1.00 26.43 ? 163 ARG A CB  1 
ATOM   1119 C  CG  . ARG A 1 163 ? -32.384 -9.909  -8.996  1.00 24.72 ? 163 ARG A CG  1 
ATOM   1120 C  CD  . ARG A 1 163 ? -32.001 -9.156  -10.278 1.00 20.91 ? 163 ARG A CD  1 
ATOM   1121 N  NE  . ARG A 1 163 ? -33.088 -8.331  -10.811 1.00 23.35 ? 163 ARG A NE  1 
ATOM   1122 C  CZ  . ARG A 1 163 ? -33.442 -7.133  -10.345 1.00 25.43 ? 163 ARG A CZ  1 
ATOM   1123 N  NH1 . ARG A 1 163 ? -32.794 -6.586  -9.323  1.00 25.16 ? 163 ARG A NH1 1 
ATOM   1124 N  NH2 . ARG A 1 163 ? -34.458 -6.481  -10.895 1.00 25.36 ? 163 ARG A NH2 1 
ATOM   1125 N  N   . PRO A 1 164 ? -31.083 -12.647 -11.345 1.00 24.37 ? 164 PRO A N   1 
ATOM   1126 C  CA  . PRO A 1 164 ? -29.680 -13.071 -11.312 1.00 23.91 ? 164 PRO A CA  1 
ATOM   1127 C  C   . PRO A 1 164 ? -28.932 -11.774 -11.028 1.00 25.98 ? 164 PRO A C   1 
ATOM   1128 O  O   . PRO A 1 164 ? -29.328 -10.718 -11.520 1.00 25.52 ? 164 PRO A O   1 
ATOM   1129 C  CB  . PRO A 1 164 ? -29.419 -13.568 -12.739 1.00 23.11 ? 164 PRO A CB  1 
ATOM   1130 C  CG  . PRO A 1 164 ? -30.798 -13.830 -13.303 1.00 23.70 ? 164 PRO A CG  1 
ATOM   1131 C  CD  . PRO A 1 164 ? -31.604 -12.694 -12.720 1.00 23.42 ? 164 PRO A CD  1 
ATOM   1132 N  N   . THR A 1 165 ? -27.870 -11.845 -10.239 1.00 26.43 ? 165 THR A N   1 
ATOM   1133 C  CA  . THR A 1 165 ? -27.108 -10.656 -9.885  1.00 28.04 ? 165 THR A CA  1 
ATOM   1134 C  C   . THR A 1 165 ? -25.639 -11.024 -9.831  1.00 28.82 ? 165 THR A C   1 
ATOM   1135 O  O   . THR A 1 165 ? -25.264 -12.071 -9.293  1.00 31.18 ? 165 THR A O   1 
ATOM   1136 C  CB  . THR A 1 165 ? -27.556 -10.114 -8.526  1.00 28.45 ? 165 THR A CB  1 
ATOM   1137 O  OG1 . THR A 1 165 ? -28.984 -10.027 -8.511  1.00 31.05 ? 165 THR A OG1 1 
ATOM   1138 C  CG2 . THR A 1 165 ? -26.968 -8.734  -8.270  1.00 28.86 ? 165 THR A CG2 1 
ATOM   1139 N  N   . PHE A 1 166 ? -24.818 -10.145 -10.388 1.00 27.81 ? 166 PHE A N   1 
ATOM   1140 C  CA  . PHE A 1 166 ? -23.377 -10.342 -10.487 1.00 28.21 ? 166 PHE A CA  1 
ATOM   1141 C  C   . PHE A 1 166 ? -22.709 -9.087  -9.904  1.00 27.58 ? 166 PHE A C   1 
ATOM   1142 O  O   . PHE A 1 166 ? -22.889 -7.987  -10.431 1.00 27.19 ? 166 PHE A O   1 
ATOM   1143 C  CB  . PHE A 1 166 ? -23.037 -10.507 -11.974 1.00 27.51 ? 166 PHE A CB  1 
ATOM   1144 C  CG  . PHE A 1 166 ? -21.771 -11.260 -12.247 1.00 26.87 ? 166 PHE A CG  1 
ATOM   1145 C  CD1 . PHE A 1 166 ? -20.905 -11.618 -11.215 1.00 25.84 ? 166 PHE A CD1 1 
ATOM   1146 C  CD2 . PHE A 1 166 ? -21.420 -11.572 -13.561 1.00 24.80 ? 166 PHE A CD2 1 
ATOM   1147 C  CE1 . PHE A 1 166 ? -19.702 -12.272 -11.490 1.00 25.07 ? 166 PHE A CE1 1 
ATOM   1148 C  CE2 . PHE A 1 166 ? -20.222 -12.225 -13.846 1.00 23.45 ? 166 PHE A CE2 1 
ATOM   1149 C  CZ  . PHE A 1 166 ? -19.361 -12.574 -12.809 1.00 24.33 ? 166 PHE A CZ  1 
ATOM   1150 N  N   . ILE A 1 167 ? -21.946 -9.253  -8.824  1.00 26.85 ? 167 ILE A N   1 
ATOM   1151 C  CA  . ILE A 1 167 ? -21.305 -8.117  -8.165  1.00 24.79 ? 167 ILE A CA  1 
ATOM   1152 C  C   . ILE A 1 167 ? -19.841 -8.317  -7.829  1.00 25.02 ? 167 ILE A C   1 
ATOM   1153 O  O   . ILE A 1 167 ? -19.420 -9.427  -7.514  1.00 24.68 ? 167 ILE A O   1 
ATOM   1154 C  CB  . ILE A 1 167 ? -22.008 -7.767  -6.835  1.00 25.33 ? 167 ILE A CB  1 
ATOM   1155 C  CG1 . ILE A 1 167 ? -21.977 -8.978  -5.900  1.00 24.84 ? 167 ILE A CG1 1 
ATOM   1156 C  CG2 . ILE A 1 167 ? -23.436 -7.306  -7.085  1.00 22.95 ? 167 ILE A CG2 1 
ATOM   1157 C  CD1 . ILE A 1 167 ? -22.518 -8.679  -4.505  1.00 27.30 ? 167 ILE A CD1 1 
ATOM   1158 N  N   . GLY A 1 168 ? -19.079 -7.225  -7.873  1.00 24.79 ? 168 GLY A N   1 
ATOM   1159 C  CA  . GLY A 1 168 ? -17.663 -7.282  -7.545  1.00 25.62 ? 168 GLY A CA  1 
ATOM   1160 C  C   . GLY A 1 168 ? -17.417 -7.187  -6.045  1.00 26.42 ? 168 GLY A C   1 
ATOM   1161 O  O   . GLY A 1 168 ? -17.982 -6.335  -5.365  1.00 24.56 ? 168 GLY A O   1 
ATOM   1162 N  N   . THR A 1 169 ? -16.571 -8.066  -5.519  1.00 29.25 ? 169 THR A N   1 
ATOM   1163 C  CA  . THR A 1 169 ? -16.276 -8.061  -4.092  1.00 31.78 ? 169 THR A CA  1 
ATOM   1164 C  C   . THR A 1 169 ? -14.811 -7.774  -3.799  1.00 33.86 ? 169 THR A C   1 
ATOM   1165 O  O   . THR A 1 169 ? -14.255 -8.259  -2.818  1.00 35.60 ? 169 THR A O   1 
ATOM   1166 C  CB  . THR A 1 169 ? -16.685 -9.400  -3.425  1.00 30.74 ? 169 THR A CB  1 
ATOM   1167 O  OG1 . THR A 1 169 ? -16.297 -10.497 -4.261  1.00 30.86 ? 169 THR A OG1 1 
ATOM   1168 C  CG2 . THR A 1 169 ? -18.190 -9.443  -3.201  1.00 30.41 ? 169 THR A CG2 1 
ATOM   1169 N  N   . GLU A 1 170 ? -14.200 -6.965  -4.658  1.00 36.60 ? 170 GLU A N   1 
ATOM   1170 C  CA  . GLU A 1 170 ? -12.804 -6.567  -4.513  1.00 38.60 ? 170 GLU A CA  1 
ATOM   1171 C  C   . GLU A 1 170 ? -12.621 -5.778  -3.212  1.00 38.23 ? 170 GLU A C   1 
ATOM   1172 O  O   . GLU A 1 170 ? -13.088 -4.644  -3.092  1.00 37.86 ? 170 GLU A O   1 
ATOM   1173 C  CB  . GLU A 1 170 ? -12.387 -5.690  -5.704  1.00 40.29 ? 170 GLU A CB  1 
ATOM   1174 C  CG  . GLU A 1 170 ? -11.300 -6.295  -6.580  1.00 41.21 ? 170 GLU A CG  1 
ATOM   1175 C  CD  . GLU A 1 170 ? -9.963  -6.357  -5.887  1.00 40.91 ? 170 GLU A CD  1 
ATOM   1176 O  OE1 . GLU A 1 170 ? -9.934  -6.699  -4.690  1.00 41.52 ? 170 GLU A OE1 1 
ATOM   1177 O  OE2 . GLU A 1 170 ? -8.938  -6.071  -6.539  1.00 44.90 ? 170 GLU A OE2 1 
ATOM   1178 N  N   . PRO A 1 171 ? -11.929 -6.364  -2.224  1.00 36.48 ? 171 PRO A N   1 
ATOM   1179 C  CA  . PRO A 1 171 ? -11.727 -5.660  -0.962  1.00 36.42 ? 171 PRO A CA  1 
ATOM   1180 C  C   . PRO A 1 171 ? -10.689 -4.542  -1.045  1.00 36.99 ? 171 PRO A C   1 
ATOM   1181 O  O   . PRO A 1 171 ? -9.844  -4.415  -0.160  1.00 38.81 ? 171 PRO A O   1 
ATOM   1182 C  CB  . PRO A 1 171 ? -11.305 -6.782  -0.018  1.00 36.08 ? 171 PRO A CB  1 
ATOM   1183 C  CG  . PRO A 1 171 ? -10.518 -7.662  -0.907  1.00 33.99 ? 171 PRO A CG  1 
ATOM   1184 C  CD  . PRO A 1 171 ? -11.354 -7.719  -2.162  1.00 36.35 ? 171 PRO A CD  1 
ATOM   1185 N  N   . SER A 1 172 ? -10.744 -3.739  -2.104  1.00 36.43 ? 172 SER A N   1 
ATOM   1186 C  CA  . SER A 1 172 ? -9.791  -2.639  -2.255  1.00 35.83 ? 172 SER A CA  1 
ATOM   1187 C  C   . SER A 1 172 ? -10.432 -1.412  -2.916  1.00 33.61 ? 172 SER A C   1 
ATOM   1188 O  O   . SER A 1 172 ? -11.221 -1.526  -3.852  1.00 33.14 ? 172 SER A O   1 
ATOM   1189 C  CB  . SER A 1 172 ? -8.560  -3.098  -3.050  1.00 34.52 ? 172 SER A CB  1 
ATOM   1190 O  OG  . SER A 1 172 ? -8.797  -3.061  -4.446  1.00 39.92 ? 172 SER A OG  1 
ATOM   1191 N  N   . LEU A 1 173 ? -10.077 -0.236  -2.412  1.00 31.94 ? 173 LEU A N   1 
ATOM   1192 C  CA  . LEU A 1 173 ? -10.619 1.024   -2.899  1.00 30.09 ? 173 LEU A CA  1 
ATOM   1193 C  C   . LEU A 1 173 ? -10.151 1.484   -4.285  1.00 30.70 ? 173 LEU A C   1 
ATOM   1194 O  O   . LEU A 1 173 ? -10.660 2.474   -4.822  1.00 28.91 ? 173 LEU A O   1 
ATOM   1195 C  CB  . LEU A 1 173 ? -10.322 2.113   -1.871  1.00 28.34 ? 173 LEU A CB  1 
ATOM   1196 C  CG  . LEU A 1 173 ? -10.931 1.876   -0.494  1.00 26.72 ? 173 LEU A CG  1 
ATOM   1197 C  CD1 . LEU A 1 173 ? -10.348 2.858   0.485   1.00 25.64 ? 173 LEU A CD1 1 
ATOM   1198 C  CD2 . LEU A 1 173 ? -12.447 2.017   -0.571  1.00 28.15 ? 173 LEU A CD2 1 
ATOM   1199 N  N   . GLY A 1 174 ? -9.189  0.777   -4.865  1.00 30.35 ? 174 GLY A N   1 
ATOM   1200 C  CA  . GLY A 1 174 ? -8.699  1.166   -6.177  1.00 29.22 ? 174 GLY A CA  1 
ATOM   1201 C  C   . GLY A 1 174 ? -9.665  0.825   -7.298  1.00 29.94 ? 174 GLY A C   1 
ATOM   1202 O  O   . GLY A 1 174 ? -10.133 -0.306  -7.406  1.00 29.64 ? 174 GLY A O   1 
ATOM   1203 N  N   . VAL A 1 175 ? -9.982  1.803   -8.136  1.00 30.92 ? 175 VAL A N   1 
ATOM   1204 C  CA  . VAL A 1 175 ? -10.885 1.552   -9.246  1.00 32.95 ? 175 VAL A CA  1 
ATOM   1205 C  C   . VAL A 1 175 ? -10.127 0.656   -10.207 1.00 34.95 ? 175 VAL A C   1 
ATOM   1206 O  O   . VAL A 1 175 ? -9.235  1.121   -10.908 1.00 37.74 ? 175 VAL A O   1 
ATOM   1207 C  CB  . VAL A 1 175 ? -11.268 2.852   -9.967  1.00 33.95 ? 175 VAL A CB  1 
ATOM   1208 C  CG1 . VAL A 1 175 ? -12.313 2.567   -11.049 1.00 32.48 ? 175 VAL A CG1 1 
ATOM   1209 C  CG2 . VAL A 1 175 ? -11.798 3.854   -8.957  1.00 32.36 ? 175 VAL A CG2 1 
ATOM   1210 N  N   . LYS A 1 176 ? -10.480 -0.626  -10.231 1.00 35.69 ? 176 LYS A N   1 
ATOM   1211 C  CA  . LYS A 1 176 ? -9.812  -1.596  -11.093 1.00 36.63 ? 176 LYS A CA  1 
ATOM   1212 C  C   . LYS A 1 176 ? -10.656 -2.849  -11.308 1.00 35.55 ? 176 LYS A C   1 
ATOM   1213 O  O   . LYS A 1 176 ? -11.561 -3.146  -10.524 1.00 35.49 ? 176 LYS A O   1 
ATOM   1214 C  CB  . LYS A 1 176 ? -8.489  -2.018  -10.461 1.00 38.80 ? 176 LYS A CB  1 
ATOM   1215 C  CG  . LYS A 1 176 ? -8.666  -2.753  -9.129  1.00 41.29 ? 176 LYS A CG  1 
ATOM   1216 C  CD  . LYS A 1 176 ? -7.332  -2.967  -8.432  1.00 43.77 ? 176 LYS A CD  1 
ATOM   1217 C  CE  . LYS A 1 176 ? -7.524  -3.392  -6.984  1.00 46.77 ? 176 LYS A CE  1 
ATOM   1218 N  NZ  . LYS A 1 176 ? -6.259  -3.272  -6.191  1.00 47.04 ? 176 LYS A NZ  1 
ATOM   1219 N  N   . LYS A 1 177 ? -10.346 -3.582  -12.372 1.00 34.53 ? 177 LYS A N   1 
ATOM   1220 C  CA  . LYS A 1 177 ? -11.046 -4.825  -12.673 1.00 33.51 ? 177 LYS A CA  1 
ATOM   1221 C  C   . LYS A 1 177 ? -10.986 -5.685  -11.404 1.00 30.96 ? 177 LYS A C   1 
ATOM   1222 O  O   . LYS A 1 177 ? -9.913  -5.976  -10.884 1.00 30.86 ? 177 LYS A O   1 
ATOM   1223 C  CB  . LYS A 1 177 ? -10.361 -5.540  -13.835 1.00 32.16 ? 177 LYS A CB  1 
ATOM   1224 C  CG  . LYS A 1 177 ? -10.968 -6.882  -14.202 1.00 35.65 ? 177 LYS A CG  1 
ATOM   1225 C  CD  . LYS A 1 177 ? -10.253 -7.458  -15.420 1.00 38.78 ? 177 LYS A CD  1 
ATOM   1226 C  CE  . LYS A 1 177 ? -10.788 -8.823  -15.791 1.00 42.23 ? 177 LYS A CE  1 
ATOM   1227 N  NZ  . LYS A 1 177 ? -10.669 -9.782  -14.650 1.00 46.17 ? 177 LYS A NZ  1 
ATOM   1228 N  N   . PRO A 1 178 ? -12.148 -6.094  -10.892 1.00 28.82 ? 178 PRO A N   1 
ATOM   1229 C  CA  . PRO A 1 178 ? -12.209 -6.909  -9.680  1.00 27.90 ? 178 PRO A CA  1 
ATOM   1230 C  C   . PRO A 1 178 ? -11.512 -8.271  -9.772  1.00 27.85 ? 178 PRO A C   1 
ATOM   1231 O  O   . PRO A 1 178 ? -11.569 -8.951  -10.791 1.00 28.13 ? 178 PRO A O   1 
ATOM   1232 C  CB  . PRO A 1 178 ? -13.713 -7.019  -9.426  1.00 26.56 ? 178 PRO A CB  1 
ATOM   1233 C  CG  . PRO A 1 178 ? -14.257 -7.092  -10.820 1.00 28.30 ? 178 PRO A CG  1 
ATOM   1234 C  CD  . PRO A 1 178 ? -13.473 -6.002  -11.533 1.00 27.04 ? 178 PRO A CD  1 
ATOM   1235 N  N   . THR A 1 179 ? -10.851 -8.648  -8.684  1.00 27.77 ? 179 THR A N   1 
ATOM   1236 C  CA  . THR A 1 179 ? -10.141 -9.910  -8.585  1.00 27.29 ? 179 THR A CA  1 
ATOM   1237 C  C   . THR A 1 179 ? -10.992 -10.879 -7.764  1.00 29.62 ? 179 THR A C   1 
ATOM   1238 O  O   . THR A 1 179 ? -10.604 -12.021 -7.513  1.00 29.08 ? 179 THR A O   1 
ATOM   1239 C  CB  . THR A 1 179 ? -8.794  -9.705  -7.900  1.00 28.38 ? 179 THR A CB  1 
ATOM   1240 O  OG1 . THR A 1 179 ? -9.007  -9.230  -6.565  1.00 25.96 ? 179 THR A OG1 1 
ATOM   1241 C  CG2 . THR A 1 179 ? -7.969  -8.678  -8.667  1.00 25.06 ? 179 THR A CG2 1 
ATOM   1242 N  N   . LYS A 1 180 ? -12.158 -10.397 -7.343  1.00 29.77 ? 180 LYS A N   1 
ATOM   1243 C  CA  . LYS A 1 180 ? -13.112 -11.189 -6.575  1.00 30.40 ? 180 LYS A CA  1 
ATOM   1244 C  C   . LYS A 1 180 ? -14.525 -10.810 -6.999  1.00 29.31 ? 180 LYS A C   1 
ATOM   1245 O  O   . LYS A 1 180 ? -14.839 -9.630  -7.182  1.00 28.69 ? 180 LYS A O   1 
ATOM   1246 C  CB  . LYS A 1 180 ? -12.957 -10.948 -5.072  1.00 32.22 ? 180 LYS A CB  1 
ATOM   1247 C  CG  . LYS A 1 180 ? -12.097 -11.967 -4.344  1.00 35.51 ? 180 LYS A CG  1 
ATOM   1248 C  CD  . LYS A 1 180 ? -12.214 -11.787 -2.832  1.00 36.31 ? 180 LYS A CD  1 
ATOM   1249 C  CE  . LYS A 1 180 ? -13.667 -11.920 -2.375  1.00 39.42 ? 180 LYS A CE  1 
ATOM   1250 N  NZ  . LYS A 1 180 ? -13.881 -11.549 -0.947  1.00 41.54 ? 180 LYS A NZ  1 
ATOM   1251 N  N   . ALA A 1 181 ? -15.377 -11.812 -7.158  1.00 27.44 ? 181 ALA A N   1 
ATOM   1252 C  CA  . ALA A 1 181 ? -16.744 -11.555 -7.567  1.00 26.37 ? 181 ALA A CA  1 
ATOM   1253 C  C   . ALA A 1 181 ? -17.719 -12.506 -6.896  1.00 26.67 ? 181 ALA A C   1 
ATOM   1254 O  O   . ALA A 1 181 ? -17.329 -13.524 -6.312  1.00 26.78 ? 181 ALA A O   1 
ATOM   1255 C  CB  . ALA A 1 181 ? -16.865 -11.665 -9.086  1.00 26.49 ? 181 ALA A CB  1 
ATOM   1256 N  N   . LEU A 1 182 ? -18.996 -12.157 -6.985  1.00 25.50 ? 182 LEU A N   1 
ATOM   1257 C  CA  . LEU A 1 182 ? -20.054 -12.954 -6.403  1.00 26.32 ? 182 LEU A CA  1 
ATOM   1258 C  C   . LEU A 1 182 ? -21.279 -12.932 -7.321  1.00 27.13 ? 182 LEU A C   1 
ATOM   1259 O  O   . LEU A 1 182 ? -21.781 -11.866 -7.710  1.00 24.46 ? 182 LEU A O   1 
ATOM   1260 C  CB  . LEU A 1 182 ? -20.394 -12.417 -5.016  1.00 26.24 ? 182 LEU A CB  1 
ATOM   1261 C  CG  . LEU A 1 182 ? -21.362 -13.235 -4.164  1.00 28.04 ? 182 LEU A CG  1 
ATOM   1262 C  CD1 . LEU A 1 182 ? -22.760 -13.047 -4.668  1.00 28.94 ? 182 LEU A CD1 1 
ATOM   1263 C  CD2 . LEU A 1 182 ? -20.961 -14.704 -4.186  1.00 27.85 ? 182 LEU A CD2 1 
ATOM   1264 N  N   . LEU A 1 183 ? -21.734 -14.128 -7.679  1.00 27.08 ? 183 LEU A N   1 
ATOM   1265 C  CA  . LEU A 1 183 ? -22.887 -14.306 -8.554  1.00 26.09 ? 183 LEU A CA  1 
ATOM   1266 C  C   . LEU A 1 183 ? -23.953 -15.011 -7.740  1.00 26.30 ? 183 LEU A C   1 
ATOM   1267 O  O   . LEU A 1 183 ? -23.669 -16.013 -7.077  1.00 26.30 ? 183 LEU A O   1 
ATOM   1268 C  CB  . LEU A 1 183 ? -22.493 -15.173 -9.747  1.00 26.92 ? 183 LEU A CB  1 
ATOM   1269 C  CG  . LEU A 1 183 ? -23.443 -15.372 -10.927 1.00 31.02 ? 183 LEU A CG  1 
ATOM   1270 C  CD1 . LEU A 1 183 ? -24.714 -16.110 -10.511 1.00 30.72 ? 183 LEU A CD1 1 
ATOM   1271 C  CD2 . LEU A 1 183 ? -23.761 -14.018 -11.498 1.00 30.89 ? 183 LEU A CD2 1 
ATOM   1272 N  N   . PHE A 1 184 ? -25.175 -14.490 -7.772  1.00 26.51 ? 184 PHE A N   1 
ATOM   1273 C  CA  . PHE A 1 184 ? -26.258 -15.116 -7.027  1.00 24.29 ? 184 PHE A CA  1 
ATOM   1274 C  C   . PHE A 1 184 ? -27.602 -14.956 -7.724  1.00 24.99 ? 184 PHE A C   1 
ATOM   1275 O  O   . PHE A 1 184 ? -27.720 -14.218 -8.700  1.00 24.86 ? 184 PHE A O   1 
ATOM   1276 C  CB  . PHE A 1 184 ? -26.298 -14.561 -5.596  1.00 24.28 ? 184 PHE A CB  1 
ATOM   1277 C  CG  . PHE A 1 184 ? -26.667 -13.101 -5.500  1.00 25.18 ? 184 PHE A CG  1 
ATOM   1278 C  CD1 . PHE A 1 184 ? -27.972 -12.718 -5.229  1.00 24.99 ? 184 PHE A CD1 1 
ATOM   1279 C  CD2 . PHE A 1 184 ? -25.703 -12.115 -5.634  1.00 23.26 ? 184 PHE A CD2 1 
ATOM   1280 C  CE1 . PHE A 1 184 ? -28.311 -11.366 -5.087  1.00 27.40 ? 184 PHE A CE1 1 
ATOM   1281 C  CE2 . PHE A 1 184 ? -26.030 -10.767 -5.494  1.00 25.32 ? 184 PHE A CE2 1 
ATOM   1282 C  CZ  . PHE A 1 184 ? -27.336 -10.392 -5.219  1.00 24.56 ? 184 PHE A CZ  1 
ATOM   1283 N  N   . VAL A 1 185 ? -28.613 -15.675 -7.252  1.00 26.40 ? 185 VAL A N   1 
ATOM   1284 C  CA  . VAL A 1 185 ? -29.936 -15.574 -7.866  1.00 26.41 ? 185 VAL A CA  1 
ATOM   1285 C  C   . VAL A 1 185 ? -31.018 -15.614 -6.801  1.00 26.93 ? 185 VAL A C   1 
ATOM   1286 O  O   . VAL A 1 185 ? -31.048 -16.519 -5.964  1.00 25.52 ? 185 VAL A O   1 
ATOM   1287 C  CB  . VAL A 1 185 ? -30.200 -16.719 -8.888  1.00 24.32 ? 185 VAL A CB  1 
ATOM   1288 C  CG1 . VAL A 1 185 ? -31.467 -16.435 -9.654  1.00 25.52 ? 185 VAL A CG1 1 
ATOM   1289 C  CG2 . VAL A 1 185 ? -29.034 -16.860 -9.851  1.00 24.74 ? 185 VAL A CG2 1 
ATOM   1290 N  N   . LEU A 1 186 ? -31.894 -14.613 -6.837  1.00 27.11 ? 186 LEU A N   1 
ATOM   1291 C  CA  . LEU A 1 186 ? -32.999 -14.503 -5.890  1.00 25.75 ? 186 LEU A CA  1 
ATOM   1292 C  C   . LEU A 1 186 ? -34.315 -14.829 -6.577  1.00 25.01 ? 186 LEU A C   1 
ATOM   1293 O  O   . LEU A 1 186 ? -34.469 -14.624 -7.781  1.00 21.99 ? 186 LEU A O   1 
ATOM   1294 C  CB  . LEU A 1 186 ? -33.091 -13.082 -5.334  1.00 24.43 ? 186 LEU A CB  1 
ATOM   1295 C  CG  . LEU A 1 186 ? -31.845 -12.460 -4.722  1.00 25.81 ? 186 LEU A CG  1 
ATOM   1296 C  CD1 . LEU A 1 186 ? -32.183 -11.047 -4.248  1.00 25.16 ? 186 LEU A CD1 1 
ATOM   1297 C  CD2 . LEU A 1 186 ? -31.350 -13.317 -3.577  1.00 24.71 ? 186 LEU A CD2 1 
ATOM   1298 N  N   . LEU A 1 187 ? -35.267 -15.325 -5.797  1.00 27.38 ? 187 LEU A N   1 
ATOM   1299 C  CA  . LEU A 1 187 ? -36.582 -15.666 -6.317  1.00 27.24 ? 187 LEU A CA  1 
ATOM   1300 C  C   . LEU A 1 187 ? -37.640 -14.875 -5.564  1.00 27.24 ? 187 LEU A C   1 
ATOM   1301 O  O   . LEU A 1 187 ? -37.674 -14.873 -4.335  1.00 27.03 ? 187 LEU A O   1 
ATOM   1302 C  CB  . LEU A 1 187 ? -36.833 -17.159 -6.165  1.00 26.23 ? 187 LEU A CB  1 
ATOM   1303 C  CG  . LEU A 1 187 ? -35.785 -18.018 -6.873  1.00 28.61 ? 187 LEU A CG  1 
ATOM   1304 C  CD1 . LEU A 1 187 ? -36.145 -19.488 -6.714  1.00 29.90 ? 187 LEU A CD1 1 
ATOM   1305 C  CD2 . LEU A 1 187 ? -35.710 -17.633 -8.351  1.00 25.16 ? 187 LEU A CD2 1 
ATOM   1306 N  N   . SER A 1 188 ? -38.503 -14.200 -6.311  1.00 27.19 ? 188 SER A N   1 
ATOM   1307 C  CA  . SER A 1 188 ? -39.545 -13.398 -5.702  1.00 27.37 ? 188 SER A CA  1 
ATOM   1308 C  C   . SER A 1 188 ? -40.905 -13.564 -6.364  1.00 28.27 ? 188 SER A C   1 
ATOM   1309 O  O   . SER A 1 188 ? -41.118 -13.113 -7.487  1.00 29.10 ? 188 SER A O   1 
ATOM   1310 C  CB  . SER A 1 188 ? -39.150 -11.915 -5.735  1.00 26.20 ? 188 SER A CB  1 
ATOM   1311 O  OG  . SER A 1 188 ? -40.239 -11.092 -5.348  1.00 19.91 ? 188 SER A OG  1 
ATOM   1312 N  N   . PRO A 1 189 ? -41.846 -14.226 -5.679  1.00 30.13 ? 189 PRO A N   1 
ATOM   1313 C  CA  . PRO A 1 189 ? -43.149 -14.360 -6.333  1.00 32.34 ? 189 PRO A CA  1 
ATOM   1314 C  C   . PRO A 1 189 ? -43.731 -12.952 -6.510  1.00 33.97 ? 189 PRO A C   1 
ATOM   1315 O  O   . PRO A 1 189 ? -43.638 -12.116 -5.603  1.00 34.13 ? 189 PRO A O   1 
ATOM   1316 C  CB  . PRO A 1 189 ? -43.944 -15.202 -5.338  1.00 30.71 ? 189 PRO A CB  1 
ATOM   1317 C  CG  . PRO A 1 189 ? -43.350 -14.781 -4.001  1.00 29.52 ? 189 PRO A CG  1 
ATOM   1318 C  CD  . PRO A 1 189 ? -41.875 -14.775 -4.310  1.00 29.49 ? 189 PRO A CD  1 
ATOM   1319 N  N   . VAL A 1 190 ? -44.310 -12.687 -7.677  1.00 35.00 ? 190 VAL A N   1 
ATOM   1320 C  CA  . VAL A 1 190 ? -44.904 -11.384 -7.946  1.00 37.54 ? 190 VAL A CA  1 
ATOM   1321 C  C   . VAL A 1 190 ? -46.134 -11.457 -8.851  1.00 38.95 ? 190 VAL A C   1 
ATOM   1322 O  O   . VAL A 1 190 ? -46.408 -12.481 -9.482  1.00 37.44 ? 190 VAL A O   1 
ATOM   1323 C  CB  . VAL A 1 190 ? -43.893 -10.428 -8.625  1.00 38.01 ? 190 VAL A CB  1 
ATOM   1324 C  CG1 . VAL A 1 190 ? -42.606 -10.365 -7.816  1.00 37.49 ? 190 VAL A CG1 1 
ATOM   1325 C  CG2 . VAL A 1 190 ? -43.620 -10.886 -10.053 1.00 34.06 ? 190 VAL A CG2 1 
ATOM   1326 N  N   . GLY A 1 191 ? -46.867 -10.347 -8.893  1.00 40.96 ? 191 GLY A N   1 
ATOM   1327 C  CA  . GLY A 1 191 ? -48.045 -10.229 -9.735  1.00 42.17 ? 191 GLY A CA  1 
ATOM   1328 C  C   . GLY A 1 191 ? -47.712 -9.107  -10.698 1.00 42.93 ? 191 GLY A C   1 
ATOM   1329 O  O   . GLY A 1 191 ? -46.988 -9.330  -11.670 1.00 43.74 ? 191 GLY A O   1 
ATOM   1330 N  N   . PRO A 1 192 ? -48.224 -7.889  -10.459 1.00 44.62 ? 192 PRO A N   1 
ATOM   1331 C  CA  . PRO A 1 192 ? -47.965 -6.719  -11.311 1.00 46.85 ? 192 PRO A CA  1 
ATOM   1332 C  C   . PRO A 1 192 ? -46.782 -5.885  -10.788 1.00 47.46 ? 192 PRO A C   1 
ATOM   1333 O  O   . PRO A 1 192 ? -46.320 -6.085  -9.661  1.00 45.70 ? 192 PRO A O   1 
ATOM   1334 C  CB  . PRO A 1 192 ? -49.273 -5.951  -11.234 1.00 46.24 ? 192 PRO A CB  1 
ATOM   1335 C  CG  . PRO A 1 192 ? -49.658 -6.160  -9.801  1.00 47.97 ? 192 PRO A CG  1 
ATOM   1336 C  CD  . PRO A 1 192 ? -49.376 -7.640  -9.572  1.00 45.60 ? 192 PRO A CD  1 
ATOM   1337 N  N   . TYR A 1 193 ? -46.307 -4.949  -11.606 1.00 49.30 ? 193 TYR A N   1 
ATOM   1338 C  CA  . TYR A 1 193 ? -45.186 -4.093  -11.223 1.00 51.62 ? 193 TYR A CA  1 
ATOM   1339 C  C   . TYR A 1 193 ? -45.647 -2.889  -10.396 1.00 54.36 ? 193 TYR A C   1 
ATOM   1340 O  O   . TYR A 1 193 ? -45.079 -2.603  -9.337  1.00 54.89 ? 193 TYR A O   1 
ATOM   1341 C  CB  . TYR A 1 193 ? -44.442 -3.601  -12.471 1.00 50.02 ? 193 TYR A CB  1 
ATOM   1342 C  CG  . TYR A 1 193 ? -43.086 -2.980  -12.193 1.00 46.75 ? 193 TYR A CG  1 
ATOM   1343 C  CD1 . TYR A 1 193 ? -42.057 -3.730  -11.615 1.00 44.84 ? 193 TYR A CD1 1 
ATOM   1344 C  CD2 . TYR A 1 193 ? -42.822 -1.650  -12.530 1.00 47.50 ? 193 TYR A CD2 1 
ATOM   1345 C  CE1 . TYR A 1 193 ? -40.797 -3.176  -11.378 1.00 43.71 ? 193 TYR A CE1 1 
ATOM   1346 C  CE2 . TYR A 1 193 ? -41.561 -1.080  -12.297 1.00 45.93 ? 193 TYR A CE2 1 
ATOM   1347 C  CZ  . TYR A 1 193 ? -40.551 -1.848  -11.720 1.00 45.79 ? 193 TYR A CZ  1 
ATOM   1348 O  OH  . TYR A 1 193 ? -39.308 -1.287  -11.475 1.00 43.92 ? 193 TYR A OH  1 
ATOM   1349 N  N   . PHE A 1 194 ? -46.673 -2.187  -10.876 1.00 56.80 ? 194 PHE A N   1 
ATOM   1350 C  CA  . PHE A 1 194 ? -47.187 -1.011  -10.170 1.00 59.14 ? 194 PHE A CA  1 
ATOM   1351 C  C   . PHE A 1 194 ? -48.197 -1.361  -9.077  1.00 59.90 ? 194 PHE A C   1 
ATOM   1352 O  O   . PHE A 1 194 ? -48.534 -2.556  -8.942  1.00 60.88 ? 194 PHE A O   1 
ATOM   1353 C  CB  . PHE A 1 194 ? -47.833 -0.033  -11.157 1.00 59.50 ? 194 PHE A CB  1 
ATOM   1354 C  CG  . PHE A 1 194 ? -46.884 0.505   -12.195 1.00 61.20 ? 194 PHE A CG  1 
ATOM   1355 C  CD1 . PHE A 1 194 ? -46.448 -0.299  -13.245 1.00 61.14 ? 194 PHE A CD1 1 
ATOM   1356 C  CD2 . PHE A 1 194 ? -46.433 1.820   -12.126 1.00 60.66 ? 194 PHE A CD2 1 
ATOM   1357 C  CE1 . PHE A 1 194 ? -45.578 0.198   -14.215 1.00 61.30 ? 194 PHE A CE1 1 
ATOM   1358 C  CE2 . PHE A 1 194 ? -45.562 2.327   -13.090 1.00 61.49 ? 194 PHE A CE2 1 
ATOM   1359 C  CZ  . PHE A 1 194 ? -45.134 1.514   -14.138 1.00 61.23 ? 194 PHE A CZ  1 
ATOM   1360 N  N   . PHE A 1 199 ? -55.485 -3.411  -18.146 1.00 49.38 ? 199 PHE A N   1 
ATOM   1361 C  CA  . PHE A 1 199 ? -54.306 -2.507  -17.983 1.00 48.84 ? 199 PHE A CA  1 
ATOM   1362 C  C   . PHE A 1 199 ? -54.540 -1.401  -16.968 1.00 49.23 ? 199 PHE A C   1 
ATOM   1363 O  O   . PHE A 1 199 ? -55.591 -1.320  -16.321 1.00 51.06 ? 199 PHE A O   1 
ATOM   1364 C  CB  . PHE A 1 199 ? -53.946 -1.839  -19.305 1.00 46.99 ? 199 PHE A CB  1 
ATOM   1365 C  CG  . PHE A 1 199 ? -53.434 -2.781  -20.348 1.00 44.94 ? 199 PHE A CG  1 
ATOM   1366 C  CD1 . PHE A 1 199 ? -52.241 -3.468  -20.157 1.00 43.60 ? 199 PHE A CD1 1 
ATOM   1367 C  CD2 . PHE A 1 199 ? -54.117 -2.937  -21.549 1.00 41.61 ? 199 PHE A CD2 1 
ATOM   1368 C  CE1 . PHE A 1 199 ? -51.728 -4.293  -21.149 1.00 42.69 ? 199 PHE A CE1 1 
ATOM   1369 C  CE2 . PHE A 1 199 ? -53.615 -3.756  -22.546 1.00 42.86 ? 199 PHE A CE2 1 
ATOM   1370 C  CZ  . PHE A 1 199 ? -52.414 -4.437  -22.347 1.00 42.06 ? 199 PHE A CZ  1 
ATOM   1371 N  N   . ASN A 1 200 ? -53.533 -0.546  -16.855 1.00 46.58 ? 200 ASN A N   1 
ATOM   1372 C  CA  . ASN A 1 200 ? -53.561 0.597   -15.963 1.00 43.76 ? 200 ASN A CA  1 
ATOM   1373 C  C   . ASN A 1 200 ? -52.612 1.614   -16.591 1.00 40.52 ? 200 ASN A C   1 
ATOM   1374 O  O   . ASN A 1 200 ? -51.436 1.676   -16.250 1.00 40.31 ? 200 ASN A O   1 
ATOM   1375 C  CB  . ASN A 1 200 ? -53.080 0.196   -14.571 1.00 45.15 ? 200 ASN A CB  1 
ATOM   1376 N  N   . PRO A 1 201 ? -53.118 2.418   -17.533 1.00 38.21 ? 201 PRO A N   1 
ATOM   1377 C  CA  . PRO A 1 201 ? -52.282 3.423   -18.196 1.00 37.68 ? 201 PRO A CA  1 
ATOM   1378 C  C   . PRO A 1 201 ? -51.468 4.266   -17.211 1.00 35.79 ? 201 PRO A C   1 
ATOM   1379 O  O   . PRO A 1 201 ? -51.844 4.427   -16.052 1.00 36.00 ? 201 PRO A O   1 
ATOM   1380 C  CB  . PRO A 1 201 ? -53.298 4.248   -18.990 1.00 36.64 ? 201 PRO A CB  1 
ATOM   1381 C  CG  . PRO A 1 201 ? -54.554 4.114   -18.184 1.00 37.45 ? 201 PRO A CG  1 
ATOM   1382 C  CD  . PRO A 1 201 ? -54.543 2.649   -17.824 1.00 38.53 ? 201 PRO A CD  1 
ATOM   1383 N  N   . VAL A 1 202 ? -50.340 4.784   -17.678 1.00 33.05 ? 202 VAL A N   1 
ATOM   1384 C  CA  . VAL A 1 202 ? -49.484 5.606   -16.839 1.00 31.39 ? 202 VAL A CA  1 
ATOM   1385 C  C   . VAL A 1 202 ? -49.296 6.958   -17.492 1.00 28.44 ? 202 VAL A C   1 
ATOM   1386 O  O   . VAL A 1 202 ? -49.517 7.113   -18.689 1.00 28.29 ? 202 VAL A O   1 
ATOM   1387 C  CB  . VAL A 1 202 ? -48.085 4.966   -16.640 1.00 31.38 ? 202 VAL A CB  1 
ATOM   1388 C  CG1 . VAL A 1 202 ? -48.205 3.672   -15.868 1.00 29.87 ? 202 VAL A CG1 1 
ATOM   1389 C  CG2 . VAL A 1 202 ? -47.421 4.716   -17.998 1.00 32.10 ? 202 VAL A CG2 1 
ATOM   1390 N  N   . SER A 1 203 ? -48.898 7.935   -16.692 1.00 29.32 ? 203 SER A N   1 
ATOM   1391 C  CA  . SER A 1 203 ? -48.645 9.284   -17.178 1.00 30.24 ? 203 SER A CA  1 
ATOM   1392 C  C   . SER A 1 203 ? -47.143 9.490   -17.051 1.00 29.02 ? 203 SER A C   1 
ATOM   1393 O  O   . SER A 1 203 ? -46.549 9.127   -16.034 1.00 28.02 ? 203 SER A O   1 
ATOM   1394 C  CB  . SER A 1 203 ? -49.404 10.305  -16.333 1.00 31.44 ? 203 SER A CB  1 
ATOM   1395 O  OG  . SER A 1 203 ? -49.114 11.619  -16.776 1.00 36.43 ? 203 SER A OG  1 
ATOM   1396 N  N   . LEU A 1 204 ? -46.529 10.072  -18.078 1.00 30.14 ? 204 LEU A N   1 
ATOM   1397 C  CA  . LEU A 1 204 ? -45.081 10.264  -18.089 1.00 29.58 ? 204 LEU A CA  1 
ATOM   1398 C  C   . LEU A 1 204 ? -44.593 11.680  -17.866 1.00 30.11 ? 204 LEU A C   1 
ATOM   1399 O  O   . LEU A 1 204 ? -45.211 12.651  -18.307 1.00 29.47 ? 204 LEU A O   1 
ATOM   1400 C  CB  . LEU A 1 204 ? -44.509 9.756   -19.410 1.00 27.55 ? 204 LEU A CB  1 
ATOM   1401 C  CG  . LEU A 1 204 ? -44.918 8.328   -19.740 1.00 29.16 ? 204 LEU A CG  1 
ATOM   1402 C  CD1 . LEU A 1 204 ? -44.555 7.998   -21.186 1.00 29.00 ? 204 LEU A CD1 1 
ATOM   1403 C  CD2 . LEU A 1 204 ? -44.243 7.389   -18.762 1.00 28.09 ? 204 LEU A CD2 1 
ATOM   1404 N  N   . TRP A 1 205 ? -43.458 11.776  -17.185 1.00 30.78 ? 205 TRP A N   1 
ATOM   1405 C  CA  . TRP A 1 205 ? -42.827 13.054  -16.894 1.00 32.58 ? 205 TRP A CA  1 
ATOM   1406 C  C   . TRP A 1 205 ? -41.710 13.225  -17.927 1.00 32.11 ? 205 TRP A C   1 
ATOM   1407 O  O   . TRP A 1 205 ? -40.799 12.399  -18.010 1.00 30.42 ? 205 TRP A O   1 
ATOM   1408 C  CB  . TRP A 1 205 ? -42.261 13.027  -15.470 1.00 34.49 ? 205 TRP A CB  1 
ATOM   1409 C  CG  . TRP A 1 205 ? -41.631 14.303  -15.024 1.00 36.96 ? 205 TRP A CG  1 
ATOM   1410 C  CD1 . TRP A 1 205 ? -40.336 14.477  -14.626 1.00 38.50 ? 205 TRP A CD1 1 
ATOM   1411 C  CD2 . TRP A 1 205 ? -42.269 15.580  -14.889 1.00 36.90 ? 205 TRP A CD2 1 
ATOM   1412 N  NE1 . TRP A 1 205 ? -40.129 15.784  -14.249 1.00 39.55 ? 205 TRP A NE1 1 
ATOM   1413 C  CE2 . TRP A 1 205 ? -41.298 16.482  -14.400 1.00 38.18 ? 205 TRP A CE2 1 
ATOM   1414 C  CE3 . TRP A 1 205 ? -43.567 16.050  -15.131 1.00 37.88 ? 205 TRP A CE3 1 
ATOM   1415 C  CZ2 . TRP A 1 205 ? -41.584 17.832  -14.147 1.00 40.55 ? 205 TRP A CZ2 1 
ATOM   1416 C  CZ3 . TRP A 1 205 ? -43.855 17.394  -14.879 1.00 38.79 ? 205 TRP A CZ3 1 
ATOM   1417 C  CH2 . TRP A 1 205 ? -42.864 18.269  -14.392 1.00 40.26 ? 205 TRP A CH2 1 
ATOM   1418 N  N   . ALA A 1 206 ? -41.787 14.283  -18.728 1.00 30.49 ? 206 ALA A N   1 
ATOM   1419 C  CA  . ALA A 1 206 ? -40.775 14.503  -19.746 1.00 31.42 ? 206 ALA A CA  1 
ATOM   1420 C  C   . ALA A 1 206 ? -39.941 15.762  -19.521 1.00 32.15 ? 206 ALA A C   1 
ATOM   1421 O  O   . ALA A 1 206 ? -40.292 16.844  -19.980 1.00 32.62 ? 206 ALA A O   1 
ATOM   1422 C  CB  . ALA A 1 206 ? -41.427 14.541  -21.114 1.00 30.28 ? 206 ALA A CB  1 
ATOM   1423 N  N   . ASN A 1 207 ? -38.826 15.596  -18.815 1.00 33.63 ? 207 ASN A N   1 
ATOM   1424 C  CA  . ASN A 1 207 ? -37.907 16.689  -18.512 1.00 35.06 ? 207 ASN A CA  1 
ATOM   1425 C  C   . ASN A 1 207 ? -36.554 16.399  -19.161 1.00 34.64 ? 207 ASN A C   1 
ATOM   1426 O  O   . ASN A 1 207 ? -35.779 15.583  -18.661 1.00 35.58 ? 207 ASN A O   1 
ATOM   1427 C  CB  . ASN A 1 207 ? -37.725 16.820  -16.996 1.00 36.22 ? 207 ASN A CB  1 
ATOM   1428 C  CG  . ASN A 1 207 ? -36.812 17.968  -16.613 1.00 35.00 ? 207 ASN A CG  1 
ATOM   1429 O  OD1 . ASN A 1 207 ? -36.175 18.590  -17.466 1.00 35.61 ? 207 ASN A OD1 1 
ATOM   1430 N  ND2 . ASN A 1 207 ? -36.737 18.249  -15.322 1.00 36.52 ? 207 ASN A ND2 1 
ATOM   1431 N  N   . PRO A 1 208 ? -36.243 17.089  -20.267 1.00 33.56 ? 208 PRO A N   1 
ATOM   1432 C  CA  . PRO A 1 208 ? -34.980 16.900  -20.992 1.00 32.54 ? 208 PRO A CA  1 
ATOM   1433 C  C   . PRO A 1 208 ? -33.697 17.209  -20.214 1.00 31.38 ? 208 PRO A C   1 
ATOM   1434 O  O   . PRO A 1 208 ? -32.601 16.954  -20.710 1.00 30.55 ? 208 PRO A O   1 
ATOM   1435 C  CB  . PRO A 1 208 ? -35.149 17.804  -22.217 1.00 32.74 ? 208 PRO A CB  1 
ATOM   1436 C  CG  . PRO A 1 208 ? -35.970 18.945  -21.661 1.00 32.86 ? 208 PRO A CG  1 
ATOM   1437 C  CD  . PRO A 1 208 ? -37.007 18.227  -20.818 1.00 33.39 ? 208 PRO A CD  1 
ATOM   1438 N  N   . LYS A 1 209 ? -33.820 17.759  -19.009 1.00 30.73 ? 209 LYS A N   1 
ATOM   1439 C  CA  . LYS A 1 209 ? -32.635 18.076  -18.213 1.00 31.27 ? 209 LYS A CA  1 
ATOM   1440 C  C   . LYS A 1 209 ? -31.976 16.811  -17.672 1.00 31.04 ? 209 LYS A C   1 
ATOM   1441 O  O   . LYS A 1 209 ? -30.831 16.850  -17.231 1.00 30.35 ? 209 LYS A O   1 
ATOM   1442 C  CB  . LYS A 1 209 ? -32.999 19.020  -17.053 1.00 31.35 ? 209 LYS A CB  1 
ATOM   1443 N  N   . TYR A 1 210 ? -32.701 15.693  -17.704 1.00 31.97 ? 210 TYR A N   1 
ATOM   1444 C  CA  . TYR A 1 210 ? -32.177 14.416  -17.219 1.00 31.26 ? 210 TYR A CA  1 
ATOM   1445 C  C   . TYR A 1 210 ? -31.943 13.446  -18.367 1.00 31.10 ? 210 TYR A C   1 
ATOM   1446 O  O   . TYR A 1 210 ? -32.867 13.140  -19.121 1.00 30.98 ? 210 TYR A O   1 
ATOM   1447 C  CB  . TYR A 1 210 ? -33.150 13.786  -16.213 1.00 33.87 ? 210 TYR A CB  1 
ATOM   1448 C  CG  . TYR A 1 210 ? -33.389 14.641  -14.990 1.00 37.28 ? 210 TYR A CG  1 
ATOM   1449 C  CD1 . TYR A 1 210 ? -34.641 14.685  -14.374 1.00 38.08 ? 210 TYR A CD1 1 
ATOM   1450 C  CD2 . TYR A 1 210 ? -32.374 15.447  -14.478 1.00 39.29 ? 210 TYR A CD2 1 
ATOM   1451 C  CE1 . TYR A 1 210 ? -34.873 15.525  -13.285 1.00 39.71 ? 210 TYR A CE1 1 
ATOM   1452 C  CE2 . TYR A 1 210 ? -32.594 16.284  -13.395 1.00 40.02 ? 210 TYR A CE2 1 
ATOM   1453 C  CZ  . TYR A 1 210 ? -33.840 16.324  -12.805 1.00 39.70 ? 210 TYR A CZ  1 
ATOM   1454 O  OH  . TYR A 1 210 ? -34.046 17.190  -11.757 1.00 40.42 ? 210 TYR A OH  1 
ATOM   1455 N  N   . VAL A 1 211 ? -30.707 12.969  -18.503 1.00 30.37 ? 211 VAL A N   1 
ATOM   1456 C  CA  . VAL A 1 211 ? -30.374 12.021  -19.565 1.00 29.94 ? 211 VAL A CA  1 
ATOM   1457 C  C   . VAL A 1 211 ? -30.030 10.661  -18.984 1.00 28.82 ? 211 VAL A C   1 
ATOM   1458 O  O   . VAL A 1 211 ? -29.130 10.535  -18.160 1.00 27.43 ? 211 VAL A O   1 
ATOM   1459 C  CB  . VAL A 1 211 ? -29.170 12.478  -20.423 1.00 30.56 ? 211 VAL A CB  1 
ATOM   1460 C  CG1 . VAL A 1 211 ? -28.873 11.415  -21.469 1.00 27.23 ? 211 VAL A CG1 1 
ATOM   1461 C  CG2 . VAL A 1 211 ? -29.466 13.805  -21.097 1.00 27.80 ? 211 VAL A CG2 1 
ATOM   1462 N  N   . ARG A 1 212 ? -30.742 9.640   -19.438 1.00 28.58 ? 212 ARG A N   1 
ATOM   1463 C  CA  . ARG A 1 212 ? -30.519 8.296   -18.953 1.00 27.82 ? 212 ARG A CA  1 
ATOM   1464 C  C   . ARG A 1 212 ? -29.212 7.717   -19.464 1.00 27.81 ? 212 ARG A C   1 
ATOM   1465 O  O   . ARG A 1 212 ? -28.407 7.219   -18.687 1.00 27.66 ? 212 ARG A O   1 
ATOM   1466 C  CB  . ARG A 1 212 ? -31.671 7.382   -19.379 1.00 29.07 ? 212 ARG A CB  1 
ATOM   1467 C  CG  . ARG A 1 212 ? -31.697 6.063   -18.630 1.00 29.83 ? 212 ARG A CG  1 
ATOM   1468 C  CD  . ARG A 1 212 ? -32.776 5.137   -19.157 1.00 30.12 ? 212 ARG A CD  1 
ATOM   1469 N  NE  . ARG A 1 212 ? -32.359 4.443   -20.369 1.00 27.34 ? 212 ARG A NE  1 
ATOM   1470 C  CZ  . ARG A 1 212 ? -31.448 3.476   -20.402 1.00 27.27 ? 212 ARG A CZ  1 
ATOM   1471 N  NH1 . ARG A 1 212 ? -30.846 3.081   -19.285 1.00 23.07 ? 212 ARG A NH1 1 
ATOM   1472 N  NH2 . ARG A 1 212 ? -31.148 2.891   -21.558 1.00 26.45 ? 212 ARG A NH2 1 
ATOM   1473 N  N   . ALA A 1 213 ? -29.002 7.778   -20.774 1.00 27.68 ? 213 ALA A N   1 
ATOM   1474 C  CA  . ALA A 1 213 ? -27.793 7.215   -21.356 1.00 28.16 ? 213 ALA A CA  1 
ATOM   1475 C  C   . ALA A 1 213 ? -27.201 8.069   -22.466 1.00 27.83 ? 213 ALA A C   1 
ATOM   1476 O  O   . ALA A 1 213 ? -27.896 8.853   -23.108 1.00 28.56 ? 213 ALA A O   1 
ATOM   1477 C  CB  . ALA A 1 213 ? -28.087 5.811   -21.876 1.00 28.54 ? 213 ALA A CB  1 
ATOM   1478 N  N   . TRP A 1 214 ? -25.910 7.884   -22.706 1.00 29.71 ? 214 TRP A N   1 
ATOM   1479 C  CA  . TRP A 1 214 ? -25.195 8.651   -23.713 1.00 30.19 ? 214 TRP A CA  1 
ATOM   1480 C  C   . TRP A 1 214 ? -24.376 7.737   -24.624 1.00 31.27 ? 214 TRP A C   1 
ATOM   1481 O  O   . TRP A 1 214 ? -23.899 6.681   -24.197 1.00 30.09 ? 214 TRP A O   1 
ATOM   1482 C  CB  . TRP A 1 214 ? -24.282 9.657   -23.000 1.00 31.10 ? 214 TRP A CB  1 
ATOM   1483 C  CG  . TRP A 1 214 ? -23.778 10.764  -23.859 1.00 32.10 ? 214 TRP A CG  1 
ATOM   1484 C  CD1 . TRP A 1 214 ? -22.665 10.754  -24.648 1.00 33.13 ? 214 TRP A CD1 1 
ATOM   1485 C  CD2 . TRP A 1 214 ? -24.398 12.038  -24.055 1.00 33.18 ? 214 TRP A CD2 1 
ATOM   1486 N  NE1 . TRP A 1 214 ? -22.554 11.943  -25.328 1.00 32.78 ? 214 TRP A NE1 1 
ATOM   1487 C  CE2 . TRP A 1 214 ? -23.607 12.749  -24.984 1.00 34.54 ? 214 TRP A CE2 1 
ATOM   1488 C  CE3 . TRP A 1 214 ? -25.548 12.649  -23.535 1.00 33.81 ? 214 TRP A CE3 1 
ATOM   1489 C  CZ2 . TRP A 1 214 ? -23.930 14.041  -25.408 1.00 33.50 ? 214 TRP A CZ2 1 
ATOM   1490 C  CZ3 . TRP A 1 214 ? -25.868 13.931  -23.955 1.00 32.52 ? 214 TRP A CZ3 1 
ATOM   1491 C  CH2 . TRP A 1 214 ? -25.062 14.612  -24.884 1.00 33.35 ? 214 TRP A CH2 1 
ATOM   1492 N  N   . LYS A 1 215 ? -24.226 8.129   -25.885 1.00 31.59 ? 215 LYS A N   1 
ATOM   1493 C  CA  . LYS A 1 215 ? -23.433 7.327   -26.811 1.00 31.97 ? 215 LYS A CA  1 
ATOM   1494 C  C   . LYS A 1 215 ? -22.052 7.186   -26.193 1.00 31.29 ? 215 LYS A C   1 
ATOM   1495 O  O   . LYS A 1 215 ? -21.442 8.184   -25.808 1.00 32.75 ? 215 LYS A O   1 
ATOM   1496 C  CB  . LYS A 1 215 ? -23.307 8.018   -28.171 1.00 31.91 ? 215 LYS A CB  1 
ATOM   1497 C  CG  . LYS A 1 215 ? -24.411 7.699   -29.161 1.00 34.69 ? 215 LYS A CG  1 
ATOM   1498 C  CD  . LYS A 1 215 ? -25.769 8.188   -28.697 1.00 35.07 ? 215 LYS A CD  1 
ATOM   1499 C  CE  . LYS A 1 215 ? -26.822 8.010   -29.782 1.00 34.62 ? 215 LYS A CE  1 
ATOM   1500 N  NZ  . LYS A 1 215 ? -26.568 8.888   -30.959 1.00 35.97 ? 215 LYS A NZ  1 
ATOM   1501 N  N   . GLY A 1 216 ? -21.567 5.954   -26.085 1.00 28.95 ? 216 GLY A N   1 
ATOM   1502 C  CA  . GLY A 1 216 ? -20.254 5.741   -25.510 1.00 26.37 ? 216 GLY A CA  1 
ATOM   1503 C  C   . GLY A 1 216 ? -20.338 5.285   -24.069 1.00 27.31 ? 216 GLY A C   1 
ATOM   1504 O  O   . GLY A 1 216 ? -19.317 4.989   -23.441 1.00 26.70 ? 216 GLY A O   1 
ATOM   1505 N  N   . GLY A 1 217 ? -21.561 5.230   -23.550 1.00 27.72 ? 217 GLY A N   1 
ATOM   1506 C  CA  . GLY A 1 217 ? -21.782 4.796   -22.180 1.00 27.80 ? 217 GLY A CA  1 
ATOM   1507 C  C   . GLY A 1 217 ? -22.200 3.334   -22.098 1.00 28.89 ? 217 GLY A C   1 
ATOM   1508 O  O   . GLY A 1 217 ? -21.850 2.525   -22.964 1.00 27.83 ? 217 GLY A O   1 
ATOM   1509 N  N   . THR A 1 218 ? -22.970 2.998   -21.067 1.00 28.61 ? 218 THR A N   1 
ATOM   1510 C  CA  . THR A 1 218 ? -23.412 1.623   -20.849 1.00 28.95 ? 218 THR A CA  1 
ATOM   1511 C  C   . THR A 1 218 ? -24.934 1.429   -20.831 1.00 28.71 ? 218 THR A C   1 
ATOM   1512 O  O   . THR A 1 218 ? -25.441 0.414   -20.332 1.00 27.07 ? 218 THR A O   1 
ATOM   1513 C  CB  . THR A 1 218 ? -22.843 1.095   -19.517 1.00 28.29 ? 218 THR A CB  1 
ATOM   1514 O  OG1 . THR A 1 218 ? -23.215 1.990   -18.468 1.00 26.92 ? 218 THR A OG1 1 
ATOM   1515 C  CG2 . THR A 1 218 ? -21.331 1.009   -19.573 1.00 27.04 ? 218 THR A CG2 1 
ATOM   1516 N  N   . GLY A 1 219 ? -25.658 2.397   -21.381 1.00 29.00 ? 219 GLY A N   1 
ATOM   1517 C  CA  . GLY A 1 219 ? -27.110 2.313   -21.400 1.00 27.14 ? 219 GLY A CA  1 
ATOM   1518 C  C   . GLY A 1 219 ? -27.671 1.036   -22.001 1.00 25.89 ? 219 GLY A C   1 
ATOM   1519 O  O   . GLY A 1 219 ? -28.776 0.620   -21.649 1.00 23.99 ? 219 GLY A O   1 
ATOM   1520 N  N   . ASP A 1 220 ? -26.925 0.406   -22.903 1.00 24.95 ? 220 ASP A N   1 
ATOM   1521 C  CA  . ASP A 1 220 ? -27.407 -0.818  -23.531 1.00 25.71 ? 220 ASP A CA  1 
ATOM   1522 C  C   . ASP A 1 220 ? -27.093 -2.103  -22.778 1.00 25.09 ? 220 ASP A C   1 
ATOM   1523 O  O   . ASP A 1 220 ? -27.193 -3.190  -23.336 1.00 27.91 ? 220 ASP A O   1 
ATOM   1524 C  CB  . ASP A 1 220 ? -26.894 -0.926  -24.964 1.00 26.81 ? 220 ASP A CB  1 
ATOM   1525 C  CG  . ASP A 1 220 ? -25.393 -0.887  -25.046 1.00 28.40 ? 220 ASP A CG  1 
ATOM   1526 O  OD1 . ASP A 1 220 ? -24.742 -0.760  -23.989 1.00 32.81 ? 220 ASP A OD1 1 
ATOM   1527 O  OD2 . ASP A 1 220 ? -24.866 -0.977  -26.172 1.00 30.69 ? 220 ASP A OD2 1 
ATOM   1528 N  N   . CYS A 1 221 ? -26.720 -1.981  -21.512 1.00 25.55 ? 221 CYS A N   1 
ATOM   1529 C  CA  . CYS A 1 221 ? -26.438 -3.151  -20.679 1.00 25.82 ? 221 CYS A CA  1 
ATOM   1530 C  C   . CYS A 1 221 ? -27.246 -2.969  -19.399 1.00 25.70 ? 221 CYS A C   1 
ATOM   1531 O  O   . CYS A 1 221 ? -27.643 -1.846  -19.079 1.00 23.25 ? 221 CYS A O   1 
ATOM   1532 C  CB  . CYS A 1 221 ? -24.948 -3.231  -20.334 1.00 24.81 ? 221 CYS A CB  1 
ATOM   1533 S  SG  . CYS A 1 221 ? -23.854 -3.351  -21.768 1.00 31.35 ? 221 CYS A SG  1 
ATOM   1534 N  N   . LYS A 1 222 ? -27.503 -4.056  -18.674 1.00 25.39 ? 222 LYS A N   1 
ATOM   1535 C  CA  . LYS A 1 222 ? -28.258 -3.941  -17.431 1.00 25.63 ? 222 LYS A CA  1 
ATOM   1536 C  C   . LYS A 1 222 ? -27.289 -3.875  -16.266 1.00 24.60 ? 222 LYS A C   1 
ATOM   1537 O  O   . LYS A 1 222 ? -27.259 -4.762  -15.420 1.00 26.31 ? 222 LYS A O   1 
ATOM   1538 C  CB  . LYS A 1 222 ? -29.215 -5.125  -17.235 1.00 27.73 ? 222 LYS A CB  1 
ATOM   1539 C  CG  . LYS A 1 222 ? -30.292 -5.265  -18.296 1.00 29.67 ? 222 LYS A CG  1 
ATOM   1540 C  CD  . LYS A 1 222 ? -31.359 -6.312  -17.931 1.00 30.30 ? 222 LYS A CD  1 
ATOM   1541 C  CE  . LYS A 1 222 ? -32.459 -5.746  -17.016 1.00 31.58 ? 222 LYS A CE  1 
ATOM   1542 N  NZ  . LYS A 1 222 ? -33.064 -4.583  -17.701 1.00 33.79 ? 222 LYS A NZ  1 
ATOM   1543 N  N   . MET A 1 223 ? -26.481 -2.824  -16.243 1.00 25.63 ? 223 MET A N   1 
ATOM   1544 C  CA  . MET A 1 223 ? -25.510 -2.614  -15.178 1.00 25.61 ? 223 MET A CA  1 
ATOM   1545 C  C   . MET A 1 223 ? -26.102 -1.603  -14.203 1.00 25.66 ? 223 MET A C   1 
ATOM   1546 O  O   . MET A 1 223 ? -26.615 -0.564  -14.615 1.00 21.56 ? 223 MET A O   1 
ATOM   1547 C  CB  . MET A 1 223 ? -24.192 -2.094  -15.761 1.00 26.39 ? 223 MET A CB  1 
ATOM   1548 C  CG  . MET A 1 223 ? -23.437 -3.132  -16.596 1.00 27.82 ? 223 MET A CG  1 
ATOM   1549 S  SD  . MET A 1 223 ? -22.014 -2.446  -17.480 1.00 32.89 ? 223 MET A SD  1 
ATOM   1550 C  CE  . MET A 1 223 ? -21.053 -1.860  -16.066 1.00 27.38 ? 223 MET A CE  1 
ATOM   1551 N  N   . GLY A 1 224 ? -26.030 -1.925  -12.914 1.00 26.15 ? 224 GLY A N   1 
ATOM   1552 C  CA  . GLY A 1 224 ? -26.580 -1.065  -11.879 1.00 25.73 ? 224 GLY A CA  1 
ATOM   1553 C  C   . GLY A 1 224 ? -26.318 0.429   -11.946 1.00 26.77 ? 224 GLY A C   1 
ATOM   1554 O  O   . GLY A 1 224 ? -27.149 1.226   -11.507 1.00 27.82 ? 224 GLY A O   1 
ATOM   1555 N  N   . GLY A 1 225 ? -25.169 0.815   -12.491 1.00 27.51 ? 225 GLY A N   1 
ATOM   1556 C  CA  . GLY A 1 225 ? -24.826 2.223   -12.587 1.00 27.29 ? 225 GLY A CA  1 
ATOM   1557 C  C   . GLY A 1 225 ? -25.773 3.064   -13.422 1.00 29.23 ? 225 GLY A C   1 
ATOM   1558 O  O   . GLY A 1 225 ? -25.811 4.288   -13.289 1.00 28.82 ? 225 GLY A O   1 
ATOM   1559 N  N   . ASN A 1 226 ? -26.540 2.421   -14.293 1.00 29.46 ? 226 ASN A N   1 
ATOM   1560 C  CA  . ASN A 1 226 ? -27.475 3.162   -15.133 1.00 28.95 ? 226 ASN A CA  1 
ATOM   1561 C  C   . ASN A 1 226 ? -28.774 3.463   -14.396 1.00 27.94 ? 226 ASN A C   1 
ATOM   1562 O  O   . ASN A 1 226 ? -29.586 4.260   -14.865 1.00 27.59 ? 226 ASN A O   1 
ATOM   1563 C  CB  . ASN A 1 226 ? -27.814 2.363   -16.396 1.00 28.61 ? 226 ASN A CB  1 
ATOM   1564 C  CG  . ASN A 1 226 ? -26.587 1.801   -17.086 1.00 30.46 ? 226 ASN A CG  1 
ATOM   1565 O  OD1 . ASN A 1 226 ? -25.543 2.443   -17.132 1.00 31.93 ? 226 ASN A OD1 1 
ATOM   1566 N  ND2 . ASN A 1 226 ? -26.715 0.600   -17.643 1.00 31.80 ? 226 ASN A ND2 1 
ATOM   1567 N  N   . TYR A 1 227 ? -28.973 2.834   -13.243 1.00 26.51 ? 227 TYR A N   1 
ATOM   1568 C  CA  . TYR A 1 227 ? -30.221 3.018   -12.516 1.00 28.61 ? 227 TYR A CA  1 
ATOM   1569 C  C   . TYR A 1 227 ? -30.247 3.915   -11.295 1.00 28.32 ? 227 TYR A C   1 
ATOM   1570 O  O   . TYR A 1 227 ? -31.223 4.635   -11.092 1.00 29.03 ? 227 TYR A O   1 
ATOM   1571 C  CB  . TYR A 1 227 ? -30.794 1.651   -12.158 1.00 28.35 ? 227 TYR A CB  1 
ATOM   1572 C  CG  . TYR A 1 227 ? -30.900 0.778   -13.379 1.00 28.03 ? 227 TYR A CG  1 
ATOM   1573 C  CD1 . TYR A 1 227 ? -29.769 0.172   -13.917 1.00 28.18 ? 227 TYR A CD1 1 
ATOM   1574 C  CD2 . TYR A 1 227 ? -32.110 0.638   -14.060 1.00 28.00 ? 227 TYR A CD2 1 
ATOM   1575 C  CE1 . TYR A 1 227 ? -29.831 -0.546  -15.105 1.00 26.29 ? 227 TYR A CE1 1 
ATOM   1576 C  CE2 . TYR A 1 227 ? -32.183 -0.080  -15.259 1.00 29.84 ? 227 TYR A CE2 1 
ATOM   1577 C  CZ  . TYR A 1 227 ? -31.035 -0.664  -15.772 1.00 26.46 ? 227 TYR A CZ  1 
ATOM   1578 O  OH  . TYR A 1 227 ? -31.069 -1.329  -16.969 1.00 28.04 ? 227 TYR A OH  1 
ATOM   1579 N  N   . GLY A 1 228 ? -29.200 3.880   -10.483 1.00 29.04 ? 228 GLY A N   1 
ATOM   1580 C  CA  . GLY A 1 228 ? -29.186 4.713   -9.289  1.00 29.85 ? 228 GLY A CA  1 
ATOM   1581 C  C   . GLY A 1 228 ? -29.436 6.172   -9.602  1.00 30.35 ? 228 GLY A C   1 
ATOM   1582 O  O   . GLY A 1 228 ? -30.214 6.851   -8.934  1.00 29.82 ? 228 GLY A O   1 
ATOM   1583 N  N   . SER A 1 229 ? -28.775 6.636   -10.653 1.00 32.68 ? 229 SER A N   1 
ATOM   1584 C  CA  . SER A 1 229 ? -28.860 8.014   -11.116 1.00 33.40 ? 229 SER A CA  1 
ATOM   1585 C  C   . SER A 1 229 ? -30.231 8.506   -11.596 1.00 33.57 ? 229 SER A C   1 
ATOM   1586 O  O   . SER A 1 229 ? -30.375 9.684   -11.919 1.00 35.00 ? 229 SER A O   1 
ATOM   1587 C  CB  . SER A 1 229 ? -27.819 8.226   -12.227 1.00 34.99 ? 229 SER A CB  1 
ATOM   1588 O  OG  . SER A 1 229 ? -27.792 7.123   -13.128 1.00 36.84 ? 229 SER A OG  1 
ATOM   1589 N  N   . SER A 1 230 ? -31.235 7.633   -11.641 1.00 32.06 ? 230 SER A N   1 
ATOM   1590 C  CA  . SER A 1 230 ? -32.554 8.062   -12.103 1.00 31.92 ? 230 SER A CA  1 
ATOM   1591 C  C   . SER A 1 230 ? -33.632 8.200   -11.027 1.00 31.84 ? 230 SER A C   1 
ATOM   1592 O  O   . SER A 1 230 ? -34.704 8.744   -11.290 1.00 33.28 ? 230 SER A O   1 
ATOM   1593 C  CB  . SER A 1 230 ? -33.050 7.145   -13.233 1.00 30.92 ? 230 SER A CB  1 
ATOM   1594 O  OG  . SER A 1 230 ? -33.021 5.780   -12.869 1.00 36.04 ? 230 SER A OG  1 
ATOM   1595 N  N   . LEU A 1 231 ? -33.353 7.727   -9.816  1.00 32.05 ? 231 LEU A N   1 
ATOM   1596 C  CA  . LEU A 1 231 ? -34.317 7.833   -8.720  1.00 29.97 ? 231 LEU A CA  1 
ATOM   1597 C  C   . LEU A 1 231 ? -34.738 9.281   -8.452  1.00 28.37 ? 231 LEU A C   1 
ATOM   1598 O  O   . LEU A 1 231 ? -35.850 9.536   -7.991  1.00 29.69 ? 231 LEU A O   1 
ATOM   1599 C  CB  . LEU A 1 231 ? -33.737 7.225   -7.446  1.00 30.81 ? 231 LEU A CB  1 
ATOM   1600 C  CG  . LEU A 1 231 ? -33.738 5.695   -7.343  1.00 33.02 ? 231 LEU A CG  1 
ATOM   1601 C  CD1 . LEU A 1 231 ? -33.236 5.057   -8.624  1.00 34.15 ? 231 LEU A CD1 1 
ATOM   1602 C  CD2 . LEU A 1 231 ? -32.872 5.291   -6.170  1.00 31.05 ? 231 LEU A CD2 1 
ATOM   1603 N  N   . PHE A 1 232 ? -33.858 10.232  -8.748  1.00 27.03 ? 232 PHE A N   1 
ATOM   1604 C  CA  . PHE A 1 232 ? -34.180 11.637  -8.523  1.00 27.17 ? 232 PHE A CA  1 
ATOM   1605 C  C   . PHE A 1 232 ? -35.285 12.081  -9.492  1.00 29.21 ? 232 PHE A C   1 
ATOM   1606 O  O   . PHE A 1 232 ? -36.237 12.759  -9.092  1.00 29.34 ? 232 PHE A O   1 
ATOM   1607 C  CB  . PHE A 1 232 ? -32.939 12.513  -8.720  1.00 25.48 ? 232 PHE A CB  1 
ATOM   1608 C  CG  . PHE A 1 232 ? -33.116 13.937  -8.240  1.00 29.02 ? 232 PHE A CG  1 
ATOM   1609 C  CD1 . PHE A 1 232 ? -33.069 14.239  -6.880  1.00 28.22 ? 232 PHE A CD1 1 
ATOM   1610 C  CD2 . PHE A 1 232 ? -33.350 14.971  -9.145  1.00 27.96 ? 232 PHE A CD2 1 
ATOM   1611 C  CE1 . PHE A 1 232 ? -33.254 15.549  -6.423  1.00 27.27 ? 232 PHE A CE1 1 
ATOM   1612 C  CE2 . PHE A 1 232 ? -33.537 16.289  -8.701  1.00 30.32 ? 232 PHE A CE2 1 
ATOM   1613 C  CZ  . PHE A 1 232 ? -33.488 16.577  -7.333  1.00 29.71 ? 232 PHE A CZ  1 
ATOM   1614 N  N   . ALA A 1 233 ? -35.152 11.686  -10.760 1.00 28.02 ? 233 ALA A N   1 
ATOM   1615 C  CA  . ALA A 1 233 ? -36.123 12.033  -11.786 1.00 26.41 ? 233 ALA A CA  1 
ATOM   1616 C  C   . ALA A 1 233 ? -37.434 11.320  -11.503 1.00 26.77 ? 233 ALA A C   1 
ATOM   1617 O  O   . ALA A 1 233 ? -38.509 11.895  -11.669 1.00 23.95 ? 233 ALA A O   1 
ATOM   1618 C  CB  . ALA A 1 233 ? -35.597 11.645  -13.170 1.00 25.40 ? 233 ALA A CB  1 
ATOM   1619 N  N   . GLN A 1 234 ? -37.346 10.064  -11.074 1.00 28.81 ? 234 GLN A N   1 
ATOM   1620 C  CA  . GLN A 1 234 ? -38.550 9.297   -10.769 1.00 32.50 ? 234 GLN A CA  1 
ATOM   1621 C  C   . GLN A 1 234 ? -39.341 10.024  -9.687  1.00 34.06 ? 234 GLN A C   1 
ATOM   1622 O  O   . GLN A 1 234 ? -40.559 10.178  -9.796  1.00 34.56 ? 234 GLN A O   1 
ATOM   1623 C  CB  . GLN A 1 234 ? -38.187 7.894   -10.288 1.00 34.92 ? 234 GLN A CB  1 
ATOM   1624 C  CG  . GLN A 1 234 ? -39.351 7.131   -9.658  1.00 39.84 ? 234 GLN A CG  1 
ATOM   1625 C  CD  . GLN A 1 234 ? -40.305 6.547   -10.682 1.00 42.88 ? 234 GLN A CD  1 
ATOM   1626 O  OE1 . GLN A 1 234 ? -40.844 7.262   -11.527 1.00 41.98 ? 234 GLN A OE1 1 
ATOM   1627 N  NE2 . GLN A 1 234 ? -40.520 5.234   -10.609 1.00 44.35 ? 234 GLN A NE2 1 
ATOM   1628 N  N   . CYS A 1 235 ? -38.642 10.474  -8.647  1.00 34.48 ? 235 CYS A N   1 
ATOM   1629 C  CA  . CYS A 1 235 ? -39.280 11.198  -7.555  1.00 34.35 ? 235 CYS A CA  1 
ATOM   1630 C  C   . CYS A 1 235 ? -39.913 12.467  -8.100  1.00 34.34 ? 235 CYS A C   1 
ATOM   1631 O  O   . CYS A 1 235 ? -41.064 12.787  -7.793  1.00 33.43 ? 235 CYS A O   1 
ATOM   1632 C  CB  . CYS A 1 235 ? -38.254 11.550  -6.471  1.00 34.59 ? 235 CYS A CB  1 
ATOM   1633 S  SG  . CYS A 1 235 ? -37.769 10.141  -5.465  1.00 37.82 ? 235 CYS A SG  1 
ATOM   1634 N  N   . GLU A 1 236 ? -39.157 13.194  -8.913  1.00 34.78 ? 236 GLU A N   1 
ATOM   1635 C  CA  . GLU A 1 236 ? -39.680 14.412  -9.502  1.00 35.14 ? 236 GLU A CA  1 
ATOM   1636 C  C   . GLU A 1 236 ? -40.915 14.064  -10.341 1.00 35.68 ? 236 GLU A C   1 
ATOM   1637 O  O   . GLU A 1 236 ? -41.805 14.891  -10.527 1.00 36.56 ? 236 GLU A O   1 
ATOM   1638 C  CB  . GLU A 1 236 ? -38.620 15.080  -10.380 1.00 34.41 ? 236 GLU A CB  1 
ATOM   1639 C  CG  . GLU A 1 236 ? -39.159 16.249  -11.170 1.00 33.35 ? 236 GLU A CG  1 
ATOM   1640 C  CD  . GLU A 1 236 ? -38.085 17.017  -11.879 1.00 35.55 ? 236 GLU A CD  1 
ATOM   1641 O  OE1 . GLU A 1 236 ? -37.326 17.740  -11.198 1.00 37.71 ? 236 GLU A OE1 1 
ATOM   1642 O  OE2 . GLU A 1 236 ? -37.996 16.894  -13.121 1.00 37.31 ? 236 GLU A OE2 1 
ATOM   1643 N  N   . ALA A 1 237 ? -40.969 12.830  -10.833 1.00 34.64 ? 237 ALA A N   1 
ATOM   1644 C  CA  . ALA A 1 237 ? -42.096 12.394  -11.643 1.00 35.69 ? 237 ALA A CA  1 
ATOM   1645 C  C   . ALA A 1 237 ? -43.357 12.274  -10.802 1.00 35.13 ? 237 ALA A C   1 
ATOM   1646 O  O   . ALA A 1 237 ? -44.381 12.878  -11.121 1.00 34.37 ? 237 ALA A O   1 
ATOM   1647 C  CB  . ALA A 1 237 ? -41.784 11.058  -12.309 1.00 35.27 ? 237 ALA A CB  1 
ATOM   1648 N  N   . VAL A 1 238 ? -43.289 11.490  -9.731  1.00 35.30 ? 238 VAL A N   1 
ATOM   1649 C  CA  . VAL A 1 238 ? -44.450 11.310  -8.873  1.00 36.41 ? 238 VAL A CA  1 
ATOM   1650 C  C   . VAL A 1 238 ? -44.917 12.652  -8.328  1.00 36.47 ? 238 VAL A C   1 
ATOM   1651 O  O   . VAL A 1 238 ? -46.107 12.953  -8.330  1.00 37.92 ? 238 VAL A O   1 
ATOM   1652 C  CB  . VAL A 1 238 ? -44.150 10.354  -7.701  1.00 37.04 ? 238 VAL A CB  1 
ATOM   1653 C  CG1 . VAL A 1 238 ? -43.670 9.015   -8.244  1.00 37.33 ? 238 VAL A CG1 1 
ATOM   1654 C  CG2 . VAL A 1 238 ? -43.105 10.954  -6.775  1.00 39.81 ? 238 VAL A CG2 1 
ATOM   1655 N  N   . ASP A 1 239 ? -43.974 13.467  -7.881  1.00 37.44 ? 239 ASP A N   1 
ATOM   1656 C  CA  . ASP A 1 239 ? -44.313 14.770  -7.345  1.00 38.77 ? 239 ASP A CA  1 
ATOM   1657 C  C   . ASP A 1 239 ? -45.249 15.499  -8.290  1.00 38.84 ? 239 ASP A C   1 
ATOM   1658 O  O   . ASP A 1 239 ? -46.081 16.296  -7.862  1.00 39.44 ? 239 ASP A O   1 
ATOM   1659 C  CB  . ASP A 1 239 ? -43.041 15.590  -7.113  1.00 40.97 ? 239 ASP A CB  1 
ATOM   1660 C  CG  . ASP A 1 239 ? -42.359 15.246  -5.793  1.00 43.50 ? 239 ASP A CG  1 
ATOM   1661 O  OD1 . ASP A 1 239 ? -42.240 14.042  -5.472  1.00 43.32 ? 239 ASP A OD1 1 
ATOM   1662 O  OD2 . ASP A 1 239 ? -41.938 16.179  -5.075  1.00 46.22 ? 239 ASP A OD2 1 
ATOM   1663 N  N   . ASN A 1 240 ? -45.126 15.210  -9.578  1.00 38.43 ? 240 ASN A N   1 
ATOM   1664 C  CA  . ASN A 1 240 ? -45.969 15.845  -10.576 1.00 37.67 ? 240 ASN A CA  1 
ATOM   1665 C  C   . ASN A 1 240 ? -47.061 14.918  -11.107 1.00 38.13 ? 240 ASN A C   1 
ATOM   1666 O  O   . ASN A 1 240 ? -47.402 14.963  -12.288 1.00 38.23 ? 240 ASN A O   1 
ATOM   1667 C  CB  . ASN A 1 240 ? -45.105 16.351  -11.724 1.00 37.60 ? 240 ASN A CB  1 
ATOM   1668 C  CG  . ASN A 1 240 ? -44.337 17.600  -11.362 1.00 37.46 ? 240 ASN A CG  1 
ATOM   1669 O  OD1 . ASN A 1 240 ? -44.820 18.716  -11.553 1.00 40.43 ? 240 ASN A OD1 1 
ATOM   1670 N  ND2 . ASN A 1 240 ? -43.139 17.423  -10.825 1.00 37.71 ? 240 ASN A ND2 1 
ATOM   1671 N  N   . GLY A 1 241 ? -47.599 14.076  -10.231 1.00 38.32 ? 241 GLY A N   1 
ATOM   1672 C  CA  . GLY A 1 241 ? -48.665 13.170  -10.622 1.00 39.24 ? 241 GLY A CA  1 
ATOM   1673 C  C   . GLY A 1 241 ? -48.375 12.091  -11.657 1.00 39.25 ? 241 GLY A C   1 
ATOM   1674 O  O   . GLY A 1 241 ? -49.296 11.395  -12.087 1.00 40.53 ? 241 GLY A O   1 
ATOM   1675 N  N   . CYS A 1 242 ? -47.118 11.939  -12.061 1.00 38.47 ? 242 CYS A N   1 
ATOM   1676 C  CA  . CYS A 1 242 ? -46.756 10.919  -13.046 1.00 36.50 ? 242 CYS A CA  1 
ATOM   1677 C  C   . CYS A 1 242 ? -46.231 9.638   -12.390 1.00 36.82 ? 242 CYS A C   1 
ATOM   1678 O  O   . CYS A 1 242 ? -45.662 9.666   -11.294 1.00 36.06 ? 242 CYS A O   1 
ATOM   1679 C  CB  . CYS A 1 242 ? -45.706 11.469  -14.013 1.00 33.15 ? 242 CYS A CB  1 
ATOM   1680 S  SG  . CYS A 1 242 ? -46.259 12.921  -14.947 1.00 33.61 ? 242 CYS A SG  1 
ATOM   1681 N  N   . GLN A 1 243 ? -46.418 8.513   -13.073 1.00 36.86 ? 243 GLN A N   1 
ATOM   1682 C  CA  . GLN A 1 243 ? -45.968 7.222   -12.558 1.00 35.86 ? 243 GLN A CA  1 
ATOM   1683 C  C   . GLN A 1 243 ? -44.591 6.799   -13.079 1.00 35.35 ? 243 GLN A C   1 
ATOM   1684 O  O   . GLN A 1 243 ? -43.941 5.942   -12.482 1.00 34.45 ? 243 GLN A O   1 
ATOM   1685 C  CB  . GLN A 1 243 ? -46.988 6.132   -12.905 1.00 35.90 ? 243 GLN A CB  1 
ATOM   1686 C  CG  . GLN A 1 243 ? -48.350 6.260   -12.207 1.00 38.67 ? 243 GLN A CG  1 
ATOM   1687 C  CD  . GLN A 1 243 ? -49.249 7.339   -12.801 1.00 38.77 ? 243 GLN A CD  1 
ATOM   1688 O  OE1 . GLN A 1 243 ? -49.528 7.339   -14.003 1.00 38.24 ? 243 GLN A OE1 1 
ATOM   1689 N  NE2 . GLN A 1 243 ? -49.719 8.253   -11.955 1.00 38.52 ? 243 GLN A NE2 1 
ATOM   1690 N  N   . GLN A 1 244 ? -44.154 7.397   -14.186 1.00 34.78 ? 244 GLN A N   1 
ATOM   1691 C  CA  . GLN A 1 244 ? -42.863 7.070   -14.797 1.00 34.32 ? 244 GLN A CA  1 
ATOM   1692 C  C   . GLN A 1 244 ? -42.219 8.265   -15.496 1.00 33.05 ? 244 GLN A C   1 
ATOM   1693 O  O   . GLN A 1 244 ? -42.861 9.291   -15.727 1.00 30.36 ? 244 GLN A O   1 
ATOM   1694 C  CB  . GLN A 1 244 ? -43.031 5.958   -15.834 1.00 37.33 ? 244 GLN A CB  1 
ATOM   1695 C  CG  . GLN A 1 244 ? -43.252 4.571   -15.271 1.00 42.01 ? 244 GLN A CG  1 
ATOM   1696 C  CD  . GLN A 1 244 ? -42.017 4.028   -14.590 1.00 45.40 ? 244 GLN A CD  1 
ATOM   1697 O  OE1 . GLN A 1 244 ? -41.772 4.294   -13.410 1.00 46.14 ? 244 GLN A OE1 1 
ATOM   1698 N  NE2 . GLN A 1 244 ? -41.218 3.268   -15.337 1.00 46.99 ? 244 GLN A NE2 1 
ATOM   1699 N  N   . VAL A 1 245 ? -40.949 8.100   -15.857 1.00 31.12 ? 245 VAL A N   1 
ATOM   1700 C  CA  . VAL A 1 245 ? -40.194 9.141   -16.542 1.00 29.46 ? 245 VAL A CA  1 
ATOM   1701 C  C   . VAL A 1 245 ? -40.005 8.831   -18.029 1.00 29.06 ? 245 VAL A C   1 
ATOM   1702 O  O   . VAL A 1 245 ? -39.612 7.718   -18.395 1.00 30.13 ? 245 VAL A O   1 
ATOM   1703 C  CB  . VAL A 1 245 ? -38.776 9.306   -15.931 1.00 30.23 ? 245 VAL A CB  1 
ATOM   1704 C  CG1 . VAL A 1 245 ? -38.002 10.355  -16.709 1.00 27.53 ? 245 VAL A CG1 1 
ATOM   1705 C  CG2 . VAL A 1 245 ? -38.863 9.667   -14.442 1.00 27.20 ? 245 VAL A CG2 1 
ATOM   1706 N  N   . LEU A 1 246 ? -40.297 9.807   -18.885 1.00 27.82 ? 246 LEU A N   1 
ATOM   1707 C  CA  . LEU A 1 246 ? -40.077 9.635   -20.318 1.00 27.13 ? 246 LEU A CA  1 
ATOM   1708 C  C   . LEU A 1 246 ? -38.672 10.179  -20.532 1.00 27.67 ? 246 LEU A C   1 
ATOM   1709 O  O   . LEU A 1 246 ? -38.428 11.363  -20.322 1.00 29.06 ? 246 LEU A O   1 
ATOM   1710 C  CB  . LEU A 1 246 ? -41.061 10.448  -21.157 1.00 25.45 ? 246 LEU A CB  1 
ATOM   1711 C  CG  . LEU A 1 246 ? -40.864 10.289  -22.674 1.00 28.16 ? 246 LEU A CG  1 
ATOM   1712 C  CD1 . LEU A 1 246 ? -41.016 8.803   -23.067 1.00 17.87 ? 246 LEU A CD1 1 
ATOM   1713 C  CD2 . LEU A 1 246 ? -41.877 11.161  -23.430 1.00 23.72 ? 246 LEU A CD2 1 
ATOM   1714 N  N   . TRP A 1 247 ? -37.749 9.312   -20.930 1.00 25.89 ? 247 TRP A N   1 
ATOM   1715 C  CA  . TRP A 1 247 ? -36.375 9.728   -21.137 1.00 24.90 ? 247 TRP A CA  1 
ATOM   1716 C  C   . TRP A 1 247 ? -36.113 10.352  -22.495 1.00 25.22 ? 247 TRP A C   1 
ATOM   1717 O  O   . TRP A 1 247 ? -36.267 9.709   -23.540 1.00 26.58 ? 247 TRP A O   1 
ATOM   1718 C  CB  . TRP A 1 247 ? -35.448 8.541   -20.908 1.00 24.60 ? 247 TRP A CB  1 
ATOM   1719 C  CG  . TRP A 1 247 ? -35.504 8.043   -19.497 1.00 27.32 ? 247 TRP A CG  1 
ATOM   1720 C  CD1 . TRP A 1 247 ? -36.171 6.939   -19.030 1.00 28.18 ? 247 TRP A CD1 1 
ATOM   1721 C  CD2 . TRP A 1 247 ? -34.859 8.631   -18.365 1.00 27.22 ? 247 TRP A CD2 1 
ATOM   1722 N  NE1 . TRP A 1 247 ? -35.969 6.803   -17.673 1.00 28.81 ? 247 TRP A NE1 1 
ATOM   1723 C  CE2 . TRP A 1 247 ? -35.168 7.828   -17.241 1.00 28.22 ? 247 TRP A CE2 1 
ATOM   1724 C  CE3 . TRP A 1 247 ? -34.047 9.758   -18.190 1.00 28.04 ? 247 TRP A CE3 1 
ATOM   1725 C  CZ2 . TRP A 1 247 ? -34.689 8.118   -15.961 1.00 28.07 ? 247 TRP A CZ2 1 
ATOM   1726 C  CZ3 . TRP A 1 247 ? -33.568 10.047  -16.905 1.00 29.11 ? 247 TRP A CZ3 1 
ATOM   1727 C  CH2 . TRP A 1 247 ? -33.892 9.228   -15.814 1.00 24.92 ? 247 TRP A CH2 1 
ATOM   1728 N  N   . LEU A 1 248 ? -35.696 11.611  -22.465 1.00 23.43 ? 248 LEU A N   1 
ATOM   1729 C  CA  . LEU A 1 248 ? -35.409 12.362  -23.676 1.00 24.37 ? 248 LEU A CA  1 
ATOM   1730 C  C   . LEU A 1 248 ? -33.904 12.426  -23.956 1.00 26.06 ? 248 LEU A C   1 
ATOM   1731 O  O   . LEU A 1 248 ? -33.088 12.407  -23.033 1.00 25.67 ? 248 LEU A O   1 
ATOM   1732 C  CB  . LEU A 1 248 ? -36.002 13.765  -23.541 1.00 24.57 ? 248 LEU A CB  1 
ATOM   1733 C  CG  . LEU A 1 248 ? -37.501 13.774  -23.184 1.00 25.51 ? 248 LEU A CG  1 
ATOM   1734 C  CD1 . LEU A 1 248 ? -37.976 15.216  -23.069 1.00 26.38 ? 248 LEU A CD1 1 
ATOM   1735 C  CD2 . LEU A 1 248 ? -38.321 13.024  -24.254 1.00 24.31 ? 248 LEU A CD2 1 
ATOM   1736 N  N   . TYR A 1 249 ? -33.540 12.501  -25.234 1.00 26.54 ? 249 TYR A N   1 
ATOM   1737 C  CA  . TYR A 1 249 ? -32.132 12.534  -25.633 1.00 26.86 ? 249 TYR A CA  1 
ATOM   1738 C  C   . TYR A 1 249 ? -31.853 13.412  -26.844 1.00 25.31 ? 249 TYR A C   1 
ATOM   1739 O  O   . TYR A 1 249 ? -32.598 13.392  -27.815 1.00 24.87 ? 249 TYR A O   1 
ATOM   1740 C  CB  . TYR A 1 249 ? -31.643 11.118  -25.969 1.00 25.44 ? 249 TYR A CB  1 
ATOM   1741 C  CG  . TYR A 1 249 ? -30.197 11.063  -26.433 1.00 26.74 ? 249 TYR A CG  1 
ATOM   1742 C  CD1 . TYR A 1 249 ? -29.148 11.047  -25.514 1.00 26.25 ? 249 TYR A CD1 1 
ATOM   1743 C  CD2 . TYR A 1 249 ? -29.878 11.038  -27.794 1.00 29.06 ? 249 TYR A CD2 1 
ATOM   1744 C  CE1 . TYR A 1 249 ? -27.824 11.006  -25.931 1.00 27.12 ? 249 TYR A CE1 1 
ATOM   1745 C  CE2 . TYR A 1 249 ? -28.546 10.999  -28.225 1.00 28.72 ? 249 TYR A CE2 1 
ATOM   1746 C  CZ  . TYR A 1 249 ? -27.529 10.982  -27.285 1.00 30.84 ? 249 TYR A CZ  1 
ATOM   1747 O  OH  . TYR A 1 249 ? -26.214 10.930  -27.693 1.00 37.52 ? 249 TYR A OH  1 
ATOM   1748 N  N   . GLY A 1 250 ? -30.758 14.156  -26.790 1.00 27.44 ? 250 GLY A N   1 
ATOM   1749 C  CA  . GLY A 1 250 ? -30.382 14.992  -27.911 1.00 29.05 ? 250 GLY A CA  1 
ATOM   1750 C  C   . GLY A 1 250 ? -31.164 16.272  -28.075 1.00 32.50 ? 250 GLY A C   1 
ATOM   1751 O  O   . GLY A 1 250 ? -32.215 16.465  -27.463 1.00 32.25 ? 250 GLY A O   1 
ATOM   1752 N  N   . GLU A 1 251 ? -30.636 17.145  -28.927 1.00 35.36 ? 251 GLU A N   1 
ATOM   1753 C  CA  . GLU A 1 251 ? -31.237 18.440  -29.210 1.00 37.97 ? 251 GLU A CA  1 
ATOM   1754 C  C   . GLU A 1 251 ? -32.663 18.315  -29.717 1.00 37.34 ? 251 GLU A C   1 
ATOM   1755 O  O   . GLU A 1 251 ? -33.509 19.152  -29.424 1.00 38.75 ? 251 GLU A O   1 
ATOM   1756 C  CB  . GLU A 1 251 ? -30.406 19.174  -30.261 1.00 41.84 ? 251 GLU A CB  1 
ATOM   1757 C  CG  . GLU A 1 251 ? -28.930 19.232  -29.945 1.00 47.83 ? 251 GLU A CG  1 
ATOM   1758 C  CD  . GLU A 1 251 ? -28.123 19.852  -31.067 1.00 51.45 ? 251 GLU A CD  1 
ATOM   1759 O  OE1 . GLU A 1 251 ? -28.251 19.384  -32.221 1.00 54.26 ? 251 GLU A OE1 1 
ATOM   1760 O  OE2 . GLU A 1 251 ? -27.357 20.803  -30.792 1.00 53.20 ? 251 GLU A OE2 1 
