data_2CRY
# 
_entry.id   2CRY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CRY         
RCSB  RCSB024555   
WWPDB D_1000024555 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002001834 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CRY 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-20 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kurosaki, C.'                                           1 
'Hayashi, F.'                                            2 
'Yoshida, M.'                                            3 
'Yokoyama, S.'                                           4 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the fifth ig-like domain of human kin of IRRE like 3' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kurosaki, C.' 1 
primary 'Hayashi, F.'  2 
primary 'Yoshida, M.'  3 
primary 'Yokoyama, S.' 4 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Kin of IRRE-like protein 3' 
_entity.formula_weight             13077.362 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Ig domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Kin of irregular chiasm-like protein 3, Nephrin-like 2, UNQ5923/PRO4502/PRO19814' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTI
SNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTI
SNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002001834 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   THR n 
1 9   LEU n 
1 10  THR n 
1 11  VAL n 
1 12  ASN n 
1 13  GLY n 
1 14  PRO n 
1 15  PRO n 
1 16  ILE n 
1 17  ILE n 
1 18  SER n 
1 19  SER n 
1 20  THR n 
1 21  GLN n 
1 22  THR n 
1 23  GLN n 
1 24  HIS n 
1 25  ALA n 
1 26  LEU n 
1 27  HIS n 
1 28  GLY n 
1 29  GLU n 
1 30  LYS n 
1 31  GLY n 
1 32  GLN n 
1 33  ILE n 
1 34  LYS n 
1 35  CYS n 
1 36  PHE n 
1 37  ILE n 
1 38  ARG n 
1 39  SER n 
1 40  THR n 
1 41  PRO n 
1 42  PRO n 
1 43  PRO n 
1 44  ASP n 
1 45  ARG n 
1 46  ILE n 
1 47  ALA n 
1 48  TRP n 
1 49  SER n 
1 50  TRP n 
1 51  LYS n 
1 52  GLU n 
1 53  ASN n 
1 54  VAL n 
1 55  LEU n 
1 56  GLU n 
1 57  SER n 
1 58  GLY n 
1 59  THR n 
1 60  SER n 
1 61  GLY n 
1 62  ARG n 
1 63  TYR n 
1 64  THR n 
1 65  VAL n 
1 66  GLU n 
1 67  THR n 
1 68  ILE n 
1 69  SER n 
1 70  THR n 
1 71  GLU n 
1 72  GLU n 
1 73  GLY n 
1 74  VAL n 
1 75  ILE n 
1 76  SER n 
1 77  THR n 
1 78  LEU n 
1 79  THR n 
1 80  ILE n 
1 81  SER n 
1 82  ASN n 
1 83  ILE n 
1 84  VAL n 
1 85  ARG n 
1 86  ALA n 
1 87  ASP n 
1 88  PHE n 
1 89  GLN n 
1 90  THR n 
1 91  ILE n 
1 92  TYR n 
1 93  ASN n 
1 94  CYS n 
1 95  THR n 
1 96  ALA n 
1 97  TRP n 
1 98  ASN n 
1 99  SER n 
1 100 PHE n 
1 101 GLY n 
1 102 SER n 
1 103 ASP n 
1 104 THR n 
1 105 GLU n 
1 106 ILE n 
1 107 ILE n 
1 108 ARG n 
1 109 LEU n 
1 110 LYS n 
1 111 GLU n 
1 112 GLN n 
1 113 GLY n 
1 114 SER n 
1 115 GLU n 
1 116 MET n 
1 117 SER n 
1 118 GLY n 
1 119 PRO n 
1 120 SER n 
1 121 SER n 
1 122 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'KIRREL3, KIAA1867, NEPH2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040202-89 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KIRR3_HUMAN 
_struct_ref.pdbx_db_accession          Q8IZU9 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRAD
FQTIYNCTAWNSFGSDTEIIRLKEQGSEM
;
_struct_ref.pdbx_align_begin           413 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2CRY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 116 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8IZU9 
_struct_ref_seq.db_align_beg                  413 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  521 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       116 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2CRY GLY A 1   ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 1   1  
1 2CRY SER A 2   ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 2   2  
1 2CRY SER A 3   ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 3   3  
1 2CRY GLY A 4   ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 4   4  
1 2CRY SER A 5   ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 5   5  
1 2CRY SER A 6   ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 6   6  
1 2CRY GLY A 7   ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 7   7  
1 2CRY SER A 117 ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 117 8  
1 2CRY GLY A 118 ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 118 9  
1 2CRY PRO A 119 ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 119 10 
1 2CRY SER A 120 ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 120 11 
1 2CRY SER A 121 ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 121 12 
1 2CRY GLY A 122 ? UNP Q8IZU9 ? ? 'CLONING ARTIFACT' 122 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.20mM 13C, 15N-labeled protein; 20mM d-Tris-Hcl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 INOVA Varian 800 ? 
2 INOVA Varian 900 ? 
# 
_pdbx_nmr_refine.entry_id           2CRY 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2CRY 
_pdbx_nmr_details.text       'spectometer_id 1 for 3D_15N_separated_NOESY, spectometer_1d 2 for 3D_13C_separated_NOESY' 
# 
_pdbx_nmr_ensemble.entry_id                                      2CRY 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2CRY 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian           1 
processing           NMRPipe 20031121 'Delaglio, F.'   2 
'data analysis'      NMRView 5.0.4    'Johnson, B. A.' 3 
'data analysis'      Kujira  0.9298   'Kobayashi, N.'  4 
'structure solution' CYANA   2.0.17   'Guntert, P.'    5 
refinement           CYANA   2.0.17   'Guntert, P.'    6 
# 
_exptl.entry_id          2CRY 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2CRY 
_struct.title                     'Solution structure of the fifth ig-like domain of human kin of IRRE like 3' 
_struct.pdbx_descriptor           'Kin of IRRE-like protein 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CRY 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            
;Ig fold, Kin of irregular chiasm-like protein 3, Nephrin-like 2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, IMMUNE SYSTEM
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       VAL 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        84 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       THR 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        90 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        VAL 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         84 
_struct_conf.end_auth_comp_id        THR 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         90 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 1  -0.07 
2  THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 2  -0.02 
3  THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 3  -0.08 
4  THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 4  0.02  
5  THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 5  -0.07 
6  THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 6  -0.02 
7  THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 7  -0.07 
8  THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 8  -0.13 
9  THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 9  0.00  
10 THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 10 -0.08 
11 THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 11 -0.06 
12 THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 12 -0.10 
13 THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 13 -0.13 
14 THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 14 -0.04 
15 THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 15 -0.03 
16 THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 16 -0.10 
17 THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 17 -0.12 
18 THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 18 -0.04 
19 THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 19 -0.13 
20 THR 40 A . ? THR 40 A PRO 41 A ? PRO 41 A 20 -0.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 17  ? THR A 20  ? ILE A 17  THR A 20  
A 2 CYS A 35  ? ILE A 37  ? CYS A 35  ILE A 37  
A 3 GLY A 73  ? THR A 79  ? GLY A 73  THR A 79  
A 4 TYR A 63  ? THR A 70  ? TYR A 63  THR A 70  
A 5 GLY A 58  ? SER A 60  ? GLY A 58  SER A 60  
B 1 VAL A 54  ? LEU A 55  ? VAL A 54  LEU A 55  
B 2 ARG A 45  ? SER A 49  ? ARG A 45  SER A 49  
B 3 TYR A 92  ? TRP A 97  ? TYR A 92  TRP A 97  
B 4 SER A 102 ? ILE A 107 ? SER A 102 ILE A 107 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 19 ? N SER A 19 O PHE A 36  ? O PHE A 36  
A 2 3 N ILE A 37 ? N ILE A 37 O VAL A 74  ? O VAL A 74  
A 3 4 O THR A 77 ? O THR A 77 N GLU A 66  ? N GLU A 66  
A 4 5 O TYR A 63 ? O TYR A 63 N SER A 60  ? N SER A 60  
B 1 2 O LEU A 55 ? O LEU A 55 N TRP A 48  ? N TRP A 48  
B 2 3 N ARG A 45 ? N ARG A 45 O TRP A 97  ? O TRP A 97  
B 3 4 N TYR A 92 ? N TYR A 92 O ILE A 107 ? O ILE A 107 
# 
_database_PDB_matrix.entry_id          2CRY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CRY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 9.198   47.727  6.109   1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 8.918   46.445  5.489   1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 9.948   46.071  4.441   1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 10.864  46.843  4.158   1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 9.860   47.787  6.830   1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 8.905   45.683  6.253   1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 7.946   46.489  5.021   1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 9.798   44.883  3.864   1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 10.725  44.406  2.845   1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 10.163  44.639  1.446   1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 9.038   44.242  1.143   1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 11.017  42.918  3.048   1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 11.876  42.713  4.156   1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 9.047   44.313  4.132   1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 11.645  44.961  2.948   1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 10.091  42.393  3.224   1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 11.492  42.523  2.161   1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 12.780  42.915  3.903   1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 10.955  45.287  0.597   1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 10.536  45.578  -0.769  1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 11.011  44.489  -1.726  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 12.107  44.568  -2.279  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 11.080  46.937  -1.213  1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 10.457  47.369  -2.410  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 11.841  45.579  0.899   1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 9.456   45.609  -0.785  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 10.893  47.667  -0.440  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 12.144  46.857  -1.383  1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 9.573   46.997  -2.464  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 10.176  43.472  -1.917  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 10.527  42.381  -2.807  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 11.271  41.268  -2.095  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 12.487  41.136  -2.236  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 9.315   43.462  -1.449  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 9.624   41.978  -3.238  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 11.152  42.766  -3.600  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 10.540  40.467  -1.327  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 11.139  39.363  -0.586  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 11.618  38.269  -1.534  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 10.921  37.279  -1.761  1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 10.132  38.785  0.411   1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 10.791  38.237  1.540   1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 9.575   40.624  -1.255  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 11.988  39.750  -0.043  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 9.468   39.568  0.743   1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 9.559   38.006  -0.071  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 10.152  38.084  2.240   1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 12.813  38.454  -2.086  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 13.385  37.485  -3.014  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 14.003  36.311  -2.260  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 14.911  36.488  -1.449  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 14.442  38.153  -3.895  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 14.726  37.365  -5.038  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 13.320  39.263  -1.866  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 12.587  37.115  -3.641  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 14.080  39.117  -4.218  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 15.351  38.282  -3.326  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 14.535  36.444  -4.847  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 13.503  35.110  -2.535  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 14.017  33.924  -1.876  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 13.740  32.658  -2.661  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 12.843  32.624  -3.504  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 12.779  35.029  -3.191  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 15.084  34.030  -1.748  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 13.555  33.838  -0.903  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . THR A 1 8   ? 14.513  31.612  -2.387  1.00 0.00 ? 8   THR A N    1  
ATOM 67    C CA   . THR A 1 8   ? 14.349  30.338  -3.077  1.00 0.00 ? 8   THR A CA   1  
ATOM 68    C C    . THR A 1 8   ? 13.097  29.611  -2.598  1.00 0.00 ? 8   THR A C    1  
ATOM 69    O O    . THR A 1 8   ? 12.649  29.804  -1.467  1.00 0.00 ? 8   THR A O    1  
ATOM 70    C CB   . THR A 1 8   ? 15.571  29.424  -2.867  1.00 0.00 ? 8   THR A CB   1  
ATOM 71    O OG1  . THR A 1 8   ? 16.778  30.155  -3.112  1.00 0.00 ? 8   THR A OG1  1  
ATOM 72    C CG2  . THR A 1 8   ? 15.508  28.216  -3.789  1.00 0.00 ? 8   THR A CG2  1  
ATOM 73    H H    . THR A 1 8   ? 15.212  31.700  -1.705  1.00 0.00 ? 8   THR A H    1  
ATOM 74    H HA   . THR A 1 8   ? 14.255  30.541  -4.134  1.00 0.00 ? 8   THR A HA   1  
ATOM 75    H HB   . THR A 1 8   ? 15.571  29.077  -1.843  1.00 0.00 ? 8   THR A HB   1  
ATOM 76    H HG1  . THR A 1 8   ? 17.485  29.543  -3.328  1.00 0.00 ? 8   THR A HG1  1  
ATOM 77    H HG21 . THR A 1 8   ? 15.038  28.498  -4.720  1.00 0.00 ? 8   THR A HG21 1  
ATOM 78    H HG22 . THR A 1 8   ? 14.933  27.433  -3.318  1.00 0.00 ? 8   THR A HG22 1  
ATOM 79    H HG23 . THR A 1 8   ? 16.508  27.860  -3.985  1.00 0.00 ? 8   THR A HG23 1  
ATOM 80    N N    . LEU A 1 9   ? 12.537  28.776  -3.465  1.00 0.00 ? 9   LEU A N    1  
ATOM 81    C CA   . LEU A 1 9   ? 11.335  28.018  -3.131  1.00 0.00 ? 9   LEU A CA   1  
ATOM 82    C C    . LEU A 1 9   ? 11.676  26.563  -2.828  1.00 0.00 ? 9   LEU A C    1  
ATOM 83    O O    . LEU A 1 9   ? 12.262  25.865  -3.657  1.00 0.00 ? 9   LEU A O    1  
ATOM 84    C CB   . LEU A 1 9   ? 10.327  28.090  -4.279  1.00 0.00 ? 9   LEU A CB   1  
ATOM 85    C CG   . LEU A 1 9   ? 9.420   29.321  -4.299  1.00 0.00 ? 9   LEU A CG   1  
ATOM 86    C CD1  . LEU A 1 9   ? 10.206  30.557  -4.708  1.00 0.00 ? 9   LEU A CD1  1  
ATOM 87    C CD2  . LEU A 1 9   ? 8.243   29.101  -5.239  1.00 0.00 ? 9   LEU A CD2  1  
ATOM 88    H H    . LEU A 1 9   ? 12.939  28.664  -4.351  1.00 0.00 ? 9   LEU A H    1  
ATOM 89    H HA   . LEU A 1 9   ? 10.898  28.464  -2.250  1.00 0.00 ? 9   LEU A HA   1  
ATOM 90    H HB2  . LEU A 1 9   ? 10.880  28.072  -5.206  1.00 0.00 ? 9   LEU A HB2  1  
ATOM 91    H HB3  . LEU A 1 9   ? 9.697   27.214  -4.220  1.00 0.00 ? 9   LEU A HB3  1  
ATOM 92    H HG   . LEU A 1 9   ? 9.029   29.489  -3.305  1.00 0.00 ? 9   LEU A HG   1  
ATOM 93    H HD11 . LEU A 1 9   ? 9.521   31.349  -4.969  1.00 0.00 ? 9   LEU A HD11 1  
ATOM 94    H HD12 . LEU A 1 9   ? 10.828  30.323  -5.559  1.00 0.00 ? 9   LEU A HD12 1  
ATOM 95    H HD13 . LEU A 1 9   ? 10.829  30.876  -3.884  1.00 0.00 ? 9   LEU A HD13 1  
ATOM 96    H HD21 . LEU A 1 9   ? 7.460   28.572  -4.716  1.00 0.00 ? 9   LEU A HD21 1  
ATOM 97    H HD22 . LEU A 1 9   ? 8.566   28.517  -6.089  1.00 0.00 ? 9   LEU A HD22 1  
ATOM 98    H HD23 . LEU A 1 9   ? 7.870   30.055  -5.578  1.00 0.00 ? 9   LEU A HD23 1  
ATOM 99    N N    . THR A 1 10  ? 11.303  26.108  -1.636  1.00 0.00 ? 10  THR A N    1  
ATOM 100   C CA   . THR A 1 10  ? 11.568  24.736  -1.224  1.00 0.00 ? 10  THR A CA   1  
ATOM 101   C C    . THR A 1 10  ? 10.786  24.379  0.035   1.00 0.00 ? 10  THR A C    1  
ATOM 102   O O    . THR A 1 10  ? 10.247  25.255  0.713   1.00 0.00 ? 10  THR A O    1  
ATOM 103   C CB   . THR A 1 10  ? 13.068  24.506  -0.964  1.00 0.00 ? 10  THR A CB   1  
ATOM 104   O OG1  . THR A 1 10  ? 13.308  23.127  -0.663  1.00 0.00 ? 10  THR A OG1  1  
ATOM 105   C CG2  . THR A 1 10  ? 13.558  25.374  0.185   1.00 0.00 ? 10  THR A CG2  1  
ATOM 106   H H    . THR A 1 10  ? 10.840  26.713  -1.019  1.00 0.00 ? 10  THR A H    1  
ATOM 107   H HA   . THR A 1 10  ? 11.258  24.081  -2.026  1.00 0.00 ? 10  THR A HA   1  
ATOM 108   H HB   . THR A 1 10  ? 13.617  24.773  -1.856  1.00 0.00 ? 10  THR A HB   1  
ATOM 109   H HG1  . THR A 1 10  ? 14.238  22.928  -0.796  1.00 0.00 ? 10  THR A HG1  1  
ATOM 110   H HG21 . THR A 1 10  ? 14.465  25.882  -0.108  1.00 0.00 ? 10  THR A HG21 1  
ATOM 111   H HG22 . THR A 1 10  ? 13.754  24.753  1.046   1.00 0.00 ? 10  THR A HG22 1  
ATOM 112   H HG23 . THR A 1 10  ? 12.802  26.104  0.432   1.00 0.00 ? 10  THR A HG23 1  
ATOM 113   N N    . VAL A 1 11  ? 10.728  23.088  0.345   1.00 0.00 ? 11  VAL A N    1  
ATOM 114   C CA   . VAL A 1 11  ? 10.013  22.615  1.524   1.00 0.00 ? 11  VAL A CA   1  
ATOM 115   C C    . VAL A 1 11  ? 10.732  21.434  2.166   1.00 0.00 ? 11  VAL A C    1  
ATOM 116   O O    . VAL A 1 11  ? 11.425  20.675  1.490   1.00 0.00 ? 11  VAL A O    1  
ATOM 117   C CB   . VAL A 1 11  ? 8.571   22.198  1.177   1.00 0.00 ? 11  VAL A CB   1  
ATOM 118   C CG1  . VAL A 1 11  ? 7.799   23.375  0.602   1.00 0.00 ? 11  VAL A CG1  1  
ATOM 119   C CG2  . VAL A 1 11  ? 8.575   21.027  0.207   1.00 0.00 ? 11  VAL A CG2  1  
ATOM 120   H H    . VAL A 1 11  ? 11.177  22.437  -0.234  1.00 0.00 ? 11  VAL A H    1  
ATOM 121   H HA   . VAL A 1 11  ? 9.969   23.427  2.236   1.00 0.00 ? 11  VAL A HA   1  
ATOM 122   H HB   . VAL A 1 11  ? 8.080   21.884  2.087   1.00 0.00 ? 11  VAL A HB   1  
ATOM 123   H HG11 . VAL A 1 11  ? 6.761   23.302  0.893   1.00 0.00 ? 11  VAL A HG11 1  
ATOM 124   H HG12 . VAL A 1 11  ? 8.215   24.298  0.978   1.00 0.00 ? 11  VAL A HG12 1  
ATOM 125   H HG13 . VAL A 1 11  ? 7.871   23.360  -0.476  1.00 0.00 ? 11  VAL A HG13 1  
ATOM 126   H HG21 . VAL A 1 11  ? 7.558   20.771  -0.050  1.00 0.00 ? 11  VAL A HG21 1  
ATOM 127   H HG22 . VAL A 1 11  ? 9.115   21.301  -0.687  1.00 0.00 ? 11  VAL A HG22 1  
ATOM 128   H HG23 . VAL A 1 11  ? 9.054   20.177  0.670   1.00 0.00 ? 11  VAL A HG23 1  
ATOM 129   N N    . ASN A 1 12  ? 10.560  21.284  3.475   1.00 0.00 ? 12  ASN A N    1  
ATOM 130   C CA   . ASN A 1 12  ? 11.192  20.194  4.209   1.00 0.00 ? 12  ASN A CA   1  
ATOM 131   C C    . ASN A 1 12  ? 10.332  19.763  5.393   1.00 0.00 ? 12  ASN A C    1  
ATOM 132   O O    . ASN A 1 12  ? 9.434   20.489  5.817   1.00 0.00 ? 12  ASN A O    1  
ATOM 133   C CB   . ASN A 1 12  ? 12.578  20.618  4.699   1.00 0.00 ? 12  ASN A CB   1  
ATOM 134   C CG   . ASN A 1 12  ? 12.546  21.929  5.461   1.00 0.00 ? 12  ASN A CG   1  
ATOM 135   O OD1  . ASN A 1 12  ? 11.508  22.585  5.545   1.00 0.00 ? 12  ASN A OD1  1  
ATOM 136   N ND2  . ASN A 1 12  ? 13.686  22.315  6.021   1.00 0.00 ? 12  ASN A ND2  1  
ATOM 137   H H    . ASN A 1 12  ? 9.995   21.921  3.960   1.00 0.00 ? 12  ASN A H    1  
ATOM 138   H HA   . ASN A 1 12  ? 11.299  19.358  3.534   1.00 0.00 ? 12  ASN A HA   1  
ATOM 139   H HB2  . ASN A 1 12  ? 12.972  19.853  5.354   1.00 0.00 ? 12  ASN A HB2  1  
ATOM 140   H HB3  . ASN A 1 12  ? 13.235  20.732  3.850   1.00 0.00 ? 12  ASN A HB3  1  