ATOM   1761 N  N   . ASP A 1 252 ? -32.923 17.269  -30.489 1.00 36.40 ? 252 ASP A N   1 
ATOM   1762 C  CA  . ASP A 1 252 ? -34.244 17.063  -31.059 1.00 35.10 ? 252 ASP A CA  1 
ATOM   1763 C  C   . ASP A 1 252 ? -35.203 16.297  -30.145 1.00 33.88 ? 252 ASP A C   1 
ATOM   1764 O  O   . ASP A 1 252 ? -36.259 15.834  -30.581 1.00 32.62 ? 252 ASP A O   1 
ATOM   1765 C  CB  . ASP A 1 252 ? -34.108 16.365  -32.415 1.00 37.62 ? 252 ASP A CB  1 
ATOM   1766 C  CG  . ASP A 1 252 ? -33.175 15.154  -32.370 1.00 42.04 ? 252 ASP A CG  1 
ATOM   1767 O  OD1 . ASP A 1 252 ? -32.943 14.555  -33.447 1.00 42.08 ? 252 ASP A OD1 1 
ATOM   1768 O  OD2 . ASP A 1 252 ? -32.675 14.799  -31.272 1.00 42.75 ? 252 ASP A OD2 1 
ATOM   1769 N  N   . HIS A 1 253 ? -34.826 16.170  -28.877 1.00 30.91 ? 253 HIS A N   1 
ATOM   1770 C  CA  . HIS A 1 253 ? -35.651 15.492  -27.884 1.00 29.92 ? 253 HIS A CA  1 
ATOM   1771 C  C   . HIS A 1 253 ? -36.252 14.175  -28.351 1.00 28.51 ? 253 HIS A C   1 
ATOM   1772 O  O   . HIS A 1 253 ? -37.472 14.014  -28.355 1.00 25.24 ? 253 HIS A O   1 
ATOM   1773 C  CB  . HIS A 1 253 ? -36.787 16.411  -27.427 1.00 33.04 ? 253 HIS A CB  1 
ATOM   1774 C  CG  . HIS A 1 253 ? -36.330 17.762  -26.987 1.00 35.16 ? 253 HIS A CG  1 
ATOM   1775 N  ND1 . HIS A 1 253 ? -35.380 17.943  -26.008 1.00 37.76 ? 253 HIS A ND1 1 
ATOM   1776 C  CD2 . HIS A 1 253 ? -36.674 19.001  -27.411 1.00 39.05 ? 253 HIS A CD2 1 
ATOM   1777 C  CE1 . HIS A 1 253 ? -35.154 19.235  -25.847 1.00 37.57 ? 253 HIS A CE1 1 
ATOM   1778 N  NE2 . HIS A 1 253 ? -35.927 19.899  -26.687 1.00 40.32 ? 253 HIS A NE2 1 
ATOM   1779 N  N   . GLN A 1 254 ? -35.403 13.233  -28.748 1.00 28.20 ? 254 GLN A N   1 
ATOM   1780 C  CA  . GLN A 1 254 ? -35.893 11.930  -29.181 1.00 28.07 ? 254 GLN A CA  1 
ATOM   1781 C  C   . GLN A 1 254 ? -36.468 11.239  -27.953 1.00 26.39 ? 254 GLN A C   1 
ATOM   1782 O  O   . GLN A 1 254 ? -36.003 11.463  -26.836 1.00 26.76 ? 254 GLN A O   1 
ATOM   1783 C  CB  . GLN A 1 254 ? -34.750 11.069  -29.725 1.00 28.47 ? 254 GLN A CB  1 
ATOM   1784 C  CG  . GLN A 1 254 ? -33.869 11.750  -30.754 1.00 28.95 ? 254 GLN A CG  1 
ATOM   1785 C  CD  . GLN A 1 254 ? -32.614 10.952  -31.054 1.00 28.08 ? 254 GLN A CD  1 
ATOM   1786 O  OE1 . GLN A 1 254 ? -31.702 11.438  -31.714 1.00 33.06 ? 254 GLN A OE1 1 
ATOM   1787 N  NE2 . GLN A 1 254 ? -32.565 9.722   -30.569 1.00 31.67 ? 254 GLN A NE2 1 
ATOM   1788 N  N   . ILE A 1 255 ? -37.492 10.424  -28.149 1.00 25.89 ? 255 ILE A N   1 
ATOM   1789 C  CA  . ILE A 1 255 ? -38.068 9.683   -27.039 1.00 24.83 ? 255 ILE A CA  1 
ATOM   1790 C  C   . ILE A 1 255 ? -37.385 8.313   -27.112 1.00 26.07 ? 255 ILE A C   1 
ATOM   1791 O  O   . ILE A 1 255 ? -37.411 7.654   -28.150 1.00 25.08 ? 255 ILE A O   1 
ATOM   1792 C  CB  . ILE A 1 255 ? -39.597 9.558   -27.180 1.00 25.61 ? 255 ILE A CB  1 
ATOM   1793 C  CG1 . ILE A 1 255 ? -39.959 8.837   -28.475 1.00 23.24 ? 255 ILE A CG1 1 
ATOM   1794 C  CG2 . ILE A 1 255 ? -40.231 10.951  -27.179 1.00 23.71 ? 255 ILE A CG2 1 
ATOM   1795 C  CD1 . ILE A 1 255 ? -41.453 8.652   -28.636 1.00 27.13 ? 255 ILE A CD1 1 
ATOM   1796 N  N   . THR A 1 256 ? -36.759 7.892   -26.018 1.00 26.55 ? 256 THR A N   1 
ATOM   1797 C  CA  . THR A 1 256 ? -36.019 6.637   -26.016 1.00 26.18 ? 256 THR A CA  1 
ATOM   1798 C  C   . THR A 1 256 ? -36.658 5.477   -25.289 1.00 26.67 ? 256 THR A C   1 
ATOM   1799 O  O   . THR A 1 256 ? -36.874 4.417   -25.873 1.00 27.81 ? 256 THR A O   1 
ATOM   1800 C  CB  . THR A 1 256 ? -34.629 6.838   -25.420 1.00 27.41 ? 256 THR A CB  1 
ATOM   1801 O  OG1 . THR A 1 256 ? -34.742 7.101   -24.013 1.00 26.10 ? 256 THR A OG1 1 
ATOM   1802 C  CG2 . THR A 1 256 ? -33.939 8.011   -26.102 1.00 26.78 ? 256 THR A CG2 1 
ATOM   1803 N  N   . GLU A 1 257 ? -36.929 5.665   -24.006 1.00 26.92 ? 257 GLU A N   1 
ATOM   1804 C  CA  . GLU A 1 257 ? -37.538 4.619   -23.204 1.00 27.69 ? 257 GLU A CA  1 
ATOM   1805 C  C   . GLU A 1 257 ? -38.560 5.190   -22.215 1.00 28.39 ? 257 GLU A C   1 
ATOM   1806 O  O   . GLU A 1 257 ? -38.460 6.353   -21.802 1.00 25.76 ? 257 GLU A O   1 
ATOM   1807 C  CB  . GLU A 1 257 ? -36.445 3.833   -22.468 1.00 30.16 ? 257 GLU A CB  1 
ATOM   1808 C  CG  . GLU A 1 257 ? -35.504 3.053   -23.412 1.00 32.91 ? 257 GLU A CG  1 
ATOM   1809 C  CD  . GLU A 1 257 ? -34.737 1.932   -22.710 1.00 35.87 ? 257 GLU A CD  1 
ATOM   1810 O  OE1 . GLU A 1 257 ? -35.371 1.168   -21.945 1.00 33.83 ? 257 GLU A OE1 1 
ATOM   1811 O  OE2 . GLU A 1 257 ? -33.508 1.801   -22.931 1.00 35.27 ? 257 GLU A OE2 1 
ATOM   1812 N  N   . VAL A 1 258 ? -39.559 4.379   -21.873 1.00 27.76 ? 258 VAL A N   1 
ATOM   1813 C  CA  . VAL A 1 258 ? -40.604 4.780   -20.929 1.00 28.09 ? 258 VAL A CA  1 
ATOM   1814 C  C   . VAL A 1 258 ? -40.147 4.270   -19.577 1.00 27.48 ? 258 VAL A C   1 
ATOM   1815 O  O   . VAL A 1 258 ? -40.382 3.116   -19.238 1.00 29.12 ? 258 VAL A O   1 
ATOM   1816 C  CB  . VAL A 1 258 ? -41.977 4.124   -21.259 1.00 28.35 ? 258 VAL A CB  1 
ATOM   1817 C  CG1 . VAL A 1 258 ? -43.026 4.612   -20.272 1.00 28.61 ? 258 VAL A CG1 1 
ATOM   1818 C  CG2 . VAL A 1 258 ? -42.406 4.453   -22.695 1.00 28.24 ? 258 VAL A CG2 1 
ATOM   1819 N  N   . GLY A 1 259 ? -39.509 5.129   -18.791 1.00 28.34 ? 259 GLY A N   1 
ATOM   1820 C  CA  . GLY A 1 259 ? -39.000 4.665   -17.519 1.00 27.64 ? 259 GLY A CA  1 
ATOM   1821 C  C   . GLY A 1 259 ? -37.956 3.640   -17.928 1.00 27.09 ? 259 GLY A C   1 
ATOM   1822 O  O   . GLY A 1 259 ? -37.138 3.915   -18.803 1.00 23.47 ? 259 GLY A O   1 
ATOM   1823 N  N   . THR A 1 260 ? -37.986 2.454   -17.335 1.00 27.64 ? 260 THR A N   1 
ATOM   1824 C  CA  . THR A 1 260 ? -37.022 1.437   -17.714 1.00 28.62 ? 260 THR A CA  1 
ATOM   1825 C  C   . THR A 1 260 ? -37.675 0.304   -18.511 1.00 29.18 ? 260 THR A C   1 
ATOM   1826 O  O   . THR A 1 260 ? -37.472 -0.877  -18.242 1.00 30.05 ? 260 THR A O   1 
ATOM   1827 C  CB  . THR A 1 260 ? -36.276 0.901   -16.478 1.00 28.74 ? 260 THR A CB  1 
ATOM   1828 O  OG1 . THR A 1 260 ? -37.206 0.339   -15.548 1.00 29.97 ? 260 THR A OG1 1 
ATOM   1829 C  CG2 . THR A 1 260 ? -35.515 2.044   -15.802 1.00 30.08 ? 260 THR A CG2 1 
ATOM   1830 N  N   . MET A 1 261 ? -38.476 0.700   -19.496 1.00 30.29 ? 261 MET A N   1 
ATOM   1831 C  CA  . MET A 1 261 ? -39.166 -0.221  -20.394 1.00 29.94 ? 261 MET A CA  1 
ATOM   1832 C  C   . MET A 1 261 ? -38.985 0.359   -21.788 1.00 30.32 ? 261 MET A C   1 
ATOM   1833 O  O   . MET A 1 261 ? -38.936 1.579   -21.956 1.00 28.56 ? 261 MET A O   1 
ATOM   1834 C  CB  . MET A 1 261 ? -40.664 -0.288  -20.090 1.00 28.90 ? 261 MET A CB  1 
ATOM   1835 C  CG  . MET A 1 261 ? -41.016 -0.881  -18.747 1.00 30.06 ? 261 MET A CG  1 
ATOM   1836 S  SD  . MET A 1 261 ? -42.777 -0.715  -18.395 1.00 30.80 ? 261 MET A SD  1 
ATOM   1837 C  CE  . MET A 1 261 ? -42.783 0.734   -17.299 1.00 31.35 ? 261 MET A CE  1 
ATOM   1838 N  N   . ASN A 1 262 ? -38.883 -0.512  -22.783 1.00 28.45 ? 262 ASN A N   1 
ATOM   1839 C  CA  . ASN A 1 262 ? -38.723 -0.063  -24.153 1.00 26.44 ? 262 ASN A CA  1 
ATOM   1840 C  C   . ASN A 1 262 ? -40.006 0.592   -24.634 1.00 26.66 ? 262 ASN A C   1 
ATOM   1841 O  O   . ASN A 1 262 ? -41.099 0.217   -24.205 1.00 26.82 ? 262 ASN A O   1 
ATOM   1842 C  CB  . ASN A 1 262 ? -38.314 -1.237  -25.026 1.00 23.49 ? 262 ASN A CB  1 
ATOM   1843 C  CG  . ASN A 1 262 ? -36.911 -1.696  -24.718 1.00 23.90 ? 262 ASN A CG  1 
ATOM   1844 O  OD1 . ASN A 1 262 ? -35.955 -0.931  -24.877 1.00 23.64 ? 262 ASN A OD1 1 
ATOM   1845 N  ND2 . ASN A 1 262 ? -36.773 -2.937  -24.261 1.00 21.99 ? 262 ASN A ND2 1 
ATOM   1846 N  N   . LEU A 1 263 ? -39.857 1.570   -25.525 1.00 25.71 ? 263 LEU A N   1 
ATOM   1847 C  CA  . LEU A 1 263 ? -40.975 2.362   -26.031 1.00 25.29 ? 263 LEU A CA  1 
ATOM   1848 C  C   . LEU A 1 263 ? -41.502 2.042   -27.429 1.00 26.50 ? 263 LEU A C   1 
ATOM   1849 O  O   . LEU A 1 263 ? -40.756 2.065   -28.409 1.00 27.34 ? 263 LEU A O   1 
ATOM   1850 C  CB  . LEU A 1 263 ? -40.569 3.841   -25.961 1.00 22.78 ? 263 LEU A CB  1 
ATOM   1851 C  CG  . LEU A 1 263 ? -41.450 4.999   -26.434 1.00 24.77 ? 263 LEU A CG  1 
ATOM   1852 C  CD1 . LEU A 1 263 ? -40.769 6.302   -26.011 1.00 21.67 ? 263 LEU A CD1 1 
ATOM   1853 C  CD2 . LEU A 1 263 ? -41.644 4.976   -27.953 1.00 24.86 ? 263 LEU A CD2 1 
ATOM   1854 N  N   . PHE A 1 264 ? -42.802 1.778   -27.518 1.00 26.40 ? 264 PHE A N   1 
ATOM   1855 C  CA  . PHE A 1 264 ? -43.437 1.487   -28.799 1.00 25.83 ? 264 PHE A CA  1 
ATOM   1856 C  C   . PHE A 1 264 ? -44.515 2.523   -29.119 1.00 27.55 ? 264 PHE A C   1 
ATOM   1857 O  O   . PHE A 1 264 ? -45.261 2.950   -28.235 1.00 27.89 ? 264 PHE A O   1 
ATOM   1858 C  CB  . PHE A 1 264 ? -44.056 0.087   -28.794 1.00 26.42 ? 264 PHE A CB  1 
ATOM   1859 C  CG  . PHE A 1 264 ? -43.051 -1.027  -28.892 1.00 26.34 ? 264 PHE A CG  1 
ATOM   1860 C  CD1 . PHE A 1 264 ? -42.546 -1.633  -27.750 1.00 26.32 ? 264 PHE A CD1 1 
ATOM   1861 C  CD2 . PHE A 1 264 ? -42.608 -1.470  -30.136 1.00 27.61 ? 264 PHE A CD2 1 
ATOM   1862 C  CE1 . PHE A 1 264 ? -41.610 -2.671  -27.842 1.00 28.51 ? 264 PHE A CE1 1 
ATOM   1863 C  CE2 . PHE A 1 264 ? -41.674 -2.503  -30.240 1.00 28.01 ? 264 PHE A CE2 1 
ATOM   1864 C  CZ  . PHE A 1 264 ? -41.175 -3.104  -29.089 1.00 28.98 ? 264 PHE A CZ  1 
ATOM   1865 N  N   . LEU A 1 265 ? -44.593 2.918   -30.388 1.00 28.53 ? 265 LEU A N   1 
ATOM   1866 C  CA  . LEU A 1 265 ? -45.570 3.906   -30.847 1.00 28.52 ? 265 LEU A CA  1 
ATOM   1867 C  C   . LEU A 1 265 ? -46.329 3.437   -32.090 1.00 29.72 ? 265 LEU A C   1 
ATOM   1868 O  O   . LEU A 1 265 ? -45.807 3.510   -33.197 1.00 30.72 ? 265 LEU A O   1 
ATOM   1869 C  CB  . LEU A 1 265 ? -44.863 5.214   -31.173 1.00 27.81 ? 265 LEU A CB  1 
ATOM   1870 C  CG  . LEU A 1 265 ? -45.767 6.301   -31.744 1.00 29.20 ? 265 LEU A CG  1 
ATOM   1871 C  CD1 . LEU A 1 265 ? -46.685 6.833   -30.648 1.00 27.70 ? 265 LEU A CD1 1 
ATOM   1872 C  CD2 . LEU A 1 265 ? -44.901 7.412   -32.323 1.00 29.36 ? 265 LEU A CD2 1 
ATOM   1873 N  N   . TYR A 1 266 ? -47.560 2.966   -31.901 1.00 30.47 ? 266 TYR A N   1 
ATOM   1874 C  CA  . TYR A 1 266 ? -48.404 2.483   -32.993 1.00 30.74 ? 266 TYR A CA  1 
ATOM   1875 C  C   . TYR A 1 266 ? -49.087 3.687   -33.654 1.00 32.01 ? 266 TYR A C   1 
ATOM   1876 O  O   . TYR A 1 266 ? -49.892 4.374   -33.023 1.00 32.20 ? 266 TYR A O   1 
ATOM   1877 C  CB  . TYR A 1 266 ? -49.449 1.526   -32.421 1.00 32.21 ? 266 TYR A CB  1 
ATOM   1878 C  CG  . TYR A 1 266 ? -50.275 0.795   -33.444 1.00 31.52 ? 266 TYR A CG  1 
ATOM   1879 C  CD1 . TYR A 1 266 ? -51.531 0.304   -33.110 1.00 34.31 ? 266 TYR A CD1 1 
ATOM   1880 C  CD2 . TYR A 1 266 ? -49.806 0.584   -34.741 1.00 32.56 ? 266 TYR A CD2 1 
ATOM   1881 C  CE1 . TYR A 1 266 ? -52.312 -0.380  -34.038 1.00 35.92 ? 266 TYR A CE1 1 
ATOM   1882 C  CE2 . TYR A 1 266 ? -50.582 -0.106  -35.687 1.00 32.80 ? 266 TYR A CE2 1 
ATOM   1883 C  CZ  . TYR A 1 266 ? -51.833 -0.581  -35.323 1.00 34.80 ? 266 TYR A CZ  1 
ATOM   1884 O  OH  . TYR A 1 266 ? -52.618 -1.262  -36.223 1.00 36.03 ? 266 TYR A OH  1 
ATOM   1885 N  N   . TRP A 1 267 ? -48.792 3.939   -34.925 1.00 32.93 ? 267 TRP A N   1 
ATOM   1886 C  CA  . TRP A 1 267 ? -49.367 5.108   -35.580 1.00 33.22 ? 267 TRP A CA  1 
ATOM   1887 C  C   . TRP A 1 267 ? -49.313 5.129   -37.106 1.00 34.91 ? 267 TRP A C   1 
ATOM   1888 O  O   . TRP A 1 267 ? -48.894 4.170   -37.762 1.00 35.19 ? 267 TRP A O   1 
ATOM   1889 C  CB  . TRP A 1 267 ? -48.645 6.363   -35.071 1.00 33.23 ? 267 TRP A CB  1 
ATOM   1890 C  CG  . TRP A 1 267 ? -47.234 6.518   -35.629 1.00 31.38 ? 267 TRP A CG  1 
ATOM   1891 C  CD1 . TRP A 1 267 ? -46.457 5.536   -36.185 1.00 33.45 ? 267 TRP A CD1 1 
ATOM   1892 C  CD2 . TRP A 1 267 ? -46.435 7.712   -35.650 1.00 32.50 ? 267 TRP A CD2 1 
ATOM   1893 N  NE1 . TRP A 1 267 ? -45.231 6.043   -36.547 1.00 32.74 ? 267 TRP A NE1 1 
ATOM   1894 C  CE2 . TRP A 1 267 ? -45.189 7.374   -36.229 1.00 32.97 ? 267 TRP A CE2 1 
ATOM   1895 C  CE3 . TRP A 1 267 ? -46.648 9.033   -35.234 1.00 33.44 ? 267 TRP A CE3 1 
ATOM   1896 C  CZ2 . TRP A 1 267 ? -44.163 8.309   -36.401 1.00 34.30 ? 267 TRP A CZ2 1 
ATOM   1897 C  CZ3 . TRP A 1 267 ? -45.620 9.966   -35.406 1.00 33.09 ? 267 TRP A CZ3 1 
ATOM   1898 C  CH2 . TRP A 1 267 ? -44.398 9.596   -35.984 1.00 34.59 ? 267 TRP A CH2 1 
ATOM   1899 N  N   . ILE A 1 268 ? -49.746 6.266   -37.642 1.00 35.57 ? 268 ILE A N   1 
ATOM   1900 C  CA  . ILE A 1 268 ? -49.736 6.552   -39.066 1.00 35.95 ? 268 ILE A CA  1 
ATOM   1901 C  C   . ILE A 1 268 ? -48.543 7.485   -39.198 1.00 36.53 ? 268 ILE A C   1 
ATOM   1902 O  O   . ILE A 1 268 ? -48.595 8.622   -38.728 1.00 34.81 ? 268 ILE A O   1 
ATOM   1903 C  CB  . ILE A 1 268 ? -51.010 7.320   -39.502 1.00 37.16 ? 268 ILE A CB  1 
ATOM   1904 C  CG1 . ILE A 1 268 ? -52.174 6.345   -39.700 1.00 37.93 ? 268 ILE A CG1 1 
ATOM   1905 C  CG2 . ILE A 1 268 ? -50.745 8.105   -40.783 1.00 37.30 ? 268 ILE A CG2 1 
ATOM   1906 C  CD1 . ILE A 1 268 ? -52.629 5.650   -38.439 1.00 40.12 ? 268 ILE A CD1 1 
ATOM   1907 N  N   . ASN A 1 269 ? -47.470 7.012   -39.824 1.00 37.81 ? 269 ASN A N   1 
ATOM   1908 C  CA  . ASN A 1 269 ? -46.274 7.834   -39.975 1.00 39.37 ? 269 ASN A CA  1 
ATOM   1909 C  C   . ASN A 1 269 ? -46.444 8.984   -40.960 1.00 40.37 ? 269 ASN A C   1 
ATOM   1910 O  O   . ASN A 1 269 ? -47.521 9.178   -41.523 1.00 39.81 ? 269 ASN A O   1 
ATOM   1911 C  CB  . ASN A 1 269 ? -45.075 6.967   -40.374 1.00 40.59 ? 269 ASN A CB  1 
ATOM   1912 C  CG  . ASN A 1 269 ? -45.264 6.271   -41.705 1.00 43.22 ? 269 ASN A CG  1 
ATOM   1913 O  OD1 . ASN A 1 269 ? -44.486 5.384   -42.061 1.00 45.23 ? 269 ASN A OD1 1 
ATOM   1914 N  ND2 . ASN A 1 269 ? -46.289 6.671   -42.454 1.00 44.31 ? 269 ASN A ND2 1 
ATOM   1915 N  N   . GLU A 1 270 ? -45.371 9.743   -41.160 1.00 40.96 ? 270 GLU A N   1 
ATOM   1916 C  CA  . GLU A 1 270 ? -45.388 10.891  -42.055 1.00 42.81 ? 270 GLU A CA  1 
ATOM   1917 C  C   . GLU A 1 270 ? -45.778 10.529  -43.491 1.00 43.64 ? 270 GLU A C   1 
ATOM   1918 O  O   . GLU A 1 270 ? -46.041 11.412  -44.313 1.00 43.36 ? 270 GLU A O   1 
ATOM   1919 C  CB  . GLU A 1 270 ? -44.016 11.582  -42.045 1.00 43.29 ? 270 GLU A CB  1 
ATOM   1920 C  CG  . GLU A 1 270 ? -43.567 12.075  -40.668 1.00 44.13 ? 270 GLU A CG  1 
ATOM   1921 C  CD  . GLU A 1 270 ? -42.623 11.111  -39.962 1.00 44.58 ? 270 GLU A CD  1 
ATOM   1922 O  OE1 . GLU A 1 270 ? -42.843 9.881   -40.044 1.00 43.16 ? 270 GLU A OE1 1 
ATOM   1923 O  OE2 . GLU A 1 270 ? -41.663 11.587  -39.316 1.00 46.33 ? 270 GLU A OE2 1 
ATOM   1924 N  N   . ASP A 1 271 ? -45.821 9.234   -43.786 1.00 44.03 ? 271 ASP A N   1 
ATOM   1925 C  CA  . ASP A 1 271 ? -46.172 8.762   -45.121 1.00 45.05 ? 271 ASP A CA  1 
ATOM   1926 C  C   . ASP A 1 271 ? -47.585 8.212   -45.226 1.00 44.67 ? 271 ASP A C   1 
ATOM   1927 O  O   . ASP A 1 271 ? -47.971 7.698   -46.276 1.00 45.12 ? 271 ASP A O   1 
ATOM   1928 C  CB  . ASP A 1 271 ? -45.188 7.687   -45.574 1.00 47.76 ? 271 ASP A CB  1 
ATOM   1929 C  CG  . ASP A 1 271 ? -43.957 8.267   -46.214 1.00 49.68 ? 271 ASP A CG  1 
ATOM   1930 O  OD1 . ASP A 1 271 ? -42.997 7.503   -46.445 1.00 50.79 ? 271 ASP A OD1 1 
ATOM   1931 O  OD2 . ASP A 1 271 ? -43.956 9.486   -46.490 1.00 50.96 ? 271 ASP A OD2 1 
ATOM   1932 N  N   . GLY A 1 272 ? -48.350 8.311   -44.143 1.00 43.03 ? 272 GLY A N   1 
ATOM   1933 C  CA  . GLY A 1 272 ? -49.717 7.820   -44.158 1.00 41.15 ? 272 GLY A CA  1 
ATOM   1934 C  C   . GLY A 1 272 ? -49.809 6.312   -44.025 1.00 40.93 ? 272 GLY A C   1 
ATOM   1935 O  O   . GLY A 1 272 ? -50.844 5.716   -44.314 1.00 39.63 ? 272 GLY A O   1 
ATOM   1936 N  N   . GLU A 1 273 ? -48.725 5.689   -43.580 1.00 39.82 ? 273 GLU A N   1 
ATOM   1937 C  CA  . GLU A 1 273 ? -48.708 4.244   -43.418 1.00 39.27 ? 273 GLU A CA  1 
ATOM   1938 C  C   . GLU A 1 273 ? -48.891 3.826   -41.967 1.00 37.09 ? 273 GLU A C   1 
ATOM   1939 O  O   . GLU A 1 273 ? -48.375 4.465   -41.055 1.00 35.86 ? 273 GLU A O   1 
ATOM   1940 C  CB  . GLU A 1 273 ? -47.386 3.672   -43.941 1.00 41.05 ? 273 GLU A CB  1 
ATOM   1941 C  CG  . GLU A 1 273 ? -47.184 3.840   -45.440 1.00 45.63 ? 273 GLU A CG  1 
ATOM   1942 C  CD  . GLU A 1 273 ? -45.751 3.580   -45.878 1.00 48.08 ? 273 GLU A CD  1 
ATOM   1943 O  OE1 . GLU A 1 273 ? -45.534 3.371   -47.090 1.00 50.03 ? 273 GLU A OE1 1 
ATOM   1944 O  OE2 . GLU A 1 273 ? -44.840 3.595   -45.020 1.00 48.63 ? 273 GLU A OE2 1 
ATOM   1945 N  N   . GLU A 1 274 ? -49.652 2.760   -41.764 1.00 35.85 ? 274 GLU A N   1 
ATOM   1946 C  CA  . GLU A 1 274 ? -49.856 2.218   -40.435 1.00 36.85 ? 274 GLU A CA  1 
ATOM   1947 C  C   . GLU A 1 274 ? -48.456 1.720   -40.057 1.00 36.30 ? 274 GLU A C   1 
ATOM   1948 O  O   . GLU A 1 274 ? -47.774 1.106   -40.879 1.00 34.59 ? 274 GLU A O   1 
ATOM   1949 C  CB  . GLU A 1 274 ? -50.854 1.059   -40.492 1.00 37.68 ? 274 GLU A CB  1 
ATOM   1950 C  CG  . GLU A 1 274 ? -51.226 0.484   -39.139 1.00 40.79 ? 274 GLU A CG  1 
ATOM   1951 C  CD  . GLU A 1 274 ? -52.459 -0.396  -39.206 1.00 41.82 ? 274 GLU A CD  1 
ATOM   1952 O  OE1 . GLU A 1 274 ? -53.501 0.079   -39.705 1.00 43.90 ? 274 GLU A OE1 1 
ATOM   1953 O  OE2 . GLU A 1 274 ? -52.393 -1.558  -38.758 1.00 42.27 ? 274 GLU A OE2 1 
ATOM   1954 N  N   . GLU A 1 275 ? -48.025 1.981   -38.827 1.00 35.04 ? 275 GLU A N   1 
ATOM   1955 C  CA  . GLU A 1 275 ? -46.681 1.590   -38.430 1.00 33.57 ? 275 GLU A CA  1 
ATOM   1956 C  C   . GLU A 1 275 ? -46.490 1.369   -36.928 1.00 32.72 ? 275 GLU A C   1 
ATOM   1957 O  O   . GLU A 1 275 ? -47.107 2.040   -36.098 1.00 32.00 ? 275 GLU A O   1 
ATOM   1958 C  CB  . GLU A 1 275 ? -45.713 2.667   -38.924 1.00 34.91 ? 275 GLU A CB  1 
ATOM   1959 C  CG  . GLU A 1 275 ? -44.233 2.423   -38.647 1.00 37.41 ? 275 GLU A CG  1 
ATOM   1960 C  CD  . GLU A 1 275 ? -43.359 3.566   -39.154 1.00 36.52 ? 275 GLU A CD  1 
ATOM   1961 O  OE1 . GLU A 1 275 ? -43.380 4.648   -38.539 1.00 37.46 ? 275 GLU A OE1 1 
ATOM   1962 O  OE2 . GLU A 1 275 ? -42.660 3.390   -40.176 1.00 38.84 ? 275 GLU A OE2 1 
ATOM   1963 N  N   . LEU A 1 276 ? -45.638 0.407   -36.592 1.00 31.07 ? 276 LEU A N   1 
ATOM   1964 C  CA  . LEU A 1 276 ? -45.317 0.111   -35.199 1.00 32.23 ? 276 LEU A CA  1 
ATOM   1965 C  C   . LEU A 1 276 ? -43.868 0.562   -35.093 1.00 33.11 ? 276 LEU A C   1 
ATOM   1966 O  O   . LEU A 1 276 ? -42.969 -0.080  -35.643 1.00 34.43 ? 276 LEU A O   1 
ATOM   1967 C  CB  . LEU A 1 276 ? -45.424 -1.391  -34.919 1.00 30.96 ? 276 LEU A CB  1 
ATOM   1968 C  CG  . LEU A 1 276 ? -45.514 -1.909  -33.469 1.00 30.41 ? 276 LEU A CG  1 
ATOM   1969 C  CD1 . LEU A 1 276 ? -44.410 -2.919  -33.220 1.00 25.00 ? 276 LEU A CD1 1 
ATOM   1970 C  CD2 . LEU A 1 276 ? -45.429 -0.781  -32.474 1.00 26.36 ? 276 LEU A CD2 1 
ATOM   1971 N  N   . ALA A 1 277 ? -43.643 1.677   -34.410 1.00 32.36 ? 277 ALA A N   1 
ATOM   1972 C  CA  . ALA A 1 277 ? -42.300 2.218   -34.280 1.00 29.78 ? 277 ALA A CA  1 
ATOM   1973 C  C   . ALA A 1 277 ? -41.708 2.063   -32.889 1.00 28.98 ? 277 ALA A C   1 
ATOM   1974 O  O   . ALA A 1 277 ? -42.431 2.020   -31.894 1.00 26.78 ? 277 ALA A O   1 
ATOM   1975 C  CB  . ALA A 1 277 ? -42.300 3.692   -34.692 1.00 29.64 ? 277 ALA A CB  1 
ATOM   1976 N  N   . THR A 1 278 ? -40.379 1.988   -32.843 1.00 29.03 ? 278 THR A N   1 
ATOM   1977 C  CA  . THR A 1 278 ? -39.622 1.838   -31.600 1.00 28.74 ? 278 THR A CA  1 
ATOM   1978 C  C   . THR A 1 278 ? -38.170 2.245   -31.882 1.00 28.08 ? 278 THR A C   1 
ATOM   1979 O  O   . THR A 1 278 ? -37.619 1.926   -32.939 1.00 29.87 ? 278 THR A O   1 
ATOM   1980 C  CB  . THR A 1 278 ? -39.672 0.382   -31.090 1.00 28.58 ? 278 THR A CB  1 
ATOM   1981 O  OG1 . THR A 1 278 ? -39.101 0.312   -29.777 1.00 31.79 ? 278 THR A OG1 1 
ATOM   1982 C  CG2 . THR A 1 278 ? -38.904 -0.548  -32.032 1.00 28.33 ? 278 THR A CG2 1 
ATOM   1983 N  N   . PRO A 1 279 ? -37.533 2.964   -30.945 1.00 27.07 ? 279 PRO A N   1 
ATOM   1984 C  CA  . PRO A 1 279 ? -36.146 3.389   -31.165 1.00 26.62 ? 279 PRO A CA  1 
ATOM   1985 C  C   . PRO A 1 279 ? -35.181 2.254   -31.508 1.00 25.94 ? 279 PRO A C   1 
ATOM   1986 O  O   . PRO A 1 279 ? -35.344 1.119   -31.051 1.00 23.84 ? 279 PRO A O   1 
ATOM   1987 C  CB  . PRO A 1 279 ? -35.788 4.088   -29.858 1.00 25.76 ? 279 PRO A CB  1 
ATOM   1988 C  CG  . PRO A 1 279 ? -37.130 4.653   -29.410 1.00 26.56 ? 279 PRO A CG  1 
ATOM   1989 C  CD  . PRO A 1 279 ? -38.049 3.485   -29.665 1.00 26.69 ? 279 PRO A CD  1 
ATOM   1990 N  N   . PRO A 1 280 ? -34.164 2.553   -32.331 1.00 25.11 ? 280 PRO A N   1 
ATOM   1991 C  CA  . PRO A 1 280 ? -33.166 1.558   -32.738 1.00 27.30 ? 280 PRO A CA  1 
ATOM   1992 C  C   . PRO A 1 280 ? -32.062 1.391   -31.687 1.00 27.23 ? 280 PRO A C   1 
ATOM   1993 O  O   . PRO A 1 280 ? -31.833 2.279   -30.872 1.00 26.97 ? 280 PRO A O   1 
ATOM   1994 C  CB  . PRO A 1 280 ? -32.636 2.131   -34.050 1.00 25.62 ? 280 PRO A CB  1 
ATOM   1995 C  CG  . PRO A 1 280 ? -32.620 3.603   -33.756 1.00 25.14 ? 280 PRO A CG  1 
ATOM   1996 C  CD  . PRO A 1 280 ? -33.948 3.833   -33.034 1.00 23.83 ? 280 PRO A CD  1 
ATOM   1997 N  N   . LEU A 1 281 ? -31.387 0.248   -31.719 1.00 27.08 ? 281 LEU A N   1 
ATOM   1998 C  CA  . LEU A 1 281 ? -30.303 -0.038  -30.788 1.00 27.24 ? 281 LEU A CA  1 
ATOM   1999 C  C   . LEU A 1 281 ? -29.021 0.663   -31.226 1.00 27.55 ? 281 LEU A C   1 
ATOM   2000 O  O   . LEU A 1 281 ? -28.093 0.018   -31.726 1.00 26.90 ? 281 LEU A O   1 
ATOM   2001 C  CB  . LEU A 1 281 ? -30.066 -1.543  -30.732 1.00 26.73 ? 281 LEU A CB  1 
ATOM   2002 C  CG  . LEU A 1 281 ? -31.346 -2.335  -30.476 1.00 29.19 ? 281 LEU A CG  1 
ATOM   2003 C  CD1 . LEU A 1 281 ? -31.081 -3.836  -30.645 1.00 28.09 ? 281 LEU A CD1 1 
ATOM   2004 C  CD2 . LEU A 1 281 ? -31.869 -1.993  -29.076 1.00 27.34 ? 281 LEU A CD2 1 
ATOM   2005 N  N   . ASP A 1 282 ? -28.974 1.981   -31.046 1.00 28.21 ? 282 ASP A N   1 
ATOM   2006 C  CA  . ASP A 1 282 ? -27.800 2.756   -31.428 1.00 26.82 ? 282 ASP A CA  1 
ATOM   2007 C  C   . ASP A 1 282 ? -26.909 3.058   -30.235 1.00 27.02 ? 282 ASP A C   1 
ATOM   2008 O  O   . ASP A 1 282 ? -26.127 4.013   -30.268 1.00 25.36 ? 282 ASP A O   1 
ATOM   2009 C  CB  . ASP A 1 282 ? -28.200 4.071   -32.122 1.00 28.97 ? 282 ASP A CB  1 
ATOM   2010 C  CG  . ASP A 1 282 ? -28.944 5.031   -31.203 1.00 27.84 ? 282 ASP A CG  1 
ATOM   2011 O  OD1 . ASP A 1 282 ? -29.128 6.208   -31.589 1.00 24.19 ? 282 ASP A OD1 1 
ATOM   2012 O  OD2 . ASP A 1 282 ? -29.352 4.613   -30.102 1.00 29.74 ? 282 ASP A OD2 1 
ATOM   2013 N  N   . GLY A 1 283 ? -27.041 2.252   -29.181 1.00 25.81 ? 283 GLY A N   1 
ATOM   2014 C  CA  . GLY A 1 283 ? -26.204 2.426   -28.007 1.00 25.30 ? 283 GLY A CA  1 
ATOM   2015 C  C   . GLY A 1 283 ? -26.849 2.982   -26.750 1.00 27.25 ? 283 GLY A C   1 
ATOM   2016 O  O   . GLY A 1 283 ? -26.322 2.774   -25.652 1.00 26.78 ? 283 GLY A O   1 
ATOM   2017 N  N   . ILE A 1 284 ? -27.976 3.680   -26.886 1.00 27.22 ? 284 ILE A N   1 
ATOM   2018 C  CA  . ILE A 1 284 ? -28.646 4.260   -25.723 1.00 28.14 ? 284 ILE A CA  1 
ATOM   2019 C  C   . ILE A 1 284 ? -29.963 3.584   -25.328 1.00 28.41 ? 284 ILE A C   1 
ATOM   2020 O  O   . ILE A 1 284 ? -30.672 4.064   -24.440 1.00 29.24 ? 284 ILE A O   1 
ATOM   2021 C  CB  . ILE A 1 284 ? -28.924 5.767   -25.919 1.00 27.76 ? 284 ILE A CB  1 
ATOM   2022 C  CG1 . ILE A 1 284 ? -29.904 5.971   -27.067 1.00 26.11 ? 284 ILE A CG1 1 
ATOM   2023 C  CG2 . ILE A 1 284 ? -27.628 6.506   -26.198 1.00 29.09 ? 284 ILE A CG2 1 
ATOM   2024 C  CD1 . ILE A 1 284 ? -30.436 7.388   -27.177 1.00 31.53 ? 284 ILE A CD1 1 
ATOM   2025 N  N   . ILE A 1 285 ? -30.296 2.485   -25.992 1.00 26.02 ? 285 ILE A N   1 
ATOM   2026 C  CA  . ILE A 1 285 ? -31.512 1.744   -25.670 1.00 26.36 ? 285 ILE A CA  1 
ATOM   2027 C  C   . ILE A 1 285 ? -31.128 0.327   -25.256 1.00 27.19 ? 285 ILE A C   1 
ATOM   2028 O  O   . ILE A 1 285 ? -30.230 -0.278  -25.837 1.00 28.72 ? 285 ILE A O   1 
ATOM   2029 C  CB  . ILE A 1 285 ? -32.475 1.662   -26.879 1.00 26.21 ? 285 ILE A CB  1 
ATOM   2030 C  CG1 . ILE A 1 285 ? -33.062 3.044   -27.178 1.00 24.48 ? 285 ILE A CG1 1 
ATOM   2031 C  CG2 . ILE A 1 285 ? -33.574 0.655   -26.604 1.00 24.72 ? 285 ILE A CG2 1 
ATOM   2032 C  CD1 . ILE A 1 285 ? -32.152 3.913   -27.992 1.00 28.81 ? 285 ILE A CD1 1 
ATOM   2033 N  N   . LEU A 1 286 ? -31.799 -0.207  -24.247 1.00 26.40 ? 286 LEU A N   1 
ATOM   2034 C  CA  . LEU A 1 286 ? -31.480 -1.553  -23.808 1.00 28.73 ? 286 LEU A CA  1 
ATOM   2035 C  C   . LEU A 1 286 ? -32.308 -2.578  -24.578 1.00 28.77 ? 286 LEU A C   1 
ATOM   2036 O  O   . LEU A 1 286 ? -33.532 -2.517  -24.592 1.00 27.87 ? 286 LEU A O   1 
ATOM   2037 C  CB  . LEU A 1 286 ? -31.723 -1.682  -22.304 1.00 30.48 ? 286 LEU A CB  1 
ATOM   2038 C  CG  . LEU A 1 286 ? -31.256 -2.994  -21.687 1.00 31.22 ? 286 LEU A CG  1 
ATOM   2039 C  CD1 . LEU A 1 286 ? -30.834 -2.747  -20.258 1.00 32.72 ? 286 LEU A CD1 1 
ATOM   2040 C  CD2 . LEU A 1 286 ? -32.365 -4.039  -21.786 1.00 32.51 ? 286 LEU A CD2 1 
ATOM   2041 N  N   . PRO A 1 287 ? -31.642 -3.530  -25.242 1.00 30.10 ? 287 PRO A N   1 
ATOM   2042 C  CA  . PRO A 1 287 ? -32.362 -4.556  -26.007 1.00 31.01 ? 287 PRO A CA  1 
ATOM   2043 C  C   . PRO A 1 287 ? -33.167 -5.487  -25.108 1.00 29.55 ? 287 PRO A C   1 
ATOM   2044 O  O   . PRO A 1 287 ? -32.651 -6.489  -24.620 1.00 29.23 ? 287 PRO A O   1 
ATOM   2045 C  CB  . PRO A 1 287 ? -31.243 -5.278  -26.761 1.00 33.51 ? 287 PRO A CB  1 
ATOM   2046 C  CG  . PRO A 1 287 ? -30.060 -5.130  -25.833 1.00 34.30 ? 287 PRO A CG  1 
ATOM   2047 C  CD  . PRO A 1 287 ? -30.182 -3.691  -25.375 1.00 31.98 ? 287 PRO A CD  1 
ATOM   2048 N  N   . GLY A 1 288 ? -34.434 -5.141  -24.895 1.00 28.81 ? 288 GLY A N   1 
ATOM   2049 C  CA  . GLY A 1 288 ? -35.291 -5.942  -24.046 1.00 30.26 ? 288 GLY A CA  1 
ATOM   2050 C  C   . GLY A 1 288 ? -35.815 -7.194  -24.715 1.00 32.43 ? 288 GLY A C   1 
ATOM   2051 O  O   . GLY A 1 288 ? -36.056 -7.220  -25.927 1.00 33.56 ? 288 GLY A O   1 
ATOM   2052 N  N   . VAL A 1 289 ? -35.990 -8.240  -23.917 1.00 32.53 ? 289 VAL A N   1 
ATOM   2053 C  CA  . VAL A 1 289 ? -36.507 -9.508  -24.418 1.00 32.68 ? 289 VAL A CA  1 
ATOM   2054 C  C   . VAL A 1 289 ? -37.939 -9.310  -24.917 1.00 32.16 ? 289 VAL A C   1 
ATOM   2055 O  O   . VAL A 1 289 ? -38.351 -9.888  -25.926 1.00 32.08 ? 289 VAL A O   1 
ATOM   2056 C  CB  . VAL A 1 289 ? -36.508 -10.584 -23.303 1.00 33.60 ? 289 VAL A CB  1 
ATOM   2057 C  CG1 . VAL A 1 289 ? -37.062 -11.900 -23.845 1.00 31.54 ? 289 VAL A CG1 1 
ATOM   2058 C  CG2 . VAL A 1 289 ? -35.096 -10.777 -22.765 1.00 32.18 ? 289 VAL A CG2 1 
ATOM   2059 N  N   . THR A 1 290 ? -38.694 -8.480  -24.207 1.00 31.29 ? 290 THR A N   1 
ATOM   2060 C  CA  . THR A 1 290 ? -40.073 -8.213  -24.582 1.00 29.56 ? 290 THR A CA  1 
ATOM   2061 C  C   . THR A 1 290 ? -40.097 -7.414  -25.874 1.00 29.80 ? 290 THR A C   1 
ATOM   2062 O  O   . THR A 1 290 ? -40.992 -7.572  -26.703 1.00 31.58 ? 290 THR A O   1 
ATOM   2063 C  CB  . THR A 1 290 ? -40.788 -7.436  -23.486 1.00 28.25 ? 290 THR A CB  1 
ATOM   2064 O  OG1 . THR A 1 290 ? -40.475 -8.025  -22.216 1.00 28.69 ? 290 THR A OG1 1 
ATOM   2065 C  CG2 . THR A 1 290 ? -42.289 -7.487  -23.700 1.00 25.74 ? 290 THR A CG2 1 
ATOM   2066 N  N   . ARG A 1 291 ? -39.103 -6.552  -26.040 1.00 29.06 ? 291 ARG A N   1 
ATOM   2067 C  CA  . ARG A 1 291 ? -38.988 -5.742  -27.245 1.00 28.55 ? 291 ARG A CA  1 
ATOM   2068 C  C   . ARG A 1 291 ? -38.784 -6.697  -28.426 1.00 28.94 ? 291 ARG A C   1 
ATOM   2069 O  O   . ARG A 1 291 ? -39.543 -6.665  -29.396 1.00 29.00 ? 291 ARG A O   1 
ATOM   2070 C  CB  . ARG A 1 291 ? -37.792 -4.793  -27.110 1.00 24.97 ? 291 ARG A CB  1 
ATOM   2071 C  CG  . ARG A 1 291 ? -37.468 -3.954  -28.336 1.00 22.71 ? 291 ARG A CG  1 
ATOM   2072 C  CD  . ARG A 1 291 ? -36.189 -3.125  -28.087 1.00 23.18 ? 291 ARG A CD  1 
ATOM   2073 N  NE  . ARG A 1 291 ? -35.857 -2.259  -29.214 1.00 27.32 ? 291 ARG A NE  1 
ATOM   2074 C  CZ  . ARG A 1 291 ? -35.224 -2.651  -30.318 1.00 26.52 ? 291 ARG A CZ  1 
ATOM   2075 N  NH1 . ARG A 1 291 ? -34.835 -3.913  -30.457 1.00 26.78 ? 291 ARG A NH1 1 
ATOM   2076 N  NH2 . ARG A 1 291 ? -34.988 -1.776  -31.291 1.00 22.38 ? 291 ARG A NH2 1 
ATOM   2077 N  N   . ARG A 1 292 ? -37.758 -7.545  -28.326 1.00 27.43 ? 292 ARG A N   1 
ATOM   2078 C  CA  . ARG A 1 292 ? -37.443 -8.522  -29.369 1.00 28.37 ? 292 ARG A CA  1 
ATOM   2079 C  C   . ARG A 1 292 ? -38.707 -9.244  -29.812 1.00 29.51 ? 292 ARG A C   1 
ATOM   2080 O  O   . ARG A 1 292 ? -39.051 -9.249  -30.994 1.00 28.50 ? 292 ARG A O   1 
ATOM   2081 C  CB  . ARG A 1 292 ? -36.444 -9.562  -28.841 1.00 28.70 ? 292 ARG A CB  1 
ATOM   2082 C  CG  . ARG A 1 292 ? -36.048 -10.687 -29.831 1.00 28.06 ? 292 ARG A CG  1 
ATOM   2083 C  CD  . ARG A 1 292 ? -35.070 -10.201 -30.915 1.00 27.55 ? 292 ARG A CD  1 
ATOM   2084 N  NE  . ARG A 1 292 ? -35.746 -9.723  -32.120 1.00 28.08 ? 292 ARG A NE  1 
ATOM   2085 C  CZ  . ARG A 1 292 ? -35.562 -8.521  -32.659 1.00 27.29 ? 292 ARG A CZ  1 
ATOM   2086 N  NH1 . ARG A 1 292 ? -34.723 -7.664  -32.099 1.00 29.25 ? 292 ARG A NH1 1 
ATOM   2087 N  NH2 . ARG A 1 292 ? -36.213 -8.177  -33.761 1.00 28.91 ? 292 ARG A NH2 1 
ATOM   2088 N  N   . CYS A 1 293 ? -39.398 -9.847  -28.850 1.00 30.29 ? 293 CYS A N   1 
ATOM   2089 C  CA  . CYS A 1 293 ? -40.612 -10.599 -29.132 1.00 31.91 ? 293 CYS A CA  1 
ATOM   2090 C  C   . CYS A 1 293 ? -41.672 -9.798  -29.880 1.00 32.29 ? 293 CYS A C   1 
ATOM   2091 O  O   . CYS A 1 293 ? -42.230 -10.266 -30.879 1.00 33.35 ? 293 CYS A O   1 
ATOM   2092 C  CB  . CYS A 1 293 ? -41.195 -11.149 -27.829 1.00 33.06 ? 293 CYS A CB  1 
ATOM   2093 S  SG  . CYS A 1 293 ? -40.127 -12.364 -27.007 1.00 37.03 ? 293 CYS A SG  1 
ATOM   2094 N  N   . ILE A 1 294 ? -41.950 -8.595  -29.396 1.00 30.86 ? 294 ILE A N   1 
ATOM   2095 C  CA  . ILE A 1 294 ? -42.945 -7.742  -30.023 1.00 29.43 ? 294 ILE A CA  1 
ATOM   2096 C  C   . ILE A 1 294 ? -42.555 -7.413  -31.466 1.00 29.31 ? 294 ILE A C   1 
ATOM   2097 O  O   . ILE A 1 294 ? -43.419 -7.220  -32.327 1.00 28.77 ? 294 ILE A O   1 
ATOM   2098 C  CB  . ILE A 1 294 ? -43.127 -6.438  -29.210 1.00 28.93 ? 294 ILE A CB  1 
ATOM   2099 C  CG1 . ILE A 1 294 ? -43.774 -6.768  -27.855 1.00 29.05 ? 294 ILE A CG1 1 
ATOM   2100 C  CG2 . ILE A 1 294 ? -43.970 -5.440  -29.992 1.00 25.83 ? 294 ILE A CG2 1 
ATOM   2101 C  CD1 . ILE A 1 294 ? -43.774 -5.615  -26.864 1.00 29.60 ? 294 ILE A CD1 1 
ATOM   2102 N  N   . LEU A 1 295 ? -41.256 -7.338  -31.732 1.00 28.73 ? 295 LEU A N   1 
ATOM   2103 C  CA  . LEU A 1 295 ? -40.797 -7.045  -33.087 1.00 27.98 ? 295 LEU A CA  1 
ATOM   2104 C  C   . LEU A 1 295 ? -40.968 -8.287  -33.965 1.00 29.21 ? 295 LEU A C   1 
ATOM   2105 O  O   . LEU A 1 295 ? -41.333 -8.182  -35.141 1.00 28.55 ? 295 LEU A O   1 
ATOM   2106 C  CB  . LEU A 1 295 ? -39.332 -6.595  -33.076 1.00 25.37 ? 295 LEU A CB  1 
ATOM   2107 C  CG  . LEU A 1 295 ? -39.071 -5.164  -32.584 1.00 25.60 ? 295 LEU A CG  1 
ATOM   2108 C  CD1 . LEU A 1 295 ? -37.583 -4.961  -32.359 1.00 24.79 ? 295 LEU A CD1 1 
ATOM   2109 C  CD2 . LEU A 1 295 ? -39.602 -4.160  -33.597 1.00 23.43 ? 295 LEU A CD2 1 
ATOM   2110 N  N   . ASP A 1 296 ? -40.713 -9.461  -33.390 1.00 28.04 ? 296 ASP A N   1 
ATOM   2111 C  CA  . ASP A 1 296 ? -40.856 -10.708 -34.131 1.00 29.34 ? 296 ASP A CA  1 
ATOM   2112 C  C   . ASP A 1 296 ? -42.331 -10.954 -34.435 1.00 28.52 ? 296 ASP A C   1 
ATOM   2113 O  O   . ASP A 1 296 ? -42.680 -11.358 -35.546 1.00 27.16 ? 296 ASP A O   1 
ATOM   2114 C  CB  . ASP A 1 296 ? -40.279 -11.894 -33.340 1.00 29.16 ? 296 ASP A CB  1 
ATOM   2115 C  CG  . ASP A 1 296 ? -38.764 -11.862 -33.261 1.00 29.08 ? 296 ASP A CG  1 
ATOM   2116 O  OD1 . ASP A 1 296 ? -38.133 -11.202 -34.115 1.00 28.96 ? 296 ASP A OD1 1 
ATOM   2117 O  OD2 . ASP A 1 296 ? -38.205 -12.512 -32.354 1.00 31.06 ? 296 ASP A OD2 1 
ATOM   2118 N  N   . LEU A 1 297 ? -43.193 -10.714 -33.448 1.00 29.82 ? 297 LEU A N   1 
ATOM   2119 C  CA  . LEU A 1 297 ? -44.627 -10.890 -33.653 1.00 30.34 ? 297 LEU A CA  1 
ATOM   2120 C  C   . LEU A 1 297 ? -45.090 -9.955  -34.763 1.00 30.58 ? 297 LEU A C   1 
ATOM   2121 O  O   . LEU A 1 297 ? -45.722 -10.390 -35.724 1.00 33.04 ? 297 LEU A O   1 
ATOM   2122 C  CB  . LEU A 1 297 ? -45.410 -10.581 -32.372 1.00 28.30 ? 297 LEU A CB  1 
ATOM   2123 C  CG  . LEU A 1 297 ? -45.225 -11.586 -31.231 1.00 30.75 ? 297 LEU A CG  1 
ATOM   2124 C  CD1 . LEU A 1 297 ? -46.146 -11.227 -30.080 1.00 27.99 ? 297 LEU A CD1 1 
ATOM   2125 C  CD2 . LEU A 1 297 ? -45.532 -13.003 -31.731 1.00 29.11 ? 297 LEU A CD2 1 
ATOM   2126 N  N   . ALA A 1 298 ? -44.751 -8.676  -34.635 1.00 30.60 ? 298 ALA A N   1 
ATOM   2127 C  CA  . ALA A 1 298 ? -45.139 -7.670  -35.618 1.00 30.82 ? 298 ALA A CA  1 
ATOM   2128 C  C   . ALA A 1 298 ? -44.662 -8.035  -37.011 1.00 31.98 ? 298 ALA A C   1 
ATOM   2129 O  O   . ALA A 1 298 ? -45.414 -7.935  -37.977 1.00 32.73 ? 298 ALA A O   1 
ATOM   2130 C  CB  . ALA A 1 298 ? -44.586 -6.304  -35.222 1.00 28.65 ? 298 ALA A CB  1 
ATOM   2131 N  N   . HIS A 1 299 ? -43.405 -8.443  -37.121 1.00 33.56 ? 299 HIS A N   1 
ATOM   2132 C  CA  . HIS A 1 299 ? -42.863 -8.823  -38.421 1.00 34.82 ? 299 HIS A CA  1 
ATOM   2133 C  C   . HIS A 1 299 ? -43.586 -10.063 -38.945 1.00 35.80 ? 299 HIS A C   1 
ATOM   2134 O  O   . HIS A 1 299 ? -43.827 -10.188 -40.143 1.00 35.60 ? 299 HIS A O   1 
ATOM   2135 C  CB  . HIS A 1 299 ? -41.362 -9.121  -38.318 1.00 31.99 ? 299 HIS A CB  1 
ATOM   2136 C  CG  . HIS A 1 299 ? -40.500 -7.897  -38.247 1.00 33.82 ? 299 HIS A CG  1 
ATOM   2137 N  ND1 . HIS A 1 299 ? -40.570 -6.883  -39.180 1.00 33.14 ? 299 HIS A ND1 1 
ATOM   2138 C  CD2 . HIS A 1 299 ? -39.512 -7.548  -37.385 1.00 31.12 ? 299 HIS A CD2 1 
ATOM   2139 C  CE1 . HIS A 1 299 ? -39.662 -5.965  -38.899 1.00 31.02 ? 299 HIS A CE1 1 
ATOM   2140 N  NE2 . HIS A 1 299 ? -39.007 -6.345  -37.815 1.00 32.81 ? 299 HIS A NE2 1 
ATOM   2141 N  N   . GLN A 1 300 ? -43.938 -10.967 -38.036 1.00 36.50 ? 300 GLN A N   1 
ATOM   2142 C  CA  . GLN A 1 300 ? -44.611 -12.208 -38.401 1.00 39.54 ? 300 GLN A CA  1 
ATOM   2143 C  C   . GLN A 1 300 ? -46.024 -12.027 -38.957 1.00 39.64 ? 300 GLN A C   1 
ATOM   2144 O  O   . GLN A 1 300 ? -46.364 -12.616 -39.989 1.00 38.33 ? 300 GLN A O   1 
ATOM   2145 C  CB  . GLN A 1 300 ? -44.667 -13.153 -37.202 1.00 41.37 ? 300 GLN A CB  1 
ATOM   2146 C  CG  . GLN A 1 300 ? -45.157 -14.533 -37.581 1.00 47.92 ? 300 GLN A CG  1 
ATOM   2147 C  CD  . GLN A 1 300 ? -45.398 -15.434 -36.389 1.00 51.17 ? 300 GLN A CD  1 
ATOM   2148 O  OE1 . GLN A 1 300 ? -45.668 -16.627 -36.552 1.00 55.55 ? 300 GLN A OE1 1 
ATOM   2149 N  NE2 . GLN A 1 300 ? -45.310 -14.873 -35.185 1.00 51.66 ? 300 GLN A NE2 1 
ATOM   2150 N  N   . TRP A 1 301 ? -46.846 -11.230 -38.272 1.00 38.44 ? 301 TRP A N   1 
ATOM   2151 C  CA  . TRP A 1 301 ? -48.217 -10.987 -38.723 1.00 37.18 ? 301 TRP A CA  1 
ATOM   2152 C  C   . TRP A 1 301 ? -48.225 -10.224 -40.048 1.00 36.60 ? 301 TRP A C   1 
ATOM   2153 O  O   . TRP A 1 301 ? -49.125 -10.391 -40.872 1.00 35.78 ? 301 TRP A O   1 
ATOM   2154 C  CB  . TRP A 1 301 ? -49.002 -10.172 -37.692 1.00 36.78 ? 301 TRP A CB  1 
ATOM   2155 C  CG  . TRP A 1 301 ? -49.050 -10.752 -36.311 1.00 36.91 ? 301 TRP A CG  1 
ATOM   2156 C  CD1 . TRP A 1 301 ? -49.154 -12.073 -35.968 1.00 36.32 ? 301 TRP A CD1 1 
ATOM   2157 C  CD2 . TRP A 1 301 ? -49.036 -10.019 -35.082 1.00 35.03 ? 301 TRP A CD2 1 
ATOM   2158 N  NE1 . TRP A 1 301 ? -49.205 -12.205 -34.601 1.00 34.24 ? 301 TRP A NE1 1 
ATOM   2159 C  CE2 . TRP A 1 301 ? -49.133 -10.961 -34.031 1.00 33.93 ? 301 TRP A CE2 1 
ATOM   2160 C  CE3 . TRP A 1 301 ? -48.953 -8.655  -34.765 1.00 34.74 ? 301 TRP A CE3 1 
ATOM   2161 C  CZ2 . TRP A 1 301 ? -49.146 -10.585 -32.685 1.00 33.56 ? 301 TRP A CZ2 1 
ATOM   2162 C  CZ3 . TRP A 1 301 ? -48.969 -8.277  -33.419 1.00 33.88 ? 301 TRP A CZ3 1 
ATOM   2163 C  CH2 . TRP A 1 301 ? -49.064 -9.242  -32.398 1.00 33.83 ? 301 TRP A CH2 1 
ATOM   2164 N  N   . GLY A 1 302 ? -47.224 -9.374  -40.236 1.00 34.89 ? 302 GLY A N   1 
ATOM   2165 C  CA  . GLY A 1 302 ? -47.134 -8.599  -41.456 1.00 35.89 ? 302 GLY A CA  1 
ATOM   2166 C  C   . GLY A 1 302 ? -48.399 -7.827  -41.783 1.00 36.55 ? 302 GLY A C   1 
ATOM   2167 O  O   . GLY A 1 302 ? -48.811 -7.770  -42.944 1.00 38.14 ? 302 GLY A O   1 
ATOM   2168 N  N   . GLU A 1 303 ? -49.020 -7.234  -40.768 1.00 34.75 ? 303 GLU A N   1 
ATOM   2169 C  CA  . GLU A 1 303 ? -50.240 -6.458  -40.974 1.00 35.49 ? 303 GLU A CA  1 
ATOM   2170 C  C   . GLU A 1 303 ? -49.949 -4.979  -41.207 1.00 34.74 ? 303 GLU A C   1 
ATOM   2171 O  O   . GLU A 1 303 ? -50.795 -4.236  -41.706 1.00 34.35 ? 303 GLU A O   1 
ATOM   2172 C  CB  . GLU A 1 303 ? -51.171 -6.615  -39.773 1.00 37.37 ? 303 GLU A CB  1 
ATOM   2173 C  CG  . GLU A 1 303 ? -51.848 -7.966  -39.711 1.00 41.80 ? 303 GLU A CG  1 
ATOM   2174 C  CD  . GLU A 1 303 ? -52.652 -8.154  -38.447 1.00 44.19 ? 303 GLU A CD  1 
ATOM   2175 O  OE1 . GLU A 1 303 ? -53.304 -7.180  -38.009 1.00 46.95 ? 303 GLU A OE1 1 
ATOM   2176 O  OE2 . GLU A 1 303 ? -52.639 -9.278  -37.901 1.00 44.35 ? 303 GLU A OE2 1 
ATOM   2177 N  N   . PHE A 1 304 ? -48.749 -4.552  -40.837 1.00 34.14 ? 304 PHE A N   1 
ATOM   2178 C  CA  . PHE A 1 304 ? -48.349 -3.164  -41.011 1.00 31.94 ? 304 PHE A CA  1 
ATOM   2179 C  C   . PHE A 1 304 ? -46.838 -3.054  -40.983 1.00 31.80 ? 304 PHE A C   1 
ATOM   2180 O  O   . PHE A 1 304 ? -46.136 -4.028  -40.695 1.00 31.68 ? 304 PHE A O   1 
ATOM   2181 C  CB  . PHE A 1 304 ? -48.967 -2.304  -39.909 1.00 32.46 ? 304 PHE A CB  1 
ATOM   2182 C  CG  . PHE A 1 304 ? -48.957 -2.959  -38.559 1.00 31.38 ? 304 PHE A CG  1 
ATOM   2183 C  CD1 . PHE A 1 304 ? -47.824 -2.924  -37.763 1.00 29.39 ? 304 PHE A CD1 1 
ATOM   2184 C  CD2 . PHE A 1 304 ? -50.072 -3.657  -38.107 1.00 31.40 ? 304 PHE A CD2 1 
ATOM   2185 C  CE1 . PHE A 1 304 ? -47.797 -3.581  -36.531 1.00 32.99 ? 304 PHE A CE1 1 
ATOM   2186 C  CE2 . PHE A 1 304 ? -50.057 -4.317  -36.877 1.00 32.84 ? 304 PHE A CE2 1 
ATOM   2187 C  CZ  . PHE A 1 304 ? -48.917 -4.281  -36.088 1.00 29.95 ? 304 PHE A CZ  1 
ATOM   2188 N  N   . LYS A 1 305 ? -46.336 -1.864  -41.281 1.00 31.04 ? 305 LYS A N   1 
ATOM   2189 C  CA  . LYS A 1 305 ? -44.902 -1.640  -41.289 1.00 31.86 ? 305 LYS A CA  1 
ATOM   2190 C  C   . LYS A 1 305 ? -44.325 -1.634  -39.865 1.00 32.57 ? 305 LYS A C   1 
ATOM   2191 O  O   . LYS A 1 305 ? -44.917 -1.064  -38.941 1.00 30.83 ? 305 LYS A O   1 
ATOM   2192 C  CB  . LYS A 1 305 ? -44.601 -0.317  -41.994 1.00 33.07 ? 305 LYS A CB  1 
ATOM   2193 C  CG  . LYS A 1 305 ? -43.126 0.009   -42.114 1.00 35.92 ? 305 LYS A CG  1 
ATOM   2194 C  CD  . LYS A 1 305 ? -42.916 1.230   -43.001 1.00 36.48 ? 305 LYS A CD  1 
ATOM   2195 C  CE  . LYS A 1 305 ? -41.447 1.626   -43.084 1.00 36.60 ? 305 LYS A CE  1 
ATOM   2196 N  NZ  . LYS A 1 305 ? -41.268 2.767   -44.025 1.00 39.07 ? 305 LYS A NZ  1 
ATOM   2197 N  N   . VAL A 1 306 ? -43.176 -2.288  -39.706 1.00 31.30 ? 306 VAL A N   1 
ATOM   2198 C  CA  . VAL A 1 306 ? -42.466 -2.380  -38.437 1.00 30.79 ? 306 VAL A CA  1 
ATOM   2199 C  C   . VAL A 1 306 ? -41.161 -1.630  -38.653 1.00 31.40 ? 306 VAL A C   1 
ATOM   2200 O  O   . VAL A 1 306 ? -40.335 -2.046  -39.461 1.00 32.78 ? 306 VAL A O   1 
ATOM   2201 C  CB  . VAL A 1 306 ? -42.142 -3.843  -38.071 1.00 32.26 ? 306 VAL A CB  1 
ATOM   2202 C  CG1 . VAL A 1 306 ? -41.427 -3.898  -36.727 1.00 32.95 ? 306 VAL A CG1 1 
ATOM   2203 C  CG2 . VAL A 1 306 ? -43.428 -4.674  -38.024 1.00 35.16 ? 306 VAL A CG2 1 
ATOM   2204 N  N   . SER A 1 307 ? -40.969 -0.529  -37.935 1.00 31.40 ? 307 SER A N   1 
ATOM   2205 C  CA  . SER A 1 307 ? -39.764 0.268   -38.118 1.00 30.01 ? 307 SER A CA  1 
ATOM   2206 C  C   . SER A 1 307 ? -39.015 0.648   -36.854 1.00 29.74 ? 307 SER A C   1 
ATOM   2207 O  O   . SER A 1 307 ? -39.581 1.213   -35.917 1.00 31.10 ? 307 SER A O   1 
ATOM   2208 C  CB  . SER A 1 307 ? -40.105 1.552   -38.882 1.00 31.30 ? 307 SER A CB  1 
ATOM   2209 O  OG  . SER A 1 307 ? -40.772 1.270   -40.101 1.00 35.85 ? 307 SER A OG  1 
ATOM   2210 N  N   . GLU A 1 308 ? -37.727 0.337   -36.842 1.00 28.90 ? 308 GLU A N   1 
ATOM   2211 C  CA  . GLU A 1 308 ? -36.870 0.688   -35.721 1.00 29.51 ? 308 GLU A CA  1 
ATOM   2212 C  C   . GLU A 1 308 ? -36.264 2.007   -36.185 1.00 29.68 ? 308 GLU A C   1 
ATOM   2213 O  O   . GLU A 1 308 ? -35.382 2.013   -37.031 1.00 27.33 ? 308 GLU A O   1 
ATOM   2214 C  CB  . GLU A 1 308 ? -35.799 -0.397  -35.518 1.00 28.02 ? 308 GLU A CB  1 
ATOM   2215 C  CG  . GLU A 1 308 ? -36.403 -1.738  -35.087 1.00 30.19 ? 308 GLU A CG  1 
ATOM   2216 C  CD  . GLU A 1 308 ? -35.369 -2.819  -34.803 1.00 34.22 ? 308 GLU A CD  1 
ATOM   2217 O  OE1 . GLU A 1 308 ? -34.392 -2.536  -34.074 1.00 35.06 ? 308 GLU A OE1 1 
ATOM   2218 O  OE2 . GLU A 1 308 ? -35.543 -3.961  -35.296 1.00 35.80 ? 308 GLU A OE2 1 
ATOM   2219 N  N   . ARG A 1 309 ? -36.754 3.123   -35.644 1.00 30.61 ? 309 ARG A N   1 
ATOM   2220 C  CA  . ARG A 1 309 ? -36.286 4.448   -36.059 1.00 30.43 ? 309 ARG A CA  1 
ATOM   2221 C  C   . ARG A 1 309 ? -36.326 5.493   -34.943 1.00 30.56 ? 309 ARG A C   1 
ATOM   2222 O  O   . ARG A 1 309 ? -36.758 5.208   -33.827 1.00 30.12 ? 309 ARG A O   1 
ATOM   2223 C  CB  . ARG A 1 309 ? -37.160 4.926   -37.211 1.00 32.96 ? 309 ARG A CB  1 
ATOM   2224 C  CG  . ARG A 1 309 ? -38.655 4.834   -36.877 1.00 34.87 ? 309 ARG A CG  1 
ATOM   2225 C  CD  . ARG A 1 309 ? -39.298 6.210   -36.789 1.00 37.72 ? 309 ARG A CD  1 
ATOM   2226 N  NE  . ARG A 1 309 ? -40.062 6.520   -37.994 1.00 39.42 ? 309 ARG A NE  1 
ATOM   2227 C  CZ  . ARG A 1 309 ? -40.499 7.732   -38.324 1.00 38.52 ? 309 ARG A CZ  1 
ATOM   2228 N  NH1 . ARG A 1 309 ? -40.256 8.782   -37.545 1.00 34.36 ? 309 ARG A NH1 1 
ATOM   2229 N  NH2 . ARG A 1 309 ? -41.183 7.890   -39.447 1.00 39.51 ? 309 ARG A NH2 1 
ATOM   2230 N  N   . TYR A 1 310 ? -35.889 6.709   -35.264 1.00 29.49 ? 310 TYR A N   1 
ATOM   2231 C  CA  . TYR A 1 310 ? -35.872 7.808   -34.304 1.00 29.37 ? 310 TYR A CA  1 
ATOM   2232 C  C   . TYR A 1 310 ? -37.227 8.496   -34.186 1.00 31.22 ? 310 TYR A C   1 
ATOM   2233 O  O   . TYR A 1 310 ? -37.844 8.877   -35.189 1.00 33.46 ? 310 TYR A O   1 
ATOM   2234 C  CB  . TYR A 1 310 ? -34.785 8.834   -34.675 1.00 26.95 ? 310 TYR A CB  1 
ATOM   2235 C  CG  . TYR A 1 310 ? -33.383 8.266   -34.573 1.00 26.42 ? 310 TYR A CG  1 
ATOM   2236 C  CD1 . TYR A 1 310 ? -32.537 8.243   -35.681 1.00 25.12 ? 310 TYR A CD1 1 
ATOM   2237 C  CD2 . TYR A 1 310 ? -32.937 7.666   -33.389 1.00 24.63 ? 310 TYR A CD2 1 
ATOM   2238 C  CE1 . TYR A 1 310 ? -31.287 7.624   -35.625 1.00 24.26 ? 310 TYR A CE1 1 
ATOM   2239 C  CE2 . TYR A 1 310 ? -31.689 7.047   -33.318 1.00 26.85 ? 310 TYR A CE2 1 
ATOM   2240 C  CZ  . TYR A 1 310 ? -30.871 7.027   -34.444 1.00 26.00 ? 310 TYR A CZ  1 
ATOM   2241 O  OH  . TYR A 1 310 ? -29.657 6.391   -34.394 1.00 24.84 ? 310 TYR A OH  1 
ATOM   2242 N  N   . LEU A 1 311 ? -37.676 8.646   -32.944 1.00 30.12 ? 311 LEU A N   1 
ATOM   2243 C  CA  . LEU A 1 311 ? -38.952 9.269   -32.632 1.00 30.11 ? 311 LEU A CA  1 
ATOM   2244 C  C   . LEU A 1 311 ? -38.720 10.471  -31.717 1.00 31.75 ? 311 LEU A C   1 
ATOM   2245 O  O   . LEU A 1 311 ? -38.076 10.349  -30.670 1.00 30.38 ? 311 LEU A O   1 
ATOM   2246 C  CB  . LEU A 1 311 ? -39.860 8.253   -31.934 1.00 26.86 ? 311 LEU A CB  1 
ATOM   2247 C  CG  . LEU A 1 311 ? -40.131 6.979   -32.733 1.00 25.66 ? 311 LEU A CG  1 
ATOM   2248 C  CD1 . LEU A 1 311 ? -40.999 6.023   -31.913 1.00 27.25 ? 311 LEU A CD1 1 
ATOM   2249 C  CD2 . LEU A 1 311 ? -40.825 7.348   -34.041 1.00 24.90 ? 311 LEU A CD2 1 
ATOM   2250 N  N   . THR A 1 312 ? -39.244 11.629  -32.107 1.00 31.36 ? 312 THR A N   1 
ATOM   2251 C  CA  . THR A 1 312 ? -39.059 12.825  -31.300 1.00 31.80 ? 312 THR A CA  1 
ATOM   2252 C  C   . THR A 1 312 ? -40.388 13.353  -30.793 1.00 32.53 ? 312 THR A C   1 
ATOM   2253 O  O   . THR A 1 312 ? -41.448 12.932  -31.252 1.00 33.36 ? 312 THR A O   1 
ATOM   2254 C  CB  . THR A 1 312 ? -38.368 13.932  -32.104 1.00 31.90 ? 312 THR A CB  1 
ATOM   2255 O  OG1 . THR A 1 312 ? -39.320 14.563  -32.965 1.00 31.70 ? 312 THR A OG1 1 
ATOM   2256 C  CG2 . THR A 1 312 ? -37.239 13.344  -32.952 1.00 31.69 ? 312 THR A CG2 1 
ATOM   2257 N  N   . MET A 1 313 ? -40.329 14.270  -29.832 1.00 33.21 ? 313 MET A N   1 
ATOM   2258 C  CA  . MET A 1 313 ? -41.537 14.858  -29.280 1.00 32.37 ? 313 MET A CA  1 
ATOM   2259 C  C   . MET A 1 313 ? -42.284 15.571  -30.393 1.00 32.67 ? 313 MET A C   1 
ATOM   2260 O  O   . MET A 1 313 ? -43.515 15.502  -30.467 1.00 33.38 ? 313 MET A O   1 
ATOM   2261 C  CB  . MET A 1 313 ? -41.202 15.846  -28.156 1.00 31.90 ? 313 MET A CB  1 
ATOM   2262 C  CG  . MET A 1 313 ? -40.744 15.190  -26.858 1.00 30.38 ? 313 MET A CG  1 
ATOM   2263 S  SD  . MET A 1 313 ? -41.952 14.045  -26.150 1.00 32.70 ? 313 MET A SD  1 
ATOM   2264 C  CE  . MET A 1 313 ? -43.261 15.158  -25.746 1.00 31.27 ? 313 MET A CE  1 
ATOM   2265 N  N   . ASP A 1 314 ? -41.541 16.244  -31.264 1.00 32.70 ? 314 ASP A N   1 
ATOM   2266 C  CA  . ASP A 1 314 ? -42.158 16.961  -32.371 1.00 34.92 ? 314 ASP A CA  1 
ATOM   2267 C  C   . ASP A 1 314 ? -42.871 16.012  -33.332 1.00 35.29 ? 314 ASP A C   1 
ATOM   2268 O  O   . ASP A 1 314 ? -43.925 16.354  -33.877 1.00 34.09 ? 314 ASP A O   1 
ATOM   2269 C  CB  . ASP A 1 314 ? -41.117 17.807  -33.107 1.00 38.15 ? 314 ASP A CB  1 
ATOM   2270 C  CG  . ASP A 1 314 ? -40.755 19.072  -32.340 1.00 43.48 ? 314 ASP A CG  1 
ATOM   2271 O  OD1 . ASP A 1 314 ? -40.066 19.942  -32.910 1.00 45.78 ? 314 ASP A OD1 1 
ATOM   2272 O  OD2 . ASP A 1 314 ? -41.163 19.201  -31.162 1.00 45.71 ? 314 ASP A OD2 1 
ATOM   2273 N  N   . ASP A 1 315 ? -42.307 14.822  -33.539 1.00 34.52 ? 315 ASP A N   1 
ATOM   2274 C  CA  . ASP A 1 315 ? -42.949 13.841  -34.408 1.00 33.22 ? 315 ASP A CA  1 
ATOM   2275 C  C   . ASP A 1 315 ? -44.233 13.405  -33.708 1.00 33.07 ? 315 ASP A C   1 
ATOM   2276 O  O   . ASP A 1 315 ? -45.267 13.196  -34.347 1.00 34.15 ? 315 ASP A O   1 
ATOM   2277 C  CB  . ASP A 1 315 ? -42.066 12.604  -34.629 1.00 32.17 ? 315 ASP A CB  1 
ATOM   2278 C  CG  . ASP A 1 315 ? -40.807 12.903  -35.412 1.00 33.15 ? 315 ASP A CG  1 
ATOM   2279 O  OD1 . ASP A 1 315 ? -40.848 13.773  -36.313 1.00 37.64 ? 315 ASP A OD1 1 
ATOM   2280 O  OD2 . ASP A 1 315 ? -39.776 12.247  -35.142 1.00 32.97 ? 315 ASP A OD2 1 
ATOM   2281 N  N   . LEU A 1 316 ? -44.156 13.268  -32.387 1.00 31.06 ? 316 LEU A N   1 
ATOM   2282 C  CA  . LEU A 1 316 ? -45.309 12.853  -31.597 1.00 31.93 ? 316 LEU A CA  1 
ATOM   2283 C  C   . LEU A 1 316 ? -46.374 13.959  -31.578 1.00 32.19 ? 316 LEU A C   1 
ATOM   2284 O  O   . LEU A 1 316 ? -47.544 13.712  -31.888 1.00 29.76 ? 316 LEU A O   1 
ATOM   2285 C  CB  . LEU A 1 316 ? -44.862 12.506  -30.169 1.00 33.17 ? 316 LEU A CB  1 
ATOM   2286 C  CG  . LEU A 1 316 ? -45.892 11.908  -29.204 1.00 36.42 ? 316 LEU A CG  1 
ATOM   2287 C  CD1 . LEU A 1 316 ? -46.419 10.586  -29.749 1.00 36.59 ? 316 LEU A CD1 1 
ATOM   2288 C  CD2 . LEU A 1 316 ? -45.248 11.686  -27.849 1.00 37.73 ? 316 LEU A CD2 1 
ATOM   2289 N  N   . THR A 1 317 ? -45.970 15.180  -31.228 1.00 33.11 ? 317 THR A N   1 
ATOM   2290 C  CA  . THR A 1 317 ? -46.914 16.296  -31.184 1.00 35.69 ? 317 THR A CA  1 
ATOM   2291 C  C   . THR A 1 317 ? -47.566 16.483  -32.542 1.00 36.16 ? 317 THR A C   1 
ATOM   2292 O  O   . THR A 1 317 ? -48.788 16.473  -32.650 1.00 38.02 ? 317 THR A O   1 
ATOM   2293 C  CB  . THR A 1 317 ? -46.234 17.633  -30.759 1.00 35.29 ? 317 THR A CB  1 
ATOM   2294 O  OG1 . THR A 1 317 ? -45.043 17.837  -31.524 1.00 36.07 ? 317 THR A OG1 1 
ATOM   2295 C  CG2 . THR A 1 317 ? -45.889 17.613  -29.275 1.00 34.80 ? 317 THR A CG2 1 
ATOM   2296 N  N   . THR A 1 318 ? -46.751 16.637  -33.580 1.00 37.95 ? 318 THR A N   1 
ATOM   2297 C  CA  . THR A 1 318 ? -47.274 16.814  -34.927 1.00 39.26 ? 318 THR A CA  1 
ATOM   2298 C  C   . THR A 1 318 ? -48.300 15.721  -35.249 1.00 40.27 ? 318 THR A C   1 
ATOM   2299 O  O   . THR A 1 318 ? -49.368 15.999  -35.815 1.00 40.40 ? 318 THR A O   1 
ATOM   2300 C  CB  . THR A 1 318 ? -46.142 16.774  -35.971 1.00 41.13 ? 318 THR A CB  1 
ATOM   2301 O  OG1 . THR A 1 318 ? -45.234 17.858  -35.736 1.00 42.23 ? 318 THR A OG1 1 
ATOM   2302 C  CG2 . THR A 1 318 ? -46.711 16.902  -37.380 1.00 41.87 ? 318 THR A CG2 1 
ATOM   2303 N  N   . ALA A 1 319 ? -47.976 14.482  -34.881 1.00 39.51 ? 319 ALA A N   1 
ATOM   2304 C  CA  . ALA A 1 319 ? -48.869 13.353  -35.120 1.00 38.31 ? 319 ALA A CA  1 
ATOM   2305 C  C   . ALA A 1 319 ? -50.156 13.482  -34.312 1.00 38.97 ? 319 ALA A C   1 
ATOM   2306 O  O   . ALA A 1 319 ? -51.250 13.312  -34.852 1.00 38.28 ? 319 ALA A O   1 
ATOM   2307 C  CB  . ALA A 1 319 ? -48.173 12.045  -34.777 1.00 35.88 ? 319 ALA A CB  1 
ATOM   2308 N  N   . LEU A 1 320 ? -50.031 13.781  -33.020 1.00 40.03 ? 320 LEU A N   1 
ATOM   2309 C  CA  . LEU A 1 320 ? -51.213 13.924  -32.177 1.00 40.62 ? 320 LEU A CA  1 
ATOM   2310 C  C   . LEU A 1 320 ? -52.149 15.005  -32.702 1.00 40.84 ? 320 LEU A C   1 
ATOM   2311 O  O   . LEU A 1 320 ? -53.360 14.800  -32.768 1.00 39.83 ? 320 LEU A O   1 
ATOM   2312 C  CB  . LEU A 1 320 ? -50.823 14.230  -30.729 1.00 40.10 ? 320 LEU A CB  1 
ATOM   2313 C  CG  . LEU A 1 320 ? -50.390 13.028  -29.880 1.00 41.39 ? 320 LEU A CG  1 
ATOM   2314 C  CD1 . LEU A 1 320 ? -50.069 13.505  -28.484 1.00 42.94 ? 320 LEU A CD1 1 
ATOM   2315 C  CD2 . LEU A 1 320 ? -51.489 11.979  -29.822 1.00 40.43 ? 320 LEU A CD2 1 
ATOM   2316 N  N   . GLU A 1 321 ? -51.598 16.156  -33.068 1.00 41.40 ? 321 GLU A N   1 
ATOM   2317 C  CA  . GLU A 1 321 ? -52.430 17.224  -33.599 1.00 44.44 ? 321 GLU A CA  1 
ATOM   2318 C  C   . GLU A 1 321 ? -52.607 16.952  -35.081 1.00 45.03 ? 321 GLU A C   1 
ATOM   2319 O  O   . GLU A 1 321 ? -52.273 17.777  -35.935 1.00 47.66 ? 321 GLU A O   1 
ATOM   2320 C  CB  . GLU A 1 321 ? -51.784 18.595  -33.377 1.00 46.64 ? 321 GLU A CB  1 
ATOM   2321 C  CG  . GLU A 1 321 ? -50.415 18.762  -34.008 1.00 51.82 ? 321 GLU A CG  1 
ATOM   2322 C  CD  . GLU A 1 321 ? -49.802 20.120  -33.718 1.00 54.13 ? 321 GLU A CD  1 
ATOM   2323 O  OE1 . GLU A 1 321 ? -48.653 20.358  -34.159 1.00 54.10 ? 321 GLU A OE1 1 
ATOM   2324 O  OE2 . GLU A 1 321 ? -50.470 20.945  -33.052 1.00 54.43 ? 321 GLU A OE2 1 
ATOM   2325 N  N   . GLY A 1 322 ? -53.135 15.769  -35.365 1.00 43.15 ? 322 GLY A N   1 
ATOM   2326 C  CA  . GLY A 1 322 ? -53.371 15.343  -36.728 1.00 42.27 ? 322 GLY A CA  1 
ATOM   2327 C  C   . GLY A 1 322 ? -54.122 14.027  -36.669 1.00 42.53 ? 322 GLY A C   1 
ATOM   2328 O  O   . GLY A 1 322 ? -54.465 13.448  -37.696 1.00 42.41 ? 322 GLY A O   1 
ATOM   2329 N  N   . ASN A 1 323 ? -54.369 13.555  -35.448 1.00 41.95 ? 323 ASN A N   1 
ATOM   2330 C  CA  . ASN A 1 323 ? -55.093 12.308  -35.219 1.00 42.25 ? 323 ASN A CA  1 
ATOM   2331 C  C   . ASN A 1 323 ? -54.400 11.102  -35.845 1.00 40.93 ? 323 ASN A C   1 
ATOM   2332 O  O   . ASN A 1 323 ? -55.060 10.164  -36.305 1.00 41.01 ? 323 ASN A O   1 
ATOM   2333 C  CB  . ASN A 1 323 ? -56.518 12.431  -35.769 1.00 44.82 ? 323 ASN A CB  1 
ATOM   2334 C  CG  . ASN A 1 323 ? -57.338 13.492  -35.042 1.00 48.16 ? 323 ASN A CG  1 
ATOM   2335 O  OD1 . ASN A 1 323 ? -58.386 13.922  -35.528 1.00 49.19 ? 323 ASN A OD1 1 
ATOM   2336 N  ND2 . ASN A 1 323 ? -56.868 13.908  -33.867 1.00 49.32 ? 323 ASN A ND2 1 
ATOM   2337 N  N   . ARG A 1 324 ? -53.071 11.123  -35.844 1.00 38.63 ? 324 ARG A N   1 
ATOM   2338 C  CA  . ARG A 1 324 ? -52.281 10.041  -36.422 1.00 37.20 ? 324 ARG A CA  1 
ATOM   2339 C  C   . ARG A 1 324 ? -51.771 8.994   -35.430 1.00 36.29 ? 324 ARG A C   1 
ATOM   2340 O  O   . ARG A 1 324 ? -51.237 7.959   -35.842 1.00 35.29 ? 324 ARG A O   1 
ATOM   2341 C  CB  . ARG A 1 324 ? -51.103 10.629  -37.205 1.00 35.86 ? 324 ARG A CB  1 
ATOM   2342 C  CG  . ARG A 1 324 ? -51.468 11.102  -38.612 1.00 37.19 ? 324 ARG A CG  1 
ATOM   2343 C  CD  . ARG A 1 324 ? -50.341 11.914  -39.220 1.00 39.20 ? 324 ARG A CD  1 
ATOM   2344 N  NE  . ARG A 1 324 ? -49.062 11.227  -39.077 1.00 40.94 ? 324 ARG A NE  1 
ATOM   2345 C  CZ  . ARG A 1 324 ? -47.921 11.826  -38.753 1.00 41.56 ? 324 ARG A CZ  1 
ATOM   2346 N  NH1 . ARG A 1 324 ? -47.893 13.135  -38.537 1.00 41.27 ? 324 ARG A NH1 1 
ATOM   2347 N  NH2 . ARG A 1 324 ? -46.809 11.109  -38.628 1.00 44.05 ? 324 ARG A NH2 1 
ATOM   2348 N  N   . VAL A 1 325 ? -51.933 9.255   -34.133 1.00 35.04 ? 325 VAL A N   1 
ATOM   2349 C  CA  . VAL A 1 325 ? -51.482 8.317   -33.097 1.00 34.21 ? 325 VAL A CA  1 
ATOM   2350 C  C   . VAL A 1 325 ? -52.569 7.334   -32.664 1.00 33.72 ? 325 VAL A C   1 
ATOM   2351 O  O   . VAL A 1 325 ? -53.708 7.727   -32.412 1.00 33.70 ? 325 VAL A O   1 
ATOM   2352 C  CB  . VAL A 1 325 ? -51.000 9.062   -31.829 1.00 33.62 ? 325 VAL A CB  1 
ATOM   2353 C  CG1 . VAL A 1 325 ? -50.607 8.055   -30.746 1.00 29.22 ? 325 VAL A CG1 1 
ATOM   2354 C  CG2 . VAL A 1 325 ? -49.838 9.971   -32.172 1.00 33.96 ? 325 VAL A CG2 1 
ATOM   2355 N  N   . ARG A 1 326 ? -52.211 6.057   -32.565 1.00 32.77 ? 326 ARG A N   1 
ATOM   2356 C  CA  . ARG A 1 326 ? -53.165 5.032   -32.144 1.00 33.14 ? 326 ARG A CA  1 
ATOM   2357 C  C   . ARG A 1 326 ? -52.867 4.610   -30.706 1.00 33.06 ? 326 ARG A C   1 
ATOM   2358 O  O   . ARG A 1 326 ? -53.731 4.675   -29.835 1.00 31.79 ? 326 ARG A O   1 
ATOM   2359 C  CB  . ARG A 1 326 ? -53.073 3.800   -33.055 1.00 36.17 ? 326 ARG A CB  1 
ATOM   2360 C  CG  . ARG A 1 326 ? -53.358 4.069   -34.532 1.00 40.52 ? 326 ARG A CG  1 
ATOM   2361 C  CD  . ARG A 1 326 ? -54.841 3.993   -34.872 1.00 45.23 ? 326 ARG A CD  1 
ATOM   2362 N  NE  . ARG A 1 326 ? -55.148 4.644   -36.150 1.00 50.30 ? 326 ARG A NE  1 
ATOM   2363 C  CZ  . ARG A 1 326 ? -55.263 5.963   -36.317 1.00 51.98 ? 326 ARG A CZ  1 
ATOM   2364 N  NH1 . ARG A 1 326 ? -55.103 6.790   -35.285 1.00 50.74 ? 326 ARG A NH1 1 
ATOM   2365 N  NH2 . ARG A 1 326 ? -55.533 6.462   -37.521 1.00 51.28 ? 326 ARG A NH2 1 
ATOM   2366 N  N   . GLU A 1 327 ? -51.631 4.190   -30.463 1.00 31.78 ? 327 GLU A N   1 
ATOM   2367 C  CA  . GLU A 1 327 ? -51.234 3.737   -29.141 1.00 31.97 ? 327 GLU A CA  1 
ATOM   2368 C  C   . GLU A 1 327 ? -49.763 3.997   -28.856 1.00 31.22 ? 327 GLU A C   1 
ATOM   2369 O  O   . GLU A 1 327 ? -48.957 4.172   -29.763 1.00 31.93 ? 327 GLU A O   1 
ATOM   2370 C  CB  . GLU A 1 327 ? -51.454 2.224   -29.003 1.00 31.12 ? 327 GLU A CB  1 
ATOM   2371 C  CG  . GLU A 1 327 ? -52.830 1.718   -29.334 1.00 31.81 ? 327 GLU A CG  1 
ATOM   2372 C  CD  . GLU A 1 327 ? -52.868 0.201   -29.466 1.00 34.00 ? 327 GLU A CD  1 
ATOM   2373 O  OE1 . GLU A 1 327 ? -52.305 -0.500  -28.594 1.00 32.11 ? 327 GLU A OE1 1 
ATOM   2374 O  OE2 . GLU A 1 327 ? -53.472 -0.294  -30.439 1.00 34.42 ? 327 GLU A OE2 1 
ATOM   2375 N  N   . MET A 1 328 ? -49.438 4.009   -27.569 1.00 31.34 ? 328 MET A N   1 
ATOM   2376 C  CA  . MET A 1 328 ? -48.070 4.157   -27.095 1.00 30.61 ? 328 MET A CA  1 
ATOM   2377 C  C   . MET A 1 328 ? -47.984 3.229   -25.888 1.00 27.45 ? 328 MET A C   1 
ATOM   2378 O  O   . MET A 1 328 ? -48.917 3.147   -25.088 1.00 26.56 ? 328 MET A O   1 
ATOM   2379 C  CB  . MET A 1 328 ? -47.755 5.591   -26.661 1.00 31.66 ? 328 MET A CB  1 
ATOM   2380 C  CG  . MET A 1 328 ? -46.260 5.789   -26.385 1.00 34.59 ? 328 MET A CG  1 
ATOM   2381 S  SD  . MET A 1 328 ? -45.774 7.439   -25.850 1.00 39.66 ? 328 MET A SD  1 
ATOM   2382 C  CE  . MET A 1 328 ? -46.484 8.415   -27.124 1.00 38.29 ? 328 MET A CE  1 
ATOM   2383 N  N   . PHE A 1 329 ? -46.883 2.511   -25.759 1.00 26.69 ? 329 PHE A N   1 
ATOM   2384 C  CA  . PHE A 1 329 ? -46.752 1.621   -24.622 1.00 26.81 ? 329 PHE A CA  1 
ATOM   2385 C  C   . PHE A 1 329 ? -45.324 1.160   -24.409 1.00 26.91 ? 329 PHE A C   1 
ATOM   2386 O  O   . PHE A 1 329 ? -44.524 1.120   -25.346 1.00 28.21 ? 329 PHE A O   1 
ATOM   2387 C  CB  . PHE A 1 329 ? -47.700 0.420   -24.789 1.00 24.37 ? 329 PHE A CB  1 
ATOM   2388 C  CG  . PHE A 1 329 ? -47.469 -0.384  -26.052 1.00 25.65 ? 329 PHE A CG  1 
ATOM   2389 C  CD1 . PHE A 1 329 ? -46.531 -1.413  -26.081 1.00 25.46 ? 329 PHE A CD1 1 
ATOM   2390 C  CD2 . PHE A 1 329 ? -48.177 -0.094  -27.216 1.00 26.66 ? 329 PHE A CD2 1 
ATOM   2391 C  CE1 . PHE A 1 329 ? -46.298 -2.143  -27.248 1.00 27.80 ? 329 PHE A CE1 1 
ATOM   2392 C  CE2 . PHE A 1 329 ? -47.953 -0.818  -28.394 1.00 27.06 ? 329 PHE A CE2 1 
ATOM   2393 C  CZ  . PHE A 1 329 ? -47.013 -1.843  -28.410 1.00 28.53 ? 329 PHE A CZ  1 
ATOM   2394 N  N   . GLY A 1 330 ? -45.007 0.837   -23.160 1.00 27.24 ? 330 GLY A N   1 
ATOM   2395 C  CA  . GLY A 1 330 ? -43.681 0.358   -22.827 1.00 26.74 ? 330 GLY A CA  1 
ATOM   2396 C  C   . GLY A 1 330 ? -43.710 -1.156  -22.688 1.00 28.62 ? 330 GLY A C   1 
ATOM   2397 O  O   . GLY A 1 330 ? -44.740 -1.736  -22.349 1.00 28.90 ? 330 GLY A O   1 
ATOM   2398 N  N   . SER A 1 331 ? -42.582 -1.802  -22.955 1.00 27.99 ? 331 SER A N   1 
ATOM   2399 C  CA  . SER A 1 331 ? -42.502 -3.252  -22.860 1.00 27.64 ? 331 SER A CA  1 
ATOM   2400 C  C   . SER A 1 331 ? -41.408 -3.594  -21.874 1.00 26.51 ? 331 SER A C   1 
ATOM   2401 O  O   . SER A 1 331 ? -40.432 -2.863  -21.763 1.00 24.20 ? 331 SER A O   1 
ATOM   2402 C  CB  . SER A 1 331 ? -42.163 -3.865  -24.228 1.00 29.11 ? 331 SER A CB  1 
ATOM   2403 O  OG  . SER A 1 331 ? -40.863 -3.472  -24.657 1.00 28.94 ? 331 SER A OG  1 
ATOM   2404 N  N   . GLY A 1 332 ? -41.581 -4.707  -21.168 1.00 27.16 ? 332 GLY A N   1 
ATOM   2405 C  CA  . GLY A 1 332 ? -40.598 -5.146  -20.197 1.00 28.14 ? 332 GLY A CA  1 
ATOM   2406 C  C   . GLY A 1 332 ? -41.070 -6.436  -19.567 1.00 29.65 ? 332 GLY A C   1 
ATOM   2407 O  O   . GLY A 1 332 ? -42.200 -6.851  -19.792 1.00 29.42 ? 332 GLY A O   1 
ATOM   2408 N  N   . THR A 1 333 ? -40.228 -7.072  -18.764 1.00 31.13 ? 333 THR A N   1 
ATOM   2409 C  CA  . THR A 1 333 ? -40.618 -8.333  -18.137 1.00 33.12 ? 333 THR A CA  1 
ATOM   2410 C  C   . THR A 1 333 ? -41.687 -8.194  -17.048 1.00 33.65 ? 333 THR A C   1 
ATOM   2411 O  O   . THR A 1 333 ? -42.590 -9.026  -16.951 1.00 32.99 ? 333 THR A O   1 
ATOM   2412 C  CB  . THR A 1 333 ? -39.386 -9.051  -17.551 1.00 33.92 ? 333 THR A CB  1 
ATOM   2413 O  OG1 . THR A 1 333 ? -38.481 -9.373  -18.613 1.00 33.74 ? 333 THR A OG1 1 
ATOM   2414 C  CG2 . THR A 1 333 ? -39.790 -10.332 -16.839 1.00 31.94 ? 333 THR A CG2 1 
ATOM   2415 N  N   . ALA A 1 334 ? -41.601 -7.137  -16.246 1.00 36.19 ? 334 ALA A N   1 
ATOM   2416 C  CA  . ALA A 1 334 ? -42.557 -6.919  -15.158 1.00 37.41 ? 334 ALA A CA  1 
ATOM   2417 C  C   . ALA A 1 334 ? -43.985 -6.550  -15.581 1.00 37.73 ? 334 ALA A C   1 
ATOM   2418 O  O   . ALA A 1 334 ? -44.947 -7.006  -14.972 1.00 39.62 ? 334 ALA A O   1 
ATOM   2419 C  CB  . ALA A 1 334 ? -42.011 -5.862  -14.205 1.00 37.83 ? 334 ALA A CB  1 
ATOM   2420 N  N   . CYS A 1 335 ? -44.125 -5.724  -16.610 1.00 38.41 ? 335 CYS A N   1 
ATOM   2421 C  CA  . CYS A 1 335 ? -45.446 -5.308  -17.084 1.00 39.75 ? 335 CYS A CA  1 
ATOM   2422 C  C   . CYS A 1 335 ? -45.848 -6.054  -18.352 1.00 39.68 ? 335 CYS A C   1 
ATOM   2423 O  O   . CYS A 1 335 ? -47.035 -6.156  -18.680 1.00 40.12 ? 335 CYS A O   1 
ATOM   2424 C  CB  . CYS A 1 335 ? -45.454 -3.810  -17.403 1.00 39.71 ? 335 CYS A CB  1 
ATOM   2425 S  SG  . CYS A 1 335 ? -44.839 -2.731  -16.101 1.00 49.03 ? 335 CYS A SG  1 
ATOM   2426 N  N   . VAL A 1 336 ? -44.849 -6.578  -19.055 1.00 37.37 ? 336 VAL A N   1 
ATOM   2427 C  CA  . VAL A 1 336 ? -45.066 -7.264  -20.318 1.00 35.88 ? 336 VAL A CA  1 
ATOM   2428 C  C   . VAL A 1 336 ? -45.439 -6.129  -21.271 1.00 34.78 ? 336 VAL A C   1 
ATOM   2429 O  O   . VAL A 1 336 ? -44.737 -5.868  -22.249 1.00 35.75 ? 336 VAL A O   1 
ATOM   2430 C  CB  . VAL A 1 336 ? -46.198 -8.313  -20.221 1.00 37.13 ? 336 VAL A CB  1 
ATOM   2431 C  CG1 . VAL A 1 336 ? -46.113 -9.279  -21.396 1.00 35.59 ? 336 VAL A CG1 1 
ATOM   2432 C  CG2 . VAL A 1 336 ? -46.082 -9.082  -18.916 1.00 37.26 ? 336 VAL A CG2 1 
ATOM   2433 N  N   . VAL A 1 337 ? -46.529 -5.433  -20.972 1.00 32.64 ? 337 VAL A N   1 
ATOM   2434 C  CA  . VAL A 1 337 ? -46.951 -4.288  -21.779 1.00 32.24 ? 337 VAL A CA  1 
ATOM   2435 C  C   . VAL A 1 337 ? -47.604 -3.262  -20.859 1.00 30.64 ? 337 VAL A C   1 
ATOM   2436 O  O   . VAL A 1 337 ? -48.408 -3.612  -19.998 1.00 29.86 ? 337 VAL A O   1 
ATOM   2437 C  CB  . VAL A 1 337 ? -47.941 -4.704  -22.891 1.00 32.62 ? 337 VAL A CB  1 
ATOM   2438 C  CG1 . VAL A 1 337 ? -48.423 -3.478  -23.645 1.00 34.32 ? 337 VAL A CG1 1 
ATOM   2439 C  CG2 . VAL A 1 337 ? -47.259 -5.655  -23.852 1.00 35.70 ? 337 VAL A CG2 1 
ATOM   2440 N  N   . CYS A 1 338 ? -47.262 -1.992  -21.043 1.00 30.14 ? 338 CYS A N   1 
ATOM   2441 C  CA  . CYS A 1 338 ? -47.803 -0.932  -20.197 1.00 29.97 ? 338 CYS A CA  1 
ATOM   2442 C  C   . CYS A 1 338 ? -48.262 0.276   -21.024 1.00 30.61 ? 338 CYS A C   1 
ATOM   2443 O  O   . CYS A 1 338 ? -47.450 1.009   -21.595 1.00 31.84 ? 338 CYS A O   1 
ATOM   2444 C  CB  . CYS A 1 338 ? -46.738 -0.518  -19.169 1.00 28.91 ? 338 CYS A CB  1 
ATOM   2445 S  SG  . CYS A 1 338 ? -47.155 0.910   -18.130 1.00 36.27 ? 338 CYS A SG  1 
ATOM   2446 N  N   . PRO A 1 339 ? -49.581 0.506   -21.085 1.00 29.73 ? 339 PRO A N   1 
ATOM   2447 C  CA  . PRO A 1 339 ? -50.136 1.627   -21.851 1.00 29.22 ? 339 PRO A CA  1 
ATOM   2448 C  C   . PRO A 1 339 ? -49.778 3.007   -21.306 1.00 29.18 ? 339 PRO A C   1 
ATOM   2449 O  O   . PRO A 1 339 ? -49.743 3.218   -20.089 1.00 26.45 ? 339 PRO A O   1 
ATOM   2450 C  CB  . PRO A 1 339 ? -51.649 1.379   -21.792 1.00 28.52 ? 339 PRO A CB  1 
ATOM   2451 C  CG  . PRO A 1 339 ? -51.768 -0.091  -21.510 1.00 29.75 ? 339 PRO A CG  1 
ATOM   2452 C  CD  . PRO A 1 339 ? -50.660 -0.316  -20.512 1.00 29.54 ? 339 PRO A CD  1 
ATOM   2453 N  N   . VAL A 1 340 ? -49.521 3.942   -22.217 1.00 28.37 ? 340 VAL A N   1 
ATOM   2454 C  CA  . VAL A 1 340 ? -49.206 5.318   -21.848 1.00 28.73 ? 340 VAL A CA  1 
ATOM   2455 C  C   . VAL A 1 340 ? -50.397 6.171   -22.263 1.00 30.68 ? 340 VAL A C   1 
ATOM   2456 O  O   . VAL A 1 340 ? -50.848 6.088   -23.404 1.00 32.57 ? 340 VAL A O   1 
ATOM   2457 C  CB  . VAL A 1 340 ? -47.973 5.843   -22.594 1.00 29.28 ? 340 VAL A CB  1 
ATOM   2458 C  CG1 . VAL A 1 340 ? -47.755 7.300   -22.240 1.00 30.45 ? 340 VAL A CG1 1 
ATOM   2459 C  CG2 . VAL A 1 340 ? -46.744 5.011   -22.242 1.00 29.18 ? 340 VAL A CG2 1 
ATOM   2460 N  N   . SER A 1 341 ? -50.904 6.998   -21.358 1.00 30.31 ? 341 SER A N   1 
ATOM   2461 C  CA  . SER A 1 341 ? -52.052 7.826   -21.697 1.00 29.93 ? 341 SER A CA  1 
ATOM   2462 C  C   . SER A 1 341 ? -51.777 9.320   -21.678 1.00 29.40 ? 341 SER A C   1 
ATOM   2463 O  O   . SER A 1 341 ? -52.575 10.094  -22.201 1.00 29.39 ? 341 SER A O   1 
ATOM   2464 C  CB  . SER A 1 341 ? -53.226 7.513   -20.762 1.00 29.15 ? 341 SER A CB  1 
ATOM   2465 O  OG  . SER A 1 341 ? -52.844 7.668   -19.412 1.00 30.95 ? 341 SER A OG  1 
ATOM   2466 N  N   . ASP A 1 342 ? -50.659 9.726   -21.080 1.00 28.84 ? 342 ASP A N   1 
ATOM   2467 C  CA  . ASP A 1 342 ? -50.313 11.150  -21.006 1.00 28.51 ? 342 ASP A CA  1 
ATOM   2468 C  C   . ASP A 1 342 ? -48.814 11.390  -20.849 1.00 29.22 ? 342 ASP A C   1 
ATOM   2469 O  O   . ASP A 1 342 ? -48.082 10.534  -20.354 1.00 30.73 ? 342 ASP A O   1 
ATOM   2470 C  CB  . ASP A 1 342 ? -51.024 11.813  -19.822 1.00 27.89 ? 342 ASP A CB  1 
ATOM   2471 C  CG  . ASP A 1 342 ? -52.524 11.709  -19.909 1.00 27.32 ? 342 ASP A CG  1 
ATOM   2472 O  OD1 . ASP A 1 342 ? -53.111 12.393  -20.772 1.00 32.63 ? 342 ASP A OD1 1 
ATOM   2473 O  OD2 . ASP A 1 342 ? -53.120 10.945  -19.119 1.00 26.98 ? 342 ASP A OD2 1 
ATOM   2474 N  N   . ILE A 1 343 ? -48.373 12.573  -21.266 1.00 29.43 ? 343 ILE A N   1 
ATOM   2475 C  CA  . ILE A 1 343 ? -46.974 12.969  -21.162 1.00 29.71 ? 343 ILE A CA  1 
ATOM   2476 C  C   . ILE A 1 343 ? -46.929 14.442  -20.756 1.00 31.85 ? 343 ILE A C   1 
ATOM   2477 O  O   . ILE A 1 343 ? -47.477 15.300  -21.460 1.00 31.75 ? 343 ILE A O   1 
ATOM   2478 C  CB  . ILE A 1 343 ? -46.242 12.829  -22.506 1.00 29.40 ? 343 ILE A CB  1 
ATOM   2479 C  CG1 . ILE A 1 343 ? -46.277 11.378  -22.982 1.00 29.32 ? 343 ILE A CG1 1 
ATOM   2480 C  CG2 . ILE A 1 343 ? -44.813 13.291  -22.356 1.00 28.62 ? 343 ILE A CG2 1 
ATOM   2481 C  CD1 . ILE A 1 343 ? -45.800 11.199  -24.421 1.00 24.95 ? 343 ILE A CD1 1 
ATOM   2482 N  N   . LEU A 1 344 ? -46.296 14.729  -19.618 1.00 32.28 ? 344 LEU A N   1 
ATOM   2483 C  CA  . LEU A 1 344 ? -46.172 16.103  -19.138 1.00 32.25 ? 344 LEU A CA  1 
ATOM   2484 C  C   . LEU A 1 344 ? -44.893 16.685  -19.717 1.00 33.02 ? 344 LEU A C   1 
ATOM   2485 O  O   . LEU A 1 344 ? -43.789 16.305  -19.328 1.00 34.06 ? 344 LEU A O   1 
ATOM   2486 C  CB  . LEU A 1 344 ? -46.155 16.143  -17.609 1.00 32.14 ? 344 LEU A CB  1 
ATOM   2487 C  CG  . LEU A 1 344 ? -47.542 16.376  -16.997 1.00 32.65 ? 344 LEU A CG  1 
ATOM   2488 C  CD1 . LEU A 1 344 ? -48.457 15.205  -17.325 1.00 33.23 ? 344 LEU A CD1 1 
ATOM   2489 C  CD2 . LEU A 1 344 ? -47.423 16.566  -15.496 1.00 30.55 ? 344 LEU A CD2 1 
ATOM   2490 N  N   . TYR A 1 345 ? -45.064 17.617  -20.651 1.00 33.52 ? 345 TYR A N   1 
ATOM   2491 C  CA  . TYR A 1 345 ? -43.953 18.227  -21.367 1.00 34.30 ? 345 TYR A CA  1 
ATOM   2492 C  C   . TYR A 1 345 ? -44.080 19.751  -21.480 1.00 34.49 ? 345 TYR A C   1 
ATOM   2493 O  O   . TYR A 1 345 ? -45.085 20.270  -21.968 1.00 34.49 ? 345 TYR A O   1 
ATOM   2494 C  CB  . TYR A 1 345 ? -43.899 17.583  -22.763 1.00 32.16 ? 345 TYR A CB  1 
ATOM   2495 C  CG  . TYR A 1 345 ? -42.764 18.017  -23.660 1.00 32.04 ? 345 TYR A CG  1 
ATOM   2496 C  CD1 . TYR A 1 345 ? -41.432 17.932  -23.240 1.00 32.42 ? 345 TYR A CD1 1 
ATOM   2497 C  CD2 . TYR A 1 345 ? -43.019 18.474  -24.956 1.00 31.54 ? 345 TYR A CD2 1 
ATOM   2498 C  CE1 . TYR A 1 345 ? -40.381 18.294  -24.096 1.00 32.73 ? 345 TYR A CE1 1 
ATOM   2499 C  CE2 . TYR A 1 345 ? -41.980 18.834  -25.815 1.00 32.49 ? 345 TYR A CE2 1 
ATOM   2500 C  CZ  . TYR A 1 345 ? -40.668 18.741  -25.381 1.00 31.89 ? 345 TYR A CZ  1 
ATOM   2501 O  OH  . TYR A 1 345 ? -39.657 19.077  -26.244 1.00 35.04 ? 345 TYR A OH  1 
ATOM   2502 N  N   . LYS A 1 346 ? -43.053 20.463  -21.029 1.00 34.72 ? 346 LYS A N   1 
ATOM   2503 C  CA  . LYS A 1 346 ? -43.058 21.923  -21.092 1.00 37.83 ? 346 LYS A CA  1 
ATOM   2504 C  C   . LYS A 1 346 ? -44.307 22.532  -20.454 1.00 38.61 ? 346 LYS A C   1 
ATOM   2505 O  O   . LYS A 1 346 ? -45.025 23.304  -21.094 1.00 37.87 ? 346 LYS A O   1 
ATOM   2506 C  CB  . LYS A 1 346 ? -42.948 22.379  -22.550 1.00 38.72 ? 346 LYS A CB  1 
ATOM   2507 C  CG  . LYS A 1 346 ? -41.616 22.035  -23.201 1.00 38.28 ? 346 LYS A CG  1 
ATOM   2508 C  CD  . LYS A 1 346 ? -41.621 22.334  -24.692 1.00 39.26 ? 346 LYS A CD  1 
ATOM   2509 C  CE  . LYS A 1 346 ? -40.252 22.059  -25.310 1.00 40.09 ? 346 LYS A CE  1 
ATOM   2510 N  NZ  . LYS A 1 346 ? -40.295 22.112  -26.797 1.00 41.08 ? 346 LYS A NZ  1 
ATOM   2511 N  N   . GLY A 1 347 ? -44.557 22.161  -19.199 1.00 40.21 ? 347 GLY A N   1 
ATOM   2512 C  CA  . GLY A 1 347 ? -45.698 22.667  -18.447 1.00 42.93 ? 347 GLY A CA  1 
ATOM   2513 C  C   . GLY A 1 347 ? -47.064 22.322  -19.010 1.00 44.52 ? 347 GLY A C   1 
ATOM   2514 O  O   . GLY A 1 347 ? -48.099 22.666  -18.439 1.00 45.43 ? 347 GLY A O   1 
ATOM   2515 N  N   . GLU A 1 348 ? -47.069 21.618  -20.128 1.00 45.59 ? 348 GLU A N   1 
ATOM   2516 C  CA  . GLU A 1 348 ? -48.305 21.249  -20.798 1.00 46.59 ? 348 GLU A CA  1 
ATOM   2517 C  C   . GLU A 1 348 ? -48.569 19.746  -20.681 1.00 46.94 ? 348 GLU A C   1 
ATOM   2518 O  O   . GLU A 1 348 ? -47.635 18.939  -20.713 1.00 48.48 ? 348 GLU A O   1 
ATOM   2519 C  CB  . GLU A 1 348 ? -48.181 21.679  -22.261 1.00 48.04 ? 348 GLU A CB  1 
ATOM   2520 C  CG  . GLU A 1 348 ? -49.305 21.291  -23.187 1.00 51.47 ? 348 GLU A CG  1 
ATOM   2521 C  CD  . GLU A 1 348 ? -49.026 21.750  -24.609 1.00 52.60 ? 348 GLU A CD  1 
ATOM   2522 O  OE1 . GLU A 1 348 ? -48.943 22.982  -24.831 1.00 52.96 ? 348 GLU A OE1 1 
ATOM   2523 O  OE2 . GLU A 1 348 ? -48.875 20.880  -25.496 1.00 50.07 ? 348 GLU A OE2 1 
ATOM   2524 N  N   . THR A 1 349 ? -49.837 19.373  -20.522 1.00 45.23 ? 349 THR A N   1 
ATOM   2525 C  CA  . THR A 1 349 ? -50.208 17.964  -20.425 1.00 41.83 ? 349 THR A CA  1 
ATOM   2526 C  C   . THR A 1 349 ? -50.699 17.509  -21.793 1.00 40.41 ? 349 THR A C   1 
ATOM   2527 O  O   . THR A 1 349 ? -51.638 18.081  -22.352 1.00 39.10 ? 349 THR A O   1 
ATOM   2528 C  CB  . THR A 1 349 ? -51.321 17.730  -19.390 1.00 42.27 ? 349 THR A CB  1 
ATOM   2529 O  OG1 . THR A 1 349 ? -50.881 18.175  -18.100 1.00 42.26 ? 349 THR A OG1 1 
ATOM   2530 C  CG2 . THR A 1 349 ? -51.663 16.252  -19.316 1.00 41.75 ? 349 THR A CG2 1 
ATOM   2531 N  N   . ILE A 1 350 ? -50.055 16.479  -22.328 1.00 38.57 ? 350 ILE A N   1 
ATOM   2532 C  CA  . ILE A 1 350 ? -50.395 15.956  -23.646 1.00 36.10 ? 350 ILE A CA  1 
ATOM   2533 C  C   . ILE A 1 350 ? -51.027 14.573  -23.534 1.00 34.99 ? 350 ILE A C   1 
ATOM   2534 O  O   . ILE A 1 350 ? -50.364 13.605  -23.161 1.00 34.09 ? 350 ILE A O   1 
ATOM   2535 C  CB  . ILE A 1 350 ? -49.127 15.883  -24.524 1.00 35.81 ? 350 ILE A CB  1 
ATOM   2536 C  CG1 . ILE A 1 350 ? -48.444 17.257  -24.545 1.00 33.95 ? 350 ILE A CG1 1 
ATOM   2537 C  CG2 . ILE A 1 350 ? -49.485 15.444  -25.930 1.00 33.56 ? 350 ILE A CG2 1 
ATOM   2538 C  CD1 . ILE A 1 350 ? -47.083 17.266  -25.188 1.00 31.33 ? 350 ILE A CD1 1 
ATOM   2539 N  N   . HIS A 1 351 ? -52.311 14.484  -23.857 1.00 33.82 ? 351 HIS A N   1 
ATOM   2540 C  CA  . HIS A 1 351 ? -53.011 13.214  -23.762 1.00 34.27 ? 351 HIS A CA  1 
ATOM   2541 C  C   . HIS A 1 351 ? -52.730 12.309  -24.949 1.00 33.74 ? 351 HIS A C   1 
ATOM   2542 O  O   . HIS A 1 351 ? -52.654 12.765  -26.089 1.00 34.34 ? 351 HIS A O   1 
ATOM   2543 C  CB  . HIS A 1 351 ? -54.524 13.437  -23.623 1.00 33.97 ? 351 HIS A CB  1 
ATOM   2544 C  CG  . HIS A 1 351 ? -55.290 12.181  -23.337 1.00 34.91 ? 351 HIS A CG  1 
ATOM   2545 N  ND1 . HIS A 1 351 ? -56.036 11.526  -24.295 1.00 34.88 ? 351 HIS A ND1 1 
ATOM   2546 C  CD2 . HIS A 1 351 ? -55.373 11.424  -22.216 1.00 32.97 ? 351 HIS A CD2 1 
ATOM   2547 C  CE1 . HIS A 1 351 ? -56.541 10.419  -23.777 1.00 31.50 ? 351 HIS A CE1 1 
ATOM   2548 N  NE2 . HIS A 1 351 ? -56.154 10.333  -22.518 1.00 31.94 ? 351 HIS A NE2 1 
ATOM   2549 N  N   . ILE A 1 352 ? -52.556 11.023  -24.658 1.00 33.13 ? 352 ILE A N   1 
ATOM   2550 C  CA  . ILE A 1 352 ? -52.294 10.015  -25.677 1.00 30.47 ? 352 ILE A CA  1 
ATOM   2551 C  C   . ILE A 1 352 ? -53.533 9.132   -25.688 1.00 29.64 ? 352 ILE A C   1 
ATOM   2552 O  O   . ILE A 1 352 ? -53.853 8.494   -24.682 1.00 29.44 ? 352 ILE A O   1 
ATOM   2553 C  CB  . ILE A 1 352 ? -51.046 9.175   -25.325 1.00 30.17 ? 352 ILE A CB  1 
ATOM   2554 C  CG1 . ILE A 1 352 ? -49.860 10.101  -25.053 1.00 28.35 ? 352 ILE A CG1 1 
ATOM   2555 C  CG2 . ILE A 1 352 ? -50.703 8.238   -26.477 1.00 30.05 ? 352 ILE A CG2 1 
ATOM   2556 C  CD1 . ILE A 1 352 ? -49.502 11.007  -26.220 1.00 28.89 ? 352 ILE A CD1 1 
ATOM   2557 N  N   . PRO A 1 353 ? -54.245 9.082   -26.831 1.00 29.65 ? 353 PRO A N   1 
ATOM   2558 C  CA  . PRO A 1 353 ? -55.476 8.302   -27.040 1.00 30.22 ? 353 PRO A CA  1 
ATOM   2559 C  C   . PRO A 1 353 ? -55.337 6.770   -27.017 1.00 32.63 ? 353 PRO A C   1 
ATOM   2560 O  O   . PRO A 1 353 ? -56.206 6.046   -27.514 1.00 32.76 ? 353 PRO A O   1 
ATOM   2561 C  CB  . PRO A 1 353 ? -55.977 8.823   -28.383 1.00 27.96 ? 353 PRO A CB  1 
ATOM   2562 C  CG  . PRO A 1 353 ? -54.690 9.027   -29.135 1.00 28.13 ? 353 PRO A CG  1 
ATOM   2563 C  CD  . PRO A 1 353 ? -53.778 9.674   -28.103 1.00 28.83 ? 353 PRO A CD  1 
ATOM   2564 N  N   . THR A 1 354 ? -54.247 6.290   -26.429 1.00 33.83 ? 354 THR A N   1 
ATOM   2565 C  CA  . THR A 1 354 ? -53.971 4.863   -26.325 1.00 35.24 ? 354 THR A CA  1 
ATOM   2566 C  C   . THR A 1 354 ? -55.160 4.054   -25.826 1.00 36.30 ? 354 THR A C   1 
ATOM   2567 O  O   . THR A 1 354 ? -55.471 2.994   -26.368 1.00 36.44 ? 354 THR A O   1 
ATOM   2568 C  CB  . THR A 1 354 ? -52.790 4.612   -25.379 1.00 36.58 ? 354 THR A CB  1 
ATOM   2569 O  OG1 . THR A 1 354 ? -51.618 5.246   -25.907 1.00 37.80 ? 354 THR A OG1 1 
ATOM   2570 C  CG2 . THR A 1 354 ? -52.540 3.116   -25.213 1.00 37.83 ? 354 THR A CG2 1 
ATOM   2571 N  N   . MET A 1 355 ? -55.820 4.553   -24.786 1.00 37.59 ? 355 MET A N   1 
ATOM   2572 C  CA  . MET A 1 355 ? -56.962 3.855   -24.215 1.00 36.11 ? 355 MET A CA  1 
ATOM   2573 C  C   . MET A 1 355 ? -58.213 4.015   -25.063 1.00 37.59 ? 355 MET A C   1 
ATOM   2574 O  O   . MET A 1 355 ? -59.108 3.167   -25.035 1.00 37.25 ? 355 MET A O   1 
ATOM   2575 C  CB  . MET A 1 355 ? -57.228 4.343   -22.789 1.00 35.01 ? 355 MET A CB  1 
ATOM   2576 C  CG  . MET A 1 355 ? -56.092 4.040   -21.827 1.00 33.06 ? 355 MET A CG  1 
ATOM   2577 S  SD  . MET A 1 355 ? -55.437 2.365   -22.041 1.00 34.63 ? 355 MET A SD  1 
ATOM   2578 C  CE  . MET A 1 355 ? -56.718 1.365   -21.210 1.00 29.60 ? 355 MET A CE  1 
ATOM   2579 N  N   . GLU A 1 356 ? -58.281 5.103   -25.819 1.00 36.80 ? 356 GLU A N   1 
ATOM   2580 C  CA  . GLU A 1 356 ? -59.438 5.317   -26.667 1.00 36.50 ? 356 GLU A CA  1 
ATOM   2581 C  C   . GLU A 1 356 ? -59.279 4.585   -28.003 1.00 36.27 ? 356 GLU A C   1 
ATOM   2582 O  O   . GLU A 1 356 ? -59.906 4.942   -28.997 1.00 38.09 ? 356 GLU A O   1 
ATOM   2583 C  CB  . GLU A 1 356 ? -59.676 6.818   -26.885 1.00 36.19 ? 356 GLU A CB  1 
ATOM   2584 C  CG  . GLU A 1 356 ? -60.046 7.573   -25.608 1.00 37.34 ? 356 GLU A CG  1 
ATOM   2585 C  CD  . GLU A 1 356 ? -58.855 7.783   -24.686 1.00 39.07 ? 356 GLU A CD  1 
ATOM   2586 O  OE1 . GLU A 1 356 ? -57.909 8.476   -25.110 1.00 37.20 ? 356 GLU A OE1 1 
ATOM   2587 O  OE2 . GLU A 1 356 ? -58.860 7.261   -23.547 1.00 38.74 ? 356 GLU A OE2 1 
ATOM   2588 N  N   . ASN A 1 357 ? -58.427 3.564   -28.026 1.00 34.19 ? 357 ASN A N   1 
ATOM   2589 C  CA  . ASN A 1 357 ? -58.233 2.773   -29.237 1.00 32.82 ? 357 ASN A CA  1 
ATOM   2590 C  C   . ASN A 1 357 ? -58.042 1.316   -28.844 1.00 32.29 ? 357 ASN A C   1 
ATOM   2591 O  O   . ASN A 1 357 ? -57.246 0.586   -29.430 1.00 31.10 ? 357 ASN A O   1 
ATOM   2592 C  CB  . ASN A 1 357 ? -57.038 3.290   -30.047 1.00 33.58 ? 357 ASN A CB  1 
ATOM   2593 C  CG  . ASN A 1 357 ? -57.287 4.682   -30.626 1.00 36.72 ? 357 ASN A CG  1 
ATOM   2594 O  OD1 . ASN A 1 357 ? -58.346 4.943   -31.193 1.00 38.30 ? 357 ASN A OD1 1 
ATOM   2595 N  ND2 . ASN A 1 357 ? -56.312 5.574   -30.488 1.00 36.31 ? 357 ASN A ND2 1 
ATOM   2596 N  N   . GLY A 1 358 ? -58.791 0.904   -27.829 1.00 33.01 ? 358 GLY A N   1 
ATOM   2597 C  CA  . GLY A 1 358 ? -58.721 -0.465  -27.361 1.00 35.00 ? 358 GLY A CA  1 
ATOM   2598 C  C   . GLY A 1 358 ? -58.160 -0.531  -25.959 1.00 36.23 ? 358 GLY A C   1 
ATOM   2599 O  O   . GLY A 1 358 ? -58.921 -0.549  -24.989 1.00 38.91 ? 358 GLY A O   1 
ATOM   2600 N  N   . PRO A 1 359 ? -56.824 -0.564  -25.818 1.00 35.11 ? 359 PRO A N   1 
ATOM   2601 C  CA  . PRO A 1 359 ? -55.891 -0.540  -26.950 1.00 34.16 ? 359 PRO A CA  1 
ATOM   2602 C  C   . PRO A 1 359 ? -55.788 -1.912  -27.639 1.00 33.81 ? 359 PRO A C   1 
ATOM   2603 O  O   . PRO A 1 359 ? -55.376 -2.899  -27.017 1.00 31.23 ? 359 PRO A O   1 
ATOM   2604 C  CB  . PRO A 1 359 ? -54.588 -0.108  -26.295 1.00 35.72 ? 359 PRO A CB  1 
ATOM   2605 C  CG  . PRO A 1 359 ? -54.665 -0.803  -24.950 1.00 35.76 ? 359 PRO A CG  1 
ATOM   2606 C  CD  . PRO A 1 359 ? -56.103 -0.555  -24.530 1.00 34.28 ? 359 PRO A CD  1 
ATOM   2607 N  N   . LYS A 1 360 ? -56.160 -1.959  -28.920 1.00 31.79 ? 360 LYS A N   1 
ATOM   2608 C  CA  . LYS A 1 360 ? -56.128 -3.191  -29.713 1.00 32.63 ? 360 LYS A CA  1 
ATOM   2609 C  C   . LYS A 1 360 ? -54.758 -3.865  -29.839 1.00 32.28 ? 360 LYS A C   1 
ATOM   2610 O  O   . LYS A 1 360 ? -54.630 -5.067  -29.583 1.00 33.36 ? 360 LYS A O   1 
ATOM   2611 C  CB  . LYS A 1 360 ? -56.706 -2.928  -31.110 1.00 33.54 ? 360 LYS A CB  1 
ATOM   2612 N  N   . LEU A 1 361 ? -53.733 -3.115  -30.235 1.00 30.78 ? 361 LEU A N   1 
ATOM   2613 C  CA  . LEU A 1 361 ? -52.404 -3.714  -30.378 1.00 30.86 ? 361 LEU A CA  1 
ATOM   2614 C  C   . LEU A 1 361 ? -51.840 -4.136  -29.024 1.00 31.08 ? 361 LEU A C   1 
ATOM   2615 O  O   . LEU A 1 361 ? -51.453 -5.292  -28.832 1.00 31.45 ? 361 LEU A O   1 
ATOM   2616 C  CB  . LEU A 1 361 ? -51.425 -2.741  -31.042 1.00 29.32 ? 361 LEU A CB  1 
ATOM   2617 C  CG  . LEU A 1 361 ? -50.475 -3.338  -32.094 1.00 32.27 ? 361 LEU A CG  1 
ATOM   2618 C  CD1 . LEU A 1 361 ? -49.178 -2.536  -32.098 1.00 30.35 ? 361 LEU A CD1 1 
ATOM   2619 C  CD2 . LEU A 1 361 ? -50.183 -4.812  -31.796 1.00 27.78 ? 361 LEU A CD2 1 
ATOM   2620 N  N   . ALA A 1 362 ? -51.790 -3.189  -28.091 1.00 30.23 ? 362 ALA A N   1 
ATOM   2621 C  CA  . ALA A 1 362 ? -51.285 -3.457  -26.751 1.00 30.20 ? 362 ALA A CA  1 
ATOM   2622 C  C   . ALA A 1 362 ? -51.910 -4.732  -26.179 1.00 29.58 ? 362 ALA A C   1 
ATOM   2623 O  O   . ALA A 1 362 ? -51.202 -5.646  -25.755 1.00 28.03 ? 362 ALA A O   1 
ATOM   2624 C  CB  . ALA A 1 362 ? -51.576 -2.272  -25.840 1.00 31.01 ? 362 ALA A CB  1 
ATOM   2625 N  N   . SER A 1 363 ? -53.237 -4.794  -26.190 1.00 29.52 ? 363 SER A N   1 
ATOM   2626 C  CA  . SER A 1 363 ? -53.954 -5.955  -25.672 1.00 31.36 ? 363 SER A CA  1 
ATOM   2627 C  C   . SER A 1 363 ? -53.610 -7.230  -26.438 1.00 32.18 ? 363 SER A C   1 
ATOM   2628 O  O   . SER A 1 363 ? -53.404 -8.288  -25.834 1.00 33.11 ? 363 SER A O   1 
ATOM   2629 C  CB  . SER A 1 363 ? -55.466 -5.715  -25.731 1.00 31.50 ? 363 SER A CB  1 
ATOM   2630 O  OG  . SER A 1 363 ? -55.817 -4.548  -25.006 1.00 32.99 ? 363 SER A OG  1 
ATOM   2631 N  N   . ARG A 1 364 ? -53.551 -7.130  -27.764 1.00 33.18 ? 364 ARG A N   1 
ATOM   2632 C  CA  . ARG A 1 364 ? -53.231 -8.288  -28.597 1.00 32.99 ? 364 ARG A CA  1 
ATOM   2633 C  C   . ARG A 1 364 ? -51.869 -8.852  -28.211 1.00 33.06 ? 364 ARG A C   1 
ATOM   2634 O  O   . ARG A 1 364 ? -51.682 -10.071 -28.138 1.00 34.58 ? 364 ARG A O   1 
ATOM   2635 C  CB  . ARG A 1 364 ? -53.228 -7.901  -30.079 1.00 32.04 ? 364 ARG A CB  1 
ATOM   2636 C  CG  . ARG A 1 364 ? -52.850 -9.043  -31.031 1.00 30.61 ? 364 ARG A CG  1 
ATOM   2637 C  CD  . ARG A 1 364 ? -52.890 -8.584  -32.488 1.00 28.84 ? 364 ARG A CD  1 
ATOM   2638 N  NE  . ARG A 1 364 ? -52.606 -9.663  -33.431 1.00 29.44 ? 364 ARG A NE  1 
ATOM   2639 C  CZ  . ARG A 1 364 ? -52.563 -9.510  -34.754 1.00 30.96 ? 364 ARG A CZ  1 
ATOM   2640 N  NH1 . ARG A 1 364 ? -52.786 -8.319  -35.297 1.00 29.16 ? 364 ARG A NH1 1 
ATOM   2641 N  NH2 . ARG A 1 364 ? -52.292 -10.546 -35.541 1.00 31.97 ? 364 ARG A NH2 1 
ATOM   2642 N  N   . ILE A 1 365 ? -50.921 -7.957  -27.960 1.00 32.32 ? 365 ILE A N   1 
ATOM   2643 C  CA  . ILE A 1 365 ? -49.582 -8.368  -27.578 1.00 32.44 ? 365 ILE A CA  1 
ATOM   2644 C  C   . ILE A 1 365 ? -49.609 -9.069  -26.227 1.00 33.39 ? 365 ILE A C   1 
ATOM   2645 O  O   . ILE A 1 365 ? -49.005 -10.136 -26.052 1.00 32.89 ? 365 ILE A O   1 
ATOM   2646 C  CB  . ILE A 1 365 ? -48.639 -7.156  -27.506 1.00 33.21 ? 365 ILE A CB  1 
ATOM   2647 C  CG1 . ILE A 1 365 ? -48.456 -6.569  -28.909 1.00 33.00 ? 365 ILE A CG1 1 
ATOM   2648 C  CG2 . ILE A 1 365 ? -47.297 -7.566  -26.913 1.00 33.63 ? 365 ILE A CG2 1 
ATOM   2649 C  CD1 . ILE A 1 365 ? -47.577 -5.336  -28.946 1.00 34.28 ? 365 ILE A CD1 1 
ATOM   2650 N  N   . LEU A 1 366 ? -50.317 -8.466  -25.276 1.00 31.01 ? 366 LEU A N   1 
ATOM   2651 C  CA  . LEU A 1 366 ? -50.422 -9.026  -23.942 1.00 31.77 ? 366 LEU A CA  1 
ATOM   2652 C  C   . LEU A 1 366 ? -50.971 -10.447 -24.006 1.00 33.46 ? 366 LEU A C   1 
ATOM   2653 O  O   . LEU A 1 366 ? -50.364 -11.374 -23.464 1.00 33.47 ? 366 LEU A O   1 
ATOM   2654 C  CB  . LEU A 1 366 ? -51.330 -8.153  -23.078 1.00 33.29 ? 366 LEU A CB  1 
ATOM   2655 C  CG  . LEU A 1 366 ? -51.501 -8.544  -21.608 1.00 33.10 ? 366 LEU A CG  1 
ATOM   2656 C  CD1 . LEU A 1 366 ? -50.167 -8.461  -20.883 1.00 33.32 ? 366 LEU A CD1 1 
ATOM   2657 C  CD2 . LEU A 1 366 ? -52.505 -7.606  -20.960 1.00 34.00 ? 366 LEU A CD2 1 
ATOM   2658 N  N   . SER A 1 367 ? -52.112 -10.617 -24.676 1.00 34.08 ? 367 SER A N   1 
ATOM   2659 C  CA  . SER A 1 367 ? -52.740 -11.933 -24.806 1.00 33.94 ? 367 SER A CA  1 
ATOM   2660 C  C   . SER A 1 367 ? -51.761 -12.937 -25.377 1.00 32.70 ? 367 SER A C   1 
ATOM   2661 O  O   . SER A 1 367 ? -51.558 -14.013 -24.813 1.00 31.46 ? 367 SER A O   1 
ATOM   2662 C  CB  . SER A 1 367 ? -53.956 -11.877 -25.737 1.00 36.34 ? 367 SER A CB  1 
ATOM   2663 O  OG  . SER A 1 367 ? -54.915 -10.945 -25.286 1.00 41.66 ? 367 SER A OG  1 
ATOM   2664 N  N   . LYS A 1 368 ? -51.164 -12.571 -26.506 1.00 31.69 ? 368 LYS A N   1 
ATOM   2665 C  CA  . LYS A 1 368 ? -50.214 -13.431 -27.192 1.00 33.26 ? 368 LYS A CA  1 
ATOM   2666 C  C   . LYS A 1 368 ? -49.074 -13.878 -26.272 1.00 34.40 ? 368 LYS A C   1 
ATOM   2667 O  O   . LYS A 1 368 ? -48.866 -15.076 -26.061 1.00 36.85 ? 368 LYS A O   1 
ATOM   2668 C  CB  . LYS A 1 368 ? -49.651 -12.703 -28.416 1.00 33.64 ? 368 LYS A CB  1 
ATOM   2669 C  CG  . LYS A 1 368 ? -48.840 -13.575 -29.364 1.00 35.02 ? 368 LYS A CG  1 
ATOM   2670 C  CD  . LYS A 1 368 ? -49.720 -14.582 -30.096 1.00 38.88 ? 368 LYS A CD  1 
ATOM   2671 C  CE  . LYS A 1 368 ? -48.968 -15.233 -31.251 1.00 41.56 ? 368 LYS A CE  1 
ATOM   2672 N  NZ  . LYS A 1 368 ? -49.866 -16.025 -32.142 1.00 44.49 ? 368 LYS A NZ  1 
ATOM   2673 N  N   . LEU A 1 369 ? -48.342 -12.920 -25.715 1.00 34.89 ? 369 LEU A N   1 
ATOM   2674 C  CA  . LEU A 1 369 ? -47.234 -13.253 -24.832 1.00 34.67 ? 369 LEU A CA  1 
ATOM   2675 C  C   . LEU A 1 369 ? -47.672 -14.088 -23.635 1.00 35.04 ? 369 LEU A C   1 
ATOM   2676 O  O   . LEU A 1 369 ? -46.989 -15.030 -23.250 1.00 34.30 ? 369 LEU A O   1 
ATOM   2677 C  CB  . LEU A 1 369 ? -46.541 -11.982 -24.340 1.00 34.66 ? 369 LEU A CB  1 
ATOM   2678 C  CG  . LEU A 1 369 ? -45.957 -11.056 -25.412 1.00 36.62 ? 369 LEU A CG  1 
ATOM   2679 C  CD1 . LEU A 1 369 ? -45.221 -9.914  -24.713 1.00 33.02 ? 369 LEU A CD1 1 
ATOM   2680 C  CD2 . LEU A 1 369 ? -45.016 -11.835 -26.353 1.00 33.00 ? 369 LEU A CD2 1 
ATOM   2681 N  N   . THR A 1 370 ? -48.813 -13.744 -23.050 1.00 35.93 ? 370 THR A N   1 
ATOM   2682 C  CA  . THR A 1 370 ? -49.315 -14.462 -21.886 1.00 37.49 ? 370 THR A CA  1 
ATOM   2683 C  C   . THR A 1 370 ? -49.813 -15.863 -22.247 1.00 38.59 ? 370 THR A C   1 
ATOM   2684 O  O   . THR A 1 370 ? -49.621 -16.816 -21.488 1.00 36.10 ? 370 THR A O   1 
ATOM   2685 C  CB  . THR A 1 370 ? -50.444 -13.668 -21.202 1.00 38.18 ? 370 THR A CB  1 
ATOM   2686 O  OG1 . THR A 1 370 ? -49.972 -12.352 -20.882 1.00 41.03 ? 370 THR A OG1 1 
ATOM   2687 C  CG2 . THR A 1 370 ? -50.870 -14.349 -19.916 1.00 40.07 ? 370 THR A CG2 1 
ATOM   2688 N  N   . ASP A 1 371 ? -50.449 -15.992 -23.405 1.00 40.12 ? 371 ASP A N   1 
ATOM   2689 C  CA  . ASP A 1 371 ? -50.939 -17.295 -23.835 1.00 41.72 ? 371 ASP A CA  1 
ATOM   2690 C  C   . ASP A 1 371 ? -49.743 -18.229 -23.945 1.00 40.85 ? 371 ASP A C   1 
ATOM   2691 O  O   . ASP A 1 371 ? -49.807 -19.385 -23.533 1.00 40.76 ? 371 ASP A O   1 
ATOM   2692 C  CB  . ASP A 1 371 ? -51.649 -17.186 -25.191 1.00 43.38 ? 371 ASP A CB  1 
ATOM   2693 C  CG  . ASP A 1 371 ? -53.010 -16.512 -25.088 1.00 45.63 ? 371 ASP A CG  1 
ATOM   2694 O  OD1 . ASP A 1 371 ? -53.615 -16.234 -26.145 1.00 46.82 ? 371 ASP A OD1 1 
ATOM   2695 O  OD2 . ASP A 1 371 ? -53.478 -16.265 -23.955 1.00 45.93 ? 371 ASP A OD2 1 
ATOM   2696 N  N   . ILE A 1 372 ? -48.645 -17.704 -24.478 1.00 39.26 ? 372 ILE A N   1 
ATOM   2697 C  CA  . ILE A 1 372 ? -47.424 -18.476 -24.651 1.00 37.66 ? 372 ILE A CA  1 
ATOM   2698 C  C   . ILE A 1 372 ? -46.703 -18.799 -23.339 1.00 38.91 ? 372 ILE A C   1 
ATOM   2699 O  O   . ILE A 1 372 ? -46.253 -19.929 -23.136 1.00 37.75 ? 372 ILE A O   1 
ATOM   2700 C  CB  . ILE A 1 372 ? -46.442 -17.737 -25.563 1.00 38.02 ? 372 ILE A CB  1 
ATOM   2701 C  CG1 . ILE A 1 372 ? -47.102 -17.477 -26.923 1.00 36.92 ? 372 ILE A CG1 1 
ATOM   2702 C  CG2 . ILE A 1 372 ? -45.153 -18.544 -25.692 1.00 36.42 ? 372 ILE A CG2 1 
ATOM   2703 C  CD1 . ILE A 1 372 ? -46.184 -16.828 -27.953 1.00 36.98 ? 372 ILE A CD1 1 
ATOM   2704 N  N   . GLN A 1 373 ? -46.591 -17.809 -22.455 1.00 38.99 ? 373 GLN A N   1 
ATOM   2705 C  CA  . GLN A 1 373 ? -45.909 -17.993 -21.174 1.00 38.59 ? 373 GLN A CA  1 
ATOM   2706 C  C   . GLN A 1 373 ? -46.601 -19.001 -20.259 1.00 39.20 ? 373 GLN A C   1 
ATOM   2707 O  O   . GLN A 1 373 ? -45.938 -19.765 -19.554 1.00 37.74 ? 373 GLN A O   1 
ATOM   2708 C  CB  . GLN A 1 373 ? -45.779 -16.647 -20.454 1.00 37.96 ? 373 GLN A CB  1 
ATOM   2709 C  CG  . GLN A 1 373 ? -45.094 -15.595 -21.299 1.00 38.33 ? 373 GLN A CG  1 
ATOM   2710 C  CD  . GLN A 1 373 ? -45.044 -14.242 -20.632 1.00 37.88 ? 373 GLN A CD  1 
ATOM   2711 O  OE1 . GLN A 1 373 ? -45.980 -13.838 -19.944 1.00 39.48 ? 373 GLN A OE1 1 
ATOM   2712 N  NE2 . GLN A 1 373 ? -43.954 -13.521 -20.849 1.00 35.89 ? 373 GLN A NE2 1 
ATOM   2713 N  N   . TYR A 1 374 ? -47.931 -19.003 -20.269 1.00 39.63 ? 374 TYR A N   1 
ATOM   2714 C  CA  . TYR A 1 374 ? -48.685 -19.923 -19.430 1.00 40.27 ? 374 TYR A CA  1 
ATOM   2715 C  C   . TYR A 1 374 ? -49.099 -21.221 -20.122 1.00 40.86 ? 374 TYR A C   1 
ATOM   2716 O  O   . TYR A 1 374 ? -50.086 -21.847 -19.742 1.00 43.21 ? 374 TYR A O   1 
ATOM   2717 C  CB  . TYR A 1 374 ? -49.921 -19.227 -18.856 1.00 39.45 ? 374 TYR A CB  1 
ATOM   2718 C  CG  . TYR A 1 374 ? -49.604 -18.173 -17.814 1.00 38.50 ? 374 TYR A CG  1 
ATOM   2719 C  CD1 . TYR A 1 374 ? -49.601 -16.818 -18.142 1.00 38.55 ? 374 TYR A CD1 1 
ATOM   2720 C  CD2 . TYR A 1 374 ? -49.303 -18.534 -16.496 1.00 39.80 ? 374 TYR A CD2 1 
ATOM   2721 C  CE1 . TYR A 1 374 ? -49.311 -15.840 -17.181 1.00 38.58 ? 374 TYR A CE1 1 
ATOM   2722 C  CE2 . TYR A 1 374 ? -49.007 -17.567 -15.525 1.00 37.99 ? 374 TYR A CE2 1 
ATOM   2723 C  CZ  . TYR A 1 374 ? -49.015 -16.225 -15.878 1.00 38.80 ? 374 TYR A CZ  1 
ATOM   2724 O  OH  . TYR A 1 374 ? -48.732 -15.271 -14.937 1.00 36.70 ? 374 TYR A OH  1 
ATOM   2725 N  N   . GLY A 1 375 ? -48.346 -21.623 -21.138 1.00 41.60 ? 375 GLY A N   1 
ATOM   2726 C  CA  . GLY A 1 375 ? -48.644 -22.865 -21.837 1.00 43.43 ? 375 GLY A CA  1 
ATOM   2727 C  C   . GLY A 1 375 ? -49.931 -22.973 -22.643 1.00 42.90 ? 375 GLY A C   1 
ATOM   2728 O  O   . GLY A 1 375 ? -50.195 -24.023 -23.232 1.00 42.16 ? 375 GLY A O   1 
ATOM   2729 N  N   . ARG A 1 376 ? -50.733 -21.913 -22.674 1.00 43.70 ? 376 ARG A N   1 
ATOM   2730 C  CA  . ARG A 1 376 ? -51.978 -21.931 -23.432 1.00 46.03 ? 376 ARG A CA  1 
ATOM   2731 C  C   . ARG A 1 376 ? -51.681 -22.031 -24.927 1.00 48.71 ? 376 ARG A C   1 
ATOM   2732 O  O   . ARG A 1 376 ? -52.489 -22.548 -25.701 1.00 50.28 ? 376 ARG A O   1 
ATOM   2733 C  CB  . ARG A 1 376 ? -52.799 -20.677 -23.149 1.00 46.40 ? 376 ARG A CB  1 
ATOM   2734 C  CG  . ARG A 1 376 ? -53.346 -20.600 -21.734 1.00 47.94 ? 376 ARG A CG  1 
ATOM   2735 C  CD  . ARG A 1 376 ? -54.350 -19.467 -21.609 1.00 49.50 ? 376 ARG A CD  1 
ATOM   2736 N  NE  . ARG A 1 376 ? -53.760 -18.206 -21.164 1.00 51.42 ? 376 ARG A NE  1 
ATOM   2737 C  CZ  . ARG A 1 376 ? -53.453 -17.934 -19.898 1.00 51.77 ? 376 ARG A CZ  1 
ATOM   2738 N  NH1 . ARG A 1 376 ? -53.674 -18.842 -18.956 1.00 53.08 ? 376 ARG A NH1 1 
ATOM   2739 N  NH2 . ARG A 1 376 ? -52.954 -16.747 -19.567 1.00 50.64 ? 376 ARG A NH2 1 
ATOM   2740 N  N   . GLU A 1 377 ? -50.520 -21.528 -25.331 1.00 49.53 ? 377 GLU A N   1 
ATOM   2741 C  CA  . GLU A 1 377 ? -50.108 -21.602 -26.723 1.00 50.24 ? 377 GLU A CA  1 
ATOM   2742 C  C   . GLU A 1 377 ? -48.720 -22.215 -26.725 1.00 51.10 ? 377 GLU A C   1 
ATOM   2743 O  O   . GLU A 1 377 ? -47.844 -21.791 -25.969 1.00 49.62 ? 377 GLU A O   1 
ATOM   2744 C  CB  . GLU A 1 377 ? -50.056 -20.215 -27.370 1.00 51.16 ? 377 GLU A CB  1 
ATOM   2745 C  CG  . GLU A 1 377 ? -49.769 -20.271 -28.867 1.00 50.68 ? 377 GLU A CG  1 
ATOM   2746 C  CD  . GLU A 1 377 ? -49.582 -18.901 -29.499 1.00 51.47 ? 377 GLU A CD  1 
ATOM   2747 O  OE1 . GLU A 1 377 ? -50.449 -18.025 -29.290 1.00 51.45 ? 377 GLU A OE1 1 
ATOM   2748 O  OE2 . GLU A 1 377 ? -48.569 -18.707 -30.213 1.00 50.34 ? 377 GLU A OE2 1 
ATOM   2749 N  N   . GLU A 1 378 ? -48.524 -23.219 -27.572 1.00 52.53 ? 378 GLU A N   1 
ATOM   2750 C  CA  . GLU A 1 378 ? -47.240 -23.900 -27.663 1.00 52.96 ? 378 GLU A CA  1 
ATOM   2751 C  C   . GLU A 1 378 ? -46.318 -23.178 -28.646 1.00 52.10 ? 378 GLU A C   1 
ATOM   2752 O  O   . GLU A 1 378 ? -46.717 -22.841 -29.761 1.00 51.75 ? 378 GLU A O   1 
ATOM   2753 C  CB  . GLU A 1 378 ? -47.459 -25.354 -28.097 1.00 53.90 ? 378 GLU A CB  1 
ATOM   2754 C  CG  . GLU A 1 378 ? -46.629 -26.368 -27.326 1.00 55.61 ? 378 GLU A CG  1 
ATOM   2755 C  CD  . GLU A 1 378 ? -45.299 -26.670 -27.985 1.00 56.42 ? 378 GLU A CD  1 
ATOM   2756 O  OE1 . GLU A 1 378 ? -44.547 -25.720 -28.294 1.00 56.41 ? 378 GLU A OE1 1 
ATOM   2757 O  OE2 . GLU A 1 378 ? -45.006 -27.867 -28.189 1.00 56.61 ? 378 GLU A OE2 1 
ATOM   2758 N  N   . ARG A 1 379 ? -45.086 -22.932 -28.217 1.00 51.69 ? 379 ARG A N   1 
ATOM   2759 C  CA  . ARG A 1 379 ? -44.106 -22.257 -29.053 1.00 50.70 ? 379 ARG A CA  1 
ATOM   2760 C  C   . ARG A 1 379 ? -42.706 -22.488 -28.483 1.00 50.49 ? 379 ARG A C   1 
ATOM   2761 O  O   . ARG A 1 379 ? -42.543 -22.817 -27.302 1.00 49.56 ? 379 ARG A O   1 
ATOM   2762 C  CB  . ARG A 1 379 ? -44.432 -20.754 -29.138 1.00 50.85 ? 379 ARG A CB  1 
ATOM   2763 C  CG  . ARG A 1 379 ? -43.483 -19.940 -30.020 1.00 51.03 ? 379 ARG A CG  1 
ATOM   2764 C  CD  . ARG A 1 379 ? -44.118 -18.626 -30.506 1.00 48.71 ? 379 ARG A CD  1 
ATOM   2765 N  NE  . ARG A 1 379 ? -43.161 -17.824 -31.270 1.00 47.08 ? 379 ARG A NE  1 
ATOM   2766 C  CZ  . ARG A 1 379 ? -43.480 -16.823 -32.091 1.00 46.79 ? 379 ARG A CZ  1 
ATOM   2767 N  NH1 . ARG A 1 379 ? -44.747 -16.474 -32.283 1.00 43.89 ? 379 ARG A NH1 1 
ATOM   2768 N  NH2 . ARG A 1 379 ? -42.519 -16.160 -32.722 1.00 47.02 ? 379 ARG A NH2 1 
ATOM   2769 N  N   . ASP A 1 380 ? -41.702 -22.326 -29.337 1.00 49.76 ? 380 ASP A N   1 
ATOM   2770 C  CA  . ASP A 1 380 ? -40.309 -22.526 -28.957 1.00 49.78 ? 380 ASP A CA  1 
ATOM   2771 C  C   . ASP A 1 380 ? -39.802 -21.527 -27.913 1.00 48.27 ? 380 ASP A C   1 
ATOM   2772 O  O   . ASP A 1 380 ? -38.809 -21.785 -27.238 1.00 47.00 ? 380 ASP A O   1 
ATOM   2773 C  CB  . ASP A 1 380 ? -39.433 -22.434 -30.202 1.00 52.66 ? 380 ASP A CB  1 
ATOM   2774 C  CG  . ASP A 1 380 ? -39.492 -21.063 -30.839 1.00 56.07 ? 380 ASP A CG  1 
ATOM   2775 O  OD1 . ASP A 1 380 ? -40.618 -20.577 -31.092 1.00 57.42 ? 380 ASP A OD1 1 
ATOM   2776 O  OD2 . ASP A 1 380 ? -38.419 -20.471 -31.079 1.00 57.86 ? 380 ASP A OD2 1 
ATOM   2777 N  N   . TRP A 1 381 ? -40.476 -20.390 -27.781 1.00 46.96 ? 381 TRP A N   1 
ATOM   2778 C  CA  . TRP A 1 381 ? -40.057 -19.375 -26.816 1.00 46.02 ? 381 TRP A CA  1 
ATOM   2779 C  C   . TRP A 1 381 ? -40.042 -19.814 -25.356 1.00 45.81 ? 381 TRP A C   1 
ATOM   2780 O  O   . TRP A 1 381 ? -39.623 -19.049 -24.488 1.00 47.47 ? 381 TRP A O   1 
ATOM   2781 C  CB  . TRP A 1 381 ? -40.924 -18.123 -26.945 1.00 44.76 ? 381 TRP A CB  1 
ATOM   2782 C  CG  . TRP A 1 381 ? -40.580 -17.289 -28.127 1.00 43.31 ? 381 TRP A CG  1 
ATOM   2783 C  CD1 . TRP A 1 381 ? -39.535 -17.475 -28.987 1.00 42.68 ? 381 TRP A CD1 1 
ATOM   2784 C  CD2 . TRP A 1 381 ? -41.242 -16.092 -28.551 1.00 43.43 ? 381 TRP A CD2 1 
ATOM   2785 N  NE1 . TRP A 1 381 ? -39.502 -16.464 -29.918 1.00 43.24 ? 381 TRP A NE1 1 
ATOM   2786 C  CE2 . TRP A 1 381 ? -40.539 -15.601 -29.673 1.00 42.75 ? 381 TRP A CE2 1 
ATOM   2787 C  CE3 . TRP A 1 381 ? -42.362 -15.383 -28.091 1.00 41.66 ? 381 TRP A CE3 1 
ATOM   2788 C  CZ2 . TRP A 1 381 ? -40.920 -14.431 -30.344 1.00 41.90 ? 381 TRP A CZ2 1 
ATOM   2789 C  CZ3 . TRP A 1 381 ? -42.740 -14.219 -28.761 1.00 38.80 ? 381 TRP A CZ3 1 
ATOM   2790 C  CH2 . TRP A 1 381 ? -42.021 -13.758 -29.872 1.00 38.70 ? 381 TRP A CH2 1 
ATOM   2791 N  N   . THR A 1 382 ? -40.493 -21.030 -25.067 1.00 44.59 ? 382 THR A N   1 
ATOM   2792 C  CA  . THR A 1 382 ? -40.482 -21.489 -23.683 1.00 43.36 ? 382 THR A CA  1 
ATOM   2793 C  C   . THR A 1 382 ? -39.758 -22.812 -23.478 1.00 43.15 ? 382 THR A C   1 
ATOM   2794 O  O   . THR A 1 382 ? -39.545 -23.585 -24.415 1.00 39.43 ? 382 THR A O   1 
ATOM   2795 C  CB  . THR A 1 382 ? -41.905 -21.641 -23.113 1.00 43.87 ? 382 THR A CB  1 
ATOM   2796 O  OG1 . THR A 1 382 ? -42.650 -22.564 -23.917 1.00 43.56 ? 382 THR A OG1 1 
ATOM   2797 C  CG2 . THR A 1 382 ? -42.613 -20.295 -23.075 1.00 41.92 ? 382 THR A CG2 1 
ATOM   2798 N  N   . ILE A 1 383 ? -39.375 -23.045 -22.228 1.00 43.10 ? 383 ILE A N   1 
ATOM   2799 C  CA  . ILE A 1 383 ? -38.691 -24.259 -21.827 1.00 43.48 ? 383 ILE A CA  1 
ATOM   2800 C  C   . ILE A 1 383 ? -39.448 -24.779 -20.617 1.00 43.75 ? 383 ILE A C   1 
ATOM   2801 O  O   . ILE A 1 383 ? -39.669 -24.047 -19.655 1.00 42.87 ? 383 ILE A O   1 
ATOM   2802 C  CB  . ILE A 1 383 ? -37.225 -23.982 -21.428 1.00 44.31 ? 383 ILE A CB  1 
ATOM   2803 C  CG1 . ILE A 1 383 ? -36.455 -23.430 -22.627 1.00 45.51 ? 383 ILE A CG1 1 
ATOM   2804 C  CG2 . ILE A 1 383 ? -36.562 -25.265 -20.933 1.00 44.84 ? 383 ILE A CG2 1 
ATOM   2805 C  CD1 . ILE A 1 383 ? -34.986 -23.195 -22.356 1.00 44.59 ? 383 ILE A CD1 1 
ATOM   2806 N  N   . VAL A 1 384 ? -39.868 -26.037 -20.675 1.00 44.96 ? 384 VAL A N   1 
ATOM   2807 C  CA  . VAL A 1 384 ? -40.604 -26.628 -19.567 1.00 45.97 ? 384 VAL A CA  1 
ATOM   2808 C  C   . VAL A 1 384 ? -39.605 -27.166 -18.564 1.00 45.74 ? 384 VAL A C   1 
ATOM   2809 O  O   . VAL A 1 384 ? -38.426 -27.290 -18.866 1.00 45.87 ? 384 VAL A O   1 
ATOM   2810 C  CB  . VAL A 1 384 ? -41.499 -27.786 -20.044 1.00 46.08 ? 384 VAL A CB  1 
ATOM   2811 C  CG1 . VAL A 1 384 ? -42.429 -28.226 -18.921 1.00 45.66 ? 384 VAL A CG1 1 
ATOM   2812 C  CG2 . VAL A 1 384 ? -42.296 -27.351 -21.257 1.00 46.96 ? 384 VAL A CG2 1 
ATOM   2813 N  N   . LEU A 1 385 ? -40.075 -27.476 -17.367 1.00 47.58 ? 385 LEU A N   1 
ATOM   2814 C  CA  . LEU A 1 385 ? -39.204 -28.014 -16.338 1.00 48.62 ? 385 LEU A CA  1 
ATOM   2815 C  C   . LEU A 1 385 ? -39.850 -29.177 -15.611 1.00 48.02 ? 385 LEU A C   1 
ATOM   2816 O  O   . LEU A 1 385 ? -41.091 -29.291 -15.681 1.00 48.01 ? 385 LEU A O   1 
ATOM   2817 C  CB  . LEU A 1 385 ? -38.844 -26.926 -15.332 1.00 48.50 ? 385 LEU A CB  1 
ATOM   2818 C  CG  . LEU A 1 385 ? -37.552 -26.178 -15.646 1.00 50.15 ? 385 LEU A CG  1 
ATOM   2819 C  CD1 . LEU A 1 385 ? -37.299 -25.145 -14.551 1.00 49.28 ? 385 LEU A CD1 1 
ATOM   2820 C  CD2 . LEU A 1 385 ? -36.390 -27.183 -15.746 1.00 47.85 ? 385 LEU A CD2 1 
ATOM   2821 N  N   . THR B 1 24  ? -31.748 13.131  12.067  1.00 36.31 ? 24  THR B N   1 
ATOM   2822 C  CA  . THR B 1 24  ? -30.266 12.953  11.950  1.00 34.77 ? 24  THR B CA  1 
ATOM   2823 C  C   . THR B 1 24  ? -29.636 12.393  13.227  1.00 34.52 ? 24  THR B C   1 
ATOM   2824 O  O   . THR B 1 24  ? -30.115 12.651  14.326  1.00 34.33 ? 24  THR B O   1 
ATOM   2825 C  CB  . THR B 1 24  ? -29.559 14.285  11.633  1.00 33.07 ? 24  THR B CB  1 
ATOM   2826 O  OG1 . THR B 1 24  ? -28.142 14.089  11.689  1.00 35.57 ? 24  THR B OG1 1 
ATOM   2827 C  CG2 . THR B 1 24  ? -29.941 15.349  12.646  1.00 32.34 ? 24  THR B CG2 1 
ATOM   2828 N  N   . PHE B 1 25  ? -28.555 11.632  13.072  1.00 33.11 ? 25  PHE B N   1 
ATOM   2829 C  CA  . PHE B 1 25  ? -27.851 11.047  14.211  1.00 30.72 ? 25  PHE B CA  1 
ATOM   2830 C  C   . PHE B 1 25  ? -26.929 12.082  14.829  1.00 28.88 ? 25  PHE B C   1 
ATOM   2831 O  O   . PHE B 1 25  ? -26.655 13.112  14.215  1.00 24.30 ? 25  PHE B O   1 
ATOM   2832 C  CB  . PHE B 1 25  ? -27.032 9.817   13.769  1.00 29.08 ? 25  PHE B CB  1 
ATOM   2833 C  CG  . PHE B 1 25  ? -26.091 10.090  12.624  1.00 27.62 ? 25  PHE B CG  1 
ATOM   2834 C  CD1 . PHE B 1 25  ? -24.811 10.570  12.854  1.00 27.17 ? 25  PHE B CD1 1 
ATOM   2835 C  CD2 . PHE B 1 25  ? -26.504 9.897   11.313  1.00 26.16 ? 25  PHE B CD2 1 
ATOM   2836 C  CE1 . PHE B 1 25  ? -23.955 10.856  11.794  1.00 26.16 ? 25  PHE B CE1 1 
ATOM   2837 C  CE2 . PHE B 1 25  ? -25.661 10.179  10.251  1.00 24.81 ? 25  PHE B CE2 1 
ATOM   2838 C  CZ  . PHE B 1 25  ? -24.382 10.661  10.489  1.00 27.09 ? 25  PHE B CZ  1 
ATOM   2839 N  N   . LYS B 1 26  ? -26.466 11.802  16.048  1.00 28.49 ? 26  LYS B N   1 
ATOM   2840 C  CA  . LYS B 1 26  ? -25.568 12.703  16.750  1.00 29.45 ? 26  LYS B CA  1 
ATOM   2841 C  C   . LYS B 1 26  ? -24.334 11.995  17.306  1.00 28.40 ? 26  LYS B C   1 
ATOM   2842 O  O   . LYS B 1 26  ? -24.415 10.868  17.807  1.00 27.49 ? 26  LYS B O   1 
ATOM   2843 C  CB  . LYS B 1 26  ? -26.319 13.429  17.876  1.00 33.11 ? 26  LYS B CB  1 
ATOM   2844 C  CG  . LYS B 1 26  ? -27.331 14.462  17.371  1.00 37.87 ? 26  LYS B CG  1 
ATOM   2845 C  CD  . LYS B 1 26  ? -27.778 15.422  18.472  1.00 40.59 ? 26  LYS B CD  1 
ATOM   2846 C  CE  . LYS B 1 26  ? -28.468 16.657  17.888  1.00 40.66 ? 26  LYS B CE  1 
ATOM   2847 N  NZ  . LYS B 1 26  ? -29.656 16.289  17.064  1.00 42.99 ? 26  LYS B NZ  1 
ATOM   2848 N  N   . ALA B 1 27  ? -23.187 12.665  17.196  1.00 28.14 ? 27  ALA B N   1 
ATOM   2849 C  CA  . ALA B 1 27  ? -21.917 12.132  17.672  1.00 28.89 ? 27  ALA B CA  1 
ATOM   2850 C  C   . ALA B 1 27  ? -22.001 11.841  19.155  1.00 30.04 ? 27  ALA B C   1 
ATOM   2851 O  O   . ALA B 1 27  ? -21.425 10.866  19.639  1.00 31.88 ? 27  ALA B O   1 
ATOM   2852 C  CB  . ALA B 1 27  ? -20.800 13.124  17.412  1.00 28.00 ? 27  ALA B CB  1 
ATOM   2853 N  N   . LYS B 1 28  ? -22.726 12.695  19.868  1.00 29.02 ? 28  LYS B N   1 
ATOM   2854 C  CA  . LYS B 1 28  ? -22.891 12.538  21.299  1.00 28.90 ? 28  LYS B CA  1 
ATOM   2855 C  C   . LYS B 1 28  ? -23.415 11.157  21.646  1.00 29.62 ? 28  LYS B C   1 
ATOM   2856 O  O   . LYS B 1 28  ? -23.217 10.696  22.762  1.00 33.72 ? 28  LYS B O   1 
ATOM   2857 C  CB  . LYS B 1 28  ? -23.838 13.611  21.842  1.00 30.27 ? 28  LYS B CB  1 
ATOM   2858 N  N   . ASP B 1 29  ? -24.073 10.488  20.700  1.00 28.97 ? 29  ASP B N   1 
ATOM   2859 C  CA  . ASP B 1 29  ? -24.627 9.162   20.968  1.00 29.21 ? 29  ASP B CA  1 
ATOM   2860 C  C   . ASP B 1 29  ? -23.729 8.011   20.547  1.00 29.82 ? 29  ASP B C   1 
ATOM   2861 O  O   . ASP B 1 29  ? -24.137 6.850   20.621  1.00 30.35 ? 29  ASP B O   1 
ATOM   2862 C  CB  . ASP B 1 29  ? -25.990 8.984   20.284  1.00 28.14 ? 29  ASP B CB  1 
ATOM   2863 C  CG  . ASP B 1 29  ? -27.062 9.876   20.870  1.00 27.77 ? 29  ASP B CG  1 
ATOM   2864 O  OD1 . ASP B 1 29  ? -27.188 9.921   22.113  1.00 27.57 ? 29  ASP B OD1 1 
ATOM   2865 O  OD2 . ASP B 1 29  ? -27.786 10.526  20.088  1.00 25.27 ? 29  ASP B OD2 1 
ATOM   2866 N  N   . LEU B 1 30  ? -22.515 8.321   20.109  1.00 28.74 ? 30  LEU B N   1 
ATOM   2867 C  CA  . LEU B 1 30  ? -21.599 7.276   19.678  1.00 29.56 ? 30  LEU B CA  1 
ATOM   2868 C  C   . LEU B 1 30  ? -21.523 6.130   20.675  1.00 30.83 ? 30  LEU B C   1 
ATOM   2869 O  O   . LEU B 1 30  ? -21.527 6.344   21.890  1.00 31.52 ? 30  LEU B O   1 
ATOM   2870 C  CB  . LEU B 1 30  ? -20.189 7.840   19.477  1.00 27.95 ? 30  LEU B CB  1 
ATOM   2871 C  CG  . LEU B 1 30  ? -19.767 8.362   18.099  1.00 29.20 ? 30  LEU B CG  1 
ATOM   2872 C  CD1 . LEU B 1 30  ? -18.371 9.001   18.198  1.00 28.67 ? 30  LEU B CD1 1 
ATOM   2873 C  CD2 . LEU B 1 30  ? -19.755 7.224   17.091  1.00 25.42 ? 30  LEU B CD2 1 
ATOM   2874 N  N   . ILE B 1 31  ? -21.472 4.911   20.152  1.00 29.34 ? 31  ILE B N   1 
ATOM   2875 C  CA  . ILE B 1 31  ? -21.327 3.721   20.984  1.00 26.81 ? 31  ILE B CA  1 
ATOM   2876 C  C   . ILE B 1 31  ? -20.061 3.059   20.460  1.00 27.07 ? 31  ILE B C   1 
ATOM   2877 O  O   . ILE B 1 31  ? -19.983 2.682   19.287  1.00 24.99 ? 31  ILE B O   1 
ATOM   2878 C  CB  . ILE B 1 31  ? -22.523 2.770   20.853  1.00 27.88 ? 31  ILE B CB  1 
ATOM   2879 C  CG1 . ILE B 1 31  ? -23.750 3.412   21.499  1.00 24.73 ? 31  ILE B CG1 1 
ATOM   2880 C  CG2 . ILE B 1 31  ? -22.217 1.438   21.529  1.00 26.46 ? 31  ILE B CG2 1 
ATOM   2881 C  CD1 . ILE B 1 31  ? -25.041 2.682   21.198  1.00 24.51 ? 31  ILE B CD1 1 
ATOM   2882 N  N   . VAL B 1 32  ? -19.074 2.940   21.342  1.00 26.00 ? 32  VAL B N   1 
ATOM   2883 C  CA  . VAL B 1 32  ? -17.773 2.392   21.004  1.00 25.66 ? 32  VAL B CA  1 
ATOM   2884 C  C   . VAL B 1 32  ? -17.534 0.949   21.442  1.00 27.90 ? 32  VAL B C   1 
ATOM   2885 O  O   . VAL B 1 32  ? -17.742 0.603   22.600  1.00 31.04 ? 32  VAL B O   1 
ATOM   2886 C  CB  . VAL B 1 32  ? -16.685 3.275   21.626  1.00 25.49 ? 32  VAL B CB  1 
ATOM   2887 C  CG1 . VAL B 1 32  ? -15.308 2.878   21.099  1.00 22.93 ? 32  VAL B CG1 1 
ATOM   2888 C  CG2 . VAL B 1 32  ? -17.005 4.748   21.345  1.00 23.11 ? 32  VAL B CG2 1 
ATOM   2889 N  N   . THR B 1 33  ? -17.071 0.124   20.510  1.00 27.62 ? 33  THR B N   1 
ATOM   2890 C  CA  . THR B 1 33  ? -16.777 -1.280  20.775  1.00 29.51 ? 33  THR B CA  1 
ATOM   2891 C  C   . THR B 1 33  ? -15.380 -1.590  20.239  1.00 31.05 ? 33  THR B C   1 
ATOM   2892 O  O   . THR B 1 33  ? -15.223 -2.123  19.143  1.00 32.85 ? 33  THR B O   1 
ATOM   2893 C  CB  . THR B 1 33  ? -17.803 -2.170  20.090  1.00 29.59 ? 33  THR B CB  1 
ATOM   2894 O  OG1 . THR B 1 33  ? -19.091 -1.910  20.659  1.00 32.15 ? 33  THR B OG1 1 
ATOM   2895 C  CG2 . THR B 1 33  ? -17.447 -3.644  20.271  1.00 31.28 ? 33  THR B CG2 1 
ATOM   2896 N  N   . PRO B 1 34  ? -14.340 -1.258  21.016  1.00 32.79 ? 34  PRO B N   1 
ATOM   2897 C  CA  . PRO B 1 34  ? -12.953 -1.493  20.605  1.00 33.12 ? 34  PRO B CA  1 
ATOM   2898 C  C   . PRO B 1 34  ? -12.609 -2.926  20.257  1.00 32.30 ? 34  PRO B C   1 
ATOM   2899 O  O   . PRO B 1 34  ? -13.162 -3.862  20.827  1.00 35.60 ? 34  PRO B O   1 
ATOM   2900 C  CB  . PRO B 1 34  ? -12.146 -0.969  21.797  1.00 34.55 ? 34  PRO B CB  1 
ATOM   2901 C  CG  . PRO B 1 34  ? -13.072 -1.197  22.957  1.00 35.35 ? 34  PRO B CG  1 
ATOM   2902 C  CD  . PRO B 1 34  ? -14.397 -0.756  22.402  1.00 34.78 ? 34  PRO B CD  1 
ATOM   2903 N  N   . ALA B 1 35  ? -11.705 -3.091  19.300  1.00 30.22 ? 35  ALA B N   1 
ATOM   2904 C  CA  . ALA B 1 35  ? -11.266 -4.414  18.906  1.00 29.75 ? 35  ALA B CA  1 
ATOM   2905 C  C   . ALA B 1 35  ? -10.480 -4.954  20.102  1.00 30.42 ? 35  ALA B C   1 
ATOM   2906 O  O   . ALA B 1 35  ? -9.906  -4.180  20.865  1.00 27.19 ? 35  ALA B O   1 
ATOM   2907 C  CB  . ALA B 1 35  ? -10.378 -4.324  17.679  1.00 28.10 ? 35  ALA B CB  1 
ATOM   2908 N  N   . THR B 1 36  ? -10.469 -6.270  20.289  1.00 31.39 ? 36  THR B N   1 
ATOM   2909 C  CA  . THR B 1 36  ? -9.735  -6.838  21.413  1.00 35.80 ? 36  THR B CA  1 
ATOM   2910 C  C   . THR B 1 36  ? -8.335  -7.249  20.980  1.00 36.30 ? 36  THR B C   1 
ATOM   2911 O  O   . THR B 1 36  ? -7.479  -7.569  21.808  1.00 36.94 ? 36  THR B O   1 
ATOM   2912 C  CB  . THR B 1 36  ? -10.482 -8.050  22.028  1.00 36.99 ? 36  THR B CB  1 
ATOM   2913 O  OG1 . THR B 1 36  ? -11.112 -8.805  20.987  1.00 38.77 ? 36  THR B OG1 1 
ATOM   2914 C  CG2 . THR B 1 36  ? -11.534 -7.579  23.031  1.00 35.63 ? 36  THR B CG2 1 
ATOM   2915 N  N   . ILE B 1 37  ? -8.113  -7.220  19.671  1.00 36.78 ? 37  ILE B N   1 
ATOM   2916 C  CA  . ILE B 1 37  ? -6.826  -7.560  19.085  1.00 36.74 ? 37  ILE B CA  1 
ATOM   2917 C  C   . ILE B 1 37  ? -6.521  -6.565  17.963  1.00 38.03 ? 37  ILE B C   1 
ATOM   2918 O  O   . ILE B 1 37  ? -7.128  -6.618  16.894  1.00 38.79 ? 37  ILE B O   1 
ATOM   2919 C  CB  . ILE B 1 37  ? -6.842  -9.000  18.530  1.00 36.74 ? 37  ILE B CB  1 
ATOM   2920 C  CG1 . ILE B 1 37  ? -6.906  -9.990  19.696  1.00 36.48 ? 37  ILE B CG1 1 
ATOM   2921 C  CG2 . ILE B 1 37  ? -5.617  -9.253  17.671  1.00 35.29 ? 37  ILE B CG2 1 
ATOM   2922 C  CD1 . ILE B 1 37  ? -6.780  -11.432 19.284  1.00 37.74 ? 37  ILE B CD1 1 
ATOM   2923 N  N   . LEU B 1 38  ? -5.582  -5.656  18.218  1.00 38.40 ? 38  LEU B N   1 
ATOM   2924 C  CA  . LEU B 1 38  ? -5.207  -4.636  17.239  1.00 38.92 ? 38  LEU B CA  1 
ATOM   2925 C  C   . LEU B 1 38  ? -4.186  -5.145  16.223  1.00 38.40 ? 38  LEU B C   1 
ATOM   2926 O  O   . LEU B 1 38  ? -3.314  -5.948  16.555  1.00 39.22 ? 38  LEU B O   1 
ATOM   2927 C  CB  . LEU B 1 38  ? -4.649  -3.401  17.954  1.00 37.75 ? 38  LEU B CB  1 
ATOM   2928 C  CG  . LEU B 1 38  ? -5.525  -2.738  19.023  1.00 38.55 ? 38  LEU B CG  1 
ATOM   2929 C  CD1 . LEU B 1 38  ? -4.861  -1.449  19.493  1.00 37.89 ? 38  LEU B CD1 1 
ATOM   2930 C  CD2 . LEU B 1 38  ? -6.902  -2.433  18.469  1.00 36.85 ? 38  LEU B CD2 1 
ATOM   2931 N  N   . LYS B 1 39  ? -4.299  -4.674  14.984  1.00 36.68 ? 39  LYS B N   1 
ATOM   2932 C  CA  . LYS B 1 39  ? -3.385  -5.090  13.929  1.00 36.70 ? 39  LYS B CA  1 
ATOM   2933 C  C   . LYS B 1 39  ? -2.088  -4.296  13.916  1.00 37.42 ? 39  LYS B C   1 
ATOM   2934 O  O   . LYS B 1 39  ? -2.000  -3.192  14.451  1.00 38.42 ? 39  LYS B O   1 
ATOM   2935 C  CB  . LYS B 1 39  ? -4.051  -4.970  12.558  1.00 34.64 ? 39  LYS B CB  1 
ATOM   2936 C  CG  . LYS B 1 39  ? -5.151  -5.983  12.312  1.00 34.75 ? 39  LYS B CG  1 
ATOM   2937 C  CD  . LYS B 1 39  ? -5.838  -5.748  10.978  1.00 34.34 ? 39  LYS B CD  1 
ATOM   2938 C  CE  . LYS B 1 39  ? -6.678  -4.472  10.987  1.00 36.83 ? 39  LYS B CE  1 
ATOM   2939 N  NZ  . LYS B 1 39  ? -7.286  -4.196  9.648   1.00 36.52 ? 39  LYS B NZ  1 
ATOM   2940 N  N   . GLU B 1 40  ? -1.079  -4.886  13.296  1.00 40.40 ? 40  GLU B N   1 
ATOM   2941 C  CA  . GLU B 1 40  ? 0.233   -4.275  13.162  1.00 43.19 ? 40  GLU B CA  1 
ATOM   2942 C  C   . GLU B 1 40  ? 0.182   -3.249  12.032  1.00 41.12 ? 40  GLU B C   1 
ATOM   2943 O  O   . GLU B 1 40  ? -0.253  -3.555  10.926  1.00 41.62 ? 40  GLU B O   1 
ATOM   2944 C  CB  . GLU B 1 40  ? 1.275   -5.354  12.837  1.00 46.40 ? 40  GLU B CB  1 
ATOM   2945 C  CG  . GLU B 1 40  ? 1.003   -6.103  11.528  1.00 51.64 ? 40  GLU B CG  1 
ATOM   2946 C  CD  . GLU B 1 40  ? -0.327  -6.852  11.529  1.00 55.69 ? 40  GLU B CD  1 
ATOM   2947 O  OE1 . GLU B 1 40  ? -0.838  -7.162  10.430  1.00 59.44 ? 40  GLU B OE1 1 
ATOM   2948 O  OE2 . GLU B 1 40  ? -0.860  -7.143  12.622  1.00 56.53 ? 40  GLU B OE2 1 
ATOM   2949 N  N   . LYS B 1 41  ? 0.610   -2.031  12.329  1.00 40.49 ? 41  LYS B N   1 
ATOM   2950 C  CA  . LYS B 1 41  ? 0.640   -0.950  11.354  1.00 40.15 ? 41  LYS B CA  1 
ATOM   2951 C  C   . LYS B 1 41  ? 1.637   -1.312  10.247  1.00 41.02 ? 41  LYS B C   1 
ATOM   2952 O  O   . LYS B 1 41  ? 2.745   -1.753  10.533  1.00 40.75 ? 41  LYS B O   1 
ATOM   2953 C  CB  . LYS B 1 41  ? 1.058   0.350   12.050  1.00 39.17 ? 41  LYS B CB  1 
ATOM   2954 C  CG  . LYS B 1 41  ? -0.054  1.075   12.828  1.00 37.99 ? 41  LYS B CG  1 
ATOM   2955 C  CD  . LYS B 1 41  ? -0.811  0.182   13.814  1.00 37.24 ? 41  LYS B CD  1 
ATOM   2956 C  CE  . LYS B 1 41  ? -1.706  1.023   14.733  1.00 35.82 ? 41  LYS B CE  1 
ATOM   2957 N  NZ  . LYS B 1 41  ? -2.607  0.192   15.595  1.00 37.36 ? 41  LYS B NZ  1 
ATOM   2958 N  N   . PRO B 1 42  ? 1.255   -1.116  8.968   1.00 42.23 ? 42  PRO B N   1 
ATOM   2959 C  CA  . PRO B 1 42  ? 2.075   -1.413  7.781   1.00 43.21 ? 42  PRO B CA  1 
ATOM   2960 C  C   . PRO B 1 42  ? 3.282   -0.509  7.527   1.00 44.68 ? 42  PRO B C   1 
ATOM   2961 O  O   . PRO B 1 42  ? 3.454   0.521   8.180   1.00 43.63 ? 42  PRO B O   1 
ATOM   2962 C  CB  . PRO B 1 42  ? 1.067   -1.314  6.646   1.00 42.90 ? 42  PRO B CB  1 
ATOM   2963 C  CG  . PRO B 1 42  ? 0.203   -0.170  7.106   1.00 39.69 ? 42  PRO B CG  1 
ATOM   2964 C  CD  . PRO B 1 42  ? -0.036  -0.524  8.564   1.00 40.51 ? 42  PRO B CD  1 
ATOM   2965 N  N   . ASP B 1 43  ? 4.100   -0.903  6.550   1.00 48.10 ? 43  ASP B N   1 
ATOM   2966 C  CA  . ASP B 1 43  ? 5.294   -0.144  6.168   1.00 50.98 ? 43  ASP B CA  1 
ATOM   2967 C  C   . ASP B 1 43  ? 4.907   1.031   5.267   1.00 51.76 ? 43  ASP B C   1 
ATOM   2968 O  O   . ASP B 1 43  ? 4.402   0.829   4.162   1.00 52.15 ? 43  ASP B O   1 
ATOM   2969 C  CB  . ASP B 1 43  ? 6.280   -1.042  5.418   1.00 52.23 ? 43  ASP B CB  1 
ATOM   2970 C  CG  . ASP B 1 43  ? 7.610   -0.355  5.153   1.00 53.54 ? 43  ASP B CG  1 
ATOM   2971 O  OD1 . ASP B 1 43  ? 8.352   -0.816  4.261   1.00 54.91 ? 43  ASP B OD1 1 
ATOM   2972 O  OD2 . ASP B 1 43  ? 7.918   0.641   5.842   1.00 55.01 ? 43  ASP B OD2 1 
ATOM   2973 N  N   . PRO B 1 44  ? 5.164   2.273   5.723   1.00 52.24 ? 44  PRO B N   1 
ATOM   2974 C  CA  . PRO B 1 44  ? 4.860   3.522   5.008   1.00 53.81 ? 44  PRO B CA  1 
ATOM   2975 C  C   . PRO B 1 44  ? 5.492   3.674   3.621   1.00 55.16 ? 44  PRO B C   1 
ATOM   2976 O  O   . PRO B 1 44  ? 4.910   4.304   2.735   1.00 54.00 ? 44  PRO B O   1 
ATOM   2977 C  CB  . PRO B 1 44  ? 5.364   4.608   5.965   1.00 53.34 ? 44  PRO B CB  1 
ATOM   2978 C  CG  . PRO B 1 44  ? 5.325   3.947   7.310   1.00 53.25 ? 44  PRO B CG  1 
ATOM   2979 C  CD  . PRO B 1 44  ? 5.833   2.564   7.002   1.00 51.62 ? 44  PRO B CD  1 
ATOM   2980 N  N   . ASN B 1 45  ? 6.678   3.097   3.439   1.00 56.72 ? 45  ASN B N   1 
ATOM   2981 C  CA  . ASN B 1 45  ? 7.404   3.212   2.174   1.00 58.13 ? 45  ASN B CA  1 
ATOM   2982 C  C   . ASN B 1 45  ? 6.827   2.505   0.958   1.00 57.98 ? 45  ASN B C   1 
ATOM   2983 O  O   . ASN B 1 45  ? 7.103   2.910   -0.168  1.00 58.70 ? 45  ASN B O   1 
ATOM   2984 C  CB  . ASN B 1 45  ? 8.861   2.783   2.362   1.00 59.48 ? 45  ASN B CB  1 
ATOM   2985 C  CG  . ASN B 1 45  ? 9.640   3.755   3.222   1.00 61.45 ? 45  ASN B CG  1 
ATOM   2986 O  OD1 . ASN B 1 45  ? 9.563   4.974   3.026   1.00 61.93 ? 45  ASN B OD1 1 
ATOM   2987 N  ND2 . ASN B 1 45  ? 10.399  3.227   4.180   1.00 62.04 ? 45  ASN B ND2 1 
ATOM   2988 N  N   . ASN B 1 46  ? 6.050   1.447   1.160   1.00 57.70 ? 46  ASN B N   1 
ATOM   2989 C  CA  . ASN B 1 46  ? 5.462   0.767   0.013   1.00 57.07 ? 46  ASN B CA  1 
ATOM   2990 C  C   . ASN B 1 46  ? 4.040   0.298   0.294   1.00 55.48 ? 46  ASN B C   1 
ATOM   2991 O  O   . ASN B 1 46  ? 3.800   -0.857  0.654   1.00 55.70 ? 46  ASN B O   1 
ATOM   2992 C  CB  . ASN B 1 46  ? 6.329   -0.416  -0.433  1.00 58.85 ? 46  ASN B CB  1 
ATOM   2993 C  CG  . ASN B 1 46  ? 6.406   -0.542  -1.957  1.00 60.49 ? 46  ASN B CG  1 
ATOM   2994 O  OD1 . ASN B 1 46  ? 5.380   -0.565  -2.650  1.00 60.03 ? 46  ASN B OD1 1 
ATOM   2995 N  ND2 . ASN B 1 46  ? 7.626   -0.625  -2.482  1.00 60.37 ? 46  ASN B ND2 1 
ATOM   2996 N  N   . LEU B 1 47  ? 3.099   1.218   0.120   1.00 52.32 ? 47  LEU B N   1 
ATOM   2997 C  CA  . LEU B 1 47  ? 1.695   0.933   0.338   1.00 48.79 ? 47  LEU B CA  1 
ATOM   2998 C  C   . LEU B 1 47  ? 0.887   1.031   -0.938  1.00 46.47 ? 47  LEU B C   1 
ATOM   2999 O  O   . LEU B 1 47  ? 0.960   2.030   -1.658  1.00 45.53 ? 47  LEU B O   1 
ATOM   3000 C  CB  . LEU B 1 47  ? 1.113   1.902   1.362   1.00 48.40 ? 47  LEU B CB  1 
ATOM   3001 C  CG  . LEU B 1 47  ? 1.288   1.482   2.815   1.00 48.60 ? 47  LEU B CG  1 
ATOM   3002 C  CD1 . LEU B 1 47  ? 0.835   2.603   3.745   1.00 49.62 ? 47  LEU B CD1 1 
ATOM   3003 C  CD2 . LEU B 1 47  ? 0.488   0.210   3.048   1.00 47.30 ? 47  LEU B CD2 1 
ATOM   3004 N  N   . VAL B 1 48  ? 0.122   -0.017  -1.219  1.00 44.46 ? 48  VAL B N   1 
ATOM   3005 C  CA  . VAL B 1 48  ? -0.740  -0.021  -2.387  1.00 43.45 ? 48  VAL B CA  1 
ATOM   3006 C  C   . VAL B 1 48  ? -2.016  0.674   -1.928  1.00 41.38 ? 48  VAL B C   1 
ATOM   3007 O  O   . VAL B 1 48  ? -2.596  0.306   -0.906  1.00 41.91 ? 48  VAL B O   1 
ATOM   3008 C  CB  . VAL B 1 48  ? -1.079  -1.445  -2.841  1.00 44.00 ? 48  VAL B CB  1 
ATOM   3009 C  CG1 . VAL B 1 48  ? -1.991  -1.392  -4.058  1.00 43.71 ? 48  VAL B CG1 1 
ATOM   3010 C  CG2 . VAL B 1 48  ? 0.198   -2.202  -3.160  1.00 45.93 ? 48  VAL B CG2 1 
ATOM   3011 N  N   . PHE B 1 49  ? -2.441  1.680   -2.683  1.00 38.31 ? 49  PHE B N   1 
ATOM   3012 C  CA  . PHE B 1 49  ? -3.627  2.456   -2.349  1.00 34.49 ? 49  PHE B CA  1 
ATOM   3013 C  C   . PHE B 1 49  ? -4.870  1.657   -1.952  1.00 33.20 ? 49  PHE B C   1 
ATOM   3014 O  O   . PHE B 1 49  ? -5.289  0.744   -2.666  1.00 35.07 ? 49  PHE B O   1 
ATOM   3015 C  CB  . PHE B 1 49  ? -3.986  3.384   -3.511  1.00 32.35 ? 49  PHE B CB  1 
ATOM   3016 C  CG  . PHE B 1 49  ? -5.181  4.242   -3.234  1.00 31.95 ? 49  PHE B CG  1 
ATOM   3017 C  CD1 . PHE B 1 49  ? -5.085  5.329   -2.373  1.00 29.46 ? 49  PHE B CD1 1 
ATOM   3018 C  CD2 . PHE B 1 49  ? -6.421  3.917   -3.768  1.00 30.32 ? 49  PHE B CD2 1 
ATOM   3019 C  CE1 . PHE B 1 49  ? -6.205  6.078   -2.041  1.00 32.94 ? 49  PHE B CE1 1 
ATOM   3020 C  CE2 . PHE B 1 49  ? -7.550  4.659   -3.441  1.00 34.31 ? 49  PHE B CE2 1 
ATOM   3021 C  CZ  . PHE B 1 49  ? -7.443  5.742   -2.575  1.00 34.15 ? 49  PHE B CZ  1 
ATOM   3022 N  N   . GLY B 1 50  ? -5.447  2.020   -0.806  1.00 29.91 ? 50  GLY B N   1 
ATOM   3023 C  CA  . GLY B 1 50  ? -6.655  1.383   -0.308  1.00 29.70 ? 50  GLY B CA  1 
ATOM   3024 C  C   . GLY B 1 50  ? -6.727  -0.132  -0.212  1.00 29.78 ? 50  GLY B C   1 
ATOM   3025 O  O   . GLY B 1 50  ? -7.763  -0.725  -0.528  1.00 28.33 ? 50  GLY B O   1 
ATOM   3026 N  N   . THR B 1 51  ? -5.650  -0.765  0.243   1.00 30.82 ? 51  THR B N   1 
ATOM   3027 C  CA  . THR B 1 51  ? -5.631  -2.219  0.367   1.00 31.08 ? 51  THR B CA  1 
ATOM   3028 C  C   . THR B 1 51  ? -5.494  -2.625  1.820   1.00 29.66 ? 51  THR B C   1 
ATOM   3029 O  O   . THR B 1 51  ? -5.961  -3.689  2.228   1.00 31.74 ? 51  THR B O   1 
ATOM   3030 C  CB  . THR B 1 51  ? -4.473  -2.828  -0.418  1.00 32.67 ? 51  THR B CB  1 
ATOM   3031 O  OG1 . THR B 1 51  ? -3.236  -2.384  0.155   1.00 34.78 ? 51  THR B OG1 1 
ATOM   3032 C  CG2 . THR B 1 51  ? -4.547  -2.400  -1.889  1.00 33.03 ? 51  THR B CG2 1 
ATOM   3033 N  N   . VAL B 1 52  ? -4.839  -1.782  2.604   1.00 28.27 ? 52  VAL B N   1 
ATOM   3034 C  CA  . VAL B 1 52  ? -4.677  -2.059  4.020   1.00 27.53 ? 52  VAL B CA  1 
ATOM   3035 C  C   . VAL B 1 52  ? -5.692  -1.220  4.775   1.00 28.38 ? 52  VAL B C   1 
ATOM   3036 O  O   . VAL B 1 52  ? -5.818  -0.023  4.529   1.00 29.93 ? 52  VAL B O   1 
ATOM   3037 C  CB  . VAL B 1 52  ? -3.259  -1.710  4.493   1.00 29.15 ? 52  VAL B CB  1 
ATOM   3038 C  CG1 . VAL B 1 52  ? -3.156  -1.864  6.006   1.00 27.48 ? 52  VAL B CG1 1 
ATOM   3039 C  CG2 . VAL B 1 52  ? -2.253  -2.625  3.802   1.00 26.89 ? 52  VAL B CG2 1 
ATOM   3040 N  N   . PHE B 1 53  ? -6.433  -1.850  5.680   1.00 27.67 ? 53  PHE B N   1 
ATOM   3041 C  CA  . PHE B 1 53  ? -7.438  -1.133  6.460   1.00 27.56 ? 53  PHE B CA  1 
ATOM   3042 C  C   . PHE B 1 53  ? -7.097  -1.137  7.946   1.00 25.75 ? 53  PHE B C   1 
ATOM   3043 O  O   . PHE B 1 53  ? -6.405  -2.038  8.421   1.00 24.70 ? 53  PHE B O   1 