ATOM 141   H HD21 . ASN A 1 12  ? 14.473  21.742  5.913   1.00 0.00 ? 12  ASN A HD21 1  
ATOM 142   H HD22 . ASN A 1 12  ? 13.693  23.159  6.521   1.00 0.00 ? 12  ASN A HD22 1  
ATOM 143   N N    . GLY A 1 13  ? 10.613  18.577  5.923   1.00 0.00 ? 13  GLY A N    1  
ATOM 144   C CA   . GLY A 1 13  ? 9.857   18.070  7.053   1.00 0.00 ? 13  GLY A CA   1  
ATOM 145   C C    . GLY A 1 13  ? 9.660   16.569  6.993   1.00 0.00 ? 13  GLY A C    1  
ATOM 146   O O    . GLY A 1 13  ? 10.390  15.852  6.307   1.00 0.00 ? 13  GLY A O    1  
ATOM 147   H H    . GLY A 1 13  ? 11.341  18.041  5.543   1.00 0.00 ? 13  GLY A H    1  
ATOM 148   H HA2  . GLY A 1 13  ? 10.382  18.318  7.963   1.00 0.00 ? 13  GLY A HA2  1  
ATOM 149   H HA3  . GLY A 1 13  ? 8.888   18.548  7.066   1.00 0.00 ? 13  GLY A HA3  1  
ATOM 150   N N    . PRO A 1 14  ? 8.653   16.070  7.725   1.00 0.00 ? 14  PRO A N    1  
ATOM 151   C CA   . PRO A 1 14  ? 8.340   14.639  7.769   1.00 0.00 ? 14  PRO A CA   1  
ATOM 152   C C    . PRO A 1 14  ? 7.764   14.130  6.452   1.00 0.00 ? 14  PRO A C    1  
ATOM 153   O O    . PRO A 1 14  ? 7.334   14.903  5.595   1.00 0.00 ? 14  PRO A O    1  
ATOM 154   C CB   . PRO A 1 14  ? 7.295   14.539  8.884   1.00 0.00 ? 14  PRO A CB   1  
ATOM 155   C CG   . PRO A 1 14  ? 6.661   15.886  8.931   1.00 0.00 ? 14  PRO A CG   1  
ATOM 156   C CD   . PRO A 1 14  ? 7.742   16.865  8.565   1.00 0.00 ? 14  PRO A CD   1  
ATOM 157   H HA   . PRO A 1 14  ? 9.207   14.051  8.033   1.00 0.00 ? 14  PRO A HA   1  
ATOM 158   H HB2  . PRO A 1 14  ? 6.575   13.771  8.638   1.00 0.00 ? 14  PRO A HB2  1  
ATOM 159   H HB3  . PRO A 1 14  ? 7.781   14.298  9.817   1.00 0.00 ? 14  PRO A HB3  1  
ATOM 160   H HG2  . PRO A 1 14  ? 5.853   15.936  8.218   1.00 0.00 ? 14  PRO A HG2  1  
ATOM 161   H HG3  . PRO A 1 14  ? 6.297   16.085  9.928   1.00 0.00 ? 14  PRO A HG3  1  
ATOM 162   H HD2  . PRO A 1 14  ? 7.329   17.694  8.009   1.00 0.00 ? 14  PRO A HD2  1  
ATOM 163   H HD3  . PRO A 1 14  ? 8.247   17.218  9.452   1.00 0.00 ? 14  PRO A HD3  1  
ATOM 164   N N    . PRO A 1 15  ? 7.753   12.799  6.285   1.00 0.00 ? 15  PRO A N    1  
ATOM 165   C CA   . PRO A 1 15  ? 7.231   12.158  5.074   1.00 0.00 ? 15  PRO A CA   1  
ATOM 166   C C    . PRO A 1 15  ? 5.715   12.283  4.959   1.00 0.00 ? 15  PRO A C    1  
ATOM 167   O O    . PRO A 1 15  ? 4.975   11.754  5.788   1.00 0.00 ? 15  PRO A O    1  
ATOM 168   C CB   . PRO A 1 15  ? 7.634   10.692  5.248   1.00 0.00 ? 15  PRO A CB   1  
ATOM 169   C CG   . PRO A 1 15  ? 7.759   10.505  6.720   1.00 0.00 ? 15  PRO A CG   1  
ATOM 170   C CD   . PRO A 1 15  ? 8.248   11.818  7.265   1.00 0.00 ? 15  PRO A CD   1  
ATOM 171   H HA   . PRO A 1 15  ? 7.692   12.557  4.183   1.00 0.00 ? 15  PRO A HA   1  
ATOM 172   H HB2  . PRO A 1 15  ? 6.868   10.053  4.831   1.00 0.00 ? 15  PRO A HB2  1  
ATOM 173   H HB3  . PRO A 1 15  ? 8.573   10.511  4.746   1.00 0.00 ? 15  PRO A HB3  1  
ATOM 174   H HG2  . PRO A 1 15  ? 6.796   10.259  7.142   1.00 0.00 ? 15  PRO A HG2  1  
ATOM 175   H HG3  . PRO A 1 15  ? 8.473   9.722   6.931   1.00 0.00 ? 15  PRO A HG3  1  
ATOM 176   H HD2  . PRO A 1 15  ? 7.827   12.002  8.242   1.00 0.00 ? 15  PRO A HD2  1  
ATOM 177   H HD3  . PRO A 1 15  ? 9.327   11.830  7.309   1.00 0.00 ? 15  PRO A HD3  1  
ATOM 178   N N    . ILE A 1 16  ? 5.261   12.986  3.927   1.00 0.00 ? 16  ILE A N    1  
ATOM 179   C CA   . ILE A 1 16  ? 3.834   13.179  3.704   1.00 0.00 ? 16  ILE A CA   1  
ATOM 180   C C    . ILE A 1 16  ? 3.276   12.116  2.764   1.00 0.00 ? 16  ILE A C    1  
ATOM 181   O O    . ILE A 1 16  ? 3.697   12.008  1.612   1.00 0.00 ? 16  ILE A O    1  
ATOM 182   C CB   . ILE A 1 16  ? 3.539   14.572  3.117   1.00 0.00 ? 16  ILE A CB   1  
ATOM 183   C CG1  . ILE A 1 16  ? 4.101   15.663  4.030   1.00 0.00 ? 16  ILE A CG1  1  
ATOM 184   C CG2  . ILE A 1 16  ? 2.042   14.758  2.921   1.00 0.00 ? 16  ILE A CG2  1  
ATOM 185   C CD1  . ILE A 1 16  ? 4.440   16.945  3.302   1.00 0.00 ? 16  ILE A CD1  1  
ATOM 186   H H    . ILE A 1 16  ? 5.901   13.384  3.301   1.00 0.00 ? 16  ILE A H    1  
ATOM 187   H HA   . ILE A 1 16  ? 3.334   13.099  4.658   1.00 0.00 ? 16  ILE A HA   1  
ATOM 188   H HB   . ILE A 1 16  ? 4.015   14.640  2.151   1.00 0.00 ? 16  ILE A HB   1  
ATOM 189   H HG12 . ILE A 1 16  ? 3.374   15.897  4.792   1.00 0.00 ? 16  ILE A HG12 1  
ATOM 190   H HG13 . ILE A 1 16  ? 5.004   15.299  4.500   1.00 0.00 ? 16  ILE A HG13 1  
ATOM 191   H HG21 . ILE A 1 16  ? 1.641   13.909  2.387   1.00 0.00 ? 16  ILE A HG21 1  
ATOM 192   H HG22 . ILE A 1 16  ? 1.560   14.837  3.884   1.00 0.00 ? 16  ILE A HG22 1  
ATOM 193   H HG23 . ILE A 1 16  ? 1.862   15.658  2.352   1.00 0.00 ? 16  ILE A HG23 1  
ATOM 194   H HD11 . ILE A 1 16  ? 5.386   16.832  2.793   1.00 0.00 ? 16  ILE A HD11 1  
ATOM 195   H HD12 . ILE A 1 16  ? 3.667   17.166  2.582   1.00 0.00 ? 16  ILE A HD12 1  
ATOM 196   H HD13 . ILE A 1 16  ? 4.510   17.756  4.014   1.00 0.00 ? 16  ILE A HD13 1  
ATOM 197   N N    . ILE A 1 17  ? 2.325   11.333  3.263   1.00 0.00 ? 17  ILE A N    1  
ATOM 198   C CA   . ILE A 1 17  ? 1.707   10.280  2.467   1.00 0.00 ? 17  ILE A CA   1  
ATOM 199   C C    . ILE A 1 17  ? 0.297   10.671  2.038   1.00 0.00 ? 17  ILE A C    1  
ATOM 200   O O    . ILE A 1 17  ? -0.663  10.491  2.787   1.00 0.00 ? 17  ILE A O    1  
ATOM 201   C CB   . ILE A 1 17  ? 1.646   8.951   3.242   1.00 0.00 ? 17  ILE A CB   1  
ATOM 202   C CG1  . ILE A 1 17  ? 3.002   8.645   3.881   1.00 0.00 ? 17  ILE A CG1  1  
ATOM 203   C CG2  . ILE A 1 17  ? 1.222   7.818   2.318   1.00 0.00 ? 17  ILE A CG2  1  
ATOM 204   C CD1  . ILE A 1 17  ? 2.929   7.624   4.994   1.00 0.00 ? 17  ILE A CD1  1  
ATOM 205   H H    . ILE A 1 17  ? 2.031   11.468  4.188   1.00 0.00 ? 17  ILE A H    1  
ATOM 206   H HA   . ILE A 1 17  ? 2.312   10.132  1.584   1.00 0.00 ? 17  ILE A HA   1  
ATOM 207   H HB   . ILE A 1 17  ? 0.903   9.046   4.019   1.00 0.00 ? 17  ILE A HB   1  
ATOM 208   H HG12 . ILE A 1 17  ? 3.671   8.264   3.125   1.00 0.00 ? 17  ILE A HG12 1  
ATOM 209   H HG13 . ILE A 1 17  ? 3.412   9.557   4.292   1.00 0.00 ? 17  ILE A HG13 1  
ATOM 210   H HG21 . ILE A 1 17  ? 2.085   7.446   1.786   1.00 0.00 ? 17  ILE A HG21 1  
ATOM 211   H HG22 . ILE A 1 17  ? 0.789   7.020   2.903   1.00 0.00 ? 17  ILE A HG22 1  
ATOM 212   H HG23 . ILE A 1 17  ? 0.493   8.184   1.611   1.00 0.00 ? 17  ILE A HG23 1  
ATOM 213   H HD11 . ILE A 1 17  ? 2.489   8.076   5.870   1.00 0.00 ? 17  ILE A HD11 1  
ATOM 214   H HD12 . ILE A 1 17  ? 2.325   6.787   4.677   1.00 0.00 ? 17  ILE A HD12 1  
ATOM 215   H HD13 . ILE A 1 17  ? 3.926   7.278   5.231   1.00 0.00 ? 17  ILE A HD13 1  
ATOM 216   N N    . SER A 1 18  ? 0.179   11.205  0.827   1.00 0.00 ? 18  SER A N    1  
ATOM 217   C CA   . SER A 1 18  ? -1.114  11.623  0.298   1.00 0.00 ? 18  SER A CA   1  
ATOM 218   C C    . SER A 1 18  ? -2.103  10.461  0.298   1.00 0.00 ? 18  SER A C    1  
ATOM 219   O O    . SER A 1 18  ? -3.070  10.455  1.059   1.00 0.00 ? 18  SER A O    1  
ATOM 220   C CB   . SER A 1 18  ? -0.956  12.173  -1.121  1.00 0.00 ? 18  SER A CB   1  
ATOM 221   O OG   . SER A 1 18  ? -2.108  12.895  -1.520  1.00 0.00 ? 18  SER A OG   1  
ATOM 222   H H    . SER A 1 18  ? 0.981   11.323  0.277   1.00 0.00 ? 18  SER A H    1  
ATOM 223   H HA   . SER A 1 18  ? -1.496  12.406  0.937   1.00 0.00 ? 18  SER A HA   1  
ATOM 224   H HB2  . SER A 1 18  ? -0.102  12.833  -1.155  1.00 0.00 ? 18  SER A HB2  1  
ATOM 225   H HB3  . SER A 1 18  ? -0.804  11.352  -1.807  1.00 0.00 ? 18  SER A HB3  1  
ATOM 226   H HG   . SER A 1 18  ? -1.844  13.650  -2.051  1.00 0.00 ? 18  SER A HG   1  
ATOM 227   N N    . SER A 1 19  ? -1.852  9.479   -0.562  1.00 0.00 ? 19  SER A N    1  
ATOM 228   C CA   . SER A 1 19  ? -2.721  8.313   -0.665  1.00 0.00 ? 19  SER A CA   1  
ATOM 229   C C    . SER A 1 19  ? -2.138  7.285   -1.631  1.00 0.00 ? 19  SER A C    1  
ATOM 230   O O    . SER A 1 19  ? -1.047  7.471   -2.170  1.00 0.00 ? 19  SER A O    1  
ATOM 231   C CB   . SER A 1 19  ? -4.118  8.731   -1.128  1.00 0.00 ? 19  SER A CB   1  
ATOM 232   O OG   . SER A 1 19  ? -4.902  9.185   -0.039  1.00 0.00 ? 19  SER A OG   1  
ATOM 233   H H    . SER A 1 19  ? -1.065  9.542   -1.142  1.00 0.00 ? 19  SER A H    1  
ATOM 234   H HA   . SER A 1 19  ? -2.794  7.867   0.315   1.00 0.00 ? 19  SER A HA   1  
ATOM 235   H HB2  . SER A 1 19  ? -4.031  9.528   -1.851  1.00 0.00 ? 19  SER A HB2  1  
ATOM 236   H HB3  . SER A 1 19  ? -4.611  7.884   -1.584  1.00 0.00 ? 19  SER A HB3  1  
ATOM 237   H HG   . SER A 1 19  ? -5.037  8.464   0.581   1.00 0.00 ? 19  SER A HG   1  
ATOM 238   N N    . THR A 1 20  ? -2.875  6.200   -1.845  1.00 0.00 ? 20  THR A N    1  
ATOM 239   C CA   . THR A 1 20  ? -2.433  5.141   -2.744  1.00 0.00 ? 20  THR A CA   1  
ATOM 240   C C    . THR A 1 20  ? -3.330  5.054   -3.974  1.00 0.00 ? 20  THR A C    1  
ATOM 241   O O    . THR A 1 20  ? -4.542  5.244   -3.883  1.00 0.00 ? 20  THR A O    1  
ATOM 242   C CB   . THR A 1 20  ? -2.417  3.773   -2.037  1.00 0.00 ? 20  THR A CB   1  
ATOM 243   O OG1  . THR A 1 20  ? -3.697  3.510   -1.451  1.00 0.00 ? 20  THR A OG1  1  
ATOM 244   C CG2  . THR A 1 20  ? -1.343  3.733   -0.960  1.00 0.00 ? 20  THR A CG2  1  
ATOM 245   H H    . THR A 1 20  ? -3.736  6.109   -1.386  1.00 0.00 ? 20  THR A H    1  
ATOM 246   H HA   . THR A 1 20  ? -1.426  5.371   -3.060  1.00 0.00 ? 20  THR A HA   1  
ATOM 247   H HB   . THR A 1 20  ? -2.201  3.009   -2.769  1.00 0.00 ? 20  THR A HB   1  
ATOM 248   H HG1  . THR A 1 20  ? -3.970  4.265   -0.924  1.00 0.00 ? 20  THR A HG1  1  
ATOM 249   H HG21 . THR A 1 20  ? -1.455  2.833   -0.373  1.00 0.00 ? 20  THR A HG21 1  
ATOM 250   H HG22 . THR A 1 20  ? -1.443  4.596   -0.319  1.00 0.00 ? 20  THR A HG22 1  
ATOM 251   H HG23 . THR A 1 20  ? -0.369  3.740   -1.424  1.00 0.00 ? 20  THR A HG23 1  
ATOM 252   N N    . GLN A 1 21  ? -2.725  4.766   -5.122  1.00 0.00 ? 21  GLN A N    1  
ATOM 253   C CA   . GLN A 1 21  ? -3.471  4.654   -6.370  1.00 0.00 ? 21  GLN A CA   1  
ATOM 254   C C    . GLN A 1 21  ? -4.024  3.244   -6.549  1.00 0.00 ? 21  GLN A C    1  
ATOM 255   O O    . GLN A 1 21  ? -3.912  2.653   -7.624  1.00 0.00 ? 21  GLN A O    1  
ATOM 256   C CB   . GLN A 1 21  ? -2.578  5.019   -7.557  1.00 0.00 ? 21  GLN A CB   1  
ATOM 257   C CG   . GLN A 1 21  ? -3.345  5.239   -8.851  1.00 0.00 ? 21  GLN A CG   1  
ATOM 258   C CD   . GLN A 1 21  ? -2.509  5.919   -9.916  1.00 0.00 ? 21  GLN A CD   1  
ATOM 259   O OE1  . GLN A 1 21  ? -2.733  7.084   -10.248 1.00 0.00 ? 21  GLN A OE1  1  
ATOM 260   N NE2  . GLN A 1 21  ? -1.537  5.195   -10.459 1.00 0.00 ? 21  GLN A NE2  1  
ATOM 261   H H    . GLN A 1 21  ? -1.756  4.625   -5.130  1.00 0.00 ? 21  GLN A H    1  
ATOM 262   H HA   . GLN A 1 21  ? -4.297  5.348   -6.326  1.00 0.00 ? 21  GLN A HA   1  
ATOM 263   H HB2  . GLN A 1 21  ? -2.041  5.926   -7.323  1.00 0.00 ? 21  GLN A HB2  1  
ATOM 264   H HB3  . GLN A 1 21  ? -1.867  4.221   -7.716  1.00 0.00 ? 21  GLN A HB3  1  
ATOM 265   H HG2  . GLN A 1 21  ? -3.670  4.281   -9.229  1.00 0.00 ? 21  GLN A HG2  1  
ATOM 266   H HG3  . GLN A 1 21  ? -4.207  5.854   -8.642  1.00 0.00 ? 21  GLN A HG3  1  
ATOM 267   H HE21 . GLN A 1 21  ? -1.417  4.274   -10.146 1.00 0.00 ? 21  GLN A HE21 1  
ATOM 268   H HE22 . GLN A 1 21  ? -0.982  5.610   -11.151 1.00 0.00 ? 21  GLN A HE22 1  
ATOM 269   N N    . THR A 1 22  ? -4.621  2.708   -5.489  1.00 0.00 ? 22  THR A N    1  
ATOM 270   C CA   . THR A 1 22  ? -5.190  1.367   -5.529  1.00 0.00 ? 22  THR A CA   1  
ATOM 271   C C    . THR A 1 22  ? -6.063  1.176   -6.764  1.00 0.00 ? 22  THR A C    1  
ATOM 272   O O    . THR A 1 22  ? -6.254  2.105   -7.548  1.00 0.00 ? 22  THR A O    1  
ATOM 273   C CB   . THR A 1 22  ? -6.030  1.076   -4.271  1.00 0.00 ? 22  THR A CB   1  
ATOM 274   O OG1  . THR A 1 22  ? -6.986  2.123   -4.067  1.00 0.00 ? 22  THR A OG1  1  
ATOM 275   C CG2  . THR A 1 22  ? -5.141  0.948   -3.044  1.00 0.00 ? 22  THR A CG2  1  
ATOM 276   H H    . THR A 1 22  ? -4.679  3.229   -4.661  1.00 0.00 ? 22  THR A H    1  
ATOM 277   H HA   . THR A 1 22  ? -4.374  0.660   -5.563  1.00 0.00 ? 22  THR A HA   1  
ATOM 278   H HB   . THR A 1 22  ? -6.555  0.143   -4.415  1.00 0.00 ? 22  THR A HB   1  
ATOM 279   H HG1  . THR A 1 22  ? -7.478  1.954   -3.260  1.00 0.00 ? 22  THR A HG1  1  
ATOM 280   H HG21 . THR A 1 22  ? -5.684  0.447   -2.256  1.00 0.00 ? 22  THR A HG21 1  
ATOM 281   H HG22 . THR A 1 22  ? -4.846  1.932   -2.709  1.00 0.00 ? 22  THR A HG22 1  
ATOM 282   H HG23 . THR A 1 22  ? -4.261  0.375   -3.295  1.00 0.00 ? 22  THR A HG23 1  
ATOM 283   N N    . GLN A 1 23  ? -6.589  -0.033  -6.930  1.00 0.00 ? 23  GLN A N    1  
ATOM 284   C CA   . GLN A 1 23  ? -7.441  -0.344  -8.071  1.00 0.00 ? 23  GLN A CA   1  
ATOM 285   C C    . GLN A 1 23  ? -8.319  -1.557  -7.780  1.00 0.00 ? 23  GLN A C    1  
ATOM 286   O O    . GLN A 1 23  ? -8.248  -2.142  -6.699  1.00 0.00 ? 23  GLN A O    1  
ATOM 287   C CB   . GLN A 1 23  ? -6.590  -0.603  -9.315  1.00 0.00 ? 23  GLN A CB   1  
ATOM 288   C CG   . GLN A 1 23  ? -5.805  -1.904  -9.256  1.00 0.00 ? 23  GLN A CG   1  
ATOM 289   C CD   . GLN A 1 23  ? -4.909  -1.989  -8.037  1.00 0.00 ? 23  GLN A CD   1  
ATOM 290   O OE1  . GLN A 1 23  ? -3.745  -1.590  -8.078  1.00 0.00 ? 23  GLN A OE1  1  
ATOM 291   N NE2  . GLN A 1 23  ? -5.447  -2.512  -6.941  1.00 0.00 ? 23  GLN A NE2  1  
ATOM 292   H H    . GLN A 1 23  ? -6.399  -0.731  -6.270  1.00 0.00 ? 23  GLN A H    1  
ATOM 293   H HA   . GLN A 1 23  ? -8.077  0.509   -8.253  1.00 0.00 ? 23  GLN A HA   1  
ATOM 294   H HB2  . GLN A 1 23  ? -7.237  -0.637  -10.179 1.00 0.00 ? 23  GLN A HB2  1  
ATOM 295   H HB3  . GLN A 1 23  ? -5.888  0.210   -9.432  1.00 0.00 ? 23  GLN A HB3  1  
ATOM 296   H HG2  . GLN A 1 23  ? -6.502  -2.729  -9.229  1.00 0.00 ? 23  GLN A HG2  1  
ATOM 297   H HG3  . GLN A 1 23  ? -5.192  -1.980  -10.142 1.00 0.00 ? 23  GLN A HG3  1  
ATOM 298   H HE21 . GLN A 1 23  ? -6.380  -2.811  -6.981  1.00 0.00 ? 23  GLN A HE21 1  
ATOM 299   H HE22 . GLN A 1 23  ? -4.890  -2.580  -6.139  1.00 0.00 ? 23  GLN A HE22 1  
ATOM 300   N N    . HIS A 1 24  ? -9.147  -1.929  -8.751  1.00 0.00 ? 24  HIS A N    1  
ATOM 301   C CA   . HIS A 1 24  ? -10.039 -3.073  -8.599  1.00 0.00 ? 24  HIS A CA   1  
ATOM 302   C C    . HIS A 1 24  ? -9.309  -4.377  -8.910  1.00 0.00 ? 24  HIS A C    1  
ATOM 303   O O    . HIS A 1 24  ? -9.404  -4.904  -10.017 1.00 0.00 ? 24  HIS A O    1  
ATOM 304   C CB   . HIS A 1 24  ? -11.254 -2.925  -9.516  1.00 0.00 ? 24  HIS A CB   1  
ATOM 305   C CG   . HIS A 1 24  ? -10.898 -2.779  -10.963 1.00 0.00 ? 24  HIS A CG   1  
ATOM 306   N ND1  . HIS A 1 24  ? -10.399 -1.612  -11.502 1.00 0.00 ? 24  HIS A ND1  1  
ATOM 307   C CD2  . HIS A 1 24  ? -10.969 -3.663  -11.986 1.00 0.00 ? 24  HIS A CD2  1  
ATOM 308   C CE1  . HIS A 1 24  ? -10.181 -1.784  -12.793 1.00 0.00 ? 24  HIS A CE1  1  
ATOM 309   N NE2  . HIS A 1 24  ? -10.518 -3.020  -13.112 1.00 0.00 ? 24  HIS A NE2  1  
ATOM 310   H H    . HIS A 1 24  ? -9.157  -1.423  -9.590  1.00 0.00 ? 24  HIS A H    1  
ATOM 311   H HA   . HIS A 1 24  ? -10.373 -3.099  -7.573  1.00 0.00 ? 24  HIS A HA   1  
ATOM 312   H HB2  . HIS A 1 24  ? -11.881 -3.799  -9.415  1.00 0.00 ? 24  HIS A HB2  1  
ATOM 313   H HB3  . HIS A 1 24  ? -11.814 -2.049  -9.221  1.00 0.00 ? 24  HIS A HB3  1  
ATOM 314   H HD1  . HIS A 1 24  ? -10.231 -0.781  -11.011 1.00 0.00 ? 24  HIS A HD1  1  
ATOM 315   H HD2  . HIS A 1 24  ? -11.317 -4.685  -11.928 1.00 0.00 ? 24  HIS A HD2  1  
ATOM 316   H HE1  . HIS A 1 24  ? -9.792  -1.041  -13.473 1.00 0.00 ? 24  HIS A HE1  1  
ATOM 317   H HE2  . HIS A 1 24  ? -10.537 -3.383  -14.022 1.00 0.00 ? 24  HIS A HE2  1  
ATOM 318   N N    . ALA A 1 25  ? -8.580  -4.890  -7.924  1.00 0.00 ? 25  ALA A N    1  
ATOM 319   C CA   . ALA A 1 25  ? -7.835  -6.132  -8.092  1.00 0.00 ? 25  ALA A CA   1  
ATOM 320   C C    . ALA A 1 25  ? -8.773  -7.301  -8.369  1.00 0.00 ? 25  ALA A C    1  
ATOM 321   O O    . ALA A 1 25  ? -9.910  -7.325  -7.895  1.00 0.00 ? 25  ALA A O    1  
ATOM 322   C CB   . ALA A 1 25  ? -6.990  -6.411  -6.857  1.00 0.00 ? 25  ALA A CB   1  
ATOM 323   H H    . ALA A 1 25  ? -8.543  -4.423  -7.063  1.00 0.00 ? 25  ALA A H    1  
ATOM 324   H HA   . ALA A 1 25  ? -7.168  -6.010  -8.934  1.00 0.00 ? 25  ALA A HA   1  
ATOM 325   H HB1  . ALA A 1 25  ? -6.695  -5.476  -6.405  1.00 0.00 ? 25  ALA A HB1  1  
ATOM 326   H HB2  . ALA A 1 25  ? -7.567  -6.988  -6.150  1.00 0.00 ? 25  ALA A HB2  1  
ATOM 327   H HB3  . ALA A 1 25  ? -6.109  -6.967  -7.143  1.00 0.00 ? 25  ALA A HB3  1  
ATOM 328   N N    . LEU A 1 26  ? -8.291  -8.270  -9.140  1.00 0.00 ? 26  LEU A N    1  
ATOM 329   C CA   . LEU A 1 26  ? -9.087  -9.444  -9.481  1.00 0.00 ? 26  LEU A CA   1  
ATOM 330   C C    . LEU A 1 26  ? -8.506  -10.701 -8.840  1.00 0.00 ? 26  LEU A C    1  
ATOM 331   O O    . LEU A 1 26  ? -7.305  -10.956 -8.926  1.00 0.00 ? 26  LEU A O    1  
ATOM 332   C CB   . LEU A 1 26  ? -9.153  -9.616  -11.000 1.00 0.00 ? 26  LEU A CB   1  
ATOM 333   C CG   . LEU A 1 26  ? -10.287 -8.875  -11.710 1.00 0.00 ? 26  LEU A CG   1  
ATOM 334   C CD1  . LEU A 1 26  ? -11.634 -9.282  -11.133 1.00 0.00 ? 26  LEU A CD1  1  
ATOM 335   C CD2  . LEU A 1 26  ? -10.091 -7.370  -11.601 1.00 0.00 ? 26  LEU A CD2  1  
ATOM 336   H H    . LEU A 1 26  ? -7.378  -8.196  -9.487  1.00 0.00 ? 26  LEU A H    1  
ATOM 337   H HA   . LEU A 1 26  ? -10.085 -9.289  -9.100  1.00 0.00 ? 26  LEU A HA   1  
ATOM 338   H HB2  . LEU A 1 26  ? -8.220  -9.266  -11.413 1.00 0.00 ? 26  LEU A HB2  1  
ATOM 339   H HB3  . LEU A 1 26  ? -9.264  -10.671 -11.208 1.00 0.00 ? 26  LEU A HB3  1  
ATOM 340   H HG   . LEU A 1 26  ? -10.279 -9.140  -12.758 1.00 0.00 ? 26  LEU A HG   1  
ATOM 341   H HD11 . LEU A 1 26  ? -12.373 -9.293  -11.920 1.00 0.00 ? 26  LEU A HD11 1  
ATOM 342   H HD12 . LEU A 1 26  ? -11.928 -8.575  -10.372 1.00 0.00 ? 26  LEU A HD12 1  
ATOM 343   H HD13 . LEU A 1 26  ? -11.556 -10.268 -10.698 1.00 0.00 ? 26  LEU A HD13 1  
ATOM 344   H HD21 . LEU A 1 26  ? -9.048  -7.156  -11.418 1.00 0.00 ? 26  LEU A HD21 1  
ATOM 345   H HD22 . LEU A 1 26  ? -10.686 -6.988  -10.785 1.00 0.00 ? 26  LEU A HD22 1  
ATOM 346   H HD23 . LEU A 1 26  ? -10.399 -6.900  -12.523 1.00 0.00 ? 26  LEU A HD23 1  
ATOM 347   N N    . HIS A 1 27  ? -9.368  -11.484 -8.200  1.00 0.00 ? 27  HIS A N    1  
ATOM 348   C CA   . HIS A 1 27  ? -8.941  -12.717 -7.547  1.00 0.00 ? 27  HIS A CA   1  
ATOM 349   C C    . HIS A 1 27  ? -7.981  -13.499 -8.438  1.00 0.00 ? 27  HIS A C    1  
ATOM 350   O O    . HIS A 1 27  ? -8.403  -14.234 -9.329  1.00 0.00 ? 27  HIS A O    1  
ATOM 351   C CB   . HIS A 1 27  ? -10.154 -13.582 -7.202  1.00 0.00 ? 27  HIS A CB   1  
ATOM 352   C CG   . HIS A 1 27  ? -9.826  -14.748 -6.320  1.00 0.00 ? 27  HIS A CG   1  
ATOM 353   N ND1  . HIS A 1 27  ? -8.778  -15.608 -6.568  1.00 0.00 ? 27  HIS A ND1  1  
ATOM 354   C CD2  . HIS A 1 27  ? -10.415 -15.192 -5.185  1.00 0.00 ? 27  HIS A CD2  1  
ATOM 355   C CE1  . HIS A 1 27  ? -8.737  -16.532 -5.624  1.00 0.00 ? 27  HIS A CE1  1  
ATOM 356   N NE2  . HIS A 1 27  ? -9.720  -16.302 -4.773  1.00 0.00 ? 27  HIS A NE2  1  
ATOM 357   H H    . HIS A 1 27  ? -10.313 -11.228 -8.166  1.00 0.00 ? 27  HIS A H    1  
ATOM 358   H HA   . HIS A 1 27  ? -8.430  -12.449 -6.635  1.00 0.00 ? 27  HIS A HA   1  
ATOM 359   H HB2  . HIS A 1 27  ? -10.887 -12.976 -6.691  1.00 0.00 ? 27  HIS A HB2  1  
ATOM 360   H HB3  . HIS A 1 27  ? -10.585 -13.967 -8.115  1.00 0.00 ? 27  HIS A HB3  1  
ATOM 361   H HD1  . HIS A 1 27  ? -8.157  -15.551 -7.323  1.00 0.00 ? 27  HIS A HD1  1  
ATOM 362   H HD2  . HIS A 1 27  ? -11.274 -14.755 -4.694  1.00 0.00 ? 27  HIS A HD2  1  
ATOM 363   H HE1  . HIS A 1 27  ? -8.021  -17.338 -5.560  1.00 0.00 ? 27  HIS A HE1  1  
ATOM 364   H HE2  . HIS A 1 27  ? -9.969  -16.887 -4.027  1.00 0.00 ? 27  HIS A HE2  1  
ATOM 365   N N    . GLY A 1 28  ? -6.685  -13.334 -8.190  1.00 0.00 ? 28  GLY A N    1  
ATOM 366   C CA   . GLY A 1 28  ? -5.684  -14.029 -8.978  1.00 0.00 ? 28  GLY A CA   1  
ATOM 367   C C    . GLY A 1 28  ? -4.584  -13.107 -9.465  1.00 0.00 ? 28  GLY A C    1  
ATOM 368   O O    . GLY A 1 28  ? -3.408  -13.466 -9.439  1.00 0.00 ? 28  GLY A O    1  
ATOM 369   H H    . GLY A 1 28  ? -6.405  -12.734 -7.466  1.00 0.00 ? 28  GLY A H    1  
ATOM 370   H HA2  . GLY A 1 28  ? -5.245  -14.810 -8.375  1.00 0.00 ? 28  GLY A HA2  1  
ATOM 371   H HA3  . GLY A 1 28  ? -6.166  -14.479 -9.835  1.00 0.00 ? 28  GLY A HA3  1  
ATOM 372   N N    . GLU A 1 29  ? -4.968  -11.914 -9.911  1.00 0.00 ? 29  GLU A N    1  
ATOM 373   C CA   . GLU A 1 29  ? -4.005  -10.939 -10.407 1.00 0.00 ? 29  GLU A CA   1  