ATOM   3044 C  CB  . PHE B 1 53  ? -8.827  -1.747  6.228   1.00 26.04 ? 53  PHE B CB  1 
ATOM   3045 C  CG  . PHE B 1 53  ? -9.317  -1.594  4.821   1.00 23.37 ? 53  PHE B CG  1 
ATOM   3046 C  CD1 . PHE B 1 53  ? -9.183  -2.629  3.906   1.00 23.85 ? 53  PHE B CD1 1 
ATOM   3047 C  CD2 . PHE B 1 53  ? -9.849  -0.387  4.390   1.00 22.45 ? 53  PHE B CD2 1 
ATOM   3048 C  CE1 . PHE B 1 53  ? -9.568  -2.457  2.576   1.00 23.93 ? 53  PHE B CE1 1 
ATOM   3049 C  CE2 . PHE B 1 53  ? -10.238 -0.205  3.063   1.00 23.13 ? 53  PHE B CE2 1 
ATOM   3050 C  CZ  . PHE B 1 53  ? -10.097 -1.236  2.156   1.00 22.35 ? 53  PHE B CZ  1 
ATOM   3051 N  N   . THR B 1 54  ? -7.590  -0.128  8.667   1.00 24.76 ? 54  THR B N   1 
ATOM   3052 C  CA  . THR B 1 54  ? -7.329  0.010   10.102  1.00 23.77 ? 54  THR B CA  1 
ATOM   3053 C  C   . THR B 1 54  ? -8.174  -0.915  10.977  1.00 23.10 ? 54  THR B C   1 
ATOM   3054 O  O   . THR B 1 54  ? -8.903  -1.764  10.472  1.00 25.33 ? 54  THR B O   1 
ATOM   3055 C  CB  . THR B 1 54  ? -7.530  1.462   10.562  1.00 21.36 ? 54  THR B CB  1 
ATOM   3056 O  OG1 . THR B 1 54  ? -8.913  1.823   10.454  1.00 22.86 ? 54  THR B OG1 1 
ATOM   3057 C  CG2 . THR B 1 54  ? -6.690  2.394   9.707   1.00 18.77 ? 54  THR B CG2 1 
ATOM   3058 N  N   . ASP B 1 55  ? -8.072  -0.745  12.292  1.00 25.05 ? 55  ASP B N   1 
ATOM   3059 C  CA  . ASP B 1 55  ? -8.791  -1.596  13.245  1.00 24.30 ? 55  ASP B CA  1 
ATOM   3060 C  C   . ASP B 1 55  ? -10.276 -1.319  13.416  1.00 24.40 ? 55  ASP B C   1 
ATOM   3061 O  O   . ASP B 1 55  ? -11.045 -2.235  13.711  1.00 21.28 ? 55  ASP B O   1 
ATOM   3062 C  CB  . ASP B 1 55  ? -8.137  -1.509  14.623  1.00 24.93 ? 55  ASP B CB  1 
ATOM   3063 C  CG  . ASP B 1 55  ? -6.735  -2.065  14.642  1.00 25.62 ? 55  ASP B CG  1 
ATOM   3064 O  OD1 . ASP B 1 55  ? -6.570  -3.262  14.342  1.00 30.94 ? 55  ASP B OD1 1 
ATOM   3065 O  OD2 . ASP B 1 55  ? -5.799  -1.306  14.963  1.00 28.19 ? 55  ASP B OD2 1 
ATOM   3066 N  N   . HIS B 1 56  ? -10.673 -0.063  13.233  1.00 24.17 ? 56  HIS B N   1 
ATOM   3067 C  CA  . HIS B 1 56  ? -12.058 0.335   13.424  1.00 25.30 ? 56  HIS B CA  1 
ATOM   3068 C  C   . HIS B 1 56  ? -12.715 0.982   12.215  1.00 26.89 ? 56  HIS B C   1 
ATOM   3069 O  O   . HIS B 1 56  ? -12.049 1.500   11.320  1.00 29.09 ? 56  HIS B O   1 
ATOM   3070 C  CB  . HIS B 1 56  ? -12.143 1.296   14.612  1.00 23.62 ? 56  HIS B CB  1 
ATOM   3071 C  CG  . HIS B 1 56  ? -11.556 0.744   15.870  1.00 24.88 ? 56  HIS B CG  1 
ATOM   3072 N  ND1 . HIS B 1 56  ? -12.207 -0.190  16.646  1.00 27.25 ? 56  HIS B ND1 1 
ATOM   3073 C  CD2 . HIS B 1 56  ? -10.352 0.949   16.456  1.00 23.78 ? 56  HIS B CD2 1 
ATOM   3074 C  CE1 . HIS B 1 56  ? -11.429 -0.538  17.656  1.00 27.21 ? 56  HIS B CE1 1 
ATOM   3075 N  NE2 . HIS B 1 56  ? -10.297 0.137   17.562  1.00 25.99 ? 56  HIS B NE2 1 
ATOM   3076 N  N   . MET B 1 57  ? -14.042 0.951   12.219  1.00 26.46 ? 57  MET B N   1 
ATOM   3077 C  CA  . MET B 1 57  ? -14.846 1.532   11.158  1.00 26.05 ? 57  MET B CA  1 
ATOM   3078 C  C   . MET B 1 57  ? -16.016 2.209   11.849  1.00 25.98 ? 57  MET B C   1 
ATOM   3079 O  O   . MET B 1 57  ? -16.273 1.960   13.029  1.00 24.63 ? 57  MET B O   1 
ATOM   3080 C  CB  . MET B 1 57  ? -15.370 0.437   10.227  1.00 26.15 ? 57  MET B CB  1 
ATOM   3081 C  CG  . MET B 1 57  ? -16.460 -0.432  10.861  1.00 25.98 ? 57  MET B CG  1 
ATOM   3082 S  SD  . MET B 1 57  ? -16.855 -1.911  9.911   1.00 31.08 ? 57  MET B SD  1 
ATOM   3083 C  CE  . MET B 1 57  ? -17.519 -1.212  8.415   1.00 23.97 ? 57  MET B CE  1 
ATOM   3084 N  N   . LEU B 1 58  ? -16.719 3.059   11.108  1.00 26.46 ? 58  LEU B N   1 
ATOM   3085 C  CA  . LEU B 1 58  ? -17.884 3.776   11.619  1.00 26.12 ? 58  LEU B CA  1 
ATOM   3086 C  C   . LEU B 1 58  ? -19.106 3.237   10.888  1.00 26.06 ? 58  LEU B C   1 
ATOM   3087 O  O   . LEU B 1 58  ? -19.036 2.963   9.691   1.00 25.59 ? 58  LEU B O   1 
ATOM   3088 C  CB  . LEU B 1 58  ? -17.731 5.281   11.346  1.00 27.94 ? 58  LEU B CB  1 
ATOM   3089 C  CG  . LEU B 1 58  ? -18.803 6.307   11.753  1.00 29.09 ? 58  LEU B CG  1 
ATOM   3090 C  CD1 . LEU B 1 58  ? -19.996 6.169   10.838  1.00 31.92 ? 58  LEU B CD1 1 
ATOM   3091 C  CD2 . LEU B 1 58  ? -19.213 6.130   13.214  1.00 26.37 ? 58  LEU B CD2 1 
ATOM   3092 N  N   . THR B 1 59  ? -20.213 3.063   11.608  1.00 24.73 ? 59  THR B N   1 
ATOM   3093 C  CA  . THR B 1 59  ? -21.451 2.578   11.004  1.00 24.64 ? 59  THR B CA  1 
ATOM   3094 C  C   . THR B 1 59  ? -22.695 3.218   11.615  1.00 24.08 ? 59  THR B C   1 
ATOM   3095 O  O   . THR B 1 59  ? -22.823 3.320   12.841  1.00 22.99 ? 59  THR B O   1 
ATOM   3096 C  CB  . THR B 1 59  ? -21.616 1.032   11.129  1.00 24.94 ? 59  THR B CB  1 
ATOM   3097 O  OG1 . THR B 1 59  ? -21.505 0.641   12.503  1.00 24.59 ? 59  THR B OG1 1 
ATOM   3098 C  CG2 . THR B 1 59  ? -20.577 0.314   10.313  1.00 24.14 ? 59  THR B CG2 1 
ATOM   3099 N  N   . VAL B 1 60  ? -23.610 3.648   10.751  1.00 22.46 ? 60  VAL B N   1 
ATOM   3100 C  CA  . VAL B 1 60  ? -24.860 4.239   11.198  1.00 22.62 ? 60  VAL B CA  1 
ATOM   3101 C  C   . VAL B 1 60  ? -25.977 3.743   10.292  1.00 23.63 ? 60  VAL B C   1 
ATOM   3102 O  O   . VAL B 1 60  ? -25.932 3.933   9.079   1.00 20.85 ? 60  VAL B O   1 
ATOM   3103 C  CB  . VAL B 1 60  ? -24.835 5.771   11.145  1.00 22.80 ? 60  VAL B CB  1 
ATOM   3104 C  CG1 . VAL B 1 60  ? -25.789 6.325   12.204  1.00 21.13 ? 60  VAL B CG1 1 
ATOM   3105 C  CG2 . VAL B 1 60  ? -23.428 6.288   11.366  1.00 22.45 ? 60  VAL B CG2 1 
ATOM   3106 N  N   . GLU B 1 61  ? -26.974 3.105   10.897  1.00 25.79 ? 61  GLU B N   1 
ATOM   3107 C  CA  . GLU B 1 61  ? -28.111 2.548   10.175  1.00 28.21 ? 61  GLU B CA  1 
ATOM   3108 C  C   . GLU B 1 61  ? -29.278 3.515   10.105  1.00 29.19 ? 61  GLU B C   1 
ATOM   3109 O  O   . GLU B 1 61  ? -29.519 4.294   11.037  1.00 28.86 ? 61  GLU B O   1 
ATOM   3110 C  CB  . GLU B 1 61  ? -28.592 1.260   10.858  1.00 29.29 ? 61  GLU B CB  1 
ATOM   3111 C  CG  . GLU B 1 61  ? -27.682 0.061   10.682  1.00 34.78 ? 61  GLU B CG  1 
ATOM   3112 C  CD  . GLU B 1 61  ? -27.994 -0.741  9.423   1.00 37.04 ? 61  GLU B CD  1 
ATOM   3113 O  OE1 . GLU B 1 61  ? -28.856 -0.311  8.623   1.00 36.28 ? 61  GLU B OE1 1 
ATOM   3114 O  OE2 . GLU B 1 61  ? -27.370 -1.809  9.235   1.00 39.02 ? 61  GLU B OE2 1 
ATOM   3115 N  N   . TRP B 1 62  ? -30.016 3.436   9.002   1.00 28.82 ? 62  TRP B N   1 
ATOM   3116 C  CA  . TRP B 1 62  ? -31.183 4.278   8.791   1.00 28.68 ? 62  TRP B CA  1 
ATOM   3117 C  C   . TRP B 1 62  ? -32.342 3.490   8.213   1.00 28.73 ? 62  TRP B C   1 
ATOM   3118 O  O   . TRP B 1 62  ? -32.152 2.554   7.433   1.00 28.33 ? 62  TRP B O   1 
ATOM   3119 C  CB  . TRP B 1 62  ? -30.870 5.419   7.829   1.00 26.27 ? 62  TRP B CB  1 
ATOM   3120 C  CG  . TRP B 1 62  ? -32.044 6.325   7.606   1.00 23.93 ? 62  TRP B CG  1 
ATOM   3121 C  CD1 . TRP B 1 62  ? -32.413 7.393   8.372   1.00 24.33 ? 62  TRP B CD1 1 
ATOM   3122 C  CD2 . TRP B 1 62  ? -32.978 6.268   6.520   1.00 24.39 ? 62  TRP B CD2 1 
ATOM   3123 N  NE1 . TRP B 1 62  ? -33.511 8.015   7.825   1.00 26.24 ? 62  TRP B NE1 1 
ATOM   3124 C  CE2 . TRP B 1 62  ? -33.879 7.346   6.687   1.00 25.55 ? 62  TRP B CE2 1 
ATOM   3125 C  CE3 . TRP B 1 62  ? -33.140 5.415   5.421   1.00 20.16 ? 62  TRP B CE3 1 
ATOM   3126 C  CZ2 . TRP B 1 62  ? -34.923 7.594   5.795   1.00 23.27 ? 62  TRP B CZ2 1 
ATOM   3127 C  CZ3 . TRP B 1 62  ? -34.178 5.661   4.536   1.00 23.05 ? 62  TRP B CZ3 1 
ATOM   3128 C  CH2 . TRP B 1 62  ? -35.056 6.744   4.727   1.00 22.21 ? 62  TRP B CH2 1 
ATOM   3129 N  N   . SER B 1 63  ? -33.545 3.902   8.589   1.00 29.07 ? 63  SER B N   1 
ATOM   3130 C  CA  . SER B 1 63  ? -34.765 3.279   8.109   1.00 28.64 ? 63  SER B CA  1 
ATOM   3131 C  C   . SER B 1 63  ? -35.780 4.399   8.029   1.00 28.62 ? 63  SER B C   1 
ATOM   3132 O  O   . SER B 1 63  ? -35.881 5.194   8.952   1.00 29.00 ? 63  SER B O   1 
ATOM   3133 C  CB  . SER B 1 63  ? -35.252 2.232   9.101   1.00 29.04 ? 63  SER B CB  1 
ATOM   3134 O  OG  . SER B 1 63  ? -35.625 2.849   10.322  1.00 32.50 ? 63  SER B OG  1 
ATOM   3135 N  N   . SER B 1 64  ? -36.524 4.469   6.932   1.00 28.82 ? 64  SER B N   1 
ATOM   3136 C  CA  . SER B 1 64  ? -37.532 5.512   6.769   1.00 31.63 ? 64  SER B CA  1 
ATOM   3137 C  C   . SER B 1 64  ? -38.538 5.446   7.913   1.00 33.34 ? 64  SER B C   1 
ATOM   3138 O  O   . SER B 1 64  ? -39.096 6.466   8.324   1.00 34.06 ? 64  SER B O   1 
ATOM   3139 C  CB  . SER B 1 64  ? -38.272 5.348   5.439   1.00 30.73 ? 64  SER B CB  1 
ATOM   3140 O  OG  . SER B 1 64  ? -39.047 4.161   5.424   1.00 29.80 ? 64  SER B OG  1 
ATOM   3141 N  N   . GLU B 1 65  ? -38.759 4.239   8.421   1.00 32.03 ? 65  GLU B N   1 
ATOM   3142 C  CA  . GLU B 1 65  ? -39.699 4.023   9.512   1.00 33.76 ? 65  GLU B CA  1 
ATOM   3143 C  C   . GLU B 1 65  ? -39.254 4.670   10.832  1.00 34.36 ? 65  GLU B C   1 
ATOM   3144 O  O   . GLU B 1 65  ? -40.021 5.415   11.441  1.00 31.89 ? 65  GLU B O   1 
ATOM   3145 C  CB  . GLU B 1 65  ? -39.939 2.517   9.708   1.00 34.73 ? 65  GLU B CB  1 
ATOM   3146 C  CG  . GLU B 1 65  ? -38.870 1.603   9.073   1.00 37.94 ? 65  GLU B CG  1 
ATOM   3147 C  CD  . GLU B 1 65  ? -39.011 1.449   7.552   1.00 38.97 ? 65  GLU B CD  1 
ATOM   3148 O  OE1 . GLU B 1 65  ? -38.056 0.966   6.908   1.00 39.97 ? 65  GLU B OE1 1 
ATOM   3149 O  OE2 . GLU B 1 65  ? -40.078 1.796   6.997   1.00 42.77 ? 65  GLU B OE2 1 
ATOM   3150 N  N   . PHE B 1 66  ? -38.024 4.400   11.273  1.00 35.51 ? 66  PHE B N   1 
ATOM   3151 C  CA  . PHE B 1 66  ? -37.542 4.977   12.532  1.00 36.94 ? 66  PHE B CA  1 
ATOM   3152 C  C   . PHE B 1 66  ? -36.416 5.998   12.383  1.00 36.31 ? 66  PHE B C   1 
ATOM   3153 O  O   . PHE B 1 66  ? -35.831 6.425   13.379  1.00 37.93 ? 66  PHE B O   1 
ATOM   3154 C  CB  . PHE B 1 66  ? -37.055 3.888   13.489  1.00 36.04 ? 66  PHE B CB  1 
ATOM   3155 C  CG  . PHE B 1 66  ? -37.910 2.662   13.503  1.00 40.04 ? 66  PHE B CG  1 
ATOM   3156 C  CD1 . PHE B 1 66  ? -37.622 1.591   12.662  1.00 40.89 ? 66  PHE B CD1 1 
ATOM   3157 C  CD2 . PHE B 1 66  ? -38.980 2.556   14.384  1.00 41.87 ? 66  PHE B CD2 1 
ATOM   3158 C  CE1 . PHE B 1 66  ? -38.382 0.422   12.699  1.00 42.32 ? 66  PHE B CE1 1 
ATOM   3159 C  CE2 . PHE B 1 66  ? -39.751 1.390   14.432  1.00 44.08 ? 66  PHE B CE2 1 
ATOM   3160 C  CZ  . PHE B 1 66  ? -39.449 0.322   13.589  1.00 42.88 ? 66  PHE B CZ  1 
ATOM   3161 N  N   . GLY B 1 67  ? -36.114 6.392   11.153  1.00 34.41 ? 67  GLY B N   1 
ATOM   3162 C  CA  . GLY B 1 67  ? -35.048 7.352   10.944  1.00 34.79 ? 67  GLY B CA  1 
ATOM   3163 C  C   . GLY B 1 67  ? -33.684 6.762   11.262  1.00 34.85 ? 67  GLY B C   1 
ATOM   3164 O  O   . GLY B 1 67  ? -33.462 5.557   11.113  1.00 34.49 ? 67  GLY B O   1 
ATOM   3165 N  N   . TRP B 1 68  ? -32.772 7.617   11.710  1.00 35.09 ? 68  TRP B N   1 
ATOM   3166 C  CA  . TRP B 1 68  ? -31.416 7.203   12.046  1.00 34.07 ? 68  TRP B CA  1 
ATOM   3167 C  C   . TRP B 1 68  ? -31.256 6.532   13.399  1.00 34.85 ? 68  TRP B C   1 
ATOM   3168 O  O   . TRP B 1 68  ? -31.824 6.975   14.395  1.00 35.13 ? 68  TRP B O   1 
ATOM   3169 C  CB  . TRP B 1 68  ? -30.480 8.400   12.029  1.00 32.17 ? 68  TRP B CB  1 
ATOM   3170 C  CG  . TRP B 1 68  ? -30.209 8.965   10.689  1.00 31.06 ? 68  TRP B CG  1 
ATOM   3171 C  CD1 . TRP B 1 68  ? -30.766 10.078  10.145  1.00 30.38 ? 68  TRP B CD1 1 
ATOM   3172 C  CD2 . TRP B 1 68  ? -29.256 8.483   9.737   1.00 30.23 ? 68  TRP B CD2 1 
ATOM   3173 N  NE1 . TRP B 1 68  ? -30.215 10.330  8.914   1.00 32.80 ? 68  TRP B NE1 1 
ATOM   3174 C  CE2 . TRP B 1 68  ? -29.284 9.364   8.638   1.00 29.26 ? 68  TRP B CE2 1 
ATOM   3175 C  CE3 . TRP B 1 68  ? -28.378 7.392   9.709   1.00 28.88 ? 68  TRP B CE3 1 
ATOM   3176 C  CZ2 . TRP B 1 68  ? -28.472 9.193   7.521   1.00 26.59 ? 68  TRP B CZ2 1 
ATOM   3177 C  CZ3 . TRP B 1 68  ? -27.568 7.219   8.601   1.00 25.89 ? 68  TRP B CZ3 1 
ATOM   3178 C  CH2 . TRP B 1 68  ? -27.621 8.118   7.519   1.00 28.81 ? 68  TRP B CH2 1 
ATOM   3179 N  N   . GLU B 1 69  ? -30.462 5.469   13.431  1.00 34.32 ? 69  GLU B N   1 
ATOM   3180 C  CA  . GLU B 1 69  ? -30.180 4.777   14.679  1.00 34.46 ? 69  GLU B CA  1 
ATOM   3181 C  C   . GLU B 1 69  ? -28.882 5.412   15.191  1.00 33.38 ? 69  GLU B C   1 
ATOM   3182 O  O   . GLU B 1 69  ? -28.288 6.238   14.502  1.00 31.25 ? 69  GLU B O   1 
ATOM   3183 C  CB  . GLU B 1 69  ? -29.984 3.273   14.435  1.00 35.50 ? 69  GLU B CB  1 
ATOM   3184 C  CG  . GLU B 1 69  ? -31.262 2.496   14.076  1.00 37.93 ? 69  GLU B CG  1 
ATOM   3185 C  CD  . GLU B 1 69  ? -32.293 2.453   15.208  1.00 40.69 ? 69  GLU B CD  1 
ATOM   3186 O  OE1 . GLU B 1 69  ? -31.939 2.070   16.349  1.00 38.45 ? 69  GLU B OE1 1 
ATOM   3187 O  OE2 . GLU B 1 69  ? -33.470 2.793   14.953  1.00 44.89 ? 69  GLU B OE2 1 
ATOM   3188 N  N   . LYS B 1 70  ? -28.445 5.041   16.389  1.00 32.89 ? 70  LYS B N   1 
ATOM   3189 C  CA  . LYS B 1 70  ? -27.216 5.595   16.950  1.00 32.14 ? 70  LYS B CA  1 
ATOM   3190 C  C   . LYS B 1 70  ? -25.975 5.090   16.215  1.00 31.03 ? 70  LYS B C   1 
ATOM   3191 O  O   . LYS B 1 70  ? -25.878 3.908   15.886  1.00 27.48 ? 70  LYS B O   1 
ATOM   3192 C  CB  . LYS B 1 70  ? -27.097 5.225   18.432  1.00 33.70 ? 70  LYS B CB  1 
ATOM   3193 C  CG  . LYS B 1 70  ? -28.158 5.837   19.320  1.00 34.86 ? 70  LYS B CG  1 
ATOM   3194 C  CD  . LYS B 1 70  ? -27.980 5.392   20.759  1.00 37.54 ? 70  LYS B CD  1 
ATOM   3195 C  CE  . LYS B 1 70  ? -28.952 6.112   21.678  1.00 40.26 ? 70  LYS B CE  1 
ATOM   3196 N  NZ  . LYS B 1 70  ? -28.811 5.639   23.084  1.00 42.13 ? 70  LYS B NZ  1 
ATOM   3197 N  N   . PRO B 1 71  ? -24.999 5.982   15.970  1.00 30.14 ? 71  PRO B N   1 
ATOM   3198 C  CA  . PRO B 1 71  ? -23.744 5.659   15.279  1.00 28.46 ? 71  PRO B CA  1 
ATOM   3199 C  C   . PRO B 1 71  ? -22.826 4.749   16.104  1.00 28.40 ? 71  PRO B C   1 
ATOM   3200 O  O   . PRO B 1 71  ? -22.778 4.851   17.333  1.00 27.41 ? 71  PRO B O   1 
ATOM   3201 C  CB  . PRO B 1 71  ? -23.130 7.033   15.032  1.00 27.90 ? 71  PRO B CB  1 
ATOM   3202 C  CG  . PRO B 1 71  ? -23.574 7.806   16.238  1.00 30.10 ? 71  PRO B CG  1 
ATOM   3203 C  CD  . PRO B 1 71  ? -25.031 7.404   16.362  1.00 29.49 ? 71  PRO B CD  1 
ATOM   3204 N  N   . HIS B 1 72  ? -22.106 3.860   15.418  1.00 28.36 ? 72  HIS B N   1 
ATOM   3205 C  CA  . HIS B 1 72  ? -21.187 2.919   16.069  1.00 27.22 ? 72  HIS B CA  1 
ATOM   3206 C  C   . HIS B 1 72  ? -19.752 2.998   15.558  1.00 26.34 ? 72  HIS B C   1 
ATOM   3207 O  O   . HIS B 1 72  ? -19.500 3.289   14.392  1.00 25.79 ? 72  HIS B O   1 
ATOM   3208 C  CB  . HIS B 1 72  ? -21.644 1.469   15.857  1.00 27.67 ? 72  HIS B CB  1 
ATOM   3209 C  CG  . HIS B 1 72  ? -22.795 1.054   16.714  1.00 32.40 ? 72  HIS B CG  1 
ATOM   3210 N  ND1 . HIS B 1 72  ? -22.645 0.690   18.035  1.00 34.40 ? 72  HIS B ND1 1 
ATOM   3211 C  CD2 . HIS B 1 72  ? -24.115 0.932   16.437  1.00 31.56 ? 72  HIS B CD2 1 
ATOM   3212 C  CE1 . HIS B 1 72  ? -23.822 0.360   18.535  1.00 32.14 ? 72  HIS B CE1 1 
ATOM   3213 N  NE2 . HIS B 1 72  ? -24.730 0.498   17.586  1.00 34.15 ? 72  HIS B NE2 1 
ATOM   3214 N  N   . ILE B 1 73  ? -18.817 2.735   16.458  1.00 25.29 ? 73  ILE B N   1 
ATOM   3215 C  CA  . ILE B 1 73  ? -17.404 2.670   16.130  1.00 25.43 ? 73  ILE B CA  1 
ATOM   3216 C  C   . ILE B 1 73  ? -17.085 1.279   16.660  1.00 26.92 ? 73  ILE B C   1 
ATOM   3217 O  O   . ILE B 1 73  ? -17.036 1.057   17.866  1.00 26.24 ? 73  ILE B O   1 
ATOM   3218 C  CB  . ILE B 1 73  ? -16.580 3.750   16.861  1.00 25.07 ? 73  ILE B CB  1 
ATOM   3219 C  CG1 . ILE B 1 73  ? -16.749 5.083   16.135  1.00 22.05 ? 73  ILE B CG1 1 
ATOM   3220 C  CG2 . ILE B 1 73  ? -15.101 3.355   16.909  1.00 21.14 ? 73  ILE B CG2 1 
ATOM   3221 C  CD1 . ILE B 1 73  ? -15.998 6.228   16.759  1.00 24.17 ? 73  ILE B CD1 1 
ATOM   3222 N  N   . LYS B 1 74  ? -16.924 0.339   15.740  1.00 28.12 ? 74  LYS B N   1 
ATOM   3223 C  CA  . LYS B 1 74  ? -16.664 -1.045  16.087  1.00 27.94 ? 74  LYS B CA  1 
ATOM   3224 C  C   . LYS B 1 74  ? -15.537 -1.609  15.228  1.00 28.74 ? 74  LYS B C   1 
ATOM   3225 O  O   . LYS B 1 74  ? -15.136 -1.001  14.236  1.00 29.77 ? 74  LYS B O   1 
ATOM   3226 C  CB  . LYS B 1 74  ? -17.942 -1.859  15.878  1.00 29.49 ? 74  LYS B CB  1 
ATOM   3227 C  CG  . LYS B 1 74  ? -18.507 -1.781  14.454  1.00 31.15 ? 74  LYS B CG  1 
ATOM   3228 C  CD  . LYS B 1 74  ? -19.879 -2.454  14.332  1.00 29.61 ? 74  LYS B CD  1 
ATOM   3229 C  CE  . LYS B 1 74  ? -20.428 -2.353  12.899  1.00 34.36 ? 74  LYS B CE  1 
ATOM   3230 N  NZ  . LYS B 1 74  ? -21.874 -2.751  12.748  1.00 32.09 ? 74  LYS B NZ  1 
ATOM   3231 N  N   . PRO B 1 75  ? -15.015 -2.787  15.599  1.00 28.75 ? 75  PRO B N   1 
ATOM   3232 C  CA  . PRO B 1 75  ? -13.928 -3.417  14.845  1.00 27.54 ? 75  PRO B CA  1 
ATOM   3233 C  C   . PRO B 1 75  ? -14.258 -3.534  13.360  1.00 28.02 ? 75  PRO B C   1 
ATOM   3234 O  O   . PRO B 1 75  ? -15.406 -3.771  12.991  1.00 29.64 ? 75  PRO B O   1 
ATOM   3235 C  CB  . PRO B 1 75  ? -13.804 -4.786  15.507  1.00 27.69 ? 75  PRO B CB  1 
ATOM   3236 C  CG  . PRO B 1 75  ? -14.227 -4.512  16.925  1.00 27.20 ? 75  PRO B CG  1 
ATOM   3237 C  CD  . PRO B 1 75  ? -15.429 -3.638  16.731  1.00 27.10 ? 75  PRO B CD  1 
ATOM   3238 N  N   . LEU B 1 76  ? -13.251 -3.356  12.511  1.00 27.95 ? 76  LEU B N   1 
ATOM   3239 C  CA  . LEU B 1 76  ? -13.449 -3.478  11.080  1.00 27.71 ? 76  LEU B CA  1 
ATOM   3240 C  C   . LEU B 1 76  ? -13.990 -4.879  10.836  1.00 30.14 ? 76  LEU B C   1 
ATOM   3241 O  O   . LEU B 1 76  ? -13.317 -5.868  11.139  1.00 32.26 ? 76  LEU B O   1 
ATOM   3242 C  CB  . LEU B 1 76  ? -12.127 -3.310  10.344  1.00 27.21 ? 76  LEU B CB  1 
ATOM   3243 C  CG  . LEU B 1 76  ? -12.233 -3.450  8.828   1.00 26.64 ? 76  LEU B CG  1 
ATOM   3244 C  CD1 . LEU B 1 76  ? -13.154 -2.372  8.283   1.00 24.31 ? 76  LEU B CD1 1 
ATOM   3245 C  CD2 . LEU B 1 76  ? -10.853 -3.334  8.214   1.00 28.39 ? 76  LEU B CD2 1 
ATOM   3246 N  N   . GLN B 1 77  ? -15.202 -4.961  10.299  1.00 29.50 ? 77  GLN B N   1 
ATOM   3247 C  CA  . GLN B 1 77  ? -15.842 -6.243  10.039  1.00 29.80 ? 77  GLN B CA  1 
ATOM   3248 C  C   . GLN B 1 77  ? -16.598 -6.222  8.715   1.00 31.45 ? 77  GLN B C   1 
ATOM   3249 O  O   . GLN B 1 77  ? -16.744 -5.174  8.077   1.00 29.96 ? 77  GLN B O   1 
ATOM   3250 C  CB  . GLN B 1 77  ? -16.808 -6.576  11.180  1.00 27.36 ? 77  GLN B CB  1 
ATOM   3251 N  N   . ASN B 1 78  ? -17.078 -7.391  8.306   1.00 32.52 ? 78  ASN B N   1 
ATOM   3252 C  CA  . ASN B 1 78  ? -17.842 -7.516  7.074   1.00 33.00 ? 78  ASN B CA  1 
ATOM   3253 C  C   . ASN B 1 78  ? -19.234 -6.956  7.316   1.00 33.93 ? 78  ASN B C   1 
ATOM   3254 O  O   . ASN B 1 78  ? -19.752 -7.029  8.431   1.00 36.62 ? 78  ASN B O   1 
ATOM   3255 C  CB  . ASN B 1 78  ? -17.962 -8.982  6.670   1.00 32.29 ? 78  ASN B CB  1 
ATOM   3256 C  CG  . ASN B 1 78  ? -16.896 -9.409  5.690   1.00 32.67 ? 78  ASN B CG  1 
ATOM   3257 O  OD1 . ASN B 1 78  ? -15.866 -8.748  5.537   1.00 31.40 ? 78  ASN B OD1 1 
ATOM   3258 N  ND2 . ASN B 1 78  ? -17.134 -10.532 5.022   1.00 30.16 ? 78  ASN B ND2 1 
ATOM   3259 N  N   . LEU B 1 79  ? -19.834 -6.390  6.277   1.00 32.50 ? 79  LEU B N   1 
ATOM   3260 C  CA  . LEU B 1 79  ? -21.177 -5.852  6.394   1.00 31.61 ? 79  LEU B CA  1 
ATOM   3261 C  C   . LEU B 1 79  ? -22.144 -7.000  6.138   1.00 33.11 ? 79  LEU B C   1 
ATOM   3262 O  O   . LEU B 1 79  ? -21.838 -7.916  5.376   1.00 34.30 ? 79  LEU B O   1 
ATOM   3263 C  CB  . LEU B 1 79  ? -21.394 -4.763  5.352   1.00 31.07 ? 79  LEU B CB  1 
ATOM   3264 C  CG  . LEU B 1 79  ? -20.375 -3.629  5.351   1.00 31.17 ? 79  LEU B CG  1 
ATOM   3265 C  CD1 . LEU B 1 79  ? -20.708 -2.623  4.247   1.00 29.01 ? 79  LEU B CD1 1 
ATOM   3266 C  CD2 . LEU B 1 79  ? -20.382 -2.964  6.718   1.00 26.42 ? 79  LEU B CD2 1 
ATOM   3267 N  N   . SER B 1 80  ? -23.301 -6.969  6.788   1.00 33.67 ? 80  SER B N   1 
ATOM   3268 C  CA  . SER B 1 80  ? -24.299 -8.010  6.581   1.00 31.73 ? 80  SER B CA  1 
ATOM   3269 C  C   . SER B 1 80  ? -25.422 -7.341  5.808   1.00 31.02 ? 80  SER B C   1 
ATOM   3270 O  O   . SER B 1 80  ? -26.163 -6.525  6.358   1.00 31.06 ? 80  SER B O   1 
ATOM   3271 C  CB  . SER B 1 80  ? -24.815 -8.546  7.916   1.00 32.68 ? 80  SER B CB  1 
ATOM   3272 O  OG  . SER B 1 80  ? -25.626 -9.693  7.711   1.00 30.09 ? 80  SER B OG  1 
ATOM   3273 N  N   . LEU B 1 81  ? -25.544 -7.687  4.532   1.00 30.16 ? 81  LEU B N   1 
ATOM   3274 C  CA  . LEU B 1 81  ? -26.546 -7.071  3.671   1.00 28.30 ? 81  LEU B CA  1 
ATOM   3275 C  C   . LEU B 1 81  ? -27.540 -8.029  3.042   1.00 26.88 ? 81  LEU B C   1 
ATOM   3276 O  O   . LEU B 1 81  ? -27.171 -9.101  2.588   1.00 24.97 ? 81  LEU B O   1 
ATOM   3277 C  CB  . LEU B 1 81  ? -25.843 -6.307  2.549   1.00 27.94 ? 81  LEU B CB  1 
ATOM   3278 C  CG  . LEU B 1 81  ? -24.778 -5.324  3.015   1.00 24.39 ? 81  LEU B CG  1 
ATOM   3279 C  CD1 . LEU B 1 81  ? -24.075 -4.715  1.818   1.00 26.43 ? 81  LEU B CD1 1 
ATOM   3280 C  CD2 . LEU B 1 81  ? -25.435 -4.252  3.843   1.00 25.16 ? 81  LEU B CD2 1 
ATOM   3281 N  N   . HIS B 1 82  ? -28.806 -7.628  3.017   1.00 26.60 ? 82  HIS B N   1 
ATOM   3282 C  CA  . HIS B 1 82  ? -29.834 -8.443  2.394   1.00 26.89 ? 82  HIS B CA  1 
ATOM   3283 C  C   . HIS B 1 82  ? -29.462 -8.449  0.913   1.00 26.22 ? 82  HIS B C   1 
ATOM   3284 O  O   . HIS B 1 82  ? -29.223 -7.398  0.326   1.00 25.76 ? 82  HIS B O   1 
ATOM   3285 C  CB  . HIS B 1 82  ? -31.207 -7.813  2.608   1.00 27.70 ? 82  HIS B CB  1 
ATOM   3286 C  CG  . HIS B 1 82  ? -32.326 -8.567  1.965   1.00 29.29 ? 82  HIS B CG  1 
ATOM   3287 N  ND1 . HIS B 1 82  ? -32.491 -8.631  0.597   1.00 30.20 ? 82  HIS B ND1 1 
ATOM   3288 C  CD2 . HIS B 1 82  ? -33.335 -9.294  2.500   1.00 30.85 ? 82  HIS B CD2 1 
ATOM   3289 C  CE1 . HIS B 1 82  ? -33.554 -9.365  0.318   1.00 31.15 ? 82  HIS B CE1 1 
ATOM   3290 N  NE2 . HIS B 1 82  ? -34.084 -9.780  1.454   1.00 34.24 ? 82  HIS B NE2 1 
ATOM   3291 N  N   . PRO B 1 83  ? -29.411 -9.638  0.293   1.00 25.42 ? 83  PRO B N   1 
ATOM   3292 C  CA  . PRO B 1 83  ? -29.054 -9.776  -1.121  1.00 24.76 ? 83  PRO B CA  1 
ATOM   3293 C  C   . PRO B 1 83  ? -29.833 -8.887  -2.082  1.00 23.01 ? 83  PRO B C   1 
ATOM   3294 O  O   . PRO B 1 83  ? -29.460 -8.742  -3.246  1.00 24.37 ? 83  PRO B O   1 
ATOM   3295 C  CB  . PRO B 1 83  ? -29.250 -11.272 -1.382  1.00 25.06 ? 83  PRO B CB  1 
ATOM   3296 C  CG  . PRO B 1 83  ? -30.344 -11.636 -0.443  1.00 27.21 ? 83  PRO B CG  1 
ATOM   3297 C  CD  . PRO B 1 83  ? -29.955 -10.902 0.821   1.00 25.59 ? 83  PRO B CD  1 
ATOM   3298 N  N   . GLY B 1 84  ? -30.901 -8.276  -1.591  1.00 21.70 ? 84  GLY B N   1 
ATOM   3299 C  CA  . GLY B 1 84  ? -31.694 -7.399  -2.437  1.00 21.78 ? 84  GLY B CA  1 
ATOM   3300 C  C   . GLY B 1 84  ? -31.377 -5.916  -2.289  1.00 20.76 ? 84  GLY B C   1 
ATOM   3301 O  O   . GLY B 1 84  ? -31.971 -5.086  -2.975  1.00 17.23 ? 84  GLY B O   1 
ATOM   3302 N  N   . SER B 1 85  ? -30.442 -5.583  -1.401  1.00 20.82 ? 85  SER B N   1 
ATOM   3303 C  CA  . SER B 1 85  ? -30.061 -4.189  -1.159  1.00 21.87 ? 85  SER B CA  1 
ATOM   3304 C  C   . SER B 1 85  ? -29.868 -3.443  -2.470  1.00 22.89 ? 85  SER B C   1 
ATOM   3305 O  O   . SER B 1 85  ? -29.047 -3.834  -3.300  1.00 24.59 ? 85  SER B O   1 
ATOM   3306 C  CB  . SER B 1 85  ? -28.776 -4.126  -0.326  1.00 20.62 ? 85  SER B CB  1 
ATOM   3307 O  OG  . SER B 1 85  ? -28.937 -4.810  0.914   1.00 21.74 ? 85  SER B OG  1 
ATOM   3308 N  N   . SER B 1 86  ? -30.620 -2.359  -2.640  1.00 23.80 ? 86  SER B N   1 
ATOM   3309 C  CA  . SER B 1 86  ? -30.575 -1.572  -3.865  1.00 23.96 ? 86  SER B CA  1 
ATOM   3310 C  C   . SER B 1 86  ? -29.175 -1.148  -4.301  1.00 24.20 ? 86  SER B C   1 
ATOM   3311 O  O   . SER B 1 86  ? -28.937 -0.925  -5.489  1.00 26.00 ? 86  SER B O   1 
ATOM   3312 C  CB  . SER B 1 86  ? -31.511 -0.351  -3.762  1.00 22.42 ? 86  SER B CB  1 
ATOM   3313 O  OG  . SER B 1 86  ? -31.108 0.546   -2.749  1.00 23.21 ? 86  SER B OG  1 
ATOM   3314 N  N   . ALA B 1 87  ? -28.240 -1.043  -3.363  1.00 22.39 ? 87  ALA B N   1 
ATOM   3315 C  CA  . ALA B 1 87  ? -26.881 -0.672  -3.745  1.00 22.67 ? 87  ALA B CA  1 
ATOM   3316 C  C   . ALA B 1 87  ? -26.249 -1.732  -4.656  1.00 21.26 ? 87  ALA B C   1 
ATOM   3317 O  O   . ALA B 1 87  ? -25.390 -1.417  -5.468  1.00 20.16 ? 87  ALA B O   1 
ATOM   3318 C  CB  . ALA B 1 87  ? -26.010 -0.476  -2.506  1.00 22.02 ? 87  ALA B CB  1 
ATOM   3319 N  N   . LEU B 1 88  ? -26.681 -2.983  -4.523  1.00 22.24 ? 88  LEU B N   1 
ATOM   3320 C  CA  . LEU B 1 88  ? -26.123 -4.071  -5.327  1.00 21.21 ? 88  LEU B CA  1 
ATOM   3321 C  C   . LEU B 1 88  ? -26.796 -4.226  -6.677  1.00 22.81 ? 88  LEU B C   1 
ATOM   3322 O  O   . LEU B 1 88  ? -26.192 -4.721  -7.634  1.00 23.84 ? 88  LEU B O   1 
ATOM   3323 C  CB  . LEU B 1 88  ? -26.232 -5.391  -4.562  1.00 17.38 ? 88  LEU B CB  1 
ATOM   3324 C  CG  . LEU B 1 88  ? -25.650 -5.351  -3.142  1.00 16.16 ? 88  LEU B CG  1 
ATOM   3325 C  CD1 . LEU B 1 88  ? -25.828 -6.702  -2.468  1.00 14.29 ? 88  LEU B CD1 1 
ATOM   3326 C  CD2 . LEU B 1 88  ? -24.172 -4.956  -3.201  1.00 9.66  ? 88  LEU B CD2 1 
ATOM   3327 N  N   . HIS B 1 89  ? -28.045 -3.790  -6.758  1.00 23.81 ? 89  HIS B N   1 
ATOM   3328 C  CA  . HIS B 1 89  ? -28.815 -3.911  -7.988  1.00 23.90 ? 89  HIS B CA  1 
ATOM   3329 C  C   . HIS B 1 89  ? -28.903 -2.639  -8.836  1.00 26.41 ? 89  HIS B C   1 
ATOM   3330 O  O   . HIS B 1 89  ? -28.719 -2.689  -10.058 1.00 26.68 ? 89  HIS B O   1 
ATOM   3331 C  CB  . HIS B 1 89  ? -30.228 -4.380  -7.648  1.00 21.15 ? 89  HIS B CB  1 
ATOM   3332 C  CG  . HIS B 1 89  ? -30.272 -5.719  -6.984  1.00 24.37 ? 89  HIS B CG  1 
ATOM   3333 N  ND1 . HIS B 1 89  ? -30.466 -6.891  -7.684  1.00 24.89 ? 89  HIS B ND1 1 
ATOM   3334 C  CD2 . HIS B 1 89  ? -30.085 -6.077  -5.692  1.00 24.06 ? 89  HIS B CD2 1 
ATOM   3335 C  CE1 . HIS B 1 89  ? -30.393 -7.915  -6.851  1.00 24.73 ? 89  HIS B CE1 1 
ATOM   3336 N  NE2 . HIS B 1 89  ? -30.162 -7.449  -5.636  1.00 26.03 ? 89  HIS B NE2 1 
ATOM   3337 N  N   . TYR B 1 90  ? -29.178 -1.508  -8.188  1.00 25.14 ? 90  TYR B N   1 
ATOM   3338 C  CA  . TYR B 1 90  ? -29.349 -0.247  -8.899  1.00 25.23 ? 90  TYR B CA  1 
ATOM   3339 C  C   . TYR B 1 90  ? -28.347 0.832   -8.552  1.00 24.11 ? 90  TYR B C   1 
ATOM   3340 O  O   . TYR B 1 90  ? -28.617 2.009   -8.745  1.00 23.27 ? 90  TYR B O   1 
ATOM   3341 C  CB  . TYR B 1 90  ? -30.766 0.270   -8.659  1.00 25.12 ? 90  TYR B CB  1 
ATOM   3342 C  CG  . TYR B 1 90  ? -31.795 -0.817  -8.835  1.00 26.10 ? 90  TYR B CG  1 
ATOM   3343 C  CD1 . TYR B 1 90  ? -32.646 -1.176  -7.788  1.00 24.28 ? 90  TYR B CD1 1 
ATOM   3344 C  CD2 . TYR B 1 90  ? -31.872 -1.536  -10.026 1.00 26.70 ? 90  TYR B CD2 1 
ATOM   3345 C  CE1 . TYR B 1 90  ? -33.541 -2.224  -7.917  1.00 23.33 ? 90  TYR B CE1 1 
ATOM   3346 C  CE2 . TYR B 1 90  ? -32.766 -2.590  -10.168 1.00 29.11 ? 90  TYR B CE2 1 
ATOM   3347 C  CZ  . TYR B 1 90  ? -33.597 -2.930  -9.108  1.00 27.29 ? 90  TYR B CZ  1 
ATOM   3348 O  OH  . TYR B 1 90  ? -34.476 -3.979  -9.246  1.00 28.73 ? 90  TYR B OH  1 
ATOM   3349 N  N   . ALA B 1 91  ? -27.191 0.425   -8.046  1.00 23.28 ? 91  ALA B N   1 
ATOM   3350 C  CA  . ALA B 1 91  ? -26.129 1.353   -7.679  1.00 23.22 ? 91  ALA B CA  1 
ATOM   3351 C  C   . ALA B 1 91  ? -26.584 2.551   -6.842  1.00 22.86 ? 91  ALA B C   1 
ATOM   3352 O  O   . ALA B 1 91  ? -26.147 3.679   -7.076  1.00 22.32 ? 91  ALA B O   1 
ATOM   3353 C  CB  . ALA B 1 91  ? -25.414 1.839   -8.933  1.00 21.17 ? 91  ALA B CB  1 
ATOM   3354 N  N   . VAL B 1 92  ? -27.470 2.312   -5.881  1.00 22.56 ? 92  VAL B N   1 
ATOM   3355 C  CA  . VAL B 1 92  ? -27.934 3.384   -5.006  1.00 23.12 ? 92  VAL B CA  1 
ATOM   3356 C  C   . VAL B 1 92  ? -26.804 3.546   -3.997  1.00 23.99 ? 92  VAL B C   1 
ATOM   3357 O  O   . VAL B 1 92  ? -26.844 2.962   -2.914  1.00 25.30 ? 92  VAL B O   1 
ATOM   3358 C  CB  . VAL B 1 92  ? -29.215 2.979   -4.257  1.00 24.69 ? 92  VAL B CB  1 
ATOM   3359 C  CG1 . VAL B 1 92  ? -29.739 4.161   -3.421  1.00 22.85 ? 92  VAL B CG1 1 
ATOM   3360 C  CG2 . VAL B 1 92  ? -30.257 2.503   -5.250  1.00 22.99 ? 92  VAL B CG2 1 
ATOM   3361 N  N   . GLU B 1 93  ? -25.793 4.332   -4.351  1.00 21.92 ? 93  GLU B N   1 
ATOM   3362 C  CA  . GLU B 1 93  ? -24.634 4.495   -3.477  1.00 21.37 ? 93  GLU B CA  1 
ATOM   3363 C  C   . GLU B 1 93  ? -23.792 5.698   -3.878  1.00 19.74 ? 93  GLU B C   1 
ATOM   3364 O  O   . GLU B 1 93  ? -23.841 6.125   -5.027  1.00 18.24 ? 93  GLU B O   1 
ATOM   3365 C  CB  . GLU B 1 93  ? -23.752 3.252   -3.602  1.00 20.81 ? 93  GLU B CB  1 
ATOM   3366 C  CG  . GLU B 1 93  ? -23.124 3.152   -5.002  1.00 21.43 ? 93  GLU B CG  1 
ATOM   3367 C  CD  . GLU B 1 93  ? -22.481 1.815   -5.285  1.00 22.07 ? 93  GLU B CD  1 
ATOM   3368 O  OE1 . GLU B 1 93  ? -21.418 1.796   -5.947  1.00 22.14 ? 93  GLU B OE1 1 
ATOM   3369 O  OE2 . GLU B 1 93  ? -23.041 0.784   -4.861  1.00 21.52 ? 93  GLU B OE2 1 
ATOM   3370 N  N   . LEU B 1 94  ? -23.004 6.215   -2.934  1.00 20.66 ? 94  LEU B N   1 
ATOM   3371 C  CA  . LEU B 1 94  ? -22.093 7.339   -3.195  1.00 22.15 ? 94  LEU B CA  1 
ATOM   3372 C  C   . LEU B 1 94  ? -20.966 7.274   -2.163  1.00 24.00 ? 94  LEU B C   1 
ATOM   3373 O  O   . LEU B 1 94  ? -21.098 6.606   -1.134  1.00 24.65 ? 94  LEU B O   1 
ATOM   3374 C  CB  . LEU B 1 94  ? -22.829 8.682   -3.111  1.00 20.52 ? 94  LEU B CB  1 
ATOM   3375 C  CG  . LEU B 1 94  ? -23.252 9.158   -1.728  1.00 20.90 ? 94  LEU B CG  1 
ATOM   3376 C  CD1 . LEU B 1 94  ? -22.105 9.914   -1.076  1.00 22.14 ? 94  LEU B CD1 1 
ATOM   3377 C  CD2 . LEU B 1 94  ? -24.459 10.068  -1.858  1.00 24.86 ? 94  LEU B CD2 1 
ATOM   3378 N  N   . PHE B 1 95  ? -19.866 7.973   -2.424  1.00 25.00 ? 95  PHE B N   1 
ATOM   3379 C  CA  . PHE B 1 95  ? -18.720 7.940   -1.516  1.00 25.60 ? 95  PHE B CA  1 
ATOM   3380 C  C   . PHE B 1 95  ? -17.943 9.250   -1.496  1.00 25.54 ? 95  PHE B C   1 
ATOM   3381 O  O   . PHE B 1 95  ? -18.221 10.165  -2.267  1.00 26.35 ? 95  PHE B O   1 
ATOM   3382 C  CB  . PHE B 1 95  ? -17.764 6.837   -1.954  1.00 25.59 ? 95  PHE B CB  1 
ATOM   3383 C  CG  . PHE B 1 95  ? -17.076 7.136   -3.250  1.00 26.82 ? 95  PHE B CG  1 
ATOM   3384 C  CD1 . PHE B 1 95  ? -15.854 7.809   -3.267  1.00 25.22 ? 95  PHE B CD1 1 
ATOM   3385 C  CD2 . PHE B 1 95  ? -17.675 6.797   -4.463  1.00 27.43 ? 95  PHE B CD2 1 
ATOM   3386 C  CE1 . PHE B 1 95  ? -15.238 8.141   -4.476  1.00 27.56 ? 95  PHE B CE1 1 
ATOM   3387 C  CE2 . PHE B 1 95  ? -17.067 7.125   -5.682  1.00 28.01 ? 95  PHE B CE2 1 
ATOM   3388 C  CZ  . PHE B 1 95  ? -15.845 7.799   -5.689  1.00 27.67 ? 95  PHE B CZ  1 
ATOM   3389 N  N   . GLU B 1 96  ? -16.947 9.310   -0.615  1.00 25.43 ? 96  GLU B N   1 
ATOM   3390 C  CA  . GLU B 1 96  ? -16.091 10.480  -0.483  1.00 24.11 ? 96  GLU B CA  1 
ATOM   3391 C  C   . GLU B 1 96  ? -14.629 10.080  -0.300  1.00 22.26 ? 96  GLU B C   1 
ATOM   3392 O  O   . GLU B 1 96  ? -14.320 8.916   -0.038  1.00 18.36 ? 96  GLU B O   1 
ATOM   3393 C  CB  . GLU B 1 96  ? -16.542 11.343  0.702   1.00 25.20 ? 96  GLU B CB  1 
ATOM   3394 C  CG  . GLU B 1 96  ? -17.393 12.547  0.291   1.00 23.83 ? 96  GLU B CG  1 
ATOM   3395 C  CD  . GLU B 1 96  ? -16.681 13.440  -0.707  1.00 26.73 ? 96  GLU B CD  1 
ATOM   3396 O  OE1 . GLU B 1 96  ? -17.368 14.024  -1.573  1.00 29.83 ? 96  GLU B OE1 1 
ATOM   3397 O  OE2 . GLU B 1 96  ? -15.437 13.568  -0.629  1.00 28.40 ? 96  GLU B OE2 1 
ATOM   3398 N  N   . GLY B 1 97  ? -13.742 11.059  -0.458  1.00 22.86 ? 97  GLY B N   1 
ATOM   3399 C  CA  . GLY B 1 97  ? -12.315 10.841  -0.291  1.00 22.54 ? 97  GLY B CA  1 
ATOM   3400 C  C   . GLY B 1 97  ? -11.646 12.024  0.402   1.00 24.25 ? 97  GLY B C   1 
ATOM   3401 O  O   . GLY B 1 97  ? -11.639 13.137  -0.122  1.00 23.61 ? 97  GLY B O   1 
ATOM   3402 N  N   . LEU B 1 98  ? -11.117 11.805  1.604   1.00 26.28 ? 98  LEU B N   1 
ATOM   3403 C  CA  . LEU B 1 98  ? -10.412 12.862  2.330   1.00 27.45 ? 98  LEU B CA  1 
ATOM   3404 C  C   . LEU B 1 98  ? -9.328  12.254  3.210   1.00 29.26 ? 98  LEU B C   1 
ATOM   3405 O  O   . LEU B 1 98  ? -9.395  11.073  3.570   1.00 29.80 ? 98  LEU B O   1 
ATOM   3406 C  CB  . LEU B 1 98  ? -11.385 13.740  3.140   1.00 28.28 ? 98  LEU B CB  1 
ATOM   3407 C  CG  . LEU B 1 98  ? -12.374 13.212  4.179   1.00 30.08 ? 98  LEU B CG  1 
ATOM   3408 C  CD1 . LEU B 1 98  ? -13.260 12.141  3.579   1.00 30.10 ? 98  LEU B CD1 1 
ATOM   3409 C  CD2 . LEU B 1 98  ? -11.620 12.677  5.355   1.00 34.51 ? 98  LEU B CD2 1 
ATOM   3410 N  N   . LYS B 1 99  ? -8.325  13.057  3.553   1.00 29.23 ? 99  LYS B N   1 
ATOM   3411 C  CA  . LYS B 1 99  ? -7.200  12.559  4.329   1.00 29.16 ? 99  LYS B CA  1 
ATOM   3412 C  C   . LYS B 1 99  ? -6.890  13.204  5.671   1.00 29.55 ? 99  LYS B C   1 
ATOM   3413 O  O   . LYS B 1 99  ? -7.283  14.333  5.967   1.00 30.20 ? 99  LYS B O   1 
ATOM   3414 C  CB  . LYS B 1 99  ? -5.924  12.644  3.488   1.00 31.16 ? 99  LYS B CB  1 
ATOM   3415 C  CG  . LYS B 1 99  ? -5.879  11.790  2.233   1.00 32.76 ? 99  LYS B CG  1 
ATOM   3416 C  CD  . LYS B 1 99  ? -4.626  12.157  1.434   1.00 35.70 ? 99  LYS B CD  1 
ATOM   3417 C  CE  . LYS B 1 99  ? -4.269  11.113  0.397   1.00 39.57 ? 99  LYS B CE  1 
ATOM   3418 N  NZ  . LYS B 1 99  ? -2.975  11.455  -0.267  1.00 42.20 ? 99  LYS B NZ  1 
ATOM   3419 N  N   . ALA B 1 100 ? -6.143  12.448  6.467   1.00 29.58 ? 100 ALA B N   1 
ATOM   3420 C  CA  . ALA B 1 100 ? -5.675  12.879  7.777   1.00 28.84 ? 100 ALA B CA  1 
ATOM   3421 C  C   . ALA B 1 100 ? -4.143  12.871  7.667   1.00 27.53 ? 100 ALA B C   1 
ATOM   3422 O  O   . ALA B 1 100 ? -3.545  11.895  7.201   1.00 24.24 ? 100 ALA B O   1 
ATOM   3423 C  CB  . ALA B 1 100 ? -6.142  11.905  8.860   1.00 26.62 ? 100 ALA B CB  1 
ATOM   3424 N  N   . PHE B 1 101 ? -3.516  13.963  8.083   1.00 27.93 ? 101 PHE B N   1 
ATOM   3425 C  CA  . PHE B 1 101 ? -2.066  14.074  8.011   1.00 29.17 ? 101 PHE B CA  1 
ATOM   3426 C  C   . PHE B 1 101 ? -1.470  14.333  9.387   1.00 30.97 ? 101 PHE B C   1 
ATOM   3427 O  O   . PHE B 1 101 ? -2.027  15.092  10.189  1.00 31.03 ? 101 PHE B O   1 
ATOM   3428 C  CB  . PHE B 1 101 ? -1.654  15.227  7.077   1.00 28.11 ? 101 PHE B CB  1 
ATOM   3429 C  CG  . PHE B 1 101 ? -2.283  15.175  5.707   1.00 26.73 ? 101 PHE B CG  1 
ATOM   3430 C  CD1 . PHE B 1 101 ? -3.600  15.587  5.511   1.00 24.54 ? 101 PHE B CD1 1 
ATOM   3431 C  CD2 . PHE B 1 101 ? -1.541  14.758  4.602   1.00 25.25 ? 101 PHE B CD2 1 
ATOM   3432 C  CE1 . PHE B 1 101 ? -4.167  15.592  4.231   1.00 25.13 ? 101 PHE B CE1 1 
ATOM   3433 C  CE2 . PHE B 1 101 ? -2.098  14.757  3.320   1.00 25.44 ? 101 PHE B CE2 1 
ATOM   3434 C  CZ  . PHE B 1 101 ? -3.417  15.180  3.133   1.00 23.05 ? 101 PHE B CZ  1 
ATOM   3435 N  N   . ARG B 1 102 ? -0.331  13.700  9.654   1.00 33.82 ? 102 ARG B N   1 
ATOM   3436 C  CA  . ARG B 1 102 ? 0.370   13.887  10.920  1.00 33.09 ? 102 ARG B CA  1 
ATOM   3437 C  C   . ARG B 1 102 ? 1.353   15.033  10.708  1.00 33.61 ? 102 ARG B C   1 
ATOM   3438 O  O   . ARG B 1 102 ? 2.390   14.848  10.082  1.00 32.18 ? 102 ARG B O   1 
ATOM   3439 C  CB  . ARG B 1 102 ? 1.133   12.614  11.310  1.00 32.32 ? 102 ARG B CB  1 
ATOM   3440 C  CG  . ARG B 1 102 ? 1.977   12.754  12.589  1.00 30.62 ? 102 ARG B CG  1 
ATOM   3441 C  CD  . ARG B 1 102 ? 2.703   11.450  12.916  1.00 30.85 ? 102 ARG B CD  1 
ATOM   3442 N  NE  . ARG B 1 102 ? 1.784   10.353  13.215  1.00 26.90 ? 102 ARG B NE  1 
ATOM   3443 C  CZ  . ARG B 1 102 ? 1.036   10.276  14.313  1.00 26.03 ? 102 ARG B CZ  1 
ATOM   3444 N  NH1 . ARG B 1 102 ? 1.095   11.225  15.229  1.00 22.39 ? 102 ARG B NH1 1 
ATOM   3445 N  NH2 . ARG B 1 102 ? 0.209   9.254   14.492  1.00 29.94 ? 102 ARG B NH2 1 
ATOM   3446 N  N   . GLY B 1 103 ? 1.010   16.216  11.211  1.00 36.83 ? 103 GLY B N   1 
ATOM   3447 C  CA  . GLY B 1 103 ? 1.875   17.373  11.061  1.00 39.19 ? 103 GLY B CA  1 
ATOM   3448 C  C   . GLY B 1 103 ? 3.287   17.152  11.575  1.00 42.53 ? 103 GLY B C   1 
ATOM   3449 O  O   . GLY B 1 103 ? 3.504   16.342  12.482  1.00 42.59 ? 103 GLY B O   1 
ATOM   3450 N  N   . VAL B 1 104 ? 4.251   17.872  10.999  1.00 43.97 ? 104 VAL B N   1 
ATOM   3451 C  CA  . VAL B 1 104 ? 5.653   17.756  11.405  1.00 43.77 ? 104 VAL B CA  1 
ATOM   3452 C  C   . VAL B 1 104 ? 5.814   18.155  12.868  1.00 43.44 ? 104 VAL B C   1 
ATOM   3453 O  O   . VAL B 1 104 ? 6.890   18.009  13.440  1.00 43.81 ? 104 VAL B O   1 
ATOM   3454 C  CB  . VAL B 1 104 ? 6.589   18.656  10.541  1.00 43.90 ? 104 VAL B CB  1 
ATOM   3455 C  CG1 . VAL B 1 104 ? 6.418   18.324  9.055   1.00 42.13 ? 104 VAL B CG1 1 
ATOM   3456 C  CG2 . VAL B 1 104 ? 6.297   20.133  10.813  1.00 43.13 ? 104 VAL B CG2 1 
ATOM   3457 N  N   . ASP B 1 105 ? 4.740   18.676  13.456  1.00 43.93 ? 105 ASP B N   1 
ATOM   3458 C  CA  . ASP B 1 105 ? 4.736   19.074  14.859  1.00 44.64 ? 105 ASP B CA  1 
ATOM   3459 C  C   . ASP B 1 105 ? 3.980   17.994  15.630  1.00 43.54 ? 105 ASP B C   1 
ATOM   3460 O  O   . ASP B 1 105 ? 3.563   18.178  16.776  1.00 42.40 ? 105 ASP B O   1 
ATOM   3461 C  CB  . ASP B 1 105 ? 4.065   20.449  15.028  1.00 45.76 ? 105 ASP B CB  1 
ATOM   3462 C  CG  . ASP B 1 105 ? 2.601   20.456  14.611  1.00 47.17 ? 105 ASP B CG  1 
ATOM   3463 O  OD1 . ASP B 1 105 ? 2.010   21.554  14.607  1.00 46.47 ? 105 ASP B OD1 1 
ATOM   3464 O  OD2 . ASP B 1 105 ? 2.036   19.383  14.296  1.00 46.80 ? 105 ASP B OD2 1 
ATOM   3465 N  N   . ASN B 1 106 ? 3.810   16.866  14.950  1.00 44.56 ? 106 ASN B N   1 
ATOM   3466 C  CA  . ASN B 1 106 ? 3.138   15.676  15.460  1.00 43.82 ? 106 ASN B CA  1 
ATOM   3467 C  C   . ASN B 1 106 ? 1.665   15.829  15.805  1.00 43.85 ? 106 ASN B C   1 
ATOM   3468 O  O   . ASN B 1 106 ? 1.109   15.030  16.564  1.00 44.24 ? 106 ASN B O   1 
ATOM   3469 C  CB  . ASN B 1 106 ? 3.882   15.118  16.669  1.00 42.32 ? 106 ASN B CB  1 
ATOM   3470 C  CG  . ASN B 1 106 ? 3.449   13.708  17.002  1.00 41.38 ? 106 ASN B CG  1 
ATOM   3471 O  OD1 . ASN B 1 106 ? 3.595   12.790  16.184  1.00 34.78 ? 106 ASN B OD1 1 
ATOM   3472 N  ND2 . ASN B 1 106 ? 2.902   13.526  18.201  1.00 41.44 ? 106 ASN B ND2 1 
ATOM   3473 N  N   . LYS B 1 107 ? 1.030   16.851  15.249  1.00 42.10 ? 107 LYS B N   1 
ATOM   3474 C  CA  . LYS B 1 107 ? -0.391  17.060  15.475  1.00 41.48 ? 107 LYS B CA  1 
ATOM   3475 C  C   . LYS B 1 107 ? -1.112  16.575  14.213  1.00 39.63 ? 107 LYS B C   1 
ATOM   3476 O  O   . LYS B 1 107 ? -0.696  16.899  13.099  1.00 40.13 ? 107 LYS B O   1 
ATOM   3477 C  CB  . LYS B 1 107 ? -0.674  18.542  15.724  1.00 44.76 ? 107 LYS B CB  1 
ATOM   3478 C  CG  . LYS B 1 107 ? -0.027  19.079  16.992  1.00 46.50 ? 107 LYS B CG  1 
ATOM   3479 C  CD  . LYS B 1 107 ? -0.477  20.499  17.278  1.00 50.49 ? 107 LYS B CD  1 
ATOM   3480 C  CE  . LYS B 1 107 ? -0.088  20.929  18.685  1.00 51.69 ? 107 LYS B CE  1 
ATOM   3481 N  NZ  . LYS B 1 107 ? 1.383   20.838  18.912  1.00 53.34 ? 107 LYS B NZ  1 
ATOM   3482 N  N   . ILE B 1 108 ? -2.172  15.787  14.385  1.00 36.19 ? 108 ILE B N   1 
ATOM   3483 C  CA  . ILE B 1 108 ? -2.924  15.261  13.246  1.00 32.98 ? 108 ILE B CA  1 
ATOM   3484 C  C   . ILE B 1 108 ? -3.951  16.262  12.728  1.00 30.63 ? 108 ILE B C   1 
ATOM   3485 O  O   . ILE B 1 108 ? -4.728  16.816  13.501  1.00 30.65 ? 108 ILE B O   1 
ATOM   3486 C  CB  . ILE B 1 108 ? -3.625  13.934  13.610  1.00 33.81 ? 108 ILE B CB  1 
ATOM   3487 C  CG1 . ILE B 1 108 ? -2.565  12.879  13.950  1.00 34.67 ? 108 ILE B CG1 1 
ATOM   3488 C  CG2 . ILE B 1 108 ? -4.480  13.453  12.441  1.00 32.56 ? 108 ILE B CG2 1 
ATOM   3489 C  CD1 . ILE B 1 108 ? -3.128  11.533  14.374  1.00 37.64 ? 108 ILE B CD1 1 
ATOM   3490 N  N   . ARG B 1 109 ? -3.951  16.486  11.414  1.00 28.41 ? 109 ARG B N   1 
ATOM   3491 C  CA  . ARG B 1 109 ? -4.868  17.443  10.801  1.00 27.97 ? 109 ARG B CA  1 
ATOM   3492 C  C   . ARG B 1 109 ? -5.715  16.891  9.661   1.00 26.68 ? 109 ARG B C   1 
ATOM   3493 O  O   . ARG B 1 109 ? -5.396  15.870  9.062   1.00 28.03 ? 109 ARG B O   1 
ATOM   3494 C  CB  . ARG B 1 109 ? -4.087  18.643  10.262  1.00 27.46 ? 109 ARG B CB  1 
ATOM   3495 C  CG  . ARG B 1 109 ? -3.196  19.307  11.274  1.00 28.99 ? 109 ARG B CG  1 
ATOM   3496 C  CD  . ARG B 1 109 ? -2.546  20.542  10.677  1.00 30.81 ? 109 ARG B CD  1 
ATOM   3497 N  NE  . ARG B 1 109 ? -1.798  21.287  11.683  1.00 29.53 ? 109 ARG B NE  1 
ATOM   3498 C  CZ  . ARG B 1 109 ? -0.689  20.854  12.269  1.00 29.09 ? 109 ARG B CZ  1 
ATOM   3499 N  NH1 . ARG B 1 109 ? -0.180  19.676  11.946  1.00 33.60 ? 109 ARG B NH1 1 
ATOM   3500 N  NH2 . ARG B 1 109 ? -0.104  21.592  13.199  1.00 32.90 ? 109 ARG B NH2 1 
ATOM   3501 N  N   . LEU B 1 110 ? -6.796  17.599  9.365   1.00 25.22 ? 110 LEU B N   1 
ATOM   3502 C  CA  . LEU B 1 110 ? -7.689  17.233  8.282   1.00 25.32 ? 110 LEU B CA  1 
ATOM   3503 C  C   . LEU B 1 110 ? -7.644  18.395  7.305   1.00 25.50 ? 110 LEU B C   1 
ATOM   3504 O  O   . LEU B 1 110 ? -7.502  19.546  7.703   1.00 25.44 ? 110 LEU B O   1 
ATOM   3505 C  CB  . LEU B 1 110 ? -9.117  17.013  8.791   1.00 24.16 ? 110 LEU B CB  1 
ATOM   3506 C  CG  . LEU B 1 110 ? -9.360  15.765  9.644   1.00 26.05 ? 110 LEU B CG  1 
ATOM   3507 C  CD1 . LEU B 1 110 ? -10.853 15.632  9.934   1.00 27.65 ? 110 LEU B CD1 1 
ATOM   3508 C  CD2 . LEU B 1 110 ? -8.862  14.527  8.906   1.00 26.17 ? 110 LEU B CD2 1 
ATOM   3509 N  N   . PHE B 1 111 ? -7.766  18.085  6.023   1.00 26.25 ? 111 PHE B N   1 
ATOM   3510 C  CA  . PHE B 1 111 ? -7.691  19.096  4.981   1.00 25.99 ? 111 PHE B CA  1 
ATOM   3511 C  C   . PHE B 1 111 ? -9.041  19.411  4.346   1.00 25.59 ? 111 PHE B C   1 
ATOM   3512 O  O   . PHE B 1 111 ? -9.632  18.552  3.696   1.00 26.54 ? 111 PHE B O   1 
ATOM   3513 C  CB  . PHE B 1 111 ? -6.713  18.614  3.907   1.00 26.03 ? 111 PHE B CB  1 
ATOM   3514 C  CG  . PHE B 1 111 ? -6.409  19.637  2.862   1.00 28.40 ? 111 PHE B CG  1 
ATOM   3515 C  CD1 . PHE B 1 111 ? -5.607  20.729  3.157   1.00 26.29 ? 111 PHE B CD1 1 
ATOM   3516 C  CD2 . PHE B 1 111 ? -6.931  19.512  1.580   1.00 28.90 ? 111 PHE B CD2 1 
ATOM   3517 C  CE1 . PHE B 1 111 ? -5.329  21.682  2.194   1.00 27.36 ? 111 PHE B CE1 1 
ATOM   3518 C  CE2 . PHE B 1 111 ? -6.659  20.462  0.609   1.00 30.05 ? 111 PHE B CE2 1 
ATOM   3519 C  CZ  . PHE B 1 111 ? -5.855  21.552  0.917   1.00 28.63 ? 111 PHE B CZ  1 
ATOM   3520 N  N   . GLN B 1 112 ? -9.520  20.642  4.532   1.00 25.72 ? 112 GLN B N   1 
ATOM   3521 C  CA  . GLN B 1 112 ? -10.802 21.074  3.959   1.00 28.38 ? 112 GLN B CA  1 
ATOM   3522 C  C   . GLN B 1 112 ? -11.938 20.054  4.162   1.00 27.28 ? 112 GLN B C   1 
ATOM   3523 O  O   . GLN B 1 112 ? -12.785 19.891  3.285   1.00 26.41 ? 112 GLN B O   1 
ATOM   3524 C  CB  . GLN B 1 112 ? -10.629 21.310  2.453   1.00 28.17 ? 112 GLN B CB  1 
ATOM   3525 C  CG  . GLN B 1 112 ? -9.770  22.502  2.063   1.00 32.77 ? 112 GLN B CG  1 
ATOM   3526 C  CD  . GLN B 1 112 ? -10.584 23.775  1.884   1.00 35.38 ? 112 GLN B CD  1 
ATOM   3527 O  OE1 . GLN B 1 112 ? -10.142 24.716  1.230   1.00 34.72 ? 112 GLN B OE1 1 
ATOM   3528 N  NE2 . GLN B 1 112 ? -11.779 23.806  2.468   1.00 39.09 ? 112 GLN B NE2 1 
ATOM   3529 N  N   . PRO B 1 113 ? -11.994 19.389  5.331   1.00 27.22 ? 113 PRO B N   1 
ATOM   3530 C  CA  . PRO B 1 113 ? -13.035 18.389  5.596   1.00 25.96 ? 113 PRO B CA  1 
ATOM   3531 C  C   . PRO B 1 113 ? -14.477 18.827  5.390   1.00 25.75 ? 113 PRO B C   1 
ATOM   3532 O  O   . PRO B 1 113 ? -15.300 18.040  4.912   1.00 23.93 ? 113 PRO B O   1 
ATOM   3533 C  CB  . PRO B 1 113 ? -12.753 17.979  7.035   1.00 27.22 ? 113 PRO B CB  1 
ATOM   3534 C  CG  . PRO B 1 113 ? -12.288 19.251  7.631   1.00 26.64 ? 113 PRO B CG  1 
ATOM   3535 C  CD  . PRO B 1 113 ? -11.319 19.759  6.588   1.00 27.08 ? 113 PRO B CD  1 
ATOM   3536 N  N   . ASN B 1 114 ? -14.801 20.070  5.735   1.00 26.85 ? 114 ASN B N   1 
ATOM   3537 C  CA  . ASN B 1 114 ? -16.176 20.506  5.554   1.00 28.13 ? 114 ASN B CA  1 
ATOM   3538 C  C   . ASN B 1 114 ? -16.593 20.623  4.090   1.00 28.31 ? 114 ASN B C   1 
ATOM   3539 O  O   . ASN B 1 114 ? -17.785 20.663  3.795   1.00 30.64 ? 114 ASN B O   1 
ATOM   3540 C  CB  . ASN B 1 114 ? -16.455 21.813  6.298   1.00 29.39 ? 114 ASN B CB  1 
ATOM   3541 C  CG  . ASN B 1 114 ? -16.682 21.591  7.790   1.00 34.81 ? 114 ASN B CG  1 
ATOM   3542 O  OD1 . ASN B 1 114 ? -15.739 21.595  8.583   1.00 35.33 ? 114 ASN B OD1 1 
ATOM   3543 N  ND2 . ASN B 1 114 ? -17.941 21.371  8.174   1.00 37.70 ? 114 ASN B ND2 1 
ATOM   3544 N  N   . LEU B 1 115 ? -15.635 20.683  3.170   1.00 25.02 ? 115 LEU B N   1 
ATOM   3545 C  CA  . LEU B 1 115 ? -16.004 20.734  1.760   1.00 26.79 ? 115 LEU B CA  1 
ATOM   3546 C  C   . LEU B 1 115 ? -16.449 19.337  1.322   1.00 27.27 ? 115 LEU B C   1 
ATOM   3547 O  O   . LEU B 1 115 ? -17.324 19.188  0.477   1.00 28.81 ? 115 LEU B O   1 
ATOM   3548 C  CB  . LEU B 1 115 ? -14.840 21.217  0.890   1.00 26.35 ? 115 LEU B CB  1 
ATOM   3549 C  CG  . LEU B 1 115 ? -14.674 22.745  0.895   1.00 30.23 ? 115 LEU B CG  1 
ATOM   3550 C  CD1 . LEU B 1 115 ? -13.507 23.160  0.009   1.00 28.72 ? 115 LEU B CD1 1 
ATOM   3551 C  CD2 . LEU B 1 115 ? -15.966 23.389  0.401   1.00 27.31 ? 115 LEU B CD2 1 
ATOM   3552 N  N   . ASN B 1 116 ? -15.859 18.311  1.918   1.00 26.61 ? 116 ASN B N   1 
ATOM   3553 C  CA  . ASN B 1 116 ? -16.225 16.944  1.582   1.00 27.78 ? 116 ASN B CA  1 
ATOM   3554 C  C   . ASN B 1 116 ? -17.619 16.631  2.124   1.00 28.34 ? 116 ASN B C   1 
ATOM   3555 O  O   . ASN B 1 116 ? -18.442 15.996  1.454   1.00 28.47 ? 116 ASN B O   1 
ATOM   3556 C  CB  . ASN B 1 116 ? -15.174 15.999  2.150   1.00 27.28 ? 116 ASN B CB  1 
ATOM   3557 C  CG  . ASN B 1 116 ? -13.853 16.120  1.421   1.00 24.33 ? 116 ASN B CG  1 
ATOM   3558 O  OD1 . ASN B 1 116 ? -13.647 15.482  0.395   1.00 26.09 ? 116 ASN B OD1 1 
ATOM   3559 N  ND2 . ASN B 1 116 ? -12.965 16.963  1.931   1.00 21.65 ? 116 ASN B ND2 1 
ATOM   3560 N  N   . MET B 1 117 ? -17.887 17.099  3.336   1.00 27.32 ? 117 MET B N   1 
ATOM   3561 C  CA  . MET B 1 117 ? -19.186 16.901  3.948   1.00 26.02 ? 117 MET B CA  1 
ATOM   3562 C  C   . MET B 1 117 ? -20.257 17.532  3.065   1.00 26.25 ? 117 MET B C   1 
ATOM   3563 O  O   . MET B 1 117 ? -21.315 16.943  2.858   1.00 26.41 ? 117 MET B O   1 
ATOM   3564 C  CB  . MET B 1 117 ? -19.213 17.534  5.340   1.00 25.84 ? 117 MET B CB  1 
ATOM   3565 C  CG  . MET B 1 117 ? -18.211 16.917  6.298   1.00 25.29 ? 117 MET B CG  1 
ATOM   3566 S  SD  . MET B 1 117 ? -18.539 15.171  6.609   1.00 27.33 ? 117 MET B SD  1 
ATOM   3567 C  CE  . MET B 1 117 ? -17.393 14.382  5.542   1.00 26.83 ? 117 MET B CE  1 
ATOM   3568 N  N   . ASP B 1 118 ? -19.983 18.724  2.537   1.00 26.57 ? 118 ASP B N   1 
ATOM   3569 C  CA  . ASP B 1 118 ? -20.948 19.411  1.669   1.00 27.34 ? 118 ASP B CA  1 
ATOM   3570 C  C   . ASP B 1 118 ? -21.184 18.686  0.347   1.00 24.32 ? 118 ASP B C   1 
ATOM   3571 O  O   . ASP B 1 118 ? -22.294 18.663  -0.168  1.00 24.41 ? 118 ASP B O   1 
ATOM   3572 C  CB  . ASP B 1 118 ? -20.496 20.842  1.352   1.00 30.02 ? 118 ASP B CB  1 
ATOM   3573 C  CG  . ASP B 1 118 ? -20.442 21.722  2.578   1.00 32.39 ? 118 ASP B CG  1 
ATOM   3574 O  OD1 . ASP B 1 118 ? -21.341 21.597  3.437   1.00 34.53 ? 118 ASP B OD1 1 
ATOM   3575 O  OD2 . ASP B 1 118 ? -19.507 22.548  2.671   1.00 32.91 ? 118 ASP B OD2 1 
ATOM   3576 N  N   . ARG B 1 119 ? -20.135 18.110  -0.213  1.00 23.43 ? 119 ARG B N   1 
ATOM   3577 C  CA  . ARG B 1 119 ? -20.278 17.400  -1.470  1.00 24.66 ? 119 ARG B CA  1 
ATOM   3578 C  C   . ARG B 1 119 ? -21.045 16.106  -1.230  1.00 23.60 ? 119 ARG B C   1 
ATOM   3579 O  O   . ARG B 1 119 ? -21.986 15.778  -1.960  1.00 21.96 ? 119 ARG B O   1 
ATOM   3580 C  CB  . ARG B 1 119 ? -18.906 17.101  -2.056  1.00 23.53 ? 119 ARG B CB  1 
ATOM   3581 C  CG  . ARG B 1 119 ? -18.921 16.782  -3.526  1.00 20.34 ? 119 ARG B CG  1 
ATOM   3582 C  CD  . ARG B 1 119 ? -17.505 16.837  -4.063  1.00 21.97 ? 119 ARG B CD  1 
ATOM   3583 N  NE  . ARG B 1 119 ? -16.631 15.876  -3.395  1.00 21.60 ? 119 ARG B NE  1 
ATOM   3584 C  CZ  . ARG B 1 119 ? -15.311 15.843  -3.538  1.00 22.90 ? 119 ARG B CZ  1 
ATOM   3585 N  NH1 . ARG B 1 119 ? -14.704 16.727  -4.323  1.00 23.42 ? 119 ARG B NH1 1 
ATOM   3586 N  NH2 . ARG B 1 119 ? -14.600 14.915  -2.917  1.00 20.74 ? 119 ARG B NH2 1 
ATOM   3587 N  N   . MET B 1 120 ? -20.654 15.375  -0.194  1.00 24.35 ? 120 MET B N   1 
ATOM   3588 C  CA  . MET B 1 120 ? -21.339 14.127  0.122   1.00 25.52 ? 120 MET B CA  1 
ATOM   3589 C  C   . MET B 1 120 ? -22.828 14.376  0.412   1.00 26.56 ? 120 MET B C   1 
ATOM   3590 O  O   . MET B 1 120 ? -23.687 13.546  0.103   1.00 28.11 ? 120 MET B O   1 
ATOM   3591 C  CB  . MET B 1 120 ? -20.679 13.467  1.322   1.00 25.45 ? 120 MET B CB  1 
ATOM   3592 C  CG  . MET B 1 120 ? -21.370 12.215  1.776   1.00 30.81 ? 120 MET B CG  1 
ATOM   3593 S  SD  . MET B 1 120 ? -20.482 11.450  3.123   1.00 29.35 ? 120 MET B SD  1 
ATOM   3594 C  CE  . MET B 1 120 ? -20.872 9.734   2.825   1.00 36.55 ? 120 MET B CE  1 
ATOM   3595 N  N   . TYR B 1 121 ? -23.133 15.535  0.984   1.00 24.94 ? 121 TYR B N   1 
ATOM   3596 C  CA  . TYR B 1 121 ? -24.508 15.864  1.316   1.00 24.36 ? 121 TYR B CA  1 
ATOM   3597 C  C   . TYR B 1 121 ? -25.332 16.119  0.062   1.00 26.00 ? 121 TYR B C   1 
ATOM   3598 O  O   . TYR B 1 121 ? -26.458 15.628  -0.057  1.00 28.93 ? 121 TYR B O   1 
ATOM   3599 C  CB  . TYR B 1 121 ? -24.549 17.090  2.227   1.00 21.99 ? 121 TYR B CB  1 
ATOM   3600 C  CG  . TYR B 1 121 ? -25.927 17.420  2.745   1.00 20.13 ? 121 TYR B CG  1 
ATOM   3601 C  CD1 . TYR B 1 121 ? -26.406 16.832  3.910   1.00 18.66 ? 121 TYR B CD1 1 
ATOM   3602 C  CD2 . TYR B 1 121 ? -26.744 18.346  2.081   1.00 17.71 ? 121 TYR B CD2 1 
ATOM   3603 C  CE1 . TYR B 1 121 ? -27.651 17.156  4.416   1.00 18.84 ? 121 TYR B CE1 1 
ATOM   3604 C  CE2 . TYR B 1 121 ? -28.000 18.680  2.573   1.00 15.13 ? 121 TYR B CE2 1 
ATOM   3605 C  CZ  . TYR B 1 121 ? -28.447 18.082  3.749   1.00 21.40 ? 121 TYR B CZ  1 
ATOM   3606 O  OH  . TYR B 1 121 ? -29.668 18.423  4.285   1.00 15.52 ? 121 TYR B OH  1 
ATOM   3607 N  N   . ARG B 1 122 ? -24.774 16.887  -0.869  1.00 26.35 ? 122 ARG B N   1 
ATOM   3608 C  CA  . ARG B 1 122 ? -25.467 17.200  -2.116  1.00 27.18 ? 122 ARG B CA  1 
ATOM   3609 C  C   . ARG B 1 122 ? -25.630 15.957  -2.979  1.00 26.71 ? 122 ARG B C   1 
ATOM   3610 O  O   . ARG B 1 122 ? -26.623 15.809  -3.680  1.00 28.44 ? 122 ARG B O   1 
ATOM   3611 C  CB  . ARG B 1 122 ? -24.722 18.288  -2.899  1.00 28.63 ? 122 ARG B CB  1 
ATOM   3612 C  CG  . ARG B 1 122 ? -24.850 19.689  -2.291  1.00 35.59 ? 122 ARG B CG  1 
ATOM   3613 C  CD  . ARG B 1 122 ? -24.225 20.747  -3.197  1.00 41.91 ? 122 ARG B CD  1 
ATOM   3614 N  NE  . ARG B 1 122 ? -23.269 21.600  -2.490  1.00 47.24 ? 122 ARG B NE  1 
ATOM   3615 C  CZ  . ARG B 1 122 ? -23.584 22.434  -1.501  1.00 50.92 ? 122 ARG B CZ  1 
ATOM   3616 N  NH1 . ARG B 1 122 ? -24.842 22.539  -1.091  1.00 52.30 ? 122 ARG B NH1 1 
ATOM   3617 N  NH2 . ARG B 1 122 ? -22.637 23.160  -0.914  1.00 51.61 ? 122 ARG B NH2 1 
ATOM   3618 N  N   . SER B 1 123 ? -24.659 15.058  -2.932  1.00 26.74 ? 123 SER B N   1 
ATOM   3619 C  CA  . SER B 1 123 ? -24.768 13.840  -3.714  1.00 27.45 ? 123 SER B CA  1 
ATOM   3620 C  C   . SER B 1 123 ? -25.849 12.944  -3.109  1.00 26.26 ? 123 SER B C   1 
ATOM   3621 O  O   . SER B 1 123 ? -26.596 12.283  -3.830  1.00 25.71 ? 123 SER B O   1 
ATOM   3622 C  CB  . SER B 1 123 ? -23.421 13.124  -3.756  1.00 27.58 ? 123 SER B CB  1 
ATOM   3623 O  OG  . SER B 1 123 ? -22.499 13.883  -4.516  1.00 30.45 ? 123 SER B OG  1 
ATOM   3624 N  N   . ALA B 1 124 ? -25.947 12.945  -1.785  1.00 24.15 ? 124 ALA B N   1 
ATOM   3625 C  CA  . ALA B 1 124 ? -26.955 12.139  -1.100  1.00 24.15 ? 124 ALA B CA  1 
ATOM   3626 C  C   . ALA B 1 124 ? -28.346 12.517  -1.595  1.00 24.91 ? 124 ALA B C   1 
ATOM   3627 O  O   . ALA B 1 124 ? -29.168 11.650  -1.898  1.00 25.26 ? 124 ALA B O   1 
ATOM   3628 C  CB  . ALA B 1 124 ? -26.864 12.351  0.408   1.00 23.32 ? 124 ALA B CB  1 
ATOM   3629 N  N   . VAL B 1 125 ? -28.596 13.821  -1.663  1.00 24.64 ? 125 VAL B N   1 
ATOM   3630 C  CA  . VAL B 1 125 ? -29.871 14.350  -2.127  1.00 24.11 ? 125 VAL B CA  1 
ATOM   3631 C  C   . VAL B 1 125 ? -30.150 13.940  -3.580  1.00 26.49 ? 125 VAL B C   1 
ATOM   3632 O  O   . VAL B 1 125 ? -31.262 13.517  -3.914  1.00 25.15 ? 125 VAL B O   1 
ATOM   3633 C  CB  . VAL B 1 125 ? -29.896 15.908  -2.021  1.00 24.19 ? 125 VAL B CB  1 
ATOM   3634 C  CG1 . VAL B 1 125 ? -31.083 16.482  -2.805  1.00 22.04 ? 125 VAL B CG1 1 
ATOM   3635 C  CG2 . VAL B 1 125 ? -29.996 16.325  -0.559  1.00 23.61 ? 125 VAL B CG2 1 
ATOM   3636 N  N   . ARG B 1 126 ? -29.144 14.064  -4.442  1.00 26.29 ? 126 ARG B N   1 
ATOM   3637 C  CA  . ARG B 1 126 ? -29.322 13.710  -5.846  1.00 28.32 ? 126 ARG B CA  1 
ATOM   3638 C  C   . ARG B 1 126 ? -29.482 12.200  -6.007  1.00 27.68 ? 126 ARG B C   1 
ATOM   3639 O  O   . ARG B 1 126 ? -29.928 11.729  -7.049  1.00 26.82 ? 126 ARG B O   1 
ATOM   3640 C  CB  . ARG B 1 126 ? -28.137 14.196  -6.689  1.00 28.19 ? 126 ARG B CB  1 
ATOM   3641 C  CG  . ARG B 1 126 ? -28.349 14.041  -8.198  1.00 33.70 ? 126 ARG B CG  1 
ATOM   3642 C  CD  . ARG B 1 126 ? -28.627 15.390  -8.867  1.00 34.61 ? 126 ARG B CD  1 
ATOM   3643 N  NE  . ARG B 1 126 ? -27.430 16.231  -8.858  1.00 34.08 ? 126 ARG B NE  1 
ATOM   3644 C  CZ  . ARG B 1 126 ? -26.487 16.219  -9.797  1.00 31.94 ? 126 ARG B CZ  1 
ATOM   3645 N  NH1 . ARG B 1 126 ? -26.587 15.422  -10.852 1.00 32.48 ? 126 ARG B NH1 1 
ATOM   3646 N  NH2 . ARG B 1 126 ? -25.420 16.987  -9.663  1.00 35.35 ? 126 ARG B NH2 1 
ATOM   3647 N  N   . ALA B 1 127 ? -29.121 11.453  -4.966  1.00 26.98 ? 127 ALA B N   1 
ATOM   3648 C  CA  . ALA B 1 127 ? -29.220 9.993   -4.982  1.00 23.82 ? 127 ALA B CA  1 
ATOM   3649 C  C   . ALA B 1 127 ? -30.486 9.531   -4.282  1.00 23.41 ? 127 ALA B C   1 
ATOM   3650 O  O   . ALA B 1 127 ? -30.822 8.350   -4.310  1.00 21.92 ? 127 ALA B O   1 
ATOM   3651 C  CB  . ALA B 1 127 ? -28.005 9.382   -4.288  1.00 21.98 ? 127 ALA B CB  1 
ATOM   3652 N  N   . THR B 1 128 ? -31.184 10.485  -3.672  1.00 23.55 ? 128 THR B N   1 
ATOM   3653 C  CA  . THR B 1 128 ? -32.402 10.254  -2.896  1.00 22.63 ? 128 THR B CA  1 
ATOM   3654 C  C   . THR B 1 128 ? -32.098 9.463   -1.629  1.00 22.95 ? 128 THR B C   1 
ATOM   3655 O  O   . THR B 1 128 ? -32.975 8.804   -1.076  1.00 26.07 ? 128 THR B O   1 
ATOM   3656 C  CB  . THR B 1 128 ? -33.531 9.519   -3.683  1.00 25.94 ? 128 THR B CB  1 
ATOM   3657 O  OG1 . THR B 1 128 ? -33.185 8.141   -3.876  1.00 24.33 ? 128 THR B OG1 1 
ATOM   3658 C  CG2 . THR B 1 128 ? -33.790 10.208  -5.026  1.00 20.50 ? 128 THR B CG2 1 
ATOM   3659 N  N   . LEU B 1 129 ? -30.850 9.520   -1.175  1.00 22.78 ? 129 LEU B N   1 
ATOM   3660 C  CA  . LEU B 1 129 ? -30.469 8.853   0.065   1.00 23.28 ? 129 LEU B CA  1 
ATOM   3661 C  C   . LEU B 1 129 ? -30.859 9.797   1.211   1.00 24.01 ? 129 LEU B C   1 
ATOM   3662 O  O   . LEU B 1 129 ? -31.092 10.985  0.993   1.00 25.02 ? 129 LEU B O   1 
ATOM   3663 C  CB  . LEU B 1 129 ? -28.965 8.552   0.079   1.00 21.43 ? 129 LEU B CB  1 
ATOM   3664 C  CG  . LEU B 1 129 ? -28.596 7.213   -0.585  1.00 19.35 ? 129 LEU B CG  1 
ATOM   3665 C  CD1 . LEU B 1 129 ? -27.122 7.162   -0.869  1.00 17.56 ? 129 LEU B CD1 1 
ATOM   3666 C  CD2 . LEU B 1 129 ? -29.010 6.048   0.327   1.00 19.33 ? 129 LEU B CD2 1 
ATOM   3667 N  N   . PRO B 1 130 ? -30.956 9.276   2.439   1.00 23.72 ? 130 PRO B N   1 
ATOM   3668 C  CA  . PRO B 1 130 ? -31.331 10.102  3.593   1.00 23.37 ? 130 PRO B CA  1 
ATOM   3669 C  C   . PRO B 1 130 ? -30.300 11.169  3.952   1.00 24.45 ? 130 PRO B C   1 
ATOM   3670 O  O   . PRO B 1 130 ? -29.101 10.905  3.916   1.00 26.36 ? 130 PRO B O   1 
ATOM   3671 C  CB  . PRO B 1 130 ? -31.514 9.067   4.701   1.00 23.80 ? 130 PRO B CB  1 
ATOM   3672 C  CG  . PRO B 1 130 ? -30.500 8.015   4.347   1.00 22.35 ? 130 PRO B CG  1 
ATOM   3673 C  CD  . PRO B 1 130 ? -30.662 7.889   2.848   1.00 24.12 ? 130 PRO B CD  1 
ATOM   3674 N  N   . VAL B 1 131 ? -30.762 12.374  4.279   1.00 22.87 ? 131 VAL B N   1 
ATOM   3675 C  CA  . VAL B 1 131 ? -29.848 13.455  4.653   1.00 23.59 ? 131 VAL B CA  1 
ATOM   3676 C  C   . VAL B 1 131 ? -29.325 13.251  6.076   1.00 24.21 ? 131 VAL B C   1 
ATOM   3677 O  O   . VAL B 1 131 ? -29.878 12.471  6.860   1.00 22.73 ? 131 VAL B O   1 
ATOM   3678 C  CB  . VAL B 1 131 ? -30.511 14.869  4.576   1.00 24.76 ? 131 VAL B CB  1 
ATOM   3679 C  CG1 . VAL B 1 131 ? -30.766 15.254  3.128   1.00 24.17 ? 131 VAL B CG1 1 
ATOM   3680 C  CG2 . VAL B 1 131 ? -31.807 14.888  5.367   1.00 23.65 ? 131 VAL B CG2 1 
ATOM   3681 N  N   . PHE B 1 132 ? -28.256 13.961  6.408   1.00 22.22 ? 132 PHE B N   1 
ATOM   3682 C  CA  . PHE B 1 132 ? -27.651 13.828  7.724   1.00 23.32 ? 132 PHE B CA  1 
ATOM   3683 C  C   . PHE B 1 132 ? -27.057 15.174  8.087   1.00 23.69 ? 132 PHE B C   1 
ATOM   3684 O  O   . PHE B 1 132 ? -26.834 16.007  7.212   1.00 27.03 ? 132 PHE B O   1 
ATOM   3685 C  CB  . PHE B 1 132 ? -26.553 12.763  7.664   1.00 21.78 ? 132 PHE B CB  1 