ATOM 374   C C    . GLU A 1 29  ? -3.189  -10.347 -9.261  1.00 0.00 ? 29  GLU A C    1  
ATOM 375   O O    . GLU A 1 29  ? -3.458  -10.615 -8.090  1.00 0.00 ? 29  GLU A O    1  
ATOM 376   C CB   . GLU A 1 29  ? -4.722  -9.821  -11.167 1.00 0.00 ? 29  GLU A CB   1  
ATOM 377   C CG   . GLU A 1 29  ? -5.275  -10.258 -12.513 1.00 0.00 ? 29  GLU A CG   1  
ATOM 378   C CD   . GLU A 1 29  ? -4.248  -10.162 -13.624 1.00 0.00 ? 29  GLU A CD   1  
ATOM 379   O OE1  . GLU A 1 29  ? -3.221  -10.868 -13.545 1.00 0.00 ? 29  GLU A OE1  1  
ATOM 380   O OE2  . GLU A 1 29  ? -4.470  -9.381  -14.573 1.00 0.00 ? 29  GLU A OE2  1  
ATOM 381   H H    . GLU A 1 29  ? -5.921  -11.686 -9.906  1.00 0.00 ? 29  GLU A H    1  
ATOM 382   H HA   . GLU A 1 29  ? -3.335  -11.449 -11.083 1.00 0.00 ? 29  GLU A HA   1  
ATOM 383   H HB2  . GLU A 1 29  ? -5.543  -9.461  -10.564 1.00 0.00 ? 29  GLU A HB2  1  
ATOM 384   H HB3  . GLU A 1 29  ? -4.027  -9.012  -11.333 1.00 0.00 ? 29  GLU A HB3  1  
ATOM 385   H HG2  . GLU A 1 29  ? -5.605  -11.283 -12.437 1.00 0.00 ? 29  GLU A HG2  1  
ATOM 386   H HG3  . GLU A 1 29  ? -6.116  -9.628  -12.764 1.00 0.00 ? 29  GLU A HG3  1  
ATOM 387   N N    . LYS A 1 30  ? -2.191  -9.542  -9.607  1.00 0.00 ? 30  LYS A N    1  
ATOM 388   C CA   . LYS A 1 30  ? -1.335  -8.911  -8.610  1.00 0.00 ? 30  LYS A CA   1  
ATOM 389   C C    . LYS A 1 30  ? -1.960  -7.616  -8.098  1.00 0.00 ? 30  LYS A C    1  
ATOM 390   O O    . LYS A 1 30  ? -2.206  -6.688  -8.867  1.00 0.00 ? 30  LYS A O    1  
ATOM 391   C CB   . LYS A 1 30  ? 0.047   -8.624  -9.201  1.00 0.00 ? 30  LYS A CB   1  
ATOM 392   C CG   . LYS A 1 30  ? 0.819   -9.876  -9.577  1.00 0.00 ? 30  LYS A CG   1  
ATOM 393   C CD   . LYS A 1 30  ? 2.298   -9.584  -9.766  1.00 0.00 ? 30  LYS A CD   1  
ATOM 394   C CE   . LYS A 1 30  ? 2.969   -10.640 -10.631 1.00 0.00 ? 30  LYS A CE   1  
ATOM 395   N NZ   . LYS A 1 30  ? 2.478   -10.600 -12.036 1.00 0.00 ? 30  LYS A NZ   1  
ATOM 396   H H    . LYS A 1 30  ? -2.026  -9.367  -10.558 1.00 0.00 ? 30  LYS A H    1  
ATOM 397   H HA   . LYS A 1 30  ? -1.228  -9.596  -7.783  1.00 0.00 ? 30  LYS A HA   1  
ATOM 398   H HB2  . LYS A 1 30  ? -0.073  -8.020  -10.088 1.00 0.00 ? 30  LYS A HB2  1  
ATOM 399   H HB3  . LYS A 1 30  ? 0.628   -8.072  -8.476  1.00 0.00 ? 30  LYS A HB3  1  
ATOM 400   H HG2  . LYS A 1 30  ? 0.706   -10.608 -8.791  1.00 0.00 ? 30  LYS A HG2  1  
ATOM 401   H HG3  . LYS A 1 30  ? 0.419   -10.272 -10.500 1.00 0.00 ? 30  LYS A HG3  1  
ATOM 402   H HD2  . LYS A 1 30  ? 2.408   -8.621  -10.243 1.00 0.00 ? 30  LYS A HD2  1  
ATOM 403   H HD3  . LYS A 1 30  ? 2.779   -9.565  -8.798  1.00 0.00 ? 30  LYS A HD3  1  
ATOM 404   H HE2  . LYS A 1 30  ? 4.035   -10.466 -10.626 1.00 0.00 ? 30  LYS A HE2  1  
ATOM 405   H HE3  . LYS A 1 30  ? 2.762   -11.613 -10.213 1.00 0.00 ? 30  LYS A HE3  1  
ATOM 406   H HZ1  . LYS A 1 30  ? 3.195   -10.167 -12.653 1.00 0.00 ? 30  LYS A HZ1  1  
ATOM 407   H HZ2  . LYS A 1 30  ? 1.604   -10.039 -12.093 1.00 0.00 ? 30  LYS A HZ2  1  
ATOM 408   H HZ3  . LYS A 1 30  ? 2.282   -11.564 -12.373 1.00 0.00 ? 30  LYS A HZ3  1  
ATOM 409   N N    . GLY A 1 31  ? -2.212  -7.561  -6.794  1.00 0.00 ? 31  GLY A N    1  
ATOM 410   C CA   . GLY A 1 31  ? -2.804  -6.376  -6.202  1.00 0.00 ? 31  GLY A CA   1  
ATOM 411   C C    . GLY A 1 31  ? -1.770  -5.323  -5.856  1.00 0.00 ? 31  GLY A C    1  
ATOM 412   O O    . GLY A 1 31  ? -1.321  -5.238  -4.713  1.00 0.00 ? 31  GLY A O    1  
ATOM 413   H H    . GLY A 1 31  ? -1.995  -8.332  -6.228  1.00 0.00 ? 31  GLY A H    1  
ATOM 414   H HA2  . GLY A 1 31  ? -3.513  -5.954  -6.899  1.00 0.00 ? 31  GLY A HA2  1  
ATOM 415   H HA3  . GLY A 1 31  ? -3.327  -6.660  -5.301  1.00 0.00 ? 31  GLY A HA3  1  
ATOM 416   N N    . GLN A 1 32  ? -1.391  -4.520  -6.845  1.00 0.00 ? 32  GLN A N    1  
ATOM 417   C CA   . GLN A 1 32  ? -0.402  -3.469  -6.639  1.00 0.00 ? 32  GLN A CA   1  
ATOM 418   C C    . GLN A 1 32  ? -1.023  -2.267  -5.934  1.00 0.00 ? 32  GLN A C    1  
ATOM 419   O O    . GLN A 1 32  ? -2.102  -1.807  -6.307  1.00 0.00 ? 32  GLN A O    1  
ATOM 420   C CB   . GLN A 1 32  ? 0.200   -3.036  -7.977  1.00 0.00 ? 32  GLN A CB   1  
ATOM 421   C CG   . GLN A 1 32  ? 1.543   -2.337  -7.842  1.00 0.00 ? 32  GLN A CG   1  
ATOM 422   C CD   . GLN A 1 32  ? 2.182   -2.037  -9.184  1.00 0.00 ? 32  GLN A CD   1  
ATOM 423   O OE1  . GLN A 1 32  ? 1.577   -1.397  -10.043 1.00 0.00 ? 32  GLN A OE1  1  
ATOM 424   N NE2  . GLN A 1 32  ? 3.413   -2.500  -9.370  1.00 0.00 ? 32  GLN A NE2  1  
ATOM 425   H H    . GLN A 1 32  ? -1.786  -4.637  -7.734  1.00 0.00 ? 32  GLN A H    1  
ATOM 426   H HA   . GLN A 1 32  ? 0.382   -3.870  -6.015  1.00 0.00 ? 32  GLN A HA   1  
ATOM 427   H HB2  . GLN A 1 32  ? 0.334   -3.910  -8.597  1.00 0.00 ? 32  GLN A HB2  1  
ATOM 428   H HB3  . GLN A 1 32  ? -0.486  -2.360  -8.464  1.00 0.00 ? 32  GLN A HB3  1  
ATOM 429   H HG2  . GLN A 1 32  ? 1.399   -1.406  -7.314  1.00 0.00 ? 32  GLN A HG2  1  
ATOM 430   H HG3  . GLN A 1 32  ? 2.209   -2.971  -7.276  1.00 0.00 ? 32  GLN A HG3  1  
ATOM 431   H HE21 . GLN A 1 32  ? 3.833   -3.004  -8.641  1.00 0.00 ? 32  GLN A HE21 1  
ATOM 432   H HE22 . GLN A 1 32  ? 3.849   -2.322  -10.228 1.00 0.00 ? 32  GLN A HE22 1  
ATOM 433   N N    . ILE A 1 33  ? -0.334  -1.764  -4.915  1.00 0.00 ? 33  ILE A N    1  
ATOM 434   C CA   . ILE A 1 33  ? -0.819  -0.616  -4.160  1.00 0.00 ? 33  ILE A CA   1  
ATOM 435   C C    . ILE A 1 33  ? 0.216   0.504   -4.138  1.00 0.00 ? 33  ILE A C    1  
ATOM 436   O O    . ILE A 1 33  ? 0.947   0.672   -3.161  1.00 0.00 ? 33  ILE A O    1  
ATOM 437   C CB   . ILE A 1 33  ? -1.170  -1.002  -2.711  1.00 0.00 ? 33  ILE A CB   1  
ATOM 438   C CG1  . ILE A 1 33  ? -2.246  -2.090  -2.697  1.00 0.00 ? 33  ILE A CG1  1  
ATOM 439   C CG2  . ILE A 1 33  ? -1.636  0.221   -1.935  1.00 0.00 ? 33  ILE A CG2  1  
ATOM 440   C CD1  . ILE A 1 33  ? -2.405  -2.765  -1.353  1.00 0.00 ? 33  ILE A CD1  1  
ATOM 441   H H    . ILE A 1 33  ? 0.519   -2.175  -4.666  1.00 0.00 ? 33  ILE A H    1  
ATOM 442   H HA   . ILE A 1 33  ? -1.715  -0.254  -4.642  1.00 0.00 ? 33  ILE A HA   1  
ATOM 443   H HB   . ILE A 1 33  ? -0.278  -1.382  -2.237  1.00 0.00 ? 33  ILE A HB   1  
ATOM 444   H HG12 . ILE A 1 33  ? -3.195  -1.652  -2.962  1.00 0.00 ? 33  ILE A HG12 1  
ATOM 445   H HG13 . ILE A 1 33  ? -1.989  -2.849  -3.422  1.00 0.00 ? 33  ILE A HG13 1  
ATOM 446   H HG21 . ILE A 1 33  ? -0.783  0.838   -1.690  1.00 0.00 ? 33  ILE A HG21 1  
ATOM 447   H HG22 . ILE A 1 33  ? -2.328  0.788   -2.539  1.00 0.00 ? 33  ILE A HG22 1  
ATOM 448   H HG23 . ILE A 1 33  ? -2.125  -0.094  -1.025  1.00 0.00 ? 33  ILE A HG23 1  
ATOM 449   H HD11 . ILE A 1 33  ? -1.453  -3.163  -1.034  1.00 0.00 ? 33  ILE A HD11 1  
ATOM 450   H HD12 . ILE A 1 33  ? -2.757  -2.047  -0.628  1.00 0.00 ? 33  ILE A HD12 1  
ATOM 451   H HD13 . ILE A 1 33  ? -3.120  -3.571  -1.437  1.00 0.00 ? 33  ILE A HD13 1  
ATOM 452   N N    . LYS A 1 34  ? 0.273   1.271   -5.222  1.00 0.00 ? 34  LYS A N    1  
ATOM 453   C CA   . LYS A 1 34  ? 1.216   2.378   -5.329  1.00 0.00 ? 34  LYS A CA   1  
ATOM 454   C C    . LYS A 1 34  ? 0.863   3.489   -4.345  1.00 0.00 ? 34  LYS A C    1  
ATOM 455   O O    . LYS A 1 34  ? -0.270  3.971   -4.319  1.00 0.00 ? 34  LYS A O    1  
ATOM 456   C CB   . LYS A 1 34  ? 1.227   2.930   -6.756  1.00 0.00 ? 34  LYS A CB   1  
ATOM 457   C CG   . LYS A 1 34  ? 2.437   3.794   -7.064  1.00 0.00 ? 34  LYS A CG   1  
ATOM 458   C CD   . LYS A 1 34  ? 2.539   4.102   -8.548  1.00 0.00 ? 34  LYS A CD   1  
ATOM 459   C CE   . LYS A 1 34  ? 3.348   3.045   -9.283  1.00 0.00 ? 34  LYS A CE   1  
ATOM 460   N NZ   . LYS A 1 34  ? 2.498   1.908   -9.733  1.00 0.00 ? 34  LYS A NZ   1  
ATOM 461   H H    . LYS A 1 34  ? -0.335  1.088   -5.969  1.00 0.00 ? 34  LYS A H    1  
ATOM 462   H HA   . LYS A 1 34  ? 2.199   2.001   -5.090  1.00 0.00 ? 34  LYS A HA   1  
ATOM 463   H HB2  . LYS A 1 34  ? 1.217   2.102   -7.449  1.00 0.00 ? 34  LYS A HB2  1  
ATOM 464   H HB3  . LYS A 1 34  ? 0.338   3.525   -6.906  1.00 0.00 ? 34  LYS A HB3  1  
ATOM 465   H HG2  . LYS A 1 34  ? 2.353   4.723   -6.520  1.00 0.00 ? 34  LYS A HG2  1  
ATOM 466   H HG3  . LYS A 1 34  ? 3.331   3.272   -6.752  1.00 0.00 ? 34  LYS A HG3  1  
ATOM 467   H HD2  . LYS A 1 34  ? 1.545   4.136   -8.970  1.00 0.00 ? 34  LYS A HD2  1  
ATOM 468   H HD3  . LYS A 1 34  ? 3.019   5.063   -8.676  1.00 0.00 ? 34  LYS A HD3  1  
ATOM 469   H HE2  . LYS A 1 34  ? 3.812   3.499   -10.145 1.00 0.00 ? 34  LYS A HE2  1  
ATOM 470   H HE3  . LYS A 1 34  ? 4.113   2.670   -8.619  1.00 0.00 ? 34  LYS A HE3  1  
ATOM 471   H HZ1  . LYS A 1 34  ? 3.039   1.285   -10.365 1.00 0.00 ? 34  LYS A HZ1  1  
ATOM 472   H HZ2  . LYS A 1 34  ? 1.666   2.265   -10.245 1.00 0.00 ? 34  LYS A HZ2  1  
ATOM 473   H HZ3  . LYS A 1 34  ? 2.175   1.357   -8.912  1.00 0.00 ? 34  LYS A HZ3  1  
ATOM 474   N N    . CYS A 1 35  ? 1.840   3.892   -3.540  1.00 0.00 ? 35  CYS A N    1  
ATOM 475   C CA   . CYS A 1 35  ? 1.632   4.948   -2.555  1.00 0.00 ? 35  CYS A CA   1  
ATOM 476   C C    . CYS A 1 35  ? 2.343   6.231   -2.975  1.00 0.00 ? 35  CYS A C    1  
ATOM 477   O O    . CYS A 1 35  ? 3.522   6.212   -3.331  1.00 0.00 ? 35  CYS A O    1  
ATOM 478   C CB   . CYS A 1 35  ? 2.133   4.499   -1.182  1.00 0.00 ? 35  CYS A CB   1  
ATOM 479   S SG   . CYS A 1 35  ? 1.336   5.340   0.206   1.00 0.00 ? 35  CYS A SG   1  
ATOM 480   H H    . CYS A 1 35  ? 2.721   3.470   -3.608  1.00 0.00 ? 35  CYS A H    1  
ATOM 481   H HA   . CYS A 1 35  ? 0.572   5.142   -2.497  1.00 0.00 ? 35  CYS A HA   1  
ATOM 482   H HB2  . CYS A 1 35  ? 1.953   3.440   -1.070  1.00 0.00 ? 35  CYS A HB2  1  
ATOM 483   H HB3  . CYS A 1 35  ? 3.194   4.686   -1.116  1.00 0.00 ? 35  CYS A HB3  1  
ATOM 484   H HG   . CYS A 1 35  ? 0.169   5.805   -0.214  1.00 0.00 ? 35  CYS A HG   1  
ATOM 485   N N    . PHE A 1 36  ? 1.618   7.344   -2.933  1.00 0.00 ? 36  PHE A N    1  
ATOM 486   C CA   . PHE A 1 36  ? 2.179   8.636   -3.312  1.00 0.00 ? 36  PHE A CA   1  
ATOM 487   C C    . PHE A 1 36  ? 2.801   9.333   -2.106  1.00 0.00 ? 36  PHE A C    1  
ATOM 488   O O    . PHE A 1 36  ? 2.132   10.084  -1.396  1.00 0.00 ? 36  PHE A O    1  
ATOM 489   C CB   . PHE A 1 36  ? 1.095   9.525   -3.926  1.00 0.00 ? 36  PHE A CB   1  
ATOM 490   C CG   . PHE A 1 36  ? 0.944   9.347   -5.410  1.00 0.00 ? 36  PHE A CG   1  
ATOM 491   C CD1  . PHE A 1 36  ? 1.294   8.152   -6.017  1.00 0.00 ? 36  PHE A CD1  1  
ATOM 492   C CD2  . PHE A 1 36  ? 0.451   10.375  -6.197  1.00 0.00 ? 36  PHE A CD2  1  
ATOM 493   C CE1  . PHE A 1 36  ? 1.156   7.985   -7.382  1.00 0.00 ? 36  PHE A CE1  1  
ATOM 494   C CE2  . PHE A 1 36  ? 0.310   10.214  -7.562  1.00 0.00 ? 36  PHE A CE2  1  
ATOM 495   C CZ   . PHE A 1 36  ? 0.664   9.018   -8.156  1.00 0.00 ? 36  PHE A CZ   1  
ATOM 496   H H    . PHE A 1 36  ? 0.683   7.295   -2.641  1.00 0.00 ? 36  PHE A H    1  
ATOM 497   H HA   . PHE A 1 36  ? 2.948   8.459   -4.048  1.00 0.00 ? 36  PHE A HA   1  
ATOM 498   H HB2  . PHE A 1 36  ? 0.147   9.294   -3.466  1.00 0.00 ? 36  PHE A HB2  1  
ATOM 499   H HB3  . PHE A 1 36  ? 1.340   10.559  -3.738  1.00 0.00 ? 36  PHE A HB3  1  
ATOM 500   H HD1  . PHE A 1 36  ? 1.680   7.343   -5.412  1.00 0.00 ? 36  PHE A HD1  1  
ATOM 501   H HD2  . PHE A 1 36  ? 0.175   11.311  -5.735  1.00 0.00 ? 36  PHE A HD2  1  
ATOM 502   H HE1  . PHE A 1 36  ? 1.434   7.048   -7.842  1.00 0.00 ? 36  PHE A HE1  1  
ATOM 503   H HE2  . PHE A 1 36  ? -0.075  11.023  -8.165  1.00 0.00 ? 36  PHE A HE2  1  
ATOM 504   H HZ   . PHE A 1 36  ? 0.554   8.889   -9.222  1.00 0.00 ? 36  PHE A HZ   1  
ATOM 505   N N    . ILE A 1 37  ? 4.086   9.077   -1.881  1.00 0.00 ? 37  ILE A N    1  
ATOM 506   C CA   . ILE A 1 37  ? 4.799   9.680   -0.762  1.00 0.00 ? 37  ILE A CA   1  
ATOM 507   C C    . ILE A 1 37  ? 5.511   10.959  -1.188  1.00 0.00 ? 37  ILE A C    1  
ATOM 508   O O    . ILE A 1 37  ? 6.604   10.915  -1.754  1.00 0.00 ? 37  ILE A O    1  
ATOM 509   C CB   . ILE A 1 37  ? 5.832   8.707   -0.162  1.00 0.00 ? 37  ILE A CB   1  
ATOM 510   C CG1  . ILE A 1 37  ? 5.211   7.321   0.023   1.00 0.00 ? 37  ILE A CG1  1  
ATOM 511   C CG2  . ILE A 1 37  ? 6.355   9.240   1.163   1.00 0.00 ? 37  ILE A CG2  1  
ATOM 512   C CD1  . ILE A 1 37  ? 6.185   6.287   0.544   1.00 0.00 ? 37  ILE A CD1  1  
ATOM 513   H H    . ILE A 1 37  ? 4.565   8.470   -2.482  1.00 0.00 ? 37  ILE A H    1  
ATOM 514   H HA   . ILE A 1 37  ? 4.075   9.921   0.004   1.00 0.00 ? 37  ILE A HA   1  
ATOM 515   H HB   . ILE A 1 37  ? 6.663   8.633   -0.847  1.00 0.00 ? 37  ILE A HB   1  
ATOM 516   H HG12 . ILE A 1 37  ? 4.394   7.390   0.724   1.00 0.00 ? 37  ILE A HG12 1  
ATOM 517   H HG13 . ILE A 1 37  ? 4.835   6.973   -0.929  1.00 0.00 ? 37  ILE A HG13 1  
ATOM 518   H HG21 . ILE A 1 37  ? 7.301   8.770   1.392   1.00 0.00 ? 37  ILE A HG21 1  
ATOM 519   H HG22 . ILE A 1 37  ? 6.494   10.308  1.091   1.00 0.00 ? 37  ILE A HG22 1  
ATOM 520   H HG23 . ILE A 1 37  ? 5.645   9.020   1.945   1.00 0.00 ? 37  ILE A HG23 1  
ATOM 521   H HD11 . ILE A 1 37  ? 7.159   6.457   0.109   1.00 0.00 ? 37  ILE A HD11 1  
ATOM 522   H HD12 . ILE A 1 37  ? 6.251   6.365   1.619   1.00 0.00 ? 37  ILE A HD12 1  
ATOM 523   H HD13 . ILE A 1 37  ? 5.839   5.299   0.276   1.00 0.00 ? 37  ILE A HD13 1  
ATOM 524   N N    . ARG A 1 38  ? 4.885   12.099  -0.912  1.00 0.00 ? 38  ARG A N    1  
ATOM 525   C CA   . ARG A 1 38  ? 5.458   13.391  -1.267  1.00 0.00 ? 38  ARG A CA   1  
ATOM 526   C C    . ARG A 1 38  ? 6.461   13.849  -0.211  1.00 0.00 ? 38  ARG A C    1  
ATOM 527   O O    . ARG A 1 38  ? 6.424   14.994  0.239   1.00 0.00 ? 38  ARG A O    1  
ATOM 528   C CB   . ARG A 1 38  ? 4.353   14.437  -1.424  1.00 0.00 ? 38  ARG A CB   1  
ATOM 529   C CG   . ARG A 1 38  ? 3.359   14.113  -2.527  1.00 0.00 ? 38  ARG A CG   1  
ATOM 530   C CD   . ARG A 1 38  ? 2.273   15.171  -2.627  1.00 0.00 ? 38  ARG A CD   1  
ATOM 531   N NE   . ARG A 1 38  ? 1.732   15.275  -3.979  1.00 0.00 ? 38  ARG A NE   1  
ATOM 532   C CZ   . ARG A 1 38  ? 0.805   16.157  -4.335  1.00 0.00 ? 38  ARG A CZ   1  
ATOM 533   N NH1  . ARG A 1 38  ? 0.318   17.008  -3.442  1.00 0.00 ? 38  ARG A NH1  1  
ATOM 534   N NH2  . ARG A 1 38  ? 0.363   16.190  -5.586  1.00 0.00 ? 38  ARG A NH2  1  
ATOM 535   H H    . ARG A 1 38  ? 4.016   12.069  -0.460  1.00 0.00 ? 38  ARG A H    1  
ATOM 536   H HA   . ARG A 1 38  ? 5.972   13.279  -2.210  1.00 0.00 ? 38  ARG A HA   1  
ATOM 537   H HB2  . ARG A 1 38  ? 3.811   14.515  -0.493  1.00 0.00 ? 38  ARG A HB2  1  
ATOM 538   H HB3  . ARG A 1 38  ? 4.807   15.391  -1.647  1.00 0.00 ? 38  ARG A HB3  1  
ATOM 539   H HG2  . ARG A 1 38  ? 3.885   14.062  -3.469  1.00 0.00 ? 38  ARG A HG2  1  
ATOM 540   H HG3  . ARG A 1 38  ? 2.902   13.158  -2.316  1.00 0.00 ? 38  ARG A HG3  1  
ATOM 541   H HD2  . ARG A 1 38  ? 1.473   14.912  -1.949  1.00 0.00 ? 38  ARG A HD2  1  
ATOM 542   H HD3  . ARG A 1 38  ? 2.691   16.125  -2.342  1.00 0.00 ? 38  ARG A HD3  1  
ATOM 543   H HE   . ARG A 1 38  ? 2.078   14.656  -4.655  1.00 0.00 ? 38  ARG A HE   1  
ATOM 544   H HH11 . ARG A 1 38  ? 0.650   16.986  -2.499  1.00 0.00 ? 38  ARG A HH11 1  
ATOM 545   H HH12 . ARG A 1 38  ? -0.380  17.672  -3.713  1.00 0.00 ? 38  ARG A HH12 1  
ATOM 546   H HH21 . ARG A 1 38  ? 0.728   15.550  -6.261  1.00 0.00 ? 38  ARG A HH21 1  
ATOM 547   H HH22 . ARG A 1 38  ? -0.335  16.854  -5.852  1.00 0.00 ? 38  ARG A HH22 1  
ATOM 548   N N    . SER A 1 39  ? 7.355   12.946  0.179   1.00 0.00 ? 39  SER A N    1  
ATOM 549   C CA   . SER A 1 39  ? 8.365   13.256  1.184   1.00 0.00 ? 39  SER A CA   1  
ATOM 550   C C    . SER A 1 39  ? 9.557   13.972  0.555   1.00 0.00 ? 39  SER A C    1  
ATOM 551   O O    . SER A 1 39  ? 9.961   13.663  -0.567  1.00 0.00 ? 39  SER A O    1  
ATOM 552   C CB   . SER A 1 39  ? 8.833   11.976  1.878   1.00 0.00 ? 39  SER A CB   1  
ATOM 553   O OG   . SER A 1 39  ? 9.849   12.252  2.827   1.00 0.00 ? 39  SER A OG   1  
ATOM 554   H H    . SER A 1 39  ? 7.333   12.050  -0.217  1.00 0.00 ? 39  SER A H    1  
ATOM 555   H HA   . SER A 1 39  ? 7.914   13.909  1.917   1.00 0.00 ? 39  SER A HA   1  
ATOM 556   H HB2  . SER A 1 39  ? 7.998   11.518  2.386   1.00 0.00 ? 39  SER A HB2  1  
ATOM 557   H HB3  . SER A 1 39  ? 9.224   11.291  1.139   1.00 0.00 ? 39  SER A HB3  1  
ATOM 558   H HG   . SER A 1 39  ? 9.591   11.903  3.684   1.00 0.00 ? 39  SER A HG   1  
ATOM 559   N N    . THR A 1 40  ? 10.116  14.931  1.285   1.00 0.00 ? 40  THR A N    1  
ATOM 560   C CA   . THR A 1 40  ? 11.260  15.693  0.800   1.00 0.00 ? 40  THR A CA   1  
ATOM 561   C C    . THR A 1 40  ? 11.988  16.382  1.948   1.00 0.00 ? 40  THR A C    1  
ATOM 562   O O    . THR A 1 40  ? 11.528  17.384  2.495   1.00 0.00 ? 40  THR A O    1  
ATOM 563   C CB   . THR A 1 40  ? 10.832  16.753  -0.232  1.00 0.00 ? 40  THR A CB   1  
ATOM 564   O OG1  . THR A 1 40  ? 10.232  16.118  -1.366  1.00 0.00 ? 40  THR A OG1  1  
ATOM 565   C CG2  . THR A 1 40  ? 12.025  17.583  -0.681  1.00 0.00 ? 40  THR A CG2  1  
ATOM 566   H H    . THR A 1 40  ? 9.749   15.131  2.172   1.00 0.00 ? 40  THR A H    1  
ATOM 567   H HA   . THR A 1 40  ? 11.939  15.004  0.318   1.00 0.00 ? 40  THR A HA   1  
ATOM 568   H HB   . THR A 1 40  ? 10.108  17.410  0.229   1.00 0.00 ? 40  THR A HB   1  
ATOM 569   H HG1  . THR A 1 40  ? 9.366   16.502  -1.527  1.00 0.00 ? 40  THR A HG1  1  
ATOM 570   H HG21 . THR A 1 40  ? 12.597  17.890  0.182   1.00 0.00 ? 40  THR A HG21 1  
ATOM 571   H HG22 . THR A 1 40  ? 11.677  18.456  -1.212  1.00 0.00 ? 40  THR A HG22 1  
ATOM 572   H HG23 . THR A 1 40  ? 12.650  16.991  -1.333  1.00 0.00 ? 40  THR A HG23 1  
ATOM 573   N N    . PRO A 1 41  ? 13.154  15.835  2.324   1.00 0.00 ? 41  PRO A N    1  
ATOM 574   C CA   . PRO A 1 41  ? 13.712  14.642  1.681   1.00 0.00 ? 41  PRO A CA   1  
ATOM 575   C C    . PRO A 1 41  ? 12.909  13.384  1.995   1.00 0.00 ? 41  PRO A C    1  
ATOM 576   O O    . PRO A 1 41  ? 12.035  13.378  2.863   1.00 0.00 ? 41  PRO A O    1  
ATOM 577   C CB   . PRO A 1 41  ? 15.118  14.541  2.279   1.00 0.00 ? 41  PRO A CB   1  
ATOM 578   C CG   . PRO A 1 41  ? 15.021  15.236  3.593   1.00 0.00 ? 41  PRO A CG   1  
ATOM 579   C CD   . PRO A 1 41  ? 14.017  16.339  3.406   1.00 0.00 ? 41  PRO A CD   1  
ATOM 580   H HA   . PRO A 1 41  ? 13.783  14.764  0.610   1.00 0.00 ? 41  PRO A HA   1  
ATOM 581   H HB2  . PRO A 1 41  ? 15.387  13.501  2.399   1.00 0.00 ? 41  PRO A HB2  1  
ATOM 582   H HB3  . PRO A 1 41  ? 15.826  15.029  1.626   1.00 0.00 ? 41  PRO A HB3  1  
ATOM 583   H HG2  . PRO A 1 41  ? 14.682  14.544  4.350   1.00 0.00 ? 41  PRO A HG2  1  
ATOM 584   H HG3  . PRO A 1 41  ? 15.983  15.646  3.863   1.00 0.00 ? 41  PRO A HG3  1  
ATOM 585   H HD2  . PRO A 1 41  ? 13.450  16.491  4.312   1.00 0.00 ? 41  PRO A HD2  1  
ATOM 586   H HD3  . PRO A 1 41  ? 14.511  17.253  3.110   1.00 0.00 ? 41  PRO A HD3  1  
ATOM 587   N N    . PRO A 1 42  ? 13.209  12.293  1.275   1.00 0.00 ? 42  PRO A N    1  
ATOM 588   C CA   . PRO A 1 42  ? 12.527  11.010  1.461   1.00 0.00 ? 42  PRO A CA   1  
ATOM 589   C C    . PRO A 1 42  ? 12.882  10.351  2.790   1.00 0.00 ? 42  PRO A C    1  
ATOM 590   O O    . PRO A 1 42  ? 13.886  10.676  3.423   1.00 0.00 ? 42  PRO A O    1  
ATOM 591   C CB   . PRO A 1 42  ? 13.037  10.164  0.291   1.00 0.00 ? 42  PRO A CB   1  
ATOM 592   C CG   . PRO A 1 42  ? 14.359  10.757  -0.055  1.00 0.00 ? 42  PRO A CG   1  
ATOM 593   C CD   . PRO A 1 42  ? 14.240  12.229  0.225   1.00 0.00 ? 42  PRO A CD   1  
ATOM 594   H HA   . PRO A 1 42  ? 11.454  11.116  1.389   1.00 0.00 ? 42  PRO A HA   1  
ATOM 595   H HB2  . PRO A 1 42  ? 13.135  9.134   0.604   1.00 0.00 ? 42  PRO A HB2  1  
ATOM 596   H HB3  . PRO A 1 42  ? 12.346  10.231  -0.535  1.00 0.00 ? 42  PRO A HB3  1  
ATOM 597   H HG2  . PRO A 1 42  ? 15.131  10.319  0.560   1.00 0.00 ? 42  PRO A HG2  1  
ATOM 598   H HG3  . PRO A 1 42  ? 14.572  10.591  -1.101  1.00 0.00 ? 42  PRO A HG3  1  
ATOM 599   H HD2  . PRO A 1 42  ? 15.180  12.623  0.583   1.00 0.00 ? 42  PRO A HD2  1  
ATOM 600   H HD3  . PRO A 1 42  ? 13.920  12.757  -0.661  1.00 0.00 ? 42  PRO A HD3  1  
ATOM 601   N N    . PRO A 1 43  ? 12.040  9.401   3.224   1.00 0.00 ? 43  PRO A N    1  
ATOM 602   C CA   . PRO A 1 43  ? 12.245  8.676   4.481   1.00 0.00 ? 43  PRO A CA   1  
ATOM 603   C C    . PRO A 1 43  ? 13.436  7.727   4.415   1.00 0.00 ? 43  PRO A C    1  
ATOM 604   O O    . PRO A 1 43  ? 13.815  7.265   3.339   1.00 0.00 ? 43  PRO A O    1  
ATOM 605   C CB   . PRO A 1 43  ? 10.943  7.889   4.653   1.00 0.00 ? 43  PRO A CB   1  
ATOM 606   C CG   . PRO A 1 43  ? 10.415  7.724   3.270   1.00 0.00 ? 43  PRO A CG   1  
ATOM 607   C CD   . PRO A 1 43  ? 10.823  8.962   2.520   1.00 0.00 ? 43  PRO A CD   1  