ATOM   3686 C  CG  . PHE B 1 132 ? -25.568 12.994  6.556   1.00 21.07 ? 132 PHE B CG  1 
ATOM   3687 C  CD1 . PHE B 1 132 ? -24.512 13.882  6.722   1.00 17.41 ? 132 PHE B CD1 1 
ATOM   3688 C  CD2 . PHE B 1 132 ? -25.748 12.388  5.313   1.00 17.82 ? 132 PHE B CD2 1 
ATOM   3689 C  CE1 . PHE B 1 132 ? -23.648 14.169  5.656   1.00 21.96 ? 132 PHE B CE1 1 
ATOM   3690 C  CE2 . PHE B 1 132 ? -24.893 12.668  4.244   1.00 19.03 ? 132 PHE B CE2 1 
ATOM   3691 C  CZ  . PHE B 1 132 ? -23.842 13.560  4.412   1.00 19.23 ? 132 PHE B CZ  1 
ATOM   3692 N  N   . ASP B 1 133 ? -26.805 15.385  9.374   1.00 22.15 ? 133 ASP B N   1 
ATOM   3693 C  CA  . ASP B 1 133 ? -26.218 16.633  9.835   1.00 22.51 ? 133 ASP B CA  1 
ATOM   3694 C  C   . ASP B 1 133 ? -24.702 16.601  9.606   1.00 23.08 ? 133 ASP B C   1 
ATOM   3695 O  O   . ASP B 1 133 ? -23.959 15.950  10.354  1.00 21.65 ? 133 ASP B O   1 
ATOM   3696 C  CB  . ASP B 1 133 ? -26.561 16.839  11.316  1.00 22.12 ? 133 ASP B CB  1 
ATOM   3697 C  CG  . ASP B 1 133 ? -26.087 18.185  11.857  1.00 24.22 ? 133 ASP B CG  1 
ATOM   3698 O  OD1 . ASP B 1 133 ? -26.715 18.689  12.813  1.00 22.66 ? 133 ASP B OD1 1 
ATOM   3699 O  OD2 . ASP B 1 133 ? -25.084 18.730  11.349  1.00 23.27 ? 133 ASP B OD2 1 
ATOM   3700 N  N   . LYS B 1 134 ? -24.257 17.309  8.564   1.00 24.04 ? 134 LYS B N   1 
ATOM   3701 C  CA  . LYS B 1 134 ? -22.841 17.377  8.187   1.00 24.19 ? 134 LYS B CA  1 
ATOM   3702 C  C   . LYS B 1 134 ? -21.856 17.450  9.348   1.00 26.34 ? 134 LYS B C   1 
ATOM   3703 O  O   . LYS B 1 134 ? -20.826 16.776  9.333   1.00 29.02 ? 134 LYS B O   1 
ATOM   3704 C  CB  . LYS B 1 134 ? -22.598 18.565  7.243   1.00 22.51 ? 134 LYS B CB  1 
ATOM   3705 C  CG  . LYS B 1 134 ? -23.098 18.320  5.838   1.00 19.38 ? 134 LYS B CG  1 
ATOM   3706 C  CD  . LYS B 1 134 ? -22.873 19.496  4.924   1.00 22.21 ? 134 LYS B CD  1 
ATOM   3707 C  CE  . LYS B 1 134 ? -23.880 20.615  5.173   1.00 23.76 ? 134 LYS B CE  1 
ATOM   3708 N  NZ  . LYS B 1 134 ? -25.285 20.180  4.894   1.00 26.04 ? 134 LYS B NZ  1 
ATOM   3709 N  N   . GLU B 1 135 ? -22.165 18.269  10.345  1.00 26.94 ? 135 GLU B N   1 
ATOM   3710 C  CA  . GLU B 1 135 ? -21.286 18.427  11.498  1.00 28.75 ? 135 GLU B CA  1 
ATOM   3711 C  C   . GLU B 1 135 ? -21.263 17.186  12.392  1.00 27.05 ? 135 GLU B C   1 
ATOM   3712 O  O   . GLU B 1 135 ? -20.258 16.893  13.046  1.00 26.39 ? 135 GLU B O   1 
ATOM   3713 C  CB  . GLU B 1 135 ? -21.705 19.661  12.314  1.00 32.70 ? 135 GLU B CB  1 
ATOM   3714 C  CG  . GLU B 1 135 ? -21.418 20.985  11.624  1.00 38.39 ? 135 GLU B CG  1 
ATOM   3715 C  CD  . GLU B 1 135 ? -21.747 22.188  12.497  1.00 44.08 ? 135 GLU B CD  1 
ATOM   3716 O  OE1 . GLU B 1 135 ? -21.888 22.020  13.733  1.00 47.67 ? 135 GLU B OE1 1 
ATOM   3717 O  OE2 . GLU B 1 135 ? -21.847 23.307  11.948  1.00 43.96 ? 135 GLU B OE2 1 
ATOM   3718 N  N   . GLU B 1 136 ? -22.363 16.449  12.428  1.00 27.52 ? 136 GLU B N   1 
ATOM   3719 C  CA  . GLU B 1 136 ? -22.392 15.248  13.247  1.00 27.26 ? 136 GLU B CA  1 
ATOM   3720 C  C   . GLU B 1 136 ? -21.533 14.162  12.606  1.00 27.16 ? 136 GLU B C   1 
ATOM   3721 O  O   . GLU B 1 136 ? -20.878 13.390  13.302  1.00 29.32 ? 136 GLU B O   1 
ATOM   3722 C  CB  . GLU B 1 136 ? -23.825 14.760  13.421  1.00 27.55 ? 136 GLU B CB  1 
ATOM   3723 C  CG  . GLU B 1 136 ? -24.696 15.723  14.214  1.00 33.72 ? 136 GLU B CG  1 
ATOM   3724 C  CD  . GLU B 1 136 ? -24.185 15.963  15.629  1.00 35.72 ? 136 GLU B CD  1 
ATOM   3725 O  OE1 . GLU B 1 136 ? -24.528 17.016  16.206  1.00 38.14 ? 136 GLU B OE1 1 
ATOM   3726 O  OE2 . GLU B 1 136 ? -23.451 15.104  16.166  1.00 35.45 ? 136 GLU B OE2 1 
ATOM   3727 N  N   . LEU B 1 137 ? -21.525 14.119  11.277  1.00 25.43 ? 137 LEU B N   1 
ATOM   3728 C  CA  . LEU B 1 137 ? -20.754 13.123  10.554  1.00 24.83 ? 137 LEU B CA  1 
ATOM   3729 C  C   . LEU B 1 137 ? -19.269 13.438  10.727  1.00 25.43 ? 137 LEU B C   1 
ATOM   3730 O  O   . LEU B 1 137 ? -18.472 12.560  11.050  1.00 24.87 ? 137 LEU B O   1 
ATOM   3731 C  CB  . LEU B 1 137 ? -21.118 13.153  9.062   1.00 22.87 ? 137 LEU B CB  1 
ATOM   3732 C  CG  . LEU B 1 137 ? -21.061 11.860  8.229   1.00 25.08 ? 137 LEU B CG  1 
ATOM   3733 C  CD1 . LEU B 1 137 ? -20.706 12.225  6.797   1.00 22.96 ? 137 LEU B CD1 1 
ATOM   3734 C  CD2 . LEU B 1 137 ? -20.039 10.871  8.781   1.00 23.56 ? 137 LEU B CD2 1 
ATOM   3735 N  N   . LEU B 1 138 ? -18.905 14.699  10.512  1.00 24.43 ? 138 LEU B N   1 
ATOM   3736 C  CA  . LEU B 1 138 ? -17.515 15.117  10.637  1.00 25.07 ? 138 LEU B CA  1 
ATOM   3737 C  C   . LEU B 1 138 ? -16.963 14.830  12.030  1.00 24.45 ? 138 LEU B C   1 
ATOM   3738 O  O   . LEU B 1 138 ? -15.823 14.390  12.180  1.00 25.12 ? 138 LEU B O   1 
ATOM   3739 C  CB  . LEU B 1 138 ? -17.379 16.611  10.335  1.00 23.78 ? 138 LEU B CB  1 
ATOM   3740 C  CG  . LEU B 1 138 ? -15.959 17.164  10.488  1.00 27.13 ? 138 LEU B CG  1 
ATOM   3741 C  CD1 . LEU B 1 138 ? -15.005 16.358  9.616   1.00 27.15 ? 138 LEU B CD1 1 
ATOM   3742 C  CD2 . LEU B 1 138 ? -15.924 18.638  10.100  1.00 27.86 ? 138 LEU B CD2 1 
ATOM   3743 N  N   . GLU B 1 139 ? -17.765 15.102  13.051  1.00 24.75 ? 139 GLU B N   1 
ATOM   3744 C  CA  . GLU B 1 139 ? -17.338 14.847  14.416  1.00 26.71 ? 139 GLU B CA  1 
ATOM   3745 C  C   . GLU B 1 139 ? -17.155 13.338  14.622  1.00 25.72 ? 139 GLU B C   1 
ATOM   3746 O  O   . GLU B 1 139 ? -16.190 12.910  15.244  1.00 25.53 ? 139 GLU B O   1 
ATOM   3747 C  CB  . GLU B 1 139 ? -18.368 15.412  15.400  1.00 29.61 ? 139 GLU B CB  1 
ATOM   3748 C  CG  . GLU B 1 139 ? -18.074 15.134  16.873  1.00 35.95 ? 139 GLU B CG  1 
ATOM   3749 C  CD  . GLU B 1 139 ? -16.629 15.416  17.267  1.00 39.30 ? 139 GLU B CD  1 
ATOM   3750 O  OE1 . GLU B 1 139 ? -16.074 16.443  16.829  1.00 41.08 ? 139 GLU B OE1 1 
ATOM   3751 O  OE2 . GLU B 1 139 ? -16.050 14.613  18.030  1.00 40.29 ? 139 GLU B OE2 1 
ATOM   3752 N  N   . CYS B 1 140 ? -18.066 12.536  14.078  1.00 23.80 ? 140 CYS B N   1 
ATOM   3753 C  CA  . CYS B 1 140 ? -17.968 11.087  14.224  1.00 25.28 ? 140 CYS B CA  1 
ATOM   3754 C  C   . CYS B 1 140 ? -16.705 10.600  13.569  1.00 24.96 ? 140 CYS B C   1 
ATOM   3755 O  O   . CYS B 1 140 ? -15.981 9.786   14.130  1.00 27.31 ? 140 CYS B O   1 
ATOM   3756 C  CB  . CYS B 1 140 ? -19.163 10.380  13.587  1.00 24.64 ? 140 CYS B CB  1 
ATOM   3757 S  SG  . CYS B 1 140 ? -20.630 10.356  14.609  1.00 23.43 ? 140 CYS B SG  1 
ATOM   3758 N  N   . ILE B 1 141 ? -16.443 11.105  12.373  1.00 23.14 ? 141 ILE B N   1 
ATOM   3759 C  CA  . ILE B 1 141 ? -15.254 10.719  11.650  1.00 20.85 ? 141 ILE B CA  1 
ATOM   3760 C  C   . ILE B 1 141 ? -14.009 11.095  12.458  1.00 22.61 ? 141 ILE B C   1 
ATOM   3761 O  O   . ILE B 1 141 ? -13.061 10.308  12.561  1.00 19.94 ? 141 ILE B O   1 
ATOM   3762 C  CB  . ILE B 1 141 ? -15.222 11.390  10.255  1.00 20.62 ? 141 ILE B CB  1 
ATOM   3763 C  CG1 . ILE B 1 141 ? -16.269 10.728  9.351   1.00 18.19 ? 141 ILE B CG1 1 
ATOM   3764 C  CG2 . ILE B 1 141 ? -13.829 11.275  9.641   1.00 20.49 ? 141 ILE B CG2 1 
ATOM   3765 C  CD1 . ILE B 1 141 ? -16.242 11.197  7.914   1.00 14.84 ? 141 ILE B CD1 1 
ATOM   3766 N  N   . GLN B 1 142 ? -14.009 12.289  13.041  1.00 22.95 ? 142 GLN B N   1 
ATOM   3767 C  CA  . GLN B 1 142 ? -12.855 12.707  13.828  1.00 27.61 ? 142 GLN B CA  1 
ATOM   3768 C  C   . GLN B 1 142 ? -12.621 11.720  14.968  1.00 28.01 ? 142 GLN B C   1 
ATOM   3769 O  O   . GLN B 1 142 ? -11.481 11.375  15.276  1.00 29.90 ? 142 GLN B O   1 
ATOM   3770 C  CB  . GLN B 1 142 ? -13.051 14.111  14.411  1.00 27.82 ? 142 GLN B CB  1 
ATOM   3771 C  CG  . GLN B 1 142 ? -13.202 15.215  13.383  1.00 29.88 ? 142 GLN B CG  1 
ATOM   3772 C  CD  . GLN B 1 142 ? -12.782 16.565  13.934  1.00 35.23 ? 142 GLN B CD  1 
ATOM   3773 O  OE1 . GLN B 1 142 ? -13.238 17.610  13.474  1.00 35.19 ? 142 GLN B OE1 1 
ATOM   3774 N  NE2 . GLN B 1 142 ? -11.891 16.545  14.923  1.00 38.85 ? 142 GLN B NE2 1 
ATOM   3775 N  N   . GLN B 1 143 ? -13.704 11.262  15.588  1.00 29.07 ? 143 GLN B N   1 
ATOM   3776 C  CA  . GLN B 1 143 ? -13.584 10.319  16.692  1.00 30.77 ? 143 GLN B CA  1 
ATOM   3777 C  C   . GLN B 1 143 ? -13.045 8.983   16.219  1.00 28.76 ? 143 GLN B C   1 
ATOM   3778 O  O   . GLN B 1 143 ? -12.265 8.341   16.914  1.00 31.28 ? 143 GLN B O   1 
ATOM   3779 C  CB  . GLN B 1 143 ? -14.932 10.127  17.382  1.00 32.16 ? 143 GLN B CB  1 
ATOM   3780 C  CG  . GLN B 1 143 ? -15.416 11.373  18.081  1.00 38.08 ? 143 GLN B CG  1 
ATOM   3781 C  CD  . GLN B 1 143 ? -14.454 11.838  19.152  1.00 43.53 ? 143 GLN B CD  1 
ATOM   3782 O  OE1 . GLN B 1 143 ? -14.642 12.897  19.752  1.00 48.08 ? 143 GLN B OE1 1 
ATOM   3783 N  NE2 . GLN B 1 143 ? -13.415 11.045  19.403  1.00 46.32 ? 143 GLN B NE2 1 
ATOM   3784 N  N   . LEU B 1 144 ? -13.463 8.567   15.034  1.00 27.18 ? 144 LEU B N   1 
ATOM   3785 C  CA  . LEU B 1 144 ? -12.991 7.312   14.487  1.00 27.02 ? 144 LEU B CA  1 
ATOM   3786 C  C   . LEU B 1 144 ? -11.494 7.451   14.225  1.00 28.55 ? 144 LEU B C   1 
ATOM   3787 O  O   . LEU B 1 144 ? -10.712 6.545   14.532  1.00 28.13 ? 144 LEU B O   1 
ATOM   3788 C  CB  . LEU B 1 144 ? -13.714 6.997   13.181  1.00 25.05 ? 144 LEU B CB  1 
ATOM   3789 C  CG  . LEU B 1 144 ? -13.157 5.817   12.380  1.00 27.31 ? 144 LEU B CG  1 
ATOM   3790 C  CD1 . LEU B 1 144 ? -13.388 4.508   13.143  1.00 23.53 ? 144 LEU B CD1 1 
ATOM   3791 C  CD2 . LEU B 1 144 ? -13.829 5.786   11.011  1.00 25.70 ? 144 LEU B CD2 1 
ATOM   3792 N  N   . VAL B 1 145 ? -11.096 8.591   13.662  1.00 27.55 ? 145 VAL B N   1 
ATOM   3793 C  CA  . VAL B 1 145 ? -9.687  8.813   13.368  1.00 27.57 ? 145 VAL B CA  1 
ATOM   3794 C  C   . VAL B 1 145 ? -8.903  8.886   14.672  1.00 28.73 ? 145 VAL B C   1 
ATOM   3795 O  O   . VAL B 1 145 ? -7.825  8.290   14.799  1.00 25.45 ? 145 VAL B O   1 
ATOM   3796 C  CB  . VAL B 1 145 ? -9.476  10.107  12.553  1.00 25.63 ? 145 VAL B CB  1 
ATOM   3797 C  CG1 . VAL B 1 145 ? -7.979  10.355  12.348  1.00 23.97 ? 145 VAL B CG1 1 
ATOM   3798 C  CG2 . VAL B 1 145 ? -10.173 9.975   11.200  1.00 24.17 ? 145 VAL B CG2 1 
ATOM   3799 N  N   . LYS B 1 146 ? -9.456  9.604   15.646  1.00 27.60 ? 146 LYS B N   1 
ATOM   3800 C  CA  . LYS B 1 146 ? -8.803  9.722   16.942  1.00 29.52 ? 146 LYS B CA  1 
ATOM   3801 C  C   . LYS B 1 146 ? -8.546  8.340   17.568  1.00 29.33 ? 146 LYS B C   1 
ATOM   3802 O  O   . LYS B 1 146 ? -7.460  8.072   18.075  1.00 28.94 ? 146 LYS B O   1 
ATOM   3803 C  CB  . LYS B 1 146 ? -9.648  10.580  17.880  1.00 28.74 ? 146 LYS B CB  1 
ATOM   3804 C  CG  . LYS B 1 146 ? -8.949  10.911  19.183  1.00 32.70 ? 146 LYS B CG  1 
ATOM   3805 C  CD  . LYS B 1 146 ? -9.699  11.988  19.952  1.00 37.51 ? 146 LYS B CD  1 
ATOM   3806 C  CE  . LYS B 1 146 ? -8.960  12.388  21.223  1.00 39.54 ? 146 LYS B CE  1 
ATOM   3807 N  NZ  . LYS B 1 146 ? -8.859  11.246  22.180  1.00 43.40 ? 146 LYS B NZ  1 
ATOM   3808 N  N   . LEU B 1 147 ? -9.534  7.456   17.522  1.00 29.62 ? 147 LEU B N   1 
ATOM   3809 C  CA  . LEU B 1 147 ? -9.353  6.121   18.094  1.00 30.03 ? 147 LEU B CA  1 
ATOM   3810 C  C   . LEU B 1 147 ? -8.241  5.364   17.374  1.00 29.75 ? 147 LEU B C   1 
ATOM   3811 O  O   . LEU B 1 147 ? -7.405  4.728   18.014  1.00 33.43 ? 147 LEU B O   1 
ATOM   3812 C  CB  . LEU B 1 147 ? -10.650 5.321   18.008  1.00 29.64 ? 147 LEU B CB  1 
ATOM   3813 C  CG  . LEU B 1 147 ? -10.628 3.907   18.583  1.00 30.80 ? 147 LEU B CG  1 
ATOM   3814 C  CD1 . LEU B 1 147 ? -10.416 3.958   20.096  1.00 28.32 ? 147 LEU B CD1 1 
ATOM   3815 C  CD2 . LEU B 1 147 ? -11.940 3.223   18.248  1.00 30.97 ? 147 LEU B CD2 1 
ATOM   3816 N  N   . ASP B 1 148 ? -8.226  5.441   16.045  1.00 27.95 ? 148 ASP B N   1 
ATOM   3817 C  CA  . ASP B 1 148 ? -7.210  4.758   15.248  1.00 27.51 ? 148 ASP B CA  1 
ATOM   3818 C  C   . ASP B 1 148 ? -6.024  5.652   14.863  1.00 26.90 ? 148 ASP B C   1 
ATOM   3819 O  O   . ASP B 1 148 ? -5.230  5.305   13.991  1.00 29.03 ? 148 ASP B O   1 
ATOM   3820 C  CB  . ASP B 1 148 ? -7.852  4.191   13.982  1.00 29.43 ? 148 ASP B CB  1 
ATOM   3821 C  CG  . ASP B 1 148 ? -8.340  2.770   14.163  1.00 31.66 ? 148 ASP B CG  1 
ATOM   3822 O  OD1 . ASP B 1 148 ? -8.937  2.224   13.210  1.00 29.49 ? 148 ASP B OD1 1 
ATOM   3823 O  OD2 . ASP B 1 148 ? -8.117  2.197   15.255  1.00 32.41 ? 148 ASP B OD2 1 
ATOM   3824 N  N   . GLN B 1 149 ? -5.899  6.791   15.530  1.00 26.03 ? 149 GLN B N   1 
ATOM   3825 C  CA  . GLN B 1 149 ? -4.838  7.754   15.253  1.00 27.14 ? 149 GLN B CA  1 
ATOM   3826 C  C   . GLN B 1 149 ? -3.455  7.183   14.956  1.00 25.87 ? 149 GLN B C   1 
ATOM   3827 O  O   . GLN B 1 149 ? -2.751  7.693   14.088  1.00 25.34 ? 149 GLN B O   1 
ATOM   3828 C  CB  . GLN B 1 149 ? -4.710  8.737   16.416  1.00 30.72 ? 149 GLN B CB  1 
ATOM   3829 C  CG  . GLN B 1 149 ? -3.993  8.170   17.626  1.00 30.50 ? 149 GLN B CG  1 
ATOM   3830 C  CD  . GLN B 1 149 ? -4.011  9.121   18.791  1.00 34.40 ? 149 GLN B CD  1 
ATOM   3831 O  OE1 . GLN B 1 149 ? -3.520  10.243  18.694  1.00 34.41 ? 149 GLN B OE1 1 
ATOM   3832 N  NE2 . GLN B 1 149 ? -4.585  8.681   19.906  1.00 36.38 ? 149 GLN B NE2 1 
ATOM   3833 N  N   . GLU B 1 150 ? -3.048  6.141   15.673  1.00 26.30 ? 150 GLU B N   1 
ATOM   3834 C  CA  . GLU B 1 150 ? -1.726  5.586   15.434  1.00 26.69 ? 150 GLU B CA  1 
ATOM   3835 C  C   . GLU B 1 150 ? -1.572  5.026   14.035  1.00 25.59 ? 150 GLU B C   1 
ATOM   3836 O  O   . GLU B 1 150 ? -0.484  4.617   13.641  1.00 26.57 ? 150 GLU B O   1 
ATOM   3837 C  CB  . GLU B 1 150 ? -1.385  4.528   16.473  1.00 25.64 ? 150 GLU B CB  1 
ATOM   3838 C  CG  . GLU B 1 150 ? -1.031  5.122   17.828  1.00 30.50 ? 150 GLU B CG  1 
ATOM   3839 C  CD  . GLU B 1 150 ? 0.092   6.146   17.743  1.00 30.96 ? 150 GLU B CD  1 
ATOM   3840 O  OE1 . GLU B 1 150 ? 1.133   5.847   17.116  1.00 29.25 ? 150 GLU B OE1 1 
ATOM   3841 O  OE2 . GLU B 1 150 ? -0.065  7.248   18.309  1.00 31.89 ? 150 GLU B OE2 1 
ATOM   3842 N  N   . TRP B 1 151 ? -2.663  5.007   13.281  1.00 26.67 ? 151 TRP B N   1 
ATOM   3843 C  CA  . TRP B 1 151 ? -2.610  4.520   11.911  1.00 26.33 ? 151 TRP B CA  1 
ATOM   3844 C  C   . TRP B 1 151 ? -2.207  5.669   10.989  1.00 27.03 ? 151 TRP B C   1 
ATOM   3845 O  O   . TRP B 1 151 ? -1.729  5.443   9.881   1.00 29.11 ? 151 TRP B O   1 
ATOM   3846 C  CB  . TRP B 1 151 ? -3.962  3.940   11.488  1.00 26.44 ? 151 TRP B CB  1 
ATOM   3847 C  CG  . TRP B 1 151 ? -4.245  2.605   12.102  1.00 25.79 ? 151 TRP B CG  1 
ATOM   3848 C  CD1 . TRP B 1 151 ? -4.787  2.357   13.337  1.00 24.94 ? 151 TRP B CD1 1 
ATOM   3849 C  CD2 . TRP B 1 151 ? -3.981  1.322   11.514  1.00 24.08 ? 151 TRP B CD2 1 
ATOM   3850 N  NE1 . TRP B 1 151 ? -4.876  0.999   13.547  1.00 22.25 ? 151 TRP B NE1 1 
ATOM   3851 C  CE2 . TRP B 1 151 ? -4.391  0.343   12.445  1.00 22.17 ? 151 TRP B CE2 1 
ATOM   3852 C  CE3 . TRP B 1 151 ? -3.438  0.908   10.290  1.00 22.05 ? 151 TRP B CE3 1 
ATOM   3853 C  CZ2 . TRP B 1 151 ? -4.277  -1.028  12.189  1.00 25.69 ? 151 TRP B CZ2 1 
ATOM   3854 C  CZ3 . TRP B 1 151 ? -3.324  -0.450  10.037  1.00 25.41 ? 151 TRP B CZ3 1 
ATOM   3855 C  CH2 . TRP B 1 151 ? -3.743  -1.404  10.983  1.00 24.43 ? 151 TRP B CH2 1 
ATOM   3856 N  N   . VAL B 1 152 ? -2.405  6.906   11.442  1.00 28.43 ? 152 VAL B N   1 
ATOM   3857 C  CA  . VAL B 1 152 ? -1.999  8.054   10.635  1.00 29.67 ? 152 VAL B CA  1 
ATOM   3858 C  C   . VAL B 1 152 ? -0.478  7.935   10.594  1.00 31.09 ? 152 VAL B C   1 
ATOM   3859 O  O   . VAL B 1 152 ? 0.209   8.259   11.556  1.00 31.80 ? 152 VAL B O   1 
ATOM   3860 C  CB  . VAL B 1 152 ? -2.411  9.396   11.283  1.00 28.37 ? 152 VAL B CB  1 
ATOM   3861 C  CG1 . VAL B 1 152 ? -1.978  10.555  10.388  1.00 26.58 ? 152 VAL B CG1 1 
ATOM   3862 C  CG2 . VAL B 1 152 ? -3.916  9.430   11.493  1.00 26.11 ? 152 VAL B CG2 1 
ATOM   3863 N  N   . PRO B 1 153 ? 0.062   7.460   9.466   1.00 32.71 ? 153 PRO B N   1 
ATOM   3864 C  CA  . PRO B 1 153 ? 1.503   7.280   9.303   1.00 33.11 ? 153 PRO B CA  1 
ATOM   3865 C  C   . PRO B 1 153 ? 2.426   8.359   9.845   1.00 33.25 ? 153 PRO B C   1 
ATOM   3866 O  O   . PRO B 1 153 ? 2.072   9.543   9.927   1.00 30.35 ? 153 PRO B O   1 
ATOM   3867 C  CB  . PRO B 1 153 ? 1.659   7.073   7.796   1.00 31.83 ? 153 PRO B CB  1 
ATOM   3868 C  CG  . PRO B 1 153 ? 0.485   7.786   7.230   1.00 33.48 ? 153 PRO B CG  1 
ATOM   3869 C  CD  . PRO B 1 153 ? -0.615  7.393   8.161   1.00 31.41 ? 153 PRO B CD  1 
ATOM   3870 N  N   . TYR B 1 154 ? 3.607   7.900   10.248  1.00 34.40 ? 154 TYR B N   1 
ATOM   3871 C  CA  . TYR B 1 154 ? 4.673   8.747   10.766  1.00 35.15 ? 154 TYR B CA  1 
ATOM   3872 C  C   . TYR B 1 154 ? 5.578   8.950   9.556   1.00 35.49 ? 154 TYR B C   1 
ATOM   3873 O  O   . TYR B 1 154 ? 6.687   8.418   9.479   1.00 33.47 ? 154 TYR B O   1 
ATOM   3874 C  CB  . TYR B 1 154 ? 5.420   8.029   11.896  1.00 34.12 ? 154 TYR B CB  1 
ATOM   3875 C  CG  . TYR B 1 154 ? 4.669   8.018   13.213  1.00 34.14 ? 154 TYR B CG  1 
ATOM   3876 C  CD1 . TYR B 1 154 ? 4.782   9.080   14.110  1.00 33.24 ? 154 TYR B CD1 1 
ATOM   3877 C  CD2 . TYR B 1 154 ? 3.798   6.976   13.535  1.00 32.21 ? 154 TYR B CD2 1 
ATOM   3878 C  CE1 . TYR B 1 154 ? 4.040   9.105   15.291  1.00 32.28 ? 154 TYR B CE1 1 
ATOM   3879 C  CE2 . TYR B 1 154 ? 3.055   6.992   14.713  1.00 29.45 ? 154 TYR B CE2 1 
ATOM   3880 C  CZ  . TYR B 1 154 ? 3.175   8.057   15.582  1.00 30.96 ? 154 TYR B CZ  1 
ATOM   3881 O  OH  . TYR B 1 154 ? 2.410   8.100   16.727  1.00 31.08 ? 154 TYR B OH  1 
ATOM   3882 N  N   . SER B 1 155 ? 5.066   9.716   8.599   1.00 35.83 ? 155 SER B N   1 
ATOM   3883 C  CA  . SER B 1 155 ? 5.774   9.995   7.361   1.00 36.58 ? 155 SER B CA  1 
ATOM   3884 C  C   . SER B 1 155 ? 5.234   11.301  6.802   1.00 36.76 ? 155 SER B C   1 
ATOM   3885 O  O   . SER B 1 155 ? 4.066   11.633  7.015   1.00 35.62 ? 155 SER B O   1 
ATOM   3886 C  CB  . SER B 1 155 ? 5.528   8.862   6.361   1.00 35.61 ? 155 SER B CB  1 
ATOM   3887 O  OG  . SER B 1 155 ? 6.160   9.117   5.122   1.00 40.29 ? 155 SER B OG  1 
ATOM   3888 N  N   . THR B 1 156 ? 6.084   12.046  6.102   1.00 36.56 ? 156 THR B N   1 
ATOM   3889 C  CA  . THR B 1 156 ? 5.666   13.311  5.511   1.00 35.49 ? 156 THR B CA  1 
ATOM   3890 C  C   . THR B 1 156 ? 5.263   13.083  4.058   1.00 35.08 ? 156 THR B C   1 
ATOM   3891 O  O   . THR B 1 156 ? 4.877   14.018  3.361   1.00 33.88 ? 156 THR B O   1 
ATOM   3892 C  CB  . THR B 1 156 ? 6.787   14.365  5.576   1.00 36.43 ? 156 THR B CB  1 
ATOM   3893 O  OG1 . THR B 1 156 ? 8.005   13.808  5.060   1.00 37.71 ? 156 THR B OG1 1 
ATOM   3894 C  CG2 . THR B 1 156 ? 7.005   14.815  7.010   1.00 37.03 ? 156 THR B CG2 1 
ATOM   3895 N  N   . SER B 1 157 ? 5.351   11.832  3.610   1.00 34.24 ? 157 SER B N   1 
ATOM   3896 C  CA  . SER B 1 157 ? 4.972   11.485  2.243   1.00 35.51 ? 157 SER B CA  1 
ATOM   3897 C  C   . SER B 1 157 ? 3.902   10.387  2.243   1.00 35.71 ? 157 SER B C   1 
ATOM   3898 O  O   . SER B 1 157 ? 3.708   9.677   1.247   1.00 36.60 ? 157 SER B O   1 
ATOM   3899 C  CB  . SER B 1 157 ? 6.195   11.024  1.446   1.00 34.49 ? 157 SER B CB  1 
ATOM   3900 O  OG  . SER B 1 157 ? 6.712   9.815   1.962   1.00 36.58 ? 157 SER B OG  1 
ATOM   3901 N  N   . ALA B 1 158 ? 3.213   10.256  3.374   1.00 33.75 ? 158 ALA B N   1 
ATOM   3902 C  CA  . ALA B 1 158 ? 2.151   9.268   3.533   1.00 31.55 ? 158 ALA B CA  1 
ATOM   3903 C  C   . ALA B 1 158 ? 1.029   9.888   4.357   1.00 29.04 ? 158 ALA B C   1 
ATOM   3904 O  O   . ALA B 1 158 ? 1.226   10.903  5.019   1.00 30.59 ? 158 ALA B O   1 
ATOM   3905 C  CB  . ALA B 1 158 ? 2.690   8.023   4.220   1.00 31.99 ? 158 ALA B CB  1 
ATOM   3906 N  N   . SER B 1 159 ? -0.149  9.286   4.315   1.00 26.93 ? 159 SER B N   1 
ATOM   3907 C  CA  . SER B 1 159 ? -1.283  9.817   5.061   1.00 25.80 ? 159 SER B CA  1 
ATOM   3908 C  C   . SER B 1 159 ? -2.308  8.729   5.313   1.00 24.40 ? 159 SER B C   1 
ATOM   3909 O  O   . SER B 1 159 ? -2.078  7.569   4.984   1.00 23.60 ? 159 SER B O   1 
ATOM   3910 C  CB  . SER B 1 159 ? -1.939  10.949  4.276   1.00 26.30 ? 159 SER B CB  1 
ATOM   3911 O  OG  . SER B 1 159 ? -2.384  10.479  3.016   1.00 25.92 ? 159 SER B OG  1 
ATOM   3912 N  N   . LEU B 1 160 ? -3.440  9.111   5.896   1.00 22.81 ? 160 LEU B N   1 
ATOM   3913 C  CA  . LEU B 1 160 ? -4.507  8.157   6.173   1.00 22.35 ? 160 LEU B CA  1 
ATOM   3914 C  C   . LEU B 1 160 ? -5.735  8.553   5.357   1.00 22.12 ? 160 LEU B C   1 
ATOM   3915 O  O   . LEU B 1 160 ? -6.327  9.609   5.574   1.00 22.98 ? 160 LEU B O   1 
ATOM   3916 C  CB  . LEU B 1 160 ? -4.854  8.139   7.671   1.00 21.47 ? 160 LEU B CB  1 
ATOM   3917 C  CG  . LEU B 1 160 ? -5.820  7.025   8.094   1.00 21.21 ? 160 LEU B CG  1 
ATOM   3918 C  CD1 . LEU B 1 160 ? -5.172  5.680   7.843   1.00 17.43 ? 160 LEU B CD1 1 
ATOM   3919 C  CD2 . LEU B 1 160 ? -6.178  7.157   9.567   1.00 24.62 ? 160 LEU B CD2 1 
ATOM   3920 N  N   . TYR B 1 161 ? -6.100  7.700   4.408   1.00 21.31 ? 161 TYR B N   1 
ATOM   3921 C  CA  . TYR B 1 161 ? -7.242  7.946   3.542   1.00 21.87 ? 161 TYR B CA  1 
ATOM   3922 C  C   . TYR B 1 161 ? -8.512  7.642   4.316   1.00 20.73 ? 161 TYR B C   1 
ATOM   3923 O  O   . TYR B 1 161 ? -8.619  6.622   4.986   1.00 18.98 ? 161 TYR B O   1 
ATOM   3924 C  CB  . TYR B 1 161 ? -7.155  7.048   2.301   1.00 23.42 ? 161 TYR B CB  1 
ATOM   3925 C  CG  . TYR B 1 161 ? -8.158  7.347   1.210   1.00 23.79 ? 161 TYR B CG  1 
ATOM   3926 C  CD1 . TYR B 1 161 ? -8.045  8.491   0.427   1.00 25.34 ? 161 TYR B CD1 1 
ATOM   3927 C  CD2 . TYR B 1 161 ? -9.209  6.471   0.943   1.00 23.97 ? 161 TYR B CD2 1 
ATOM   3928 C  CE1 . TYR B 1 161 ? -8.956  8.754   -0.604  1.00 23.99 ? 161 TYR B CE1 1 
ATOM   3929 C  CE2 . TYR B 1 161 ? -10.119 6.725   -0.082  1.00 21.40 ? 161 TYR B CE2 1 
ATOM   3930 C  CZ  . TYR B 1 161 ? -9.987  7.866   -0.849  1.00 21.60 ? 161 TYR B CZ  1 
ATOM   3931 O  OH  . TYR B 1 161 ? -10.882 8.119   -1.863  1.00 21.20 ? 161 TYR B OH  1 
ATOM   3932 N  N   . ILE B 1 162 ? -9.474  8.543   4.219   1.00 22.83 ? 162 ILE B N   1 
ATOM   3933 C  CA  . ILE B 1 162 ? -10.738 8.371   4.906   1.00 22.26 ? 162 ILE B CA  1 
ATOM   3934 C  C   . ILE B 1 162 ? -11.809 8.176   3.857   1.00 22.09 ? 162 ILE B C   1 
ATOM   3935 O  O   . ILE B 1 162 ? -11.980 9.008   2.966   1.00 23.93 ? 162 ILE B O   1 
ATOM   3936 C  CB  . ILE B 1 162 ? -11.057 9.593   5.759   1.00 22.83 ? 162 ILE B CB  1 
ATOM   3937 C  CG1 . ILE B 1 162 ? -9.955  9.781   6.804   1.00 20.65 ? 162 ILE B CG1 1 
ATOM   3938 C  CG2 . ILE B 1 162 ? -12.408 9.424   6.415   1.00 23.62 ? 162 ILE B CG2 1 
ATOM   3939 C  CD1 . ILE B 1 162 ? -10.094 11.054  7.615   1.00 22.07 ? 162 ILE B CD1 1 
ATOM   3940 N  N   . ARG B 1 163 ? -12.527 7.067   3.962   1.00 21.55 ? 163 ARG B N   1 
ATOM   3941 C  CA  . ARG B 1 163 ? -13.554 6.756   2.994   1.00 19.89 ? 163 ARG B CA  1 
ATOM   3942 C  C   . ARG B 1 163 ? -14.986 6.664   3.527   1.00 21.33 ? 163 ARG B C   1 
ATOM   3943 O  O   . ARG B 1 163 ? -15.427 5.614   4.014   1.00 24.50 ? 163 ARG B O   1 
ATOM   3944 C  CB  . ARG B 1 163 ? -13.168 5.460   2.248   1.00 19.88 ? 163 ARG B CB  1 
ATOM   3945 C  CG  . ARG B 1 163 ? -14.245 4.844   1.352   1.00 16.84 ? 163 ARG B CG  1 
ATOM   3946 C  CD  . ARG B 1 163 ? -14.780 5.825   0.326   1.00 16.22 ? 163 ARG B CD  1 
ATOM   3947 N  NE  . ARG B 1 163 ? -13.772 6.225   -0.652  1.00 18.05 ? 163 ARG B NE  1 
ATOM   3948 C  CZ  . ARG B 1 163 ? -13.513 5.559   -1.773  1.00 21.11 ? 163 ARG B CZ  1 
ATOM   3949 N  NH1 . ARG B 1 163 ? -14.189 4.461   -2.060  1.00 20.71 ? 163 ARG B NH1 1 
ATOM   3950 N  NH2 . ARG B 1 163 ? -12.582 5.990   -2.612  1.00 22.82 ? 163 ARG B NH2 1 
ATOM   3951 N  N   . PRO B 1 164 ? -15.719 7.789   3.483   1.00 21.36 ? 164 PRO B N   1 
ATOM   3952 C  CA  . PRO B 1 164 ? -17.111 7.786   3.945   1.00 19.56 ? 164 PRO B CA  1 
ATOM   3953 C  C   . PRO B 1 164 ? -17.901 7.130   2.798   1.00 21.45 ? 164 PRO B C   1 
ATOM   3954 O  O   . PRO B 1 164 ? -17.667 7.446   1.630   1.00 21.32 ? 164 PRO B O   1 
ATOM   3955 C  CB  . PRO B 1 164 ? -17.430 9.271   4.079   1.00 18.87 ? 164 PRO B CB  1 
ATOM   3956 C  CG  . PRO B 1 164 ? -16.109 9.872   4.436   1.00 16.40 ? 164 PRO B CG  1 
ATOM   3957 C  CD  . PRO B 1 164 ? -15.185 9.163   3.463   1.00 18.15 ? 164 PRO B CD  1 
ATOM   3958 N  N   . THR B 1 165 ? -18.820 6.226   3.119   1.00 20.52 ? 165 THR B N   1 
ATOM   3959 C  CA  . THR B 1 165 ? -19.592 5.537   2.094   1.00 22.14 ? 165 THR B CA  1 
ATOM   3960 C  C   . THR B 1 165 ? -21.059 5.465   2.501   1.00 24.25 ? 165 THR B C   1 
ATOM   3961 O  O   . THR B 1 165 ? -21.376 5.222   3.666   1.00 27.87 ? 165 THR B O   1 
ATOM   3962 C  CB  . THR B 1 165 ? -19.027 4.124   1.874   1.00 22.40 ? 165 THR B CB  1 
ATOM   3963 O  OG1 . THR B 1 165 ? -17.597 4.194   1.849   1.00 25.94 ? 165 THR B OG1 1 
ATOM   3964 C  CG2 . THR B 1 165 ? -19.495 3.559   0.566   1.00 20.64 ? 165 THR B CG2 1 
ATOM   3965 N  N   . PHE B 1 166 ? -21.949 5.654   1.530   1.00 22.59 ? 166 PHE B N   1 
ATOM   3966 C  CA  . PHE B 1 166 ? -23.389 5.690   1.775   1.00 19.38 ? 166 PHE B CA  1 
ATOM   3967 C  C   . PHE B 1 166 ? -24.119 4.740   0.817   1.00 20.46 ? 166 PHE B C   1 
ATOM   3968 O  O   . PHE B 1 166 ? -24.176 5.003   -0.385  1.00 19.77 ? 166 PHE B O   1 
ATOM   3969 C  CB  . PHE B 1 166 ? -23.855 7.124   1.525   1.00 19.46 ? 166 PHE B CB  1 
ATOM   3970 C  CG  . PHE B 1 166 ? -24.971 7.589   2.412   1.00 21.59 ? 166 PHE B CG  1 
ATOM   3971 C  CD1 . PHE B 1 166 ? -25.772 6.686   3.106   1.00 20.10 ? 166 PHE B CD1 1 
ATOM   3972 C  CD2 . PHE B 1 166 ? -25.268 8.955   2.493   1.00 19.34 ? 166 PHE B CD2 1 
ATOM   3973 C  CE1 . PHE B 1 166 ? -26.854 7.131   3.862   1.00 22.30 ? 166 PHE B CE1 1 
ATOM   3974 C  CE2 . PHE B 1 166 ? -26.349 9.411   3.245   1.00 24.34 ? 166 PHE B CE2 1 
ATOM   3975 C  CZ  . PHE B 1 166 ? -27.147 8.498   3.932   1.00 21.41 ? 166 PHE B CZ  1 
ATOM   3976 N  N   . ILE B 1 167 ? -24.691 3.654   1.333   1.00 20.72 ? 167 ILE B N   1 
ATOM   3977 C  CA  . ILE B 1 167 ? -25.395 2.705   0.467   1.00 19.97 ? 167 ILE B CA  1 
ATOM   3978 C  C   . ILE B 1 167 ? -26.866 2.468   0.802   1.00 20.84 ? 167 ILE B C   1 
ATOM   3979 O  O   . ILE B 1 167 ? -27.271 2.479   1.962   1.00 21.29 ? 167 ILE B O   1 
ATOM   3980 C  CB  . ILE B 1 167 ? -24.712 1.327   0.473   1.00 20.29 ? 167 ILE B CB  1 
ATOM   3981 C  CG1 . ILE B 1 167 ? -24.721 0.753   1.889   1.00 20.04 ? 167 ILE B CG1 1 
ATOM   3982 C  CG2 . ILE B 1 167 ? -23.290 1.447   -0.034  1.00 19.82 ? 167 ILE B CG2 1 
ATOM   3983 C  CD1 . ILE B 1 167 ? -24.196 -0.664  1.981   1.00 18.65 ? 167 ILE B CD1 1 
ATOM   3984 N  N   . GLY B 1 168 ? -27.668 2.255   -0.233  1.00 22.93 ? 168 GLY B N   1 
ATOM   3985 C  CA  . GLY B 1 168 ? -29.071 1.961   -0.025  1.00 22.36 ? 168 GLY B CA  1 
ATOM   3986 C  C   . GLY B 1 168 ? -29.192 0.465   0.225   1.00 26.40 ? 168 GLY B C   1 
ATOM   3987 O  O   . GLY B 1 168 ? -28.620 -0.352  -0.517  1.00 23.32 ? 168 GLY B O   1 
ATOM   3988 N  N   . THR B 1 169 ? -29.923 0.091   1.271   1.00 26.42 ? 169 THR B N   1 
ATOM   3989 C  CA  . THR B 1 169 ? -30.077 -1.318  1.593   1.00 29.47 ? 169 THR B CA  1 
ATOM   3990 C  C   . THR B 1 169 ? -31.520 -1.777  1.495   1.00 32.05 ? 169 THR B C   1 
ATOM   3991 O  O   . THR B 1 169 ? -31.936 -2.720  2.166   1.00 32.35 ? 169 THR B O   1 
ATOM   3992 C  CB  . THR B 1 169 ? -29.512 -1.631  3.002   1.00 28.74 ? 169 THR B CB  1 
ATOM   3993 O  OG1 . THR B 1 169 ? -29.984 -0.661  3.948   1.00 29.28 ? 169 THR B OG1 1 
ATOM   3994 C  CG2 . THR B 1 169 ? -28.006 -1.587  2.972   1.00 28.37 ? 169 THR B CG2 1 
ATOM   3995 N  N   . GLU B 1 170 ? -32.283 -1.092  0.651   1.00 35.83 ? 170 GLU B N   1 
ATOM   3996 C  CA  . GLU B 1 170 ? -33.682 -1.434  0.418   1.00 37.44 ? 170 GLU B CA  1 
ATOM   3997 C  C   . GLU B 1 170 ? -33.743 -2.921  0.048   1.00 35.93 ? 170 GLU B C   1 
ATOM   3998 O  O   . GLU B 1 170 ? -33.110 -3.349  -0.913  1.00 34.79 ? 170 GLU B O   1 
ATOM   3999 C  CB  . GLU B 1 170 ? -34.239 -0.594  -0.747  1.00 38.03 ? 170 GLU B CB  1 
ATOM   4000 C  CG  . GLU B 1 170 ? -35.670 -0.933  -1.151  1.00 39.81 ? 170 GLU B CG  1 
ATOM   4001 C  CD  . GLU B 1 170 ? -36.686 -0.656  -0.043  1.00 43.18 ? 170 GLU B CD  1 
ATOM   4002 O  OE1 . GLU B 1 170 ? -36.840 0.521   0.341   1.00 42.24 ? 170 GLU B OE1 1 
ATOM   4003 O  OE2 . GLU B 1 170 ? -37.331 -1.613  0.443   1.00 44.55 ? 170 GLU B OE2 1 
ATOM   4004 N  N   . PRO B 1 171 ? -34.484 -3.725  0.821   1.00 35.64 ? 171 PRO B N   1 
ATOM   4005 C  CA  . PRO B 1 171 ? -34.591 -5.159  0.522   1.00 36.24 ? 171 PRO B CA  1 
ATOM   4006 C  C   . PRO B 1 171 ? -35.458 -5.483  -0.698  1.00 35.04 ? 171 PRO B C   1 
ATOM   4007 O  O   . PRO B 1 171 ? -35.368 -6.577  -1.236  1.00 37.49 ? 171 PRO B O   1 
ATOM   4008 C  CB  . PRO B 1 171 ? -35.191 -5.746  1.801   1.00 35.56 ? 171 PRO B CB  1 
ATOM   4009 C  CG  . PRO B 1 171 ? -34.770 -4.777  2.862   1.00 37.71 ? 171 PRO B CG  1 
ATOM   4010 C  CD  . PRO B 1 171 ? -34.963 -3.439  2.183   1.00 36.06 ? 171 PRO B CD  1 
ATOM   4011 N  N   . SER B 1 172 ? -36.297 -4.551  -1.139  1.00 34.92 ? 172 SER B N   1 
ATOM   4012 C  CA  . SER B 1 172 ? -37.160 -4.823  -2.292  1.00 35.35 ? 172 SER B CA  1 
ATOM   4013 C  C   . SER B 1 172 ? -36.470 -4.580  -3.635  1.00 34.17 ? 172 SER B C   1 
ATOM   4014 O  O   . SER B 1 172 ? -35.600 -3.719  -3.754  1.00 33.89 ? 172 SER B O   1 
ATOM   4015 C  CB  . SER B 1 172 ? -38.447 -3.993  -2.216  1.00 36.42 ? 172 SER B CB  1 
ATOM   4016 O  OG  . SER B 1 172 ? -38.205 -2.623  -2.479  1.00 41.10 ? 172 SER B OG  1 
ATOM   4017 N  N   . LEU B 1 173 ? -36.862 -5.348  -4.645  1.00 32.84 ? 173 LEU B N   1 
ATOM   4018 C  CA  . LEU B 1 173 ? -36.273 -5.216  -5.970  1.00 30.25 ? 173 LEU B CA  1 
ATOM   4019 C  C   . LEU B 1 173 ? -36.919 -4.092  -6.772  1.00 28.05 ? 173 LEU B C   1 
ATOM   4020 O  O   . LEU B 1 173 ? -36.517 -3.817  -7.903  1.00 24.71 ? 173 LEU B O   1 
ATOM   4021 C  CB  . LEU B 1 173 ? -36.393 -6.540  -6.732  1.00 29.28 ? 173 LEU B CB  1 
ATOM   4022 C  CG  . LEU B 1 173 ? -35.879 -7.779  -5.987  1.00 30.72 ? 173 LEU B CG  1 
ATOM   4023 C  CD1 . LEU B 1 173 ? -35.911 -8.992  -6.908  1.00 28.25 ? 173 LEU B CD1 1 
ATOM   4024 C  CD2 . LEU B 1 173 ? -34.460 -7.527  -5.487  1.00 29.06 ? 173 LEU B CD2 1 
ATOM   4025 N  N   . GLY B 1 174 ? -37.928 -3.450  -6.194  1.00 28.54 ? 174 GLY B N   1 
ATOM   4026 C  CA  . GLY B 1 174 ? -38.583 -2.355  -6.899  1.00 30.53 ? 174 GLY B CA  1 
ATOM   4027 C  C   . GLY B 1 174 ? -37.637 -1.170  -6.993  1.00 30.87 ? 174 GLY B C   1 
ATOM   4028 O  O   . GLY B 1 174 ? -36.898 -0.896  -6.046  1.00 31.75 ? 174 GLY B O   1 
ATOM   4029 N  N   . VAL B 1 175 ? -37.642 -0.472  -8.124  1.00 33.00 ? 175 VAL B N   1 
ATOM   4030 C  CA  . VAL B 1 175 ? -36.760 0.681   -8.317  1.00 34.26 ? 175 VAL B CA  1 
ATOM   4031 C  C   . VAL B 1 175 ? -37.357 1.948   -7.727  1.00 35.14 ? 175 VAL B C   1 
ATOM   4032 O  O   . VAL B 1 175 ? -38.200 2.579   -8.352  1.00 37.68 ? 175 VAL B O   1 
ATOM   4033 C  CB  . VAL B 1 175 ? -36.490 0.942   -9.815  1.00 35.21 ? 175 VAL B CB  1 
ATOM   4034 C  CG1 . VAL B 1 175 ? -35.682 2.216   -9.981  1.00 36.13 ? 175 VAL B CG1 1 
ATOM   4035 C  CG2 . VAL B 1 175 ? -35.743 -0.235  -10.430 1.00 35.29 ? 175 VAL B CG2 1 
ATOM   4036 N  N   . LYS B 1 176 ? -36.914 2.336   -6.536  1.00 35.36 ? 176 LYS B N   1 
ATOM   4037 C  CA  . LYS B 1 176 ? -37.451 3.537   -5.907  1.00 35.03 ? 176 LYS B CA  1 
ATOM   4038 C  C   . LYS B 1 176 ? -36.570 4.083   -4.790  1.00 34.36 ? 176 LYS B C   1 
ATOM   4039 O  O   . LYS B 1 176 ? -35.508 3.539   -4.493  1.00 35.31 ? 176 LYS B O   1 
ATOM   4040 C  CB  . LYS B 1 176 ? -38.847 3.247   -5.358  1.00 36.01 ? 176 LYS B CB  1 
ATOM   4041 C  CG  . LYS B 1 176 ? -38.869 2.440   -4.068  1.00 38.57 ? 176 LYS B CG  1 
ATOM   4042 C  CD  . LYS B 1 176 ? -37.966 1.214   -4.124  1.00 38.96 ? 176 LYS B CD  1 
ATOM   4043 C  CE  . LYS B 1 176 ? -38.267 0.242   -2.985  1.00 40.08 ? 176 LYS B CE  1 
ATOM   4044 N  NZ  . LYS B 1 176 ? -39.603 -0.420  -3.131  1.00 39.74 ? 176 LYS B NZ  1 
ATOM   4045 N  N   . LYS B 1 177 ? -37.024 5.169   -4.178  1.00 31.72 ? 177 LYS B N   1 
ATOM   4046 C  CA  . LYS B 1 177 ? -36.299 5.800   -3.085  1.00 30.59 ? 177 LYS B CA  1 
ATOM   4047 C  C   . LYS B 1 177 ? -36.150 4.768   -1.968  1.00 27.55 ? 177 LYS B C   1 
ATOM   4048 O  O   . LYS B 1 177 ? -37.129 4.153   -1.536  1.00 27.68 ? 177 LYS B O   1 
ATOM   4049 C  CB  . LYS B 1 177 ? -37.085 7.012   -2.584  1.00 32.06 ? 177 LYS B CB  1 
ATOM   4050 C  CG  . LYS B 1 177 ? -36.351 7.937   -1.629  1.00 34.58 ? 177 LYS B CG  1 
ATOM   4051 C  CD  . LYS B 1 177 ? -37.286 9.077   -1.212  1.00 37.18 ? 177 LYS B CD  1 
ATOM   4052 C  CE  . LYS B 1 177 ? -36.547 10.298  -0.680  1.00 39.87 ? 177 LYS B CE  1 
ATOM   4053 N  NZ  . LYS B 1 177 ? -35.771 10.032  0.564   1.00 43.77 ? 177 LYS B NZ  1 
ATOM   4054 N  N   . PRO B 1 178 ? -34.921 4.562   -1.487  1.00 25.37 ? 178 PRO B N   1 
ATOM   4055 C  CA  . PRO B 1 178 ? -34.682 3.588   -0.419  1.00 24.97 ? 178 PRO B CA  1 
ATOM   4056 C  C   . PRO B 1 178 ? -35.323 3.941   0.922   1.00 25.76 ? 178 PRO B C   1 
ATOM   4057 O  O   . PRO B 1 178 ? -35.387 5.106   1.315   1.00 24.44 ? 178 PRO B O   1 
ATOM   4058 C  CB  . PRO B 1 178 ? -33.164 3.533   -0.344  1.00 23.89 ? 178 PRO B CB  1 
ATOM   4059 C  CG  . PRO B 1 178 ? -32.780 4.956   -0.686  1.00 26.38 ? 178 PRO B CG  1 
ATOM   4060 C  CD  . PRO B 1 178 ? -33.676 5.257   -1.863  1.00 23.61 ? 178 PRO B CD  1 
ATOM   4061 N  N   . THR B 1 179 ? -35.793 2.907   1.610   1.00 26.76 ? 179 THR B N   1 
ATOM   4062 C  CA  . THR B 1 179 ? -36.435 3.036   2.911   1.00 27.83 ? 179 THR B CA  1 
ATOM   4063 C  C   . THR B 1 179 ? -35.507 2.482   3.994   1.00 27.43 ? 179 THR B C   1 
ATOM   4064 O  O   . THR B 1 179 ? -35.849 2.463   5.176   1.00 26.15 ? 179 THR B O   1 
ATOM   4065 C  CB  . THR B 1 179 ? -37.764 2.249   2.943   1.00 28.52 ? 179 THR B CB  1 
ATOM   4066 O  OG1 . THR B 1 179 ? -37.490 0.848   2.823   1.00 28.80 ? 179 THR B OG1 1 
ATOM   4067 C  CG2 . THR B 1 179 ? -38.668 2.679   1.780   1.00 26.84 ? 179 THR B CG2 1 
ATOM   4068 N  N   . LYS B 1 180 ? -34.339 2.016   3.569   1.00 27.41 ? 180 LYS B N   1 
ATOM   4069 C  CA  . LYS B 1 180 ? -33.336 1.459   4.471   1.00 28.45 ? 180 LYS B CA  1 
ATOM   4070 C  C   . LYS B 1 180 ? -31.957 1.768   3.886   1.00 28.14 ? 180 LYS B C   1 
ATOM   4071 O  O   . LYS B 1 180 ? -31.702 1.503   2.707   1.00 30.49 ? 180 LYS B O   1 
ATOM   4072 C  CB  . LYS B 1 180 ? -33.523 -0.058  4.604   1.00 26.86 ? 180 LYS B CB  1 
ATOM   4073 C  CG  . LYS B 1 180 ? -32.726 -0.679  5.748   1.00 30.23 ? 180 LYS B CG  1 
ATOM   4074 C  CD  . LYS B 1 180 ? -32.796 -2.204  5.717   1.00 31.09 ? 180 LYS B CD  1 
ATOM   4075 C  CE  . LYS B 1 180 ? -31.949 -2.849  6.810   1.00 27.70 ? 180 LYS B CE  1 
ATOM   4076 N  NZ  . LYS B 1 180 ? -32.573 -2.821  8.168   1.00 29.68 ? 180 LYS B NZ  1 
ATOM   4077 N  N   . ALA B 1 181 ? -31.069 2.333   4.699   1.00 25.02 ? 181 ALA B N   1 
ATOM   4078 C  CA  . ALA B 1 181 ? -29.736 2.677   4.219   1.00 23.23 ? 181 ALA B CA  1 
ATOM   4079 C  C   . ALA B 1 181 ? -28.662 2.598   5.295   1.00 24.30 ? 181 ALA B C   1 
ATOM   4080 O  O   . ALA B 1 181 ? -28.944 2.700   6.492   1.00 23.49 ? 181 ALA B O   1 
ATOM   4081 C  CB  . ALA B 1 181 ? -29.746 4.075   3.624   1.00 21.13 ? 181 ALA B CB  1 
ATOM   4082 N  N   . LEU B 1 182 ? -27.421 2.436   4.847   1.00 21.44 ? 182 LEU B N   1 
ATOM   4083 C  CA  . LEU B 1 182 ? -26.281 2.356   5.741   1.00 22.56 ? 182 LEU B CA  1 
ATOM   4084 C  C   . LEU B 1 182 ? -25.200 3.376   5.377   1.00 22.25 ? 182 LEU B C   1 
ATOM   4085 O  O   . LEU B 1 182 ? -24.852 3.548   4.207   1.00 21.33 ? 182 LEU B O   1 
ATOM   4086 C  CB  . LEU B 1 182 ? -25.672 0.950   5.701   1.00 20.53 ? 182 LEU B CB  1 
ATOM   4087 C  CG  . LEU B 1 182 ? -24.438 0.763   6.583   1.00 22.75 ? 182 LEU B CG  1 
ATOM   4088 C  CD1 . LEU B 1 182 ? -24.847 0.910   8.030   1.00 18.56 ? 182 LEU B CD1 1 
ATOM   4089 C  CD2 . LEU B 1 182 ? -23.813 -0.618  6.351   1.00 25.23 ? 182 LEU B CD2 1 
ATOM   4090 N  N   . LEU B 1 183 ? -24.675 4.051   6.390   1.00 21.80 ? 183 LEU B N   1 
ATOM   4091 C  CA  . LEU B 1 183 ? -23.607 5.026   6.189   1.00 22.43 ? 183 LEU B CA  1 
ATOM   4092 C  C   . LEU B 1 183 ? -22.421 4.534   7.004   1.00 21.49 ? 183 LEU B C   1 
ATOM   4093 O  O   . LEU B 1 183 ? -22.555 4.222   8.186   1.00 22.04 ? 183 LEU B O   1 
ATOM   4094 C  CB  . LEU B 1 183 ? -24.051 6.413   6.664   1.00 22.08 ? 183 LEU B CB  1 
ATOM   4095 C  CG  . LEU B 1 183 ? -22.992 7.518   6.764   1.00 27.75 ? 183 LEU B CG  1 
ATOM   4096 C  CD1 . LEU B 1 183 ? -22.125 7.532   5.535   1.00 26.84 ? 183 LEU B CD1 1 
ATOM   4097 C  CD2 . LEU B 1 183 ? -23.687 8.860   6.943   1.00 27.57 ? 183 LEU B CD2 1 
ATOM   4098 N  N   . PHE B 1 184 ? -21.263 4.429   6.372   1.00 21.76 ? 184 PHE B N   1 
ATOM   4099 C  CA  . PHE B 1 184 ? -20.088 3.956   7.084   1.00 22.20 ? 184 PHE B CA  1 
ATOM   4100 C  C   . PHE B 1 184 ? -18.809 4.630   6.605   1.00 21.10 ? 184 PHE B C   1 
ATOM   4101 O  O   . PHE B 1 184 ? -18.787 5.247   5.545   1.00 21.01 ? 184 PHE B O   1 
ATOM   4102 C  CB  . PHE B 1 184 ? -19.986 2.430   6.949   1.00 22.96 ? 184 PHE B CB  1 
ATOM   4103 C  CG  . PHE B 1 184 ? -19.845 1.945   5.536   1.00 21.97 ? 184 PHE B CG  1 
ATOM   4104 C  CD1 . PHE B 1 184 ? -18.593 1.804   4.958   1.00 20.50 ? 184 PHE B CD1 1 
ATOM   4105 C  CD2 . PHE B 1 184 ? -20.968 1.591   4.795   1.00 19.34 ? 184 PHE B CD2 1 
ATOM   4106 C  CE1 . PHE B 1 184 ? -18.449 1.307   3.659   1.00 20.78 ? 184 PHE B CE1 1 
ATOM   4107 C  CE2 . PHE B 1 184 ? -20.840 1.093   3.494   1.00 20.50 ? 184 PHE B CE2 1 
ATOM   4108 C  CZ  . PHE B 1 184 ? -19.576 0.949   2.926   1.00 22.62 ? 184 PHE B CZ  1 
ATOM   4109 N  N   . VAL B 1 185 ? -17.751 4.525   7.404   1.00 20.55 ? 185 VAL B N   1 
ATOM   4110 C  CA  . VAL B 1 185 ? -16.473 5.134   7.058   1.00 18.04 ? 185 VAL B CA  1 
ATOM   4111 C  C   . VAL B 1 185 ? -15.313 4.180   7.292   1.00 21.99 ? 185 VAL B C   1 
ATOM   4112 O  O   . VAL B 1 185 ? -15.225 3.526   8.336   1.00 23.72 ? 185 VAL B O   1 
ATOM   4113 C  CB  . VAL B 1 185 ? -16.226 6.424   7.878   1.00 14.53 ? 185 VAL B CB  1 
ATOM   4114 C  CG1 . VAL B 1 185 ? -14.996 7.132   7.362   1.00 10.15 ? 185 VAL B CG1 1 
ATOM   4115 C  CG2 . VAL B 1 185 ? -17.444 7.348   7.787   1.00 11.27 ? 185 VAL B CG2 1 
ATOM   4116 N  N   . LEU B 1 186 ? -14.424 4.099   6.311   1.00 25.02 ? 186 LEU B N   1 
ATOM   4117 C  CA  . LEU B 1 186 ? -13.259 3.230   6.410   1.00 25.31 ? 186 LEU B CA  1 
ATOM   4118 C  C   . LEU B 1 186 ? -11.997 4.074   6.434   1.00 27.79 ? 186 LEU B C   1 
ATOM   4119 O  O   . LEU B 1 186 ? -11.961 5.166   5.859   1.00 28.21 ? 186 LEU B O   1 
ATOM   4120 C  CB  . LEU B 1 186 ? -13.198 2.274   5.218   1.00 24.49 ? 186 LEU B CB  1 
ATOM   4121 C  CG  . LEU B 1 186 ? -14.395 1.350   4.993   1.00 24.00 ? 186 LEU B CG  1 
ATOM   4122 C  CD1 . LEU B 1 186 ? -14.169 0.531   3.726   1.00 22.11 ? 186 LEU B CD1 1 
ATOM   4123 C  CD2 . LEU B 1 186 ? -14.578 0.446   6.199   1.00 23.01 ? 186 LEU B CD2 1 
ATOM   4124 N  N   . LEU B 1 187 ? -10.973 3.564   7.111   1.00 26.80 ? 187 LEU B N   1 
ATOM   4125 C  CA  . LEU B 1 187 ? -9.694  4.244   7.200   1.00 28.54 ? 187 LEU B CA  1 
ATOM   4126 C  C   . LEU B 1 187 ? -8.655  3.316   6.600   1.00 29.88 ? 187 LEU B C   1 
ATOM   4127 O  O   . LEU B 1 187 ? -8.574  2.139   6.958   1.00 30.51 ? 187 LEU B O   1 
ATOM   4128 C  CB  . LEU B 1 187 ? -9.330  4.548   8.648   1.00 25.94 ? 187 LEU B CB  1 
ATOM   4129 C  CG  . LEU B 1 187 ? -10.288 5.438   9.422   1.00 25.17 ? 187 LEU B CG  1 
ATOM   4130 C  CD1 . LEU B 1 187 ? -9.686  5.733   10.798  1.00 21.40 ? 187 LEU B CD1 1 
ATOM   4131 C  CD2 . LEU B 1 187 ? -10.530 6.719   8.644   1.00 21.78 ? 187 LEU B CD2 1 
ATOM   4132 N  N   . SER B 1 188 ? -7.864  3.860   5.685   1.00 30.19 ? 188 SER B N   1 
ATOM   4133 C  CA  . SER B 1 188 ? -6.837  3.097   4.996   1.00 30.56 ? 188 SER B CA  1 
ATOM   4134 C  C   . SER B 1 188 ? -5.579  3.942   4.811   1.00 32.41 ? 188 SER B C   1 
ATOM   4135 O  O   . SER B 1 188 ? -5.602  4.962   4.122   1.00 30.81 ? 188 SER B O   1 
ATOM   4136 C  CB  . SER B 1 188 ? -7.365  2.652   3.631   1.00 28.14 ? 188 SER B CB  1 
ATOM   4137 O  OG  . SER B 1 188 ? -6.332  2.134   2.831   1.00 25.77 ? 188 SER B OG  1 
ATOM   4138 N  N   . PRO B 1 189 ? -4.466  3.533   5.440   1.00 33.75 ? 189 PRO B N   1 
ATOM   4139 C  CA  . PRO B 1 189 ? -3.208  4.273   5.324   1.00 35.14 ? 189 PRO B CA  1 
ATOM   4140 C  C   . PRO B 1 189 ? -2.661  4.173   3.909   1.00 35.26 ? 189 PRO B C   1 
ATOM   4141 O  O   . PRO B 1 189 ? -2.460  3.076   3.397   1.00 37.23 ? 189 PRO B O   1 
ATOM   4142 C  CB  . PRO B 1 189 ? -2.312  3.587   6.360   1.00 34.08 ? 189 PRO B CB  1 
ATOM   4143 C  CG  . PRO B 1 189 ? -2.807  2.186   6.349   1.00 33.63 ? 189 PRO B CG  1 
ATOM   4144 C  CD  . PRO B 1 189 ? -4.307  2.363   6.322   1.00 32.84 ? 189 PRO B CD  1 
ATOM   4145 N  N   . VAL B 1 190 ? -2.430  5.317   3.273   1.00 37.15 ? 190 VAL B N   1 
ATOM   4146 C  CA  . VAL B 1 190 ? -1.917  5.319   1.904   1.00 38.53 ? 190 VAL B CA  1 
ATOM   4147 C  C   . VAL B 1 190 ? -0.650  6.143   1.688   1.00 40.39 ? 190 VAL B C   1 
ATOM   4148 O  O   . VAL B 1 190 ? -0.344  7.062   2.447   1.00 38.24 ? 190 VAL B O   1 
ATOM   4149 C  CB  . VAL B 1 190 ? -2.979  5.838   0.892   1.00 38.18 ? 190 VAL B CB  1 
ATOM   4150 C  CG1 . VAL B 1 190 ? -4.234  4.970   0.953   1.00 39.74 ? 190 VAL B CG1 1 
ATOM   4151 C  CG2 . VAL B 1 190 ? -3.314  7.305   1.180   1.00 35.23 ? 190 VAL B CG2 1 
ATOM   4152 N  N   . GLY B 1 191 ? 0.086   5.774   0.644   1.00 43.65 ? 191 GLY B N   1 
ATOM   4153 C  CA  . GLY B 1 191 ? 1.289   6.484   0.258   1.00 47.85 ? 191 GLY B CA  1 
ATOM   4154 C  C   . GLY B 1 191 ? 0.876   7.133   -1.049  1.00 51.24 ? 191 GLY B C   1 
ATOM   4155 O  O   . GLY B 1 191 ? 0.250   8.195   -1.034  1.00 52.24 ? 191 GLY B O   1 
ATOM   4156 N  N   . PRO B 1 192 ? 1.207   6.520   -2.199  1.00 54.43 ? 192 PRO B N   1 
ATOM   4157 C  CA  . PRO B 1 192 ? 0.852   7.043   -3.529  1.00 56.76 ? 192 PRO B CA  1 
ATOM   4158 C  C   . PRO B 1 192 ? -0.336  6.274   -4.149  1.00 57.38 ? 192 PRO B C   1 
ATOM   4159 O  O   . PRO B 1 192 ? -0.549  5.101   -3.831  1.00 56.56 ? 192 PRO B O   1 
ATOM   4160 C  CB  . PRO B 1 192 ? 2.143   6.847   -4.316  1.00 57.16 ? 192 PRO B CB  1 
ATOM   4161 C  CG  . PRO B 1 192 ? 2.609   5.512   -3.801  1.00 55.81 ? 192 PRO B CG  1 
ATOM   4162 C  CD  . PRO B 1 192 ? 2.355   5.594   -2.294  1.00 55.28 ? 192 PRO B CD  1 
ATOM   4163 N  N   . TYR B 1 193 ? -1.105  6.920   -5.027  1.00 58.93 ? 193 TYR B N   1 
ATOM   4164 C  CA  . TYR B 1 193 ? -2.246  6.242   -5.654  1.00 60.06 ? 193 TYR B CA  1 
ATOM   4165 C  C   . TYR B 1 193 ? -1.811  5.170   -6.659  1.00 61.34 ? 193 TYR B C   1 
ATOM   4166 O  O   . TYR B 1 193 ? -2.336  4.051   -6.644  1.00 61.79 ? 193 TYR B O   1 
ATOM   4167 C  CB  . TYR B 1 193 ? -3.176  7.239   -6.366  1.00 59.74 ? 193 TYR B CB  1 
ATOM   4168 C  CG  . TYR B 1 193 ? -4.453  6.598   -6.904  1.00 59.82 ? 193 TYR B CG  1 
ATOM   4169 C  CD1 . TYR B 1 193 ? -5.471  6.193   -6.037  1.00 58.84 ? 193 TYR B CD1 1 
ATOM   4170 C  CD2 . TYR B 1 193 ? -4.621  6.352   -8.273  1.00 59.23 ? 193 TYR B CD2 1 
ATOM   4171 C  CE1 . TYR B 1 193 ? -6.628  5.556   -6.514  1.00 58.60 ? 193 TYR B CE1 1 
ATOM   4172 C  CE2 . TYR B 1 193 ? -5.777  5.711   -8.765  1.00 58.70 ? 193 TYR B CE2 1 
ATOM   4173 C  CZ  . TYR B 1 193 ? -6.782  5.312   -7.877  1.00 59.13 ? 193 TYR B CZ  1 
ATOM   4174 O  OH  . TYR B 1 193 ? -7.931  4.664   -8.336  1.00 54.10 ? 193 TYR B OH  1 
ATOM   4175 N  N   . PHE B 1 194 ? -0.859  5.504   -7.530  1.00 62.10 ? 194 PHE B N   1 
ATOM   4176 C  CA  . PHE B 1 194 ? -0.389  4.547   -8.535  1.00 62.85 ? 194 PHE B CA  1 
ATOM   4177 C  C   . PHE B 1 194 ? 0.710   3.611   -8.032  1.00 63.18 ? 194 PHE B C   1 
ATOM   4178 O  O   . PHE B 1 194 ? 1.228   3.850   -6.919  1.00 63.95 ? 194 PHE B O   1 
ATOM   4179 C  CB  . PHE B 1 194 ? 0.107   5.281   -9.787  1.00 62.16 ? 194 PHE B CB  1 
ATOM   4180 C  CG  . PHE B 1 194 ? -0.977  6.003   -10.539 1.00 61.47 ? 194 PHE B CG  1 
ATOM   4181 C  CD1 . PHE B 1 194 ? -1.380  7.281   -10.154 1.00 61.83 ? 194 PHE B CD1 1 
ATOM   4182 C  CD2 . PHE B 1 194 ? -1.606  5.397   -11.623 1.00 60.64 ? 194 PHE B CD2 1 
ATOM   4183 C  CE1 . PHE B 1 194 ? -2.399  7.950   -10.838 1.00 62.19 ? 194 PHE B CE1 1 
ATOM   4184 C  CE2 . PHE B 1 194 ? -2.627  6.051   -12.317 1.00 61.73 ? 194 PHE B CE2 1 
ATOM   4185 C  CZ  . PHE B 1 194 ? -3.025  7.334   -11.924 1.00 61.96 ? 194 PHE B CZ  1 
ATOM   4186 N  N   . PHE B 1 199 ? 8.499   12.354  -8.811  1.00 37.51 ? 199 PHE B N   1 
ATOM   4187 C  CA  . PHE B 1 199 ? 7.247   12.242  -9.626  1.00 38.13 ? 199 PHE B CA  1 
ATOM   4188 C  C   . PHE B 1 199 ? 7.263   11.065  -10.591 1.00 38.79 ? 199 PHE B C   1 
ATOM   4189 O  O   . PHE B 1 199 ? 8.259   10.802  -11.267 1.00 37.51 ? 199 PHE B O   1 
ATOM   4190 C  CB  . PHE B 1 199 ? 6.999   13.520  -10.435 1.00 35.56 ? 199 PHE B CB  1 
ATOM   4191 C  CG  . PHE B 1 199 ? 6.156   14.550  -9.724  1.00 35.73 ? 199 PHE B CG  1 
ATOM   4192 C  CD1 . PHE B 1 199 ? 5.013   14.169  -9.019  1.00 32.46 ? 199 PHE B CD1 1 
ATOM   4193 C  CD2 . PHE B 1 199 ? 6.466   15.909  -9.824  1.00 32.33 ? 199 PHE B CD2 1 
ATOM   4194 C  CE1 . PHE B 1 199 ? 4.193   15.121  -8.434  1.00 32.31 ? 199 PHE B CE1 1 
ATOM   4195 C  CE2 . PHE B 1 199 ? 5.652   16.873  -9.243  1.00 31.11 ? 199 PHE B CE2 1 
ATOM   4196 C  CZ  . PHE B 1 199 ? 4.514   16.484  -8.549  1.00 33.70 ? 199 PHE B CZ  1 
ATOM   4197 N  N   . ASN B 1 200 ? 6.139   10.368  -10.660 1.00 40.05 ? 200 ASN B N   1 
ATOM   4198 C  CA  . ASN B 1 200 ? 6.005   9.230   -11.550 1.00 40.21 ? 200 ASN B CA  1 
ATOM   4199 C  C   . ASN B 1 200 ? 4.985   9.607   -12.621 1.00 38.52 ? 200 ASN B C   1 
ATOM   4200 O  O   . ASN B 1 200 ? 3.781   9.417   -12.431 1.00 35.96 ? 200 ASN B O   1 
ATOM   4201 C  CB  . ASN B 1 200 ? 5.516   8.004   -10.764 1.00 44.36 ? 200 ASN B CB  1 
ATOM   4202 C  CG  . ASN B 1 200 ? 5.535   6.727   -11.590 1.00 48.29 ? 200 ASN B CG  1 
ATOM   4203 O  OD1 . ASN B 1 200 ? 5.067   5.674   -11.141 1.00 51.21 ? 200 ASN B OD1 1 
ATOM   4204 N  ND2 . ASN B 1 200 ? 6.082   6.811   -12.803 1.00 50.51 ? 200 ASN B ND2 1 
ATOM   4205 N  N   . PRO B 1 201 ? 5.453   10.158  -13.757 1.00 36.91 ? 201 PRO B N   1 
ATOM   4206 C  CA  . PRO B 1 201 ? 4.568   10.561  -14.857 1.00 36.72 ? 201 PRO B CA  1 
ATOM   4207 C  C   . PRO B 1 201 ? 3.799   9.376   -15.428 1.00 36.24 ? 201 PRO B C   1 
ATOM   4208 O  O   . PRO B 1 201 ? 4.255   8.235   -15.338 1.00 37.52 ? 201 PRO B O   1 
ATOM   4209 C  CB  . PRO B 1 201 ? 5.529   11.173  -15.873 1.00 35.91 ? 201 PRO B CB  1 
ATOM   4210 C  CG  . PRO B 1 201 ? 6.803   10.413  -15.631 1.00 37.36 ? 201 PRO B CG  1 
ATOM   4211 C  CD  . PRO B 1 201 ? 6.865   10.371  -14.119 1.00 37.83 ? 201 PRO B CD  1 
ATOM   4212 N  N   . VAL B 1 202 ? 2.635   9.652   -16.013 1.00 34.65 ? 202 VAL B N   1 
ATOM   4213 C  CA  . VAL B 1 202 ? 1.810   8.601   -16.580 1.00 33.17 ? 202 VAL B CA  1 
ATOM   4214 C  C   . VAL B 1 202 ? 1.419   8.902   -18.015 1.00 33.28 ? 202 VAL B C   1 
ATOM   4215 O  O   . VAL B 1 202 ? 1.408   10.058  -18.439 1.00 34.54 ? 202 VAL B O   1 
ATOM   4216 C  CB  . VAL B 1 202 ? 0.505   8.401   -15.766 1.00 32.64 ? 202 VAL B CB  1 
ATOM   4217 C  CG1 . VAL B 1 202 ? 0.815   8.374   -14.270 1.00 32.57 ? 202 VAL B CG1 1 
ATOM   4218 C  CG2 . VAL B 1 202 ? -0.489  9.496   -16.095 1.00 31.72 ? 202 VAL B CG2 1 
ATOM   4219 N  N   . SER B 1 203 ? 1.108   7.848   -18.760 1.00 32.98 ? 203 SER B N   1 
ATOM   4220 C  CA  . SER B 1 203 ? 0.678   7.985   -20.141 1.00 34.60 ? 203 SER B CA  1 
ATOM   4221 C  C   . SER B 1 203 ? -0.826  7.745   -20.117 1.00 33.15 ? 203 SER B C   1 
ATOM   4222 O  O   . SER B 1 203 ? -1.316  6.928   -19.335 1.00 33.12 ? 203 SER B O   1 
ATOM   4223 C  CB  . SER B 1 203 ? 1.385   6.959   -21.028 1.00 35.55 ? 203 SER B CB  1 
ATOM   4224 O  OG  . SER B 1 203 ? 1.277   5.661   -20.475 1.00 39.57 ? 203 SER B OG  1 
ATOM   4225 N  N   . LEU B 1 204 ? -1.555  8.470   -20.957 1.00 32.28 ? 204 LEU B N   1 
ATOM   4226 C  CA  . LEU B 1 204 ? -3.012  8.368   -21.005 1.00 31.19 ? 204 LEU B CA  1 
ATOM   4227 C  C   . LEU B 1 204 ? -3.486  7.772   -22.320 1.00 32.57 ? 204 LEU B C   1 
ATOM   4228 O  O   . LEU B 1 204 ? -2.872  8.000   -23.367 1.00 31.38 ? 204 LEU B O   1 
ATOM   4229 C  CB  . LEU B 1 204 ? -3.624  9.763   -20.844 1.00 30.40 ? 204 LEU B CB  1 
ATOM   4230 C  CG  . LEU B 1 204 ? -3.101  10.604  -19.674 1.00 29.44 ? 204 LEU B CG  1 
ATOM   4231 C  CD1 . LEU B 1 204 ? -3.784  11.974  -19.670 1.00 29.32 ? 204 LEU B CD1 1 
ATOM   4232 C  CD2 . LEU B 1 204 ? -3.376  9.873   -18.356 1.00 28.71 ? 204 LEU B CD2 1 
ATOM   4233 N  N   . TRP B 1 205 ? -4.581  7.015   -22.263 1.00 33.73 ? 205 TRP B N   1 
ATOM   4234 C  CA  . TRP B 1 205 ? -5.148  6.408   -23.457 1.00 33.73 ? 205 TRP B CA  1 
ATOM   4235 C  C   . TRP B 1 205 ? -6.418  7.158   -23.850 1.00 34.01 ? 205 TRP B C   1 
ATOM   4236 O  O   . TRP B 1 205 ? -7.420  7.099   -23.142 1.00 33.74 ? 205 TRP B O   1 
ATOM   4237 C  CB  . TRP B 1 205 ? -5.474  4.940   -23.209 1.00 37.83 ? 205 TRP B CB  1 
ATOM   4238 C  CG  . TRP B 1 205 ? -5.393  4.122   -24.460 1.00 41.98 ? 205 TRP B CG  1 
ATOM   4239 C  CD1 . TRP B 1 205 ? -4.256  3.739   -25.123 1.00 44.68 ? 205 TRP B CD1 1 
ATOM   4240 C  CD2 . TRP B 1 205 ? -6.486  3.647   -25.238 1.00 42.96 ? 205 TRP B CD2 1 
ATOM   4241 N  NE1 . TRP B 1 205 ? -4.579  3.057   -26.270 1.00 45.36 ? 205 TRP B NE1 1 
ATOM   4242 C  CE2 . TRP B 1 205 ? -5.943  2.987   -26.367 1.00 44.75 ? 205 TRP B CE2 1 
ATOM   4243 C  CE3 . TRP B 1 205 ? -7.872  3.716   -25.098 1.00 43.15 ? 205 TRP B CE3 1 
ATOM   4244 C  CZ2 . TRP B 1 205 ? -6.741  2.404   -27.345 1.00 45.00 ? 205 TRP B CZ2 1 
ATOM   4245 C  CZ3 . TRP B 1 205 ? -8.661  3.139   -26.066 1.00 45.28 ? 205 TRP B CZ3 1 
ATOM   4246 C  CH2 . TRP B 1 205 ? -8.096  2.489   -27.180 1.00 46.67 ? 205 TRP B CH2 1 
ATOM   4247 N  N   . ALA B 1 206 ? -6.366  7.860   -24.981 1.00 34.32 ? 206 ALA B N   1 
ATOM   4248 C  CA  . ALA B 1 206 ? -7.495  8.647   -25.475 1.00 34.86 ? 206 ALA B CA  1 
ATOM   4249 C  C   . ALA B 1 206 ? -8.265  7.998   -26.633 1.00 35.34 ? 206 ALA B C   1 
ATOM   4250 O  O   . ALA B 1 206 ? -7.758  7.873   -27.756 1.00 35.82 ? 206 ALA B O   1 
ATOM   4251 C  CB  . ALA B 1 206 ? -7.007  10.031  -25.891 1.00 34.76 ? 206 ALA B CB  1 
ATOM   4252 N  N   . ASN B 1 207 ? -9.501  7.606   -26.349 1.00 35.19 ? 207 ASN B N   1 
ATOM   4253 C  CA  . ASN B 1 207 ? -10.373 6.972   -27.331 1.00 34.24 ? 207 ASN B CA  1 
ATOM   4254 C  C   . ASN B 1 207 ? -11.769 7.550   -27.160 1.00 32.80 ? 207 ASN B C   1 
ATOM   4255 O  O   . ASN B 1 207 ? -12.458 7.246   -26.192 1.00 32.69 ? 207 ASN B O   1 
ATOM   4256 C  CB  . ASN B 1 207 ? -10.421 5.457   -27.097 1.00 33.39 ? 207 ASN B CB  1 
ATOM   4257 C  CG  . ASN B 1 207 ? -11.330 4.735   -28.085 1.00 32.66 ? 207 ASN B CG  1 
ATOM   4258 O  OD1 . ASN B 1 207 ? -11.997 5.364   -28.910 1.00 31.31 ? 207 ASN B OD1 1 
ATOM   4259 N  ND2 . ASN B 1 207 ? -11.365 3.407   -27.997 1.00 28.53 ? 207 ASN B ND2 1 
ATOM   4260 N  N   . PRO B 1 208 ? -12.212 8.376   -28.114 1.00 34.08 ? 208 PRO B N   1 
ATOM   4261 C  CA  . PRO B 1 208 ? -13.540 8.999   -28.056 1.00 32.40 ? 208 PRO B CA  1 
ATOM   4262 C  C   . PRO B 1 208 ? -14.720 8.023   -28.069 1.00 31.58 ? 208 PRO B C   1 
ATOM   4263 O  O   . PRO B 1 208 ? -15.869 8.445   -27.963 1.00 33.33 ? 208 PRO B O   1 
ATOM   4264 C  CB  . PRO B 1 208 ? -13.541 9.916   -29.277 1.00 32.56 ? 208 PRO B CB  1 
ATOM   4265 C  CG  . PRO B 1 208 ? -12.701 9.137   -30.272 1.00 33.03 ? 208 PRO B CG  1 
ATOM   4266 C  CD  . PRO B 1 208 ? -11.544 8.663   -29.400 1.00 33.15 ? 208 PRO B CD  1 
ATOM   4267 N  N   . LYS B 1 209 ? -14.444 6.728   -28.199 1.00 29.60 ? 209 LYS B N   1 
ATOM   4268 C  CA  . LYS B 1 209 ? -15.518 5.736   -28.228 1.00 29.93 ? 209 LYS B CA  1 
ATOM   4269 C  C   . LYS B 1 209 ? -16.181 5.547   -26.869 1.00 30.22 ? 209 LYS B C   1 
ATOM   4270 O  O   . LYS B 1 209 ? -17.276 5.002   -26.789 1.00 31.76 ? 209 LYS B O   1 
ATOM   4271 C  CB  . LYS B 1 209 ? -15.000 4.382   -28.725 1.00 32.32 ? 209 LYS B CB  1 
ATOM   4272 C  CG  . LYS B 1 209 ? -16.073 3.309   -28.813 1.00 32.62 ? 209 LYS B CG  1 
ATOM   4273 C  CD  . LYS B 1 209 ? -15.502 1.938   -29.143 1.00 34.48 ? 209 LYS B CD  1 
ATOM   4274 C  CE  . LYS B 1 209 ? -16.587 0.869   -29.035 1.00 35.11 ? 209 LYS B CE  1 
ATOM   4275 N  NZ  . LYS B 1 209 ? -16.100 -0.501  -29.393 1.00 36.39 ? 209 LYS B NZ  1 
ATOM   4276 N  N   . TYR B 1 210 ? -15.522 5.983   -25.800 1.00 29.77 ? 210 TYR B N   1 
ATOM   4277 C  CA  . TYR B 1 210 ? -16.089 5.853   -24.463 1.00 29.50 ? 210 TYR B CA  1 
ATOM   4278 C  C   . TYR B 1 210 ? -16.299 7.228   -23.819 1.00 29.88 ? 210 TYR B C   1 
ATOM   4279 O  O   . TYR B 1 210 ? -15.463 8.122   -23.942 1.00 27.66 ? 210 TYR B O   1 
ATOM   4280 C  CB  . TYR B 1 210 ? -15.191 4.984   -23.567 1.00 30.99 ? 210 TYR B CB  1 
ATOM   4281 C  CG  . TYR B 1 210 ? -14.983 3.572   -24.075 1.00 34.20 ? 210 TYR B CG  1 
ATOM   4282 C  CD1 . TYR B 1 210 ? -13.750 3.173   -24.604 1.00 34.79 ? 210 TYR B CD1 1 
ATOM   4283 C  CD2 . TYR B 1 210 ? -16.037 2.649   -24.088 1.00 35.79 ? 210 TYR B CD2 1 
ATOM   4284 C  CE1 . TYR B 1 210 ? -13.575 1.885   -25.145 1.00 38.18 ? 210 TYR B CE1 1 
ATOM   4285 C  CE2 . TYR B 1 210 ? -15.875 1.363   -24.627 1.00 36.77 ? 210 TYR B CE2 1 
ATOM   4286 C  CZ  . TYR B 1 210 ? -14.643 0.988   -25.158 1.00 37.41 ? 210 TYR B CZ  1 
ATOM   4287 O  OH  . TYR B 1 210 ? -14.488 -0.257  -25.733 1.00 35.31 ? 210 TYR B OH  1 
ATOM   4288 N  N   . VAL B 1 211 ? -17.434 7.390   -23.143 1.00 30.28 ? 211 VAL B N   1 
ATOM   4289 C  CA  . VAL B 1 211 ? -17.762 8.642   -22.481 1.00 31.27 ? 211 VAL B CA  1 
ATOM   4290 C  C   . VAL B 1 211 ? -17.975 8.357   -21.000 1.00 31.64 ? 211 VAL B C   1 
ATOM   4291 O  O   . VAL B 1 211 ? -18.699 7.429   -20.640 1.00 31.16 ? 211 VAL B O   1 
ATOM   4292 C  CB  . VAL B 1 211 ? -19.040 9.264   -23.088 1.00 31.05 ? 211 VAL B CB  1 
ATOM   4293 C  CG1 . VAL B 1 211 ? -19.441 10.517  -22.317 1.00 29.62 ? 211 VAL B CG1 1 
ATOM   4294 C  CG2 . VAL B 1 211 ? -18.794 9.598   -24.546 1.00 29.55 ? 211 VAL B CG2 1 
ATOM   4295 N  N   . ARG B 1 212 ? -17.332 9.148   -20.149 1.00 30.50 ? 212 ARG B N   1 
ATOM   4296 C  CA  . ARG B 1 212 ? -17.439 8.964   -18.705 1.00 29.27 ? 212 ARG B CA  1 
ATOM   4297 C  C   . ARG B 1 212 ? -18.726 9.554   -18.137 1.00 28.74 ? 212 ARG B C   1 
ATOM   4298 O  O   . ARG B 1 212 ? -19.413 8.913   -17.347 1.00 30.05 ? 212 ARG B O   1 
ATOM   4299 C  CB  . ARG B 1 212 ? -16.246 9.620   -17.993 1.00 29.15 ? 212 ARG B CB  1 
ATOM   4300 C  CG  . ARG B 1 212 ? -16.129 9.265   -16.505 1.00 27.93 ? 212 ARG B CG  1 
ATOM   4301 C  CD  . ARG B 1 212 ? -15.063 10.100  -15.804 1.00 26.32 ? 212 ARG B CD  1 
ATOM   4302 N  NE  . ARG B 1 212 ? -15.519 11.460  -15.519 1.00 27.03 ? 212 ARG B NE  1 
ATOM   4303 C  CZ  . ARG B 1 212 ? -16.250 11.798  -14.460 1.00 27.51 ? 212 ARG B CZ  1 
ATOM   4304 N  NH1 . ARG B 1 212 ? -16.610 10.878  -13.581 1.00 30.59 ? 212 ARG B NH1 1 
ATOM   4305 N  NH2 . ARG B 1 212 ? -16.611 13.060  -14.270 1.00 27.00 ? 212 ARG B NH2 1 
ATOM   4306 N  N   . ALA B 1 213 ? -19.037 10.783  -18.533 1.00 26.41 ? 213 ALA B N   1 
ATOM   4307 C  CA  . ALA B 1 213 ? -20.219 11.474  -18.034 1.00 25.35 ? 213 ALA B CA  1 
ATOM   4308 C  C   . ALA B 1 213 ? -20.765 12.403  -19.111 1.00 24.29 ? 213 ALA B C   1 
ATOM   4309 O  O   . ALA B 1 213 ? -20.024 12.835  -19.993 1.00 23.35 ? 213 ALA B O   1 
ATOM   4310 C  CB  . ALA B 1 213 ? -19.859 12.259  -16.783 1.00 25.02 ? 213 ALA B CB  1 
ATOM   4311 N  N   . TRP B 1 214 ? -22.054 12.721  -19.027 1.00 21.67 ? 214 TRP B N   1 
ATOM   4312 C  CA  . TRP B 1 214 ? -22.690 13.563  -20.033 1.00 25.07 ? 214 TRP B CA  1 
ATOM   4313 C  C   . TRP B 1 214 ? -23.637 14.604  -19.441 1.00 25.23 ? 214 TRP B C   1 
ATOM   4314 O  O   . TRP B 1 214 ? -24.119 14.452  -18.319 1.00 26.17 ? 214 TRP B O   1 
ATOM   4315 C  CB  . TRP B 1 214 ? -23.447 12.661  -21.012 1.00 28.44 ? 214 TRP B CB  1 
ATOM   4316 C  CG  . TRP B 1 214 ? -24.387 11.722  -20.312 1.00 31.83 ? 214 TRP B CG  1 
ATOM   4317 C  CD1 . TRP B 1 214 ? -25.679 11.976  -19.954 1.00 33.38 ? 214 TRP B CD1 1 
ATOM   4318 C  CD2 . TRP B 1 214 ? -24.069 10.428  -19.770 1.00 32.21 ? 214 TRP B CD2 1 
ATOM   4319 N  NE1 . TRP B 1 214 ? -26.184 10.928  -19.218 1.00 33.22 ? 214 TRP B NE1 1 
ATOM   4320 C  CE2 . TRP B 1 214 ? -25.217 9.966   -19.088 1.00 33.30 ? 214 TRP B CE2 1 
ATOM   4321 C  CE3 . TRP B 1 214 ? -22.923 9.617   -19.790 1.00 34.02 ? 214 TRP B CE3 1 
ATOM   4322 C  CZ2 . TRP B 1 214 ? -25.254 8.728   -18.426 1.00 32.04 ? 214 TRP B CZ2 1 
ATOM   4323 C  CZ3 . TRP B 1 214 ? -22.959 8.386   -19.133 1.00 32.44 ? 214 TRP B CZ3 1 
ATOM   4324 C  CH2 . TRP B 1 214 ? -24.120 7.957   -18.459 1.00 32.57 ? 214 TRP B CH2 1 
ATOM   4325 N  N   . LYS B 1 215 ? -23.895 15.664  -20.200 1.00 26.13 ? 215 LYS B N   1 
ATOM   4326 C  CA  . LYS B 1 215 ? -24.795 16.725  -19.756 1.00 27.91 ? 215 LYS B CA  1 
ATOM   4327 C  C   . LYS B 1 215 ? -26.130 16.090  -19.412 1.00 26.30 ? 215 LYS B C   1 
ATOM   4328 O  O   . LYS B 1 215 ? -26.655 15.280  -20.172 1.00 26.76 ? 215 LYS B O   1 
ATOM   4329 C  CB  . LYS B 1 215 ? -24.996 17.757  -20.866 1.00 30.82 ? 215 LYS B CB  1 
ATOM   4330 C  CG  . LYS B 1 215 ? -23.728 18.469  -21.312 1.00 36.46 ? 215 LYS B CG  1 
ATOM   4331 C  CD  . LYS B 1 215 ? -23.559 19.810  -20.598 1.00 40.47 ? 215 LYS B CD  1 
ATOM   4332 C  CE  . LYS B 1 215 ? -22.489 20.671  -21.273 1.00 39.96 ? 215 LYS B CE  1 
ATOM   4333 N  NZ  . LYS B 1 215 ? -22.472 22.062  -20.746 1.00 41.42 ? 215 LYS B NZ  1 
ATOM   4334 N  N   . GLY B 1 216 ? -26.683 16.467  -18.267 1.00 27.08 ? 216 GLY B N   1 
ATOM   4335 C  CA  . GLY B 1 216 ? -27.942 15.895  -17.839 1.00 24.51 ? 216 GLY B CA  1 
ATOM   4336 C  C   . GLY B 1 216 ? -27.621 14.649  -17.036 1.00 26.11 ? 216 GLY B C   1 
ATOM   4337 O  O   . GLY B 1 216 ? -28.517 13.926  -16.584 1.00 26.14 ? 216 GLY B O   1 
ATOM   4338 N  N   . GLY B 1 217 ? -26.324 14.406  -16.863 1.00 24.92 ? 217 GLY B N   1 
ATOM   4339 C  CA  . GLY B 1 217 ? -25.866 13.249  -16.119 1.00 27.28 ? 217 GLY B CA  1 
ATOM   4340 C  C   . GLY B 1 217 ? -25.547 13.562  -14.672 1.00 27.48 ? 217 GLY B C   1 
ATOM   4341 O  O   . GLY B 1 217 ? -25.843 14.646  -14.172 1.00 26.32 ? 217 GLY B O   1 
ATOM   4342 N  N   . THR B 1 218 ? -24.918 12.606  -14.004 1.00 29.02 ? 218 THR B N   1 
ATOM   4343 C  CA  . THR B 1 218 ? -24.563 12.743  -12.598 1.00 30.24 ? 218 THR B CA  1 
ATOM   4344 C  C   . THR B 1 218 ? -23.042 12.773  -12.424 1.00 29.68 ? 218 THR B C   1 
ATOM   4345 O  O   . THR B 1 218 ? -22.518 12.525  -11.338 1.00 30.99 ? 218 THR B O   1 
ATOM   4346 C  CB  . THR B 1 218 ? -25.169 11.565  -11.797 1.00 32.10 ? 218 THR B CB  1 
ATOM   4347 O  OG1 . THR B 1 218 ? -24.771 11.655  -10.427 1.00 40.76 ? 218 THR B OG1 1 
ATOM   4348 C  CG2 . THR B 1 218 ? -24.697 10.236  -12.365 1.00 29.53 ? 218 THR B CG2 1 
ATOM   4349 N  N   . GLY B 1 219 ? -22.341 13.101  -13.503 1.00 30.16 ? 219 GLY B N   1 
ATOM   4350 C  CA  . GLY B 1 219 ? -20.892 13.140  -13.478 1.00 27.52 ? 219 GLY B CA  1 
ATOM   4351 C  C   . GLY B 1 219 ? -20.258 14.113  -12.511 1.00 27.55 ? 219 GLY B C   1 
ATOM   4352 O  O   . GLY B 1 219 ? -19.065 14.012  -12.229 1.00 27.94 ? 219 GLY B O   1 
ATOM   4353 N  N   . ASP B 1 220 ? -21.024 15.070  -12.008 1.00 27.51 ? 220 ASP B N   1 
ATOM   4354 C  CA  . ASP B 1 220 ? -20.465 16.022  -11.056 1.00 26.49 ? 220 ASP B CA  1 
ATOM   4355 C  C   . ASP B 1 220 ? -20.677 15.552  -9.618  1.00 26.60 ? 220 ASP B C   1 
ATOM   4356 O  O   . ASP B 1 220 ? -20.597 16.348  -8.680  1.00 25.75 ? 220 ASP B O   1 
ATOM   4357 C  CB  . ASP B 1 220 ? -21.074 17.412  -11.261 1.00 29.13 ? 220 ASP B CB  1 
ATOM   4358 C  CG  . ASP B 1 220 ? -22.591 17.390  -11.300 1.00 30.66 ? 220 ASP B CG  1 
ATOM   4359 O  OD1 . ASP B 1 220 ? -23.176 16.293  -11.219 1.00 32.76 ? 220 ASP B OD1 1 
ATOM   4360 O  OD2 . ASP B 1 220 ? -23.200 18.472  -11.422 1.00 33.28 ? 220 ASP B OD2 1 
ATOM   4361 N  N   . CYS B 1 221 ? -20.926 14.251  -9.456  1.00 25.22 ? 221 CYS B N   1 
ATOM   4362 C  CA  . CYS B 1 221 ? -21.146 13.645  -8.140  1.00 26.35 ? 221 CYS B CA  1 
ATOM   4363 C  C   . CYS B 1 221 ? -20.363 12.346  -7.999  1.00 26.35 ? 221 CYS B C   1 
ATOM   4364 O  O   . CYS B 1 221 ? -20.129 11.642  -8.983  1.00 29.07 ? 221 CYS B O   1 
ATOM   4365 C  CB  . CYS B 1 221 ? -22.630 13.333  -7.932  1.00 26.90 ? 221 CYS B CB  1 
ATOM   4366 S  SG  . CYS B 1 221 ? -23.709 14.760  -7.953  1.00 37.13 ? 221 CYS B SG  1 
ATOM   4367 N  N   . LYS B 1 222 ? -19.977 12.020  -6.772  1.00 25.28 ? 222 LYS B N   1 
ATOM   4368 C  CA  . LYS B 1 222 ? -19.226 10.802  -6.511  1.00 26.95 ? 222 LYS B CA  1 
ATOM   4369 C  C   . LYS B 1 222 ? -20.143 9.603   -6.284  1.00 26.68 ? 222 LYS B C   1 
ATOM   4370 O  O   . LYS B 1 222 ? -20.007 8.873   -5.304  1.00 25.55 ? 222 LYS B O   1 
ATOM   4371 C  CB  . LYS B 1 222 ? -18.305 11.005  -5.302  1.00 28.73 ? 222 LYS B CB  1 
ATOM   4372 C  CG  . LYS B 1 222 ? -16.838 11.157  -5.677  1.00 30.68 ? 222 LYS B CG  1 
ATOM   4373 C  CD  . LYS B 1 222 ? -16.025 11.760  -4.545  1.00 28.84 ? 222 LYS B CD  1 
ATOM   4374 C  CE  . LYS B 1 222 ? -14.540 11.528  -4.772  1.00 28.86 ? 222 LYS B CE  1 
ATOM   4375 N  NZ  . LYS B 1 222 ? -14.220 11.967  -6.123  1.00 30.66 ? 222 LYS B NZ  1 
ATOM   4376 N  N   . MET B 1 223 ? -21.083 9.407   -7.199  1.00 27.22 ? 223 MET B N   1 
ATOM   4377 C  CA  . MET B 1 223 ? -22.009 8.290   -7.099  1.00 27.56 ? 223 MET B CA  1 
ATOM   4378 C  C   . MET B 1 223 ? -21.417 7.089   -7.822  1.00 27.37 ? 223 MET B C   1 
ATOM   4379 O  O   . MET B 1 223 ? -20.938 7.206   -8.949  1.00 26.30 ? 223 MET B O   1 
ATOM   4380 C  CB  . MET B 1 223 ? -23.354 8.670   -7.706  1.00 29.45 ? 223 MET B CB  1 
ATOM   4381 C  CG  . MET B 1 223 ? -24.087 9.781   -6.954  1.00 31.34 ? 223 MET B CG  1 
ATOM   4382 S  SD  . MET B 1 223 ? -25.466 10.384  -7.948  1.00 34.70 ? 223 MET B SD  1 
ATOM   4383 C  CE  . MET B 1 223 ? -25.567 12.067  -7.431  1.00 39.24 ? 223 MET B CE  1 
ATOM   4384 N  N   . GLY B 1 224 ? -21.466 5.939   -7.156  1.00 28.96 ? 224 GLY B N   1 
ATOM   4385 C  CA  . GLY B 1 224 ? -20.913 4.703   -7.684  1.00 29.97 ? 224 GLY B CA  1 
ATOM   4386 C  C   . GLY B 1 224 ? -21.136 4.420   -9.150  1.00 31.25 ? 224 GLY B C   1 
ATOM   4387 O  O   . GLY B 1 224 ? -20.236 3.930   -9.837  1.00 32.40 ? 224 GLY B O   1 
ATOM   4388 N  N   . GLY B 1 225 ? -22.334 4.728   -9.632  1.00 32.68 ? 225 GLY B N   1 
ATOM   4389 C  CA  . GLY B 1 225 ? -22.660 4.482   -11.026 1.00 33.38 ? 225 GLY B CA  1 
ATOM   4390 C  C   . GLY B 1 225 ? -21.771 5.164   -12.051 1.00 34.84 ? 225 GLY B C   1 
ATOM   4391 O  O   . GLY B 1 225 ? -21.799 4.797   -13.227 1.00 35.51 ? 225 GLY B O   1 
ATOM   4392 N  N   . ASN B 1 226 ? -20.987 6.154   -11.631 1.00 35.30 ? 226 ASN B N   1 
ATOM   4393 C  CA  . ASN B 1 226 ? -20.109 6.850   -12.567 1.00 35.86 ? 226 ASN B CA  1 
ATOM   4394 C  C   . ASN B 1 226 ? -18.760 6.157   -12.754 1.00 35.95 ? 226 ASN B C   1 
ATOM   4395 O  O   . ASN B 1 226 ? -18.016 6.498   -13.669 1.00 37.20 ? 226 ASN B O   1 
ATOM   4396 C  CB  . ASN B 1 226 ? -19.842 8.290   -12.109 1.00 37.61 ? 226 ASN B CB  1 
ATOM   4397 C  CG  . ASN B 1 226 ? -21.107 9.114   -11.970 1.00 37.64 ? 226 ASN B CG  1 
ATOM   4398 O  OD1 . ASN B 1 226 ? -22.029 9.006   -12.777 1.00 40.34 ? 226 ASN B OD1 1 
ATOM   4399 N  ND2 . ASN B 1 226 ? -21.146 9.962   -10.948 1.00 36.49 ? 226 ASN B ND2 1 
ATOM   4400 N  N   . TYR B 1 227 ? -18.442 5.182   -11.906 1.00 32.84 ? 227 TYR B N   1 
ATOM   4401 C  CA  . TYR B 1 227 ? -17.148 4.515   -12.006 1.00 31.06 ? 227 TYR B CA  1 
ATOM   4402 C  C   . TYR B 1 227 ? -17.173 3.108   -12.588 1.00 30.57 ? 227 TYR B C   1 
ATOM   4403 O  O   . TYR B 1 227 ? -16.243 2.705   -13.284 1.00 29.10 ? 227 TYR B O   1 
ATOM   4404 C  CB  . TYR B 1 227 ? -16.474 4.522   -10.630 1.00 29.03 ? 227 TYR B CB  1 
ATOM   4405 C  CG  . TYR B 1 227 ? -16.466 5.916   -10.044 1.00 28.91 ? 227 TYR B CG  1 
ATOM   4406 C  CD1 . TYR B 1 227 ? -17.647 6.493   -9.563  1.00 27.82 ? 227 TYR B CD1 1 
ATOM   4407 C  CD2 . TYR B 1 227 ? -15.317 6.708   -10.087 1.00 26.67 ? 227 TYR B CD2 1 
ATOM   4408 C  CE1 . TYR B 1 227 ? -17.687 7.816   -9.153  1.00 26.52 ? 227 TYR B CE1 1 
ATOM   4409 C  CE2 . TYR B 1 227 ? -15.349 8.038   -9.680  1.00 25.60 ? 227 TYR B CE2 1 
ATOM   4410 C  CZ  . TYR B 1 227 ? -16.539 8.585   -9.220  1.00 26.26 ? 227 TYR B CZ  1 
ATOM   4411 O  OH  . TYR B 1 227 ? -16.599 9.908   -8.862  1.00 28.12 ? 227 TYR B OH  1 
ATOM   4412 N  N   . GLY B 1 228 ? -18.241 2.369   -12.316 1.00 30.45 ? 228 GLY B N   1 
ATOM   4413 C  CA  . GLY B 1 228 ? -18.340 1.018   -12.834 1.00 30.43 ? 228 GLY B CA  1 
ATOM   4414 C  C   . GLY B 1 228 ? -18.353 0.979   -14.349 1.00 30.33 ? 228 GLY B C   1 
ATOM   4415 O  O   . GLY B 1 228 ? -17.858 0.040   -14.969 1.00 28.85 ? 228 GLY B O   1 
ATOM   4416 N  N   . SER B 1 229 ? -18.916 2.014   -14.950 1.00 31.51 ? 229 SER B N   1 
ATOM   4417 C  CA  . SER B 1 229 ? -18.998 2.081   -16.396 1.00 32.40 ? 229 SER B CA  1 
ATOM   4418 C  C   . SER B 1 229 ? -17.673 2.449   -17.045 1.00 33.05 ? 229 SER B C   1 
ATOM   4419 O  O   . SER B 1 229 ? -17.526 2.340   -18.261 1.00 33.85 ? 229 SER B O   1 
ATOM   4420 C  CB  . SER B 1 229 ? -20.075 3.081   -16.797 1.00 31.57 ? 229 SER B CB  1 
ATOM   4421 O  OG  . SER B 1 229 ? -21.311 2.709   -16.207 1.00 34.05 ? 229 SER B OG  1 
ATOM   4422 N  N   . SER B 1 230 ? -16.696 2.856   -16.240 1.00 31.92 ? 230 SER B N   1 
ATOM   4423 C  CA  . SER B 1 230 ? -15.409 3.247   -16.803 1.00 31.52 ? 230 SER B CA  1 
ATOM   4424 C  C   . SER B 1 230 ? -14.344 2.144   -16.826 1.00 29.26 ? 230 SER B C   1 
ATOM   4425 O  O   . SER B 1 230 ? -13.368 2.245   -17.568 1.00 29.65 ? 230 SER B O   1 
ATOM   4426 C  CB  . SER B 1 230 ? -14.864 4.480   -16.064 1.00 32.39 ? 230 SER B CB  1 
ATOM   4427 O  OG  . SER B 1 230 ? -14.395 4.142   -14.767 1.00 38.05 ? 230 SER B OG  1 
ATOM   4428 N  N   . LEU B 1 231 ? -14.538 1.092   -16.034 1.00 28.87 ? 231 LEU B N   1 
ATOM   4429 C  CA  . LEU B 1 231 ? -13.575 -0.011  -15.957 1.00 27.94 ? 231 LEU B CA  1 
ATOM   4430 C  C   . LEU B 1 231 ? -13.154 -0.627  -17.291 1.00 26.96 ? 231 LEU B C   1 
ATOM   4431 O  O   . LEU B 1 231 ? -11.983 -0.960  -17.483 1.00 27.10 ? 231 LEU B O   1 
ATOM   4432 C  CB  . LEU B 1 231 ? -14.105 -1.115  -15.031 1.00 27.96 ? 231 LEU B CB  1 
ATOM   4433 C  CG  . LEU B 1 231 ? -14.205 -0.768  -13.538 1.00 28.54 ? 231 LEU B CG  1 
ATOM   4434 C  CD1 . LEU B 1 231 ? -14.665 -1.988  -12.732 1.00 26.11 ? 231 LEU B CD1 1 
ATOM   4435 C  CD2 . LEU B 1 231 ? -12.848 -0.296  -13.052 1.00 26.41 ? 231 LEU B CD2 1 
ATOM   4436 N  N   . PHE B 1 232 ? -14.095 -0.780  -18.214 1.00 26.19 ? 232 PHE B N   1 
ATOM   4437 C  CA  . PHE B 1 232 ? -13.773 -1.365  -19.506 1.00 26.19 ? 232 PHE B CA  1 
ATOM   4438 C  C   . PHE B 1 232 ? -12.746 -0.530  -20.269 1.00 27.23 ? 232 PHE B C   1 
ATOM   4439 O  O   . PHE B 1 232 ? -11.856 -1.075  -20.932 1.00 27.30 ? 232 PHE B O   1 
ATOM   4440 C  CB  . PHE B 1 232 ? -15.030 -1.512  -20.362 1.00 26.50 ? 232 PHE B CB  1 
ATOM   4441 C  CG  . PHE B 1 232 ? -14.851 -2.441  -21.534 1.00 28.94 ? 232 PHE B CG  1 
ATOM   4442 C  CD1 . PHE B 1 232 ? -15.103 -3.805  -21.400 1.00 26.91 ? 232 PHE B CD1 1 
ATOM   4443 C  CD2 . PHE B 1 232 ? -14.385 -1.957  -22.759 1.00 28.62 ? 232 PHE B CD2 1 
ATOM   4444 C  CE1 . PHE B 1 232 ? -14.894 -4.681  -22.466 1.00 28.76 ? 232 PHE B CE1 1 
ATOM   4445 C  CE2 . PHE B 1 232 ? -14.171 -2.822  -23.838 1.00 29.00 ? 232 PHE B CE2 1 
ATOM   4446 C  CZ  . PHE B 1 232 ? -14.425 -4.187  -23.693 1.00 29.49 ? 232 PHE B CZ  1 
ATOM   4447 N  N   . ALA B 1 233 ? -12.871 0.789   -20.181 1.00 26.75 ? 233 ALA B N   1 
ATOM   4448 C  CA  . ALA B 1 233 ? -11.952 1.679   -20.878 1.00 27.98 ? 233 ALA B CA  1 
ATOM   4449 C  C   . ALA B 1 233 ? -10.629 1.683   -20.131 1.00 28.77 ? 233 ALA B C   1 
ATOM   4450 O  O   . ALA B 1 233 ? -9.556  1.773   -20.729 1.00 29.25 ? 233 ALA B O   1 
ATOM   4451 C  CB  . ALA B 1 233 ? -12.535 3.096   -20.954 1.00 27.32 ? 233 ALA B CB  1 
ATOM   4452 N  N   . GLN B 1 234 ? -10.711 1.581   -18.813 1.00 31.02 ? 234 GLN B N   1 
ATOM   4453 C  CA  . GLN B 1 234 ? -9.512  1.555   -17.994 1.00 33.75 ? 234 GLN B CA  1 
ATOM   4454 C  C   . GLN B 1 234 ? -8.700  0.324   -18.388 1.00 34.96 ? 234 GLN B C   1 
ATOM   4455 O  O   . GLN B 1 234 ? -7.492  0.412   -18.613 1.00 37.18 ? 234 GLN B O   1 
ATOM   4456 C  CB  . GLN B 1 234 ? -9.892  1.496   -16.512 1.00 34.36 ? 234 GLN B CB  1 
ATOM   4457 C  CG  . GLN B 1 234 ? -8.745  1.162   -15.583 1.00 37.12 ? 234 GLN B CG  1 
ATOM   4458 C  CD  . GLN B 1 234 ? -7.659  2.212   -15.603 1.00 40.80 ? 234 GLN B CD  1 
ATOM   4459 O  OE1 . GLN B 1 234 ? -7.104  2.525   -16.653 1.00 40.66 ? 234 GLN B OE1 1 
ATOM   4460 N  NE2 . GLN B 1 234 ? -7.345  2.761   -14.435 1.00 43.18 ? 234 GLN B NE2 1 
ATOM   4461 N  N   . CYS B 1 235 ? -9.368  -0.824  -18.478 1.00 34.58 ? 235 CYS B N   1 
ATOM   4462 C  CA  . CYS B 1 235 ? -8.693  -2.057  -18.851 1.00 36.62 ? 235 CYS B CA  1 
ATOM   4463 C  C   . CYS B 1 235 ? -8.096  -1.931  -20.244 1.00 36.01 ? 235 CYS B C   1 
ATOM   4464 O  O   . CYS B 1 235 ? -6.985  -2.390  -20.495 1.00 35.14 ? 235 CYS B O   1 
ATOM   4465 C  CB  . CYS B 1 235 ? -9.665  -3.235  -18.806 1.00 36.40 ? 235 CYS B CB  1 
ATOM   4466 S  SG  . CYS B 1 235 ? -9.978  -3.849  -17.153 1.00 38.73 ? 235 CYS B SG  1 
ATOM   4467 N  N   . GLU B 1 236 ? -8.838  -1.303  -21.149 1.00 36.37 ? 236 GLU B N   1 
ATOM   4468 C  CA  . GLU B 1 236 ? -8.355  -1.119  -22.506 1.00 38.09 ? 236 GLU B CA  1 
ATOM   4469 C  C   . GLU B 1 236 ? -7.112  -0.211  -22.517 1.00 39.46 ? 236 GLU B C   1 
ATOM   4470 O  O   . GLU B 1 236 ? -6.258  -0.312  -23.401 1.00 41.18 ? 236 GLU B O   1 
ATOM   4471 C  CB  . GLU B 1 236 ? -9.472  -0.541  -23.379 1.00 37.34 ? 236 GLU B CB  1 
ATOM   4472 C  CG  . GLU B 1 236 ? -9.031  -0.155  -24.779 1.00 38.18 ? 236 GLU B CG  1 
ATOM   4473 C  CD  . GLU B 1 236 ? -10.204 0.167   -25.680 1.00 40.80 ? 236 GLU B CD  1 
ATOM   4474 O  OE1 . GLU B 1 236 ? -10.853 -0.776  -26.190 1.00 44.07 ? 236 GLU B OE1 1 
ATOM   4475 O  OE2 . GLU B 1 236 ? -10.491 1.365   -25.867 1.00 39.03 ? 236 GLU B OE2 1 
ATOM   4476 N  N   . ALA B 1 237 ? -6.996  0.669   -21.531 1.00 38.64 ? 237 ALA B N   1 
ATOM   4477 C  CA  . ALA B 1 237 ? -5.833  1.536   -21.474 1.00 40.09 ? 237 ALA B CA  1 
ATOM   4478 C  C   . ALA B 1 237 ? -4.613  0.734   -21.003 1.00 41.05 ? 237 ALA B C   1 
ATOM   4479 O  O   . ALA B 1 237 ? -3.527  0.838   -21.587 1.00 40.62 ? 237 ALA B O   1 
ATOM   4480 C  CB  . ALA B 1 237 ? -6.095  2.708   -20.537 1.00 39.27 ? 237 ALA B CB  1 
ATOM   4481 N  N   . VAL B 1 238 ? -4.796  -0.077  -19.962 1.00 41.27 ? 238 VAL B N   1 
ATOM   4482 C  CA  . VAL B 1 238 ? -3.697  -0.879  -19.426 1.00 42.36 ? 238 VAL B CA  1 
ATOM   4483 C  C   . VAL B 1 238 ? -3.079  -1.826  -20.450 1.00 44.20 ? 238 VAL B C   1 
ATOM   4484 O  O   . VAL B 1 238 ? -1.857  -1.856  -20.598 1.00 46.15 ? 238 VAL B O   1 
ATOM   4485 C  CB  . VAL B 1 238 ? -4.125  -1.690  -18.160 1.00 42.12 ? 238 VAL B CB  1 
ATOM   4486 C  CG1 . VAL B 1 238 ? -3.135  -2.825  -17.889 1.00 41.33 ? 238 VAL B CG1 1 
ATOM   4487 C  CG2 . VAL B 1 238 ? -4.157  -0.771  -16.944 1.00 36.85 ? 238 VAL B CG2 1 
ATOM   4488 N  N   . ASP B 1 239 ? -3.891  -2.596  -21.166 1.00 45.70 ? 239 ASP B N   1 
ATOM   4489 C  CA  . ASP B 1 239 ? -3.299  -3.499  -22.142 1.00 47.35 ? 239 ASP B CA  1 
ATOM   4490 C  C   . ASP B 1 239 ? -2.768  -2.780  -23.380 1.00 46.89 ? 239 ASP B C   1 
ATOM   4491 O  O   . ASP B 1 239 ? -2.257  -3.421  -24.301 1.00 47.91 ? 239 ASP B O   1 
ATOM   4492 C  CB  . ASP B 1 239 ? -4.270  -4.617  -22.545 1.00 49.06 ? 239 ASP B CB  1 
ATOM   4493 C  CG  . ASP B 1 239 ? -5.632  -4.108  -22.920 1.00 50.65 ? 239 ASP B CG  1 
ATOM   4494 O  OD1 . ASP B 1 239 ? -5.706  -3.145  -23.709 1.00 53.20 ? 239 ASP B OD1 1 
ATOM   4495 O  OD2 . ASP B 1 239 ? -6.630  -4.687  -22.434 1.00 51.30 ? 239 ASP B OD2 1 
ATOM   4496 N  N   . ASN B 1 240 ? -2.875  -1.453  -23.398 1.00 45.52 ? 240 ASN B N   1 
ATOM   4497 C  CA  . ASN B 1 240 ? -2.365  -0.675  -24.521 1.00 45.06 ? 240 ASN B CA  1 
ATOM   4498 C  C   . ASN B 1 240 ? -1.167  0.171   -24.100 1.00 44.34 ? 240 ASN B C   1 
ATOM   4499 O  O   . ASN B 1 240 ? -0.724  1.054   -24.835 1.00 43.17 ? 240 ASN B O   1 
ATOM   4500 C  CB  . ASN B 1 240 ? -3.456  0.216   -25.111 1.00 46.31 ? 240 ASN B CB  1 
ATOM   4501 C  CG  . ASN B 1 240 ? -4.008  -0.333  -26.408 1.00 47.63 ? 240 ASN B CG  1 
ATOM   4502 O  OD1 . ASN B 1 240 ? -3.267  -0.545  -27.366 1.00 47.56 ? 240 ASN B OD1 1 
ATOM   4503 N  ND2 . ASN B 1 240 ? -5.312  -0.569  -26.447 1.00 48.55 ? 240 ASN B ND2 1 
ATOM   4504 N  N   . GLY B 1 241 ? -0.659  -0.100  -22.902 1.00 43.12 ? 241 GLY B N   1 
ATOM   4505 C  CA  . GLY B 1 241 ? 0.505   0.613   -22.413 1.00 43.67 ? 241 GLY B CA  1 
ATOM   4506 C  C   . GLY B 1 241 ? 0.297   1.807   -21.502 1.00 43.18 ? 241 GLY B C   1 
ATOM   4507 O  O   . GLY B 1 241 ? 1.274   2.396   -21.037 1.00 44.27 ? 241 GLY B O   1 
ATOM   4508 N  N   . CYS B 1 242 ? -0.950  2.171   -21.222 1.00 40.66 ? 242 CYS B N   1 
ATOM   4509 C  CA  . CYS B 1 242 ? -1.191  3.329   -20.371 1.00 40.75 ? 242 CYS B CA  1 
ATOM   4510 C  C   . CYS B 1 242 ? -1.547  2.983   -18.934 1.00 41.30 ? 242 CYS B C   1 
ATOM   4511 O  O   . CYS B 1 242 ? -1.694  1.811   -18.586 1.00 43.99 ? 242 CYS B O   1 
ATOM   4512 C  CB  . CYS B 1 242 ? -2.278  4.198   -20.992 1.00 38.72 ? 242 CYS B CB  1 
ATOM   4513 S  SG  . CYS B 1 242 ? -1.819  4.770   -22.641 1.00 37.99 ? 242 CYS B SG  1 
ATOM   4514 N  N   . GLN B 1 243 ? -1.676  4.007   -18.098 1.00 39.57 ? 243 GLN B N   1 
ATOM   4515 C  CA  . GLN B 1 243 ? -2.014  3.795   -16.698 1.00 40.34 ? 243 GLN B CA  1 
ATOM   4516 C  C   . GLN B 1 243 ? -3.331  4.468   -16.345 1.00 40.45 ? 243 GLN B C   1 
ATOM   4517 O  O   . GLN B 1 243 ? -3.872  4.262   -15.260 1.00 41.23 ? 243 GLN B O   1 
ATOM   4518 C  CB  . GLN B 1 243 ? -0.902  4.332   -15.795 1.00 41.24 ? 243 GLN B CB  1 
ATOM   4519 C  CG  . GLN B 1 243 ? 0.488   3.839   -16.185 1.00 42.76 ? 243 GLN B CG  1 
ATOM   4520 C  CD  . GLN B 1 243 ? 1.377   4.958   -16.682 1.00 44.76 ? 243 GLN B CD  1 
ATOM   4521 O  OE1 . GLN B 1 243 ? 1.892   5.751   -15.894 1.00 46.69 ? 243 GLN B OE1 1 
ATOM   4522 N  NE2 . GLN B 1 243 ? 1.554   5.037   -17.994 1.00 44.87 ? 243 GLN B NE2 1 
ATOM   4523 N  N   . GLN B 1 244 ? -3.838  5.280   -17.265 1.00 39.01 ? 244 GLN B N   1 
ATOM   4524 C  CA  . GLN B 1 244 ? -5.096  5.979   -17.052 1.00 37.86 ? 244 GLN B CA  1 
ATOM   4525 C  C   . GLN B 1 244 ? -5.745  6.391   -18.359 1.00 35.11 ? 244 GLN B C   1 
ATOM   4526 O  O   . GLN B 1 244 ? -5.096  6.433   -19.406 1.00 36.64 ? 244 GLN B O   1 
ATOM   4527 C  CB  . GLN B 1 244 ? -4.884  7.213   -16.175 1.00 40.84 ? 244 GLN B CB  1 
ATOM   4528 C  CG  . GLN B 1 244 ? -4.969  6.917   -14.690 1.00 45.83 ? 244 GLN B CG  1 
ATOM   4529 C  CD  . GLN B 1 244 ? -6.385  6.597   -14.246 1.00 49.36 ? 244 GLN B CD  1 
ATOM   4530 O  OE1 . GLN B 1 244 ? -7.112  5.859   -14.924 1.00 51.37 ? 244 GLN B OE1 1 
ATOM   4531 N  NE2 . GLN B 1 244 ? -6.787  7.147   -13.099 1.00 50.27 ? 244 GLN B NE2 1 
ATOM   4532 N  N   . VAL B 1 245 ? -7.033  6.701   -18.285 1.00 30.93 ? 245 VAL B N   1 
ATOM   4533 C  CA  . VAL B 1 245 ? -7.798  7.108   -19.451 1.00 28.31 ? 245 VAL B CA  1 
ATOM   4534 C  C   . VAL B 1 245 ? -7.900  8.628   -19.577 1.00 28.27 ? 245 VAL B C   1 
ATOM   4535 O  O   . VAL B 1 245 ? -8.050  9.324   -18.579 1.00 29.27 ? 245 VAL B O   1 
ATOM   4536 C  CB  . VAL B 1 245 ? -9.237  6.559   -19.378 1.00 26.59 ? 245 VAL B CB  1 
ATOM   4537 C  CG1 . VAL B 1 245 ? -9.995  6.935   -20.645 1.00 21.96 ? 245 VAL B CG1 1 
ATOM   4538 C  CG2 . VAL B 1 245 ? -9.218  5.039   -19.172 1.00 25.45 ? 245 VAL B CG2 1 
ATOM   4539 N  N   . LEU B 1 246 ? -7.790  9.150   -20.792 1.00 26.30 ? 246 LEU B N   1 
ATOM   4540 C  CA  . LEU B 1 246 ? -7.976  10.587  -20.980 1.00 27.28 ? 246 LEU B CA  1 
ATOM   4541 C  C   . LEU B 1 246 ? -9.411  10.662  -21.485 1.00 27.14 ? 246 LEU B C   1 
ATOM   4542 O  O   . LEU B 1 246 ? -9.700  10.230  -22.606 1.00 25.65 ? 246 LEU B O   1 
ATOM   4543 C  CB  . LEU B 1 246 ? -7.028  11.164  -22.031 1.00 25.98 ? 246 LEU B CB  1 
ATOM   4544 C  CG  . LEU B 1 246 ? -7.329  12.630  -22.364 1.00 27.17 ? 246 LEU B CG  1 
ATOM   4545 C  CD1 . LEU B 1 246 ? -7.243  13.488  -21.103 1.00 21.16 ? 246 LEU B CD1 1 
ATOM   4546 C  CD2 . LEU B 1 246 ? -6.348  13.121  -23.421 1.00 26.30 ? 246 LEU B CD2 1 
ATOM   4547 N  N   . TRP B 1 247 ? -10.309 11.187  -20.653 1.00 26.39 ? 247 TRP B N   1 
ATOM   4548 C  CA  . TRP B 1 247 ? -11.718 11.280  -21.010 1.00 27.12 ? 247 TRP B CA  1 
ATOM   4549 C  C   . TRP B 1 247 ? -12.075 12.411  -21.966 1.00 27.82 ? 247 TRP B C   1 
ATOM   4550 O  O   . TRP B 1 247 ? -11.910 13.592  -21.655 1.00 28.77 ? 247 TRP B O   1 
ATOM   4551 C  CB  . TRP B 1 247 ? -12.566 11.369  -19.742 1.00 26.36 ? 247 TRP B CB  1 
ATOM   4552 C  CG  . TRP B 1 247 ? -12.447 10.132  -18.927 1.00 26.38 ? 247 TRP B CG  1 
ATOM   4553 C  CD1 . TRP B 1 247 ? -11.740 9.974   -17.768 1.00 27.83 ? 247 TRP B CD1 1 
ATOM   4554 C  CD2 . TRP B 1 247 ? -12.990 8.847   -19.245 1.00 22.35 ? 247 TRP B CD2 1 
ATOM   4555 N  NE1 . TRP B 1 247 ? -11.808 8.670   -17.348 1.00 26.45 ? 247 TRP B NE1 1 
ATOM   4556 C  CE2 . TRP B 1 247 ? -12.569 7.956   -18.235 1.00 23.38 ? 247 TRP B CE2 1 
ATOM   4557 C  CE3 . TRP B 1 247 ? -13.788 8.362   -20.290 1.00 23.50 ? 247 TRP B CE3 1 
ATOM   4558 C  CZ2 . TRP B 1 247 ? -12.921 6.601   -18.235 1.00 23.72 ? 247 TRP B CZ2 1 
ATOM   4559 C  CZ3 . TRP B 1 247 ? -14.139 7.011   -20.295 1.00 22.57 ? 247 TRP B CZ3 1 
ATOM   4560 C  CH2 . TRP B 1 247 ? -13.704 6.147   -19.270 1.00 24.62 ? 247 TRP B CH2 1 
ATOM   4561 N  N   . LEU B 1 248 ? -12.574 12.020  -23.134 1.00 26.85 ? 248 LEU B N   1 
ATOM   4562 C  CA  . LEU B 1 248 ? -12.965 12.954  -24.174 1.00 27.74 ? 248 LEU B CA  1 
ATOM   4563 C  C   . LEU B 1 248 ? -14.471 13.069  -24.245 1.00 27.53 ? 248 LEU B C   1 
ATOM   4564 O  O   . LEU B 1 248 ? -15.188 12.104  -23.997 1.00 30.07 ? 248 LEU B O   1 
ATOM   4565 C  CB  . LEU B 1 248 ? -12.408 12.489  -25.514 1.00 27.64 ? 248 LEU B CB  1 
ATOM   4566 C  CG  . LEU B 1 248 ? -10.897 12.246  -25.459 1.00 27.31 ? 248 LEU B CG  1 
ATOM   4567 C  CD1 . LEU B 1 248 ? -10.416 11.787  -26.824 1.00 25.91 ? 248 LEU B CD1 1 
ATOM   4568 C  CD2 . LEU B 1 248 ? -10.178 13.523  -25.002 1.00 21.11 ? 248 LEU B CD2 1 
ATOM   4569 N  N   . TYR B 1 249 ? -14.952 14.258  -24.582 1.00 29.70 ? 249 TYR B N   1 
ATOM   4570 C  CA  . TYR B 1 249 ? -16.387 14.499  -24.665 1.00 29.16 ? 249 TYR B CA  1 
ATOM   4571 C  C   . TYR B 1 249 ? -16.744 15.410  -25.832 1.00 29.83 ? 249 TYR B C   1 
ATOM   4572 O  O   . TYR B 1 249 ? -16.013 16.355  -26.147 1.00 29.03 ? 249 TYR B O   1 
ATOM   4573 C  CB  . TYR B 1 249 ? -16.881 15.140  -23.359 1.00 28.04 ? 249 TYR B CB  1 
ATOM   4574 C  CG  . TYR B 1 249 ? -18.382 15.349  -23.280 1.00 28.04 ? 249 TYR B CG  1 
ATOM   4575 C  CD1 . TYR B 1 249 ? -19.246 14.271  -23.108 1.00 28.06 ? 249 TYR B CD1 1 
ATOM   4576 C  CD2 . TYR B 1 249 ? -18.935 16.628  -23.362 1.00 30.98 ? 249 TYR B CD2 1 
ATOM   4577 C  CE1 . TYR B 1 249 ? -20.627 14.452  -23.016 1.00 30.77 ? 249 TYR B CE1 1 
ATOM   4578 C  CE2 . TYR B 1 249 ? -20.316 16.824  -23.272 1.00 32.82 ? 249 TYR B CE2 1 
ATOM   4579 C  CZ  . TYR B 1 249 ? -21.155 15.727  -23.099 1.00 32.82 ? 249 TYR B CZ  1 
ATOM   4580 O  OH  . TYR B 1 249 ? -22.518 15.899  -23.020 1.00 36.08 ? 249 TYR B OH  1 
ATOM   4581 N  N   . GLY B 1 250 ? -17.874 15.108  -26.466 1.00 30.75 ? 250 GLY B N   1 
ATOM   4582 C  CA  . GLY B 1 250 ? -18.369 15.919  -27.562 1.00 29.17 ? 250 GLY B CA  1 
ATOM   4583 C  C   . GLY B 1 250 ? -17.731 15.772  -28.925 1.00 29.41 ? 250 GLY B C   1 
ATOM   4584 O  O   . GLY B 1 250 ? -16.711 15.105  -29.098 1.00 27.21 ? 250 GLY B O   1 
ATOM   4585 N  N   . GLU B 1 251 ? -18.366 16.424  -29.894 1.00 31.79 ? 251 GLU B N   1 
ATOM   4586 C  CA  . GLU B 1 251 ? -17.935 16.445  -31.287 1.00 34.10 ? 251 GLU B CA  1 
ATOM   4587 C  C   . GLU B 1 251 ? -16.510 16.979  -31.434 1.00 32.31 ? 251 GLU B C   1 
ATOM   4588 O  O   . GLU B 1 251 ? -15.743 16.484  -32.250 1.00 29.65 ? 251 GLU B O   1 
ATOM   4589 C  CB  . GLU B 1 251 ? -18.897 17.323  -32.108 1.00 37.75 ? 251 GLU B CB  1 
ATOM   4590 C  CG  . GLU B 1 251 ? -18.590 17.405  -33.607 1.00 44.39 ? 251 GLU B CG  1 
ATOM   4591 C  CD  . GLU B 1 251 ? -19.540 18.341  -34.366 1.00 48.04 ? 251 GLU B CD  1 
ATOM   4592 O  OE1 . GLU B 1 251 ? -20.775 18.135  -34.307 1.00 48.83 ? 251 GLU B OE1 1 
ATOM   4593 O  OE2 . GLU B 1 251 ? -19.050 19.283  -35.026 1.00 48.60 ? 251 GLU B OE2 1 
ATOM   4594 N  N   . ASP B 1 252 ? -16.153 17.985  -30.645 1.00 31.45 ? 252 ASP B N   1 
ATOM   4595 C  CA  . ASP B 1 252 ? -14.818 18.559  -30.741 1.00 33.34 ? 252 ASP B CA  1 
ATOM   4596 C  C   . ASP B 1 252 ? -13.788 17.892  -29.832 1.00 31.88 ? 252 ASP B C   1 
ATOM   4597 O  O   . ASP B 1 252 ? -12.684 18.403  -29.646 1.00 30.19 ? 252 ASP B O   1 
ATOM   4598 C  CB  . ASP B 1 252 ? -14.868 20.076  -30.494 1.00 36.72 ? 252 ASP B CB  1 
ATOM   4599 C  CG  . ASP B 1 252 ? -15.695 20.456  -29.273 1.00 42.96 ? 252 ASP B CG  1 
ATOM   4600 O  OD1 . ASP B 1 252 ? -15.925 21.672  -29.077 1.00 44.80 ? 252 ASP B OD1 1 
ATOM   4601 O  OD2 . ASP B 1 252 ? -16.110 19.551  -28.510 1.00 47.03 ? 252 ASP B OD2 1 
ATOM   4602 N  N   . HIS B 1 253 ? -14.155 16.737  -29.284 1.00 30.79 ? 253 HIS B N   1 
ATOM   4603 C  CA  . HIS B 1 253 ? -13.270 15.967  -28.418 1.00 29.60 ? 253 HIS B CA  1 
ATOM   4604 C  C   . HIS B 1 253 ? -12.686 16.754  -27.243 1.00 29.42 ? 253 HIS B C   1 
ATOM   4605 O  O   . HIS B 1 253 ? -11.467 16.798  -27.070 1.00 29.12 ? 253 HIS B O   1 
ATOM   4606 C  CB  . HIS B 1 253 ? -12.101 15.390  -29.219 1.00 31.08 ? 253 HIS B CB  1 
ATOM   4607 C  CG  . HIS B 1 253 ? -12.506 14.601  -30.425 1.00 35.22 ? 253 HIS B CG  1 
ATOM   4608 N  ND1 . HIS B 1 253 ? -13.487 13.631  -30.389 1.00 36.30 ? 253 HIS B ND1 1 
ATOM   4609 C  CD2 . HIS B 1 253 ? -12.018 14.597  -31.689 1.00 33.72 ? 253 HIS B CD2 1 
ATOM   4610 C  CE1 . HIS B 1 253 ? -13.584 13.063  -31.578 1.00 34.63 ? 253 HIS B CE1 1 
ATOM   4611 N  NE2 . HIS B 1 253 ? -12.704 13.631  -32.384 1.00 36.77 ? 253 HIS B NE2 1 
ATOM   4612 N  N   . GLN B 1 254 ? -13.532 17.376  -26.431 1.00 27.27 ? 254 GLN B N   1 
ATOM   4613 C  CA  . GLN B 1 254 ? -13.010 18.118  -25.293 1.00 26.15 ? 254 GLN B CA  1 
ATOM   4614 C  C   . GLN B 1 254 ? -12.253 17.162  -24.358 1.00 26.08 ? 254 GLN B C   1 
ATOM   4615 O  O   . GLN B 1 254 ? -12.581 15.978  -24.263 1.00 24.74 ? 254 GLN B O   1 
ATOM   4616 C  CB  . GLN B 1 254 ? -14.150 18.797  -24.524 1.00 26.24 ? 254 GLN B CB  1 
ATOM   4617 C  CG  . GLN B 1 254 ? -14.981 19.755  -25.351 1.00 25.39 ? 254 GLN B CG  1 
ATOM   4618 C  CD  . GLN B 1 254 ? -16.117 20.389  -24.559 1.00 28.62 ? 254 GLN B CD  1 
ATOM   4619 O  OE1 . GLN B 1 254 ? -16.910 21.151  -25.105 1.00 31.65 ? 254 GLN B OE1 1 
ATOM   4620 N  NE2 . GLN B 1 254 ? -16.195 20.083  -23.270 1.00 26.80 ? 254 GLN B NE2 1 
ATOM   4621 N  N   . ILE B 1 255 ? -11.222 17.678  -23.699 1.00 27.19 ? 255 ILE B N   1 
ATOM   4622 C  CA  . ILE B 1 255 ? -10.433 16.901  -22.752 1.00 29.93 ? 255 ILE B CA  1 
ATOM   4623 C  C   . ILE B 1 255 ? -11.037 17.265  -21.412 1.00 29.75 ? 255 ILE B C   1 
ATOM   4624 O  O   . ILE B 1 255 ? -11.017 18.434  -21.016 1.00 30.42 ? 255 ILE B O   1 
ATOM   4625 C  CB  . ILE B 1 255 ? -8.959  17.323  -22.765 1.00 32.63 ? 255 ILE B CB  1 
ATOM   4626 C  CG1 . ILE B 1 255 ? -8.319  16.941  -24.094 1.00 36.10 ? 255 ILE B CG1 1 
ATOM   4627 C  CG2 . ILE B 1 255 ? -8.220  16.666  -21.621 1.00 34.91 ? 255 ILE B CG2 1 
ATOM   4628 C  CD1 . ILE B 1 255 ? -6.829  17.229  -24.150 1.00 39.29 ? 255 ILE B CD1 1 
ATOM   4629 N  N   . THR B 1 256 ? -11.576 16.282  -20.706 1.00 27.59 ? 256 THR B N   1 
ATOM   4630 C  CA  . THR B 1 256 ? -12.216 16.590  -19.439 1.00 27.23 ? 256 THR B CA  1 
ATOM   4631 C  C   . THR B 1 256 ? -11.454 16.244  -18.174 1.00 26.75 ? 256 THR B C   1 
ATOM   4632 O  O   . THR B 1 256 ? -11.271 17.114  -17.319 1.00 25.23 ? 256 THR B O   1 
ATOM   4633 C  CB  . THR B 1 256 ? -13.606 15.944  -19.366 1.00 26.78 ? 256 THR B CB  1 
ATOM   4634 O  OG1 . THR B 1 256 ? -13.479 14.519  -19.245 1.00 26.12 ? 256 THR B OG1 1 
ATOM   4635 C  CG2 . THR B 1 256 ? -14.390 16.285  -20.621 1.00 23.23 ? 256 THR B CG2 1 
ATOM   4636 N  N   . GLU B 1 257 ? -11.026 14.987  -18.043 1.00 25.93 ? 257 GLU B N   1 
ATOM   4637 C  CA  . GLU B 1 257 ? -10.301 14.557  -16.851 1.00 27.43 ? 257 GLU B CA  1 
ATOM   4638 C  C   . GLU B 1 257 ? -9.225  13.507  -17.110 1.00 27.74 ? 257 GLU B C   1 
ATOM   4639 O  O   . GLU B 1 257 ? -9.313  12.716  -18.053 1.00 27.60 ? 257 GLU B O   1 
ATOM   4640 C  CB  . GLU B 1 257 ? -11.271 13.997  -15.804 1.00 28.96 ? 257 GLU B CB  1 
ATOM   4641 C  CG  . GLU B 1 257 ? -12.486 14.864  -15.517 1.00 34.10 ? 257 GLU B CG  1 
ATOM   4642 C  CD  . GLU B 1 257 ? -13.112 14.567  -14.160 1.00 37.19 ? 257 GLU B CD  1 
ATOM   4643 O  OE1 . GLU B 1 257 ? -14.243 15.038  -13.904 1.00 37.21 ? 257 GLU B OE1 1 
ATOM   4644 O  OE2 . GLU B 1 257 ? -12.464 13.873  -13.347 1.00 39.21 ? 257 GLU B OE2 1 
ATOM   4645 N  N   . VAL B 1 258 ? -8.212  13.516  -16.250 1.00 25.71 ? 258 VAL B N   1 
ATOM   4646 C  CA  . VAL B 1 258 ? -7.101  12.565  -16.303 1.00 24.67 ? 258 VAL B CA  1 
ATOM   4647 C  C   . VAL B 1 258 ? -7.542  11.410  -15.407 1.00 25.26 ? 258 VAL B C   1 
ATOM   4648 O  O   . VAL B 1 258 ? -7.477  11.507  -14.183 1.00 23.46 ? 258 VAL B O   1 
ATOM   4649 C  CB  . VAL B 1 258 ? -5.821  13.206  -15.730 1.00 21.98 ? 258 VAL B CB  1 
ATOM   4650 C  CG1 . VAL B 1 258 ? -4.662  12.246  -15.810 1.00 20.40 ? 258 VAL B CG1 1 
ATOM   4651 C  CG2 . VAL B 1 258 ? -5.521  14.481  -16.490 1.00 18.66 ? 258 VAL B CG2 1 
ATOM   4652 N  N   . GLY B 1 259 ? -7.996  10.322  -16.019 1.00 26.45 ? 259 GLY B N   1 
ATOM   4653 C  CA  . GLY B 1 259 ? -8.486  9.207   -15.239 1.00 26.65 ? 259 GLY B CA  1 
ATOM   4654 C  C   . GLY B 1 259 ? -9.630  9.800   -14.443 1.00 27.86 ? 259 GLY B C   1 
ATOM   4655 O  O   . GLY B 1 259 ? -10.478 10.496  -15.006 1.00 28.99 ? 259 GLY B O   1 
ATOM   4656 N  N   . THR B 1 260 ? -9.664  9.541   -13.141 1.00 28.49 ? 260 THR B N   1 
ATOM   4657 C  CA  . THR B 1 260 ? -10.697 10.124  -12.300 1.00 28.97 ? 260 THR B CA  1 
ATOM   4658 C  C   . THR B 1 260 ? -10.057 11.240  -11.477 1.00 28.46 ? 260 THR B C   1 
ATOM   4659 O  O   . THR B 1 260 ? -10.190 11.294  -10.256 1.00 28.36 ? 260 THR B O   1 
ATOM   4660 C  CB  . THR B 1 260 ? -11.348 9.073   -11.367 1.00 28.42 ? 260 THR B CB  1 
ATOM   4661 O  OG1 . THR B 1 260 ? -10.333 8.357   -10.652 1.00 27.01 ? 260 THR B OG1 1 
ATOM   4662 C  CG2 . THR B 1 260 ? -12.175 8.104   -12.180 1.00 28.50 ? 260 THR B CG2 1 
ATOM   4663 N  N   . MET B 1 261 ? -9.331  12.111  -12.170 1.00 28.91 ? 261 MET B N   1 
ATOM   4664 C  CA  . MET B 1 261 ? -8.666  13.268  -11.564 1.00 29.39 ? 261 MET B CA  1 
ATOM   4665 C  C   . MET B 1 261 ? -8.917  14.463  -12.475 1.00 28.09 ? 261 MET B C   1 
ATOM   4666 O  O   . MET B 1 261 ? -8.999  14.311  -13.694 1.00 27.63 ? 261 MET B O   1 
ATOM   4667 C  CB  . MET B 1 261 ? -7.157  13.053  -11.455 1.00 28.51 ? 261 MET B CB  1 
ATOM   4668 C  CG  . MET B 1 261 ? -6.711  11.984  -10.477 1.00 31.17 ? 261 MET B CG  1 
ATOM   4669 S  SD  . MET B 1 261 ? -4.901  11.970  -10.376 1.00 33.12 ? 261 MET B SD  1 
ATOM   4670 C  CE  . MET B 1 261 ? -4.511  10.724  -11.601 1.00 32.45 ? 261 MET B CE  1 
ATOM   4671 N  N   . ASN B 1 262 ? -9.027  15.654  -11.899 1.00 27.60 ? 262 ASN B N   1 
ATOM   4672 C  CA  . ASN B 1 262 ? -9.268  16.833  -12.714 1.00 26.63 ? 262 ASN B CA  1 
ATOM   4673 C  C   . ASN B 1 262 ? -8.071  17.132  -13.610 1.00 27.56 ? 262 ASN B C   1 
ATOM   4674 O  O   . ASN B 1 262 ? -6.936  16.839  -13.248 1.00 27.34 ? 262 ASN B O   1 
ATOM   4675 C  CB  . ASN B 1 262 ? -9.608  18.012  -11.816 1.00 25.92 ? 262 ASN B CB  1 
ATOM   4676 C  CG  . ASN B 1 262 ? -10.926 17.812  -11.097 1.00 28.22 ? 262 ASN B CG  1 
ATOM   4677 O  OD1 . ASN B 1 262 ? -11.968 17.674  -11.738 1.00 28.13 ? 262 ASN B OD1 1 
ATOM   4678 N  ND2 . ASN B 1 262 ? -10.890 17.776  -9.764  1.00 23.76 ? 262 ASN B ND2 1 
ATOM   4679 N  N   . LEU B 1 263 ? -8.336  17.711  -14.782 1.00 27.48 ? 263 LEU B N   1 
ATOM   4680 C  CA  . LEU B 1 263 ? -7.288  18.020  -15.752 1.00 26.30 ? 263 LEU B CA  1 
ATOM   4681 C  C   . LEU B 1 263 ? -6.795  19.464  -15.771 1.00 27.11 ? 263 LEU B C   1 
ATOM   4682 O  O   . LEU B 1 263 ? -7.589  20.392  -15.908 1.00 29.67 ? 263 LEU B O   1 
ATOM   4683 C  CB  . LEU B 1 263 ? -7.769  17.645  -17.157 1.00 25.38 ? 263 LEU B CB  1 
ATOM   4684 C  CG  . LEU B 1 263 ? -6.835  17.901  -18.348 1.00 27.22 ? 263 LEU B CG  1 
ATOM   4685 C  CD1 . LEU B 1 263 ? -6.818  19.378  -18.748 1.00 25.32 ? 263 LEU B CD1 1 
ATOM   4686 C  CD2 . LEU B 1 263 ? -5.442  17.434  -17.975 1.00 28.86 ? 263 LEU B CD2 1 
ATOM   4687 N  N   . PHE B 1 264 ? -5.478  19.639  -15.655 1.00 26.14 ? 264 PHE B N   1 
ATOM   4688 C  CA  . PHE B 1 264 ? -4.847  20.962  -15.703 1.00 24.71 ? 264 PHE B CA  1 
ATOM   4689 C  C   . PHE B 1 264 ? -3.838  21.063  -16.849 1.00 23.76 ? 264 PHE B C   1 
ATOM   4690 O  O   . PHE B 1 264 ? -2.999  20.180  -17.025 1.00 25.30 ? 264 PHE B O   1 
ATOM   4691 C  CB  . PHE B 1 264 ? -4.110  21.280  -14.394 1.00 22.54 ? 264 PHE B CB  1 
ATOM   4692 C  CG  . PHE B 1 264 ? -4.992  21.835  -13.320 1.00 21.75 ? 264 PHE B CG  1 
ATOM   4693 C  CD1 . PHE B 1 264 ? -5.665  20.991  -12.445 1.00 21.11 ? 264 PHE B CD1 1 
ATOM   4694 C  CD2 . PHE B 1 264 ? -5.171  23.205  -13.201 1.00 21.07 ? 264 PHE B CD2 1 
ATOM   4695 C  CE1 . PHE B 1 264 ? -6.505  21.499  -11.474 1.00 20.54 ? 264 PHE B CE1 1 
ATOM   4696 C  CE2 . PHE B 1 264 ? -6.012  23.733  -12.230 1.00 23.41 ? 264 PHE B CE2 1 
ATOM   4697 C  CZ  . PHE B 1 264 ? -6.685  22.874  -11.360 1.00 26.36 ? 264 PHE B CZ  1 
ATOM   4698 N  N   . LEU B 1 265 ? -3.916  22.139  -17.624 1.00 24.03 ? 265 LEU B N   1 
ATOM   4699 C  CA  . LEU B 1 265 ? -2.975  22.348  -18.723 1.00 24.77 ? 265 LEU B CA  1 
ATOM   4700 C  C   . LEU B 1 265 ? -2.249  23.665  -18.481 1.00 24.45 ? 265 LEU B C   1 
ATOM   4701 O  O   . LEU B 1 265 ? -2.875  24.714  -18.343 1.00 28.76 ? 265 LEU B O   1 
ATOM   4702 C  CB  . LEU B 1 265 ? -3.692  22.396  -20.080 1.00 22.91 ? 265 LEU B CB  1 
ATOM   4703 C  CG  . LEU B 1 265 ? -2.776  22.559  -21.312 1.00 25.40 ? 265 LEU B CG  1 
ATOM   4704 C  CD1 . LEU B 1 265 ? -1.753  21.423  -21.362 1.00 21.59 ? 265 LEU B CD1 1 
ATOM   4705 C  CD2 . LEU B 1 265 ? -3.607  22.571  -22.601 1.00 21.74 ? 265 LEU B CD2 1 
ATOM   4706 N  N   . TYR B 1 266 ? -0.928  23.598  -18.401 1.00 23.59 ? 266 TYR B N   1 
ATOM   4707 C  CA  . TYR B 1 266 ? -0.099  24.776  -18.176 1.00 22.36 ? 266 TYR B CA  1 
ATOM   4708 C  C   . TYR B 1 266 ? 0.570   25.068  -19.513 1.00 24.15 ? 266 TYR B C   1 
ATOM   4709 O  O   . TYR B 1 266 ? 1.373   24.270  -19.993 1.00 23.85 ? 266 TYR B O   1 
ATOM   4710 C  CB  . TYR B 1 266 ? 0.963   24.476  -17.122 1.00 20.22 ? 266 TYR B CB  1 
ATOM   4711 C  CG  . TYR B 1 266 ? 1.842   25.654  -16.782 1.00 20.42 ? 266 TYR B CG  1 
ATOM   4712 C  CD1 . TYR B 1 266 ? 3.162   25.463  -16.377 1.00 18.34 ? 266 TYR B CD1 1 
ATOM   4713 C  CD2 . TYR B 1 266 ? 1.349   26.960  -16.838 1.00 20.69 ? 266 TYR B CD2 1 
ATOM   4714 C  CE1 . TYR B 1 266 ? 3.971   26.540  -16.033 1.00 20.60 ? 266 TYR B CE1 1 
ATOM   4715 C  CE2 . TYR B 1 266 ? 2.149   28.048  -16.493 1.00 23.77 ? 266 TYR B CE2 1 
ATOM   4716 C  CZ  . TYR B 1 266 ? 3.457   27.830  -16.090 1.00 24.31 ? 266 TYR B CZ  1 
ATOM   4717 O  OH  . TYR B 1 266 ? 4.241   28.892  -15.720 1.00 24.21 ? 266 TYR B OH  1 
ATOM   4718 N  N   . TRP B 1 267 ? 0.265   26.218  -20.100 1.00 24.77 ? 267 TRP B N   1 
ATOM   4719 C  CA  . TRP B 1 267 ? 0.802   26.527  -21.415 1.00 26.04 ? 267 TRP B CA  1 
ATOM   4720 C  C   . TRP B 1 267 ? 0.700   27.992  -21.806 1.00 27.54 ? 267 TRP B C   1 
ATOM   4721 O  O   . TRP B 1 267 ? 0.354   28.861  -21.003 1.00 27.73 ? 267 TRP B O   1 
ATOM   4722 C  CB  . TRP B 1 267 ? 0.029   25.700  -22.454 1.00 26.87 ? 267 TRP B CB  1 
ATOM   4723 C  CG  . TRP B 1 267 ? -1.435  26.136  -22.618 1.00 26.88 ? 267 TRP B CG  1 
ATOM   4724 C  CD1 . TRP B 1 267 ? -2.162  26.921  -21.760 1.00 26.27 ? 267 TRP B CD1 1 
ATOM   4725 C  CD2 . TRP B 1 267 ? -2.321  25.813  -23.703 1.00 27.39 ? 267 TRP B CD2 1 
ATOM   4726 N  NE1 . TRP B 1 267 ? -3.435  27.106  -22.242 1.00 27.91 ? 267 TRP B NE1 1 
ATOM   4727 C  CE2 . TRP B 1 267 ? -3.562  26.438  -23.432 1.00 29.23 ? 267 TRP B CE2 1 
ATOM   4728 C  CE3 . TRP B 1 267 ? -2.188  25.058  -24.876 1.00 27.34 ? 267 TRP B CE3 1 
ATOM   4729 C  CZ2 . TRP B 1 267 ? -4.665  26.332  -24.294 1.00 30.34 ? 267 TRP B CZ2 1 
ATOM   4730 C  CZ3 . TRP B 1 267 ? -3.288  24.953  -25.737 1.00 29.87 ? 267 TRP B CZ3 1 
ATOM   4731 C  CH2 . TRP B 1 267 ? -4.509  25.589  -25.438 1.00 28.85 ? 267 TRP B CH2 1 
ATOM   4732 N  N   . ILE B 1 268 ? 1.024   28.240  -23.068 1.00 29.78 ? 268 ILE B N   1 
ATOM   4733 C  CA  . ILE B 1 268 ? 0.918   29.554  -23.666 1.00 30.94 ? 268 ILE B CA  1 
ATOM   4734 C  C   . ILE B 1 268 ? -0.361  29.364  -24.481 1.00 33.09 ? 268 ILE B C   1 
ATOM   4735 O  O   . ILE B 1 268 ? -0.400  28.512  -25.367 1.00 32.27 ? 268 ILE B O   1 
ATOM   4736 C  CB  . ILE B 1 268 ? 2.099   29.833  -24.613 1.00 32.25 ? 268 ILE B CB  1 
ATOM   4737 C  CG1 . ILE B 1 268 ? 3.356   30.175  -23.803 1.00 33.35 ? 268 ILE B CG1 1 
ATOM   4738 C  CG2 . ILE B 1 268 ? 1.748   30.974  -25.563 1.00 33.03 ? 268 ILE B CG2 1 
ATOM   4739 C  CD1 . ILE B 1 268 ? 3.929   29.014  -23.038 1.00 37.38 ? 268 ILE B CD1 1 
ATOM   4740 N  N   . ASN B 1 269 ? -1.413  30.119  -24.180 1.00 33.54 ? 269 ASN B N   1 
ATOM   4741 C  CA  . ASN B 1 269 ? -2.660  29.935  -24.914 1.00 34.03 ? 269 ASN B CA  1 
ATOM   4742 C  C   . ASN B 1 269 ? -2.621  30.528  -26.312 1.00 35.45 ? 269 ASN B C   1 
ATOM   4743 O  O   . ASN B 1 269 ? -1.616  31.109  -26.718 1.00 36.56 ? 269 ASN B O   1 
ATOM   4744 C  CB  . ASN B 1 269 ? -3.839  30.511  -24.137 1.00 32.02 ? 269 ASN B CB  1 
ATOM   4745 C  CG  . ASN B 1 269 ? -3.720  31.993  -23.919 1.00 34.43 ? 269 ASN B CG  1 
ATOM   4746 O  OD1 . ASN B 1 269 ? -3.269  32.731  -24.802 1.00 33.51 ? 269 ASN B OD1 1 
ATOM   4747 N  ND2 . ASN B 1 269 ? -4.142  32.450  -22.744 1.00 32.68 ? 269 ASN B ND2 1 
ATOM   4748 N  N   . GLU B 1 270 ? -3.723  30.379  -27.044 1.00 37.49 ? 270 GLU B N   1 
ATOM   4749 C  CA  . GLU B 1 270 ? -3.808  30.878  -28.416 1.00 40.06 ? 270 GLU B CA  1 
ATOM   4750 C  C   . GLU B 1 270 ? -3.554  32.379  -28.522 1.00 40.51 ? 270 GLU B C   1 
ATOM   4751 O  O   . GLU B 1 270 ? -3.177  32.875  -29.578 1.00 40.64 ? 270 GLU B O   1 
ATOM   4752 C  CB  . GLU B 1 270 ? -5.178  30.563  -29.024 1.00 39.79 ? 270 GLU B CB  1 
ATOM   4753 C  CG  . GLU B 1 270 ? -5.639  29.129  -28.861 1.00 42.57 ? 270 GLU B CG  1 
ATOM   4754 C  CD  . GLU B 1 270 ? -6.320  28.876  -27.522 1.00 44.60 ? 270 GLU B CD  1 
ATOM   4755 O  OE1 . GLU B 1 270 ? -6.949  27.798  -27.379 1.00 44.56 ? 270 GLU B OE1 1 
ATOM   4756 O  OE2 . GLU B 1 270 ? -6.229  29.749  -26.622 1.00 41.94 ? 270 GLU B OE2 1 
ATOM   4757 N  N   . ASP B 1 271 ? -3.769  33.101  -27.431 1.00 41.88 ? 271 ASP B N   1 
ATOM   4758 C  CA  . ASP B 1 271 ? -3.549  34.540  -27.436 1.00 41.96 ? 271 ASP B CA  1 
ATOM   4759 C  C   . ASP B 1 271 ? -2.096  34.845  -27.095 1.00 41.13 ? 271 ASP B C   1 
ATOM   4760 O  O   . ASP B 1 271 ? -1.686  36.007  -27.053 1.00 42.92 ? 271 ASP B O   1 
ATOM   4761 C  CB  . ASP B 1 271 ? -4.488  35.219  -26.438 1.00 42.84 ? 271 ASP B CB  1 
ATOM   4762 C  CG  . ASP B 1 271 ? -5.942  34.898  -26.708 1.00 44.34 ? 271 ASP B CG  1 
ATOM   4763 O  OD1 . ASP B 1 271 ? -6.408  35.167  -27.835 1.00 43.50 ? 271 ASP B OD1 1 
ATOM   4764 O  OD2 . ASP B 1 271 ? -6.617  34.372  -25.797 1.00 45.87 ? 271 ASP B OD2 1 
ATOM   4765 N  N   . GLY B 1 272 ? -1.321  33.793  -26.847 1.00 38.58 ? 272 GLY B N   1 
ATOM   4766 C  CA  . GLY B 1 272 ? 0.085   33.969  -26.541 1.00 35.45 ? 272 GLY B CA  1 
ATOM   4767 C  C   . GLY B 1 272 ? 0.427   34.278  -25.097 1.00 35.35 ? 272 GLY B C   1 
ATOM   4768 O  O   . GLY B 1 272 ? 1.592   34.518  -24.782 1.00 37.16 ? 272 GLY B O   1 
ATOM   4769 N  N   . GLU B 1 273 ? -0.562  34.280  -24.211 1.00 33.17 ? 273 GLU B N   1 
ATOM   4770 C  CA  . GLU B 1 273 ? -0.282  34.567  -22.812 1.00 33.66 ? 273 GLU B CA  1 
ATOM   4771 C  C   . GLU B 1 273 ? -0.114  33.282  -22.004 1.00 30.88 ? 273 GLU B C   1 
ATOM   4772 O  O   . GLU B 1 273 ? -0.816  32.301  -22.227 1.00 30.56 ? 273 GLU B O   1 
ATOM   4773 C  CB  . GLU B 1 273 ? -1.403  35.401  -22.184 1.00 35.34 ? 273 GLU B CB  1 
ATOM   4774 C  CG  . GLU B 1 273 ? -2.365  36.050  -23.163 1.00 39.07 ? 273 GLU B CG  1 
ATOM   4775 C  CD  . GLU B 1 273 ? -3.722  36.323  -22.522 1.00 41.43 ? 273 GLU B CD  1 
ATOM   4776 O  OE1 . GLU B 1 273 ? -3.761  37.043  -21.500 1.00 44.45 ? 273 GLU B OE1 1 
ATOM   4777 O  OE2 . GLU B 1 273 ? -4.745  35.810  -23.031 1.00 41.40 ? 273 GLU B OE2 1 
ATOM   4778 N  N   . GLU B 1 274 ? 0.830   33.305  -21.069 1.00 30.07 ? 274 GLU B N   1 
ATOM   4779 C  CA  . GLU B 1 274 ? 1.104   32.179  -20.189 1.00 30.15 ? 274 GLU B CA  1 
ATOM   4780 C  C   . GLU B 1 274 ? -0.211  31.929  -19.454 1.00 29.83 ? 274 GLU B C   1 
ATOM   4781 O  O   . GLU B 1 274 ? -0.851  32.869  -18.983 1.00 27.72 ? 274 GLU B O   1 
ATOM   4782 C  CB  . GLU B 1 274 ? 2.214   32.563  -19.212 1.00 31.33 ? 274 GLU B CB  1 
ATOM   4783 C  CG  . GLU B 1 274 ? 2.716   31.451  -18.298 1.00 33.48 ? 274 GLU B CG  1 
ATOM   4784 C  CD  . GLU B 1 274 ? 3.814   31.947  -17.367 1.00 34.38 ? 274 GLU B CD  1 
ATOM   4785 O  OE1 . GLU B 1 274 ? 4.292   31.171  -16.512 1.00 33.77 ? 274 GLU B OE1 1 
ATOM   4786 O  OE2 . GLU B 1 274 ? 4.204   33.128  -17.493 1.00 37.52 ? 274 GLU B OE2 1 
ATOM   4787 N  N   . GLU B 1 275 ? -0.617  30.666  -19.359 1.00 28.86 ? 275 GLU B N   1 
ATOM   4788 C  CA  . GLU B 1 275 ? -1.890  30.343  -18.730 1.00 27.11 ? 275 GLU B CA  1 
ATOM   4789 C  C   . GLU B 1 275 ? -1.933  28.950  -18.121 1.00 28.18 ? 275 GLU B C   1 
ATOM   4790 O  O   . GLU B 1 275 ? -1.224  28.038  -18.540 1.00 27.65 ? 275 GLU B O   1 
ATOM   4791 C  CB  . GLU B 1 275 ? -3.003  30.472  -19.783 1.00 28.47 ? 275 GLU B CB  1 
ATOM   4792 C  CG  . GLU B 1 275 ? -4.390  29.958  -19.394 1.00 27.27 ? 275 GLU B CG  1 
ATOM   4793 C  CD  . GLU B 1 275 ? -5.358  29.939  -20.578 1.00 29.39 ? 275 GLU B CD  1 
ATOM   4794 O  OE1 . GLU B 1 275 ? -5.256  29.036  -21.436 1.00 29.58 ? 275 GLU B OE1 1 
ATOM   4795 O  OE2 . GLU B 1 275 ? -6.221  30.837  -20.661 1.00 31.09 ? 275 GLU B OE2 1 
ATOM   4796 N  N   . LEU B 1 276 ? -2.780  28.808  -17.113 1.00 27.68 ? 276 LEU B N   1 
ATOM   4797 C  CA  . LEU B 1 276 ? -3.001  27.537  -16.447 1.00 25.80 ? 276 LEU B CA  1 
ATOM   4798 C  C   . LEU B 1 276 ? -4.502  27.388  -16.695 1.00 24.53 ? 276 LEU B C   1 
ATOM   4799 O  O   . LEU B 1 276 ? -5.288  28.280  -16.370 1.00 23.15 ? 276 LEU B O   1 
ATOM   4800 C  CB  . LEU B 1 276 ? -2.662  27.650  -14.948 1.00 24.25 ? 276 LEU B CB  1 
ATOM   4801 C  CG  . LEU B 1 276 ? -2.742  26.433  -14.007 1.00 22.61 ? 276 LEU B CG  1 
ATOM   4802 C  CD1 . LEU B 1 276 ? -4.124  26.320  -13.479 1.00 23.91 ? 276 LEU B CD1 1 
ATOM   4803 C  CD2 . LEU B 1 276 ? -2.314  25.153  -14.704 1.00 21.67 ? 276 LEU B CD2 1 
ATOM   4804 N  N   . ALA B 1 277 ? -4.897  26.280  -17.303 1.00 22.54 ? 277 ALA B N   1 
ATOM   4805 C  CA  . ALA B 1 277 ? -6.294  26.081  -17.627 1.00 20.76 ? 277 ALA B CA  1 
ATOM   4806 C  C   . ALA B 1 277 ? -6.837  24.753  -17.156 1.00 20.27 ? 277 ALA B C   1 
ATOM   4807 O  O   . ALA B 1 277 ? -6.104  23.774  -17.044 1.00 18.09 ? 277 ALA B O   1 
ATOM   4808 C  CB  . ALA B 1 277 ? -6.480  26.202  -19.137 1.00 19.40 ? 277 ALA B CB  1 
ATOM   4809 N  N   . THR B 1 278 ? -8.141  24.731  -16.909 1.00 21.55 ? 278 THR B N   1 
ATOM   4810 C  CA  . THR B 1 278 ? -8.831  23.522  -16.476 1.00 22.95 ? 278 THR B CA  1 
ATOM   4811 C  C   . THR B 1 278 ? -10.282 23.596  -16.969 1.00 21.77 ? 278 THR B C   1 
ATOM   4812 O  O   . THR B 1 278 ? -10.867 24.680  -17.044 1.00 23.52 ? 278 THR B O   1 
ATOM   4813 C  CB  . THR B 1 278 ? -8.781  23.377  -14.923 1.00 21.97 ? 278 THR B CB  1 
ATOM   4814 O  OG1 . THR B 1 278 ? -9.229  22.070  -14.548 1.00 22.33 ? 278 THR B OG1 1 
ATOM   4815 C  CG2 . THR B 1 278 ? -9.658  24.421  -14.247 1.00 21.76 ? 278 THR B CG2 1 
ATOM   4816 N  N   . PRO B 1 279 ? -10.872 22.451  -17.340 1.00 23.16 ? 279 PRO B N   1 
ATOM   4817 C  CA  . PRO B 1 279 ? -12.259 22.454  -17.821 1.00 23.43 ? 279 PRO B CA  1 
ATOM   4818 C  C   . PRO B 1 279 ? -13.216 23.146  -16.862 1.00 23.62 ? 279 PRO B C   1 
ATOM   4819 O  O   . PRO B 1 279 ? -12.979 23.195  -15.662 1.00 27.03 ? 279 PRO B O   1 
ATOM   4820 C  CB  . PRO B 1 279 ? -12.566 20.974  -17.975 1.00 18.32 ? 279 PRO B CB  1 
ATOM   4821 C  CG  . PRO B 1 279 ? -11.258 20.436  -18.439 1.00 23.90 ? 279 PRO B CG  1 
ATOM   4822 C  CD  . PRO B 1 279 ? -10.281 21.108  -17.486 1.00 23.90 ? 279 PRO B CD  1 
ATOM   4823 N  N   . PRO B 1 280 ? -14.311 23.702  -17.384 1.00 25.16 ? 280 PRO B N   1 
ATOM   4824 C  CA  . PRO B 1 280 ? -15.261 24.376  -16.501 1.00 25.61 ? 280 PRO B CA  1 
ATOM   4825 C  C   . PRO B 1 280 ? -16.228 23.383  -15.861 1.00 27.25 ? 280 PRO B C   1 
ATOM   4826 O  O   . PRO B 1 280 ? -16.432 22.281  -16.378 1.00 26.49 ? 280 PRO B O   1 
ATOM   4827 C  CB  . PRO B 1 280 ? -15.965 25.339  -17.447 1.00 26.62 ? 280 PRO B CB  1 
ATOM   4828 C  CG  . PRO B 1 280 ? -16.043 24.531  -18.711 1.00 25.71 ? 280 PRO B CG  1 
ATOM   4829 C  CD  . PRO B 1 280 ? -14.651 23.933  -18.801 1.00 24.02 ? 280 PRO B CD  1 
ATOM   4830 N  N   . LEU B 1 281 ? -16.817 23.775  -14.734 1.00 28.04 ? 281 LEU B N   1 
ATOM   4831 C  CA  . LEU B 1 281 ? -17.782 22.926  -14.045 1.00 28.32 ? 281 LEU B CA  1 
ATOM   4832 C  C   . LEU B 1 281 ? -19.140 23.125  -14.702 1.00 29.18 ? 281 LEU B C   1 
ATOM   4833 O  O   . LEU B 1 281 ? -19.983 23.866  -14.196 1.00 30.78 ? 281 LEU B O   1 
ATOM   4834 C  CB  . LEU B 1 281 ? -17.878 23.295  -12.562 1.00 27.20 ? 281 LEU B CB  1 
ATOM   4835 C  CG  . LEU B 1 281 ? -16.619 23.147  -11.702 1.00 29.42 ? 281 LEU B CG  1 
ATOM   4836 C  CD1 . LEU B 1 281 ? -16.962 23.490  -10.255 1.00 26.17 ? 281 LEU B CD1 1 
ATOM   4837 C  CD2 . LEU B 1 281 ? -16.077 21.718  -11.799 1.00 24.92 ? 281 LEU B CD2 1 
ATOM   4838 N  N   . ASP B 1 282 ? -19.338 22.458  -15.834 1.00 28.76 ? 282 ASP B N   1 
ATOM   4839 C  CA  . ASP B 1 282 ? -20.580 22.548  -16.592 1.00 28.99 ? 282 ASP B CA  1 
ATOM   4840 C  C   . ASP B 1 282 ? -21.470 21.329  -16.393 1.00 28.29 ? 282 ASP B C   1 
ATOM   4841 O  O   . ASP B 1 282 ? -22.431 21.141  -17.141 1.00 30.17 ? 282 ASP B O   1 
ATOM   4842 C  CB  . ASP B 1 282 ? -20.279 22.703  -18.093 1.00 29.21 ? 282 ASP B CB  1 
ATOM   4843 C  CG  . ASP B 1 282 ? -19.541 21.495  -18.681 1.00 28.58 ? 282 ASP B CG  1 
ATOM   4844 O  OD1 . ASP B 1 282 ? -19.278 21.489  -19.906 1.00 27.66 ? 282 ASP B OD1 1 
ATOM   4845 O  OD2 . ASP B 1 282 ? -19.220 20.550  -17.926 1.00 29.83 ? 282 ASP B OD2 1 
ATOM   4846 N  N   . GLY B 1 283 ? -21.149 20.499  -15.404 1.00 25.68 ? 283 GLY B N   1 
ATOM   4847 C  CA  . GLY B 1 283 ? -21.956 19.317  -15.160 1.00 25.33 ? 283 GLY B CA  1 
ATOM   4848 C  C   . GLY B 1 283 ? -21.321 17.968  -15.491 1.00 25.22 ? 283 GLY B C   1 
ATOM   4849 O  O   . GLY B 1 283 ? -21.798 16.944  -15.019 1.00 23.41 ? 283 GLY B O   1 
ATOM   4850 N  N   . ILE B 1 284 ? -20.265 17.941  -16.301 1.00 24.94 ? 284 ILE B N   1 
ATOM   4851 C  CA  . ILE B 1 284 ? -19.623 16.667  -16.625 1.00 25.77 ? 284 ILE B CA  1 
ATOM   4852 C  C   . ILE B 1 284 ? -18.282 16.551  -15.909 1.00 26.29 ? 284 ILE B C   1 
ATOM   4853 O  O   . ILE B 1 284 ? -17.519 15.606  -16.135 1.00 25.57 ? 284 ILE B O   1 
ATOM   4854 C  CB  . ILE B 1 284 ? -19.385 16.497  -18.154 1.00 26.59 ? 284 ILE B CB  1 
ATOM   4855 C  CG1 . ILE B 1 284 ? -18.303 17.464  -18.640 1.00 27.86 ? 284 ILE B CG1 1 
ATOM   4856 C  CG2 . ILE B 1 284 ? -20.685 16.705  -18.904 1.00 28.34 ? 284 ILE B CG2 1 
ATOM   4857 C  CD1 . ILE B 1 284 ? -17.958 17.322  -20.122 1.00 24.95 ? 284 ILE B CD1 1 
ATOM   4858 N  N   . ILE B 1 285 ? -18.008 17.525  -15.044 1.00 25.96 ? 285 ILE B N   1 
ATOM   4859 C  CA  . ILE B 1 285 ? -16.767 17.571  -14.282 1.00 25.68 ? 285 ILE B CA  1 
ATOM   4860 C  C   . ILE B 1 285 ? -17.067 17.497  -12.788 1.00 25.80 ? 285 ILE B C   1 
ATOM   4861 O  O   . ILE B 1 285 ? -17.969 18.171  -12.289 1.00 26.78 ? 285 ILE B O   1 
ATOM   4862 C  CB  . ILE B 1 285 ? -15.983 18.889  -14.557 1.00 26.58 ? 285 ILE B CB  1 
ATOM   4863 C  CG1 . ILE B 1 285 ? -15.699 19.040  -16.050 1.00 26.66 ? 285 ILE B CG1 1 
ATOM   4864 C  CG2 . ILE B 1 285 ? -14.661 18.882  -13.810 1.00 26.55 ? 285 ILE B CG2 1 
ATOM   4865 C  CD1 . ILE B 1 285 ? -14.854 17.929  -16.629 1.00 26.81 ? 285 ILE B CD1 1 
ATOM   4866 N  N   . LEU B 1 286 ? -16.315 16.671  -12.074 1.00 25.67 ? 286 LEU B N   1 
ATOM   4867 C  CA  . LEU B 1 286 ? -16.505 16.551  -10.640 1.00 25.99 ? 286 LEU B CA  1 
ATOM   4868 C  C   . LEU B 1 286 ? -15.697 17.671  -9.999  1.00 25.77 ? 286 LEU B C   1 
ATOM   4869 O  O   . LEU B 1 286 ? -14.520 17.863  -10.308 1.00 23.00 ? 286 LEU B O   1 
ATOM   4870 C  CB  . LEU B 1 286 ? -16.032 15.182  -10.153 1.00 29.75 ? 286 LEU B CB  1 
ATOM   4871 C  CG  . LEU B 1 286 ? -16.648 14.777  -8.815  1.00 30.85 ? 286 LEU B CG  1 
ATOM   4872 C  CD1 . LEU B 1 286 ? -16.849 13.274  -8.777  1.00 32.17 ? 286 LEU B CD1 1 
ATOM   4873 C  CD2 . LEU B 1 286 ? -15.756 15.249  -7.678  1.00 32.82 ? 286 LEU B CD2 1 
ATOM   4874 N  N   . PRO B 1 287 ? -16.335 18.446  -9.114  1.00 25.97 ? 287 PRO B N   1 
ATOM   4875 C  CA  . PRO B 1 287 ? -15.691 19.568  -8.424  1.00 25.42 ? 287 PRO B CA  1 
ATOM   4876 C  C   . PRO B 1 287 ? -14.698 19.124  -7.367  1.00 25.06 ? 287 PRO B C   1 
ATOM   4877 O  O   . PRO B 1 287 ? -15.005 19.153  -6.181  1.00 27.22 ? 287 PRO B O   1 
ATOM   4878 C  CB  . PRO B 1 287 ? -16.873 20.328  -7.807  1.00 27.20 ? 287 PRO B CB  1 
ATOM   4879 C  CG  . PRO B 1 287 ? -18.089 19.842  -8.602  1.00 24.64 ? 287 PRO B CG  1 
ATOM   4880 C  CD  . PRO B 1 287 ? -17.771 18.392  -8.796  1.00 24.55 ? 287 PRO B CD  1 
ATOM   4881 N  N   . GLY B 1 288 ? -13.507 18.728  -7.797  1.00 24.13 ? 288 GLY B N   1 
ATOM   4882 C  CA  . GLY B 1 288 ? -12.500 18.285  -6.854  1.00 23.54 ? 288 GLY B CA  1 
ATOM   4883 C  C   . GLY B 1 288 ? -12.091 19.356  -5.861  1.00 24.89 ? 288 GLY B C   1 
ATOM   4884 O  O   . GLY B 1 288 ? -12.126 20.552  -6.173  1.00 25.12 ? 288 GLY B O   1 
ATOM   4885 N  N   . VAL B 1 289 ? -11.721 18.937  -4.651  1.00 23.41 ? 289 VAL B N   1 
ATOM   4886 C  CA  . VAL B 1 289 ? -11.278 19.881  -3.639  1.00 22.90 ? 289 VAL B CA  1 
ATOM   4887 C  C   . VAL B 1 289 ? -9.898  20.367  -4.075  1.00 23.97 ? 289 VAL B C   1 
ATOM   4888 O  O   . VAL B 1 289 ? -9.590  21.564  -4.004  1.00 24.60 ? 289 VAL B O   1 
ATOM   4889 C  CB  . VAL B 1 289 ? -11.177 19.213  -2.241  1.00 25.10 ? 289 VAL B CB  1 
ATOM   4890 C  CG1 . VAL B 1 289 ? -10.488 20.155  -1.255  1.00 20.88 ? 289 VAL B CG1 1 
ATOM   4891 C  CG2 . VAL B 1 289 ? -12.573 18.864  -1.735  1.00 22.12 ? 289 VAL B CG2 1 
ATOM   4892 N  N   . THR B 1 290 ? -9.084  19.429  -4.558  1.00 23.09 ? 290 THR B N   1 
ATOM   4893 C  CA  . THR B 1 290 ? -7.736  19.741  -5.011  1.00 23.49 ? 290 THR B CA  1 
ATOM   4894 C  C   . THR B 1 290 ? -7.852  20.780  -6.109  1.00 24.84 ? 290 THR B C   1 
ATOM   4895 O  O   . THR B 1 290 ? -7.165  21.800  -6.086  1.00 24.63 ? 290 THR B O   1 
ATOM   4896 C  CB  . THR B 1 290 ? -7.001  18.492  -5.578  1.00 24.05 ? 290 THR B CB  1 
ATOM   4897 O  OG1 . THR B 1 290 ? -7.255  17.346  -4.748  1.00 19.81 ? 290 THR B OG1 1 
ATOM   4898 C  CG2 . THR B 1 290 ? -5.490  18.745  -5.607  1.00 21.06 ? 290 THR B CG2 1 
ATOM   4899 N  N   . ARG B 1 291 ? -8.742  20.514  -7.060  1.00 25.97 ? 291 ARG B N   1 
ATOM   4900 C  CA  . ARG B 1 291 ? -8.980  21.413  -8.184  1.00 26.52 ? 291 ARG B CA  1 
ATOM   4901 C  C   . ARG B 1 291 ? -9.203  22.856  -7.710  1.00 28.65 ? 291 ARG B C   1 
ATOM   4902 O  O   . ARG B 1 291 ? -8.540  23.779  -8.185  1.00 30.09 ? 291 ARG B O   1 
ATOM   4903 C  CB  . ARG B 1 291 ? -10.198 20.930  -8.984  1.00 24.35 ? 291 ARG B CB  1 
ATOM   4904 C  CG  . ARG B 1 291 ? -10.556 21.770  -10.225 1.00 20.18 ? 291 ARG B CG  1 
ATOM   4905 C  CD  . ARG B 1 291 ? -11.840 21.252  -10.873 1.00 19.65 ? 291 ARG B CD  1 
ATOM   4906 N  NE  . ARG B 1 291 ? -12.304 22.097  -11.974 1.00 24.76 ? 291 ARG B NE  1 
ATOM   4907 C  CZ  . ARG B 1 291 ? -12.732 23.355  -11.845 1.00 23.24 ? 291 ARG B CZ  1 
ATOM   4908 N  NH1 . ARG B 1 291 ? -12.769 23.940  -10.651 1.00 24.20 ? 291 ARG B NH1 1 
ATOM   4909 N  NH2 . ARG B 1 291 ? -13.111 24.037  -12.920 1.00 20.91 ? 291 ARG B NH2 1 
ATOM   4910 N  N   . ARG B 1 292 ? -10.127 23.044  -6.770  1.00 29.33 ? 292 ARG B N   1 
ATOM   4911 C  CA  . ARG B 1 292 ? -10.427 24.381  -6.263  1.00 29.43 ? 292 ARG B CA  1 
ATOM   4912 C  C   . ARG B 1 292 ? -9.230  25.027  -5.577  1.00 29.76 ? 292 ARG B C   1 
ATOM   4913 O  O   . ARG B 1 292 ? -8.992  26.229  -5.731  1.00 31.65 ? 292 ARG B O   1 
ATOM   4914 C  CB  . ARG B 1 292 ? -11.623 24.338  -5.302  1.00 30.15 ? 292 ARG B CB  1 
ATOM   4915 C  CG  . ARG B 1 292 ? -12.031 25.708  -4.721  1.00 35.07 ? 292 ARG B CG  1 
ATOM   4916 C  CD  . ARG B 1 292 ? -12.076 26.819  -5.789  1.00 38.89 ? 292 ARG B CD  1 
ATOM   4917 N  NE  . ARG B 1 292 ? -12.899 26.450  -6.942  1.00 42.29 ? 292 ARG B NE  1 
ATOM   4918 C  CZ  . ARG B 1 292 ? -13.096 27.218  -8.014  1.00 45.41 ? 292 ARG B CZ  1 
ATOM   4919 N  NH1 . ARG B 1 292 ? -12.525 28.418  -8.092  1.00 45.10 ? 292 ARG B NH1 1 
ATOM   4920 N  NH2 . ARG B 1 292 ? -13.865 26.781  -9.013  1.00 44.12 ? 292 ARG B NH2 1 
ATOM   4921 N  N   . CYS B 1 293 ? -8.473  24.231  -4.829  1.00 27.69 ? 293 CYS B N   1 
ATOM   4922 C  CA  . CYS B 1 293 ? -7.304  24.748  -4.133  1.00 26.36 ? 293 CYS B CA  1 
ATOM   4923 C  C   . CYS B 1 293 ? -6.201  25.228  -5.077  1.00 26.25 ? 293 CYS B C   1 
ATOM   4924 O  O   . CYS B 1 293 ? -5.571  26.258  -4.829  1.00 27.22 ? 293 CYS B O   1 
ATOM   4925 C  CB  . CYS B 1 293 ? -6.756  23.688  -3.172  1.00 26.78 ? 293 CYS B CB  1 
ATOM   4926 S  SG  . CYS B 1 293 ? -7.763  23.510  -1.681  1.00 27.60 ? 293 CYS B SG  1 
ATOM   4927 N  N   . ILE B 1 294 ? -5.965  24.483  -6.153  1.00 24.98 ? 294 ILE B N   1 
ATOM   4928 C  CA  . ILE B 1 294 ? -4.943  24.861  -7.121  1.00 24.04 ? 294 ILE B CA  1 
ATOM   4929 C  C   . ILE B 1 294 ? -5.376  26.167  -7.788  1.00 23.05 ? 294 ILE B C   1 
ATOM   4930 O  O   . ILE B 1 294 ? -4.568  27.069  -7.993  1.00 22.26 ? 294 ILE B O   1 
ATOM   4931 C  CB  . ILE B 1 294 ? -4.735  23.743  -8.174  1.00 23.67 ? 294 ILE B CB  1 
ATOM   4932 C  CG1 . ILE B 1 294 ? -3.997  22.575  -7.524  1.00 23.90 ? 294 ILE B CG1 1 
ATOM   4933 C  CG2 . ILE B 1 294 ? -3.939  24.260  -9.372  1.00 20.18 ? 294 ILE B CG2 1 
ATOM   4934 C  CD1 . ILE B 1 294 ? -3.909  21.331  -8.394  1.00 24.81 ? 294 ILE B CD1 1 
ATOM   4935 N  N   . LEU B 1 295 ? -6.657  26.273  -8.111  1.00 23.18 ? 295 LEU B N   1 
ATOM   4936 C  CA  . LEU B 1 295 ? -7.164  27.498  -8.708  1.00 24.87 ? 295 LEU B CA  1 
ATOM   4937 C  C   . LEU B 1 295 ? -6.981  28.640  -7.703  1.00 25.46 ? 295 LEU B C   1 
ATOM   4938 O  O   . LEU B 1 295 ? -6.586  29.739  -8.075  1.00 27.78 ? 295 LEU B O   1 
ATOM   4939 C  CB  . LEU B 1 295 ? -8.637  27.334  -9.097  1.00 21.67 ? 295 LEU B CB  1 
ATOM   4940 C  CG  . LEU B 1 295 ? -8.836  26.465  -10.353 1.00 24.19 ? 295 LEU B CG  1 
ATOM   4941 C  CD1 . LEU B 1 295 ? -10.315 26.172  -10.602 1.00 20.73 ? 295 LEU B CD1 1 
ATOM   4942 C  CD2 . LEU B 1 295 ? -8.236  27.191  -11.549 1.00 21.61 ? 295 LEU B CD2 1 
ATOM   4943 N  N   . ASP B 1 296 ? -7.238  28.371  -6.427  1.00 25.60 ? 296 ASP B N   1 
ATOM   4944 C  CA  . ASP B 1 296 ? -7.074  29.399  -5.405  1.00 25.31 ? 296 ASP B CA  1 
ATOM   4945 C  C   . ASP B 1 296 ? -5.618  29.865  -5.282  1.00 23.91 ? 296 ASP B C   1 
ATOM   4946 O  O   . ASP B 1 296 ? -5.357  31.066  -5.215  1.00 21.13 ? 296 ASP B O   1 
ATOM   4947 C  CB  . ASP B 1 296 ? -7.569  28.895  -4.043  1.00 27.40 ? 296 ASP B CB  1 
ATOM   4948 C  CG  . ASP B 1 296 ? -9.077  28.800  -3.968  1.00 29.78 ? 296 ASP B CG  1 
ATOM   4949 O  OD1 . ASP B 1 296 ? -9.754  29.315  -4.888  1.00 28.90 ? 296 ASP B OD1 1 
ATOM   4950 O  OD2 . ASP B 1 296 ? -9.585  28.221  -2.979  1.00 30.26 ? 296 ASP B OD2 1 
ATOM   4951 N  N   . LEU B 1 297 ? -4.678  28.920  -5.248  1.00 23.29 ? 297 LEU B N   1 
ATOM   4952 C  CA  . LEU B 1 297 ? -3.258  29.261  -5.148  1.00 24.61 ? 297 LEU B CA  1 
ATOM   4953 C  C   . LEU B 1 297 ? -2.800  29.971  -6.419  1.00 26.78 ? 297 LEU B C   1 
ATOM   4954 O  O   . LEU B 1 297 ? -2.027  30.931  -6.357  1.00 29.31 ? 297 LEU B O   1 
ATOM   4955 C  CB  . LEU B 1 297 ? -2.410  28.006  -4.946  1.00 24.99 ? 297 LEU B CB  1 
ATOM   4956 C  CG  . LEU B 1 297 ? -2.608  27.241  -3.638  1.00 25.72 ? 297 LEU B CG  1 
ATOM   4957 C  CD1 . LEU B 1 297 ? -1.786  25.953  -3.662  1.00 25.66 ? 297 LEU B CD1 1 
ATOM   4958 C  CD2 . LEU B 1 297 ? -2.195  28.123  -2.473  1.00 22.21 ? 297 LEU B CD2 1 
ATOM   4959 N  N   . ALA B 1 298 ? -3.284  29.497  -7.567  1.00 26.17 ? 298 ALA B N   1 
ATOM   4960 C  CA  . ALA B 1 298 ? -2.933  30.090  -8.858  1.00 26.08 ? 298 ALA B CA  1 
ATOM   4961 C  C   . ALA B 1 298 ? -3.420  31.532  -8.918  1.00 26.93 ? 298 ALA B C   1 
ATOM   4962 O  O   . ALA B 1 298 ? -2.668  32.431  -9.280  1.00 23.66 ? 298 ALA B O   1 
ATOM   4963 C  CB  . ALA B 1 298 ? -3.558  29.290  -10.002 1.00 24.64 ? 298 ALA B CB  1 
ATOM   4964 N  N   . HIS B 1 299 ? -4.688  31.748  -8.579  1.00 27.20 ? 299 HIS B N   1 
ATOM   4965 C  CA  . HIS B 1 299 ? -5.231  33.099  -8.595  1.00 29.40 ? 299 HIS B CA  1 
ATOM   4966 C  C   . HIS B 1 299 ? -4.437  33.963  -7.628  1.00 29.24 ? 299 HIS B C   1 
ATOM   4967 O  O   . HIS B 1 299 ? -4.091  35.092  -7.953  1.00 29.26 ? 299 HIS B O   1 
ATOM   4968 C  CB  . HIS B 1 299 ? -6.709  33.105  -8.196  1.00 28.92 ? 299 HIS B CB  1 
ATOM   4969 C  CG  . HIS B 1 299 ? -7.636  32.725  -9.309  1.00 31.75 ? 299 HIS B CG  1 