ATOM 608   H HA   . PRO A 1 43  ? 12.371  9.353   5.313   1.00 0.00 ? 43  PRO A HA   1  
ATOM 609   H HB2  . PRO A 1 43  ? 11.155  6.934   5.113   1.00 0.00 ? 43  PRO A HB2  1  
ATOM 610   H HB3  . PRO A 1 43  ? 10.259  8.449   5.273   1.00 0.00 ? 43  PRO A HB3  1  
ATOM 611   H HG2  . PRO A 1 43  ? 10.849  6.848   2.813   1.00 0.00 ? 43  PRO A HG2  1  
ATOM 612   H HG3  . PRO A 1 43  ? 9.338   7.640   3.297   1.00 0.00 ? 43  PRO A HG3  1  
ATOM 613   H HD2  . PRO A 1 43  ? 11.038  8.725   1.489   1.00 0.00 ? 43  PRO A HD2  1  
ATOM 614   H HD3  . PRO A 1 43  ? 10.049  9.714   2.584   1.00 0.00 ? 43  PRO A HD3  1  
ATOM 615   N N    . ASP A 1 44  ? 14.023  7.440   5.572   1.00 0.00 ? 44  ASP A N    1  
ATOM 616   C CA   . ASP A 1 44  ? 15.171  6.544   5.645   1.00 0.00 ? 44  ASP A CA   1  
ATOM 617   C C    . ASP A 1 44  ? 14.720  5.091   5.756   1.00 0.00 ? 44  ASP A C    1  
ATOM 618   O O    . ASP A 1 44  ? 15.420  4.178   5.317   1.00 0.00 ? 44  ASP A O    1  
ATOM 619   C CB   . ASP A 1 44  ? 16.055  6.910   6.839   1.00 0.00 ? 44  ASP A CB   1  
ATOM 620   C CG   . ASP A 1 44  ? 16.845  8.182   6.606   1.00 0.00 ? 44  ASP A CG   1  
ATOM 621   O OD1  . ASP A 1 44  ? 17.591  8.242   5.607   1.00 0.00 ? 44  ASP A OD1  1  
ATOM 622   O OD2  . ASP A 1 44  ? 16.718  9.118   7.424   1.00 0.00 ? 44  ASP A OD2  1  
ATOM 623   H H    . ASP A 1 44  ? 13.675  7.840   6.396   1.00 0.00 ? 44  ASP A H    1  
ATOM 624   H HA   . ASP A 1 44  ? 15.743  6.662   4.737   1.00 0.00 ? 44  ASP A HA   1  
ATOM 625   H HB2  . ASP A 1 44  ? 15.432  7.050   7.711   1.00 0.00 ? 44  ASP A HB2  1  
ATOM 626   H HB3  . ASP A 1 44  ? 16.750  6.104   7.024   1.00 0.00 ? 44  ASP A HB3  1  
ATOM 627   N N    . ARG A 1 45  ? 13.548  4.884   6.347   1.00 0.00 ? 45  ARG A N    1  
ATOM 628   C CA   . ARG A 1 45  ? 13.005  3.542   6.518   1.00 0.00 ? 45  ARG A CA   1  
ATOM 629   C C    . ARG A 1 45  ? 11.504  3.523   6.244   1.00 0.00 ? 45  ARG A C    1  
ATOM 630   O O    . ARG A 1 45  ? 10.810  4.515   6.469   1.00 0.00 ? 45  ARG A O    1  
ATOM 631   C CB   . ARG A 1 45  ? 13.282  3.033   7.934   1.00 0.00 ? 45  ARG A CB   1  
ATOM 632   C CG   . ARG A 1 45  ? 12.479  1.796   8.305   1.00 0.00 ? 45  ARG A CG   1  
ATOM 633   C CD   . ARG A 1 45  ? 12.456  1.578   9.809   1.00 0.00 ? 45  ARG A CD   1  
ATOM 634   N NE   . ARG A 1 45  ? 13.716  1.966   10.438  1.00 0.00 ? 45  ARG A NE   1  
ATOM 635   C CZ   . ARG A 1 45  ? 13.961  1.830   11.737  1.00 0.00 ? 45  ARG A CZ   1  
ATOM 636   N NH1  . ARG A 1 45  ? 13.039  1.318   12.539  1.00 0.00 ? 45  ARG A NH1  1  
ATOM 637   N NH2  . ARG A 1 45  ? 15.132  2.207   12.235  1.00 0.00 ? 45  ARG A NH2  1  
ATOM 638   H H    . ARG A 1 45  ? 13.036  5.652   6.677   1.00 0.00 ? 45  ARG A H    1  
ATOM 639   H HA   . ARG A 1 45  ? 13.497  2.892   5.809   1.00 0.00 ? 45  ARG A HA   1  
ATOM 640   H HB2  . ARG A 1 45  ? 14.331  2.793   8.019   1.00 0.00 ? 45  ARG A HB2  1  
ATOM 641   H HB3  . ARG A 1 45  ? 13.042  3.816   8.638   1.00 0.00 ? 45  ARG A HB3  1  
ATOM 642   H HG2  . ARG A 1 45  ? 11.465  1.918   7.954   1.00 0.00 ? 45  ARG A HG2  1  
ATOM 643   H HG3  . ARG A 1 45  ? 12.925  0.935   7.831   1.00 0.00 ? 45  ARG A HG3  1  
ATOM 644   H HD2  . ARG A 1 45  ? 11.657  2.167   10.233  1.00 0.00 ? 45  ARG A HD2  1  
ATOM 645   H HD3  . ARG A 1 45  ? 12.275  0.531   10.004  1.00 0.00 ? 45  ARG A HD3  1  
ATOM 646   H HE   . ARG A 1 45  ? 14.411  2.348   9.864   1.00 0.00 ? 45  ARG A HE   1  
ATOM 647   H HH11 . ARG A 1 45  ? 12.156  1.032   12.166  1.00 0.00 ? 45  ARG A HH11 1  
ATOM 648   H HH12 . ARG A 1 45  ? 13.227  1.215   13.516  1.00 0.00 ? 45  ARG A HH12 1  
ATOM 649   H HH21 . ARG A 1 45  ? 15.830  2.594   11.633  1.00 0.00 ? 45  ARG A HH21 1  
ATOM 650   H HH22 . ARG A 1 45  ? 15.316  2.105   13.212  1.00 0.00 ? 45  ARG A HH22 1  
ATOM 651   N N    . ILE A 1 46  ? 11.011  2.390   5.756   1.00 0.00 ? 46  ILE A N    1  
ATOM 652   C CA   . ILE A 1 46  ? 9.593   2.243   5.452   1.00 0.00 ? 46  ILE A CA   1  
ATOM 653   C C    . ILE A 1 46  ? 9.121   0.815   5.706   1.00 0.00 ? 46  ILE A C    1  
ATOM 654   O O    . ILE A 1 46  ? 9.835   -0.145  5.420   1.00 0.00 ? 46  ILE A O    1  
ATOM 655   C CB   . ILE A 1 46  ? 9.289   2.619   3.990   1.00 0.00 ? 46  ILE A CB   1  
ATOM 656   C CG1  . ILE A 1 46  ? 9.625   4.091   3.738   1.00 0.00 ? 46  ILE A CG1  1  
ATOM 657   C CG2  . ILE A 1 46  ? 7.829   2.341   3.663   1.00 0.00 ? 46  ILE A CG2  1  
ATOM 658   C CD1  . ILE A 1 46  ? 9.493   4.502   2.289   1.00 0.00 ? 46  ILE A CD1  1  
ATOM 659   H H    . ILE A 1 46  ? 11.615  1.635   5.598   1.00 0.00 ? 46  ILE A H    1  
ATOM 660   H HA   . ILE A 1 46  ? 9.043   2.913   6.097   1.00 0.00 ? 46  ILE A HA   1  
ATOM 661   H HB   . ILE A 1 46  ? 9.900   2.003   3.348   1.00 0.00 ? 46  ILE A HB   1  
ATOM 662   H HG12 . ILE A 1 46  ? 8.961   4.710   4.320   1.00 0.00 ? 46  ILE A HG12 1  
ATOM 663   H HG13 . ILE A 1 46  ? 10.645  4.276   4.045   1.00 0.00 ? 46  ILE A HG13 1  
ATOM 664   H HG21 . ILE A 1 46  ? 7.389   3.216   3.208   1.00 0.00 ? 46  ILE A HG21 1  
ATOM 665   H HG22 . ILE A 1 46  ? 7.767   1.509   2.978   1.00 0.00 ? 46  ILE A HG22 1  
ATOM 666   H HG23 . ILE A 1 46  ? 7.297   2.101   4.571   1.00 0.00 ? 46  ILE A HG23 1  
ATOM 667   H HD11 . ILE A 1 46  ? 9.243   5.551   2.233   1.00 0.00 ? 46  ILE A HD11 1  
ATOM 668   H HD12 . ILE A 1 46  ? 10.426  4.325   1.777   1.00 0.00 ? 46  ILE A HD12 1  
ATOM 669   H HD13 . ILE A 1 46  ? 8.710   3.922   1.821   1.00 0.00 ? 46  ILE A HD13 1  
ATOM 670   N N    . ALA A 1 47  ? 7.913   0.684   6.244   1.00 0.00 ? 47  ALA A N    1  
ATOM 671   C CA   . ALA A 1 47  ? 7.344   -0.626  6.533   1.00 0.00 ? 47  ALA A CA   1  
ATOM 672   C C    . ALA A 1 47  ? 5.866   -0.677  6.161   1.00 0.00 ? 47  ALA A C    1  
ATOM 673   O O    . ALA A 1 47  ? 5.131   0.288   6.369   1.00 0.00 ? 47  ALA A O    1  
ATOM 674   C CB   . ALA A 1 47  ? 7.533   -0.971  8.003   1.00 0.00 ? 47  ALA A CB   1  
ATOM 675   H H    . ALA A 1 47  ? 7.392   1.488   6.450   1.00 0.00 ? 47  ALA A H    1  
ATOM 676   H HA   . ALA A 1 47  ? 7.878   -1.359  5.945   1.00 0.00 ? 47  ALA A HA   1  
ATOM 677   H HB1  . ALA A 1 47  ? 8.551   -1.292  8.169   1.00 0.00 ? 47  ALA A HB1  1  
ATOM 678   H HB2  . ALA A 1 47  ? 7.327   -0.100  8.606   1.00 0.00 ? 47  ALA A HB2  1  
ATOM 679   H HB3  . ALA A 1 47  ? 6.856   -1.767  8.276   1.00 0.00 ? 47  ALA A HB3  1  
ATOM 680   N N    . TRP A 1 48  ? 5.438   -1.807  5.611   1.00 0.00 ? 48  TRP A N    1  
ATOM 681   C CA   . TRP A 1 48  ? 4.047   -1.983  5.209   1.00 0.00 ? 48  TRP A CA   1  
ATOM 682   C C    . TRP A 1 48  ? 3.336   -2.973  6.126   1.00 0.00 ? 48  TRP A C    1  
ATOM 683   O O    . TRP A 1 48  ? 3.464   -4.186  5.962   1.00 0.00 ? 48  TRP A O    1  
ATOM 684   C CB   . TRP A 1 48  ? 3.970   -2.465  3.760   1.00 0.00 ? 48  TRP A CB   1  
ATOM 685   C CG   . TRP A 1 48  ? 3.983   -1.348  2.761   1.00 0.00 ? 48  TRP A CG   1  
ATOM 686   C CD1  . TRP A 1 48  ? 5.081   -0.698  2.272   1.00 0.00 ? 48  TRP A CD1  1  
ATOM 687   C CD2  . TRP A 1 48  ? 2.846   -0.748  2.130   1.00 0.00 ? 48  TRP A CD2  1  
ATOM 688   N NE1  . TRP A 1 48  ? 4.694   0.269   1.376   1.00 0.00 ? 48  TRP A NE1  1  
ATOM 689   C CE2  . TRP A 1 48  ? 3.328   0.258   1.270   1.00 0.00 ? 48  TRP A CE2  1  
ATOM 690   C CE3  . TRP A 1 48  ? 1.467   -0.965  2.206   1.00 0.00 ? 48  TRP A CE3  1  
ATOM 691   C CZ2  . TRP A 1 48  ? 2.480   1.044   0.496   1.00 0.00 ? 48  TRP A CZ2  1  
ATOM 692   C CZ3  . TRP A 1 48  ? 0.627   -0.184  1.436   1.00 0.00 ? 48  TRP A CZ3  1  
ATOM 693   C CH2  . TRP A 1 48  ? 1.135   0.811   0.590   1.00 0.00 ? 48  TRP A CH2  1  
ATOM 694   H H    . TRP A 1 48  ? 6.072   -2.542  5.471   1.00 0.00 ? 48  TRP A H    1  
ATOM 695   H HA   . TRP A 1 48  ? 3.557   -1.023  5.287   1.00 0.00 ? 48  TRP A HA   1  
ATOM 696   H HB2  . TRP A 1 48  ? 4.814   -3.106  3.555   1.00 0.00 ? 48  TRP A HB2  1  
ATOM 697   H HB3  . TRP A 1 48  ? 3.056   -3.025  3.623   1.00 0.00 ? 48  TRP A HB3  1  
ATOM 698   H HD1  . TRP A 1 48  ? 6.097   -0.921  2.559   1.00 0.00 ? 48  TRP A HD1  1  
ATOM 699   H HE1  . TRP A 1 48  ? 5.299   0.868   0.890   1.00 0.00 ? 48  TRP A HE1  1  
ATOM 700   H HE3  . TRP A 1 48  ? 1.057   -1.726  2.853   1.00 0.00 ? 48  TRP A HE3  1  
ATOM 701   H HZ2  . TRP A 1 48  ? 2.857   1.814   -0.162  1.00 0.00 ? 48  TRP A HZ2  1  
ATOM 702   H HZ3  . TRP A 1 48  ? -0.441  -0.336  1.483   1.00 0.00 ? 48  TRP A HZ3  1  
ATOM 703   H HH2  . TRP A 1 48  ? 0.442   1.397   0.007   1.00 0.00 ? 48  TRP A HH2  1  
ATOM 704   N N    . SER A 1 49  ? 2.588   -2.447  7.091   1.00 0.00 ? 49  SER A N    1  
ATOM 705   C CA   . SER A 1 49  ? 1.860   -3.286  8.036   1.00 0.00 ? 49  SER A CA   1  
ATOM 706   C C    . SER A 1 49  ? 0.356   -3.057  7.919   1.00 0.00 ? 49  SER A C    1  
ATOM 707   O O    . SER A 1 49  ? -0.101  -1.921  7.785   1.00 0.00 ? 49  SER A O    1  
ATOM 708   C CB   . SER A 1 49  ? 2.322   -2.999  9.466   1.00 0.00 ? 49  SER A CB   1  
ATOM 709   O OG   . SER A 1 49  ? 1.909   -1.710  9.886   1.00 0.00 ? 49  SER A OG   1  
ATOM 710   H H    . SER A 1 49  ? 2.526   -1.472  7.170   1.00 0.00 ? 49  SER A H    1  
ATOM 711   H HA   . SER A 1 49  ? 2.075   -4.317  7.797   1.00 0.00 ? 49  SER A HA   1  
ATOM 712   H HB2  . SER A 1 49  ? 1.898   -3.734  10.133  1.00 0.00 ? 49  SER A HB2  1  
ATOM 713   H HB3  . SER A 1 49  ? 3.400   -3.051  9.510   1.00 0.00 ? 49  SER A HB3  1  
ATOM 714   H HG   . SER A 1 49  ? 1.367   -1.789  10.674  1.00 0.00 ? 49  SER A HG   1  
ATOM 715   N N    . TRP A 1 50  ? -0.407  -4.142  7.971   1.00 0.00 ? 50  TRP A N    1  
ATOM 716   C CA   . TRP A 1 50  ? -1.860  -4.061  7.872   1.00 0.00 ? 50  TRP A CA   1  
ATOM 717   C C    . TRP A 1 50  ? -2.518  -4.427  9.197   1.00 0.00 ? 50  TRP A C    1  
ATOM 718   O O    . TRP A 1 50  ? -3.093  -3.573  9.873   1.00 0.00 ? 50  TRP A O    1  
ATOM 719   C CB   . TRP A 1 50  ? -2.368  -4.984  6.763   1.00 0.00 ? 50  TRP A CB   1  
ATOM 720   C CG   . TRP A 1 50  ? -1.537  -6.219  6.592   1.00 0.00 ? 50  TRP A CG   1  
ATOM 721   C CD1  . TRP A 1 50  ? -1.841  -7.478  7.025   1.00 0.00 ? 50  TRP A CD1  1  
ATOM 722   C CD2  . TRP A 1 50  ? -0.264  -6.313  5.943   1.00 0.00 ? 50  TRP A CD2  1  
ATOM 723   N NE1  . TRP A 1 50  ? -0.834  -8.349  6.683   1.00 0.00 ? 50  TRP A NE1  1  
ATOM 724   C CE2  . TRP A 1 50  ? 0.144   -7.659  6.018   1.00 0.00 ? 50  TRP A CE2  1  
ATOM 725   C CE3  . TRP A 1 50  ? 0.569   -5.391  5.303   1.00 0.00 ? 50  TRP A CE3  1  
ATOM 726   C CZ2  . TRP A 1 50  ? 1.349   -8.102  5.479   1.00 0.00 ? 50  TRP A CZ2  1  
ATOM 727   C CZ3  . TRP A 1 50  ? 1.765   -5.832  4.769   1.00 0.00 ? 50  TRP A CZ3  1  
ATOM 728   C CH2  . TRP A 1 50  ? 2.145   -7.178  4.859   1.00 0.00 ? 50  TRP A CH2  1  
ATOM 729   H H    . TRP A 1 50  ? 0.016   -5.020  8.080   1.00 0.00 ? 50  TRP A H    1  
ATOM 730   H HA   . TRP A 1 50  ? -2.117  -3.041  7.625   1.00 0.00 ? 50  TRP A HA   1  
ATOM 731   H HB2  . TRP A 1 50  ? -3.377  -5.291  6.994   1.00 0.00 ? 50  TRP A HB2  1  
ATOM 732   H HB3  . TRP A 1 50  ? -2.364  -4.446  5.827   1.00 0.00 ? 50  TRP A HB3  1  
ATOM 733   H HD1  . TRP A 1 50  ? -2.743  -7.737  7.557   1.00 0.00 ? 50  TRP A HD1  1  
ATOM 734   H HE1  . TRP A 1 50  ? -0.820  -9.309  6.883   1.00 0.00 ? 50  TRP A HE1  1  
ATOM 735   H HE3  . TRP A 1 50  ? 0.293   -4.350  5.224   1.00 0.00 ? 50  TRP A HE3  1  
ATOM 736   H HZ2  . TRP A 1 50  ? 1.657   -9.136  5.540   1.00 0.00 ? 50  TRP A HZ2  1  
ATOM 737   H HZ3  . TRP A 1 50  ? 2.422   -5.134  4.271   1.00 0.00 ? 50  TRP A HZ3  1  
ATOM 738   H HH2  . TRP A 1 50  ? 3.088   -7.478  4.428   1.00 0.00 ? 50  TRP A HH2  1  
ATOM 739   N N    . LYS A 1 51  ? -2.430  -5.701  9.564   1.00 0.00 ? 51  LYS A N    1  
ATOM 740   C CA   . LYS A 1 51  ? -3.016  -6.180  10.811  1.00 0.00 ? 51  LYS A CA   1  
ATOM 741   C C    . LYS A 1 51  ? -1.934  -6.455  11.850  1.00 0.00 ? 51  LYS A C    1  
ATOM 742   O O    . LYS A 1 51  ? -1.760  -5.687  12.795  1.00 0.00 ? 51  LYS A O    1  
ATOM 743   C CB   . LYS A 1 51  ? -3.831  -7.451  10.559  1.00 0.00 ? 51  LYS A CB   1  
ATOM 744   C CG   . LYS A 1 51  ? -4.982  -7.253  9.587   1.00 0.00 ? 51  LYS A CG   1  
ATOM 745   C CD   . LYS A 1 51  ? -6.245  -6.806  10.303  1.00 0.00 ? 51  LYS A CD   1  
ATOM 746   C CE   . LYS A 1 51  ? -6.991  -7.986  10.907  1.00 0.00 ? 51  LYS A CE   1  
ATOM 747   N NZ   . LYS A 1 51  ? -7.873  -7.568  12.032  1.00 0.00 ? 51  LYS A NZ   1  
ATOM 748   H H    . LYS A 1 51  ? -1.959  -6.334  8.983   1.00 0.00 ? 51  LYS A H    1  
ATOM 749   H HA   . LYS A 1 51  ? -3.672  -5.410  11.187  1.00 0.00 ? 51  LYS A HA   1  
ATOM 750   H HB2  . LYS A 1 51  ? -3.176  -8.211  10.160  1.00 0.00 ? 51  LYS A HB2  1  
ATOM 751   H HB3  . LYS A 1 51  ? -4.237  -7.795  11.499  1.00 0.00 ? 51  LYS A HB3  1  
ATOM 752   H HG2  . LYS A 1 51  ? -4.705  -6.500  8.864   1.00 0.00 ? 51  LYS A HG2  1  
ATOM 753   H HG3  . LYS A 1 51  ? -5.177  -8.187  9.080   1.00 0.00 ? 51  LYS A HG3  1  
ATOM 754   H HD2  . LYS A 1 51  ? -5.978  -6.121  11.094  1.00 0.00 ? 51  LYS A HD2  1  
ATOM 755   H HD3  . LYS A 1 51  ? -6.892  -6.307  9.595   1.00 0.00 ? 51  LYS A HD3  1  
ATOM 756   H HE2  . LYS A 1 51  ? -7.595  -8.445  10.139  1.00 0.00 ? 51  LYS A HE2  1  
ATOM 757   H HE3  . LYS A 1 51  ? -6.269  -8.702  11.273  1.00 0.00 ? 51  LYS A HE3  1  
ATOM 758   H HZ1  . LYS A 1 51  ? -7.757  -8.218  12.836  1.00 0.00 ? 51  LYS A HZ1  1  
ATOM 759   H HZ2  . LYS A 1 51  ? -8.868  -7.582  11.730  1.00 0.00 ? 51  LYS A HZ2  1  
ATOM 760   H HZ3  . LYS A 1 51  ? -7.628  -6.606  12.339  1.00 0.00 ? 51  LYS A HZ3  1  
ATOM 761   N N    . GLU A 1 52  ? -1.209  -7.555  11.667  1.00 0.00 ? 52  GLU A N    1  
ATOM 762   C CA   . GLU A 1 52  ? -0.144  -7.929  12.589  1.00 0.00 ? 52  GLU A CA   1  
ATOM 763   C C    . GLU A 1 52  ? 1.161   -8.182  11.840  1.00 0.00 ? 52  GLU A C    1  
ATOM 764   O O    . GLU A 1 52  ? 2.214   -8.365  12.449  1.00 0.00 ? 52  GLU A O    1  
ATOM 765   C CB   . GLU A 1 52  ? -0.540  -9.177  13.381  1.00 0.00 ? 52  GLU A CB   1  
ATOM 766   C CG   . GLU A 1 52  ? 0.635   -9.876  14.044  1.00 0.00 ? 52  GLU A CG   1  
ATOM 767   C CD   . GLU A 1 52  ? 0.207   -10.800 15.167  1.00 0.00 ? 52  GLU A CD   1  
ATOM 768   O OE1  . GLU A 1 52  ? -0.544  -10.347 16.056  1.00 0.00 ? 52  GLU A OE1  1  
ATOM 769   O OE2  . GLU A 1 52  ? 0.622   -11.978 15.156  1.00 0.00 ? 52  GLU A OE2  1  
ATOM 770   H H    . GLU A 1 52  ? -1.396  -8.128  10.894  1.00 0.00 ? 52  GLU A H    1  
ATOM 771   H HA   . GLU A 1 52  ? 0.003   -7.110  13.277  1.00 0.00 ? 52  GLU A HA   1  
ATOM 772   H HB2  . GLU A 1 52  ? -1.244  -8.894  14.149  1.00 0.00 ? 52  GLU A HB2  1  
ATOM 773   H HB3  . GLU A 1 52  ? -1.016  -9.878  12.710  1.00 0.00 ? 52  GLU A HB3  1  
ATOM 774   H HG2  . GLU A 1 52  ? 1.159   -10.457 13.300  1.00 0.00 ? 52  GLU A HG2  1  
ATOM 775   H HG3  . GLU A 1 52  ? 1.301   -9.127  14.448  1.00 0.00 ? 52  GLU A HG3  1  
ATOM 776   N N    . ASN A 1 53  ? 1.082   -8.190  10.513  1.00 0.00 ? 53  ASN A N    1  
ATOM 777   C CA   . ASN A 1 53  ? 2.256   -8.421  9.679   1.00 0.00 ? 53  ASN A CA   1  
ATOM 778   C C    . ASN A 1 53  ? 2.962   -7.107  9.357   1.00 0.00 ? 53  ASN A C    1  
ATOM 779   O O    . ASN A 1 53  ? 2.357   -6.036  9.409   1.00 0.00 ? 53  ASN A O    1  
ATOM 780   C CB   . ASN A 1 53  ? 1.856   -9.129  8.383   1.00 0.00 ? 53  ASN A CB   1  
ATOM 781   C CG   . ASN A 1 53  ? 1.817   -10.638 8.537   1.00 0.00 ? 53  ASN A CG   1  
ATOM 782   O OD1  . ASN A 1 53  ? 2.840   -11.312 8.415   1.00 0.00 ? 53  ASN A OD1  1  
ATOM 783   N ND2  . ASN A 1 53  ? 0.632   -11.174 8.806   1.00 0.00 ? 53  ASN A ND2  1  
ATOM 784   H H    . ASN A 1 53  ? 0.214   -8.038  10.084  1.00 0.00 ? 53  ASN A H    1  
ATOM 785   H HA   . ASN A 1 53  ? 2.935   -9.055  10.230  1.00 0.00 ? 53  ASN A HA   1  
ATOM 786   H HB2  . ASN A 1 53  ? 0.874   -8.792  8.085   1.00 0.00 ? 53  ASN A HB2  1  
ATOM 787   H HB3  . ASN A 1 53  ? 2.568   -8.883  7.610   1.00 0.00 ? 53  ASN A HB3  1  
ATOM 788   H HD21 . ASN A 1 53  ? -0.139  -10.576 8.889   1.00 0.00 ? 53  ASN A HD21 1  
ATOM 789   H HD22 . ASN A 1 53  ? 0.579   -12.147 8.911   1.00 0.00 ? 53  ASN A HD22 1  
ATOM 790   N N    . VAL A 1 54  ? 4.245   -7.198  9.023   1.00 0.00 ? 54  VAL A N    1  
ATOM 791   C CA   . VAL A 1 54  ? 5.033   -6.017  8.690   1.00 0.00 ? 54  VAL A CA   1  
ATOM 792   C C    . VAL A 1 54  ? 6.119   -6.350  7.673   1.00 0.00 ? 54  VAL A C    1  
ATOM 793   O O    . VAL A 1 54  ? 7.097   -7.027  7.992   1.00 0.00 ? 54  VAL A O    1  
ATOM 794   C CB   . VAL A 1 54  ? 5.689   -5.408  9.944   1.00 0.00 ? 54  VAL A CB   1  
ATOM 795   C CG1  . VAL A 1 54  ? 6.321   -4.064  9.616   1.00 0.00 ? 54  VAL A CG1  1  
ATOM 796   C CG2  . VAL A 1 54  ? 4.668   -5.268  11.063  1.00 0.00 ? 54  VAL A CG2  1  
ATOM 797   H H    . VAL A 1 54  ? 4.672   -8.079  8.999   1.00 0.00 ? 54  VAL A H    1  
ATOM 798   H HA   . VAL A 1 54  ? 4.368   -5.280  8.264   1.00 0.00 ? 54  VAL A HA   1  
ATOM 799   H HB   . VAL A 1 54  ? 6.469   -6.076  10.278  1.00 0.00 ? 54  VAL A HB   1  
ATOM 800   H HG11 . VAL A 1 54  ? 5.779   -3.279  10.122  1.00 0.00 ? 54  VAL A HG11 1  
ATOM 801   H HG12 . VAL A 1 54  ? 7.351   -4.061  9.944   1.00 0.00 ? 54  VAL A HG12 1  
ATOM 802   H HG13 . VAL A 1 54  ? 6.282   -3.898  8.550   1.00 0.00 ? 54  VAL A HG13 1  
ATOM 803   H HG21 . VAL A 1 54  ? 5.169   -4.963  11.970  1.00 0.00 ? 54  VAL A HG21 1  
ATOM 804   H HG22 . VAL A 1 54  ? 3.934   -4.524  10.790  1.00 0.00 ? 54  VAL A HG22 1  
ATOM 805   H HG23 . VAL A 1 54  ? 4.177   -6.216  11.224  1.00 0.00 ? 54  VAL A HG23 1  
ATOM 806   N N    . LEU A 1 55  ? 5.941   -5.869  6.448   1.00 0.00 ? 55  LEU A N    1  
ATOM 807   C CA   . LEU A 1 55  ? 6.907   -6.114  5.382   1.00 0.00 ? 55  LEU A CA   1  
ATOM 808   C C    . LEU A 1 55  ? 7.725   -4.861  5.089   1.00 0.00 ? 55  LEU A C    1  
ATOM 809   O O    . LEU A 1 55  ? 7.212   -3.889  4.536   1.00 0.00 ? 55  LEU A O    1  
ATOM 810   C CB   . LEU A 1 55  ? 6.188   -6.576  4.113   1.00 0.00 ? 55  LEU A CB   1  
ATOM 811   C CG   . LEU A 1 55  ? 7.020   -7.410  3.137   1.00 0.00 ? 55  LEU A CG   1  
ATOM 812   C CD1  . LEU A 1 55  ? 7.652   -8.594  3.851   1.00 0.00 ? 55  LEU A CD1  1  
ATOM 813   C CD2  . LEU A 1 55  ? 6.160   -7.883  1.973   1.00 0.00 ? 55  LEU A CD2  1  
ATOM 814   H H    . LEU A 1 55  ? 5.143   -5.336  6.254   1.00 0.00 ? 55  LEU A H    1  
ATOM 815   H HA   . LEU A 1 55  ? 7.574   -6.896  5.713   1.00 0.00 ? 55  LEU A HA   1  
ATOM 816   H HB2  . LEU A 1 55  ? 5.338   -7.169  4.412   1.00 0.00 ? 55  LEU A HB2  1  
ATOM 817   H HB3  . LEU A 1 55  ? 5.845   -5.696  3.589   1.00 0.00 ? 55  LEU A HB3  1  
ATOM 818   H HG   . LEU A 1 55  ? 7.816   -6.797  2.738   1.00 0.00 ? 55  LEU A HG   1  
ATOM 819   H HD11 . LEU A 1 55  ? 8.519   -8.262  4.401   1.00 0.00 ? 55  LEU A HD11 1  
ATOM 820   H HD12 . LEU A 1 55  ? 7.950   -9.336  3.124   1.00 0.00 ? 55  LEU A HD12 1  
ATOM 821   H HD13 . LEU A 1 55  ? 6.936   -9.027  4.534   1.00 0.00 ? 55  LEU A HD13 1  
ATOM 822   H HD21 . LEU A 1 55  ? 5.985   -8.945  2.065   1.00 0.00 ? 55  LEU A HD21 1  
ATOM 823   H HD22 . LEU A 1 55  ? 6.672   -7.681  1.043   1.00 0.00 ? 55  LEU A HD22 1  
ATOM 824   H HD23 . LEU A 1 55  ? 5.216   -7.359  1.987   1.00 0.00 ? 55  LEU A HD23 1  
ATOM 825   N N    . GLU A 1 56  ? 9.001   -4.892  5.462   1.00 0.00 ? 56  GLU A N    1  
ATOM 826   C CA   . GLU A 1 56  ? 9.889   -3.758  5.237   1.00 0.00 ? 56  GLU A CA   1  
ATOM 827   C C    . GLU A 1 56  ? 10.370  -3.722  3.789   1.00 0.00 ? 56  GLU A C    1  
ATOM 828   O O    . GLU A 1 56  ? 10.349  -2.674  3.143   1.00 0.00 ? 56  GLU A O    1  
ATOM 829   C CB   . GLU A 1 56  ? 11.090  -3.828  6.183   1.00 0.00 ? 56  GLU A CB   1  
ATOM 830   C CG   . GLU A 1 56  ? 10.714  -3.735  7.652   1.00 0.00 ? 56  GLU A CG   1  
ATOM 831   C CD   . GLU A 1 56  ? 11.803  -4.260  8.567   1.00 0.00 ? 56  GLU A CD   1  
ATOM 832   O OE1  . GLU A 1 56  ? 12.994  -4.066  8.244   1.00 0.00 ? 56  GLU A OE1  1  
ATOM 833   O OE2  . GLU A 1 56  ? 11.465  -4.865  9.606   1.00 0.00 ? 56  GLU A OE2  1  
ATOM 834   H H    . GLU A 1 56  ? 9.352   -5.696  5.898   1.00 0.00 ? 56  GLU A H    1  
ATOM 835   H HA   . GLU A 1 56  ? 9.334   -2.856  5.442   1.00 0.00 ? 56  GLU A HA   1  
ATOM 836   H HB2  . GLU A 1 56  ? 11.606  -4.763  6.022   1.00 0.00 ? 56  GLU A HB2  1  
ATOM 837   H HB3  . GLU A 1 56  ? 11.762  -3.014  5.953   1.00 0.00 ? 56  GLU A HB3  1  
ATOM 838   H HG2  . GLU A 1 56  ? 10.527  -2.701  7.898   1.00 0.00 ? 56  GLU A HG2  1  
ATOM 839   H HG3  . GLU A 1 56  ? 9.816   -4.311  7.817   1.00 0.00 ? 56  GLU A HG3  1  
ATOM 840   N N    . SER A 1 57  ? 10.803  -4.874  3.286   1.00 0.00 ? 57  SER A N    1  