ATOM   4970 N  ND1 . HIS B 1 299 ? -7.685  33.413  -10.502 1.00 32.27 ? 299 HIS B ND1 1 
ATOM   4971 C  CD2 . HIS B 1 299 ? -8.571  31.749  -9.400  1.00 30.78 ? 299 HIS B CD2 1 
ATOM   4972 C  CE1 . HIS B 1 299 ? -8.613  32.880  -11.279 1.00 30.99 ? 299 HIS B CE1 1 
ATOM   4973 N  NE2 . HIS B 1 299 ? -9.166  31.869  -10.633 1.00 31.99 ? 299 HIS B NE2 1 
ATOM   4974 N  N   . GLN B 1 300 ? -4.132  33.411  -6.454  1.00 28.84 ? 300 GLN B N   1 
ATOM   4975 C  CA  . GLN B 1 300 ? -3.385  34.125  -5.428  1.00 27.40 ? 300 GLN B CA  1 
ATOM   4976 C  C   . GLN B 1 300 ? -1.977  34.554  -5.842  1.00 28.67 ? 300 GLN B C   1 
ATOM   4977 O  O   . GLN B 1 300 ? -1.535  35.649  -5.488  1.00 30.41 ? 300 GLN B O   1 
ATOM   4978 C  CB  . GLN B 1 300 ? -3.304  33.277  -4.158  1.00 28.89 ? 300 GLN B CB  1 
ATOM   4979 C  CG  . GLN B 1 300 ? -2.457  33.903  -3.066  1.00 31.17 ? 300 GLN B CG  1 
ATOM   4980 C  CD  . GLN B 1 300 ? -2.095  32.932  -1.948  1.00 32.76 ? 300 GLN B CD  1 
ATOM   4981 O  OE1 . GLN B 1 300 ? -1.179  33.192  -1.174  1.00 34.49 ? 300 GLN B OE1 1 
ATOM   4982 N  NE2 . GLN B 1 300 ? -2.814  31.816  -1.858  1.00 32.58 ? 300 GLN B NE2 1 
ATOM   4983 N  N   . TRP B 1 301 ? -1.260  33.711  -6.579  1.00 27.07 ? 301 TRP B N   1 
ATOM   4984 C  CA  . TRP B 1 301 ? 0.092   34.089  -6.988  1.00 25.86 ? 301 TRP B CA  1 
ATOM   4985 C  C   . TRP B 1 301 ? 0.083   35.138  -8.097  1.00 23.70 ? 301 TRP B C   1 
ATOM   4986 O  O   . TRP B 1 301 ? 1.024   35.912  -8.233  1.00 20.96 ? 301 TRP B O   1 
ATOM   4987 C  CB  . TRP B 1 301 ? 0.897   32.868  -7.447  1.00 25.00 ? 301 TRP B CB  1 
ATOM   4988 C  CG  . TRP B 1 301 ? 1.153   31.853  -6.363  1.00 25.82 ? 301 TRP B CG  1 
ATOM   4989 C  CD1 . TRP B 1 301 ? 1.399   32.104  -5.044  1.00 25.27 ? 301 TRP B CD1 1 
ATOM   4990 C  CD2 . TRP B 1 301 ? 1.233   30.429  -6.522  1.00 23.36 ? 301 TRP B CD2 1 
ATOM   4991 N  NE1 . TRP B 1 301 ? 1.629   30.924  -4.372  1.00 26.41 ? 301 TRP B NE1 1 
ATOM   4992 C  CE2 . TRP B 1 301 ? 1.533   29.883  -5.255  1.00 23.66 ? 301 TRP B CE2 1 
ATOM   4993 C  CE3 . TRP B 1 301 ? 1.081   29.563  -7.615  1.00 22.10 ? 301 TRP B CE3 1 
ATOM   4994 C  CZ2 . TRP B 1 301 ? 1.683   28.509  -5.048  1.00 24.32 ? 301 TRP B CZ2 1 
ATOM   4995 C  CZ3 . TRP B 1 301 ? 1.231   28.199  -7.409  1.00 21.72 ? 301 TRP B CZ3 1 
ATOM   4996 C  CH2 . TRP B 1 301 ? 1.529   27.685  -6.134  1.00 20.28 ? 301 TRP B CH2 1 
ATOM   4997 N  N   . GLY B 1 302 ? -0.986  35.150  -8.886  1.00 24.20 ? 302 GLY B N   1 
ATOM   4998 C  CA  . GLY B 1 302 ? -1.120  36.107  -9.972  1.00 24.60 ? 302 GLY B CA  1 
ATOM   4999 C  C   . GLY B 1 302 ? 0.063   36.218  -10.920 1.00 26.16 ? 302 GLY B C   1 
ATOM   5000 O  O   . GLY B 1 302 ? 0.328   37.291  -11.471 1.00 26.58 ? 302 GLY B O   1 
ATOM   5001 N  N   . GLU B 1 303 ? 0.775   35.116  -11.127 1.00 24.57 ? 303 GLU B N   1 
ATOM   5002 C  CA  . GLU B 1 303 ? 1.927   35.130  -12.017 1.00 24.96 ? 303 GLU B CA  1 
ATOM   5003 C  C   . GLU B 1 303 ? 1.584   34.752  -13.460 1.00 26.13 ? 303 GLU B C   1 
ATOM   5004 O  O   . GLU B 1 303 ? 2.373   34.962  -14.376 1.00 24.38 ? 303 GLU B O   1 
ATOM   5005 C  CB  . GLU B 1 303 ? 3.007   34.217  -11.451 1.00 25.65 ? 303 GLU B CB  1 
ATOM   5006 C  CG  . GLU B 1 303 ? 3.541   34.708  -10.117 1.00 25.27 ? 303 GLU B CG  1 
ATOM   5007 C  CD  . GLU B 1 303 ? 4.545   33.756  -9.513  1.00 28.64 ? 303 GLU B CD  1 
ATOM   5008 O  OE1 . GLU B 1 303 ? 5.275   33.103  -10.288 1.00 27.80 ? 303 GLU B OE1 1 
ATOM   5009 O  OE2 . GLU B 1 303 ? 4.613   33.670  -8.267  1.00 28.92 ? 303 GLU B OE2 1 
ATOM   5010 N  N   . PHE B 1 304 ? 0.394   34.199  -13.661 1.00 27.22 ? 304 PHE B N   1 
ATOM   5011 C  CA  . PHE B 1 304 ? -0.054  33.827  -14.999 1.00 27.29 ? 304 PHE B CA  1 
ATOM   5012 C  C   . PHE B 1 304 ? -1.576  33.817  -15.023 1.00 26.96 ? 304 PHE B C   1 
ATOM   5013 O  O   . PHE B 1 304 ? -2.216  33.839  -13.976 1.00 27.46 ? 304 PHE B O   1 
ATOM   5014 C  CB  . PHE B 1 304 ? 0.516   32.459  -15.400 1.00 27.02 ? 304 PHE B CB  1 
ATOM   5015 C  CG  . PHE B 1 304 ? 0.531   31.455  -14.281 1.00 26.28 ? 304 PHE B CG  1 
ATOM   5016 C  CD1 . PHE B 1 304 ? -0.658  30.936  -13.770 1.00 27.87 ? 304 PHE B CD1 1 
ATOM   5017 C  CD2 . PHE B 1 304 ? 1.735   31.045  -13.720 1.00 23.56 ? 304 PHE B CD2 1 
ATOM   5018 C  CE1 . PHE B 1 304 ? -0.645  30.023  -12.711 1.00 27.92 ? 304 PHE B CE1 1 
ATOM   5019 C  CE2 . PHE B 1 304 ? 1.762   30.135  -12.666 1.00 23.59 ? 304 PHE B CE2 1 
ATOM   5020 C  CZ  . PHE B 1 304 ? 0.568   29.624  -12.160 1.00 26.66 ? 304 PHE B CZ  1 
ATOM   5021 N  N   . LYS B 1 305 ? -2.157  33.804  -16.215 1.00 26.86 ? 305 LYS B N   1 
ATOM   5022 C  CA  . LYS B 1 305 ? -3.604  33.806  -16.336 1.00 25.96 ? 305 LYS B CA  1 
ATOM   5023 C  C   . LYS B 1 305 ? -4.133  32.437  -15.914 1.00 27.07 ? 305 LYS B C   1 
ATOM   5024 O  O   . LYS B 1 305 ? -3.520  31.407  -16.210 1.00 23.14 ? 305 LYS B O   1 
ATOM   5025 C  CB  . LYS B 1 305 ? -4.006  34.112  -17.777 1.00 27.65 ? 305 LYS B CB  1 
ATOM   5026 C  CG  . LYS B 1 305 ? -5.483  34.408  -17.966 1.00 30.56 ? 305 LYS B CG  1 
ATOM   5027 C  CD  . LYS B 1 305 ? -5.830  34.454  -19.449 1.00 32.77 ? 305 LYS B CD  1 
ATOM   5028 C  CE  . LYS B 1 305 ? -7.290  34.789  -19.679 1.00 33.82 ? 305 LYS B CE  1 
ATOM   5029 N  NZ  . LYS B 1 305 ? -7.672  34.559  -21.098 1.00 37.00 ? 305 LYS B NZ  1 
ATOM   5030 N  N   . VAL B 1 306 ? -5.269  32.445  -15.219 1.00 27.54 ? 306 VAL B N   1 
ATOM   5031 C  CA  . VAL B 1 306 ? -5.916  31.234  -14.721 1.00 27.02 ? 306 VAL B CA  1 
ATOM   5032 C  C   . VAL B 1 306 ? -7.308  31.157  -15.332 1.00 28.13 ? 306 VAL B C   1 
ATOM   5033 O  O   . VAL B 1 306 ? -8.170  31.981  -15.025 1.00 27.80 ? 306 VAL B O   1 
ATOM   5034 C  CB  . VAL B 1 306 ? -6.057  31.275  -13.184 1.00 27.43 ? 306 VAL B CB  1 
ATOM   5035 C  CG1 . VAL B 1 306 ? -6.704  30.001  -12.690 1.00 27.02 ? 306 VAL B CG1 1 
ATOM   5036 C  CG2 . VAL B 1 306 ? -4.694  31.478  -12.537 1.00 26.79 ? 306 VAL B CG2 1 
ATOM   5037 N  N   . SER B 1 307 ? -7.540  30.155  -16.175 1.00 28.37 ? 307 SER B N   1 
ATOM   5038 C  CA  . SER B 1 307 ? -8.832  30.035  -16.841 1.00 28.41 ? 307 SER B CA  1 
ATOM   5039 C  C   . SER B 1 307 ? -9.578  28.712  -16.692 1.00 28.53 ? 307 SER B C   1 
ATOM   5040 O  O   . SER B 1 307 ? -9.001  27.628  -16.809 1.00 28.03 ? 307 SER B O   1 
ATOM   5041 C  CB  . SER B 1 307 ? -8.659  30.301  -18.339 1.00 27.86 ? 307 SER B CB  1 
ATOM   5042 O  OG  . SER B 1 307 ? -7.893  31.462  -18.579 1.00 29.45 ? 307 SER B OG  1 
ATOM   5043 N  N   . GLU B 1 308 ? -10.876 28.819  -16.442 1.00 28.81 ? 308 GLU B N   1 
ATOM   5044 C  CA  . GLU B 1 308 ? -11.731 27.649  -16.363 1.00 31.21 ? 308 GLU B CA  1 
ATOM   5045 C  C   . GLU B 1 308 ? -12.364 27.690  -17.748 1.00 31.53 ? 308 GLU B C   1 
ATOM   5046 O  O   . GLU B 1 308 ? -13.323 28.428  -17.971 1.00 34.25 ? 308 GLU B O   1 
ATOM   5047 C  CB  . GLU B 1 308 ? -12.781 27.817  -15.254 1.00 30.03 ? 308 GLU B CB  1 
ATOM   5048 C  CG  . GLU B 1 308 ? -12.155 27.995  -13.864 1.00 32.42 ? 308 GLU B CG  1 
ATOM   5049 C  CD  . GLU B 1 308 ? -13.167 27.943  -12.731 1.00 35.66 ? 308 GLU B CD  1 
ATOM   5050 O  OE1 . GLU B 1 308 ? -13.827 26.891  -12.567 1.00 35.61 ? 308 GLU B OE1 1 
ATOM   5051 O  OE2 . GLU B 1 308 ? -13.299 28.953  -11.998 1.00 34.38 ? 308 GLU B OE2 1 
ATOM   5052 N  N   . ARG B 1 309 ? -11.798 26.923  -18.682 1.00 31.34 ? 309 ARG B N   1 
ATOM   5053 C  CA  . ARG B 1 309 ? -12.265 26.893  -20.074 1.00 30.25 ? 309 ARG B CA  1 
ATOM   5054 C  C   . ARG B 1 309 ? -12.172 25.514  -20.715 1.00 30.14 ? 309 ARG B C   1 
ATOM   5055 O  O   . ARG B 1 309 ? -11.544 24.605  -20.179 1.00 30.46 ? 309 ARG B O   1 
ATOM   5056 C  CB  . ARG B 1 309 ? -11.433 27.860  -20.925 1.00 30.44 ? 309 ARG B CB  1 
ATOM   5057 C  CG  . ARG B 1 309 ? -9.925  27.642  -20.764 1.00 29.45 ? 309 ARG B CG  1 
ATOM   5058 C  CD  . ARG B 1 309 ? -9.102  28.344  -21.840 1.00 29.56 ? 309 ARG B CD  1 
ATOM   5059 N  NE  . ARG B 1 309 ? -9.162  27.632  -23.112 1.00 27.42 ? 309 ARG B NE  1 
ATOM   5060 C  CZ  . ARG B 1 309 ? -8.476  27.970  -24.199 1.00 28.12 ? 309 ARG B CZ  1 
ATOM   5061 N  NH1 . ARG B 1 309 ? -7.668  29.025  -24.175 1.00 22.95 ? 309 ARG B NH1 1 
ATOM   5062 N  NH2 . ARG B 1 309 ? -8.588  27.237  -25.308 1.00 26.22 ? 309 ARG B NH2 1 
ATOM   5063 N  N   . TYR B 1 310 ? -12.781 25.370  -21.884 1.00 29.58 ? 310 TYR B N   1 
ATOM   5064 C  CA  . TYR B 1 310 ? -12.745 24.093  -22.579 1.00 31.17 ? 310 TYR B CA  1 
ATOM   5065 C  C   . TYR B 1 310 ? -11.407 23.886  -23.278 1.00 31.29 ? 310 TYR B C   1 
ATOM   5066 O  O   . TYR B 1 310 ? -10.752 24.837  -23.703 1.00 30.54 ? 310 TYR B O   1 
ATOM   5067 C  CB  . TYR B 1 310 ? -13.880 23.997  -23.603 1.00 29.79 ? 310 TYR B CB  1 
ATOM   5068 C  CG  . TYR B 1 310 ? -15.257 24.016  -22.989 1.00 30.10 ? 310 TYR B CG  1 
ATOM   5069 C  CD1 . TYR B 1 310 ? -16.056 25.161  -23.051 1.00 29.50 ? 310 TYR B CD1 1 
ATOM   5070 C  CD2 . TYR B 1 310 ? -15.763 22.890  -22.340 1.00 29.59 ? 310 TYR B CD2 1 
ATOM   5071 C  CE1 . TYR B 1 310 ? -17.327 25.183  -22.482 1.00 28.04 ? 310 TYR B CE1 1 
ATOM   5072 C  CE2 . TYR B 1 310 ? -17.030 22.901  -21.768 1.00 29.00 ? 310 TYR B CE2 1 
ATOM   5073 C  CZ  . TYR B 1 310 ? -17.809 24.048  -21.845 1.00 30.57 ? 310 TYR B CZ  1 
ATOM   5074 O  OH  . TYR B 1 310 ? -19.083 24.044  -21.315 1.00 31.02 ? 310 TYR B OH  1 
ATOM   5075 N  N   . LEU B 1 311 ? -11.003 22.627  -23.383 1.00 30.62 ? 311 LEU B N   1 
ATOM   5076 C  CA  . LEU B 1 311 ? -9.753  22.273  -24.026 1.00 29.67 ? 311 LEU B CA  1 
ATOM   5077 C  C   . LEU B 1 311 ? -10.022 21.043  -24.888 1.00 30.85 ? 311 LEU B C   1 
ATOM   5078 O  O   . LEU B 1 311 ? -10.618 20.073  -24.416 1.00 29.50 ? 311 LEU B O   1 
ATOM   5079 C  CB  . LEU B 1 311 ? -8.708  21.967  -22.953 1.00 31.58 ? 311 LEU B CB  1 
ATOM   5080 C  CG  . LEU B 1 311 ? -8.562  23.044  -21.869 1.00 33.90 ? 311 LEU B CG  1 
ATOM   5081 C  CD1 . LEU B 1 311 ? -7.609  22.577  -20.798 1.00 34.45 ? 311 LEU B CD1 1 
ATOM   5082 C  CD2 . LEU B 1 311 ? -8.063  24.346  -22.494 1.00 35.26 ? 311 LEU B CD2 1 
ATOM   5083 N  N   . THR B 1 312 ? -9.604  21.084  -26.152 1.00 30.51 ? 312 THR B N   1 
ATOM   5084 C  CA  . THR B 1 312 ? -9.825  19.955  -27.059 1.00 30.05 ? 312 THR B CA  1 
ATOM   5085 C  C   . THR B 1 312 ? -8.504  19.357  -27.512 1.00 29.88 ? 312 THR B C   1 
ATOM   5086 O  O   . THR B 1 312 ? -7.461  20.009  -27.422 1.00 27.89 ? 312 THR B O   1 
ATOM   5087 C  CB  . THR B 1 312 ? -10.564 20.398  -28.321 1.00 31.49 ? 312 THR B CB  1 
ATOM   5088 O  OG1 . THR B 1 312 ? -9.690  21.217  -29.111 1.00 33.29 ? 312 THR B OG1 1 
ATOM   5089 C  CG2 . THR B 1 312 ? -11.804 21.187  -27.964 1.00 31.36 ? 312 THR B CG2 1 
ATOM   5090 N  N   . MET B 1 313 ? -8.550  18.126  -28.020 1.00 30.75 ? 313 MET B N   1 
ATOM   5091 C  CA  . MET B 1 313 ? -7.340  17.467  -28.510 1.00 32.04 ? 313 MET B CA  1 
ATOM   5092 C  C   . MET B 1 313 ? -6.627  18.342  -29.540 1.00 33.58 ? 313 MET B C   1 
ATOM   5093 O  O   . MET B 1 313 ? -5.400  18.413  -29.555 1.00 34.15 ? 313 MET B O   1 
ATOM   5094 C  CB  . MET B 1 313 ? -7.670  16.112  -29.139 1.00 33.56 ? 313 MET B CB  1 
ATOM   5095 C  CG  . MET B 1 313 ? -7.950  15.010  -28.137 1.00 35.92 ? 313 MET B CG  1 
ATOM   5096 S  SD  . MET B 1 313 ? -6.578  14.792  -26.987 1.00 38.61 ? 313 MET B SD  1 
ATOM   5097 C  CE  . MET B 1 313 ? -5.391  14.007  -28.023 1.00 37.51 ? 313 MET B CE  1 
ATOM   5098 N  N   . ASP B 1 314 ? -7.389  19.012  -30.401 1.00 34.48 ? 314 ASP B N   1 
ATOM   5099 C  CA  . ASP B 1 314 ? -6.779  19.874  -31.406 1.00 36.54 ? 314 ASP B CA  1 
ATOM   5100 C  C   . ASP B 1 314 ? -6.177  21.125  -30.785 1.00 35.33 ? 314 ASP B C   1 
ATOM   5101 O  O   . ASP B 1 314 ? -5.215  21.668  -31.317 1.00 36.07 ? 314 ASP B O   1 
ATOM   5102 C  CB  . ASP B 1 314 ? -7.784  20.234  -32.504 1.00 38.72 ? 314 ASP B CB  1 
ATOM   5103 C  CG  . ASP B 1 314 ? -8.096  19.049  -33.411 1.00 42.47 ? 314 ASP B CG  1 
ATOM   5104 O  OD1 . ASP B 1 314 ? -7.140  18.437  -33.943 1.00 41.35 ? 314 ASP B OD1 1 
ATOM   5105 O  OD2 . ASP B 1 314 ? -9.291  18.725  -33.589 1.00 45.93 ? 314 ASP B OD2 1 
ATOM   5106 N  N   . ASP B 1 315 ? -6.737  21.586  -29.666 1.00 35.90 ? 315 ASP B N   1 
ATOM   5107 C  CA  . ASP B 1 315 ? -6.170  22.749  -28.981 1.00 34.36 ? 315 ASP B CA  1 
ATOM   5108 C  C   . ASP B 1 315 ? -4.803  22.278  -28.472 1.00 35.03 ? 315 ASP B C   1 
ATOM   5109 O  O   . ASP B 1 315 ? -3.819  23.028  -28.483 1.00 37.17 ? 315 ASP B O   1 
ATOM   5110 C  CB  . ASP B 1 315 ? -7.015  23.181  -27.764 1.00 34.81 ? 315 ASP B CB  1 
ATOM   5111 C  CG  . ASP B 1 315 ? -8.249  23.990  -28.140 1.00 35.91 ? 315 ASP B CG  1 
ATOM   5112 O  OD1 . ASP B 1 315 ? -8.296  24.541  -29.255 1.00 37.97 ? 315 ASP B OD1 1 
ATOM   5113 O  OD2 . ASP B 1 315 ? -9.171  24.094  -27.300 1.00 36.60 ? 315 ASP B OD2 1 
ATOM   5114 N  N   . LEU B 1 316 ? -4.753  21.017  -28.040 1.00 33.23 ? 316 LEU B N   1 
ATOM   5115 C  CA  . LEU B 1 316 ? -3.530  20.434  -27.501 1.00 32.21 ? 316 LEU B CA  1 
ATOM   5116 C  C   . LEU B 1 316 ? -2.474  20.076  -28.542 1.00 31.86 ? 316 LEU B C   1 
ATOM   5117 O  O   . LEU B 1 316 ? -1.336  20.538  -28.444 1.00 33.02 ? 316 LEU B O   1 
ATOM   5118 C  CB  . LEU B 1 316 ? -3.865  19.206  -26.652 1.00 30.77 ? 316 LEU B CB  1 
ATOM   5119 C  CG  . LEU B 1 316 ? -2.701  18.450  -26.008 1.00 29.34 ? 316 LEU B CG  1 
ATOM   5120 C  CD1 . LEU B 1 316 ? -1.901  19.371  -25.116 1.00 24.76 ? 316 LEU B CD1 1 
ATOM   5121 C  CD2 . LEU B 1 316 ? -3.253  17.292  -25.220 1.00 27.75 ? 316 LEU B CD2 1 
ATOM   5122 N  N   . THR B 1 317 ? -2.827  19.255  -29.529 1.00 32.74 ? 317 THR B N   1 
ATOM   5123 C  CA  . THR B 1 317 ? -1.854  18.881  -30.560 1.00 32.26 ? 317 THR B CA  1 
ATOM   5124 C  C   . THR B 1 317 ? -1.376  20.119  -31.315 1.00 31.43 ? 317 THR B C   1 
ATOM   5125 O  O   . THR B 1 317 ? -0.201  20.234  -31.665 1.00 30.18 ? 317 THR B O   1 
ATOM   5126 C  CB  . THR B 1 317 ? -2.435  17.863  -31.566 1.00 32.43 ? 317 THR B CB  1 
ATOM   5127 O  OG1 . THR B 1 317 ? -3.629  18.388  -32.156 1.00 33.97 ? 317 THR B OG1 1 
ATOM   5128 C  CG2 . THR B 1 317 ? -2.746  16.542  -30.866 1.00 31.18 ? 317 THR B CG2 1 
ATOM   5129 N  N   . THR B 1 318 ? -2.282  21.057  -31.555 1.00 33.47 ? 318 THR B N   1 
ATOM   5130 C  CA  . THR B 1 318 ? -1.898  22.279  -32.243 1.00 34.52 ? 318 THR B CA  1 
ATOM   5131 C  C   . THR B 1 318 ? -0.864  23.010  -31.392 1.00 35.08 ? 318 THR B C   1 
ATOM   5132 O  O   . THR B 1 318 ? 0.143   23.509  -31.905 1.00 35.21 ? 318 THR B O   1 
ATOM   5133 C  CB  . THR B 1 318 ? -3.109  23.201  -32.462 1.00 35.19 ? 318 THR B CB  1 
ATOM   5134 O  OG1 . THR B 1 318 ? -3.981  22.617  -33.436 1.00 35.50 ? 318 THR B OG1 1 
ATOM   5135 C  CG2 . THR B 1 318 ? -2.653  24.580  -32.946 1.00 37.02 ? 318 THR B CG2 1 
ATOM   5136 N  N   . ALA B 1 319 ? -1.115  23.047  -30.085 1.00 36.60 ? 319 ALA B N   1 
ATOM   5137 C  CA  . ALA B 1 319 ? -0.233  23.719  -29.135 1.00 36.19 ? 319 ALA B CA  1 
ATOM   5138 C  C   . ALA B 1 319 ? 1.136   23.059  -29.001 1.00 35.12 ? 319 ALA B C   1 
ATOM   5139 O  O   . ALA B 1 319 ? 2.143   23.744  -28.844 1.00 35.70 ? 319 ALA B O   1 
ATOM   5140 C  CB  . ALA B 1 319 ? -0.907  23.790  -27.769 1.00 36.70 ? 319 ALA B CB  1 
ATOM   5141 N  N   . LEU B 1 320 ? 1.166   21.733  -29.054 1.00 34.46 ? 320 LEU B N   1 
ATOM   5142 C  CA  . LEU B 1 320 ? 2.409   20.986  -28.929 1.00 35.93 ? 320 LEU B CA  1 
ATOM   5143 C  C   . LEU B 1 320 ? 3.336   21.201  -30.121 1.00 38.36 ? 320 LEU B C   1 
ATOM   5144 O  O   . LEU B 1 320 ? 4.549   21.337  -29.961 1.00 38.69 ? 320 LEU B O   1 
ATOM   5145 C  CB  . LEU B 1 320 ? 2.109   19.494  -28.780 1.00 35.20 ? 320 LEU B CB  1 
ATOM   5146 C  CG  . LEU B 1 320 ? 1.604   18.977  -27.430 1.00 33.85 ? 320 LEU B CG  1 
ATOM   5147 C  CD1 . LEU B 1 320 ? 0.868   17.669  -27.640 1.00 32.35 ? 320 LEU B CD1 1 
ATOM   5148 C  CD2 . LEU B 1 320 ? 2.777   18.792  -26.467 1.00 32.19 ? 320 LEU B CD2 1 
ATOM   5149 N  N   . GLU B 1 321 ? 2.770   21.236  -31.320 1.00 40.62 ? 321 GLU B N   1 
ATOM   5150 C  CA  . GLU B 1 321 ? 3.586   21.431  -32.508 1.00 43.01 ? 321 GLU B CA  1 
ATOM   5151 C  C   . GLU B 1 321 ? 4.106   22.857  -32.589 1.00 42.81 ? 321 GLU B C   1 
ATOM   5152 O  O   . GLU B 1 321 ? 4.877   23.202  -33.483 1.00 43.10 ? 321 GLU B O   1 
ATOM   5153 C  CB  . GLU B 1 321 ? 2.779   21.069  -33.749 1.00 46.73 ? 321 GLU B CB  1 
ATOM   5154 C  CG  . GLU B 1 321 ? 2.202   19.655  -33.661 1.00 52.14 ? 321 GLU B CG  1 
ATOM   5155 C  CD  . GLU B 1 321 ? 1.648   19.161  -34.980 1.00 54.53 ? 321 GLU B CD  1 
ATOM   5156 O  OE1 . GLU B 1 321 ? 2.445   18.978  -35.925 1.00 56.75 ? 321 GLU B OE1 1 
ATOM   5157 O  OE2 . GLU B 1 321 ? 0.418   18.956  -35.069 1.00 56.17 ? 321 GLU B OE2 1 
ATOM   5158 N  N   . GLY B 1 322 ? 3.688   23.682  -31.636 1.00 42.07 ? 322 GLY B N   1 
ATOM   5159 C  CA  . GLY B 1 322 ? 4.133   25.060  -31.599 1.00 39.26 ? 322 GLY B CA  1 
ATOM   5160 C  C   . GLY B 1 322 ? 4.980   25.272  -30.365 1.00 38.93 ? 322 GLY B C   1 
ATOM   5161 O  O   . GLY B 1 322 ? 5.387   26.393  -30.059 1.00 38.45 ? 322 GLY B O   1 
ATOM   5162 N  N   . ASN B 1 323 ? 5.255   24.176  -29.663 1.00 37.95 ? 323 ASN B N   1 
ATOM   5163 C  CA  . ASN B 1 323 ? 6.042   24.214  -28.432 1.00 38.92 ? 323 ASN B CA  1 
ATOM   5164 C  C   . ASN B 1 323 ? 5.440   25.241  -27.475 1.00 36.27 ? 323 ASN B C   1 
ATOM   5165 O  O   . ASN B 1 323 ? 6.144   26.107  -26.960 1.00 34.98 ? 323 ASN B O   1 
ATOM   5166 C  CB  . ASN B 1 323 ? 7.502   24.582  -28.730 1.00 41.32 ? 323 ASN B CB  1 
ATOM   5167 C  CG  . ASN B 1 323 ? 8.138   23.668  -29.766 1.00 44.25 ? 323 ASN B CG  1 
ATOM   5168 O  OD1 . ASN B 1 323 ? 8.217   22.454  -29.577 1.00 43.06 ? 323 ASN B OD1 1 
ATOM   5169 N  ND2 . ASN B 1 323 ? 8.597   24.252  -30.870 1.00 45.71 ? 323 ASN B ND2 1 
ATOM   5170 N  N   . ARG B 1 324 ? 4.132   25.148  -27.248 1.00 35.24 ? 324 ARG B N   1 
ATOM   5171 C  CA  . ARG B 1 324 ? 3.447   26.075  -26.347 1.00 34.61 ? 324 ARG B CA  1 
ATOM   5172 C  C   . ARG B 1 324 ? 3.014   25.422  -25.033 1.00 32.75 ? 324 ARG B C   1 
ATOM   5173 O  O   . ARG B 1 324 ? 2.582   26.102  -24.104 1.00 32.06 ? 324 ARG B O   1 
ATOM   5174 C  CB  . ARG B 1 324 ? 2.232   26.698  -27.047 1.00 33.54 ? 324 ARG B CB  1 
ATOM   5175 C  CG  . ARG B 1 324 ? 2.617   27.736  -28.095 1.00 33.14 ? 324 ARG B CG  1 
ATOM   5176 C  CD  . ARG B 1 324 ? 1.440   28.615  -28.495 1.00 32.25 ? 324 ARG B CD  1 
ATOM   5177 N  NE  . ARG B 1 324 ? 0.559   27.978  -29.464 1.00 32.94 ? 324 ARG B NE  1 
ATOM   5178 C  CZ  . ARG B 1 324 ? -0.651  27.505  -29.189 1.00 32.32 ? 324 ARG B CZ  1 
ATOM   5179 N  NH1 . ARG B 1 324 ? -1.141  27.590  -27.959 1.00 29.03 ? 324 ARG B NH1 1 
ATOM   5180 N  NH2 . ARG B 1 324 ? -1.373  26.952  -30.154 1.00 31.08 ? 324 ARG B NH2 1 
ATOM   5181 N  N   . VAL B 1 325 ? 3.145   24.102  -24.961 1.00 30.28 ? 325 VAL B N   1 
ATOM   5182 C  CA  . VAL B 1 325 ? 2.764   23.363  -23.770 1.00 30.42 ? 325 VAL B CA  1 
ATOM   5183 C  C   . VAL B 1 325 ? 3.952   23.130  -22.864 1.00 30.60 ? 325 VAL B C   1 
ATOM   5184 O  O   . VAL B 1 325 ? 5.022   22.722  -23.314 1.00 32.04 ? 325 VAL B O   1 
ATOM   5185 C  CB  . VAL B 1 325 ? 2.166   22.012  -24.137 1.00 30.94 ? 325 VAL B CB  1 
ATOM   5186 C  CG1 . VAL B 1 325 ? 1.862   21.220  -22.884 1.00 30.72 ? 325 VAL B CG1 1 
ATOM   5187 C  CG2 . VAL B 1 325 ? 0.913   22.226  -24.970 1.00 30.93 ? 325 VAL B CG2 1 
ATOM   5188 N  N   . ARG B 1 326 ? 3.758   23.380  -21.577 1.00 29.59 ? 326 ARG B N   1 
ATOM   5189 C  CA  . ARG B 1 326 ? 4.830   23.204  -20.615 1.00 29.51 ? 326 ARG B CA  1 
ATOM   5190 C  C   . ARG B 1 326 ? 4.572   22.059  -19.665 1.00 28.72 ? 326 ARG B C   1 
ATOM   5191 O  O   . ARG B 1 326 ? 5.463   21.258  -19.387 1.00 28.87 ? 326 ARG B O   1 
ATOM   5192 C  CB  . ARG B 1 326 ? 5.033   24.495  -19.828 1.00 31.64 ? 326 ARG B CB  1 
ATOM   5193 C  CG  . ARG B 1 326 ? 5.531   25.634  -20.697 1.00 35.11 ? 326 ARG B CG  1 
ATOM   5194 C  CD  . ARG B 1 326 ? 5.817   26.858  -19.861 1.00 42.70 ? 326 ARG B CD  1 
ATOM   5195 N  NE  . ARG B 1 326 ? 6.503   27.892  -20.631 1.00 46.68 ? 326 ARG B NE  1 
ATOM   5196 C  CZ  . ARG B 1 326 ? 6.781   29.102  -20.162 1.00 47.72 ? 326 ARG B CZ  1 
ATOM   5197 N  NH1 . ARG B 1 326 ? 6.429   29.430  -18.924 1.00 47.42 ? 326 ARG B NH1 1 
ATOM   5198 N  NH2 . ARG B 1 326 ? 7.404   29.984  -20.931 1.00 48.60 ? 326 ARG B NH2 1 
ATOM   5199 N  N   . GLU B 1 327 ? 3.344   21.974  -19.175 1.00 27.89 ? 327 GLU B N   1 
ATOM   5200 C  CA  . GLU B 1 327 ? 2.988   20.929  -18.233 1.00 24.66 ? 327 GLU B CA  1 
ATOM   5201 C  C   . GLU B 1 327 ? 1.537   20.489  -18.321 1.00 24.96 ? 327 GLU B C   1 
ATOM   5202 O  O   . GLU B 1 327 ? 0.632   21.291  -18.573 1.00 23.59 ? 327 GLU B O   1 
ATOM   5203 C  CB  . GLU B 1 327 ? 3.236   21.401  -16.798 1.00 24.75 ? 327 GLU B CB  1 
ATOM   5204 C  CG  . GLU B 1 327 ? 4.676   21.629  -16.398 1.00 24.30 ? 327 GLU B CG  1 
ATOM   5205 C  CD  . GLU B 1 327 ? 4.783   22.126  -14.961 1.00 27.54 ? 327 GLU B CD  1 
ATOM   5206 O  OE1 . GLU B 1 327 ? 4.362   21.397  -14.038 1.00 29.58 ? 327 GLU B OE1 1 
ATOM   5207 O  OE2 . GLU B 1 327 ? 5.277   23.249  -14.748 1.00 28.58 ? 327 GLU B OE2 1 
ATOM   5208 N  N   . MET B 1 328 ? 1.324   19.195  -18.126 1.00 24.01 ? 328 MET B N   1 
ATOM   5209 C  CA  . MET B 1 328 ? -0.024  18.668  -18.082 1.00 25.60 ? 328 MET B CA  1 
ATOM   5210 C  C   . MET B 1 328 ? -0.063  17.695  -16.913 1.00 23.83 ? 328 MET B C   1 
ATOM   5211 O  O   . MET B 1 328 ? 0.731   16.753  -16.856 1.00 24.33 ? 328 MET B O   1 
ATOM   5212 C  CB  . MET B 1 328 ? -0.422  17.945  -19.367 1.00 25.76 ? 328 MET B CB  1 
ATOM   5213 C  CG  . MET B 1 328 ? -1.842  17.421  -19.256 1.00 28.76 ? 328 MET B CG  1 
ATOM   5214 S  SD  . MET B 1 328 ? -2.485  16.558  -20.673 1.00 35.06 ? 328 MET B SD  1 
ATOM   5215 C  CE  . MET B 1 328 ? -2.752  17.910  -21.781 1.00 36.18 ? 328 MET B CE  1 
ATOM   5216 N  N   . PHE B 1 329 ? -0.969  17.939  -15.974 1.00 22.10 ? 329 PHE B N   1 
ATOM   5217 C  CA  . PHE B 1 329 ? -1.096  17.075  -14.809 1.00 23.50 ? 329 PHE B CA  1 
ATOM   5218 C  C   . PHE B 1 329 ? -2.537  16.898  -14.346 1.00 22.56 ? 329 PHE B C   1 
ATOM   5219 O  O   . PHE B 1 329 ? -3.443  17.589  -14.808 1.00 25.96 ? 329 PHE B O   1 
ATOM   5220 C  CB  . PHE B 1 329 ? -0.230  17.617  -13.666 1.00 25.06 ? 329 PHE B CB  1 
ATOM   5221 C  CG  . PHE B 1 329 ? -0.509  19.062  -13.310 1.00 26.05 ? 329 PHE B CG  1 
ATOM   5222 C  CD1 . PHE B 1 329 ? -1.452  19.388  -12.338 1.00 25.13 ? 329 PHE B CD1 1 
ATOM   5223 C  CD2 . PHE B 1 329 ? 0.189   20.091  -13.931 1.00 24.69 ? 329 PHE B CD2 1 
ATOM   5224 C  CE1 . PHE B 1 329 ? -1.690  20.719  -11.987 1.00 26.47 ? 329 PHE B CE1 1 
ATOM   5225 C  CE2 . PHE B 1 329 ? -0.040  21.422  -13.590 1.00 24.75 ? 329 PHE B CE2 1 
ATOM   5226 C  CZ  . PHE B 1 329 ? -0.983  21.738  -12.613 1.00 24.58 ? 329 PHE B CZ  1 
ATOM   5227 N  N   . GLY B 1 330 ? -2.746  15.950  -13.442 1.00 22.86 ? 330 GLY B N   1 
ATOM   5228 C  CA  . GLY B 1 330 ? -4.077  15.698  -12.920 1.00 20.24 ? 330 GLY B CA  1 
ATOM   5229 C  C   . GLY B 1 330 ? -4.071  16.072  -11.455 1.00 21.45 ? 330 GLY B C   1 
ATOM   5230 O  O   . GLY B 1 330 ? -3.009  16.093  -10.833 1.00 20.58 ? 330 GLY B O   1 
ATOM   5231 N  N   . SER B 1 331 ? -5.235  16.378  -10.896 1.00 21.10 ? 331 SER B N   1 
ATOM   5232 C  CA  . SER B 1 331 ? -5.307  16.744  -9.486  1.00 21.52 ? 331 SER B CA  1 
ATOM   5233 C  C   . SER B 1 331 ? -6.334  15.858  -8.782  1.00 22.25 ? 331 SER B C   1 
ATOM   5234 O  O   . SER B 1 331 ? -7.335  15.471  -9.376  1.00 20.75 ? 331 SER B O   1 
ATOM   5235 C  CB  . SER B 1 331 ? -5.691  18.224  -9.334  1.00 17.77 ? 331 SER B CB  1 
ATOM   5236 O  OG  . SER B 1 331 ? -7.074  18.432  -9.577  1.00 15.74 ? 331 SER B OG  1 
ATOM   5237 N  N   . GLY B 1 332 ? -6.069  15.543  -7.519  1.00 23.02 ? 332 GLY B N   1 
ATOM   5238 C  CA  . GLY B 1 332 ? -6.962  14.699  -6.745  1.00 25.65 ? 332 GLY B CA  1 
ATOM   5239 C  C   . GLY B 1 332 ? -6.382  14.446  -5.367  1.00 27.12 ? 332 GLY B C   1 
ATOM   5240 O  O   . GLY B 1 332 ? -5.177  14.560  -5.173  1.00 29.05 ? 332 GLY B O   1 
ATOM   5241 N  N   . THR B 1 333 ? -7.226  14.083  -4.409  1.00 28.33 ? 333 THR B N   1 
ATOM   5242 C  CA  . THR B 1 333 ? -6.765  13.856  -3.036  1.00 29.94 ? 333 THR B CA  1 
ATOM   5243 C  C   . THR B 1 333 ? -5.648  12.810  -2.871  1.00 30.05 ? 333 THR B C   1 
ATOM   5244 O  O   . THR B 1 333 ? -4.686  13.036  -2.131  1.00 28.92 ? 333 THR B O   1 
ATOM   5245 C  CB  . THR B 1 333 ? -7.963  13.485  -2.124  1.00 29.52 ? 333 THR B CB  1 
ATOM   5246 O  OG1 . THR B 1 333 ? -8.912  14.558  -2.138  1.00 30.01 ? 333 THR B OG1 1 
ATOM   5247 C  CG2 . THR B 1 333 ? -7.507  13.237  -0.695  1.00 28.48 ? 333 THR B CG2 1 
ATOM   5248 N  N   . ALA B 1 334 ? -5.776  11.682  -3.565  1.00 30.15 ? 334 ALA B N   1 
ATOM   5249 C  CA  . ALA B 1 334 ? -4.798  10.602  -3.488  1.00 32.71 ? 334 ALA B CA  1 
ATOM   5250 C  C   . ALA B 1 334 ? -3.393  10.981  -3.955  1.00 35.08 ? 334 ALA B C   1 
ATOM   5251 O  O   . ALA B 1 334 ? -2.411  10.701  -3.265  1.00 37.55 ? 334 ALA B O   1 
ATOM   5252 C  CB  . ALA B 1 334 ? -5.293  9.398   -4.282  1.00 32.41 ? 334 ALA B CB  1 
ATOM   5253 N  N   . CYS B 1 335 ? -3.298  11.606  -5.125  1.00 36.53 ? 335 CYS B N   1 
ATOM   5254 C  CA  . CYS B 1 335 ? -2.006  12.016  -5.685  1.00 37.09 ? 335 CYS B CA  1 
ATOM   5255 C  C   . CYS B 1 335 ? -1.655  13.461  -5.341  1.00 35.74 ? 335 CYS B C   1 
ATOM   5256 O  O   . CYS B 1 335 ? -0.476  13.814  -5.216  1.00 34.95 ? 335 CYS B O   1 
ATOM   5257 C  CB  . CYS B 1 335 ? -2.022  11.908  -7.220  1.00 37.23 ? 335 CYS B CB  1 
ATOM   5258 S  SG  . CYS B 1 335 ? -2.405  10.280  -7.911  1.00 52.39 ? 335 CYS B SG  1 
ATOM   5259 N  N   . VAL B 1 336 ? -2.689  14.284  -5.193  1.00 34.00 ? 336 VAL B N   1 
ATOM   5260 C  CA  . VAL B 1 336 ? -2.549  15.724  -4.958  1.00 33.67 ? 336 VAL B CA  1 
ATOM   5261 C  C   . VAL B 1 336 ? -2.415  16.237  -6.392  1.00 32.51 ? 336 VAL B C   1 
ATOM   5262 O  O   . VAL B 1 336 ? -3.270  16.971  -6.890  1.00 33.99 ? 336 VAL B O   1 
ATOM   5263 C  CB  . VAL B 1 336 ? -1.280  16.098  -4.154  1.00 33.27 ? 336 VAL B CB  1 
ATOM   5264 C  CG1 . VAL B 1 336 ? -1.261  17.595  -3.913  1.00 31.94 ? 336 VAL B CG1 1 
ATOM   5265 C  CG2 . VAL B 1 336 ? -1.261  15.356  -2.819  1.00 35.00 ? 336 VAL B CG2 1 
ATOM   5266 N  N   . VAL B 1 337 ? -1.332  15.838  -7.048  1.00 29.89 ? 337 VAL B N   1 
ATOM   5267 C  CA  . VAL B 1 337 ? -1.109  16.173  -8.442  1.00 29.25 ? 337 VAL B CA  1 
ATOM   5268 C  C   . VAL B 1 337 ? -0.340  15.006  -9.024  1.00 29.72 ? 337 VAL B C   1 
ATOM   5269 O  O   . VAL B 1 337 ? 0.439   14.357  -8.327  1.00 30.17 ? 337 VAL B O   1 
ATOM   5270 C  CB  . VAL B 1 337 ? -0.330  17.505  -8.662  1.00 28.17 ? 337 VAL B CB  1 
ATOM   5271 C  CG1 . VAL B 1 337 ? -1.229  18.673  -8.329  1.00 29.57 ? 337 VAL B CG1 1 
ATOM   5272 C  CG2 . VAL B 1 337 ? 0.918   17.554  -7.824  1.00 27.11 ? 337 VAL B CG2 1 
ATOM   5273 N  N   . CYS B 1 338 ? -0.600  14.721  -10.296 1.00 28.78 ? 338 CYS B N   1 
ATOM   5274 C  CA  . CYS B 1 338 ? 0.039   13.622  -10.992 1.00 27.15 ? 338 CYS B CA  1 
ATOM   5275 C  C   . CYS B 1 338 ? 0.342   14.015  -12.433 1.00 24.83 ? 338 CYS B C   1 
ATOM   5276 O  O   . CYS B 1 338 ? -0.559  14.119  -13.256 1.00 25.04 ? 338 CYS B O   1 
ATOM   5277 C  CB  . CYS B 1 338 ? -0.878  12.406  -10.961 1.00 26.28 ? 338 CYS B CB  1 
ATOM   5278 S  SG  . CYS B 1 338 ? -0.455  11.171  -12.163 1.00 35.39 ? 338 CYS B SG  1 
ATOM   5279 N  N   . PRO B 1 339 ? 1.624   14.235  -12.752 1.00 23.53 ? 339 PRO B N   1 
ATOM   5280 C  CA  . PRO B 1 339 ? 2.088   14.622  -14.085 1.00 22.79 ? 339 PRO B CA  1 
ATOM   5281 C  C   . PRO B 1 339 ? 1.799   13.644  -15.211 1.00 22.77 ? 339 PRO B C   1 
ATOM   5282 O  O   . PRO B 1 339 ? 1.785   12.423  -15.015 1.00 24.77 ? 339 PRO B O   1 
ATOM   5283 C  CB  . PRO B 1 339 ? 3.583   14.826  -13.876 1.00 23.19 ? 339 PRO B CB  1 
ATOM   5284 C  CG  . PRO B 1 339 ? 3.895   13.872  -12.778 1.00 25.38 ? 339 PRO B CG  1 
ATOM   5285 C  CD  . PRO B 1 339 ? 2.765   14.125  -11.830 1.00 24.05 ? 339 PRO B CD  1 
ATOM   5286 N  N   . VAL B 1 340 ? 1.572   14.203  -16.394 1.00 22.41 ? 340 VAL B N   1 
ATOM   5287 C  CA  . VAL B 1 340 ? 1.292   13.427  -17.597 1.00 24.57 ? 340 VAL B CA  1 
ATOM   5288 C  C   . VAL B 1 340 ? 2.432   13.615  -18.604 1.00 25.19 ? 340 VAL B C   1 
ATOM   5289 O  O   . VAL B 1 340 ? 2.855   14.734  -18.868 1.00 27.01 ? 340 VAL B O   1 
ATOM   5290 C  CB  . VAL B 1 340 ? -0.036  13.872  -18.240 1.00 23.21 ? 340 VAL B CB  1 
ATOM   5291 C  CG1 . VAL B 1 340 ? -0.242  13.157  -19.568 1.00 20.63 ? 340 VAL B CG1 1 
ATOM   5292 C  CG2 . VAL B 1 340 ? -1.185  13.576  -17.294 1.00 22.48 ? 340 VAL B CG2 1 
ATOM   5293 N  N   . SER B 1 341 ? 2.927   12.523  -19.171 1.00 25.04 ? 341 SER B N   1 
ATOM   5294 C  CA  . SER B 1 341 ? 4.032   12.629  -20.114 1.00 25.75 ? 341 SER B CA  1 
ATOM   5295 C  C   . SER B 1 341 ? 3.708   12.168  -21.524 1.00 24.24 ? 341 SER B C   1 
ATOM   5296 O  O   . SER B 1 341 ? 4.440   12.483  -22.454 1.00 24.39 ? 341 SER B O   1 
ATOM   5297 C  CB  . SER B 1 341 ? 5.239   11.848  -19.592 1.00 25.59 ? 341 SER B CB  1 
ATOM   5298 O  OG  . SER B 1 341 ? 4.951   10.464  -19.527 1.00 27.80 ? 341 SER B OG  1 
ATOM   5299 N  N   . ASP B 1 342 ? 2.622   11.417  -21.688 1.00 25.83 ? 342 ASP B N   1 
ATOM   5300 C  CA  . ASP B 1 342 ? 2.245   10.928  -23.012 1.00 26.83 ? 342 ASP B CA  1 
ATOM   5301 C  C   . ASP B 1 342 ? 0.754   10.687  -23.162 1.00 27.77 ? 342 ASP B C   1 
ATOM   5302 O  O   . ASP B 1 342 ? 0.036   10.471  -22.184 1.00 30.21 ? 342 ASP B O   1 
ATOM   5303 C  CB  . ASP B 1 342 ? 2.958   9.606   -23.344 1.00 27.11 ? 342 ASP B CB  1 
ATOM   5304 C  CG  . ASP B 1 342 ? 4.443   9.647   -23.062 1.00 27.68 ? 342 ASP B CG  1 
ATOM   5305 O  OD1 . ASP B 1 342 ? 4.837   9.474   -21.882 1.00 25.82 ? 342 ASP B OD1 1 
ATOM   5306 O  OD2 . ASP B 1 342 ? 5.215   9.861   -24.020 1.00 28.85 ? 342 ASP B OD2 1 
ATOM   5307 N  N   . ILE B 1 343 ? 0.302   10.711  -24.408 1.00 28.92 ? 343 ILE B N   1 
ATOM   5308 C  CA  . ILE B 1 343 ? -1.088  10.451  -24.732 1.00 30.42 ? 343 ILE B CA  1 
ATOM   5309 C  C   . ILE B 1 343 ? -1.149  9.644   -26.023 1.00 31.84 ? 343 ILE B C   1 
ATOM   5310 O  O   . ILE B 1 343 ? -0.627  10.072  -27.055 1.00 32.31 ? 343 ILE B O   1 
ATOM   5311 C  CB  . ILE B 1 343 ? -1.883  11.749  -24.952 1.00 31.49 ? 343 ILE B CB  1 
ATOM   5312 C  CG1 . ILE B 1 343 ? -1.959  12.562  -23.654 1.00 31.65 ? 343 ILE B CG1 1 
ATOM   5313 C  CG2 . ILE B 1 343 ? -3.269  11.410  -25.454 1.00 30.50 ? 343 ILE B CG2 1 
ATOM   5314 C  CD1 . ILE B 1 343 ? -2.703  13.880  -23.813 1.00 29.20 ? 343 ILE B CD1 1 
ATOM   5315 N  N   . LEU B 1 344 ? -1.753  8.462   -25.955 1.00 32.83 ? 344 LEU B N   1 
ATOM   5316 C  CA  . LEU B 1 344 ? -1.915  7.628   -27.138 1.00 34.32 ? 344 LEU B CA  1 
ATOM   5317 C  C   . LEU B 1 344 ? -3.266  8.044   -27.701 1.00 35.96 ? 344 LEU B C   1 
ATOM   5318 O  O   . LEU B 1 344 ? -4.304  7.847   -27.064 1.00 36.41 ? 344 LEU B O   1 
ATOM   5319 C  CB  . LEU B 1 344 ? -1.912  6.143   -26.768 1.00 35.13 ? 344 LEU B CB  1 
ATOM   5320 C  CG  . LEU B 1 344 ? -0.523  5.544   -26.506 1.00 35.83 ? 344 LEU B CG  1 
ATOM   5321 C  CD1 . LEU B 1 344 ? 0.116   6.222   -25.300 1.00 37.74 ? 344 LEU B CD1 1 
ATOM   5322 C  CD2 . LEU B 1 344 ? -0.644  4.044   -26.271 1.00 37.88 ? 344 LEU B CD2 1 
ATOM   5323 N  N   . TYR B 1 345 ? -3.249  8.635   -28.890 1.00 36.26 ? 345 TYR B N   1 
ATOM   5324 C  CA  . TYR B 1 345 ? -4.470  9.126   -29.498 1.00 37.37 ? 345 TYR B CA  1 
ATOM   5325 C  C   . TYR B 1 345 ? -4.861  8.395   -30.788 1.00 40.39 ? 345 TYR B C   1 
ATOM   5326 O  O   . TYR B 1 345 ? -5.117  7.191   -30.756 1.00 44.63 ? 345 TYR B O   1 
ATOM   5327 C  CB  . TYR B 1 345 ? -4.330  10.645  -29.709 1.00 34.02 ? 345 TYR B CB  1 
ATOM   5328 C  CG  . TYR B 1 345 ? -5.603  11.360  -30.086 1.00 30.47 ? 345 TYR B CG  1 
ATOM   5329 C  CD1 . TYR B 1 345 ? -6.818  11.013  -29.509 1.00 30.55 ? 345 TYR B CD1 1 
ATOM   5330 C  CD2 . TYR B 1 345 ? -5.593  12.381  -31.034 1.00 31.64 ? 345 TYR B CD2 1 
ATOM   5331 C  CE1 . TYR B 1 345 ? -7.997  11.662  -29.873 1.00 31.72 ? 345 TYR B CE1 1 
ATOM   5332 C  CE2 . TYR B 1 345 ? -6.763  13.040  -31.404 1.00 29.80 ? 345 TYR B CE2 1 
ATOM   5333 C  CZ  . TYR B 1 345 ? -7.962  12.672  -30.825 1.00 31.73 ? 345 TYR B CZ  1 
ATOM   5334 O  OH  . TYR B 1 345 ? -9.127  13.283  -31.227 1.00 32.47 ? 345 TYR B OH  1 
ATOM   5335 N  N   . LYS B 1 346 ? -4.913  9.097   -31.917 1.00 42.18 ? 346 LYS B N   1 
ATOM   5336 C  CA  . LYS B 1 346 ? -5.315  8.469   -33.180 1.00 42.98 ? 346 LYS B CA  1 
ATOM   5337 C  C   . LYS B 1 346 ? -4.316  7.454   -33.745 1.00 42.51 ? 346 LYS B C   1 
ATOM   5338 O  O   . LYS B 1 346 ? -3.896  7.559   -34.893 1.00 41.04 ? 346 LYS B O   1 
ATOM   5339 C  CB  . LYS B 1 346 ? -5.597  9.548   -34.229 1.00 44.41 ? 346 LYS B CB  1 
ATOM   5340 C  CG  . LYS B 1 346 ? -6.852  10.371  -33.959 1.00 46.08 ? 346 LYS B CG  1 
ATOM   5341 C  CD  . LYS B 1 346 ? -8.110  9.532   -34.143 1.00 48.69 ? 346 LYS B CD  1 
ATOM   5342 C  CE  . LYS B 1 346 ? -9.371  10.364  -33.936 1.00 49.73 ? 346 LYS B CE  1 
ATOM   5343 N  NZ  . LYS B 1 346 ? -9.395  11.564  -34.821 1.00 50.77 ? 346 LYS B NZ  1 
ATOM   5344 N  N   . GLY B 1 347 ? -3.949  6.467   -32.937 1.00 42.36 ? 347 GLY B N   1 
ATOM   5345 C  CA  . GLY B 1 347 ? -3.006  5.466   -33.386 1.00 41.68 ? 347 GLY B CA  1 
ATOM   5346 C  C   . GLY B 1 347 ? -1.557  5.877   -33.189 1.00 42.78 ? 347 GLY B C   1 
ATOM   5347 O  O   . GLY B 1 347 ? -0.647  5.105   -33.491 1.00 42.32 ? 347 GLY B O   1 
ATOM   5348 N  N   . GLU B 1 348 ? -1.324  7.090   -32.694 1.00 42.59 ? 348 GLU B N   1 
ATOM   5349 C  CA  . GLU B 1 348 ? 0.047   7.538   -32.467 1.00 42.75 ? 348 GLU B CA  1 
ATOM   5350 C  C   . GLU B 1 348 ? 0.268   7.898   -30.998 1.00 42.65 ? 348 GLU B C   1 
ATOM   5351 O  O   . GLU B 1 348 ? -0.681  7.977   -30.214 1.00 44.18 ? 348 GLU B O   1 
ATOM   5352 C  CB  . GLU B 1 348 ? 0.373   8.754   -33.342 1.00 45.24 ? 348 GLU B CB  1 
ATOM   5353 C  CG  . GLU B 1 348 ? -0.263  10.063  -32.871 1.00 49.70 ? 348 GLU B CG  1 
ATOM   5354 C  CD  . GLU B 1 348 ? 0.282   11.289  -33.605 1.00 51.75 ? 348 GLU B CD  1 
ATOM   5355 O  OE1 . GLU B 1 348 ? 1.521   11.377  -33.777 1.00 54.09 ? 348 GLU B OE1 1 
ATOM   5356 O  OE2 . GLU B 1 348 ? -0.522  12.168  -33.995 1.00 48.80 ? 348 GLU B OE2 1 
ATOM   5357 N  N   . THR B 1 349 ? 1.527   8.108   -30.630 1.00 40.89 ? 349 THR B N   1 
ATOM   5358 C  CA  . THR B 1 349 ? 1.879   8.484   -29.267 1.00 38.54 ? 349 THR B CA  1 
ATOM   5359 C  C   . THR B 1 349 ? 2.267   9.950   -29.298 1.00 37.58 ? 349 THR B C   1 
ATOM   5360 O  O   . THR B 1 349 ? 3.150   10.350  -30.052 1.00 37.84 ? 349 THR B O   1 
ATOM   5361 C  CB  . THR B 1 349 ? 3.082   7.707   -28.758 1.00 38.80 ? 349 THR B CB  1 
ATOM   5362 O  OG1 . THR B 1 349 ? 2.849   6.307   -28.930 1.00 43.51 ? 349 THR B OG1 1 
ATOM   5363 C  CG2 . THR B 1 349 ? 3.315   8.005   -27.285 1.00 38.81 ? 349 THR B CG2 1 
ATOM   5364 N  N   . ILE B 1 350 ? 1.609   10.756  -28.483 1.00 35.74 ? 350 ILE B N   1 
ATOM   5365 C  CA  . ILE B 1 350 ? 1.923   12.170  -28.458 1.00 33.35 ? 350 ILE B CA  1 
ATOM   5366 C  C   . ILE B 1 350 ? 2.657   12.457  -27.161 1.00 30.94 ? 350 ILE B C   1 
ATOM   5367 O  O   . ILE B 1 350 ? 2.118   12.251  -26.081 1.00 32.10 ? 350 ILE B O   1 
ATOM   5368 C  CB  . ILE B 1 350 ? 0.636   13.004  -28.551 1.00 34.54 ? 350 ILE B CB  1 
ATOM   5369 C  CG1 . ILE B 1 350 ? -0.194  12.519  -29.752 1.00 33.65 ? 350 ILE B CG1 1 
ATOM   5370 C  CG2 . ILE B 1 350 ? 0.984   14.478  -28.712 1.00 34.44 ? 350 ILE B CG2 1 
ATOM   5371 C  CD1 . ILE B 1 350 ? -1.533  13.198  -29.917 1.00 32.27 ? 350 ILE B CD1 1 
ATOM   5372 N  N   . HIS B 1 351 ? 3.901   12.907  -27.260 1.00 28.56 ? 351 HIS B N   1 
ATOM   5373 C  CA  . HIS B 1 351 ? 4.658   13.190  -26.057 1.00 27.40 ? 351 HIS B CA  1 
ATOM   5374 C  C   . HIS B 1 351 ? 4.344   14.566  -25.492 1.00 25.22 ? 351 HIS B C   1 
ATOM   5375 O  O   . HIS B 1 351 ? 4.138   15.517  -26.231 1.00 24.34 ? 351 HIS B O   1 
ATOM   5376 C  CB  . HIS B 1 351 ? 6.162   13.063  -26.320 1.00 28.01 ? 351 HIS B CB  1 
ATOM   5377 C  CG  . HIS B 1 351 ? 6.981   13.036  -25.066 1.00 28.76 ? 351 HIS B CG  1 
ATOM   5378 N  ND1 . HIS B 1 351 ? 7.602   14.155  -24.554 1.00 26.45 ? 351 HIS B ND1 1 
ATOM   5379 C  CD2 . HIS B 1 351 ? 7.203   12.041  -24.174 1.00 28.20 ? 351 HIS B CD2 1 
ATOM   5380 C  CE1 . HIS B 1 351 ? 8.166   13.851  -23.399 1.00 26.14 ? 351 HIS B CE1 1 
ATOM   5381 N  NE2 . HIS B 1 351 ? 7.939   12.575  -23.145 1.00 30.48 ? 351 HIS B NE2 1 
ATOM   5382 N  N   . ILE B 1 352 ? 4.298   14.655  -24.170 1.00 23.38 ? 352 ILE B N   1 
ATOM   5383 C  CA  . ILE B 1 352 ? 4.014   15.910  -23.502 1.00 25.35 ? 352 ILE B CA  1 
ATOM   5384 C  C   . ILE B 1 352 ? 5.244   16.242  -22.660 1.00 26.98 ? 352 ILE B C   1 
ATOM   5385 O  O   . ILE B 1 352 ? 5.603   15.502  -21.742 1.00 28.57 ? 352 ILE B O   1 
ATOM   5386 C  CB  . ILE B 1 352 ? 2.722   15.777  -22.671 1.00 25.61 ? 352 ILE B CB  1 
ATOM   5387 C  CG1 . ILE B 1 352 ? 1.578   15.430  -23.629 1.00 23.93 ? 352 ILE B CG1 1 
ATOM   5388 C  CG2 . ILE B 1 352 ? 2.399   17.075  -21.949 1.00 26.25 ? 352 ILE B CG2 1 
ATOM   5389 C  CD1 . ILE B 1 352 ? 0.212   15.503  -23.036 1.00 30.04 ? 352 ILE B CD1 1 
ATOM   5390 N  N   . PRO B 1 353 ? 5.915   17.361  -22.987 1.00 24.55 ? 353 PRO B N   1 
ATOM   5391 C  CA  . PRO B 1 353 ? 7.128   17.894  -22.356 1.00 24.54 ? 353 PRO B CA  1 
ATOM   5392 C  C   . PRO B 1 353 ? 6.999   18.240  -20.882 1.00 22.76 ? 353 PRO B C   1 
ATOM   5393 O  O   . PRO B 1 353 ? 7.764   19.048  -20.356 1.00 24.47 ? 353 PRO B O   1 
ATOM   5394 C  CB  . PRO B 1 353 ? 7.436   19.130  -23.205 1.00 24.93 ? 353 PRO B CB  1 
ATOM   5395 C  CG  . PRO B 1 353 ? 6.075   19.661  -23.475 1.00 24.37 ? 353 PRO B CG  1 
ATOM   5396 C  CD  . PRO B 1 353 ? 5.294   18.390  -23.843 1.00 26.12 ? 353 PRO B CD  1 
ATOM   5397 N  N   . THR B 1 354 ? 6.033   17.634  -20.217 1.00 22.66 ? 354 THR B N   1 
ATOM   5398 C  CA  . THR B 1 354 ? 5.820   17.896  -18.807 1.00 24.06 ? 354 THR B CA  1 
ATOM   5399 C  C   . THR B 1 354 ? 7.060   17.691  -17.959 1.00 26.30 ? 354 THR B C   1 
ATOM   5400 O  O   . THR B 1 354 ? 7.479   18.596  -17.241 1.00 29.04 ? 354 THR B O   1 
ATOM   5401 C  CB  . THR B 1 354 ? 4.734   17.003  -18.239 1.00 21.69 ? 354 THR B CB  1 
ATOM   5402 O  OG1 . THR B 1 354 ? 3.537   17.177  -19.009 1.00 23.96 ? 354 THR B OG1 1 
ATOM   5403 C  CG2 . THR B 1 354 ? 4.474   17.358  -16.753 1.00 22.65 ? 354 THR B CG2 1 
ATOM   5404 N  N   . MET B 1 355 ? 7.654   16.505  -18.044 1.00 27.07 ? 355 MET B N   1 
ATOM   5405 C  CA  . MET B 1 355 ? 8.823   16.203  -17.227 1.00 27.06 ? 355 MET B CA  1 
ATOM   5406 C  C   . MET B 1 355 ? 10.124  16.900  -17.605 1.00 27.70 ? 355 MET B C   1 
ATOM   5407 O  O   . MET B 1 355 ? 10.994  17.089  -16.753 1.00 25.87 ? 355 MET B O   1 
ATOM   5408 C  CB  . MET B 1 355 ? 9.026   14.689  -17.156 1.00 24.81 ? 355 MET B CB  1 
ATOM   5409 C  CG  . MET B 1 355 ? 7.866   13.989  -16.462 1.00 23.76 ? 355 MET B CG  1 
ATOM   5410 S  SD  . MET B 1 355 ? 7.547   14.718  -14.835 1.00 28.23 ? 355 MET B SD  1 
ATOM   5411 C  CE  . MET B 1 355 ? 8.812   13.953  -13.890 1.00 23.07 ? 355 MET B CE  1 
ATOM   5412 N  N   . GLU B 1 356 ? 10.281  17.288  -18.864 1.00 28.51 ? 356 GLU B N   1 
ATOM   5413 C  CA  . GLU B 1 356 ? 11.509  17.972  -19.219 1.00 30.63 ? 356 GLU B CA  1 
ATOM   5414 C  C   . GLU B 1 356 ? 11.415  19.461  -18.874 1.00 33.06 ? 356 GLU B C   1 
ATOM   5415 O  O   . GLU B 1 356 ? 12.366  20.216  -19.090 1.00 34.17 ? 356 GLU B O   1 
ATOM   5416 C  CB  . GLU B 1 356 ? 11.856  17.766  -20.695 1.00 31.16 ? 356 GLU B CB  1 
ATOM   5417 C  CG  . GLU B 1 356 ? 10.680  17.517  -21.607 1.00 35.37 ? 356 GLU B CG  1 
ATOM   5418 C  CD  . GLU B 1 356 ? 10.296  16.044  -21.737 1.00 33.00 ? 356 GLU B CD  1 
ATOM   5419 O  OE1 . GLU B 1 356 ? 9.558   15.752  -22.690 1.00 35.04 ? 356 GLU B OE1 1 
ATOM   5420 O  OE2 . GLU B 1 356 ? 10.710  15.193  -20.913 1.00 28.23 ? 356 GLU B OE2 1 
ATOM   5421 N  N   . ASN B 1 357 ? 10.272  19.866  -18.317 1.00 32.43 ? 357 ASN B N   1 
ATOM   5422 C  CA  . ASN B 1 357 ? 10.047  21.249  -17.909 1.00 31.25 ? 357 ASN B CA  1 
ATOM   5423 C  C   . ASN B 1 357 ? 9.971   21.360  -16.390 1.00 30.32 ? 357 ASN B C   1 
ATOM   5424 O  O   . ASN B 1 357 ? 9.283   22.217  -15.845 1.00 29.47 ? 357 ASN B O   1 
ATOM   5425 C  CB  . ASN B 1 357 ? 8.759   21.795  -18.532 1.00 34.21 ? 357 ASN B CB  1 
ATOM   5426 C  CG  . ASN B 1 357 ? 8.975   22.353  -19.930 1.00 36.05 ? 357 ASN B CG  1 
ATOM   5427 O  OD1 . ASN B 1 357 ? 9.899   23.129  -20.155 1.00 36.24 ? 357 ASN B OD1 1 
ATOM   5428 N  ND2 . ASN B 1 357 ? 8.115   21.972  -20.870 1.00 36.28 ? 357 ASN B ND2 1 
ATOM   5429 N  N   . GLY B 1 358 ? 10.696  20.489  -15.701 1.00 31.62 ? 358 GLY B N   1 
ATOM   5430 C  CA  . GLY B 1 358 ? 10.682  20.514  -14.252 1.00 30.03 ? 358 GLY B CA  1 
ATOM   5431 C  C   . GLY B 1 358 ? 10.125  19.215  -13.699 1.00 30.72 ? 358 GLY B C   1 
ATOM   5432 O  O   . GLY B 1 358 ? 10.887  18.307  -13.389 1.00 29.32 ? 358 GLY B O   1 
ATOM   5433 N  N   . PRO B 1 359 ? 8.799   19.096  -13.549 1.00 30.87 ? 359 PRO B N   1 
ATOM   5434 C  CA  . PRO B 1 359 ? 7.787   20.106  -13.863 1.00 31.61 ? 359 PRO B CA  1 
ATOM   5435 C  C   . PRO B 1 359 ? 7.766   21.183  -12.786 1.00 34.07 ? 359 PRO B C   1 
ATOM   5436 O  O   . PRO B 1 359 ? 7.418   20.916  -11.636 1.00 37.10 ? 359 PRO B O   1 
ATOM   5437 C  CB  . PRO B 1 359 ? 6.506   19.292  -13.901 1.00 31.22 ? 359 PRO B CB  1 
ATOM   5438 C  CG  . PRO B 1 359 ? 6.756   18.249  -12.850 1.00 31.66 ? 359 PRO B CG  1 
ATOM   5439 C  CD  . PRO B 1 359 ? 8.166   17.828  -13.148 1.00 32.07 ? 359 PRO B CD  1 
ATOM   5440 N  N   . LYS B 1 360 ? 8.135   22.401  -13.164 1.00 34.22 ? 360 LYS B N   1 
ATOM   5441 C  CA  . LYS B 1 360 ? 8.191   23.510  -12.221 1.00 33.68 ? 360 LYS B CA  1 
ATOM   5442 C  C   . LYS B 1 360 ? 6.923   23.716  -11.404 1.00 32.49 ? 360 LYS B C   1 
ATOM   5443 O  O   . LYS B 1 360 ? 6.947   23.609  -10.176 1.00 32.32 ? 360 LYS B O   1 
ATOM   5444 C  CB  . LYS B 1 360 ? 8.541   24.808  -12.957 1.00 35.51 ? 360 LYS B CB  1 
ATOM   5445 C  CG  . LYS B 1 360 ? 9.874   24.760  -13.681 1.00 39.22 ? 360 LYS B CG  1 
ATOM   5446 C  CD  . LYS B 1 360 ? 10.217  26.083  -14.360 1.00 42.45 ? 360 LYS B CD  1 
ATOM   5447 C  CE  . LYS B 1 360 ? 10.680  27.133  -13.357 1.00 43.78 ? 360 LYS B CE  1 
ATOM   5448 N  NZ  . LYS B 1 360 ? 9.645   27.441  -12.331 1.00 44.87 ? 360 LYS B NZ  1 
ATOM   5449 N  N   . LEU B 1 361 ? 5.823   24.011  -12.090 1.00 30.00 ? 361 LEU B N   1 
ATOM   5450 C  CA  . LEU B 1 361 ? 4.540   24.263  -11.443 1.00 28.93 ? 361 LEU B CA  1 
ATOM   5451 C  C   . LEU B 1 361 ? 3.974   23.069  -10.682 1.00 29.50 ? 361 LEU B C   1 
ATOM   5452 O  O   . LEU B 1 361 ? 3.492   23.213  -9.552  1.00 31.04 ? 361 LEU B O   1 
ATOM   5453 C  CB  . LEU B 1 361 ? 3.526   24.747  -12.486 1.00 29.42 ? 361 LEU B CB  1 
ATOM   5454 C  CG  . LEU B 1 361 ? 2.144   25.211  -12.015 1.00 29.42 ? 361 LEU B CG  1 
ATOM   5455 C  CD1 . LEU B 1 361 ? 2.275   26.313  -10.951 1.00 27.82 ? 361 LEU B CD1 1 
ATOM   5456 C  CD2 . LEU B 1 361 ? 1.368   25.719  -13.223 1.00 27.27 ? 361 LEU B CD2 1 
ATOM   5457 N  N   . ALA B 1 362 ? 4.025   21.893  -11.297 1.00 29.65 ? 362 ALA B N   1 
ATOM   5458 C  CA  . ALA B 1 362 ? 3.515   20.689  -10.651 1.00 29.99 ? 362 ALA B CA  1 
ATOM   5459 C  C   . ALA B 1 362 ? 4.172   20.532  -9.283  1.00 28.89 ? 362 ALA B C   1 
ATOM   5460 O  O   . ALA B 1 362 ? 3.506   20.246  -8.289  1.00 29.89 ? 362 ALA B O   1 
ATOM   5461 C  CB  . ALA B 1 362 ? 3.800   19.465  -11.517 1.00 31.90 ? 362 ALA B CB  1 
ATOM   5462 N  N   . SER B 1 363 ? 5.481   20.734  -9.236  1.00 29.30 ? 363 SER B N   1 
ATOM   5463 C  CA  . SER B 1 363 ? 6.221   20.614  -7.984  1.00 29.12 ? 363 SER B CA  1 
ATOM   5464 C  C   . SER B 1 363 ? 5.838   21.702  -6.986  1.00 27.39 ? 363 SER B C   1 
ATOM   5465 O  O   . SER B 1 363 ? 5.548   21.410  -5.825  1.00 29.22 ? 363 SER B O   1 
ATOM   5466 C  CB  . SER B 1 363 ? 7.723   20.684  -8.255  1.00 29.31 ? 363 SER B CB  1 
ATOM   5467 O  OG  . SER B 1 363 ? 8.128   19.637  -9.113  1.00 28.99 ? 363 SER B OG  1 
ATOM   5468 N  N   . ARG B 1 364 ? 5.842   22.951  -7.444  1.00 27.26 ? 364 ARG B N   1 
ATOM   5469 C  CA  . ARG B 1 364 ? 5.504   24.102  -6.601  1.00 25.76 ? 364 ARG B CA  1 
ATOM   5470 C  C   . ARG B 1 364 ? 4.153   23.862  -5.938  1.00 25.73 ? 364 ARG B C   1 
ATOM   5471 O  O   . ARG B 1 364 ? 3.969   24.097  -4.746  1.00 24.64 ? 364 ARG B O   1 
ATOM   5472 C  CB  . ARG B 1 364 ? 5.442   25.368  -7.463  1.00 24.54 ? 364 ARG B CB  1 
ATOM   5473 C  CG  . ARG B 1 364 ? 5.185   26.664  -6.697  1.00 24.10 ? 364 ARG B CG  1 
ATOM   5474 C  CD  . ARG B 1 364 ? 5.186   27.870  -7.646  1.00 23.21 ? 364 ARG B CD  1 
ATOM   5475 N  NE  . ARG B 1 364 ? 5.002   29.130  -6.933  1.00 22.93 ? 364 ARG B NE  1 
ATOM   5476 C  CZ  . ARG B 1 364 ? 4.948   30.331  -7.506  1.00 25.06 ? 364 ARG B CZ  1 
ATOM   5477 N  NH1 . ARG B 1 364 ? 5.059   30.461  -8.826  1.00 26.70 ? 364 ARG B NH1 1 
ATOM   5478 N  NH2 . ARG B 1 364 ? 4.802   31.414  -6.754  1.00 22.85 ? 364 ARG B NH2 1 
ATOM   5479 N  N   . ILE B 1 365 ? 3.212   23.382  -6.737  1.00 25.22 ? 365 ILE B N   1 
ATOM   5480 C  CA  . ILE B 1 365 ? 1.876   23.085  -6.264  1.00 26.07 ? 365 ILE B CA  1 
ATOM   5481 C  C   . ILE B 1 365 ? 1.894   22.000  -5.189  1.00 27.30 ? 365 ILE B C   1 
ATOM   5482 O  O   . ILE B 1 365 ? 1.362   22.191  -4.091  1.00 25.17 ? 365 ILE B O   1 
ATOM   5483 C  CB  . ILE B 1 365 ? 0.993   22.636  -7.437  1.00 24.40 ? 365 ILE B CB  1 
ATOM   5484 C  CG1 . ILE B 1 365 ? 0.790   23.817  -8.385  1.00 25.57 ? 365 ILE B CG1 1 
ATOM   5485 C  CG2 . ILE B 1 365 ? -0.323  22.083  -6.927  1.00 22.83 ? 365 ILE B CG2 1 
ATOM   5486 C  CD1 . ILE B 1 365 ? -0.092  23.517  -9.567  1.00 25.23 ? 365 ILE B CD1 1 
ATOM   5487 N  N   . LEU B 1 366 ? 2.500   20.861  -5.510  1.00 27.85 ? 366 LEU B N   1 
ATOM   5488 C  CA  . LEU B 1 366 ? 2.587   19.753  -4.566  1.00 30.30 ? 366 LEU B CA  1 
ATOM   5489 C  C   . LEU B 1 366 ? 3.301   20.211  -3.301  1.00 30.34 ? 366 LEU B C   1 
ATOM   5490 O  O   . LEU B 1 366 ? 2.912   19.866  -2.181  1.00 27.99 ? 366 LEU B O   1 
ATOM   5491 C  CB  . LEU B 1 366 ? 3.358   18.591  -5.197  1.00 33.45 ? 366 LEU B CB  1 
ATOM   5492 C  CG  . LEU B 1 366 ? 3.817   17.470  -4.265  1.00 34.08 ? 366 LEU B CG  1 
ATOM   5493 C  CD1 . LEU B 1 366 ? 2.611   16.796  -3.632  1.00 37.51 ? 366 LEU B CD1 1 
ATOM   5494 C  CD2 . LEU B 1 366 ? 4.633   16.465  -5.052  1.00 34.71 ? 366 LEU B CD2 1 
ATOM   5495 N  N   . SER B 1 367 ? 4.348   21.001  -3.488  1.00 30.29 ? 367 SER B N   1 
ATOM   5496 C  CA  . SER B 1 367 ? 5.112   21.497  -2.361  1.00 31.57 ? 367 SER B CA  1 
ATOM   5497 C  C   . SER B 1 367 ? 4.238   22.377  -1.468  1.00 31.25 ? 367 SER B C   1 
ATOM   5498 O  O   . SER B 1 367 ? 4.269   22.258  -0.243  1.00 32.71 ? 367 SER B O   1 
ATOM   5499 C  CB  . SER B 1 367 ? 6.330   22.280  -2.859  1.00 31.95 ? 367 SER B CB  1 
ATOM   5500 O  OG  . SER B 1 367 ? 7.147   22.701  -1.780  1.00 34.92 ? 367 SER B OG  1 
ATOM   5501 N  N   . LYS B 1 368 ? 3.445   23.250  -2.080  1.00 29.70 ? 368 LYS B N   1 
ATOM   5502 C  CA  . LYS B 1 368 ? 2.583   24.133  -1.308  1.00 30.83 ? 368 LYS B CA  1 
ATOM   5503 C  C   . LYS B 1 368 ? 1.501   23.372  -0.550  1.00 31.77 ? 368 LYS B C   1 
ATOM   5504 O  O   . LYS B 1 368 ? 1.359   23.509  0.667   1.00 34.09 ? 368 LYS B O   1 
ATOM   5505 C  CB  . LYS B 1 368 ? 1.918   25.154  -2.218  1.00 31.87 ? 368 LYS B CB  1 
ATOM   5506 C  CG  . LYS B 1 368 ? 1.150   26.206  -1.451  1.00 34.76 ? 368 LYS B CG  1 
ATOM   5507 C  CD  . LYS B 1 368 ? 2.101   27.004  -0.581  1.00 36.19 ? 368 LYS B CD  1 
ATOM   5508 C  CE  . LYS B 1 368 ? 1.439   28.244  -0.012  1.00 38.47 ? 368 LYS B CE  1 
ATOM   5509 N  NZ  . LYS B 1 368 ? 2.454   29.185  0.547   1.00 39.55 ? 368 LYS B NZ  1 
ATOM   5510 N  N   . LEU B 1 369 ? 0.733   22.574  -1.282  1.00 31.41 ? 369 LEU B N   1 
ATOM   5511 C  CA  . LEU B 1 369 ? -0.342  21.790  -0.689  1.00 32.11 ? 369 LEU B CA  1 
ATOM   5512 C  C   . LEU B 1 369 ? 0.097   20.885  0.469   1.00 31.78 ? 369 LEU B C   1 
ATOM   5513 O  O   . LEU B 1 369 ? -0.564  20.831  1.494   1.00 32.40 ? 369 LEU B O   1 
ATOM   5514 C  CB  . LEU B 1 369 ? -1.027  20.954  -1.773  1.00 30.44 ? 369 LEU B CB  1 
ATOM   5515 C  CG  . LEU B 1 369 ? -1.847  21.775  -2.771  1.00 31.43 ? 369 LEU B CG  1 
ATOM   5516 C  CD1 . LEU B 1 369 ? -2.264  20.917  -3.959  1.00 32.04 ? 369 LEU B CD1 1 
ATOM   5517 C  CD2 . LEU B 1 369 ? -3.061  22.348  -2.064  1.00 31.17 ? 369 LEU B CD2 1 
ATOM   5518 N  N   . THR B 1 370 ? 1.202   20.169  0.315   1.00 32.28 ? 370 THR B N   1 
ATOM   5519 C  CA  . THR B 1 370 ? 1.646   19.301  1.393   1.00 33.95 ? 370 THR B CA  1 
ATOM   5520 C  C   . THR B 1 370 ? 2.146   20.134  2.570   1.00 34.81 ? 370 THR B C   1 
ATOM   5521 O  O   . THR B 1 370 ? 1.913   19.786  3.726   1.00 32.19 ? 370 THR B O   1 
ATOM   5522 C  CB  . THR B 1 370 ? 2.748   18.336  0.921   1.00 33.01 ? 370 THR B CB  1 
ATOM   5523 O  OG1 . THR B 1 370 ? 3.755   19.066  0.216   1.00 33.67 ? 370 THR B OG1 1 
ATOM   5524 C  CG2 . THR B 1 370 ? 2.166   17.280  0.002   1.00 33.66 ? 370 THR B CG2 1 
ATOM   5525 N  N   . ASP B 1 371 ? 2.821   21.242  2.273   1.00 36.54 ? 371 ASP B N   1 
ATOM   5526 C  CA  . ASP B 1 371 ? 3.325   22.124  3.324   1.00 36.27 ? 371 ASP B CA  1 
ATOM   5527 C  C   . ASP B 1 371 ? 2.164   22.548  4.206   1.00 34.05 ? 371 ASP B C   1 
ATOM   5528 O  O   . ASP B 1 371 ? 2.311   22.701  5.420   1.00 35.13 ? 371 ASP B O   1 
ATOM   5529 C  CB  . ASP B 1 371 ? 4.002   23.356  2.716   1.00 36.48 ? 371 ASP B CB  1 
ATOM   5530 C  CG  . ASP B 1 371 ? 5.426   23.080  2.291   1.00 38.89 ? 371 ASP B CG  1 
ATOM   5531 O  OD1 . ASP B 1 371 ? 5.750   21.895  2.038   1.00 39.17 ? 371 ASP B OD1 1 
ATOM   5532 O  OD2 . ASP B 1 371 ? 6.215   24.044  2.200   1.00 39.99 ? 371 ASP B OD2 1 
ATOM   5533 N  N   . ILE B 1 372 ? 1.006   22.730  3.584   1.00 30.14 ? 372 ILE B N   1 
ATOM   5534 C  CA  . ILE B 1 372 ? -0.191  23.120  4.309   1.00 26.96 ? 372 ILE B CA  1 
ATOM   5535 C  C   . ILE B 1 372 ? -0.825  21.919  5.019   1.00 27.36 ? 372 ILE B C   1 
ATOM   5536 O  O   . ILE B 1 372 ? -1.260  22.030  6.165   1.00 26.72 ? 372 ILE B O   1 
ATOM   5537 C  CB  . ILE B 1 372 ? -1.206  23.745  3.356   1.00 25.56 ? 372 ILE B CB  1 
ATOM   5538 C  CG1 . ILE B 1 372 ? -0.643  25.073  2.829   1.00 24.15 ? 372 ILE B CG1 1 
ATOM   5539 C  CG2 . ILE B 1 372 ? -2.541  23.942  4.060   1.00 24.25 ? 372 ILE B CG2 1 
ATOM   5540 C  CD1 . ILE B 1 372 ? -1.472  25.707  1.757   1.00 18.34 ? 372 ILE B CD1 1 
ATOM   5541 N  N   . GLN B 1 373 ? -0.860  20.769  4.351   1.00 25.26 ? 373 GLN B N   1 
ATOM   5542 C  CA  . GLN B 1 373 ? -1.451  19.581  4.951   1.00 26.47 ? 373 GLN B CA  1 
ATOM   5543 C  C   . GLN B 1 373 ? -0.721  19.129  6.218   1.00 27.16 ? 373 GLN B C   1 
ATOM   5544 O  O   . GLN B 1 373 ? -1.362  18.783  7.206   1.00 25.59 ? 373 GLN B O   1 
ATOM   5545 C  CB  . GLN B 1 373 ? -1.502  18.447  3.927   1.00 26.02 ? 373 GLN B CB  1 
ATOM   5546 C  CG  . GLN B 1 373 ? -2.353  18.794  2.710   1.00 26.57 ? 373 GLN B CG  1 
ATOM   5547 C  CD  . GLN B 1 373 ? -2.190  17.815  1.560   1.00 25.81 ? 373 GLN B CD  1 
ATOM   5548 O  OE1 . GLN B 1 373 ? -1.083  17.370  1.260   1.00 29.05 ? 373 GLN B OE1 1 
ATOM   5549 N  NE2 . GLN B 1 373 ? -3.293  17.496  0.894   1.00 27.88 ? 373 GLN B NE2 1 
ATOM   5550 N  N   . TYR B 1 374 ? 0.610   19.146  6.197   1.00 28.38 ? 374 TYR B N   1 
ATOM   5551 C  CA  . TYR B 1 374 ? 1.397   18.730  7.362   1.00 32.61 ? 374 TYR B CA  1 
ATOM   5552 C  C   . TYR B 1 374 ? 1.709   19.865  8.332   1.00 33.53 ? 374 TYR B C   1 
ATOM   5553 O  O   . TYR B 1 374 ? 2.608   19.755  9.161   1.00 35.27 ? 374 TYR B O   1 
ATOM   5554 C  CB  . TYR B 1 374 ? 2.714   18.071  6.931   1.00 31.07 ? 374 TYR B CB  1 
ATOM   5555 C  CG  . TYR B 1 374 ? 2.523   16.790  6.161   1.00 31.42 ? 374 TYR B CG  1 
ATOM   5556 C  CD1 . TYR B 1 374 ? 2.473   16.795  4.771   1.00 32.03 ? 374 TYR B CD1 1 
ATOM   5557 C  CD2 . TYR B 1 374 ? 2.352   15.569  6.826   1.00 30.34 ? 374 TYR B CD2 1 
ATOM   5558 C  CE1 . TYR B 1 374 ? 2.257   15.620  4.056   1.00 33.32 ? 374 TYR B CE1 1 
ATOM   5559 C  CE2 . TYR B 1 374 ? 2.136   14.389  6.119   1.00 29.43 ? 374 TYR B CE2 1 
ATOM   5560 C  CZ  . TYR B 1 374 ? 2.089   14.423  4.735   1.00 32.75 ? 374 TYR B CZ  1 
ATOM   5561 O  OH  . TYR B 1 374 ? 1.866   13.270  4.016   1.00 36.86 ? 374 TYR B OH  1 
ATOM   5562 N  N   . GLY B 1 375 ? 0.970   20.958  8.220   1.00 36.55 ? 375 GLY B N   1 
ATOM   5563 C  CA  . GLY B 1 375 ? 1.188   22.078  9.113   1.00 37.40 ? 375 GLY B CA  1 
ATOM   5564 C  C   . GLY B 1 375 ? 2.553   22.747  9.069   1.00 37.44 ? 375 GLY B C   1 
ATOM   5565 O  O   . GLY B 1 375 ? 2.906   23.456  10.009  1.00 37.04 ? 375 GLY B O   1 
ATOM   5566 N  N   . ARG B 1 376 ? 3.335   22.517  8.016   1.00 38.00 ? 376 ARG B N   1 
ATOM   5567 C  CA  . ARG B 1 376 ? 4.629   23.183  7.912   1.00 38.08 ? 376 ARG B CA  1 
ATOM   5568 C  C   . ARG B 1 376 ? 4.342   24.635  7.549   1.00 37.70 ? 376 ARG B C   1 
ATOM   5569 O  O   . ARG B 1 376 ? 5.255   25.444  7.402   1.00 38.84 ? 376 ARG B O   1 
ATOM   5570 C  CB  . ARG B 1 376 ? 5.506   22.546  6.829   1.00 39.03 ? 376 ARG B CB  1 
ATOM   5571 C  CG  . ARG B 1 376 ? 6.123   21.212  7.223   1.00 40.67 ? 376 ARG B CG  1 
ATOM   5572 C  CD  . ARG B 1 376 ? 7.281   20.862  6.306   1.00 42.72 ? 376 ARG B CD  1 
ATOM   5573 N  NE  . ARG B 1 376 ? 6.846   20.534  4.954   1.00 45.57 ? 376 ARG B NE  1 
ATOM   5574 C  CZ  . ARG B 1 376 ? 6.305   19.371  4.607   1.00 47.54 ? 376 ARG B CZ  1 
ATOM   5575 N  NH1 . ARG B 1 376 ? 6.134   18.420  5.517   1.00 49.09 ? 376 ARG B NH1 1 
ATOM   5576 N  NH2 . ARG B 1 376 ? 5.936   19.156  3.351   1.00 47.94 ? 376 ARG B NH2 1 
ATOM   5577 N  N   . GLU B 1 377 ? 3.057   24.942  7.405   1.00 37.48 ? 377 GLU B N   1 
ATOM   5578 C  CA  . GLU B 1 377 ? 2.580   26.278  7.076   1.00 39.57 ? 377 GLU B CA  1 
ATOM   5579 C  C   . GLU B 1 377 ? 1.134   26.419  7.573   1.00 40.67 ? 377 GLU B C   1 
ATOM   5580 O  O   . GLU B 1 377 ? 0.306   25.538  7.340   1.00 40.80 ? 377 GLU B O   1 
ATOM   5581 C  CB  . GLU B 1 377 ? 2.616   26.496  5.565   1.00 41.09 ? 377 GLU B CB  1 
ATOM   5582 C  CG  . GLU B 1 377 ? 2.280   27.919  5.147   1.00 42.76 ? 377 GLU B CG  1 
ATOM   5583 C  CD  . GLU B 1 377 ? 1.816   28.005  3.709   1.00 44.36 ? 377 GLU B CD  1 
ATOM   5584 O  OE1 . GLU B 1 377 ? 2.520   27.460  2.833   1.00 45.61 ? 377 GLU B OE1 1 
ATOM   5585 O  OE2 . GLU B 1 377 ? 0.752   28.620  3.457   1.00 45.67 ? 377 GLU B OE2 1 
ATOM   5586 N  N   . GLU B 1 378 ? 0.828   27.525  8.246   1.00 41.13 ? 378 GLU B N   1 
ATOM   5587 C  CA  . GLU B 1 378 ? -0.520  27.745  8.767   1.00 42.18 ? 378 GLU B CA  1 
ATOM   5588 C  C   . GLU B 1 378 ? -1.463  28.385  7.748   1.00 42.18 ? 378 GLU B C   1 
ATOM   5589 O  O   . GLU B 1 378 ? -1.085  29.297  7.014   1.00 42.07 ? 378 GLU B O   1 
ATOM   5590 C  CB  . GLU B 1 378 ? -0.459  28.600  10.036  1.00 41.04 ? 378 GLU B CB  1 
ATOM   5591 N  N   . ARG B 1 379 ? -2.697  27.894  7.712   1.00 43.31 ? 379 ARG B N   1 
ATOM   5592 C  CA  . ARG B 1 379 ? -3.715  28.406  6.798   1.00 42.98 ? 379 ARG B CA  1 
ATOM   5593 C  C   . ARG B 1 379 ? -5.048  27.747  7.112   1.00 43.14 ? 379 ARG B C   1 
ATOM   5594 O  O   . ARG B 1 379 ? -5.107  26.550  7.405   1.00 44.22 ? 379 ARG B O   1 
ATOM   5595 C  CB  . ARG B 1 379 ? -3.332  28.118  5.347   1.00 42.61 ? 379 ARG B CB  1 
ATOM   5596 C  CG  . ARG B 1 379 ? -4.328  28.658  4.333   1.00 41.99 ? 379 ARG B CG  1 
ATOM   5597 C  CD  . ARG B 1 379 ? -3.792  28.526  2.912   1.00 41.58 ? 379 ARG B CD  1 
ATOM   5598 N  NE  . ARG B 1 379 ? -4.627  29.239  1.947   1.00 42.00 ? 379 ARG B NE  1 
ATOM   5599 C  CZ  . ARG B 1 379 ? -4.165  29.784  0.825   1.00 42.88 ? 379 ARG B CZ  1 
ATOM   5600 N  NH1 . ARG B 1 379 ? -2.873  29.697  0.526   1.00 42.79 ? 379 ARG B NH1 1 
ATOM   5601 N  NH2 . ARG B 1 379 ? -4.988  30.434  0.013   1.00 45.25 ? 379 ARG B NH2 1 
ATOM   5602 N  N   . ASP B 1 380 ? -6.115  28.534  7.038   1.00 41.76 ? 380 ASP B N   1 
ATOM   5603 C  CA  . ASP B 1 380 ? -7.460  28.060  7.337   1.00 41.88 ? 380 ASP B CA  1 
ATOM   5604 C  C   . ASP B 1 380 ? -7.960  26.828  6.574   1.00 40.19 ? 380 ASP B C   1 
ATOM   5605 O  O   . ASP B 1 380 ? -9.146  26.521  6.643   1.00 42.37 ? 380 ASP B O   1 
ATOM   5606 C  CB  . ASP B 1 380 ? -8.460  29.197  7.126   1.00 43.27 ? 380 ASP B CB  1 
ATOM   5607 C  CG  . ASP B 1 380 ? -8.468  29.701  5.693   1.00 46.49 ? 380 ASP B CG  1 
ATOM   5608 O  OD1 . ASP B 1 380 ? -8.656  28.884  4.766   1.00 45.59 ? 380 ASP B OD1 1 
ATOM   5609 O  OD2 . ASP B 1 380 ? -8.286  30.918  5.490   1.00 50.31 ? 380 ASP B OD2 1 
ATOM   5610 N  N   . TRP B 1 381 ? -7.090  26.126  5.854   1.00 37.25 ? 381 TRP B N   1 
ATOM   5611 C  CA  . TRP B 1 381 ? -7.525  24.938  5.114   1.00 35.84 ? 381 TRP B CA  1 
ATOM   5612 C  C   . TRP B 1 381 ? -7.389  23.635  5.898   1.00 36.07 ? 381 TRP B C   1 
ATOM   5613 O  O   . TRP B 1 381 ? -7.851  22.591  5.442   1.00 36.98 ? 381 TRP B O   1 
ATOM   5614 C  CB  . TRP B 1 381 ? -6.758  24.791  3.788   1.00 33.67 ? 381 TRP B CB  1 
ATOM   5615 C  CG  . TRP B 1 381 ? -7.166  25.761  2.703   1.00 31.41 ? 381 TRP B CG  1 
ATOM   5616 C  CD1 . TRP B 1 381 ? -8.202  26.652  2.740   1.00 29.36 ? 381 TRP B CD1 1 
ATOM   5617 C  CD2 . TRP B 1 381 ? -6.537  25.932  1.428   1.00 29.83 ? 381 TRP B CD2 1 
ATOM   5618 N  NE1 . TRP B 1 381 ? -8.254  27.369  1.571   1.00 28.23 ? 381 TRP B NE1 1 
ATOM   5619 C  CE2 . TRP B 1 381 ? -7.247  26.950  0.746   1.00 29.19 ? 381 TRP B CE2 1 
ATOM   5620 C  CE3 . TRP B 1 381 ? -5.445  25.324  0.793   1.00 27.55 ? 381 TRP B CE3 1 
ATOM   5621 C  CZ2 . TRP B 1 381 ? -6.900  27.374  -0.538  1.00 27.00 ? 381 TRP B CZ2 1 
ATOM   5622 C  CZ3 . TRP B 1 381 ? -5.100  25.742  -0.488  1.00 28.02 ? 381 TRP B CZ3 1 
ATOM   5623 C  CH2 . TRP B 1 381 ? -5.827  26.760  -1.140  1.00 29.56 ? 381 TRP B CH2 1 
ATOM   5624 N  N   . THR B 1 382 ? -6.754  23.679  7.064   1.00 36.22 ? 382 THR B N   1 
ATOM   5625 C  CA  . THR B 1 382 ? -6.599  22.458  7.854   1.00 36.73 ? 382 THR B CA  1 
ATOM   5626 C  C   . THR B 1 382 ? -7.309  22.512  9.201   1.00 36.21 ? 382 THR B C   1 
ATOM   5627 O  O   . THR B 1 382 ? -7.545  23.584  9.757   1.00 35.53 ? 382 THR B O   1 
ATOM   5628 C  CB  . THR B 1 382 ? -5.122  22.131  8.108   1.00 37.62 ? 382 THR B CB  1 
ATOM   5629 O  OG1 . THR B 1 382 ? -4.531  23.172  8.892   1.00 39.19 ? 382 THR B OG1 1 
ATOM   5630 C  CG2 . THR B 1 382 ? -4.372  21.998  6.790   1.00 37.49 ? 382 THR B CG2 1 
ATOM   5631 N  N   . ILE B 1 383 ? -7.664  21.338  9.707   1.00 36.87 ? 383 ILE B N   1 
ATOM   5632 C  CA  . ILE B 1 383 ? -8.337  21.214  10.991  1.00 39.08 ? 383 ILE B CA  1 
ATOM   5633 C  C   . ILE B 1 383 ? -7.438  20.377  11.890  1.00 39.36 ? 383 ILE B C   1 
ATOM   5634 O  O   . ILE B 1 383 ? -6.894  19.366  11.453  1.00 40.29 ? 383 ILE B O   1 
ATOM   5635 C  CB  . ILE B 1 383 ? -9.706  20.509  10.850  1.00 39.82 ? 383 ILE B CB  1 
ATOM   5636 C  CG1 . ILE B 1 383 ? -10.675 21.394  10.059  1.00 42.07 ? 383 ILE B CG1 1 
ATOM   5637 C  CG2 . ILE B 1 383 ? -10.285 20.208  12.228  1.00 40.46 ? 383 ILE B CG2 1 
ATOM   5638 C  CD1 . ILE B 1 383 ? -11.010 22.725  10.738  1.00 40.66 ? 383 ILE B CD1 1 
ATOM   5639 N  N   . VAL B 1 384 ? -7.274  20.802  13.139  1.00 40.31 ? 384 VAL B N   1 
ATOM   5640 C  CA  . VAL B 1 384 ? -6.430  20.074  14.077  1.00 40.94 ? 384 VAL B CA  1 
ATOM   5641 C  C   . VAL B 1 384 ? -7.198  18.973  14.791  1.00 42.49 ? 384 VAL B C   1 
ATOM   5642 O  O   . VAL B 1 384 ? -8.399  19.106  15.048  1.00 40.12 ? 384 VAL B O   1 
ATOM   5643 C  CB  . VAL B 1 384 ? -5.823  21.010  15.146  1.00 40.36 ? 384 VAL B CB  1 
ATOM   5644 C  CG1 . VAL B 1 384 ? -4.928  20.212  16.081  1.00 40.18 ? 384 VAL B CG1 1 
ATOM   5645 C  CG2 . VAL B 1 384 ? -5.025  22.105  14.477  1.00 38.56 ? 384 VAL B CG2 1 
ATOM   5646 N  N   . LEU B 1 385 ? -6.473  17.895  15.096  1.00 46.27 ? 385 LEU B N   1 
ATOM   5647 C  CA  . LEU B 1 385 ? -6.978  16.705  15.791  1.00 48.47 ? 385 LEU B CA  1 
ATOM   5648 C  C   . LEU B 1 385 ? -8.497  16.654  15.875  1.00 48.64 ? 385 LEU B C   1 
ATOM   5649 O  O   . LEU B 1 385 ? -9.133  16.430  14.822  1.00 50.58 ? 385 LEU B O   1 
ATOM   5650 C  CB  . LEU B 1 385 ? -6.378  16.624  17.212  1.00 49.35 ? 385 LEU B CB  1 
ATOM   5651 C  CG  . LEU B 1 385 ? -4.848  16.562  17.412  1.00 49.91 ? 385 LEU B CG  1 
ATOM   5652 C  CD1 . LEU B 1 385 ? -4.535  16.597  18.901  1.00 50.41 ? 385 LEU B CD1 1 
ATOM   5653 C  CD2 . LEU B 1 385 ? -4.260  15.297  16.789  1.00 49.16 ? 385 LEU B CD2 1 
HETATM 5654 N  N1  . PLP C 2 .   ? -35.151 -0.985  -20.523 1.00 28.76 ? 410 PLP A N1  1 
HETATM 5655 C  C2  . PLP C 2 .   ? -34.196 -0.981  -19.559 1.00 30.71 ? 410 PLP A C2  1 
HETATM 5656 C  C2A . PLP C 2 .   ? -33.388 0.334   -19.306 1.00 24.93 ? 410 PLP A C2A 1 
HETATM 5657 C  C3  . PLP C 2 .   ? -33.968 -2.137  -18.835 1.00 29.86 ? 410 PLP A C3  1 
HETATM 5658 O  O3  . PLP C 2 .   ? -33.034 -2.147  -17.871 1.00 33.20 ? 410 PLP A O3  1 
HETATM 5659 C  C4  . PLP C 2 .   ? -34.684 -3.294  -19.068 1.00 31.54 ? 410 PLP A C4  1 
HETATM 5660 C  C4A . PLP C 2 .   ? -34.331 -4.558  -18.238 1.00 31.43 ? 410 PLP A C4A 1 
HETATM 5661 C  C5  . PLP C 2 .   ? -35.656 -3.260  -20.069 1.00 32.38 ? 410 PLP A C5  1 
HETATM 5662 C  C6  . PLP C 2 .   ? -35.866 -2.104  -20.769 1.00 31.65 ? 410 PLP A C6  1 
HETATM 5663 C  C5A . PLP C 2 .   ? -36.539 -4.417  -20.439 1.00 29.36 ? 410 PLP A C5A 1 
HETATM 5664 O  O4P . PLP C 2 .   ? -35.949 -5.609  -20.924 1.00 30.72 ? 410 PLP A O4P 1 
HETATM 5665 P  P   . PLP C 2 .   ? -36.895 -6.870  -20.732 1.00 25.80 ? 410 PLP A P   1 
HETATM 5666 O  O1P . PLP C 2 .   ? -37.351 -6.984  -19.322 1.00 28.75 ? 410 PLP A O1P 1 
HETATM 5667 O  O2P . PLP C 2 .   ? -35.731 -7.921  -21.063 1.00 28.36 ? 410 PLP A O2P 1 
HETATM 5668 O  O3P . PLP C 2 .   ? -37.911 -6.860  -21.800 1.00 30.84 ? 410 PLP A O3P 1 
HETATM 5669 N  N1  . GBN D 3 .   ? -38.952 -1.483  -15.810 1.00 28.98 ? 420 GBN A N1  1 
HETATM 5670 C  C2  . GBN D 3 .   ? -38.328 -2.535  -15.053 1.00 33.55 ? 420 GBN A C2  1 
HETATM 5671 C  C3  . GBN D 3 .   ? -37.557 -4.271  -16.116 1.00 34.49 ? 420 GBN A C3  1 
HETATM 5672 C  C1R . GBN D 3 .   ? -37.158 -3.526  -14.779 1.00 34.29 ? 420 GBN A C1R 1 
HETATM 5673 C  C2R . GBN D 3 .   ? -37.107 -4.580  -13.593 1.00 33.86 ? 420 GBN A C2R 1 
HETATM 5674 C  C3R . GBN D 3 .   ? -36.698 -3.802  -12.273 1.00 34.21 ? 420 GBN A C3R 1 
HETATM 5675 C  C4R . GBN D 3 .   ? -35.267 -3.163  -12.443 1.00 33.83 ? 420 GBN A C4R 1 
HETATM 5676 C  C5R . GBN D 3 .   ? -35.314 -2.120  -13.610 1.00 32.34 ? 420 GBN A C5R 1 
HETATM 5677 C  C6R . GBN D 3 .   ? -35.730 -2.859  -14.916 1.00 31.56 ? 420 GBN A C6R 1 
HETATM 5678 C  C   . GBN D 3 .   ? -38.716 -4.990  -16.386 1.00 36.42 ? 420 GBN A C   1 
HETATM 5679 O  OA  . GBN D 3 .   ? -39.530 -4.295  -17.038 1.00 35.84 ? 420 GBN A OA  1 
HETATM 5680 O  OB  . GBN D 3 .   ? -38.945 -6.173  -16.039 1.00 40.46 ? 420 GBN A OB  1 
HETATM 5681 MG MG  . MG  E 4 .   ? -26.940 20.099  14.685  1.00 32.49 ? 430 MG  B MG  1 
HETATM 5682 N  N1  . PLP F 2 .   ? -12.592 13.513  -10.630 1.00 22.04 ? 410 PLP B N1  1 
HETATM 5683 C  C2  . PLP F 2 .   ? -13.432 12.495  -10.283 1.00 23.06 ? 410 PLP B C2  1 
HETATM 5684 C  C2A . PLP F 2 .   ? -14.263 11.802  -11.391 1.00 21.92 ? 410 PLP B C2A 1 
HETATM 5685 C  C3  . PLP F 2 .   ? -13.530 12.115  -8.951  1.00 25.75 ? 410 PLP B C3  1 
HETATM 5686 O  O3  . PLP F 2 .   ? -14.368 11.050  -8.599  1.00 26.58 ? 410 PLP B O3  1 
HETATM 5687 C  C4  . PLP F 2 .   ? -12.768 12.782  -7.964  1.00 25.08 ? 410 PLP B C4  1 
HETATM 5688 C  C4A . PLP F 2 .   ? -12.952 12.360  -6.496  1.00 26.77 ? 410 PLP B C4A 1 
HETATM 5689 C  C5  . PLP F 2 .   ? -11.913 13.839  -8.365  1.00 25.54 ? 410 PLP B C5  1 
HETATM 5690 C  C6  . PLP F 2 .   ? -11.849 14.171  -9.702  1.00 22.16 ? 410 PLP B C6  1 
HETATM 5691 C  C5A . PLP F 2 .   ? -10.994 14.655  -7.406  1.00 22.84 ? 410 PLP B C5A 1 
HETATM 5692 O  O4P . PLP F 2 .   ? -11.654 15.415  -6.390  1.00 26.58 ? 410 PLP B O4P 1 
HETATM 5693 P  P   . PLP F 2 .   ? -10.842 15.660  -5.045  1.00 24.55 ? 410 PLP B P   1 
HETATM 5694 O  O1P . PLP F 2 .   ? -10.373 14.345  -4.484  1.00 25.60 ? 410 PLP B O1P 1 
HETATM 5695 O  O2P . PLP F 2 .   ? -12.007 16.217  -4.162  1.00 24.37 ? 410 PLP B O2P 1 
HETATM 5696 O  O3P . PLP F 2 .   ? -9.879  16.730  -5.317  1.00 25.18 ? 410 PLP B O3P 1 
HETATM 5697 N  N1  . GBN G 3 .   ? -8.463  9.109   -8.976  1.00 29.59 ? 420 GBN B N1  1 
HETATM 5698 C  C2  . GBN G 3 .   ? -8.994  8.772   -7.683  1.00 26.64 ? 420 GBN B C2  1 
HETATM 5699 C  C3  . GBN G 3 .   ? -9.746  10.372  -6.407  1.00 26.27 ? 420 GBN B C3  1 
HETATM 5700 C  C1R . GBN G 3 .   ? -10.096 8.843   -6.588  1.00 24.64 ? 420 GBN B C1R 1 
HETATM 5701 C  C2R . GBN G 3 .   ? -10.022 8.130   -5.189  1.00 21.55 ? 420 GBN B C2R 1 
HETATM 5702 C  C3R . GBN G 3 .   ? -10.388 6.606   -5.416  1.00 23.51 ? 420 GBN B C3R 1 
HETATM 5703 C  C4R . GBN G 3 .   ? -11.858 6.468   -5.972  1.00 21.94 ? 420 GBN B C4R 1 
HETATM 5704 C  C5R . GBN G 3 .   ? -11.952 7.196   -7.356  1.00 23.47 ? 420 GBN B C5R 1 
HETATM 5705 C  C6R . GBN G 3 .   ? -11.563 8.690   -7.156  1.00 23.70 ? 420 GBN B C6R 1 
HETATM 5706 C  C   . GBN G 3 .   ? -8.583  10.949  -5.917  1.00 27.36 ? 420 GBN B C   1 
HETATM 5707 O  OA  . GBN G 3 .   ? -7.900  11.437  -6.852  1.00 25.55 ? 420 GBN B OA  1 
HETATM 5708 O  OB  . GBN G 3 .   ? -8.246  10.995  -4.704  1.00 28.23 ? 420 GBN B OB  1 
HETATM 5709 O  O   . HOH H 5 .   ? -35.608 -8.027  -17.580 1.00 19.99 ? 421 HOH A O   1 
HETATM 5710 O  O   . HOH H 5 .   ? -32.406 -7.796  -30.015 1.00 25.50 ? 422 HOH A O   1 
HETATM 5711 O  O   . HOH H 5 .   ? -37.603 13.275  -18.377 1.00 27.08 ? 423 HOH A O   1 
HETATM 5712 O  O   . HOH H 5 .   ? -39.013 -14.343 -18.428 1.00 23.57 ? 424 HOH A O   1 
HETATM 5713 O  O   . HOH H 5 .   ? -36.304 7.767   -30.836 1.00 30.01 ? 425 HOH A O   1 
HETATM 5714 O  O   . HOH H 5 .   ? -36.031 -10.326 -19.989 1.00 26.73 ? 426 HOH A O   1 
HETATM 5715 O  O   . HOH H 5 .   ? -36.588 5.335   -15.054 1.00 20.85 ? 427 HOH A O   1 
HETATM 5716 O  O   . HOH H 5 .   ? -12.950 -10.311 1.331   1.00 31.60 ? 428 HOH A O   1 
HETATM 5717 O  O   . HOH H 5 .   ? -33.457 7.556   -29.680 1.00 17.05 ? 429 HOH A O   1 
HETATM 5718 O  O   . HOH H 5 .   ? -37.630 -12.963 -20.573 1.00 35.78 ? 430 HOH A O   1 
HETATM 5719 O  O   . HOH H 5 .   ? -20.313 4.521   -4.221  1.00 30.51 ? 431 HOH A O   1 
HETATM 5720 O  O   . HOH H 5 .   ? -51.138 -0.888  -8.109  1.00 31.92 ? 432 HOH A O   1 
HETATM 5721 O  O   . HOH H 5 .   ? -15.816 -24.756 -4.231  1.00 26.90 ? 433 HOH A O   1 
HETATM 5722 O  O   . HOH H 5 .   ? -55.390 0.724   -32.023 1.00 28.71 ? 434 HOH A O   1 
HETATM 5723 O  O   . HOH H 5 .   ? -24.614 5.769   -20.830 1.00 38.84 ? 435 HOH A O   1 
HETATM 5724 O  O   . HOH H 5 .   ? -57.065 -9.034  -25.891 1.00 35.46 ? 436 HOH A O   1 
HETATM 5725 O  O   . HOH H 5 .   ? -30.239 -10.748 -25.364 1.00 26.58 ? 437 HOH A O   1 
HETATM 5726 O  O   . HOH H 5 .   ? -22.282 -20.997 -0.283  1.00 33.53 ? 438 HOH A O   1 
HETATM 5727 O  O   . HOH H 5 .   ? -20.638 10.431  -27.648 1.00 40.48 ? 439 HOH A O   1 
HETATM 5728 O  O   . HOH H 5 .   ? -34.436 -5.900  -28.407 1.00 31.45 ? 440 HOH A O   1 
HETATM 5729 O  O   . HOH H 5 .   ? -22.708 -0.402  -13.241 1.00 29.47 ? 441 HOH A O   1 
HETATM 5730 O  O   . HOH H 5 .   ? -13.752 -31.339 -5.902  1.00 27.34 ? 442 HOH A O   1 
HETATM 5731 O  O   . HOH H 5 .   ? -36.263 0.319   -28.804 1.00 30.62 ? 443 HOH A O   1 
HETATM 5732 O  O   . HOH H 5 .   ? -41.614 -22.801 1.842   1.00 20.85 ? 444 HOH A O   1 
HETATM 5733 O  O   . HOH H 5 .   ? -25.487 4.140   -23.374 1.00 22.47 ? 445 HOH A O   1 
HETATM 5734 O  O   . HOH H 5 .   ? -9.405  -6.165  5.737   1.00 43.57 ? 446 HOH A O   1 
HETATM 5735 O  O   . HOH H 5 .   ? -53.886 10.923  -32.497 1.00 23.00 ? 447 HOH A O   1 
HETATM 5736 O  O   . HOH H 5 .   ? -49.482 -19.577 -5.317  1.00 34.65 ? 448 HOH A O   1 
HETATM 5737 O  O   . HOH H 5 .   ? -53.777 -5.126  -34.687 1.00 40.23 ? 449 HOH A O   1 
HETATM 5738 O  O   . HOH H 5 .   ? -49.904 -13.161 1.889   1.00 38.23 ? 450 HOH A O   1 
HETATM 5739 O  O   . HOH H 5 .   ? -32.037 -1.428  -33.979 1.00 18.01 ? 451 HOH A O   1 
HETATM 5740 O  O   . HOH H 5 .   ? -48.112 25.484  -24.210 1.00 30.02 ? 452 HOH A O   1 
HETATM 5741 O  O   . HOH H 5 .   ? -39.742 5.979   -14.642 1.00 37.46 ? 453 HOH A O   1 
HETATM 5742 O  O   . HOH H 5 .   ? -54.164 -3.337  -40.871 1.00 45.02 ? 454 HOH A O   1 
HETATM 5743 O  O   . HOH H 5 .   ? -43.663 -17.970 7.032   1.00 29.77 ? 455 HOH A O   1 
HETATM 5744 O  O   . HOH H 5 .   ? -13.073 -9.820  -13.175 1.00 26.51 ? 456 HOH A O   1 
HETATM 5745 O  O   . HOH H 5 .   ? -53.799 3.346   -11.779 1.00 51.94 ? 457 HOH A O   1 
HETATM 5746 O  O   . HOH H 5 .   ? -26.827 -1.399  -28.968 1.00 26.83 ? 458 HOH A O   1 
HETATM 5747 O  O   . HOH H 5 .   ? -20.117 -31.054 -5.467  1.00 34.12 ? 459 HOH A O   1 
HETATM 5748 O  O   . HOH H 5 .   ? -19.555 -20.696 -4.365  1.00 15.55 ? 460 HOH A O   1 
HETATM 5749 O  O   . HOH H 5 .   ? -40.470 1.882   -11.930 1.00 32.37 ? 461 HOH A O   1 
HETATM 5750 O  O   . HOH H 5 .   ? -37.824 -17.057 -17.998 1.00 31.13 ? 462 HOH A O   1 
HETATM 5751 O  O   . HOH H 5 .   ? -38.886 -24.503 -1.044  1.00 37.23 ? 463 HOH A O   1 
HETATM 5752 O  O   . HOH H 5 .   ? -37.153 1.765   -26.270 1.00 31.41 ? 464 HOH A O   1 
HETATM 5753 O  O   . HOH H 5 .   ? -40.153 19.548  -16.690 1.00 27.23 ? 465 HOH A O   1 
HETATM 5754 O  O   . HOH H 5 .   ? -38.481 -4.927  -23.689 1.00 30.60 ? 466 HOH A O   1 
HETATM 5755 O  O   . HOH H 5 .   ? -33.304 11.927  -34.893 1.00 44.01 ? 467 HOH A O   1 
HETATM 5756 O  O   . HOH H 5 .   ? -38.115 -29.066 7.459   1.00 41.42 ? 468 HOH A O   1 
HETATM 5757 O  O   . HOH H 5 .   ? -42.149 -4.102  -17.095 1.00 27.92 ? 469 HOH A O   1 
HETATM 5758 O  O   . HOH H 5 .   ? -28.429 -13.667 -27.977 1.00 44.37 ? 470 HOH A O   1 
HETATM 5759 O  O   . HOH H 5 .   ? -39.240 -29.705 -4.877  1.00 35.89 ? 471 HOH A O   1 
HETATM 5760 O  O   . HOH H 5 .   ? -56.080 0.097   -35.069 1.00 34.64 ? 472 HOH A O   1 
HETATM 5761 O  O   . HOH H 5 .   ? -22.656 11.585  -29.182 1.00 34.26 ? 473 HOH A O   1 
HETATM 5762 O  O   . HOH H 5 .   ? -28.598 0.459   -28.235 1.00 18.53 ? 474 HOH A O   1 
HETATM 5763 O  O   . HOH H 5 .   ? -31.345 -24.178 8.797   1.00 47.97 ? 475 HOH A O   1 
HETATM 5764 O  O   . HOH H 5 .   ? -20.567 -21.151 2.602   1.00 40.30 ? 476 HOH A O   1 
HETATM 5765 O  O   . HOH H 5 .   ? -21.291 13.695  -28.328 1.00 39.21 ? 477 HOH A O   1 
HETATM 5766 O  O   . HOH H 5 .   ? -38.739 4.531   -46.296 1.00 40.97 ? 478 HOH A O   1 
HETATM 5767 O  O   . HOH H 5 .   ? -43.051 -1.251  -8.782  1.00 47.01 ? 479 HOH A O   1 
HETATM 5768 O  O   . HOH H 5 .   ? -36.140 7.697   -38.222 1.00 36.86 ? 480 HOH A O   1 
HETATM 5769 O  O   . HOH H 5 .   ? -38.931 13.469  -37.965 1.00 29.51 ? 481 HOH A O   1 
HETATM 5770 O  O   . HOH H 5 .   ? -48.102 20.213  -27.761 1.00 36.75 ? 482 HOH A O   1 
HETATM 5771 O  O   . HOH H 5 .   ? -45.997 -17.963 -3.743  1.00 24.71 ? 483 HOH A O   1 
HETATM 5772 O  O   . HOH H 5 .   ? -32.516 -10.113 -28.533 1.00 36.73 ? 484 HOH A O   1 
HETATM 5773 O  O   . HOH H 5 .   ? -23.260 -15.945 -0.049  1.00 31.27 ? 485 HOH A O   1 
HETATM 5774 O  O   . HOH H 5 .   ? -30.390 -7.617  -31.323 1.00 32.01 ? 486 HOH A O   1 
HETATM 5775 O  O   . HOH H 5 .   ? -20.142 -13.654 -0.358  1.00 41.32 ? 487 HOH A O   1 
HETATM 5776 O  O   . HOH H 5 .   ? -25.393 -27.838 -18.567 1.00 40.96 ? 488 HOH A O   1 
HETATM 5777 O  O   . HOH H 5 .   ? -30.883 11.270  -35.805 1.00 37.31 ? 489 HOH A O   1 
HETATM 5778 O  O   . HOH I 5 .   ? -4.068  1.241   -6.373  1.00 41.37 ? 431 HOH B O   1 
HETATM 5779 O  O   . HOH I 5 .   ? -11.317 16.016  -1.474  1.00 26.21 ? 432 HOH B O   1 
HETATM 5780 O  O   . HOH I 5 .   ? -25.249 20.724  13.005  1.00 22.33 ? 433 HOH B O   1 
HETATM 5781 O  O   . HOH I 5 .   ? -12.041 12.824  -2.955  1.00 16.20 ? 434 HOH B O   1 
HETATM 5782 O  O   . HOH I 5 .   ? -11.210 18.324  -14.980 1.00 15.98 ? 435 HOH B O   1 
HETATM 5783 O  O   . HOH I 5 .   ? -8.401  15.820  2.804   1.00 19.82 ? 436 HOH B O   1 
HETATM 5784 O  O   . HOH I 5 .   ? -0.837  9.886   17.087  1.00 39.29 ? 437 HOH B O   1 
HETATM 5785 O  O   . HOH I 5 .   ? -18.540 11.917  -27.446 1.00 25.02 ? 438 HOH B O   1 
HETATM 5786 O  O   . HOH I 5 .   ? -10.070 17.345  1.338   1.00 30.05 ? 439 HOH B O   1 
HETATM 5787 O  O   . HOH I 5 .   ? -11.571 20.985  -14.319 1.00 28.40 ? 440 HOH B O   1 
HETATM 5788 O  O   . HOH I 5 .   ? -34.017 7.729   1.467   1.00 24.60 ? 441 HOH B O   1 
HETATM 5789 O  O   . HOH I 5 .   ? -27.801 21.032  12.667  1.00 23.35 ? 442 HOH B O   1 
HETATM 5790 O  O   . HOH I 5 .   ? -24.873 17.033  -14.080 1.00 28.60 ? 443 HOH B O   1 
HETATM 5791 O  O   . HOH I 5 .   ? 2.738   30.757  -1.741  1.00 25.05 ? 444 HOH B O   1 
HETATM 5792 O  O   . HOH I 5 .   ? -28.087 16.452  -22.607 1.00 36.37 ? 445 HOH B O   1 
HETATM 5793 O  O   . HOH I 5 .   ? -15.835 11.400  -21.312 1.00 18.33 ? 446 HOH B O   1 
HETATM 5794 O  O   . HOH I 5 .   ? 4.034   5.032   10.123  1.00 21.77 ? 447 HOH B O   1 
HETATM 5795 O  O   . HOH I 5 .   ? -33.638 11.394  7.352   1.00 33.20 ? 448 HOH B O   1 
HETATM 5796 O  O   . HOH I 5 .   ? -11.911 16.759  17.567  1.00 39.16 ? 449 HOH B O   1 
HETATM 5797 O  O   . HOH I 5 .   ? -33.732 13.508  -2.870  1.00 27.68 ? 450 HOH B O   1 
HETATM 5798 O  O   . HOH I 5 .   ? -0.593  11.064  1.171   1.00 24.91 ? 451 HOH B O   1 
HETATM 5799 O  O   . HOH I 5 .   ? -26.784 -4.446  -10.446 1.00 30.63 ? 452 HOH B O   1 
HETATM 5800 O  O   . HOH I 5 .   ? 4.964   29.721  -13.003 1.00 25.58 ? 453 HOH B O   1 
HETATM 5801 O  O   . HOH I 5 .   ? -13.551 22.678  6.048   1.00 28.31 ? 454 HOH B O   1 
HETATM 5802 O  O   . HOH I 5 .   ? -21.337 21.060  -11.859 1.00 26.50 ? 455 HOH B O   1 
HETATM 5803 O  O   . HOH I 5 .   ? -10.944 26.339  -29.882 1.00 31.90 ? 456 HOH B O   1 
HETATM 5804 O  O   . HOH I 5 .   ? -19.739 12.654  -2.110  1.00 25.97 ? 457 HOH B O   1 
HETATM 5805 O  O   . HOH I 5 .   ? -4.300  -4.182  8.575   1.00 26.85 ? 458 HOH B O   1 
HETATM 5806 O  O   . HOH I 5 .   ? 9.130   24.591  -8.786  1.00 29.71 ? 459 HOH B O   1 
HETATM 5807 O  O   . HOH I 5 .   ? -16.863 -10.091 9.481   1.00 32.45 ? 460 HOH B O   1 
HETATM 5808 O  O   . HOH I 5 .   ? -8.471  17.079  -0.635  1.00 25.04 ? 461 HOH B O   1 
HETATM 5809 O  O   . HOH I 5 .   ? -15.870 13.889  -18.164 1.00 25.61 ? 462 HOH B O   1 
HETATM 5810 O  O   . HOH I 5 .   ? 2.730   35.810  -20.783 1.00 24.69 ? 463 HOH B O   1 
HETATM 5811 O  O   . HOH I 5 .   ? -12.315 20.923  -21.687 1.00 28.06 ? 464 HOH B O   1 
HETATM 5812 O  O   . HOH I 5 .   ? -6.435  17.416  -2.056  1.00 34.27 ? 465 HOH B O   1 
HETATM 5813 O  O   . HOH I 5 .   ? -14.784 19.725  -20.938 1.00 28.16 ? 466 HOH B O   1 
HETATM 5814 O  O   . HOH I 5 .   ? 6.853   26.354  -23.402 1.00 38.34 ? 467 HOH B O   1 
HETATM 5815 O  O   . HOH I 5 .   ? -17.477 13.089  -20.294 1.00 27.18 ? 468 HOH B O   1 
HETATM 5816 O  O   . HOH I 5 .   ? -0.045  32.342  -11.113 1.00 26.10 ? 469 HOH B O   1 
HETATM 5817 O  O   . HOH I 5 .   ? -23.344 11.111  -16.682 1.00 29.53 ? 470 HOH B O   1 
HETATM 5818 O  O   . HOH I 5 .   ? -24.645 23.033  11.207  1.00 37.90 ? 471 HOH B O   1 
HETATM 5819 O  O   . HOH I 5 .   ? -16.200 26.234  -13.651 1.00 29.19 ? 472 HOH B O   1 
HETATM 5820 O  O   . HOH I 5 .   ? -11.360 22.875  -31.133 1.00 31.99 ? 473 HOH B O   1 
HETATM 5821 O  O   . HOH I 5 .   ? 10.933  21.617  -11.091 1.00 27.73 ? 474 HOH B O   1 
HETATM 5822 O  O   . HOH I 5 .   ? -28.251 0.050   14.761  1.00 21.11 ? 475 HOH B O   1 
HETATM 5823 O  O   . HOH I 5 .   ? -6.175  35.043  -14.717 1.00 23.65 ? 476 HOH B O   1 
HETATM 5824 O  O   . HOH I 5 .   ? -9.286  17.751  -8.003  1.00 17.90 ? 477 HOH B O   1 
HETATM 5825 O  O   . HOH I 5 .   ? -16.416 20.693  -19.304 1.00 27.43 ? 478 HOH B O   1 
HETATM 5826 O  O   . HOH I 5 .   ? -27.995 -3.490  6.638   1.00 35.48 ? 479 HOH B O   1 
HETATM 5827 O  O   . HOH I 5 .   ? -8.385  -5.305  14.709  1.00 17.71 ? 480 HOH B O   1 
HETATM 5828 O  O   . HOH I 5 .   ? 4.613   31.930  -4.034  1.00 31.40 ? 481 HOH B O   1 
HETATM 5829 O  O   . HOH I 5 .   ? -10.809 18.059  -31.107 1.00 52.83 ? 482 HOH B O   1 
HETATM 5830 O  O   . HOH I 5 .   ? -30.873 -2.762  11.165  1.00 50.03 ? 483 HOH B O   1 
HETATM 5831 O  O   . HOH I 5 .   ? 10.620  17.814  -24.396 1.00 32.21 ? 484 HOH B O   1 
HETATM 5832 O  O   . HOH I 5 .   ? -25.772 19.590  7.312   1.00 28.29 ? 485 HOH B O   1 
HETATM 5833 O  O   . HOH I 5 .   ? -21.497 9.532   -15.256 1.00 34.73 ? 486 HOH B O   1 
HETATM 5834 O  O   . HOH I 5 .   ? -6.336  6.353   20.563  1.00 36.62 ? 487 HOH B O   1 
HETATM 5835 O  O   . HOH I 5 .   ? -30.195 18.116  6.706   1.00 25.69 ? 488 HOH B O   1 
HETATM 5836 O  O   . HOH I 5 .   ? -10.929 1.173   8.870   1.00 20.78 ? 489 HOH B O   1 
HETATM 5837 O  O   . HOH I 5 .   ? -27.749 9.804   17.406  1.00 36.30 ? 490 HOH B O   1 
HETATM 5838 O  O   . HOH I 5 .   ? 6.396   27.701  -11.044 1.00 19.13 ? 491 HOH B O   1 
HETATM 5839 O  O   . HOH I 5 .   ? -9.044  15.856  19.847  1.00 39.38 ? 492 HOH B O   1 
HETATM 5840 O  O   . HOH I 5 .   ? -34.293 11.125  13.064  1.00 39.80 ? 493 HOH B O   1 
HETATM 5841 O  O   . HOH I 5 .   ? -26.510 17.506  -24.301 1.00 26.59 ? 494 HOH B O   1 
HETATM 5842 O  O   . HOH I 5 .   ? -22.804 -2.726  10.390  1.00 29.03 ? 495 HOH B O   1 
HETATM 5843 O  O   . HOH I 5 .   ? 5.875   24.952  -0.453  1.00 36.42 ? 496 HOH B O   1 
HETATM 5844 O  O   . HOH I 5 .   ? -23.918 -4.910  8.579   1.00 28.74 ? 497 HOH B O   1 
HETATM 5845 O  O   . HOH I 5 .   ? -29.317 12.575  -13.967 1.00 35.92 ? 498 HOH B O   1 
HETATM 5846 O  O   . HOH I 5 .   ? -26.803 8.385   24.677  1.00 38.78 ? 499 HOH B O   1 
HETATM 5847 O  O   . HOH I 5 .   ? -26.802 22.334  15.503  1.00 32.58 ? 500 HOH B O   1 
HETATM 5848 O  O   . HOH I 5 .   ? 5.944   4.008   11.898  1.00 48.29 ? 501 HOH B O   1 
HETATM 5849 O  O   . HOH I 5 .   ? -7.198  -5.101  7.006   1.00 33.58 ? 502 HOH B O   1 
HETATM 5850 O  O   . HOH I 5 .   ? -19.605 22.349  15.816  1.00 48.60 ? 503 HOH B O   1 
HETATM 5851 O  O   . HOH I 5 .   ? 4.867   22.286  -26.313 1.00 31.07 ? 504 HOH B O   1 
HETATM 5852 O  O   . HOH I 5 .   ? -23.630 -1.792  15.011  1.00 27.27 ? 505 HOH B O   1 
HETATM 5853 O  O   . HOH I 5 .   ? -12.491 29.355  -4.038  1.00 32.80 ? 506 HOH B O   1 
HETATM 5854 O  O   . HOH I 5 .   ? -15.771 8.077   -13.703 1.00 39.32 ? 507 HOH B O   1 
HETATM 5855 O  O   . HOH I 5 .   ? -28.921 13.899  -11.490 1.00 35.84 ? 508 HOH B O   1 
HETATM 5856 O  O   . HOH I 5 .   ? -10.419 10.788  -3.006  1.00 25.98 ? 509 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   LYS 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   CYS 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   ?   ?   ?   A . n 
A 1 6   ASN 6   6   ?   ?   ?   A . n 
A 1 7   GLY 7   7   ?   ?   ?   A . n 
A 1 8   CYS 8   8   ?   ?   ?   A . n 
A 1 9   SER 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  GLU 11  11  ?   ?   ?   A . n 
A 1 12  CYS 12  12  ?   ?   ?   A . n 
A 1 13  THR 13  13  ?   ?   ?   A . n 
A 1 14  GLY 14  14  ?   ?   ?   A . n 
A 1 15  GLU 15  15  ?   ?   ?   A . n 
A 1 16  GLY 16  16  ?   ?   ?   A . n 
A 1 17  GLY 17  17  ?   ?   ?   A . n 
A 1 18  SER 18  18  ?   ?   ?   A . n 
A 1 19  LYS 19  19  ?   ?   ?   A . n 
A 1 20  GLU 20  20  ?   ?   ?   A . n 
A 1 21  VAL 21  21  ?   ?   ?   A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  LYS 28  28  28  LYS ALA A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  GLU 40  40  40  GLU ALA A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  ASN 45  45  45  ASN ALA A . n 
A 1 46  ASN 46  46  ?   ?   ?   A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  HIS 56  56  56  HIS HIS A . n 
A 1 57  MET 57  57  57  MET MET A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  TRP 62  62  62  TRP TRP A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  PHE 66  66  66  PHE PHE A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  TRP 68  68  68  TRP TRP A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  PRO 71  71  71  PRO PRO A . n 
A 1 72  HIS 72  72  72  HIS HIS A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  HIS 82  82  82  HIS HIS A . n 
A 1 83  PRO 83  83  83  PRO PRO A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  HIS 89  89  89  HIS HIS A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  PHE 95  95  95  PHE PHE A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 PHE 111 111 111 PHE PHE A . n 
A 1 112 GLN 112 112 112 GLN GLN A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 MET 117 117 117 MET MET A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 MET 120 120 120 MET MET A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 ARG 122 122 122 ARG ALA A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 CYS 140 140 140 CYS CYS A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 GLN 142 142 142 GLN GLN A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 TRP 151 151 151 TRP TRP A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 PRO 153 153 153 PRO PRO A . n 
A 1 154 TYR 154 154 154 TYR TYR A . n 
A 1 155 SER 155 155 155 SER SER A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 SER 157 157 157 SER SER A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 ARG 163 163 163 ARG ARG A . n 
A 1 164 PRO 164 164 164 PRO PRO A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 THR 169 169 169 THR THR A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 PRO 171 171 171 PRO PRO A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 LYS 180 180 180 LYS LYS A . n 
A 1 181 ALA 181 181 181 ALA ALA A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 PHE 184 184 184 PHE PHE A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 PRO 189 189 189 PRO PRO A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 TYR 193 193 193 TYR TYR A . n 
A 1 194 PHE 194 194 194 PHE PHE A . n 
A 1 195 SER 195 195 ?   ?   ?   A . n 
A 1 196 SER 196 196 ?   ?   ?   A . n 
A 1 197 GLY 197 197 ?   ?   ?   A . n 
A 1 198 THR 198 198 ?   ?   ?   A . n 
A 1 199 PHE 199 199 199 PHE PHE A . n 
A 1 200 ASN 200 200 200 ASN ALA A . n 
A 1 201 PRO 201 201 201 PRO PRO A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 LEU 204 204 204 LEU LEU A . n 
A 1 205 TRP 205 205 205 TRP TRP A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ASN 207 207 207 ASN ASN A . n 
A 1 208 PRO 208 208 208 PRO PRO A . n 
A 1 209 LYS 209 209 209 LYS ALA A . n 
A 1 210 TYR 210 210 210 TYR TYR A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 TRP 214 214 214 TRP TRP A . n 
A 1 215 LYS 215 215 215 LYS LYS A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 GLY 217 217 217 GLY GLY A . n 
A 1 218 THR 218 218 218 THR THR A . n 
A 1 219 GLY 219 219 219 GLY GLY A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 CYS 221 221 221 CYS CYS A . n 
A 1 222 LYS 222 222 222 LYS LYS A . n 
A 1 223 MET 223 223 223 MET MET A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 ASN 226 226 226 ASN ASN A . n 
A 1 227 TYR 227 227 227 TYR TYR A . n 
A 1 228 GLY 228 228 228 GLY GLY A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 LEU 231 231 231 LEU LEU A . n 
A 1 232 PHE 232 232 232 PHE PHE A . n 
A 1 233 ALA 233 233 233 ALA ALA A . n 
A 1 234 GLN 234 234 234 GLN GLN A . n 
A 1 235 CYS 235 235 235 CYS CYS A . n 
A 1 236 GLU 236 236 236 GLU GLU A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 ASN 240 240 240 ASN ASN A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 CYS 242 242 242 CYS CYS A . n 
A 1 243 GLN 243 243 243 GLN GLN A . n 
A 1 244 GLN 244 244 244 GLN GLN A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 TRP 247 247 247 TRP TRP A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 TYR 249 249 249 TYR TYR A . n 
A 1 250 GLY 250 250 250 GLY GLY A . n 
A 1 251 GLU 251 251 251 GLU GLU A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 HIS 253 253 253 HIS HIS A . n 
A 1 254 GLN 254 254 254 GLN GLN A . n 
A 1 255 ILE 255 255 255 ILE ILE A . n 
A 1 256 THR 256 256 256 THR THR A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 VAL 258 258 258 VAL VAL A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 THR 260 260 260 THR THR A . n 
A 1 261 MET 261 261 261 MET MET A . n 
A 1 262 ASN 262 262 262 ASN ASN A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 PHE 264 264 264 PHE PHE A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 TRP 267 267 267 TRP TRP A . n 
A 1 268 ILE 268 268 268 ILE ILE A . n 
A 1 269 ASN 269 269 269 ASN ASN A . n 
A 1 270 GLU 270 270 270 GLU GLU A . n 
A 1 271 ASP 271 271 271 ASP ASP A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 GLU 274 274 274 GLU GLU A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 THR 278 278 278 THR THR A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 PRO 280 280 280 PRO PRO A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 ASP 282 282 282 ASP ASP A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 ILE 284 284 284 ILE ILE A . n 
A 1 285 ILE 285 285 285 ILE ILE A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 PRO 287 287 287 PRO PRO A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 VAL 289 289 289 VAL VAL A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 ARG 292 292 292 ARG ARG A . n 
A 1 293 CYS 293 293 293 CYS CYS A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 ASP 296 296 296 ASP ASP A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 HIS 299 299 299 HIS HIS A . n 
A 1 300 GLN 300 300 300 GLN GLN A . n 
A 1 301 TRP 301 301 301 TRP TRP A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 GLU 303 303 303 GLU GLU A . n 
A 1 304 PHE 304 304 304 PHE PHE A . n 
A 1 305 LYS 305 305 305 LYS LYS A . n 
A 1 306 VAL 306 306 306 VAL VAL A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 ARG 309 309 309 ARG ARG A . n 
A 1 310 TYR 310 310 310 TYR TYR A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 THR 312 312 312 THR THR A . n 
A 1 313 MET 313 313 313 MET MET A . n 
A 1 314 ASP 314 314 314 ASP ASP A . n 
A 1 315 ASP 315 315 315 ASP ASP A . n 
A 1 316 LEU 316 316 316 LEU LEU A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 ALA 319 319 319 ALA ALA A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 GLU 321 321 321 GLU GLU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 ASN 323 323 323 ASN ASN A . n 
A 1 324 ARG 324 324 324 ARG ARG A . n 
A 1 325 VAL 325 325 325 VAL VAL A . n 
A 1 326 ARG 326 326 326 ARG ARG A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 MET 328 328 328 MET MET A . n 
A 1 329 PHE 329 329 329 PHE PHE A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 SER 331 331 331 SER SER A . n 
A 1 332 GLY 332 332 332 GLY GLY A . n 
A 1 333 THR 333 333 333 THR THR A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 CYS 335 335 335 CYS CYS A . n 
A 1 336 VAL 336 336 336 VAL VAL A . n 
A 1 337 VAL 337 337 337 VAL VAL A . n 
A 1 338 CYS 338 338 338 CYS CYS A . n 
A 1 339 PRO 339 339 339 PRO PRO A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 SER 341 341 341 SER SER A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 ILE 343 343 343 ILE ILE A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 TYR 345 345 345 TYR TYR A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 GLY 347 347 347 GLY GLY A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 THR 349 349 349 THR THR A . n 
A 1 350 ILE 350 350 350 ILE ILE A . n 
A 1 351 HIS 351 351 351 HIS HIS A . n 
A 1 352 ILE 352 352 352 ILE ILE A . n 
A 1 353 PRO 353 353 353 PRO PRO A . n 
A 1 354 THR 354 354 354 THR THR A . n 
A 1 355 MET 355 355 355 MET MET A . n 
A 1 356 GLU 356 356 356 GLU GLU A . n 
A 1 357 ASN 357 357 357 ASN ASN A . n 
A 1 358 GLY 358 358 358 GLY GLY A . n 
A 1 359 PRO 359 359 359 PRO PRO A . n 
A 1 360 LYS 360 360 360 LYS ALA A . n 
A 1 361 LEU 361 361 361 LEU LEU A . n 
A 1 362 ALA 362 362 362 ALA ALA A . n 
A 1 363 SER 363 363 363 SER SER A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 SER 367 367 367 SER SER A . n 
A 1 368 LYS 368 368 368 LYS LYS A . n 
A 1 369 LEU 369 369 369 LEU LEU A . n 
A 1 370 THR 370 370 370 THR THR A . n 
A 1 371 ASP 371 371 371 ASP ASP A . n 
A 1 372 ILE 372 372 372 ILE ILE A . n 
A 1 373 GLN 373 373 373 GLN GLN A . n 
A 1 374 TYR 374 374 374 TYR TYR A . n 
A 1 375 GLY 375 375 375 GLY GLY A . n 
A 1 376 ARG 376 376 376 ARG ARG A . n 
A 1 377 GLU 377 377 377 GLU GLU A . n 
A 1 378 GLU 378 378 378 GLU GLU A . n 
A 1 379 ARG 379 379 379 ARG ARG A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 TRP 381 381 381 TRP TRP A . n 
A 1 382 THR 382 382 382 THR THR A . n 
A 1 383 ILE 383 383 383 ILE ILE A . n 
A 1 384 VAL 384 384 384 VAL VAL A . n 
A 1 385 LEU 385 385 385 LEU LEU A . n 
A 1 386 SER 386 386 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   LYS 2   2   ?   ?   ?   B . n 
B 1 3   ASP 3   3   ?   ?   ?   B . n 
B 1 4   CYS 4   4   ?   ?   ?   B . n 
B 1 5   SER 5   5   ?   ?   ?   B . n 
B 1 6   ASN 6   6   ?   ?   ?   B . n 
B 1 7   GLY 7   7   ?   ?   ?   B . n 
B 1 8   CYS 8   8   ?   ?   ?   B . n 
B 1 9   SER 9   9   ?   ?   ?   B . n 
B 1 10  ALA 10  10  ?   ?   ?   B . n 
B 1 11  GLU 11  11  ?   ?   ?   B . n 
B 1 12  CYS 12  12  ?   ?   ?   B . n 
B 1 13  THR 13  13  ?   ?   ?   B . n 
B 1 14  GLY 14  14  ?   ?   ?   B . n 
B 1 15  GLU 15  15  ?   ?   ?   B . n 
B 1 16  GLY 16  16  ?   ?   ?   B . n 
B 1 17  GLY 17  17  ?   ?   ?   B . n 
B 1 18  SER 18  18  ?   ?   ?   B . n 
B 1 19  LYS 19  19  ?   ?   ?   B . n 
B 1 20  GLU 20  20  ?   ?   ?   B . n 
B 1 21  VAL 21  21  ?   ?   ?   B . n 
B 1 22  VAL 22  22  ?   ?   ?   B . n 
B 1 23  GLY 23  23  ?   ?   ?   B . n 
B 1 24  THR 24  24  24  THR THR B . n 
B 1 25  PHE 25  25  25  PHE PHE B . n 
B 1 26  LYS 26  26  26  LYS LYS B . n 
B 1 27  ALA 27  27  27  ALA ALA B . n 
B 1 28  LYS 28  28  28  LYS ALA B . n 
B 1 29  ASP 29  29  29  ASP ASP B . n 
B 1 30  LEU 30  30  30  LEU LEU B . n 
B 1 31  ILE 31  31  31  ILE ILE B . n 
B 1 32  VAL 32  32  32  VAL VAL B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  PRO 34  34  34  PRO PRO B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  THR 36  36  36  THR THR B . n 
B 1 37  ILE 37  37  37  ILE ILE B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  LYS 39  39  39  LYS LYS B . n 
B 1 40  GLU 40  40  40  GLU GLU B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  PRO 42  42  42  PRO PRO B . n 
B 1 43  ASP 43  43  43  ASP ASP B . n 
B 1 44  PRO 44  44  44  PRO PRO B . n 
B 1 45  ASN 45  45  45  ASN ASN B . n 
B 1 46  ASN 46  46  46  ASN ASN B . n 
B 1 47  LEU 47  47  47  LEU LEU B . n 
B 1 48  VAL 48  48  48  VAL VAL B . n 
B 1 49  PHE 49  49  49  PHE PHE B . n 
B 1 50  GLY 50  50  50  GLY GLY B . n 
B 1 51  THR 51  51  51  THR THR B . n 
B 1 52  VAL 52  52  52  VAL VAL B . n 
B 1 53  PHE 53  53  53  PHE PHE B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  ASP 55  55  55  ASP ASP B . n 
B 1 56  HIS 56  56  56  HIS HIS B . n 
B 1 57  MET 57  57  57  MET MET B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  THR 59  59  59  THR THR B . n 
B 1 60  VAL 60  60  60  VAL VAL B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  TRP 62  62  62  TRP TRP B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  SER 64  64  64  SER SER B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  PHE 66  66  66  PHE PHE B . n 
B 1 67  GLY 67  67  67  GLY GLY B . n 
B 1 68  TRP 68  68  68  TRP TRP B . n 
B 1 69  GLU 69  69  69  GLU GLU B . n 
B 1 70  LYS 70  70  70  LYS LYS B . n 
B 1 71  PRO 71  71  71  PRO PRO B . n 
B 1 72  HIS 72  72  72  HIS HIS B . n 
B 1 73  ILE 73  73  73  ILE ILE B . n 
B 1 74  LYS 74  74  74  LYS LYS B . n 
B 1 75  PRO 75  75  75  PRO PRO B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  GLN 77  77  77  GLN ALA B . n 
B 1 78  ASN 78  78  78  ASN ASN B . n 
B 1 79  LEU 79  79  79  LEU LEU B . n 
B 1 80  SER 80  80  80  SER SER B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  HIS 82  82  82  HIS HIS B . n 
B 1 83  PRO 83  83  83  PRO PRO B . n 
B 1 84  GLY 84  84  84  GLY GLY B . n 
B 1 85  SER 85  85  85  SER SER B . n 
B 1 86  SER 86  86  86  SER SER B . n 
B 1 87  ALA 87  87  87  ALA ALA B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  HIS 89  89  89  HIS HIS B . n 
B 1 90  TYR 90  90  90  TYR TYR B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  VAL 92  92  92  VAL VAL B . n 
B 1 93  GLU 93  93  93  GLU GLU B . n 
B 1 94  LEU 94  94  94  LEU LEU B . n 
B 1 95  PHE 95  95  95  PHE PHE B . n 
B 1 96  GLU 96  96  96  GLU GLU B . n 
B 1 97  GLY 97  97  97  GLY GLY B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  LYS 99  99  99  LYS LYS B . n 
B 1 100 ALA 100 100 100 ALA ALA B . n 
B 1 101 PHE 101 101 101 PHE PHE B . n 
B 1 102 ARG 102 102 102 ARG ARG B . n 
B 1 103 GLY 103 103 103 GLY GLY B . n 
B 1 104 VAL 104 104 104 VAL VAL B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 ASN 106 106 106 ASN ASN B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 ARG 109 109 109 ARG ARG B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 PHE 111 111 111 PHE PHE B . n 
B 1 112 GLN 112 112 112 GLN GLN B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 ASN 114 114 114 ASN ASN B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ASN 116 116 116 ASN ASN B . n 
B 1 117 MET 117 117 117 MET MET B . n 
B 1 118 ASP 118 118 118 ASP ASP B . n 
B 1 119 ARG 119 119 119 ARG ARG B . n 
B 1 120 MET 120 120 120 MET MET B . n 
B 1 121 TYR 121 121 121 TYR TYR B . n 
B 1 122 ARG 122 122 122 ARG ARG B . n 
B 1 123 SER 123 123 123 SER SER B . n 
B 1 124 ALA 124 124 124 ALA ALA B . n 
B 1 125 VAL 125 125 125 VAL VAL B . n 
B 1 126 ARG 126 126 126 ARG ARG B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 THR 128 128 128 THR THR B . n 
B 1 129 LEU 129 129 129 LEU LEU B . n 
B 1 130 PRO 130 130 130 PRO PRO B . n 
B 1 131 VAL 131 131 131 VAL VAL B . n 
B 1 132 PHE 132 132 132 PHE PHE B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 LYS 134 134 134 LYS LYS B . n 
B 1 135 GLU 135 135 135 GLU GLU B . n 
B 1 136 GLU 136 136 136 GLU GLU B . n 
B 1 137 LEU 137 137 137 LEU LEU B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 CYS 140 140 140 CYS CYS B . n 
B 1 141 ILE 141 141 141 ILE ILE B . n 
B 1 142 GLN 142 142 142 GLN GLN B . n 
B 1 143 GLN 143 143 143 GLN GLN B . n 
B 1 144 LEU 144 144 144 LEU LEU B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LYS 146 146 146 LYS LYS B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 ASP 148 148 148 ASP ASP B . n 
B 1 149 GLN 149 149 149 GLN GLN B . n 
B 1 150 GLU 150 150 150 GLU GLU B . n 
B 1 151 TRP 151 151 151 TRP TRP B . n 
B 1 152 VAL 152 152 152 VAL VAL B . n 
B 1 153 PRO 153 153 153 PRO PRO B . n 
B 1 154 TYR 154 154 154 TYR TYR B . n 
B 1 155 SER 155 155 155 SER SER B . n 
B 1 156 THR 156 156 156 THR THR B . n 
B 1 157 SER 157 157 157 SER SER B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 SER 159 159 159 SER SER B . n 
B 1 160 LEU 160 160 160 LEU LEU B . n 
B 1 161 TYR 161 161 161 TYR TYR B . n 
B 1 162 ILE 162 162 162 ILE ILE B . n 
B 1 163 ARG 163 163 163 ARG ARG B . n 
B 1 164 PRO 164 164 164 PRO PRO B . n 
B 1 165 THR 165 165 165 THR THR B . n 
B 1 166 PHE 166 166 166 PHE PHE B . n 
B 1 167 ILE 167 167 167 ILE ILE B . n 
B 1 168 GLY 168 168 168 GLY GLY B . n 
B 1 169 THR 169 169 169 THR THR B . n 
B 1 170 GLU 170 170 170 GLU GLU B . n 
B 1 171 PRO 171 171 171 PRO PRO B . n 
B 1 172 SER 172 172 172 SER SER B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 GLY 174 174 174 GLY GLY B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 LYS 177 177 177 LYS LYS B . n 
B 1 178 PRO 178 178 178 PRO PRO B . n 
B 1 179 THR 179 179 179 THR THR B . n 
B 1 180 LYS 180 180 180 LYS LYS B . n 
B 1 181 ALA 181 181 181 ALA ALA B . n 
B 1 182 LEU 182 182 182 LEU LEU B . n 
B 1 183 LEU 183 183 183 LEU LEU B . n 
B 1 184 PHE 184 184 184 PHE PHE B . n 
B 1 185 VAL 185 185 185 VAL VAL B . n 
B 1 186 LEU 186 186 186 LEU LEU B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 SER 188 188 188 SER SER B . n 
B 1 189 PRO 189 189 189 PRO PRO B . n 
B 1 190 VAL 190 190 190 VAL VAL B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 PRO 192 192 192 PRO PRO B . n 
B 1 193 TYR 193 193 193 TYR TYR B . n 
B 1 194 PHE 194 194 194 PHE PHE B . n 
B 1 195 SER 195 195 ?   ?   ?   B . n 
B 1 196 SER 196 196 ?   ?   ?   B . n 
B 1 197 GLY 197 197 ?   ?   ?   B . n 
B 1 198 THR 198 198 ?   ?   ?   B . n 
B 1 199 PHE 199 199 199 PHE PHE B . n 
B 1 200 ASN 200 200 200 ASN ASN B . n 
B 1 201 PRO 201 201 201 PRO PRO B . n 
B 1 202 VAL 202 202 202 VAL VAL B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 LEU 204 204 204 LEU LEU B . n 
B 1 205 TRP 205 205 205 TRP TRP B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ASN 207 207 207 ASN ASN B . n 
B 1 208 PRO 208 208 208 PRO PRO B . n 
B 1 209 LYS 209 209 209 LYS LYS B . n 
B 1 210 TYR 210 210 210 TYR TYR B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 ARG 212 212 212 ARG ARG B . n 
B 1 213 ALA 213 213 213 ALA ALA B . n 
B 1 214 TRP 214 214 214 TRP TRP B . n 
B 1 215 LYS 215 215 215 LYS LYS B . n 
B 1 216 GLY 216 216 216 GLY GLY B . n 
B 1 217 GLY 217 217 217 GLY GLY B . n 
B 1 218 THR 218 218 218 THR THR B . n 
B 1 219 GLY 219 219 219 GLY GLY B . n 
B 1 220 ASP 220 220 220 ASP ASP B . n 
B 1 221 CYS 221 221 221 CYS CYS B . n 
B 1 222 LYS 222 222 222 LYS LYS B . n 
B 1 223 MET 223 223 223 MET MET B . n 
B 1 224 GLY 224 224 224 GLY GLY B . n 
B 1 225 GLY 225 225 225 GLY GLY B . n 
B 1 226 ASN 226 226 226 ASN ASN B . n 
B 1 227 TYR 227 227 227 TYR TYR B . n 
B 1 228 GLY 228 228 228 GLY GLY B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 SER 230 230 230 SER SER B . n 
B 1 231 LEU 231 231 231 LEU LEU B . n 
B 1 232 PHE 232 232 232 PHE PHE B . n 
B 1 233 ALA 233 233 233 ALA ALA B . n 
B 1 234 GLN 234 234 234 GLN GLN B . n 
B 1 235 CYS 235 235 235 CYS CYS B . n 
B 1 236 GLU 236 236 236 GLU GLU B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 ASP 239 239 239 ASP ASP B . n 
B 1 240 ASN 240 240 240 ASN ASN B . n 
B 1 241 GLY 241 241 241 GLY GLY B . n 
B 1 242 CYS 242 242 242 CYS CYS B . n 
B 1 243 GLN 243 243 243 GLN GLN B . n 
B 1 244 GLN 244 244 244 GLN GLN B . n 
B 1 245 VAL 245 245 245 VAL VAL B . n 
B 1 246 LEU 246 246 246 LEU LEU B . n 
B 1 247 TRP 247 247 247 TRP TRP B . n 
B 1 248 LEU 248 248 248 LEU LEU B . n 
B 1 249 TYR 249 249 249 TYR TYR B . n 
B 1 250 GLY 250 250 250 GLY GLY B . n 
B 1 251 GLU 251 251 251 GLU GLU B . n 
B 1 252 ASP 252 252 252 ASP ASP B . n 
B 1 253 HIS 253 253 253 HIS HIS B . n 
B 1 254 GLN 254 254 254 GLN GLN B . n 
B 1 255 ILE 255 255 255 ILE ILE B . n 
B 1 256 THR 256 256 256 THR THR B . n 
B 1 257 GLU 257 257 257 GLU GLU B . n 
B 1 258 VAL 258 258 258 VAL VAL B . n 
B 1 259 GLY 259 259 259 GLY GLY B . n 
B 1 260 THR 260 260 260 THR THR B . n 
B 1 261 MET 261 261 261 MET MET B . n 
B 1 262 ASN 262 262 262 ASN ASN B . n 
B 1 263 LEU 263 263 263 LEU LEU B . n 
B 1 264 PHE 264 264 264 PHE PHE B . n 
B 1 265 LEU 265 265 265 LEU LEU B . n 
B 1 266 TYR 266 266 266 TYR TYR B . n 
B 1 267 TRP 267 267 267 TRP TRP B . n 
B 1 268 ILE 268 268 268 ILE ILE B . n 
B 1 269 ASN 269 269 269 ASN ASN B . n 
B 1 270 GLU 270 270 270 GLU GLU B . n 
B 1 271 ASP 271 271 271 ASP ASP B . n 
B 1 272 GLY 272 272 272 GLY GLY B . n 
B 1 273 GLU 273 273 273 GLU GLU B . n 
B 1 274 GLU 274 274 274 GLU GLU B . n 
B 1 275 GLU 275 275 275 GLU GLU B . n 
B 1 276 LEU 276 276 276 LEU LEU B . n 
B 1 277 ALA 277 277 277 ALA ALA B . n 
B 1 278 THR 278 278 278 THR THR B . n 
B 1 279 PRO 279 279 279 PRO PRO B . n 
B 1 280 PRO 280 280 280 PRO PRO B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 ASP 282 282 282 ASP ASP B . n 
B 1 283 GLY 283 283 283 GLY GLY B . n 
B 1 284 ILE 284 284 284 ILE ILE B . n 
B 1 285 ILE 285 285 285 ILE ILE B . n 
B 1 286 LEU 286 286 286 LEU LEU B . n 
B 1 287 PRO 287 287 287 PRO PRO B . n 
B 1 288 GLY 288 288 288 GLY GLY B . n 
B 1 289 VAL 289 289 289 VAL VAL B . n 
B 1 290 THR 290 290 290 THR THR B . n 
B 1 291 ARG 291 291 291 ARG ARG B . n 
B 1 292 ARG 292 292 292 ARG ARG B . n 
B 1 293 CYS 293 293 293 CYS CYS B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 LEU 295 295 295 LEU LEU B . n 
B 1 296 ASP 296 296 296 ASP ASP B . n 
B 1 297 LEU 297 297 297 LEU LEU B . n 
B 1 298 ALA 298 298 298 ALA ALA B . n 
B 1 299 HIS 299 299 299 HIS HIS B . n 
B 1 300 GLN 300 300 300 GLN GLN B . n 
B 1 301 TRP 301 301 301 TRP TRP B . n 
B 1 302 GLY 302 302 302 GLY GLY B . n 
B 1 303 GLU 303 303 303 GLU GLU B . n 
B 1 304 PHE 304 304 304 PHE PHE B . n 
B 1 305 LYS 305 305 305 LYS LYS B . n 
B 1 306 VAL 306 306 306 VAL VAL B . n 
B 1 307 SER 307 307 307 SER SER B . n 
B 1 308 GLU 308 308 308 GLU GLU B . n 
B 1 309 ARG 309 309 309 ARG ARG B . n 
B 1 310 TYR 310 310 310 TYR TYR B . n 
B 1 311 LEU 311 311 311 LEU LEU B . n 
B 1 312 THR 312 312 312 THR THR B . n 
B 1 313 MET 313 313 313 MET MET B . n 
B 1 314 ASP 314 314 314 ASP ASP B . n 
B 1 315 ASP 315 315 315 ASP ASP B . n 
B 1 316 LEU 316 316 316 LEU LEU B . n 
B 1 317 THR 317 317 317 THR THR B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 ALA 319 319 319 ALA ALA B . n 
B 1 320 LEU 320 320 320 LEU LEU B . n 
B 1 321 GLU 321 321 321 GLU GLU B . n 
B 1 322 GLY 322 322 322 GLY GLY B . n 
B 1 323 ASN 323 323 323 ASN ASN B . n 
B 1 324 ARG 324 324 324 ARG ARG B . n 
B 1 325 VAL 325 325 325 VAL VAL B . n 
B 1 326 ARG 326 326 326 ARG ARG B . n 
B 1 327 GLU 327 327 327 GLU GLU B . n 
B 1 328 MET 328 328 328 MET MET B . n 
B 1 329 PHE 329 329 329 PHE PHE B . n 
B 1 330 GLY 330 330 330 GLY GLY B . n 
B 1 331 SER 331 331 331 SER SER B . n 
B 1 332 GLY 332 332 332 GLY GLY B . n 
B 1 333 THR 333 333 333 THR THR B . n 
B 1 334 ALA 334 334 334 ALA ALA B . n 
B 1 335 CYS 335 335 335 CYS CYS B . n 
B 1 336 VAL 336 336 336 VAL VAL B . n 
B 1 337 VAL 337 337 337 VAL VAL B . n 
B 1 338 CYS 338 338 338 CYS CYS B . n 
B 1 339 PRO 339 339 339 PRO PRO B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 SER 341 341 341 SER SER B . n 
B 1 342 ASP 342 342 342 ASP ASP B . n 
B 1 343 ILE 343 343 343 ILE ILE B . n 
B 1 344 LEU 344 344 344 LEU LEU B . n 
B 1 345 TYR 345 345 345 TYR TYR B . n 
B 1 346 LYS 346 346 346 LYS LYS B . n 
B 1 347 GLY 347 347 347 GLY GLY B . n 
B 1 348 GLU 348 348 348 GLU GLU B . n 
B 1 349 THR 349 349 349 THR THR B . n 
B 1 350 ILE 350 350 350 ILE ILE B . n 
B 1 351 HIS 351 351 351 HIS HIS B . n 
B 1 352 ILE 352 352 352 ILE ILE B . n 
B 1 353 PRO 353 353 353 PRO PRO B . n 
B 1 354 THR 354 354 354 THR THR B . n 
B 1 355 MET 355 355 355 MET MET B . n 
B 1 356 GLU 356 356 356 GLU GLU B . n 
B 1 357 ASN 357 357 357 ASN ASN B . n 
B 1 358 GLY 358 358 358 GLY GLY B . n 
B 1 359 PRO 359 359 359 PRO PRO B . n 
B 1 360 LYS 360 360 360 LYS LYS B . n 
B 1 361 LEU 361 361 361 LEU LEU B . n 
B 1 362 ALA 362 362 362 ALA ALA B . n 
B 1 363 SER 363 363 363 SER SER B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 LEU 366 366 366 LEU LEU B . n 
B 1 367 SER 367 367 367 SER SER B . n 
B 1 368 LYS 368 368 368 LYS LYS B . n 
B 1 369 LEU 369 369 369 LEU LEU B . n 
B 1 370 THR 370 370 370 THR THR B . n 
B 1 371 ASP 371 371 371 ASP ASP B . n 
B 1 372 ILE 372 372 372 ILE ILE B . n 
B 1 373 GLN 373 373 373 GLN GLN B . n 
B 1 374 TYR 374 374 374 TYR TYR B . n 
B 1 375 GLY 375 375 375 GLY GLY B . n 
B 1 376 ARG 376 376 376 ARG ARG B . n 
B 1 377 GLU 377 377 377 GLU GLU B . n 
B 1 378 GLU 378 378 378 GLU ALA B . n 
B 1 379 ARG 379 379 379 ARG ARG B . n 
B 1 380 ASP 380 380 380 ASP ASP B . n 
B 1 381 TRP 381 381 381 TRP TRP B . n 
B 1 382 THR 382 382 382 THR THR B . n 
B 1 383 ILE 383 383 383 ILE ILE B . n 
B 1 384 VAL 384 384 384 VAL VAL B . n 
B 1 385 LEU 385 385 385 LEU LEU B . n 
B 1 386 SER 386 386 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PLP 1  410 410 PLP PLP A . 
D 3 GBN 1  420 420 GBN GBP A . 
E 4 MG  1  430 430 MG  MG  B . 
F 2 PLP 1  410 410 PLP PLP B . 
G 3 GBN 1  420 420 GBN GBP B . 
H 5 HOH 1  421 1   HOH HOH A . 
H 5 HOH 2  422 2   HOH HOH A . 
H 5 HOH 3  423 5   HOH HOH A . 
H 5 HOH 4  424 8   HOH HOH A . 
H 5 HOH 5  425 10  HOH HOH A . 
H 5 HOH 6  426 16  HOH HOH A . 
H 5 HOH 7  427 17  HOH HOH A . 
H 5 HOH 8  428 21  HOH HOH A . 
H 5 HOH 9  429 22  HOH HOH A . 
H 5 HOH 10 430 26  HOH HOH A . 
H 5 HOH 11 431 27  HOH HOH A . 
H 5 HOH 12 432 29  HOH HOH A . 
H 5 HOH 13 433 31  HOH HOH A . 
H 5 HOH 14 434 35  HOH HOH A . 
H 5 HOH 15 435 37  HOH HOH A . 
H 5 HOH 16 436 38  HOH HOH A . 
H 5 HOH 17 437 39  HOH HOH A . 
H 5 HOH 18 438 45  HOH HOH A . 
H 5 HOH 19 439 47  HOH HOH A . 
H 5 HOH 20 440 48  HOH HOH A . 
H 5 HOH 21 441 53  HOH HOH A . 
H 5 HOH 22 442 54  HOH HOH A . 
H 5 HOH 23 443 56  HOH HOH A . 
H 5 HOH 24 444 58  HOH HOH A . 
H 5 HOH 25 445 59  HOH HOH A . 
H 5 HOH 26 446 61  HOH HOH A . 
H 5 HOH 27 447 62  HOH HOH A . 
H 5 HOH 28 448 63  HOH HOH A . 
H 5 HOH 29 449 64  HOH HOH A . 
H 5 HOH 30 450 66  HOH HOH A . 
H 5 HOH 31 451 71  HOH HOH A . 
H 5 HOH 32 452 72  HOH HOH A . 
H 5 HOH 33 453 73  HOH HOH A . 
H 5 HOH 34 454 74  HOH HOH A . 
H 5 HOH 35 455 75  HOH HOH A . 
H 5 HOH 36 456 77  HOH HOH A . 
H 5 HOH 37 457 79  HOH HOH A . 
H 5 HOH 38 458 80  HOH HOH A . 
H 5 HOH 39 459 81  HOH HOH A . 
H 5 HOH 40 460 82  HOH HOH A . 
H 5 HOH 41 461 83  HOH HOH A . 
H 5 HOH 42 462 89  HOH HOH A . 
H 5 HOH 43 463 93  HOH HOH A . 
H 5 HOH 44 464 95  HOH HOH A . 
H 5 HOH 45 465 96  HOH HOH A . 
H 5 HOH 46 466 98  HOH HOH A . 
H 5 HOH 47 467 99  HOH HOH A . 
H 5 HOH 48 468 101 HOH HOH A . 
H 5 HOH 49 469 105 HOH HOH A . 
H 5 HOH 50 470 108 HOH HOH A . 
H 5 HOH 51 471 111 HOH HOH A . 
H 5 HOH 52 472 116 HOH HOH A . 
H 5 HOH 53 473 117 HOH HOH A . 
H 5 HOH 54 474 118 HOH HOH A . 
H 5 HOH 55 475 121 HOH HOH A . 
H 5 HOH 56 476 122 HOH HOH A . 
H 5 HOH 57 477 123 HOH HOH A . 
H 5 HOH 58 478 125 HOH HOH A . 
H 5 HOH 59 479 127 HOH HOH A . 
H 5 HOH 60 480 130 HOH HOH A . 
H 5 HOH 61 481 131 HOH HOH A . 
H 5 HOH 62 482 133 HOH HOH A . 
H 5 HOH 63 483 135 HOH HOH A . 
H 5 HOH 64 484 136 HOH HOH A . 
H 5 HOH 65 485 139 HOH HOH A . 
H 5 HOH 66 486 141 HOH HOH A . 
H 5 HOH 67 487 144 HOH HOH A . 
H 5 HOH 68 488 145 HOH HOH A . 
H 5 HOH 69 489 146 HOH HOH A . 
I 5 HOH 1  431 3   HOH HOH B . 
I 5 HOH 2  432 4   HOH HOH B . 
I 5 HOH 3  433 6   HOH HOH B . 
I 5 HOH 4  434 7   HOH HOH B . 
I 5 HOH 5  435 9   HOH HOH B . 
I 5 HOH 6  436 11  HOH HOH B . 
I 5 HOH 7  437 12  HOH HOH B . 
I 5 HOH 8  438 13  HOH HOH B . 
I 5 HOH 9  439 14  HOH HOH B . 
I 5 HOH 10 440 15  HOH HOH B . 
I 5 HOH 11 441 18  HOH HOH B . 
I 5 HOH 12 442 19  HOH HOH B . 
I 5 HOH 13 443 20  HOH HOH B . 
I 5 HOH 14 444 23  HOH HOH B . 
I 5 HOH 15 445 24  HOH HOH B . 
I 5 HOH 16 446 25  HOH HOH B . 
I 5 HOH 17 447 28  HOH HOH B . 
I 5 HOH 18 448 30  HOH HOH B . 
I 5 HOH 19 449 32  HOH HOH B . 
I 5 HOH 20 450 33  HOH HOH B . 
I 5 HOH 21 451 34  HOH HOH B . 
I 5 HOH 22 452 36  HOH HOH B . 
I 5 HOH 23 453 40  HOH HOH B . 
I 5 HOH 24 454 41  HOH HOH B . 
I 5 HOH 25 455 42  HOH HOH B . 
I 5 HOH 26 456 43  HOH HOH B . 
I 5 HOH 27 457 44  HOH HOH B . 
I 5 HOH 28 458 46  HOH HOH B . 
I 5 HOH 29 459 49  HOH HOH B . 
I 5 HOH 30 460 50  HOH HOH B . 
I 5 HOH 31 461 51  HOH HOH B . 
I 5 HOH 32 462 52  HOH HOH B . 
I 5 HOH 33 463 55  HOH HOH B . 
I 5 HOH 34 464 57  HOH HOH B . 
I 5 HOH 35 465 60  HOH HOH B . 
I 5 HOH 36 466 65  HOH HOH B . 
I 5 HOH 37 467 67  HOH HOH B . 
I 5 HOH 38 468 68  HOH HOH B . 
I 5 HOH 39 469 69  HOH HOH B . 
I 5 HOH 40 470 70  HOH HOH B . 
I 5 HOH 41 471 76  HOH HOH B . 
I 5 HOH 42 472 78  HOH HOH B . 
I 5 HOH 43 473 84  HOH HOH B . 
I 5 HOH 44 474 85  HOH HOH B . 
I 5 HOH 45 475 86  HOH HOH B . 
I 5 HOH 46 476 87  HOH HOH B . 
I 5 HOH 47 477 88  HOH HOH B . 
I 5 HOH 48 478 90  HOH HOH B . 
I 5 HOH 49 479 91  HOH HOH B . 
I 5 HOH 50 480 92  HOH HOH B . 
I 5 HOH 51 481 94  HOH HOH B . 
I 5 HOH 52 482 97  HOH HOH B . 
I 5 HOH 53 483 100 HOH HOH B . 
I 5 HOH 54 484 102 HOH HOH B . 
I 5 HOH 55 485 103 HOH HOH B . 
I 5 HOH 56 486 104 HOH HOH B . 
I 5 HOH 57 487 106 HOH HOH B . 
I 5 HOH 58 488 107 HOH HOH B . 
I 5 HOH 59 489 109 HOH HOH B . 
I 5 HOH 60 490 110 HOH HOH B . 
I 5 HOH 61 491 112 HOH HOH B . 
I 5 HOH 62 492 113 HOH HOH B . 
I 5 HOH 63 493 114 HOH HOH B . 
I 5 HOH 64 494 115 HOH HOH B . 
I 5 HOH 65 495 119 HOH HOH B . 
I 5 HOH 66 496 120 HOH HOH B . 
I 5 HOH 67 497 124 HOH HOH B . 
I 5 HOH 68 498 126 HOH HOH B . 
I 5 HOH 69 499 128 HOH HOH B . 
I 5 HOH 70 500 129 HOH HOH B . 
I 5 HOH 71 501 132 HOH HOH B . 
I 5 HOH 72 502 134 HOH HOH B . 
I 5 HOH 73 503 137 HOH HOH B . 
I 5 HOH 74 504 138 HOH HOH B . 
I 5 HOH 75 505 140 HOH HOH B . 
I 5 HOH 76 506 142 HOH HOH B . 
I 5 HOH 77 507 143 HOH HOH B . 
I 5 HOH 78 508 147 HOH HOH B . 
I 5 HOH 79 509 148 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7020  ? 
1 MORE         -45   ? 
1 'SSA (A^2)'  25970 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O   ? I HOH .   ? B HOH 433 ? 1_555 MG ? E MG . ? B MG 430 ? 1_555 O   ? I HOH .   ? B HOH 500 ? 1_555 87.5  ? 
2 O   ? I HOH .   ? B HOH 433 ? 1_555 MG ? E MG . ? B MG 430 ? 1_555 OD1 ? B ASP 133 ? B ASP 133 ? 1_555 62.9  ? 
3 O   ? I HOH .   ? B HOH 500 ? 1_555 MG ? E MG . ? B MG 430 ? 1_555 OD1 ? B ASP 133 ? B ASP 133 ? 1_555 146.0 ? 
4 O   ? I HOH .   ? B HOH 433 ? 1_555 MG ? E MG . ? B MG 430 ? 1_555 O   ? I HOH .   ? B HOH 442 ? 1_555 64.6  ? 
5 O   ? I HOH .   ? B HOH 500 ? 1_555 MG ? E MG . ? B MG 430 ? 1_555 O   ? I HOH .   ? B HOH 442 ? 1_555 86.8  ? 
6 OD1 ? B ASP 133 ? B ASP 133 ? 1_555 MG ? E MG . ? B MG 430 ? 1_555 O   ? I HOH .   ? B HOH 442 ? 1_555 66.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-08-30 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 44  ? ? -56.66  -4.01   
2  1 SER A 85  ? ? -37.61  129.76  
3  1 ASP A 148 ? ? -99.15  33.96   
4  1 VAL A 152 ? ? -59.60  103.65  
5  1 PRO A 153 ? ? -34.56  135.26  
6  1 PRO A 171 ? ? -74.80  44.05   
7  1 ASN A 200 ? ? -153.65 85.30   
8  1 PRO A 201 ? ? -48.42  153.60  
9  1 THR A 260 ? ? -108.42 47.22   
10 1 PRO A 287 ? ? -66.70  92.47   
11 1 VAL A 336 ? ? 71.02   -60.91  
12 1 PRO A 353 ? ? -66.87  19.48   
13 1 ASN A 357 ? ? -142.72 37.78   
14 1 GLN B 149 ? ? -39.95  -39.88  
15 1 THR B 260 ? ? -105.52 49.59   
16 1 VAL B 336 ? ? 85.21   -64.71  
17 1 TYR B 345 ? ? -114.80 -117.80 
18 1 LYS B 346 ? ? -68.87  54.45   
19 1 PRO B 353 ? ? -60.65  22.48   
20 1 ARG B 379 ? ? -173.68 140.84  
21 1 ASP B 380 ? ? -54.57  10.92   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 28  ? CG  ? A LYS 28  CG  
2  1 Y 1 A LYS 28  ? CD  ? A LYS 28  CD  
3  1 Y 1 A LYS 28  ? CE  ? A LYS 28  CE  
4  1 Y 1 A LYS 28  ? NZ  ? A LYS 28  NZ  
5  1 Y 1 A GLU 40  ? CG  ? A GLU 40  CG  
6  1 Y 1 A GLU 40  ? CD  ? A GLU 40  CD  
7  1 Y 1 A GLU 40  ? OE1 ? A GLU 40  OE1 
8  1 Y 1 A GLU 40  ? OE2 ? A GLU 40  OE2 
9  1 Y 1 A ASN 45  ? CG  ? A ASN 45  CG  
10 1 Y 1 A ASN 45  ? OD1 ? A ASN 45  OD1 
11 1 Y 1 A ASN 45  ? ND2 ? A ASN 45  ND2 
12 1 Y 1 A ARG 122 ? CG  ? A ARG 122 CG  
13 1 Y 1 A ARG 122 ? CD  ? A ARG 122 CD  
14 1 Y 1 A ARG 122 ? NE  ? A ARG 122 NE  
15 1 Y 1 A ARG 122 ? CZ  ? A ARG 122 CZ  
16 1 Y 1 A ARG 122 ? NH1 ? A ARG 122 NH1 
17 1 Y 1 A ARG 122 ? NH2 ? A ARG 122 NH2 
18 1 Y 1 A ASN 200 ? CG  ? A ASN 200 CG  
19 1 Y 1 A ASN 200 ? OD1 ? A ASN 200 OD1 
20 1 Y 1 A ASN 200 ? ND2 ? A ASN 200 ND2 
21 1 Y 1 A LYS 209 ? CG  ? A LYS 209 CG  
22 1 Y 1 A LYS 209 ? CD  ? A LYS 209 CD  
23 1 Y 1 A LYS 209 ? CE  ? A LYS 209 CE  
24 1 Y 1 A LYS 209 ? NZ  ? A LYS 209 NZ  
25 1 Y 1 A LYS 360 ? CG  ? A LYS 360 CG  
26 1 Y 1 A LYS 360 ? CD  ? A LYS 360 CD  
27 1 Y 1 A LYS 360 ? CE  ? A LYS 360 CE  
28 1 Y 1 A LYS 360 ? NZ  ? A LYS 360 NZ  
29 1 Y 1 B LYS 28  ? CG  ? B LYS 28  CG  
30 1 Y 1 B LYS 28  ? CD  ? B LYS 28  CD  
31 1 Y 1 B LYS 28  ? CE  ? B LYS 28  CE  
32 1 Y 1 B LYS 28  ? NZ  ? B LYS 28  NZ  
33 1 Y 1 B GLN 77  ? CG  ? B GLN 77  CG  
34 1 Y 1 B GLN 77  ? CD  ? B GLN 77  CD  
35 1 Y 1 B GLN 77  ? OE1 ? B GLN 77  OE1 
36 1 Y 1 B GLN 77  ? NE2 ? B GLN 77  NE2 
37 1 Y 1 B GLU 378 ? CG  ? B GLU 378 CG  
38 1 Y 1 B GLU 378 ? CD  ? B GLU 378 CD  
39 1 Y 1 B GLU 378 ? OE1 ? B GLU 378 OE1 
40 1 Y 1 B GLU 378 ? OE2 ? B GLU 378 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A LYS 2   ? A LYS 2   
3  1 Y 1 A ASP 3   ? A ASP 3   
4  1 Y 1 A CYS 4   ? A CYS 4   
5  1 Y 1 A SER 5   ? A SER 5   
6  1 Y 1 A ASN 6   ? A ASN 6   
7  1 Y 1 A GLY 7   ? A GLY 7   
8  1 Y 1 A CYS 8   ? A CYS 8   
9  1 Y 1 A SER 9   ? A SER 9   
10 1 Y 1 A ALA 10  ? A ALA 10  
11 1 Y 1 A GLU 11  ? A GLU 11  
12 1 Y 1 A CYS 12  ? A CYS 12  
13 1 Y 1 A THR 13  ? A THR 13  
14 1 Y 1 A GLY 14  ? A GLY 14  
15 1 Y 1 A GLU 15  ? A GLU 15  
16 1 Y 1 A GLY 16  ? A GLY 16  
17 1 Y 1 A GLY 17  ? A GLY 17  
18 1 Y 1 A SER 18  ? A SER 18  
19 1 Y 1 A LYS 19  ? A LYS 19  
20 1 Y 1 A GLU 20  ? A GLU 20  
21 1 Y 1 A VAL 21  ? A VAL 21  
22 1 Y 1 A ASN 46  ? A ASN 46  
23 1 Y 1 A SER 195 ? A SER 195 
24 1 Y 1 A SER 196 ? A SER 196 
25 1 Y 1 A GLY 197 ? A GLY 197 
26 1 Y 1 A THR 198 ? A THR 198 
27 1 Y 1 A SER 386 ? A SER 386 
28 1 Y 1 B MET 1   ? B MET 1   
29 1 Y 1 B LYS 2   ? B LYS 2   
30 1 Y 1 B ASP 3   ? B ASP 3   
31 1 Y 1 B CYS 4   ? B CYS 4   
32 1 Y 1 B SER 5   ? B SER 5   
33 1 Y 1 B ASN 6   ? B ASN 6   
34 1 Y 1 B GLY 7   ? B GLY 7   
35 1 Y 1 B CYS 8   ? B CYS 8   
36 1 Y 1 B SER 9   ? B SER 9   
37 1 Y 1 B ALA 10  ? B ALA 10  
38 1 Y 1 B GLU 11  ? B GLU 11  
39 1 Y 1 B CYS 12  ? B CYS 12  
40 1 Y 1 B THR 13  ? B THR 13  
41 1 Y 1 B GLY 14  ? B GLY 14  
42 1 Y 1 B GLU 15  ? B GLU 15  
43 1 Y 1 B GLY 16  ? B GLY 16  
44 1 Y 1 B GLY 17  ? B GLY 17  
45 1 Y 1 B SER 18  ? B SER 18  
46 1 Y 1 B LYS 19  ? B LYS 19  
47 1 Y 1 B GLU 20  ? B GLU 20  
48 1 Y 1 B VAL 21  ? B VAL 21  
49 1 Y 1 B VAL 22  ? B VAL 22  
50 1 Y 1 B GLY 23  ? B GLY 23  
51 1 Y 1 B SER 195 ? B SER 195 
52 1 Y 1 B SER 196 ? B SER 196 
53 1 Y 1 B GLY 197 ? B GLY 197 
54 1 Y 1 B THR 198 ? B THR 198 
55 1 Y 1 B SER 386 ? B SER 386 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "PYRIDOXAL-5'-PHOSPHATE"                 PLP 
3 '[1-(AMINOMETHYL)CYCLOHEXYL]ACETIC ACID' GBN 
4 'MAGNESIUM ION'                          MG  
5 water                                    HOH 
#