ATOM 841   C CA   . SER A 1 57  ? 11.293  -4.974  1.917   1.00 0.00 ? 57  SER A CA   1  
ATOM 842   C C    . SER A 1 57  ? 11.461  -6.434  1.505   1.00 0.00 ? 57  SER A C    1  
ATOM 843   O O    . SER A 1 57  ? 11.520  -7.326  2.350   1.00 0.00 ? 57  SER A O    1  
ATOM 844   C CB   . SER A 1 57  ? 12.625  -4.235  1.774   1.00 0.00 ? 57  SER A CB   1  
ATOM 845   O OG   . SER A 1 57  ? 12.803  -3.756  0.452   1.00 0.00 ? 57  SER A OG   1  
ATOM 846   H H    . SER A 1 57  ? 10.794  -5.675  3.851   1.00 0.00 ? 57  SER A H    1  
ATOM 847   H HA   . SER A 1 57  ? 10.563  -4.512  1.269   1.00 0.00 ? 57  SER A HA   1  
ATOM 848   H HB2  . SER A 1 57  ? 12.643  -3.397  2.453   1.00 0.00 ? 57  SER A HB2  1  
ATOM 849   H HB3  . SER A 1 57  ? 13.434  -4.910  2.012   1.00 0.00 ? 57  SER A HB3  1  
ATOM 850   H HG   . SER A 1 57  ? 13.437  -4.312  -0.007  1.00 0.00 ? 57  SER A HG   1  
ATOM 851   N N    . GLY A 1 58  ? 11.537  -6.669  0.199   1.00 0.00 ? 58  GLY A N    1  
ATOM 852   C CA   . GLY A 1 58  ? 11.698  -8.021  -0.303  1.00 0.00 ? 58  GLY A CA   1  
ATOM 853   C C    . GLY A 1 58  ? 10.372  -8.682  -0.624  1.00 0.00 ? 58  GLY A C    1  
ATOM 854   O O    . GLY A 1 58  ? 9.393   -8.005  -0.944  1.00 0.00 ? 58  GLY A O    1  
ATOM 855   H H    . GLY A 1 58  ? 11.484  -5.918  -0.429  1.00 0.00 ? 58  GLY A H    1  
ATOM 856   H HA2  . GLY A 1 58  ? 12.300  -7.992  -1.199  1.00 0.00 ? 58  GLY A HA2  1  
ATOM 857   H HA3  . GLY A 1 58  ? 12.209  -8.611  0.443   1.00 0.00 ? 58  GLY A HA3  1  
ATOM 858   N N    . THR A 1 59  ? 10.337  -10.008 -0.541  1.00 0.00 ? 59  THR A N    1  
ATOM 859   C CA   . THR A 1 59  ? 9.123   -10.761 -0.828  1.00 0.00 ? 59  THR A CA   1  
ATOM 860   C C    . THR A 1 59  ? 8.813   -11.752 0.288   1.00 0.00 ? 59  THR A C    1  
ATOM 861   O O    . THR A 1 59  ? 9.667   -12.547 0.679   1.00 0.00 ? 59  THR A O    1  
ATOM 862   C CB   . THR A 1 59  ? 9.237   -11.525 -2.161  1.00 0.00 ? 59  THR A CB   1  
ATOM 863   O OG1  . THR A 1 59  ? 9.537   -10.614 -3.224  1.00 0.00 ? 59  THR A OG1  1  
ATOM 864   C CG2  . THR A 1 59  ? 7.946   -12.267 -2.471  1.00 0.00 ? 59  THR A CG2  1  
ATOM 865   H H    . THR A 1 59  ? 11.150  -10.491 -0.282  1.00 0.00 ? 59  THR A H    1  
ATOM 866   H HA   . THR A 1 59  ? 8.306   -10.058 -0.909  1.00 0.00 ? 59  THR A HA   1  
ATOM 867   H HB   . THR A 1 59  ? 10.038  -12.245 -2.078  1.00 0.00 ? 59  THR A HB   1  
ATOM 868   H HG1  . THR A 1 59  ? 10.282  -10.063 -2.973  1.00 0.00 ? 59  THR A HG1  1  
ATOM 869   H HG21 . THR A 1 59  ? 8.127   -13.331 -2.444  1.00 0.00 ? 59  THR A HG21 1  
ATOM 870   H HG22 . THR A 1 59  ? 7.597   -11.986 -3.454  1.00 0.00 ? 59  THR A HG22 1  
ATOM 871   H HG23 . THR A 1 59  ? 7.198   -12.011 -1.736  1.00 0.00 ? 59  THR A HG23 1  
ATOM 872   N N    . SER A 1 60  ? 7.587   -11.699 0.797   1.00 0.00 ? 60  SER A N    1  
ATOM 873   C CA   . SER A 1 60  ? 7.165   -12.590 1.871   1.00 0.00 ? 60  SER A CA   1  
ATOM 874   C C    . SER A 1 60  ? 5.648   -12.575 2.026   1.00 0.00 ? 60  SER A C    1  
ATOM 875   O O    . SER A 1 60  ? 5.012   -11.527 1.918   1.00 0.00 ? 60  SER A O    1  
ATOM 876   C CB   . SER A 1 60  ? 7.828   -12.185 3.189   1.00 0.00 ? 60  SER A CB   1  
ATOM 877   O OG   . SER A 1 60  ? 7.957   -13.296 4.058   1.00 0.00 ? 60  SER A OG   1  
ATOM 878   H H    . SER A 1 60  ? 6.951   -11.042 0.443   1.00 0.00 ? 60  SER A H    1  
ATOM 879   H HA   . SER A 1 60  ? 7.479   -13.591 1.613   1.00 0.00 ? 60  SER A HA   1  
ATOM 880   H HB2  . SER A 1 60  ? 8.811   -11.785 2.987   1.00 0.00 ? 60  SER A HB2  1  
ATOM 881   H HB3  . SER A 1 60  ? 7.226   -11.430 3.674   1.00 0.00 ? 60  SER A HB3  1  
ATOM 882   H HG   . SER A 1 60  ? 8.820   -13.699 3.938   1.00 0.00 ? 60  SER A HG   1  
ATOM 883   N N    . GLY A 1 61  ? 5.073   -13.747 2.280   1.00 0.00 ? 61  GLY A N    1  
ATOM 884   C CA   . GLY A 1 61  ? 3.635   -13.847 2.446   1.00 0.00 ? 61  GLY A CA   1  
ATOM 885   C C    . GLY A 1 61  ? 2.875   -13.366 1.226   1.00 0.00 ? 61  GLY A C    1  
ATOM 886   O O    . GLY A 1 61  ? 1.808   -12.765 1.348   1.00 0.00 ? 61  GLY A O    1  
ATOM 887   H H    . GLY A 1 61  ? 5.630   -14.550 2.356   1.00 0.00 ? 61  GLY A H    1  
ATOM 888   H HA2  . GLY A 1 61  ? 3.376   -14.879 2.635   1.00 0.00 ? 61  GLY A HA2  1  
ATOM 889   H HA3  . GLY A 1 61  ? 3.340   -13.252 3.298   1.00 0.00 ? 61  GLY A HA3  1  
ATOM 890   N N    . ARG A 1 62  ? 3.427   -13.628 0.046   1.00 0.00 ? 62  ARG A N    1  
ATOM 891   C CA   . ARG A 1 62  ? 2.796   -13.215 -1.202  1.00 0.00 ? 62  ARG A CA   1  
ATOM 892   C C    . ARG A 1 62  ? 2.752   -11.693 -1.310  1.00 0.00 ? 62  ARG A C    1  
ATOM 893   O O    . ARG A 1 62  ? 1.852   -11.131 -1.935  1.00 0.00 ? 62  ARG A O    1  
ATOM 894   C CB   . ARG A 1 62  ? 1.380   -13.785 -1.295  1.00 0.00 ? 62  ARG A CB   1  
ATOM 895   C CG   . ARG A 1 62  ? 1.311   -15.286 -1.067  1.00 0.00 ? 62  ARG A CG   1  
ATOM 896   C CD   . ARG A 1 62  ? 0.156   -15.913 -1.833  1.00 0.00 ? 62  ARG A CD   1  
ATOM 897   N NE   . ARG A 1 62  ? -0.064  -17.305 -1.448  1.00 0.00 ? 62  ARG A NE   1  
ATOM 898   C CZ   . ARG A 1 62  ? 0.746   -18.299 -1.795  1.00 0.00 ? 62  ARG A CZ   1  
ATOM 899   N NH1  . ARG A 1 62  ? 1.823   -18.057 -2.529  1.00 0.00 ? 62  ARG A NH1  1  
ATOM 900   N NH2  . ARG A 1 62  ? 0.479   -19.540 -1.406  1.00 0.00 ? 62  ARG A NH2  1  
ATOM 901   H H    . ARG A 1 62  ? 4.280   -14.111 0.013   1.00 0.00 ? 62  ARG A H    1  
ATOM 902   H HA   . ARG A 1 62  ? 3.386   -13.605 -2.017  1.00 0.00 ? 62  ARG A HA   1  
ATOM 903   H HB2  . ARG A 1 62  ? 0.760   -13.302 -0.553  1.00 0.00 ? 62  ARG A HB2  1  
ATOM 904   H HB3  . ARG A 1 62  ? 0.983   -13.572 -2.276  1.00 0.00 ? 62  ARG A HB3  1  
ATOM 905   H HG2  . ARG A 1 62  ? 2.235   -15.734 -1.402  1.00 0.00 ? 62  ARG A HG2  1  
ATOM 906   H HG3  . ARG A 1 62  ? 1.178   -15.475 -0.013  1.00 0.00 ? 62  ARG A HG3  1  
ATOM 907   H HD2  . ARG A 1 62  ? -0.741  -15.348 -1.630  1.00 0.00 ? 62  ARG A HD2  1  
ATOM 908   H HD3  . ARG A 1 62  ? 0.377   -15.871 -2.889  1.00 0.00 ? 62  ARG A HD3  1  
ATOM 909   H HE   . ARG A 1 62  ? -0.854  -17.506 -0.906  1.00 0.00 ? 62  ARG A HE   1  
ATOM 910   H HH11 . ARG A 1 62  ? 2.027   -17.123 -2.822  1.00 0.00 ? 62  ARG A HH11 1  
ATOM 911   H HH12 . ARG A 1 62  ? 2.432   -18.807 -2.787  1.00 0.00 ? 62  ARG A HH12 1  
ATOM 912   H HH21 . ARG A 1 62  ? -0.332  -19.726 -0.852  1.00 0.00 ? 62  ARG A HH21 1  
ATOM 913   H HH22 . ARG A 1 62  ? 1.088   -20.287 -1.667  1.00 0.00 ? 62  ARG A HH22 1  
ATOM 914   N N    . TYR A 1 63  ? 3.728   -11.033 -0.697  1.00 0.00 ? 63  TYR A N    1  
ATOM 915   C CA   . TYR A 1 63  ? 3.799   -9.577  -0.722  1.00 0.00 ? 63  TYR A CA   1  
ATOM 916   C C    . TYR A 1 63  ? 5.189   -9.106  -1.139  1.00 0.00 ? 63  TYR A C    1  
ATOM 917   O O    . TYR A 1 63  ? 6.197   -9.516  -0.561  1.00 0.00 ? 63  TYR A O    1  
ATOM 918   C CB   . TYR A 1 63  ? 3.446   -9.004  0.651   1.00 0.00 ? 63  TYR A CB   1  
ATOM 919   C CG   . TYR A 1 63  ? 2.044   -9.343  1.105   1.00 0.00 ? 63  TYR A CG   1  
ATOM 920   C CD1  . TYR A 1 63  ? 0.936   -8.766  0.496   1.00 0.00 ? 63  TYR A CD1  1  
ATOM 921   C CD2  . TYR A 1 63  ? 1.826   -10.240 2.144   1.00 0.00 ? 63  TYR A CD2  1  
ATOM 922   C CE1  . TYR A 1 63  ? -0.346  -9.071  0.908   1.00 0.00 ? 63  TYR A CE1  1  
ATOM 923   C CE2  . TYR A 1 63  ? 0.547   -10.553 2.562   1.00 0.00 ? 63  TYR A CE2  1  
ATOM 924   C CZ   . TYR A 1 63  ? -0.536  -9.966  1.941   1.00 0.00 ? 63  TYR A CZ   1  
ATOM 925   O OH   . TYR A 1 63  ? -1.812  -10.274 2.354   1.00 0.00 ? 63  TYR A OH   1  
ATOM 926   H H    . TYR A 1 63  ? 4.417   -11.537 -0.215  1.00 0.00 ? 63  TYR A H    1  
ATOM 927   H HA   . TYR A 1 63  ? 3.080   -9.222  -1.446  1.00 0.00 ? 63  TYR A HA   1  
ATOM 928   H HB2  . TYR A 1 63  ? 4.134   -9.395  1.385   1.00 0.00 ? 63  TYR A HB2  1  
ATOM 929   H HB3  . TYR A 1 63  ? 3.533   -7.928  0.618   1.00 0.00 ? 63  TYR A HB3  1  
ATOM 930   H HD1  . TYR A 1 63  ? 1.088   -8.066  -0.314  1.00 0.00 ? 63  TYR A HD1  1  
ATOM 931   H HD2  . TYR A 1 63  ? 2.677   -10.698 2.628   1.00 0.00 ? 63  TYR A HD2  1  
ATOM 932   H HE1  . TYR A 1 63  ? -1.194  -8.612  0.422   1.00 0.00 ? 63  TYR A HE1  1  
ATOM 933   H HE2  . TYR A 1 63  ? 0.398   -11.253 3.371   1.00 0.00 ? 63  TYR A HE2  1  
ATOM 934   H HH   . TYR A 1 63  ? -2.057  -9.704  3.087   1.00 0.00 ? 63  TYR A HH   1  
ATOM 935   N N    . THR A 1 64  ? 5.237   -8.242  -2.148  1.00 0.00 ? 64  THR A N    1  
ATOM 936   C CA   . THR A 1 64  ? 6.502   -7.715  -2.644  1.00 0.00 ? 64  THR A CA   1  
ATOM 937   C C    . THR A 1 64  ? 6.555   -6.197  -2.511  1.00 0.00 ? 64  THR A C    1  
ATOM 938   O O    . THR A 1 64  ? 5.855   -5.477  -3.223  1.00 0.00 ? 64  THR A O    1  
ATOM 939   C CB   . THR A 1 64  ? 6.730   -8.098  -4.119  1.00 0.00 ? 64  THR A CB   1  
ATOM 940   O OG1  . THR A 1 64  ? 6.357   -9.464  -4.334  1.00 0.00 ? 64  THR A OG1  1  
ATOM 941   C CG2  . THR A 1 64  ? 8.186   -7.898  -4.511  1.00 0.00 ? 64  THR A CG2  1  
ATOM 942   H H    . THR A 1 64  ? 4.400   -7.954  -2.569  1.00 0.00 ? 64  THR A H    1  
ATOM 943   H HA   . THR A 1 64  ? 7.297   -8.147  -2.055  1.00 0.00 ? 64  THR A HA   1  
ATOM 944   H HB   . THR A 1 64  ? 6.115   -7.462  -4.740  1.00 0.00 ? 64  THR A HB   1  
ATOM 945   H HG1  . THR A 1 64  ? 5.587   -9.673  -3.799  1.00 0.00 ? 64  THR A HG1  1  
ATOM 946   H HG21 . THR A 1 64  ? 8.813   -8.533  -3.903  1.00 0.00 ? 64  THR A HG21 1  
ATOM 947   H HG22 . THR A 1 64  ? 8.462   -6.865  -4.356  1.00 0.00 ? 64  THR A HG22 1  
ATOM 948   H HG23 . THR A 1 64  ? 8.317   -8.153  -5.551  1.00 0.00 ? 64  THR A HG23 1  
ATOM 949   N N    . VAL A 1 65  ? 7.390   -5.717  -1.595  1.00 0.00 ? 65  VAL A N    1  
ATOM 950   C CA   . VAL A 1 65  ? 7.536   -4.284  -1.370  1.00 0.00 ? 65  VAL A CA   1  
ATOM 951   C C    . VAL A 1 65  ? 8.634   -3.699  -2.251  1.00 0.00 ? 65  VAL A C    1  
ATOM 952   O O    . VAL A 1 65  ? 9.676   -4.321  -2.456  1.00 0.00 ? 65  VAL A O    1  
ATOM 953   C CB   . VAL A 1 65  ? 7.857   -3.977  0.104   1.00 0.00 ? 65  VAL A CB   1  
ATOM 954   C CG1  . VAL A 1 65  ? 8.049   -2.482  0.310   1.00 0.00 ? 65  VAL A CG1  1  
ATOM 955   C CG2  . VAL A 1 65  ? 6.759   -4.512  1.011   1.00 0.00 ? 65  VAL A CG2  1  
ATOM 956   H H    . VAL A 1 65  ? 7.921   -6.342  -1.059  1.00 0.00 ? 65  VAL A H    1  
ATOM 957   H HA   . VAL A 1 65  ? 6.597   -3.810  -1.619  1.00 0.00 ? 65  VAL A HA   1  
ATOM 958   H HB   . VAL A 1 65  ? 8.781   -4.475  0.362   1.00 0.00 ? 65  VAL A HB   1  
ATOM 959   H HG11 . VAL A 1 65  ? 7.084   -2.008  0.420   1.00 0.00 ? 65  VAL A HG11 1  
ATOM 960   H HG12 . VAL A 1 65  ? 8.639   -2.313  1.199   1.00 0.00 ? 65  VAL A HG12 1  
ATOM 961   H HG13 . VAL A 1 65  ? 8.558   -2.064  -0.546  1.00 0.00 ? 65  VAL A HG13 1  
ATOM 962   H HG21 . VAL A 1 65  ? 6.206   -3.685  1.431   1.00 0.00 ? 65  VAL A HG21 1  
ATOM 963   H HG22 . VAL A 1 65  ? 6.090   -5.137  0.437   1.00 0.00 ? 65  VAL A HG22 1  
ATOM 964   H HG23 . VAL A 1 65  ? 7.199   -5.093  1.807   1.00 0.00 ? 65  VAL A HG23 1  
ATOM 965   N N    . GLU A 1 66  ? 8.393   -2.498  -2.768  1.00 0.00 ? 66  GLU A N    1  
ATOM 966   C CA   . GLU A 1 66  ? 9.363   -1.828  -3.627  1.00 0.00 ? 66  GLU A CA   1  
ATOM 967   C C    . GLU A 1 66  ? 9.204   -0.313  -3.549  1.00 0.00 ? 66  GLU A C    1  
ATOM 968   O O    . GLU A 1 66  ? 8.166   0.235   -3.924  1.00 0.00 ? 66  GLU A O    1  
ATOM 969   C CB   . GLU A 1 66  ? 9.202   -2.295  -5.075  1.00 0.00 ? 66  GLU A CB   1  
ATOM 970   C CG   . GLU A 1 66  ? 9.483   -3.775  -5.272  1.00 0.00 ? 66  GLU A CG   1  
ATOM 971   C CD   . GLU A 1 66  ? 9.486   -4.179  -6.734  1.00 0.00 ? 66  GLU A CD   1  
ATOM 972   O OE1  . GLU A 1 66  ? 9.984   -3.393  -7.566  1.00 0.00 ? 66  GLU A OE1  1  
ATOM 973   O OE2  . GLU A 1 66  ? 8.990   -5.283  -7.045  1.00 0.00 ? 66  GLU A OE2  1  
ATOM 974   H H    . GLU A 1 66  ? 7.544   -2.052  -2.567  1.00 0.00 ? 66  GLU A H    1  
ATOM 975   H HA   . GLU A 1 66  ? 10.351  -2.093  -3.281  1.00 0.00 ? 66  GLU A HA   1  
ATOM 976   H HB2  . GLU A 1 66  ? 8.190   -2.096  -5.395  1.00 0.00 ? 66  GLU A HB2  1  
ATOM 977   H HB3  . GLU A 1 66  ? 9.884   -1.735  -5.698  1.00 0.00 ? 66  GLU A HB3  1  
ATOM 978   H HG2  . GLU A 1 66  ? 10.450  -4.005  -4.850  1.00 0.00 ? 66  GLU A HG2  1  
ATOM 979   H HG3  . GLU A 1 66  ? 8.723   -4.345  -4.758  1.00 0.00 ? 66  GLU A HG3  1  
ATOM 980   N N    . THR A 1 67  ? 10.240  0.361   -3.059  1.00 0.00 ? 67  THR A N    1  
ATOM 981   C CA   . THR A 1 67  ? 10.216  1.812   -2.930  1.00 0.00 ? 67  THR A CA   1  
ATOM 982   C C    . THR A 1 67  ? 10.844  2.483   -4.146  1.00 0.00 ? 67  THR A C    1  
ATOM 983   O O    . THR A 1 67  ? 11.814  1.980   -4.712  1.00 0.00 ? 67  THR A O    1  
ATOM 984   C CB   . THR A 1 67  ? 10.958  2.276   -1.662  1.00 0.00 ? 67  THR A CB   1  
ATOM 985   O OG1  . THR A 1 67  ? 10.717  1.358   -0.590  1.00 0.00 ? 67  THR A OG1  1  
ATOM 986   C CG2  . THR A 1 67  ? 10.510  3.671   -1.252  1.00 0.00 ? 67  THR A CG2  1  
ATOM 987   H H    . THR A 1 67  ? 11.039  -0.132  -2.777  1.00 0.00 ? 67  THR A H    1  
ATOM 988   H HA   . THR A 1 67  ? 9.184   2.123   -2.851  1.00 0.00 ? 67  THR A HA   1  
ATOM 989   H HB   . THR A 1 67  ? 12.018  2.301   -1.872  1.00 0.00 ? 67  THR A HB   1  
ATOM 990   H HG1  . THR A 1 67  ? 10.851  1.804   0.250   1.00 0.00 ? 67  THR A HG1  1  
ATOM 991   H HG21 . THR A 1 67  ? 9.859   4.077   -2.011  1.00 0.00 ? 67  THR A HG21 1  
ATOM 992   H HG22 . THR A 1 67  ? 11.375  4.308   -1.141  1.00 0.00 ? 67  THR A HG22 1  
ATOM 993   H HG23 . THR A 1 67  ? 9.979   3.617   -0.314  1.00 0.00 ? 67  THR A HG23 1  
ATOM 994   N N    . ILE A 1 68  ? 10.284  3.621   -4.542  1.00 0.00 ? 68  ILE A N    1  
ATOM 995   C CA   . ILE A 1 68  ? 10.792  4.362   -5.691  1.00 0.00 ? 68  ILE A CA   1  
ATOM 996   C C    . ILE A 1 68  ? 11.099  5.809   -5.320  1.00 0.00 ? 68  ILE A C    1  
ATOM 997   O O    . ILE A 1 68  ? 10.668  6.298   -4.276  1.00 0.00 ? 68  ILE A O    1  
ATOM 998   C CB   . ILE A 1 68  ? 9.788   4.345   -6.859  1.00 0.00 ? 68  ILE A CB   1  
ATOM 999   C CG1  . ILE A 1 68  ? 9.158   2.957   -6.999  1.00 0.00 ? 68  ILE A CG1  1  
ATOM 1000  C CG2  . ILE A 1 68  ? 10.476  4.752   -8.154  1.00 0.00 ? 68  ILE A CG2  1  
ATOM 1001  C CD1  . ILE A 1 68  ? 10.132  1.894   -7.457  1.00 0.00 ? 68  ILE A CD1  1  
ATOM 1002  H H    . ILE A 1 68  ? 9.513   3.972   -4.050  1.00 0.00 ? 68  ILE A H    1  
ATOM 1003  H HA   . ILE A 1 68  ? 11.704  3.884   -6.019  1.00 0.00 ? 68  ILE A HA   1  
ATOM 1004  H HB   . ILE A 1 68  ? 9.013   5.065   -6.649  1.00 0.00 ? 68  ILE A HB   1  
ATOM 1005  H HG12 . ILE A 1 68  ? 8.760   2.652   -6.044  1.00 0.00 ? 68  ILE A HG12 1  
ATOM 1006  H HG13 . ILE A 1 68  ? 8.355   3.006   -7.720  1.00 0.00 ? 68  ILE A HG13 1  
ATOM 1007  H HG21 . ILE A 1 68  ? 11.465  4.319   -8.188  1.00 0.00 ? 68  ILE A HG21 1  
ATOM 1008  H HG22 . ILE A 1 68  ? 9.899   4.398   -8.995  1.00 0.00 ? 68  ILE A HG22 1  
ATOM 1009  H HG23 . ILE A 1 68  ? 10.553  5.828   -8.197  1.00 0.00 ? 68  ILE A HG23 1  
ATOM 1010  H HD11 . ILE A 1 68  ? 11.061  2.000   -6.916  1.00 0.00 ? 68  ILE A HD11 1  
ATOM 1011  H HD12 . ILE A 1 68  ? 9.714   0.917   -7.269  1.00 0.00 ? 68  ILE A HD12 1  
ATOM 1012  H HD13 . ILE A 1 68  ? 10.318  2.009   -8.515  1.00 0.00 ? 68  ILE A HD13 1  
ATOM 1013  N N    . SER A 1 69  ? 11.845  6.490   -6.184  1.00 0.00 ? 69  SER A N    1  
ATOM 1014  C CA   . SER A 1 69  ? 12.212  7.881   -5.947  1.00 0.00 ? 69  SER A CA   1  
ATOM 1015  C C    . SER A 1 69  ? 11.773  8.764   -7.111  1.00 0.00 ? 69  SER A C    1  
ATOM 1016  O O    . SER A 1 69  ? 12.262  8.623   -8.233  1.00 0.00 ? 69  SER A O    1  
ATOM 1017  C CB   . SER A 1 69  ? 13.722  8.004   -5.740  1.00 0.00 ? 69  SER A CB   1  
ATOM 1018  O OG   . SER A 1 69  ? 14.432  7.543   -6.877  1.00 0.00 ? 69  SER A OG   1  
ATOM 1019  H H    . SER A 1 69  ? 12.158  6.044   -6.999  1.00 0.00 ? 69  SER A H    1  
ATOM 1020  H HA   . SER A 1 69  ? 11.706  8.209   -5.051  1.00 0.00 ? 69  SER A HA   1  
ATOM 1021  H HB2  . SER A 1 69  ? 13.976  9.039   -5.567  1.00 0.00 ? 69  SER A HB2  1  
ATOM 1022  H HB3  . SER A 1 69  ? 14.015  7.414   -4.884  1.00 0.00 ? 69  SER A HB3  1  
ATOM 1023  H HG   . SER A 1 69  ? 15.332  7.322   -6.625  1.00 0.00 ? 69  SER A HG   1  
ATOM 1024  N N    . THR A 1 70  ? 10.845  9.676   -6.837  1.00 0.00 ? 70  THR A N    1  
ATOM 1025  C CA   . THR A 1 70  ? 10.338  10.582  -7.860  1.00 0.00 ? 70  THR A CA   1  
ATOM 1026  C C    . THR A 1 70  ? 10.671  12.032  -7.524  1.00 0.00 ? 70  THR A C    1  
ATOM 1027  O O    . THR A 1 70  ? 10.784  12.397  -6.355  1.00 0.00 ? 70  THR A O    1  
ATOM 1028  C CB   . THR A 1 70  ? 8.814   10.443  -8.028  1.00 0.00 ? 70  THR A CB   1  
ATOM 1029  O OG1  . THR A 1 70  ? 8.156   10.724  -6.787  1.00 0.00 ? 70  THR A OG1  1  
ATOM 1030  C CG2  . THR A 1 70  ? 8.446   9.044   -8.497  1.00 0.00 ? 70  THR A CG2  1  
ATOM 1031  H H    . THR A 1 70  ? 10.494  9.740   -5.925  1.00 0.00 ? 70  THR A H    1  
ATOM 1032  H HA   . THR A 1 70  ? 10.808  10.323  -8.798  1.00 0.00 ? 70  THR A HA   1  
ATOM 1033  H HB   . THR A 1 70  ? 8.482   11.155  -8.771  1.00 0.00 ? 70  THR A HB   1  
ATOM 1034  H HG1  . THR A 1 70  ? 7.233   10.930  -6.953  1.00 0.00 ? 70  THR A HG1  1  
ATOM 1035  H HG21 . THR A 1 70  ? 8.376   8.385   -7.644  1.00 0.00 ? 70  THR A HG21 1  
ATOM 1036  H HG22 . THR A 1 70  ? 9.206   8.679   -9.172  1.00 0.00 ? 70  THR A HG22 1  
ATOM 1037  H HG23 . THR A 1 70  ? 7.495   9.074   -9.007  1.00 0.00 ? 70  THR A HG23 1  
ATOM 1038  N N    . GLU A 1 71  ? 10.827  12.853  -8.558  1.00 0.00 ? 71  GLU A N    1  
ATOM 1039  C CA   . GLU A 1 71  ? 11.147  14.263  -8.371  1.00 0.00 ? 71  GLU A CA   1  
ATOM 1040  C C    . GLU A 1 71  ? 10.331  14.859  -7.227  1.00 0.00 ? 71  GLU A C    1  
ATOM 1041  O O    . GLU A 1 71  ? 10.856  15.606  -6.401  1.00 0.00 ? 71  GLU A O    1  
ATOM 1042  C CB   . GLU A 1 71  ? 10.884  15.044  -9.660  1.00 0.00 ? 71  GLU A CB   1  
ATOM 1043  C CG   . GLU A 1 71  ? 9.451   14.939  -10.154 1.00 0.00 ? 71  GLU A CG   1  
ATOM 1044  C CD   . GLU A 1 71  ? 9.283   15.458  -11.569 1.00 0.00 ? 71  GLU A CD   1  
ATOM 1045  O OE1  . GLU A 1 71  ? 9.041   16.672  -11.731 1.00 0.00 ? 71  GLU A OE1  1  
ATOM 1046  O OE2  . GLU A 1 71  ? 9.393   14.649  -12.514 1.00 0.00 ? 71  GLU A OE2  1  
ATOM 1047  H H    . GLU A 1 71  ? 10.724  12.502  -9.467  1.00 0.00 ? 71  GLU A H    1  
ATOM 1048  H HA   . GLU A 1 71  ? 12.196  14.335  -8.125  1.00 0.00 ? 71  GLU A HA   1  
ATOM 1049  H HB2  . GLU A 1 71  ? 11.109  16.087  -9.488  1.00 0.00 ? 71  GLU A HB2  1  
ATOM 1050  H HB3  . GLU A 1 71  ? 11.538  14.668  -10.434 1.00 0.00 ? 71  GLU A HB3  1  
ATOM 1051  H HG2  . GLU A 1 71  ? 9.150   13.903  -10.129 1.00 0.00 ? 71  GLU A HG2  1  
ATOM 1052  H HG3  . GLU A 1 71  ? 8.815   15.514  -9.497  1.00 0.00 ? 71  GLU A HG3  1  
ATOM 1053  N N    . GLU A 1 72  ? 9.046   14.524  -7.187  1.00 0.00 ? 72  GLU A N    1  
ATOM 1054  C CA   . GLU A 1 72  ? 8.157   15.027  -6.146  1.00 0.00 ? 72  GLU A CA   1  
ATOM 1055  C C    . GLU A 1 72  ? 8.552   14.474  -4.780  1.00 0.00 ? 72  GLU A C    1  
ATOM 1056  O O    . GLU A 1 72  ? 8.410   15.148  -3.761  1.00 0.00 ? 72  GLU A O    1  
ATOM 1057  C CB   . GLU A 1 72  ? 6.706   14.655  -6.459  1.00 0.00 ? 72  GLU A CB   1  
ATOM 1058  C CG   . GLU A 1 72  ? 6.206   15.215  -7.780  1.00 0.00 ? 72  GLU A CG   1  
ATOM 1059  C CD   . GLU A 1 72  ? 4.712   15.476  -7.775  1.00 0.00 ? 72  GLU A CD   1  
ATOM 1060  O OE1  . GLU A 1 72  ? 3.939   14.499  -7.705  1.00 0.00 ? 72  GLU A OE1  1  
ATOM 1061  O OE2  . GLU A 1 72  ? 4.318   16.659  -7.841  1.00 0.00 ? 72  GLU A OE2  1  
ATOM 1062  H H    . GLU A 1 72  ? 8.686   13.924  -7.874  1.00 0.00 ? 72  GLU A H    1  
ATOM 1063  H HA   . GLU A 1 72  ? 8.247   16.102  -6.125  1.00 0.00 ? 72  GLU A HA   1  
ATOM 1064  H HB2  . GLU A 1 72  ? 6.622   13.579  -6.493  1.00 0.00 ? 72  GLU A HB2  1  
ATOM 1065  H HB3  . GLU A 1 72  ? 6.073   15.032  -5.670  1.00 0.00 ? 72  GLU A HB3  1  
ATOM 1066  H HG2  . GLU A 1 72  ? 6.718   16.145  -7.980  1.00 0.00 ? 72  GLU A HG2  1  
ATOM 1067  H HG3  . GLU A 1 72  ? 6.430   14.507  -8.565  1.00 0.00 ? 72  GLU A HG3  1  
ATOM 1068  N N    . GLY A 1 73  ? 9.048   13.240  -4.768  1.00 0.00 ? 73  GLY A N    1  
ATOM 1069  C CA   . GLY A 1 73  ? 9.455   12.616  -3.523  1.00 0.00 ? 73  GLY A CA   1  
ATOM 1070  C C    . GLY A 1 73  ? 9.768   11.142  -3.688  1.00 0.00 ? 73  GLY A C    1  
ATOM 1071  O O    . GLY A 1 73  ? 10.831  10.778  -4.192  1.00 0.00 ? 73  GLY A O    1  
ATOM 1072  H H    . GLY A 1 73  ? 9.138   12.750  -5.612  1.00 0.00 ? 73  GLY A H    1  
ATOM 1073  H HA2  . GLY A 1 73  ? 10.334  13.121  -3.150  1.00 0.00 ? 73  GLY A HA2  1  
ATOM 1074  H HA3  . GLY A 1 73  ? 8.658   12.723  -2.802  1.00 0.00 ? 73  GLY A HA3  1  
ATOM 1075  N N    . VAL A 1 74  ? 8.842   10.290  -3.262  1.00 0.00 ? 74  VAL A N    1  
ATOM 1076  C CA   . VAL A 1 74  ? 9.025   8.847   -3.364  1.00 0.00 ? 74  VAL A CA   1  
ATOM 1077  C C    . VAL A 1 74  ? 7.691   8.137   -3.568  1.00 0.00 ? 74  VAL A C    1  
ATOM 1078  O O    . VAL A 1 74  ? 6.627   8.740   -3.421  1.00 0.00 ? 74  VAL A O    1  
ATOM 1079  C CB   . VAL A 1 74  ? 9.710   8.277   -2.108  1.00 0.00 ? 74  VAL A CB   1  
ATOM 1080  C CG1  . VAL A 1 74  ? 11.205  8.557   -2.142  1.00 0.00 ? 74  VAL A CG1  1  
ATOM 1081  C CG2  . VAL A 1 74  ? 9.080   8.854   -0.850  1.00 0.00 ? 74  VAL A CG2  1  
ATOM 1082  H H    . VAL A 1 74  ? 8.015   10.640  -2.869  1.00 0.00 ? 74  VAL A H    1  
ATOM 1083  H HA   . VAL A 1 74  ? 9.660   8.651   -4.216  1.00 0.00 ? 74  VAL A HA   1  
ATOM 1084  H HB   . VAL A 1 74  ? 9.567   7.207   -2.099  1.00 0.00 ? 74  VAL A HB   1  
ATOM 1085  H HG11 . VAL A 1 74  ? 11.370  9.624   -2.173  1.00 0.00 ? 74  VAL A HG11 1  
ATOM 1086  H HG12 . VAL A 1 74  ? 11.668  8.145   -1.258  1.00 0.00 ? 74  VAL A HG12 1  
ATOM 1087  H HG13 . VAL A 1 74  ? 11.636  8.101   -3.021  1.00 0.00 ? 74  VAL A HG13 1  
ATOM 1088  H HG21 . VAL A 1 74  ? 8.386   9.636   -1.121  1.00 0.00 ? 74  VAL A HG21 1  
ATOM 1089  H HG22 . VAL A 1 74  ? 8.552   8.074   -0.320  1.00 0.00 ? 74  VAL A HG22 1  
ATOM 1090  H HG23 . VAL A 1 74  ? 9.851   9.262   -0.214  1.00 0.00 ? 74  VAL A HG23 1  
ATOM 1091  N N    . ILE A 1 75  ? 7.755   6.854   -3.907  1.00 0.00 ? 75  ILE A N    1  
ATOM 1092  C CA   . ILE A 1 75  ? 6.552   6.062   -4.129  1.00 0.00 ? 75  ILE A CA   1  
ATOM 1093  C C    . ILE A 1 75  ? 6.777   4.603   -3.747  1.00 0.00 ? 75  ILE A C    1  
ATOM 1094  O O    . ILE A 1 75  ? 7.584   3.906   -4.362  1.00 0.00 ? 75  ILE A O    1  
ATOM 1095  C CB   . ILE A 1 75  ? 6.096   6.131   -5.599  1.00 0.00 ? 75  ILE A CB   1  
ATOM 1096  C CG1  . ILE A 1 75  ? 5.729   7.568   -5.974  1.00 0.00 ? 75  ILE A CG1  1  
ATOM 1097  C CG2  . ILE A 1 75  ? 4.917   5.199   -5.832  1.00 0.00 ? 75  ILE A CG2  1  
ATOM 1098  C CD1  . ILE A 1 75  ? 5.125   7.696   -7.355  1.00 0.00 ? 75  ILE A CD1  1  
ATOM 1099  H H    . ILE A 1 75  ? 8.633   6.430   -4.009  1.00 0.00 ? 75  ILE A H    1  
ATOM 1100  H HA   . ILE A 1 75  ? 5.766   6.469   -3.510  1.00 0.00 ? 75  ILE A HA   1  
ATOM 1101  H HB   . ILE A 1 75  ? 6.914   5.802   -6.222  1.00 0.00 ? 75  ILE A HB   1  
ATOM 1102  H HG12 . ILE A 1 75  ? 5.012   7.947   -5.263  1.00 0.00 ? 75  ILE A HG12 1  
ATOM 1103  H HG13 . ILE A 1 75  ? 6.619   8.179   -5.942  1.00 0.00 ? 75  ILE A HG13 1  
ATOM 1104  H HG21 . ILE A 1 75  ? 4.026   5.631   -5.402  1.00 0.00 ? 75  ILE A HG21 1  
ATOM 1105  H HG22 . ILE A 1 75  ? 4.773   5.060   -6.893  1.00 0.00 ? 75  ILE A HG22 1  
ATOM 1106  H HG23 . ILE A 1 75  ? 5.115   4.245   -5.367  1.00 0.00 ? 75  ILE A HG23 1  
ATOM 1107  H HD11 . ILE A 1 75  ? 4.731   8.693   -7.485  1.00 0.00 ? 75  ILE A HD11 1  
ATOM 1108  H HD12 . ILE A 1 75  ? 5.884   7.508   -8.100  1.00 0.00 ? 75  ILE A HD12 1  
ATOM 1109  H HD13 . ILE A 1 75  ? 4.326   6.977   -7.467  1.00 0.00 ? 75  ILE A HD13 1  
ATOM 1110  N N    . SER A 1 76  ? 6.055   4.146   -2.728  1.00 0.00 ? 76  SER A N    1  
ATOM 1111  C CA   . SER A 1 76  ? 6.177   2.770   -2.261  1.00 0.00 ? 76  SER A CA   1  
ATOM 1112  C C    . SER A 1 76  ? 5.089   1.892   -2.872  1.00 0.00 ? 76  SER A C    1  
ATOM 1113  O O    . SER A 1 76  ? 3.908   2.033   -2.554  1.00 0.00 ? 76  SER A O    1  
ATOM 1114  C CB   . SER A 1 76  ? 6.093   2.718   -0.734  1.00 0.00 ? 76  SER A CB   1  
ATOM 1115  O OG   . SER A 1 76  ? 6.609   1.496   -0.237  1.00 0.00 ? 76  SER A OG   1  
ATOM 1116  H H    . SER A 1 76  ? 5.429   4.751   -2.278  1.00 0.00 ? 76  SER A H    1  
ATOM 1117  H HA   . SER A 1 76  ? 7.141   2.398   -2.573  1.00 0.00 ? 76  SER A HA   1  
ATOM 1118  H HB2  . SER A 1 76  ? 6.664   3.533   -0.317  1.00 0.00 ? 76  SER A HB2  1  
ATOM 1119  H HB3  . SER A 1 76  ? 5.060   2.809   -0.430  1.00 0.00 ? 76  SER A HB3  1  
ATOM 1120  H HG   . SER A 1 76  ? 7.219   1.675   0.482   1.00 0.00 ? 76  SER A HG   1  
ATOM 1121  N N    . THR A 1 77  ? 5.496   0.983   -3.753  1.00 0.00 ? 77  THR A N    1  
ATOM 1122  C CA   . THR A 1 77  ? 4.559   0.082   -4.411  1.00 0.00 ? 77  THR A CA   1  
ATOM 1123  C C    . THR A 1 77  ? 4.629   -1.318  -3.811  1.00 0.00 ? 77  THR A C    1  
ATOM 1124  O O    . THR A 1 77  ? 5.713   -1.878  -3.642  1.00 0.00 ? 77  THR A O    1  
ATOM 1125  C CB   . THR A 1 77  ? 4.831   -0.006  -5.924  1.00 0.00 ? 77  THR A CB   1  
ATOM 1126  O OG1  . THR A 1 77  ? 5.210   1.279   -6.429  1.00 0.00 ? 77  THR A OG1  1  
ATOM 1127  C CG2  . THR A 1 77  ? 3.601   -0.506  -6.667  1.00 0.00 ? 77  THR A CG2  1  
ATOM 1128  H H    . THR A 1 77  ? 6.451   0.919   -3.966  1.00 0.00 ? 77  THR A H    1  
ATOM 1129  H HA   . THR A 1 77  ? 3.562   0.475   -4.268  1.00 0.00 ? 77  THR A HA   1  
ATOM 1130  H HB   . THR A 1 77  ? 5.641   -0.702  -6.089  1.00 0.00 ? 77  THR A HB   1  
ATOM 1131  H HG1  . THR A 1 77  ? 4.668   1.957   -6.018  1.00 0.00 ? 77  THR A HG1  1  
ATOM 1132  H HG21 . THR A 1 77  ? 3.857   -1.390  -7.232  1.00 0.00 ? 77  THR A HG21 1  
ATOM 1133  H HG22 . THR A 1 77  ? 3.250   0.262   -7.340  1.00 0.00 ? 77  THR A HG22 1  
ATOM 1134  H HG23 . THR A 1 77  ? 2.825   -0.745  -5.957  1.00 0.00 ? 77  THR A HG23 1  
ATOM 1135  N N    . LEU A 1 78  ? 3.468   -1.879  -3.492  1.00 0.00 ? 78  LEU A N    1  
ATOM 1136  C CA   . LEU A 1 78  ? 3.398   -3.215  -2.911  1.00 0.00 ? 78  LEU A CA   1  
ATOM 1137  C C    . LEU A 1 78  ? 2.595   -4.155  -3.804  1.00 0.00 ? 78  LEU A C    1  
ATOM 1138  O O    . LEU A 1 78  ? 1.396   -3.962  -4.009  1.00 0.00 ? 78  LEU A O    1  
ATOM 1139  C CB   . LEU A 1 78  ? 2.769   -3.155  -1.518  1.00 0.00 ? 78  LEU A CB   1  
ATOM 1140  C CG   . LEU A 1 78  ? 2.145   -4.454  -1.007  1.00 0.00 ? 78  LEU A CG   1  
ATOM 1141  C CD1  . LEU A 1 78  ? 3.226   -5.470  -0.672  1.00 0.00 ? 78  LEU A CD1  1  
ATOM 1142  C CD2  . LEU A 1 78  ? 1.270   -4.183  0.209   1.00 0.00 ? 78  LEU A CD2  1  
ATOM 1143  H H    . LEU A 1 78  ? 2.638   -1.383  -3.650  1.00 0.00 ? 78  LEU A H    1  
ATOM 1144  H HA   . LEU A 1 78  ? 4.406   -3.593  -2.826  1.00 0.00 ? 78  LEU A HA   1  
ATOM 1145  H HB2  . LEU A 1 78  ? 3.539   -2.862  -0.821  1.00 0.00 ? 78  LEU A HB2  1  
ATOM 1146  H HB3  . LEU A 1 78  ? 1.996   -2.400  -1.537  1.00 0.00 ? 78  LEU A HB3  1  
ATOM 1147  H HG   . LEU A 1 78  ? 1.520   -4.875  -1.782  1.00 0.00 ? 78  LEU A HG   1  
ATOM 1148  H HD11 . LEU A 1 78  ? 2.800   -6.462  -0.672  1.00 0.00 ? 78  LEU A HD11 1  
ATOM 1149  H HD12 . LEU A 1 78  ? 3.634   -5.254  0.304   1.00 0.00 ? 78  LEU A HD12 1  
ATOM 1150  H HD13 . LEU A 1 78  ? 4.012   -5.416  -1.411  1.00 0.00 ? 78  LEU A HD13 1  
ATOM 1151  H HD21 . LEU A 1 78  ? 1.795   -4.485  1.103   1.00 0.00 ? 78  LEU A HD21 1  
ATOM 1152  H HD22 . LEU A 1 78  ? 0.352   -4.745  0.123   1.00 0.00 ? 78  LEU A HD22 1  
ATOM 1153  H HD23 . LEU A 1 78  ? 1.044   -3.128  0.261   1.00 0.00 ? 78  LEU A HD23 1  
ATOM 1154  N N    . THR A 1 79  ? 3.263   -5.176  -4.333  1.00 0.00 ? 79  THR A N    1  
ATOM 1155  C CA   . THR A 1 79  ? 2.611   -6.147  -5.203  1.00 0.00 ? 79  THR A CA   1  
ATOM 1156  C C    . THR A 1 79  ? 2.199   -7.392  -4.425  1.00 0.00 ? 79  THR A C    1  
ATOM 1157  O O    . THR A 1 79  ? 2.826   -7.747  -3.427  1.00 0.00 ? 79  THR A O    1  
ATOM 1158  C CB   . THR A 1 79  ? 3.530   -6.564  -6.367  1.00 0.00 ? 79  THR A CB   1  
ATOM 1159  O OG1  . THR A 1 79  ? 4.217   -5.418  -6.882  1.00 0.00 ? 79  THR A OG1  1  
ATOM 1160  C CG2  . THR A 1 79  ? 2.729   -7.224  -7.479  1.00 0.00 ? 79  THR A CG2  1  
ATOM 1161  H H    . THR A 1 79  ? 4.217   -5.277  -4.132  1.00 0.00 ? 79  THR A H    1  
ATOM 1162  H HA   . THR A 1 79  ? 1.728   -5.684  -5.617  1.00 0.00 ? 79  THR A HA   1  
ATOM 1163  H HB   . THR A 1 79  ? 4.256   -7.273  -5.996  1.00 0.00 ? 79  THR A HB   1  
ATOM 1164  H HG1  . THR A 1 79  ? 3.605   -4.879  -7.389  1.00 0.00 ? 79  THR A HG1  1  
ATOM 1165  H HG21 . THR A 1 79  ? 2.513   -8.247  -7.209  1.00 0.00 ? 79  THR A HG21 1  
ATOM 1166  H HG22 . THR A 1 79  ? 3.301   -7.206  -8.394  1.00 0.00 ? 79  THR A HG22 1  
ATOM 1167  H HG23 . THR A 1 79  ? 1.803   -6.687  -7.622  1.00 0.00 ? 79  THR A HG23 1  
ATOM 1168  N N    . ILE A 1 80  ? 1.143   -8.051  -4.890  1.00 0.00 ? 80  ILE A N    1  
ATOM 1169  C CA   . ILE A 1 80  ? 0.649   -9.258  -4.238  1.00 0.00 ? 80  ILE A CA   1  
ATOM 1170  C C    . ILE A 1 80  ? 0.567   -10.420 -5.222  1.00 0.00 ? 80  ILE A C    1  
ATOM 1171  O O    . ILE A 1 80  ? -0.398  -10.541 -5.976  1.00 0.00 ? 80  ILE A O    1  
ATOM 1172  C CB   . ILE A 1 80  ? -0.740  -9.031  -3.612  1.00 0.00 ? 80  ILE A CB   1  
ATOM 1173  C CG1  . ILE A 1 80  ? -0.729  -7.779  -2.733  1.00 0.00 ? 80  ILE A CG1  1  
ATOM 1174  C CG2  . ILE A 1 80  ? -1.161  -10.249 -2.803  1.00 0.00 ? 80  ILE A CG2  1  
ATOM 1175  C CD1  . ILE A 1 80  ? -2.085  -7.122  -2.601  1.00 0.00 ? 80  ILE A CD1  1  
ATOM 1176  H H    . ILE A 1 80  ? 0.686   -7.718  -5.690  1.00 0.00 ? 80  ILE A H    1  
ATOM 1177  H HA   . ILE A 1 80  ? 1.340   -9.517  -3.449  1.00 0.00 ? 80  ILE A HA   1  
ATOM 1178  H HB   . ILE A 1 80  ? -1.453  -8.896  -4.411  1.00 0.00 ? 80  ILE A HB   1  
ATOM 1179  H HG12 . ILE A 1 80  ? -0.392  -8.044  -1.744  1.00 0.00 ? 80  ILE A HG12 1  
ATOM 1180  H HG13 . ILE A 1 80  ? -0.049  -7.055  -3.159  1.00 0.00 ? 80  ILE A HG13 1  
ATOM 1181  H HG21 . ILE A 1 80  ? -1.827  -9.941  -2.010  1.00 0.00 ? 80  ILE A HG21 1  
ATOM 1182  H HG22 . ILE A 1 80  ? -1.670  -10.950 -3.448  1.00 0.00 ? 80  ILE A HG22 1  
ATOM 1183  H HG23 . ILE A 1 80  ? -0.288  -10.718 -2.377  1.00 0.00 ? 80  ILE A HG23 1  
ATOM 1184  H HD11 . ILE A 1 80  ? -1.960  -6.054  -2.500  1.00 0.00 ? 80  ILE A HD11 1  
ATOM 1185  H HD12 . ILE A 1 80  ? -2.676  -7.334  -3.479  1.00 0.00 ? 80  ILE A HD12 1  
ATOM 1186  H HD13 . ILE A 1 80  ? -2.588  -7.508  -1.726  1.00 0.00 ? 80  ILE A HD13 1  
ATOM 1187  N N    . SER A 1 81  ? 1.586   -11.273 -5.208  1.00 0.00 ? 81  SER A N    1  
ATOM 1188  C CA   . SER A 1 81  ? 1.631   -12.425 -6.101  1.00 0.00 ? 81  SER A CA   1  
ATOM 1189  C C    . SER A 1 81  ? 0.231   -12.986 -6.334  1.00 0.00 ? 81  SER A C    1  
ATOM 1190  O O    . SER A 1 81  ? -0.321  -12.871 -7.428  1.00 0.00 ? 81  SER A O    1  
ATOM 1191  C CB   . SER A 1 81  ? 2.538   -13.512 -5.520  1.00 0.00 ? 81  SER A CB   1  
ATOM 1192  O OG   . SER A 1 81  ? 2.643   -14.614 -6.404  1.00 0.00 ? 81  SER A OG   1  
ATOM 1193  H H    . SER A 1 81  ? 2.327   -11.122 -4.584  1.00 0.00 ? 81  SER A H    1  
ATOM 1194  H HA   . SER A 1 81  ? 2.036   -12.097 -7.046  1.00 0.00 ? 81  SER A HA   1  
ATOM 1195  H HB2  . SER A 1 81  ? 3.523   -13.104 -5.355  1.00 0.00 ? 81  SER A HB2  1  
ATOM 1196  H HB3  . SER A 1 81  ? 2.128   -13.856 -4.582  1.00 0.00 ? 81  SER A HB3  1  
ATOM 1197  H HG   . SER A 1 81  ? 2.542   -14.310 -7.309  1.00 0.00 ? 81  SER A HG   1  
ATOM 1198  N N    . ASN A 1 82  ? -0.336  -13.594 -5.297  1.00 0.00 ? 82  ASN A N    1  
ATOM 1199  C CA   . ASN A 1 82  ? -1.671  -14.174 -5.388  1.00 0.00 ? 82  ASN A CA   1  
ATOM 1200  C C    . ASN A 1 82  ? -2.602  -13.563 -4.345  1.00 0.00 ? 82  ASN A C    1  
ATOM 1201  O O    . ASN A 1 82  ? -2.721  -14.073 -3.230  1.00 0.00 ? 82  ASN A O    1  
ATOM 1202  C CB   . ASN A 1 82  ? -1.605  -15.691 -5.203  1.00 0.00 ? 82  ASN A CB   1  
ATOM 1203  C CG   . ASN A 1 82  ? -1.268  -16.417 -6.491  1.00 0.00 ? 82  ASN A CG   1  
ATOM 1204  O OD1  . ASN A 1 82  ? -2.157  -16.792 -7.256  1.00 0.00 ? 82  ASN A OD1  1  
ATOM 1205  N ND2  . ASN A 1 82  ? 0.021   -16.619 -6.737  1.00 0.00 ? 82  ASN A ND2  1  
ATOM 1206  H H    . ASN A 1 82  ? 0.154   -13.654 -4.451  1.00 0.00 ? 82  ASN A H    1  
ATOM 1207  H HA   . ASN A 1 82  ? -2.060  -13.957 -6.372  1.00 0.00 ? 82  ASN A HA   1  
ATOM 1208  H HB2  . ASN A 1 82  ? -0.844  -15.925 -4.472  1.00 0.00 ? 82  ASN A HB2  1  
ATOM 1209  H HB3  . ASN A 1 82  ? -2.560  -16.047 -4.849  1.00 0.00 ? 82  ASN A HB3  1  
ATOM 1210  H HD21 . ASN A 1 82  ? 0.674   -16.293 -6.083  1.00 0.00 ? 82  ASN A HD21 1  
ATOM 1211  H HD22 . ASN A 1 82  ? 0.266   -17.085 -7.563  1.00 0.00 ? 82  ASN A HD22 1  
ATOM 1212  N N    . ILE A 1 83  ? -3.260  -12.470 -4.715  1.00 0.00 ? 83  ILE A N    1  
ATOM 1213  C CA   . ILE A 1 83  ? -4.182  -11.791 -3.812  1.00 0.00 ? 83  ILE A CA   1  
ATOM 1214  C C    . ILE A 1 83  ? -5.475  -12.583 -3.649  1.00 0.00 ? 83  ILE A C    1  
ATOM 1215  O O    . ILE A 1 83  ? -5.920  -13.262 -4.574  1.00 0.00 ? 83  ILE A O    1  
ATOM 1216  C CB   . ILE A 1 83  ? -4.520  -10.375 -4.313  1.00 0.00 ? 83  ILE A CB   1  
ATOM 1217  C CG1  . ILE A 1 83  ? -4.990  -9.498  -3.150  1.00 0.00 ? 83  ILE A CG1  1  
ATOM 1218  C CG2  . ILE A 1 83  ? -5.582  -10.436 -5.400  1.00 0.00 ? 83  ILE A CG2  1  
ATOM 1219  C CD1  . ILE A 1 83  ? -5.211  -8.052  -3.535  1.00 0.00 ? 83  ILE A CD1  1  
ATOM 1220  H H    . ILE A 1 83  ? -3.124  -12.112 -5.616  1.00 0.00 ? 83  ILE A H    1  
ATOM 1221  H HA   . ILE A 1 83  ? -3.701  -11.705 -2.848  1.00 0.00 ? 83  ILE A HA   1  
ATOM 1222  H HB   . ILE A 1 83  ? -3.626  -9.945  -4.740  1.00 0.00 ? 83  ILE A HB   1  
ATOM 1223  H HG12 . ILE A 1 83  ? -5.922  -9.885  -2.770  1.00 0.00 ? 83  ILE A HG12 1  
ATOM 1224  H HG13 . ILE A 1 83  ? -4.247  -9.524  -2.366  1.00 0.00 ? 83  ILE A HG13 1  
ATOM 1225  H HG21 . ILE A 1 83  ? -5.370  -9.692  -6.153  1.00 0.00 ? 83  ILE A HG21 1  
ATOM 1226  H HG22 . ILE A 1 83  ? -5.575  -11.417 -5.853  1.00 0.00 ? 83  ILE A HG22 1  
ATOM 1227  H HG23 . ILE A 1 83  ? -6.552  -10.245 -4.968  1.00 0.00 ? 83  ILE A HG23 1  
ATOM 1228  H HD11 . ILE A 1 83  ? -6.268  -7.867  -3.651  1.00 0.00 ? 83  ILE A HD11 1  
ATOM 1229  H HD12 . ILE A 1 83  ? -4.815  -7.409  -2.764  1.00 0.00 ? 83  ILE A HD12 1  
ATOM 1230  H HD13 . ILE A 1 83  ? -4.706  -7.847  -4.469  1.00 0.00 ? 83  ILE A HD13 1  
ATOM 1231  N N    . VAL A 1 84  ? -6.075  -12.488 -2.467  1.00 0.00 ? 84  VAL A N    1  
ATOM 1232  C CA   . VAL A 1 84  ? -7.319  -13.193 -2.183  1.00 0.00 ? 84  VAL A CA   1  
ATOM 1233  C C    . VAL A 1 84  ? -8.334  -12.270 -1.516  1.00 0.00 ? 84  VAL A C    1  
ATOM 1234  O O    . VAL A 1 84  ? -7.988  -11.185 -1.049  1.00 0.00 ? 84  VAL A O    1  
ATOM 1235  C CB   . VAL A 1 84  ? -7.078  -14.414 -1.275  1.00 0.00 ? 84  VAL A CB   1  
ATOM 1236  C CG1  . VAL A 1 84  ? -6.196  -15.435 -1.977  1.00 0.00 ? 84  VAL A CG1  1  
ATOM 1237  C CG2  . VAL A 1 84  ? -6.460  -13.982 0.046   1.00 0.00 ? 84  VAL A CG2  1  
ATOM 1238  H H    . VAL A 1 84  ? -5.671  -11.931 -1.769  1.00 0.00 ? 84  VAL A H    1  
ATOM 1239  H HA   . VAL A 1 84  ? -7.727  -13.543 -3.120  1.00 0.00 ? 84  VAL A HA   1  
ATOM 1240  H HB   . VAL A 1 84  ? -8.032  -14.877 -1.068  1.00 0.00 ? 84  VAL A HB   1  
ATOM 1241  H HG11 . VAL A 1 84  ? -6.325  -15.348 -3.046  1.00 0.00 ? 84  VAL A HG11 1  
ATOM 1242  H HG12 . VAL A 1 84  ? -5.163  -15.255 -1.721  1.00 0.00 ? 84  VAL A HG12 1  
ATOM 1243  H HG13 . VAL A 1 84  ? -6.477  -16.430 -1.662  1.00 0.00 ? 84  VAL A HG13 1  
ATOM 1244  H HG21 . VAL A 1 84  ? -5.420  -13.738 -0.107  1.00 0.00 ? 84  VAL A HG21 1  
ATOM 1245  H HG22 . VAL A 1 84  ? -6.982  -13.113 0.421   1.00 0.00 ? 84  VAL A HG22 1  
ATOM 1246  H HG23 . VAL A 1 84  ? -6.541  -14.786 0.762   1.00 0.00 ? 84  VAL A HG23 1  
ATOM 1247  N N    . ARG A 1 85  ? -9.587  -12.709 -1.475  1.00 0.00 ? 85  ARG A N    1  
ATOM 1248  C CA   . ARG A 1 85  ? -10.653 -11.922 -0.866  1.00 0.00 ? 85  ARG A CA   1  
ATOM 1249  C C    . ARG A 1 85  ? -10.181 -11.284 0.437   1.00 0.00 ? 85  ARG A C    1  
ATOM 1250  O O    . ARG A 1 85  ? -10.506 -10.134 0.730   1.00 0.00 ? 85  ARG A O    1  
ATOM 1251  C CB   . ARG A 1 85  ? -11.877 -12.801 -0.602  1.00 0.00 ? 85  ARG A CB   1  
ATOM 1252  C CG   . ARG A 1 85  ? -12.808 -12.924 -1.797  1.00 0.00 ? 85  ARG A CG   1  
ATOM 1253  C CD   . ARG A 1 85  ? -13.758 -14.101 -1.645  1.00 0.00 ? 85  ARG A CD   1  
ATOM 1254  N NE   . ARG A 1 85  ? -14.626 -14.259 -2.809  1.00 0.00 ? 85  ARG A NE   1  
ATOM 1255  C CZ   . ARG A 1 85  ? -15.455 -15.283 -2.974  1.00 0.00 ? 85  ARG A CZ   1  
ATOM 1256  N NH1  . ARG A 1 85  ? -15.529 -16.235 -2.055  1.00 0.00 ? 85  ARG A NH1  1  
ATOM 1257  N NH2  . ARG A 1 85  ? -16.213 -15.355 -4.061  1.00 0.00 ? 85  ARG A NH2  1  
ATOM 1258  H H    . ARG A 1 85  ? -9.801  -13.583 -1.865  1.00 0.00 ? 85  ARG A H    1  
ATOM 1259  H HA   . ARG A 1 85  ? -10.925 -11.140 -1.559  1.00 0.00 ? 85  ARG A HA   1  
ATOM 1260  H HB2  . ARG A 1 85  ? -11.543 -13.791 -0.330  1.00 0.00 ? 85  ARG A HB2  1  
ATOM 1261  H HB3  . ARG A 1 85  ? -12.436 -12.380 0.220   1.00 0.00 ? 85  ARG A HB3  1  
ATOM 1262  H HG2  . ARG A 1 85  ? -13.388 -12.017 -1.885  1.00 0.00 ? 85  ARG A HG2  1  
ATOM 1263  H HG3  . ARG A 1 85  ? -12.216 -13.062 -2.690  1.00 0.00 ? 85  ARG A HG3  1  
ATOM 1264  H HD2  . ARG A 1 85  ? -13.176 -15.002 -1.518  1.00 0.00 ? 85  ARG A HD2  1  
ATOM 1265  H HD3  . ARG A 1 85  ? -14.369 -13.942 -0.770  1.00 0.00 ? 85  ARG A HD3  1  
ATOM 1266  H HE   . ARG A 1 85  ? -14.587 -13.566 -3.501  1.00 0.00 ? 85  ARG A HE   1  
ATOM 1267  H HH11 . ARG A 1 85  ? -14.960 -16.182 -1.235  1.00 0.00 ? 85  ARG A HH11 1  
ATOM 1268  H HH12 . ARG A 1 85  ? -16.156 -17.005 -2.181  1.00 0.00 ? 85  ARG A HH12 1  
ATOM 1269  H HH21 . ARG A 1 85  ? -16.161 -14.639 -4.756  1.00 0.00 ? 85  ARG A HH21 1  
ATOM 1270  H HH22 . ARG A 1 85  ? -16.837 -16.126 -4.184  1.00 0.00 ? 85  ARG A HH22 1  
ATOM 1271  N N    . ALA A 1 86  ? -9.412  -12.039 1.215   1.00 0.00 ? 86  ALA A N    1  
ATOM 1272  C CA   . ALA A 1 86  ? -8.894  -11.547 2.486   1.00 0.00 ? 86  ALA A CA   1  
ATOM 1273  C C    . ALA A 1 86  ? -8.216  -10.192 2.314   1.00 0.00 ? 86  ALA A C    1  
ATOM 1274  O O    . ALA A 1 86  ? -8.387  -9.293  3.138   1.00 0.00 ? 86  ALA A O    1  
ATOM 1275  C CB   . ALA A 1 86  ? -7.923  -12.554 3.085   1.00 0.00 ? 86  ALA A CB   1  
ATOM 1276  H H    . ALA A 1 86  ? -9.187  -12.948 0.927   1.00 0.00 ? 86  ALA A H    1  
ATOM 1277  H HA   . ALA A 1 86  ? -9.727  -11.439 3.166   1.00 0.00 ? 86  ALA A HA   1  
ATOM 1278  H HB1  . ALA A 1 86  ? -6.937  -12.115 3.135   1.00 0.00 ? 86  ALA A HB1  1  
ATOM 1279  H HB2  . ALA A 1 86  ? -8.250  -12.822 4.078   1.00 0.00 ? 86  ALA A HB2  1  
ATOM 1280  H HB3  . ALA A 1 86  ? -7.892  -13.437 2.465   1.00 0.00 ? 86  ALA A HB3  1  
ATOM 1281  N N    . ASP A 1 87  ? -7.446  -10.053 1.241   1.00 0.00 ? 87  ASP A N    1  
ATOM 1282  C CA   . ASP A 1 87  ? -6.742  -8.807  0.962   1.00 0.00 ? 87  ASP A CA   1  
ATOM 1283  C C    . ASP A 1 87  ? -7.651  -7.605  1.196   1.00 0.00 ? 87  ASP A C    1  
ATOM 1284  O O    . ASP A 1 87  ? -7.264  -6.640  1.856   1.00 0.00 ? 87  ASP A O    1  
ATOM 1285  C CB   . ASP A 1 87  ? -6.227  -8.799  -0.479  1.00 0.00 ? 87  ASP A CB   1  
ATOM 1286  C CG   . ASP A 1 87  ? -7.243  -8.240  -1.454  1.00 0.00 ? 87  ASP A CG   1  
ATOM 1287  O OD1  . ASP A 1 87  ? -7.415  -7.003  -1.488  1.00 0.00 ? 87  ASP A OD1  1  
ATOM 1288  O OD2  . ASP A 1 87  ? -7.868  -9.038  -2.184  1.00 0.00 ? 87  ASP A OD2  1  
ATOM 1289  H H    . ASP A 1 87  ? -7.349  -10.806 0.621   1.00 0.00 ? 87  ASP A H    1  
ATOM 1290  H HA   . ASP A 1 87  ? -5.901  -8.743  1.635   1.00 0.00 ? 87  ASP A HA   1  
ATOM 1291  H HB2  . ASP A 1 87  ? -5.334  -8.194  -0.531  1.00 0.00 ? 87  ASP A HB2  1  
ATOM 1292  H HB3  . ASP A 1 87  ? -5.989  -9.810  -0.774  1.00 0.00 ? 87  ASP A HB3  1  
ATOM 1293  N N    . PHE A 1 88  ? -8.861  -7.669  0.650   1.00 0.00 ? 88  PHE A N    1  
ATOM 1294  C CA   . PHE A 1 88  ? -9.825  -6.585  0.798   1.00 0.00 ? 88  PHE A CA   1  
ATOM 1295  C C    . PHE A 1 88  ? -10.234 -6.416  2.258   1.00 0.00 ? 88  PHE A C    1  
ATOM 1296  O O    . PHE A 1 88  ? -10.326 -5.297  2.761   1.00 0.00 ? 88  PHE A O    1  
ATOM 1297  C CB   . PHE A 1 88  ? -11.062 -6.853  -0.062  1.00 0.00 ? 88  PHE A CB   1  
ATOM 1298  C CG   . PHE A 1 88  ? -10.742 -7.449  -1.403  1.00 0.00 ? 88  PHE A CG   1  
ATOM 1299  C CD1  . PHE A 1 88  ? -9.859  -6.817  -2.264  1.00 0.00 ? 88  PHE A CD1  1  
ATOM 1300  C CD2  . PHE A 1 88  ? -11.324 -8.641  -1.803  1.00 0.00 ? 88  PHE A CD2  1  
ATOM 1301  C CE1  . PHE A 1 88  ? -9.563  -7.363  -3.499  1.00 0.00 ? 88  PHE A CE1  1  
ATOM 1302  C CE2  . PHE A 1 88  ? -11.031 -9.192  -3.036  1.00 0.00 ? 88  PHE A CE2  1  
ATOM 1303  C CZ   . PHE A 1 88  ? -10.150 -8.551  -3.886  1.00 0.00 ? 88  PHE A CZ   1  
ATOM 1304  H H    . PHE A 1 88  ? -9.111  -8.464  0.134   1.00 0.00 ? 88  PHE A H    1  
ATOM 1305  H HA   . PHE A 1 88  ? -9.353  -5.675  0.461   1.00 0.00 ? 88  PHE A HA   1  
ATOM 1306  H HB2  . PHE A 1 88  ? -11.712 -7.540  0.459   1.00 0.00 ? 88  PHE A HB2  1  
ATOM 1307  H HB3  . PHE A 1 88  ? -11.585 -5.923  -0.227  1.00 0.00 ? 88  PHE A HB3  1  
ATOM 1308  H HD1  . PHE A 1 88  ? -9.399  -5.886  -1.963  1.00 0.00 ? 88  PHE A HD1  1  
ATOM 1309  H HD2  . PHE A 1 88  ? -12.014 -9.143  -1.140  1.00 0.00 ? 88  PHE A HD2  1  
ATOM 1310  H HE1  . PHE A 1 88  ? -8.873  -6.859  -4.161  1.00 0.00 ? 88  PHE A HE1  1  
ATOM 1311  H HE2  . PHE A 1 88  ? -11.491 -10.121 -3.336  1.00 0.00 ? 88  PHE A HE2  1  
ATOM 1312  H HZ   . PHE A 1 88  ? -9.919  -8.980  -4.850  1.00 0.00 ? 88  PHE A HZ   1  
ATOM 1313  N N    . GLN A 1 89  ? -10.478 -7.536  2.931   1.00 0.00 ? 89  GLN A N    1  
ATOM 1314  C CA   . GLN A 1 89  ? -10.878 -7.512  4.333   1.00 0.00 ? 89  GLN A CA   1  
ATOM 1315  C C    . GLN A 1 89  ? -9.753  -6.972  5.211   1.00 0.00 ? 89  GLN A C    1  
ATOM 1316  O O    . GLN A 1 89  ? -9.997  -6.449  6.299   1.00 0.00 ? 89  GLN A O    1  
ATOM 1317  C CB   . GLN A 1 89  ? -11.274 -8.914  4.796   1.00 0.00 ? 89  GLN A CB   1  
ATOM 1318  C CG   . GLN A 1 89  ? -12.414 -9.521  3.994   1.00 0.00 ? 89  GLN A CG   1  
ATOM 1319  C CD   . GLN A 1 89  ? -13.746 -8.855  4.277   1.00 0.00 ? 89  GLN A CD   1  
ATOM 1320  O OE1  . GLN A 1 89  ? -14.102 -7.860  3.645   1.00 0.00 ? 89  GLN A OE1  1  
ATOM 1321  N NE2  . GLN A 1 89  ? -14.491 -9.402  5.231   1.00 0.00 ? 89  GLN A NE2  1  
ATOM 1322  H H    . GLN A 1 89  ? -10.387 -8.397  2.475   1.00 0.00 ? 89  GLN A H    1  
ATOM 1323  H HA   . GLN A 1 89  ? -11.732 -6.858  4.423   1.00 0.00 ? 89  GLN A HA   1  
ATOM 1324  H HB2  . GLN A 1 89  ? -10.416 -9.565  4.711   1.00 0.00 ? 89  GLN A HB2  1  
ATOM 1325  H HB3  . GLN A 1 89  ? -11.578 -8.866  5.832   1.00 0.00 ? 89  GLN A HB3  1  
ATOM 1326  H HG2  . GLN A 1 89  ? -12.193 -9.415  2.942   1.00 0.00 ? 89  GLN A HG2  1  
ATOM 1327  H HG3  . GLN A 1 89  ? -12.492 -10.570 4.240   1.00 0.00 ? 89  GLN A HG3  1  
ATOM 1328  H HE21 . GLN A 1 89  ? -14.142 -10.194 5.692   1.00 0.00 ? 89  GLN A HE21 1  
ATOM 1329  H HE22 . GLN A 1 89  ? -15.356 -8.992  5.435   1.00 0.00 ? 89  GLN A HE22 1  
ATOM 1330  N N    . THR A 1 90  ? -8.520  -7.102  4.732   1.00 0.00 ? 90  THR A N    1  
ATOM 1331  C CA   . THR A 1 90  ? -7.358  -6.630  5.473   1.00 0.00 ? 90  THR A CA   1  
ATOM 1332  C C    . THR A 1 90  ? -7.016  -5.192  5.100   1.00 0.00 ? 90  THR A C    1  
ATOM 1333  O O    . THR A 1 90  ? -6.903  -4.856  3.921   1.00 0.00 ? 90  THR A O    1  
ATOM 1334  C CB   . THR A 1 90  ? -6.128  -7.521  5.217   1.00 0.00 ? 90  THR A CB   1  
ATOM 1335  O OG1  . THR A 1 90  ? -6.431  -8.881  5.547   1.00 0.00 ? 90  THR A OG1  1  
ATOM 1336  C CG2  . THR A 1 90  ? -4.937  -7.048  6.038   1.00 0.00 ? 90  THR A CG2  1  
ATOM 1337  H H    . THR A 1 90  ? -8.391  -7.528  3.858   1.00 0.00 ? 90  THR A H    1  
ATOM 1338  H HA   . THR A 1 90  ? -7.595  -6.672  6.526   1.00 0.00 ? 90  THR A HA   1  
ATOM 1339  H HB   . THR A 1 90  ? -5.871  -7.461  4.170   1.00 0.00 ? 90  THR A HB   1  
ATOM 1340  H HG1  . THR A 1 90  ? -7.368  -9.042  5.409   1.00 0.00 ? 90  THR A HG1  1  
ATOM 1341  H HG21 . THR A 1 90  ? -4.175  -6.662  5.378   1.00 0.00 ? 90  THR A HG21 1  
ATOM 1342  H HG22 . THR A 1 90  ? -4.538  -7.878  6.603   1.00 0.00 ? 90  THR A HG22 1  
ATOM 1343  H HG23 . THR A 1 90  ? -5.254  -6.270  6.716   1.00 0.00 ? 90  THR A HG23 1  
ATOM 1344  N N    . ILE A 1 91  ? -6.851  -4.346  6.112   1.00 0.00 ? 91  ILE A N    1  
ATOM 1345  C CA   . ILE A 1 91  ? -6.520  -2.945  5.890   1.00 0.00 ? 91  ILE A CA   1  
ATOM 1346  C C    . ILE A 1 91  ? -5.010  -2.742  5.812   1.00 0.00 ? 91  ILE A C    1  
ATOM 1347  O O    . ILE A 1 91  ? -4.270  -3.171  6.698   1.00 0.00 ? 91  ILE A O    1  
ATOM 1348  C CB   . ILE A 1 91  ? -7.090  -2.047  7.004   1.00 0.00 ? 91  ILE A CB   1  
ATOM 1349  C CG1  . ILE A 1 91  ? -8.620  -2.083  6.985   1.00 0.00 ? 91  ILE A CG1  1  
ATOM 1350  C CG2  . ILE A 1 91  ? -6.586  -0.621  6.846   1.00 0.00 ? 91  ILE A CG2  1  
ATOM 1351  C CD1  . ILE A 1 91  ? -9.210  -3.188  7.832   1.00 0.00 ? 91  ILE A CD1  1  
ATOM 1352  H H    . ILE A 1 91  ? -6.954  -4.673  7.030   1.00 0.00 ? 91  ILE A H    1  
ATOM 1353  H HA   . ILE A 1 91  ? -6.962  -2.643  4.951   1.00 0.00 ? 91  ILE A HA   1  
ATOM 1354  H HB   . ILE A 1 91  ? -6.741  -2.424  7.953   1.00 0.00 ? 91  ILE A HB   1  
ATOM 1355  H HG12 . ILE A 1 91  ? -9.000  -1.144  7.354   1.00 0.00 ? 91  ILE A HG12 1  
ATOM 1356  H HG13 . ILE A 1 91  ? -8.956  -2.228  5.968   1.00 0.00 ? 91  ILE A HG13 1  
ATOM 1357  H HG21 . ILE A 1 91  ? -6.894  -0.034  7.699   1.00 0.00 ? 91  ILE A HG21 1  
ATOM 1358  H HG22 . ILE A 1 91  ? -5.508  -0.625  6.784   1.00 0.00 ? 91  ILE A HG22 1  
ATOM 1359  H HG23 . ILE A 1 91  ? -6.997  -0.191  5.945   1.00 0.00 ? 91  ILE A HG23 1  
ATOM 1360  H HD11 . ILE A 1 91  ? -8.441  -3.909  8.070   1.00 0.00 ? 91  ILE A HD11 1  
ATOM 1361  H HD12 . ILE A 1 91  ? -9.607  -2.770  8.745   1.00 0.00 ? 91  ILE A HD12 1  
ATOM 1362  H HD13 . ILE A 1 91  ? -10.003 -3.676  7.285   1.00 0.00 ? 91  ILE A HD13 1  
ATOM 1363  N N    . TYR A 1 92  ? -4.561  -2.085  4.749   1.00 0.00 ? 92  TYR A N    1  
ATOM 1364  C CA   . TYR A 1 92  ? -3.140  -1.826  4.555   1.00 0.00 ? 92  TYR A CA   1  
ATOM 1365  C C    . TYR A 1 92  ? -2.745  -0.479  5.153   1.00 0.00 ? 92  TYR A C    1  
ATOM 1366  O O    . TYR A 1 92  ? -3.551  0.449   5.206   1.00 0.00 ? 92  TYR A O    1  
ATOM 1367  C CB   . TYR A 1 92  ? -2.793  -1.857  3.066   1.00 0.00 ? 92  TYR A CB   1  
ATOM 1368  C CG   . TYR A 1 92  ? -2.946  -3.223  2.436   1.00 0.00 ? 92  TYR A CG   1  
ATOM 1369  C CD1  . TYR A 1 92  ? -2.135  -4.283  2.824   1.00 0.00 ? 92  TYR A CD1  1  
ATOM 1370  C CD2  . TYR A 1 92  ? -3.901  -3.454  1.454   1.00 0.00 ? 92  TYR A CD2  1  
ATOM 1371  C CE1  . TYR A 1 92  ? -2.271  -5.533  2.252   1.00 0.00 ? 92  TYR A CE1  1  
ATOM 1372  C CE2  . TYR A 1 92  ? -4.045  -4.701  0.877   1.00 0.00 ? 92  TYR A CE2  1  
ATOM 1373  C CZ   . TYR A 1 92  ? -3.228  -5.737  1.279   1.00 0.00 ? 92  TYR A CZ   1  
ATOM 1374  O OH   . TYR A 1 92  ? -3.367  -6.980  0.706   1.00 0.00 ? 92  TYR A OH   1  
ATOM 1375  H H    . TYR A 1 92  ? -5.200  -1.768  4.077   1.00 0.00 ? 92  TYR A H    1  
ATOM 1376  H HA   . TYR A 1 92  ? -2.588  -2.606  5.059   1.00 0.00 ? 92  TYR A HA   1  
ATOM 1377  H HB2  . TYR A 1 92  ? -3.441  -1.175  2.538   1.00 0.00 ? 92  TYR A HB2  1  
ATOM 1378  H HB3  . TYR A 1 92  ? -1.767  -1.544  2.935   1.00 0.00 ? 92  TYR A HB3  1  
ATOM 1379  H HD1  . TYR A 1 92  ? -1.387  -4.120  3.586   1.00 0.00 ? 92  TYR A HD1  1  
ATOM 1380  H HD2  . TYR A 1 92  ? -4.539  -2.640  1.141   1.00 0.00 ? 92  TYR A HD2  1  
ATOM 1381  H HE1  . TYR A 1 92  ? -1.632  -6.344  2.566   1.00 0.00 ? 92  TYR A HE1  1  
ATOM 1382  H HE2  . TYR A 1 92  ? -4.793  -4.861  0.115   1.00 0.00 ? 92  TYR A HE2  1  
ATOM 1383  H HH   . TYR A 1 92  ? -3.624  -7.615  1.378   1.00 0.00 ? 92  TYR A HH   1  
ATOM 1384  N N    . ASN A 1 93  ? -1.498  -0.380  5.601   1.00 0.00 ? 93  ASN A N    1  
ATOM 1385  C CA   . ASN A 1 93  ? -0.994  0.853   6.195   1.00 0.00 ? 93  ASN A CA   1  
ATOM 1386  C C    . ASN A 1 93  ? 0.512   0.980   5.990   1.00 0.00 ? 93  ASN A C    1  
ATOM 1387  O O    . ASN A 1 93  ? 1.275   0.078   6.338   1.00 0.00 ? 93  ASN A O    1  
ATOM 1388  C CB   . ASN A 1 93  ? -1.322  0.895   7.689   1.00 0.00 ? 93  ASN A CB   1  
ATOM 1389  C CG   . ASN A 1 93  ? -2.674  1.523   7.967   1.00 0.00 ? 93  ASN A CG   1  
ATOM 1390  O OD1  . ASN A 1 93  ? -2.797  2.745   8.049   1.00 0.00 ? 93  ASN A OD1  1  
ATOM 1391  N ND2  . ASN A 1 93  ? -3.695  0.688   8.114   1.00 0.00 ? 93  ASN A ND2  1  
ATOM 1392  H H    . ASN A 1 93  ? -0.901  -1.155  5.531   1.00 0.00 ? 93  ASN A H    1  
ATOM 1393  H HA   . ASN A 1 93  ? -1.484  1.681   5.705   1.00 0.00 ? 93  ASN A HA   1  
ATOM 1394  H HB2  . ASN A 1 93  ? -1.328  -0.113  8.078   1.00 0.00 ? 93  ASN A HB2  1  
ATOM 1395  H HB3  . ASN A 1 93  ? -0.565  1.469   8.202   1.00 0.00 ? 93  ASN A HB3  1  
ATOM 1396  H HD21 . ASN A 1 93  ? -3.522  -0.274  8.036   1.00 0.00 ? 93  ASN A HD21 1  
ATOM 1397  H HD22 . ASN A 1 93  ? -4.581  1.067   8.294   1.00 0.00 ? 93  ASN A HD22 1  
ATOM 1398  N N    . CYS A 1 94  ? 0.933   2.106   5.423   1.00 0.00 ? 94  CYS A N    1  
ATOM 1399  C CA   . CYS A 1 94  ? 2.349   2.351   5.171   1.00 0.00 ? 94  CYS A CA   1  
ATOM 1400  C C    . CYS A 1 94  ? 2.916   3.346   6.178   1.00 0.00 ? 94  CYS A C    1  
ATOM 1401  O O    . CYS A 1 94  ? 2.455   4.485   6.271   1.00 0.00 ? 94  CYS A O    1  
ATOM 1402  C CB   . CYS A 1 94  ? 2.551   2.876   3.748   1.00 0.00 ? 94  CYS A CB   1  
ATOM 1403  S SG   . CYS A 1 94  ? 4.274   3.231   3.331   1.00 0.00 ? 94  CYS A SG   1  
ATOM 1404  H H    . CYS A 1 94  ? 0.277   2.787   5.167   1.00 0.00 ? 94  CYS A H    1  
ATOM 1405  H HA   . CYS A 1 94  ? 2.871   1.413   5.277   1.00 0.00 ? 94  CYS A HA   1  
ATOM 1406  H HB2  . CYS A 1 94  ? 2.188   2.140   3.046   1.00 0.00 ? 94  CYS A HB2  1  
ATOM 1407  H HB3  . CYS A 1 94  ? 1.987   3.789   3.626   1.00 0.00 ? 94  CYS A HB3  1  
ATOM 1408  H HG   . CYS A 1 94  ? 5.045   2.511   4.131   1.00 0.00 ? 94  CYS A HG   1  
ATOM 1409  N N    . THR A 1 95  ? 3.918   2.909   6.934   1.00 0.00 ? 95  THR A N    1  
ATOM 1410  C CA   . THR A 1 95  ? 4.547   3.759   7.937   1.00 0.00 ? 95  THR A CA   1  
ATOM 1411  C C    . THR A 1 95  ? 5.995   4.062   7.571   1.00 0.00 ? 95  THR A C    1  
ATOM 1412  O O    . THR A 1 95  ? 6.871   3.209   7.709   1.00 0.00 ? 95  THR A O    1  
ATOM 1413  C CB   . THR A 1 95  ? 4.507   3.106   9.332   1.00 0.00 ? 95  THR A CB   1  
ATOM 1414  O OG1  . THR A 1 95  ? 3.163   2.735   9.661   1.00 0.00 ? 95  THR A OG1  1  
ATOM 1415  C CG2  . THR A 1 95  ? 5.050   4.056   10.389  1.00 0.00 ? 95  THR A CG2  1  
ATOM 1416  H H    . THR A 1 95  ? 4.242   1.992   6.813   1.00 0.00 ? 95  THR A H    1  
ATOM 1417  H HA   . THR A 1 95  ? 3.995   4.687   7.981   1.00 0.00 ? 95  THR A HA   1  
ATOM 1418  H HB   . THR A 1 95  ? 5.124   2.219   9.315   1.00 0.00 ? 95  THR A HB   1  
ATOM 1419  H HG1  . THR A 1 95  ? 3.093   1.778   9.685   1.00 0.00 ? 95  THR A HG1  1  
ATOM 1420  H HG21 . THR A 1 95  ? 5.944   4.535   10.018  1.00 0.00 ? 95  THR A HG21 1  
ATOM 1421  H HG22 . THR A 1 95  ? 5.284   3.500   11.285  1.00 0.00 ? 95  THR A HG22 1  
ATOM 1422  H HG23 . THR A 1 95  ? 4.307   4.806   10.614  1.00 0.00 ? 95  THR A HG23 1  
ATOM 1423  N N    . ALA A 1 96  ? 6.240   5.283   7.106   1.00 0.00 ? 96  ALA A N    1  
ATOM 1424  C CA   . ALA A 1 96  ? 7.584   5.699   6.723   1.00 0.00 ? 96  ALA A CA   1  
ATOM 1425  C C    . ALA A 1 96  ? 8.270   6.451   7.859   1.00 0.00 ? 96  ALA A C    1  
ATOM 1426  O O    . ALA A 1 96  ? 7.612   6.944   8.775   1.00 0.00 ? 96  ALA A O    1  
ATOM 1427  C CB   . ALA A 1 96  ? 7.532   6.562   5.471   1.00 0.00 ? 96  ALA A CB   1  
ATOM 1428  H H    . ALA A 1 96  ? 5.500   5.919   7.019   1.00 0.00 ? 96  ALA A H    1  
ATOM 1429  H HA   . ALA A 1 96  ? 8.156   4.811   6.496   1.00 0.00 ? 96  ALA A HA   1  
ATOM 1430  H HB1  . ALA A 1 96  ? 7.260   5.950   4.624   1.00 0.00 ? 96  ALA A HB1  1  
ATOM 1431  H HB2  . ALA A 1 96  ? 6.798   7.343   5.603   1.00 0.00 ? 96  ALA A HB2  1  
ATOM 1432  H HB3  . ALA A 1 96  ? 8.502   7.004   5.299   1.00 0.00 ? 96  ALA A HB3  1  
ATOM 1433  N N    . TRP A 1 97  ? 9.593   6.534   7.792   1.00 0.00 ? 97  TRP A N    1  
ATOM 1434  C CA   . TRP A 1 97  ? 10.368  7.226   8.816   1.00 0.00 ? 97  TRP A CA   1  
ATOM 1435  C C    . TRP A 1 97  ? 11.435  8.114   8.184   1.00 0.00 ? 97  TRP A C    1  
ATOM 1436  O O    . TRP A 1 97  ? 12.039  7.752   7.175   1.00 0.00 ? 97  TRP A O    1  
ATOM 1437  C CB   . TRP A 1 97  ? 11.022  6.215   9.760   1.00 0.00 ? 97  TRP A CB   1  
ATOM 1438  C CG   . TRP A 1 97  ? 10.054  5.580   10.712  1.00 0.00 ? 97  TRP A CG   1  
ATOM 1439  C CD1  . TRP A 1 97  ? 9.616   6.093   11.899  1.00 0.00 ? 97  TRP A CD1  1  
ATOM 1440  C CD2  . TRP A 1 97  ? 9.406   4.313   10.557  1.00 0.00 ? 97  TRP A CD2  1  
ATOM 1441  N NE1  . TRP A 1 97  ? 8.735   5.221   12.492  1.00 0.00 ? 97  TRP A NE1  1  
ATOM 1442  C CE2  . TRP A 1 97  ? 8.589   4.122   11.688  1.00 0.00 ? 97  TRP A CE2  1  
ATOM 1443  C CE3  . TRP A 1 97  ? 9.435   3.322   9.572   1.00 0.00 ? 97  TRP A CE3  1  
ATOM 1444  C CZ2  . TRP A 1 97  ? 7.810   2.980   11.859  1.00 0.00 ? 97  TRP A CZ2  1  
ATOM 1445  C CZ3  . TRP A 1 97  ? 8.662   2.189   9.743   1.00 0.00 ? 97  TRP A CZ3  1  
ATOM 1446  C CH2  . TRP A 1 97  ? 7.858   2.026   10.879  1.00 0.00 ? 97  TRP A CH2  1  
ATOM 1447  H H    . TRP A 1 97  ? 10.061  6.121   7.036   1.00 0.00 ? 97  TRP A H    1  
ATOM 1448  H HA   . TRP A 1 97  ? 9.689   7.847   9.381   1.00 0.00 ? 97  TRP A HA   1  
ATOM 1449  H HB2  . TRP A 1 97  ? 11.479  5.431   9.176   1.00 0.00 ? 97  TRP A HB2  1  
ATOM 1450  H HB3  . TRP A 1 97  ? 11.782  6.717   10.341  1.00 0.00 ? 97  TRP A HB3  1  
ATOM 1451  H HD1  . TRP A 1 97  ? 9.927   7.045   12.302  1.00 0.00 ? 97  TRP A HD1  1  
ATOM 1452  H HE1  . TRP A 1 97  ? 8.284   5.364   13.350  1.00 0.00 ? 97  TRP A HE1  1  
ATOM 1453  H HE3  . TRP A 1 97  ? 10.048  3.430   8.689   1.00 0.00 ? 97  TRP A HE3  1  
ATOM 1454  H HZ2  . TRP A 1 97  ? 7.185   2.840   12.729  1.00 0.00 ? 97  TRP A HZ2  1  
ATOM 1455  H HZ3  . TRP A 1 97  ? 8.672   1.413   8.993   1.00 0.00 ? 97  TRP A HZ3  1  
ATOM 1456  H HH2  . TRP A 1 97  ? 7.272   1.125   10.972  1.00 0.00 ? 97  TRP A HH2  1  
ATOM 1457  N N    . ASN A 1 98  ? 11.662  9.277   8.785   1.00 0.00 ? 98  ASN A N    1  
ATOM 1458  C CA   . ASN A 1 98  ? 12.657  10.217  8.280   1.00 0.00 ? 98  ASN A CA   1  
ATOM 1459  C C    . ASN A 1 98  ? 13.276  11.019  9.421   1.00 0.00 ? 98  ASN A C    1  
ATOM 1460  O O    . ASN A 1 98  ? 12.672  11.176  10.482  1.00 0.00 ? 98  ASN A O    1  
ATOM 1461  C CB   . ASN A 1 98  ? 12.022  11.165  7.261   1.00 0.00 ? 98  ASN A CB   1  
ATOM 1462  C CG   . ASN A 1 98  ? 13.012  11.634  6.212   1.00 0.00 ? 98  ASN A CG   1  
ATOM 1463  O OD1  . ASN A 1 98  ? 13.995  10.952  5.921   1.00 0.00 ? 98  ASN A OD1  1  
ATOM 1464  N ND2  . ASN A 1 98  ? 12.757  12.805  5.640   1.00 0.00 ? 98  ASN A ND2  1  
ATOM 1465  H H    . ASN A 1 98  ? 11.149  9.510   9.587   1.00 0.00 ? 98  ASN A H    1  
ATOM 1466  H HA   . ASN A 1 98  ? 13.434  9.647   7.793   1.00 0.00 ? 98  ASN A HA   1  
ATOM 1467  H HB2  . ASN A 1 98  ? 11.212  10.655  6.760   1.00 0.00 ? 98  ASN A HB2  1  
ATOM 1468  H HB3  . ASN A 1 98  ? 11.633  12.030  7.776   1.00 0.00 ? 98  ASN A HB3  1  
ATOM 1469  H HD21 . ASN A 1 98  ? 11.956  13.294  5.922   1.00 0.00 ? 98  ASN A HD21 1  
ATOM 1470  H HD22 . ASN A 1 98  ? 13.381  13.132  4.958   1.00 0.00 ? 98  ASN A HD22 1  
ATOM 1471  N N    . SER A 1 99  ? 14.484  11.525  9.193   1.00 0.00 ? 99  SER A N    1  
ATOM 1472  C CA   . SER A 1 99  ? 15.187  12.308  10.203  1.00 0.00 ? 99  SER A CA   1  
ATOM 1473  C C    . SER A 1 99  ? 14.298  13.428  10.737  1.00 0.00 ? 99  SER A C    1  
ATOM 1474  O O    . SER A 1 99  ? 14.522  13.945  11.832  1.00 0.00 ? 99  SER A O    1  
ATOM 1475  C CB   . SER A 1 99  ? 16.472  12.897  9.618   1.00 0.00 ? 99  SER A CB   1  
ATOM 1476  O OG   . SER A 1 99  ? 17.160  13.676  10.581  1.00 0.00 ? 99  SER A OG   1  
ATOM 1477  H H    . SER A 1 99  ? 14.913  11.365  8.327   1.00 0.00 ? 99  SER A H    1  
ATOM 1478  H HA   . SER A 1 99  ? 15.441  11.647  11.017  1.00 0.00 ? 99  SER A HA   1  
ATOM 1479  H HB2  . SER A 1 99  ? 17.117  12.095  9.294   1.00 0.00 ? 99  SER A HB2  1  
ATOM 1480  H HB3  . SER A 1 99  ? 16.226  13.524  8.773   1.00 0.00 ? 99  SER A HB3  1  
ATOM 1481  H HG   . SER A 1 99  ? 18.096  13.695  10.368  1.00 0.00 ? 99  SER A HG   1  
ATOM 1482  N N    . PHE A 1 100 ? 13.289  13.797  9.956   1.00 0.00 ? 100 PHE A N    1  
ATOM 1483  C CA   . PHE A 1 100 ? 12.366  14.856  10.348  1.00 0.00 ? 100 PHE A CA   1  
ATOM 1484  C C    . PHE A 1 100 ? 11.290  14.320  11.288  1.00 0.00 ? 100 PHE A C    1  
ATOM 1485  O O    . PHE A 1 100 ? 11.008  14.911  12.329  1.00 0.00 ? 100 PHE A O    1  
ATOM 1486  C CB   . PHE A 1 100 ? 11.715  15.479  9.112   1.00 0.00 ? 100 PHE A CB   1  
ATOM 1487  C CG   . PHE A 1 100 ? 12.599  16.463  8.400   1.00 0.00 ? 100 PHE A CG   1  
ATOM 1488  C CD1  . PHE A 1 100 ? 12.621  17.795  8.779   1.00 0.00 ? 100 PHE A CD1  1  
ATOM 1489  C CD2  . PHE A 1 100 ? 13.407  16.055  7.350   1.00 0.00 ? 100 PHE A CD2  1  
ATOM 1490  C CE1  . PHE A 1 100 ? 13.434  18.703  8.126   1.00 0.00 ? 100 PHE A CE1  1  
ATOM 1491  C CE2  . PHE A 1 100 ? 14.221  16.958  6.694   1.00 0.00 ? 100 PHE A CE2  1  
ATOM 1492  C CZ   . PHE A 1 100 ? 14.234  18.284  7.081   1.00 0.00 ? 100 PHE A CZ   1  
ATOM 1493  H H    . PHE A 1 100 ? 13.162  13.348  9.094   1.00 0.00 ? 100 PHE A H    1  
ATOM 1494  H HA   . PHE A 1 100 ? 12.934  15.614  10.866  1.00 0.00 ? 100 PHE A HA   1  
ATOM 1495  H HB2  . PHE A 1 100 ? 11.462  14.695  8.414   1.00 0.00 ? 100 PHE A HB2  1  
ATOM 1496  H HB3  . PHE A 1 100 ? 10.814  15.995  9.409   1.00 0.00 ? 100 PHE A HB3  1  
ATOM 1497  H HD1  . PHE A 1 100 ? 11.995  18.124  9.597   1.00 0.00 ? 100 PHE A HD1  1  
ATOM 1498  H HD2  . PHE A 1 100 ? 13.397  15.019  7.045   1.00 0.00 ? 100 PHE A HD2  1  
ATOM 1499  H HE1  . PHE A 1 100 ? 13.441  19.738  8.432   1.00 0.00 ? 100 PHE A HE1  1  
ATOM 1500  H HE2  . PHE A 1 100 ? 14.846  16.628  5.877   1.00 0.00 ? 100 PHE A HE2  1  
ATOM 1501  H HZ   . PHE A 1 100 ? 14.870  18.991  6.570   1.00 0.00 ? 100 PHE A HZ   1  
ATOM 1502  N N    . GLY A 1 101 ? 10.692  13.193  10.911  1.00 0.00 ? 101 GLY A N    1  
ATOM 1503  C CA   . GLY A 1 101 ? 9.654   12.596  11.730  1.00 0.00 ? 101 GLY A CA   1  
ATOM 1504  C C    . GLY A 1 101 ? 9.129   11.299  11.145  1.00 0.00 ? 101 GLY A C    1  
ATOM 1505  O O    . GLY A 1 101 ? 9.904   10.449  10.707  1.00 0.00 ? 101 GLY A O    1  
ATOM 1506  H H    . GLY A 1 101 ? 10.958  12.765  10.071  1.00 0.00 ? 101 GLY A H    1  
ATOM 1507  H HA2  . GLY A 1 101 ? 10.054  12.399  12.713  1.00 0.00 ? 101 GLY A HA2  1  
ATOM 1508  H HA3  . GLY A 1 101 ? 8.835   13.294  11.819  1.00 0.00 ? 101 GLY A HA3  1  
ATOM 1509  N N    . SER A 1 102 ? 7.808   11.147  11.139  1.00 0.00 ? 102 SER A N    1  
ATOM 1510  C CA   . SER A 1 102 ? 7.181   9.942   10.609  1.00 0.00 ? 102 SER A CA   1  
ATOM 1511  C C    . SER A 1 102 ? 5.726   10.208  10.232  1.00 0.00 ? 102 SER A C    1  
ATOM 1512  O O    . SER A 1 102 ? 5.180   11.269  10.533  1.00 0.00 ? 102 SER A O    1  
ATOM 1513  C CB   . SER A 1 102 ? 7.255   8.809   11.634  1.00 0.00 ? 102 SER A CB   1  
ATOM 1514  O OG   . SER A 1 102 ? 6.513   9.126   12.799  1.00 0.00 ? 102 SER A OG   1  
ATOM 1515  H H    . SER A 1 102 ? 7.243   11.860  11.503  1.00 0.00 ? 102 SER A H    1  
ATOM 1516  H HA   . SER A 1 102 ? 7.722   9.649   9.721   1.00 0.00 ? 102 SER A HA   1  
ATOM 1517  H HB2  . SER A 1 102 ? 6.852   7.907   11.200  1.00 0.00 ? 102 SER A HB2  1  
ATOM 1518  H HB3  . SER A 1 102 ? 8.286   8.646   11.912  1.00 0.00 ? 102 SER A HB3  1  
ATOM 1519  H HG   . SER A 1 102 ? 6.736   8.508   13.499  1.00 0.00 ? 102 SER A HG   1  
ATOM 1520  N N    . ASP A 1 103 ? 5.105   9.236   9.573   1.00 0.00 ? 103 ASP A N    1  
ATOM 1521  C CA   . ASP A 1 103 ? 3.714   9.363   9.155   1.00 0.00 ? 103 ASP A CA   1  
ATOM 1522  C C    . ASP A 1 103 ? 3.141   8.008   8.753   1.00 0.00 ? 103 ASP A C    1  
ATOM 1523  O O    . ASP A 1 103 ? 3.883   7.056   8.506   1.00 0.00 ? 103 ASP A O    1  
ATOM 1524  C CB   . ASP A 1 103 ? 3.597   10.347  7.990   1.00 0.00 ? 103 ASP A CB   1  
ATOM 1525  C CG   . ASP A 1 103 ? 3.408   11.777  8.456   1.00 0.00 ? 103 ASP A CG   1  
ATOM 1526  O OD1  . ASP A 1 103 ? 2.252   12.165  8.728   1.00 0.00 ? 103 ASP A OD1  1  
ATOM 1527  O OD2  . ASP A 1 103 ? 4.415   12.508  8.549   1.00 0.00 ? 103 ASP A OD2  1  
ATOM 1528  H H    . ASP A 1 103 ? 5.595   8.413   9.362   1.00 0.00 ? 103 ASP A H    1  
ATOM 1529  H HA   . ASP A 1 103 ? 3.150   9.744   9.993   1.00 0.00 ? 103 ASP A HA   1  
ATOM 1530  H HB2  . ASP A 1 103 ? 4.497   10.298  7.394   1.00 0.00 ? 103 ASP A HB2  1  
ATOM 1531  H HB3  . ASP A 1 103 ? 2.750   10.071  7.378   1.00 0.00 ? 103 ASP A HB3  1  
ATOM 1532  N N    . THR A 1 104 ? 1.816   7.926   8.689   1.00 0.00 ? 104 THR A N    1  
ATOM 1533  C CA   . THR A 1 104 ? 1.143   6.687   8.319   1.00 0.00 ? 104 THR A CA   1  
ATOM 1534  C C    . THR A 1 104 ? -0.158  6.969   7.577   1.00 0.00 ? 104 THR A C    1  
ATOM 1535  O O    . THR A 1 104 ? -0.874  7.916   7.899   1.00 0.00 ? 104 THR A O    1  
ATOM 1536  C CB   . THR A 1 104 ? 0.839   5.822   9.557   1.00 0.00 ? 104 THR A CB   1  
ATOM 1537  O OG1  . THR A 1 104 ? 2.047   5.554   10.276  1.00 0.00 ? 104 THR A OG1  1  
ATOM 1538  C CG2  . THR A 1 104 ? 0.182   4.511   9.152   1.00 0.00 ? 104 THR A CG2  1  
ATOM 1539  H H    . THR A 1 104 ? 1.279   8.719   8.897   1.00 0.00 ? 104 THR A H    1  
ATOM 1540  H HA   . THR A 1 104 ? 1.804   6.130   7.670   1.00 0.00 ? 104 THR A HA   1  
ATOM 1541  H HB   . THR A 1 104 ? 0.160   6.365   10.198  1.00 0.00 ? 104 THR A HB   1  
ATOM 1542  H HG1  . THR A 1 104 ? 2.391   4.696   10.017  1.00 0.00 ? 104 THR A HG1  1  
ATOM 1543  H HG21 . THR A 1 104 ? -0.873  4.673   8.985   1.00 0.00 ? 104 THR A HG21 1  
ATOM 1544  H HG22 . THR A 1 104 ? 0.314   3.784   9.940   1.00 0.00 ? 104 THR A HG22 1  
ATOM 1545  H HG23 . THR A 1 104 ? 0.638   4.146   8.244   1.00 0.00 ? 104 THR A HG23 1  
ATOM 1546  N N    . GLU A 1 105 ? -0.458  6.139   6.582   1.00 0.00 ? 105 GLU A N    1  
ATOM 1547  C CA   . GLU A 1 105 ? -1.675  6.300   5.795   1.00 0.00 ? 105 GLU A CA   1  
ATOM 1548  C C    . GLU A 1 105 ? -2.446  4.986   5.711   1.00 0.00 ? 105 GLU A C    1  
ATOM 1549  O O    . GLU A 1 105 ? -1.872  3.934   5.428   1.00 0.00 ? 105 GLU A O    1  
ATOM 1550  C CB   . GLU A 1 105 ? -1.336  6.796   4.388   1.00 0.00 ? 105 GLU A CB   1  
ATOM 1551  C CG   . GLU A 1 105 ? -2.551  7.235   3.588   1.00 0.00 ? 105 GLU A CG   1  
ATOM 1552  C CD   . GLU A 1 105 ? -3.472  8.144   4.378   1.00 0.00 ? 105 GLU A CD   1  
ATOM 1553  O OE1  . GLU A 1 105 ? -3.172  9.353   4.474   1.00 0.00 ? 105 GLU A OE1  1  
ATOM 1554  O OE2  . GLU A 1 105 ? -4.493  7.648   4.899   1.00 0.00 ? 105 GLU A OE2  1  
ATOM 1555  H H    . GLU A 1 105 ? 0.153   5.402   6.373   1.00 0.00 ? 105 GLU A H    1  
ATOM 1556  H HA   . GLU A 1 105 ? -2.293  7.036   6.287   1.00 0.00 ? 105 GLU A HA   1  
ATOM 1557  H HB2  . GLU A 1 105 ? -0.661  7.636   4.468   1.00 0.00 ? 105 GLU A HB2  1  
ATOM 1558  H HB3  . GLU A 1 105 ? -0.844  6.001   3.848   1.00 0.00 ? 105 GLU A HB3  1  
ATOM 1559  H HG2  . GLU A 1 105 ? -2.216  7.764   2.709   1.00 0.00 ? 105 GLU A HG2  1  
ATOM 1560  H HG3  . GLU A 1 105 ? -3.105  6.357   3.289   1.00 0.00 ? 105 GLU A HG3  1  
ATOM 1561  N N    . ILE A 1 106 ? -3.750  5.056   5.959   1.00 0.00 ? 106 ILE A N    1  
ATOM 1562  C CA   . ILE A 1 106 ? -4.600  3.873   5.910   1.00 0.00 ? 106 ILE A CA   1  
ATOM 1563  C C    . ILE A 1 106 ? -5.132  3.635   4.501   1.00 0.00 ? 106 ILE A C    1  
ATOM 1564  O O    . ILE A 1 106 ? -5.550  4.570   3.818   1.00 0.00 ? 106 ILE A O    1  
ATOM 1565  C CB   . ILE A 1 106 ? -5.790  3.995   6.881   1.00 0.00 ? 106 ILE A CB   1  
ATOM 1566  C CG1  . ILE A 1 106 ? -5.289  4.206   8.312   1.00 0.00 ? 106 ILE A CG1  1  
ATOM 1567  C CG2  . ILE A 1 106 ? -6.669  2.756   6.800   1.00 0.00 ? 106 ILE A CG2  1  
ATOM 1568  C CD1  . ILE A 1 106 ? -6.369  4.659   9.269   1.00 0.00 ? 106 ILE A CD1  1  
ATOM 1569  H H    . ILE A 1 106 ? -4.149  5.923   6.178   1.00 0.00 ? 106 ILE A H    1  
ATOM 1570  H HA   . ILE A 1 106 ? -4.004  3.022   6.208   1.00 0.00 ? 106 ILE A HA   1  
ATOM 1571  H HB   . ILE A 1 106 ? -6.382  4.847   6.585   1.00 0.00 ? 106 ILE A HB   1  
ATOM 1572  H HG12 . ILE A 1 106 ? -4.882  3.280   8.685   1.00 0.00 ? 106 ILE A HG12 1  
ATOM 1573  H HG13 . ILE A 1 106 ? -4.513  4.958   8.306   1.00 0.00 ? 106 ILE A HG13 1  
ATOM 1574  H HG21 . ILE A 1 106 ? -6.098  1.889   7.100   1.00 0.00 ? 106 ILE A HG21 1  
ATOM 1575  H HG22 . ILE A 1 106 ? -7.516  2.873   7.458   1.00 0.00 ? 106 ILE A HG22 1  
ATOM 1576  H HG23 . ILE A 1 106 ? -7.015  2.626   5.786   1.00 0.00 ? 106 ILE A HG23 1  
ATOM 1577  H HD11 . ILE A 1 106 ? -6.513  5.724   9.172   1.00 0.00 ? 106 ILE A HD11 1  
ATOM 1578  H HD12 . ILE A 1 106 ? -7.291  4.147   9.040   1.00 0.00 ? 106 ILE A HD12 1  
ATOM 1579  H HD13 . ILE A 1 106 ? -6.071  4.428   10.282  1.00 0.00 ? 106 ILE A HD13 1  
ATOM 1580  N N    . ILE A 1 107 ? -5.114  2.377   4.073   1.00 0.00 ? 107 ILE A N    1  
ATOM 1581  C CA   . ILE A 1 107 ? -5.596  2.016   2.745   1.00 0.00 ? 107 ILE A CA   1  
ATOM 1582  C C    . ILE A 1 107 ? -6.420  0.734   2.791   1.00 0.00 ? 107 ILE A C    1  
ATOM 1583  O O    . ILE A 1 107 ? -5.994  -0.271  3.361   1.00 0.00 ? 107 ILE A O    1  
ATOM 1584  C CB   . ILE A 1 107 ? -4.432  1.830   1.754   1.00 0.00 ? 107 ILE A CB   1  
ATOM 1585  C CG1  . ILE A 1 107 ? -3.587  3.104   1.682   1.00 0.00 ? 107 ILE A CG1  1  
ATOM 1586  C CG2  . ILE A 1 107 ? -4.963  1.461   0.377   1.00 0.00 ? 107 ILE A CG2  1  
ATOM 1587  C CD1  . ILE A 1 107 ? -2.475  3.150   2.706   1.00 0.00 ? 107 ILE A CD1  1  
ATOM 1588  H H    . ILE A 1 107 ? -4.768  1.676   4.663   1.00 0.00 ? 107 ILE A H    1  
ATOM 1589  H HA   . ILE A 1 107 ? -6.222  2.821   2.388   1.00 0.00 ? 107 ILE A HA   1  
ATOM 1590  H HB   . ILE A 1 107 ? -3.816  1.017   2.106   1.00 0.00 ? 107 ILE A HB   1  
ATOM 1591  H HG12 . ILE A 1 107 ? -3.139  3.175   0.703   1.00 0.00 ? 107 ILE A HG12 1  
ATOM 1592  H HG13 . ILE A 1 107 ? -4.226  3.960   1.845   1.00 0.00 ? 107 ILE A HG13 1  
ATOM 1593  H HG21 . ILE A 1 107 ? -4.184  0.973   -0.190  1.00 0.00 ? 107 ILE A HG21 1  
ATOM 1594  H HG22 . ILE A 1 107 ? -5.803  0.790   0.484   1.00 0.00 ? 107 ILE A HG22 1  
ATOM 1595  H HG23 . ILE A 1 107 ? -5.278  2.355   -0.139  1.00 0.00 ? 107 ILE A HG23 1  
ATOM 1596  H HD11 . ILE A 1 107 ? -2.411  4.145   3.123   1.00 0.00 ? 107 ILE A HD11 1  
ATOM 1597  H HD12 . ILE A 1 107 ? -2.681  2.441   3.494   1.00 0.00 ? 107 ILE A HD12 1  
ATOM 1598  H HD13 . ILE A 1 107 ? -1.538  2.899   2.231   1.00 0.00 ? 107 ILE A HD13 1  
ATOM 1599  N N    . ARG A 1 108 ? -7.602  0.775   2.185   1.00 0.00 ? 108 ARG A N    1  
ATOM 1600  C CA   . ARG A 1 108 ? -8.486  -0.384  2.155   1.00 0.00 ? 108 ARG A CA   1  
ATOM 1601  C C    . ARG A 1 108 ? -8.780  -0.807  0.719   1.00 0.00 ? 108 ARG A C    1  
ATOM 1602  O O    . ARG A 1 108 ? -9.662  -0.249  0.064   1.00 0.00 ? 108 ARG A O    1  
ATOM 1603  C CB   . ARG A 1 108 ? -9.795  -0.073  2.884   1.00 0.00 ? 108 ARG A CB   1  
ATOM 1604  C CG   . ARG A 1 108 ? -9.627  0.113   4.383   1.00 0.00 ? 108 ARG A CG   1  
ATOM 1605  C CD   . ARG A 1 108 ? -10.889 -0.276  5.138   1.00 0.00 ? 108 ARG A CD   1  
ATOM 1606  N NE   . ARG A 1 108 ? -11.954 0.709   4.969   1.00 0.00 ? 108 ARG A NE   1  
ATOM 1607  C CZ   . ARG A 1 108 ? -11.898 1.942   5.458   1.00 0.00 ? 108 ARG A CZ   1  
ATOM 1608  N NH1  . ARG A 1 108 ? -10.835 2.341   6.142   1.00 0.00 ? 108 ARG A NH1  1  
ATOM 1609  N NH2  . ARG A 1 108 ? -12.908 2.781   5.262   1.00 0.00 ? 108 ARG A NH2  1  
ATOM 1610  H H    . ARG A 1 108 ? -7.887  1.605   1.748   1.00 0.00 ? 108 ARG A H    1  
ATOM 1611  H HA   . ARG A 1 108 ? -7.987  -1.196  2.662   1.00 0.00 ? 108 ARG A HA   1  
ATOM 1612  H HB2  . ARG A 1 108 ? -10.214 0.835   2.476   1.00 0.00 ? 108 ARG A HB2  1  
ATOM 1613  H HB3  . ARG A 1 108 ? -10.486 -0.885  2.719   1.00 0.00 ? 108 ARG A HB3  1  
ATOM 1614  H HG2  . ARG A 1 108 ? -8.811  -0.506  4.725   1.00 0.00 ? 108 ARG A HG2  1  
ATOM 1615  H HG3  . ARG A 1 108 ? -9.403  1.150   4.585   1.00 0.00 ? 108 ARG A HG3  1  
ATOM 1616  H HD2  . ARG A 1 108 ? -11.232 -1.231  4.768   1.00 0.00 ? 108 ARG A HD2  1  
ATOM 1617  H HD3  . ARG A 1 108 ? -10.652 -0.361  6.188   1.00 0.00 ? 108 ARG A HD3  1  
ATOM 1618  H HE   . ARG A 1 108 ? -12.749 0.435   4.466   1.00 0.00 ? 108 ARG A HE   1  
ATOM 1619  H HH11 . ARG A 1 108 ? -10.072 1.711   6.290   1.00 0.00 ? 108 ARG A HH11 1  
ATOM 1620  H HH12 . ARG A 1 108 ? -10.795 3.271   6.508   1.00 0.00 ? 108 ARG A HH12 1  
ATOM 1621  H HH21 . ARG A 1 108 ? -13.711 2.484   4.746   1.00 0.00 ? 108 ARG A HH21 1  
ATOM 1622  H HH22 . ARG A 1 108 ? -12.865 3.709   5.630   1.00 0.00 ? 108 ARG A HH22 1  
ATOM 1623  N N    . LEU A 1 109 ? -8.036  -1.795  0.234   1.00 0.00 ? 109 LEU A N    1  
ATOM 1624  C CA   . LEU A 1 109 ? -8.216  -2.293  -1.125  1.00 0.00 ? 109 LEU A CA   1  
ATOM 1625  C C    . LEU A 1 109 ? -9.632  -2.826  -1.327  1.00 0.00 ? 109 LEU A C    1  
ATOM 1626  O O    . LEU A 1 109 ? -9.932  -3.969  -0.982  1.00 0.00 ? 109 LEU A O    1  
ATOM 1627  C CB   . LEU A 1 109 ? -7.197  -3.394  -1.425  1.00 0.00 ? 109 LEU A CB   1  
ATOM 1628  C CG   . LEU A 1 109 ? -7.130  -3.868  -2.877  1.00 0.00 ? 109 LEU A CG   1  
ATOM 1629  C CD1  . LEU A 1 109 ? -6.598  -2.762  -3.775  1.00 0.00 ? 109 LEU A CD1  1  
ATOM 1630  C CD2  . LEU A 1 109 ? -6.263  -5.113  -2.992  1.00 0.00 ? 109 LEU A CD2  1  
ATOM 1631  H H    . LEU A 1 109 ? -7.350  -2.200  0.803   1.00 0.00 ? 109 LEU A H    1  
ATOM 1632  H HA   . LEU A 1 109 ? -8.054  -1.469  -1.804  1.00 0.00 ? 109 LEU A HA   1  
ATOM 1633  H HB2  . LEU A 1 109 ? -6.221  -3.024  -1.152  1.00 0.00 ? 109 LEU A HB2  1  
ATOM 1634  H HB3  . LEU A 1 109 ? -7.442  -4.247  -0.808  1.00 0.00 ? 109 LEU A HB3  1  
ATOM 1635  H HG   . LEU A 1 109 ? -8.126  -4.121  -3.214  1.00 0.00 ? 109 LEU A HG   1  
ATOM 1636  H HD11 . LEU A 1 109 ? -7.071  -2.825  -4.743  1.00 0.00 ? 109 LEU A HD11 1  
ATOM 1637  H HD12 . LEU A 1 109 ? -5.530  -2.873  -3.889  1.00 0.00 ? 109 LEU A HD12 1  
ATOM 1638  H HD13 . LEU A 1 109 ? -6.814  -1.802  -3.330  1.00 0.00 ? 109 LEU A HD13 1  
ATOM 1639  H HD21 . LEU A 1 109 ? -5.892  -5.385  -2.014  1.00 0.00 ? 109 LEU A HD21 1  
ATOM 1640  H HD22 . LEU A 1 109 ? -5.429  -4.912  -3.649  1.00 0.00 ? 109 LEU A HD22 1  
ATOM 1641  H HD23 . LEU A 1 109 ? -6.851  -5.925  -3.393  1.00 0.00 ? 109 LEU A HD23 1  
ATOM 1642  N N    . LYS A 1 110 ? -10.498 -1.990  -1.890  1.00 0.00 ? 110 LYS A N    1  
ATOM 1643  C CA   . LYS A 1 110 ? -11.881 -2.376  -2.142  1.00 0.00 ? 110 LYS A CA   1  
ATOM 1644  C C    . LYS A 1 110 ? -11.951 -3.533  -3.134  1.00 0.00 ? 110 LYS A C    1  
ATOM 1645  O O    . LYS A 1 110 ? -10.966 -3.851  -3.800  1.00 0.00 ? 110 LYS A O    1  
ATOM 1646  C CB   . LYS A 1 110 ? -12.676 -1.183  -2.677  1.00 0.00 ? 110 LYS A CB   1  
ATOM 1647  C CG   . LYS A 1 110 ? -12.665 0.020   -1.750  1.00 0.00 ? 110 LYS A CG   1  
ATOM 1648  C CD   . LYS A 1 110 ? -13.894 0.891   -1.952  1.00 0.00 ? 110 LYS A CD   1  
ATOM 1649  C CE   . LYS A 1 110 ? -13.943 2.029   -0.945  1.00 0.00 ? 110 LYS A CE   1  
ATOM 1650  N NZ   . LYS A 1 110 ? -15.033 2.996   -1.253  1.00 0.00 ? 110 LYS A NZ   1  
ATOM 1651  H H    . LYS A 1 110 ? -10.199 -1.091  -2.143  1.00 0.00 ? 110 LYS A H    1  
ATOM 1652  H HA   . LYS A 1 110 ? -12.313 -2.694  -1.205  1.00 0.00 ? 110 LYS A HA   1  
ATOM 1653  H HB2  . LYS A 1 110 ? -12.257 -0.884  -3.627  1.00 0.00 ? 110 LYS A HB2  1  
ATOM 1654  H HB3  . LYS A 1 110 ? -13.702 -1.487  -2.826  1.00 0.00 ? 110 LYS A HB3  1  
ATOM 1655  H HG2  . LYS A 1 110 ? -12.647 -0.325  -0.727  1.00 0.00 ? 110 LYS A HG2  1  
ATOM 1656  H HG3  . LYS A 1 110 ? -11.781 0.609   -1.950  1.00 0.00 ? 110 LYS A HG3  1  
ATOM 1657  H HD2  . LYS A 1 110 ? -13.870 1.307   -2.948  1.00 0.00 ? 110 LYS A HD2  1  
ATOM 1658  H HD3  . LYS A 1 110 ? -14.779 0.281   -1.837  1.00 0.00 ? 110 LYS A HD3  1  
ATOM 1659  H HE2  . LYS A 1 110 ? -14.106 1.616   0.038   1.00 0.00 ? 110 LYS A HE2  1  
ATOM 1660  H HE3  . LYS A 1 110 ? -12.996 2.549   -0.964  1.00 0.00 ? 110 LYS A HE3  1  
ATOM 1661  H HZ1  . LYS A 1 110 ? -14.800 3.535   -2.112  1.00 0.00 ? 110 LYS A HZ1  1  
ATOM 1662  H HZ2  . LYS A 1 110 ? -15.154 3.661   -0.463  1.00 0.00 ? 110 LYS A HZ2  1  
ATOM 1663  H HZ3  . LYS A 1 110 ? -15.928 2.489   -1.406  1.00 0.00 ? 110 LYS A HZ3  1  
ATOM 1664  N N    . GLU A 1 111 ? -13.120 -4.158  -3.226  1.00 0.00 ? 111 GLU A N    1  
ATOM 1665  C CA   . GLU A 1 111 ? -13.317 -5.279  -4.137  1.00 0.00 ? 111 GLU A CA   1  
ATOM 1666  C C    . GLU A 1 111 ? -13.965 -4.815  -5.439  1.00 0.00 ? 111 GLU A C    1  
ATOM 1667  O O    . GLU A 1 111 ? -14.736 -3.855  -5.452  1.00 0.00 ? 111 GLU A O    1  
ATOM 1668  C CB   . GLU A 1 111 ? -14.183 -6.355  -3.479  1.00 0.00 ? 111 GLU A CB   1  
ATOM 1669  C CG   . GLU A 1 111 ? -13.991 -7.740  -4.074  1.00 0.00 ? 111 GLU A CG   1  
ATOM 1670  C CD   . GLU A 1 111 ? -14.532 -8.839  -3.181  1.00 0.00 ? 111 GLU A CD   1  
ATOM 1671  O OE1  . GLU A 1 111 ? -15.628 -8.655  -2.610  1.00 0.00 ? 111 GLU A OE1  1  
ATOM 1672  O OE2  . GLU A 1 111 ? -13.860 -9.884  -3.053  1.00 0.00 ? 111 GLU A OE2  1  
ATOM 1673  H H    . GLU A 1 111 ? -13.868 -3.858  -2.668  1.00 0.00 ? 111 GLU A H    1  
ATOM 1674  H HA   . GLU A 1 111 ? -12.348 -5.698  -4.362  1.00 0.00 ? 111 GLU A HA   1  
ATOM 1675  H HB2  . GLU A 1 111 ? -13.941 -6.401  -2.427  1.00 0.00 ? 111 GLU A HB2  1  
ATOM 1676  H HB3  . GLU A 1 111 ? -15.222 -6.080  -3.588  1.00 0.00 ? 111 GLU A HB3  1  
ATOM 1677  H HG2  . GLU A 1 111 ? -14.503 -7.783  -5.023  1.00 0.00 ? 111 GLU A HG2  1  
ATOM 1678  H HG3  . GLU A 1 111 ? -12.935 -7.908  -4.228  1.00 0.00 ? 111 GLU A HG3  1  
ATOM 1679  N N    . GLN A 1 112 ? -13.647 -5.504  -6.530  1.00 0.00 ? 112 GLN A N    1  
ATOM 1680  C CA   . GLN A 1 112 ? -14.197 -5.161  -7.836  1.00 0.00 ? 112 GLN A CA   1  
ATOM 1681  C C    . GLN A 1 112 ? -15.660 -4.747  -7.719  1.00 0.00 ? 112 GLN A C    1  
ATOM 1682  O O    . GLN A 1 112 ? -16.482 -5.482  -7.174  1.00 0.00 ? 112 GLN A O    1  
ATOM 1683  C CB   . GLN A 1 112 ? -14.066 -6.346  -8.795  1.00 0.00 ? 112 GLN A CB   1  
ATOM 1684  C CG   . GLN A 1 112 ? -14.691 -6.098  -10.158 1.00 0.00 ? 112 GLN A CG   1  
ATOM 1685  C CD   . GLN A 1 112 ? -16.206 -6.133  -10.120 1.00 0.00 ? 112 GLN A CD   1  
ATOM 1686  O OE1  . GLN A 1 112 ? -16.862 -5.091  -10.088 1.00 0.00 ? 112 GLN A OE1  1  
ATOM 1687  N NE2  . GLN A 1 112 ? -16.772 -7.334  -10.124 1.00 0.00 ? 112 GLN A NE2  1  
ATOM 1688  H H    . GLN A 1 112 ? -13.028 -6.258  -6.455  1.00 0.00 ? 112 GLN A H    1  
ATOM 1689  H HA   . GLN A 1 112 ? -13.631 -4.330  -8.227  1.00 0.00 ? 112 GLN A HA   1  
ATOM 1690  H HB2  . GLN A 1 112 ? -13.018 -6.565  -8.937  1.00 0.00 ? 112 GLN A HB2  1  
ATOM 1691  H HB3  . GLN A 1 112 ? -14.548 -7.206  -8.353  1.00 0.00 ? 112 GLN A HB3  1  
ATOM 1692  H HG2  . GLN A 1 112 ? -14.377 -5.128  -10.512 1.00 0.00 ? 112 GLN A HG2  1  
ATOM 1693  H HG3  . GLN A 1 112 ? -14.345 -6.859  -10.842 1.00 0.00 ? 112 GLN A HG3  1  
ATOM 1694  H HE21 . GLN A 1 112 ? -16.186 -8.121  -10.150 1.00 0.00 ? 112 GLN A HE21 1  
ATOM 1695  H HE22 . GLN A 1 112 ? -17.749 -7.386  -10.100 1.00 0.00 ? 112 GLN A HE22 1  
ATOM 1696  N N    . GLY A 1 113 ? -15.978 -3.563  -8.235  1.00 0.00 ? 113 GLY A N    1  
ATOM 1697  C CA   . GLY A 1 113 ? -17.342 -3.071  -8.177  1.00 0.00 ? 113 GLY A CA   1  
ATOM 1698  C C    . GLY A 1 113 ? -17.439 -1.705  -7.526  1.00 0.00 ? 113 GLY A C    1  
ATOM 1699  O O    . GLY A 1 113 ? -18.210 -1.511  -6.586  1.00 0.00 ? 113 GLY A O    1  
ATOM 1700  H H    . GLY A 1 113 ? -15.281 -3.020  -8.658  1.00 0.00 ? 113 GLY A H    1  
ATOM 1701  H HA2  . GLY A 1 113 ? -17.733 -3.008  -9.181  1.00 0.00 ? 113 GLY A HA2  1  
ATOM 1702  H HA3  . GLY A 1 113 ? -17.941 -3.769  -7.611  1.00 0.00 ? 113 GLY A HA3  1  
ATOM 1703  N N    . SER A 1 114 ? -16.653 -0.757  -8.025  1.00 0.00 ? 114 SER A N    1  
ATOM 1704  C CA   . SER A 1 114 ? -16.649 0.597   -7.483  1.00 0.00 ? 114 SER A CA   1  
ATOM 1705  C C    . SER A 1 114 ? -17.891 1.363   -7.926  1.00 0.00 ? 114 SER A C    1  
ATOM 1706  O O    . SER A 1 114 ? -18.753 1.692   -7.112  1.00 0.00 ? 114 SER A O    1  
ATOM 1707  C CB   . SER A 1 114 ? -15.389 1.343   -7.926  1.00 0.00 ? 114 SER A CB   1  
ATOM 1708  O OG   . SER A 1 114 ? -14.291 1.036   -7.086  1.00 0.00 ? 114 SER A OG   1  
ATOM 1709  H H    . SER A 1 114 ? -16.059 -0.973  -8.775  1.00 0.00 ? 114 SER A H    1  
ATOM 1710  H HA   . SER A 1 114 ? -16.652 0.522   -6.405  1.00 0.00 ? 114 SER A HA   1  
ATOM 1711  H HB2  . SER A 1 114 ? -15.143 1.059   -8.938  1.00 0.00 ? 114 SER A HB2  1  
ATOM 1712  H HB3  . SER A 1 114 ? -15.572 2.408   -7.886  1.00 0.00 ? 114 SER A HB3  1  
ATOM 1713  H HG   . SER A 1 114 ? -14.361 0.126   -6.787  1.00 0.00 ? 114 SER A HG   1  
ATOM 1714  N N    . GLU A 1 115 ? -17.974 1.644   -9.223  1.00 0.00 ? 115 GLU A N    1  
ATOM 1715  C CA   . GLU A 1 115 ? -19.110 2.373   -9.774  1.00 0.00 ? 115 GLU A CA   1  
ATOM 1716  C C    . GLU A 1 115 ? -20.166 1.410   -10.310 1.00 0.00 ? 115 GLU A C    1  
ATOM 1717  O O    . GLU A 1 115 ? -20.760 1.646   -11.362 1.00 0.00 ? 115 GLU A O    1  
ATOM 1718  C CB   . GLU A 1 115 ? -18.649 3.313   -10.890 1.00 0.00 ? 115 GLU A CB   1  
ATOM 1719  C CG   . GLU A 1 115 ? -18.168 2.589   -12.136 1.00 0.00 ? 115 GLU A CG   1  
ATOM 1720  C CD   . GLU A 1 115 ? -16.683 2.286   -12.099 1.00 0.00 ? 115 GLU A CD   1  
ATOM 1721  O OE1  . GLU A 1 115 ? -16.307 1.231   -11.545 1.00 0.00 ? 115 GLU A OE1  1  
ATOM 1722  O OE2  . GLU A 1 115 ? -15.897 3.102   -12.622 1.00 0.00 ? 115 GLU A OE2  1  
ATOM 1723  H H    . GLU A 1 115 ? -17.255 1.355   -9.822  1.00 0.00 ? 115 GLU A H    1  
ATOM 1724  H HA   . GLU A 1 115 ? -19.546 2.959   -8.980  1.00 0.00 ? 115 GLU A HA   1  
ATOM 1725  H HB2  . GLU A 1 115 ? -19.471 3.956   -11.166 1.00 0.00 ? 115 GLU A HB2  1  
ATOM 1726  H HB3  . GLU A 1 115 ? -17.838 3.922   -10.518 1.00 0.00 ? 115 GLU A HB3  1  
ATOM 1727  H HG2  . GLU A 1 115 ? -18.708 1.658   -12.227 1.00 0.00 ? 115 GLU A HG2  1  
ATOM 1728  H HG3  . GLU A 1 115 ? -18.373 3.208   -12.998 1.00 0.00 ? 115 GLU A HG3  1  
ATOM 1729  N N    . MET A 1 116 ? -20.393 0.323   -9.579  1.00 0.00 ? 116 MET A N    1  
ATOM 1730  C CA   . MET A 1 116 ? -21.377 -0.675  -9.981  1.00 0.00 ? 116 MET A CA   1  
ATOM 1731  C C    . MET A 1 116 ? -22.380 -0.931  -8.860  1.00 0.00 ? 116 MET A C    1  
ATOM 1732  O O    . MET A 1 116 ? -22.124 -1.726  -7.955  1.00 0.00 ? 116 MET A O    1  
ATOM 1733  C CB   . MET A 1 116 ? -20.681 -1.982  -10.366 1.00 0.00 ? 116 MET A CB   1  
ATOM 1734  C CG   . MET A 1 116 ? -21.437 -2.788  -11.410 1.00 0.00 ? 116 MET A CG   1  
ATOM 1735  S SD   . MET A 1 116 ? -21.014 -4.541  -11.374 1.00 0.00 ? 116 MET A SD   1  
ATOM 1736  C CE   . MET A 1 116 ? -22.644 -5.283  -11.402 1.00 0.00 ? 116 MET A CE   1  
ATOM 1737  H H    . MET A 1 116 ? -19.888 0.190   -8.750  1.00 0.00 ? 116 MET A H    1  
ATOM 1738  H HA   . MET A 1 116 ? -21.905 -0.292  -10.841 1.00 0.00 ? 116 MET A HA   1  
ATOM 1739  H HB2  . MET A 1 116 ? -19.702 -1.752  -10.760 1.00 0.00 ? 116 MET A HB2  1  
ATOM 1740  H HB3  . MET A 1 116 ? -20.571 -2.592  -9.482  1.00 0.00 ? 116 MET A HB3  1  
ATOM 1741  H HG2  . MET A 1 116 ? -22.496 -2.685  -11.229 1.00 0.00 ? 116 MET A HG2  1  
ATOM 1742  H HG3  . MET A 1 116 ? -21.201 -2.394  -12.388 1.00 0.00 ? 116 MET A HG3  1  
ATOM 1743  H HE1  . MET A 1 116 ? -23.158 -4.990  -12.306 1.00 0.00 ? 116 MET A HE1  1  
ATOM 1744  H HE2  . MET A 1 116 ? -22.550 -6.358  -11.373 1.00 0.00 ? 116 MET A HE2  1  
ATOM 1745  H HE3  . MET A 1 116 ? -23.206 -4.947  -10.543 1.00 0.00 ? 116 MET A HE3  1  
ATOM 1746  N N    . SER A 1 117 ? -23.521 -0.253  -8.927  1.00 0.00 ? 117 SER A N    1  
ATOM 1747  C CA   . SER A 1 117 ? -24.560 -0.404  -7.915  1.00 0.00 ? 117 SER A CA   1  
ATOM 1748  C C    . SER A 1 117 ? -25.519 -1.531  -8.287  1.00 0.00 ? 117 SER A C    1  
ATOM 1749  O O    . SER A 1 117 ? -26.735 -1.395  -8.154  1.00 0.00 ? 117 SER A O    1  
ATOM 1750  C CB   . SER A 1 117 ? -25.334 0.905   -7.749  1.00 0.00 ? 117 SER A CB   1  
ATOM 1751  O OG   . SER A 1 117 ? -24.733 1.731   -6.766  1.00 0.00 ? 117 SER A OG   1  
ATOM 1752  H H    . SER A 1 117 ? -23.666 0.366   -9.673  1.00 0.00 ? 117 SER A H    1  
ATOM 1753  H HA   . SER A 1 117 ? -24.079 -0.650  -6.980  1.00 0.00 ? 117 SER A HA   1  
ATOM 1754  H HB2  . SER A 1 117 ? -25.345 1.436   -8.689  1.00 0.00 ? 117 SER A HB2  1  
ATOM 1755  H HB3  . SER A 1 117 ? -26.347 0.685   -7.447  1.00 0.00 ? 117 SER A HB3  1  
ATOM 1756  H HG   . SER A 1 117 ? -25.026 1.456   -5.894  1.00 0.00 ? 117 SER A HG   1  
ATOM 1757  N N    . GLY A 1 118 ? -24.962 -2.645  -8.752  1.00 0.00 ? 118 GLY A N    1  
ATOM 1758  C CA   . GLY A 1 118 ? -25.781 -3.780  -9.136  1.00 0.00 ? 118 GLY A CA   1  
ATOM 1759  C C    . GLY A 1 118 ? -26.475 -4.421  -7.951  1.00 0.00 ? 118 GLY A C    1  
ATOM 1760  O O    . GLY A 1 118 ? -26.438 -3.910  -6.831  1.00 0.00 ? 118 GLY A O    1  
ATOM 1761  H H    . GLY A 1 118 ? -23.987 -2.696  -8.836  1.00 0.00 ? 118 GLY A H    1  
ATOM 1762  H HA2  . GLY A 1 118 ? -26.529 -3.448  -9.841  1.00 0.00 ? 118 GLY A HA2  1  
ATOM 1763  H HA3  . GLY A 1 118 ? -25.153 -4.518  -9.613  1.00 0.00 ? 118 GLY A HA3  1  
ATOM 1764  N N    . PRO A 1 119 ? -27.129 -5.567  -8.192  1.00 0.00 ? 119 PRO A N    1  
ATOM 1765  C CA   . PRO A 1 119 ? -27.848 -6.303  -7.147  1.00 0.00 ? 119 PRO A CA   1  
ATOM 1766  C C    . PRO A 1 119 ? -26.905 -6.940  -6.133  1.00 0.00 ? 119 PRO A C    1  
ATOM 1767  O O    . PRO A 1 119 ? -26.159 -7.864  -6.458  1.00 0.00 ? 119 PRO A O    1  
ATOM 1768  C CB   . PRO A 1 119 ? -28.601 -7.383  -7.929  1.00 0.00 ? 119 PRO A CB   1  
ATOM 1769  C CG   . PRO A 1 119 ? -27.802 -7.578  -9.171  1.00 0.00 ? 119 PRO A CG   1  
ATOM 1770  C CD   . PRO A 1 119 ? -27.216 -6.234  -9.502  1.00 0.00 ? 119 PRO A CD   1  
ATOM 1771  H HA   . PRO A 1 119 ? -28.555 -5.670  -6.632  1.00 0.00 ? 119 PRO A HA   1  
ATOM 1772  H HB2  . PRO A 1 119 ? -28.648 -8.289  -7.341  1.00 0.00 ? 119 PRO A HB2  1  
ATOM 1773  H HB3  . PRO A 1 119 ? -29.600 -7.040  -8.152  1.00 0.00 ? 119 PRO A HB3  1  
ATOM 1774  H HG2  . PRO A 1 119 ? -27.016 -8.296  -8.993  1.00 0.00 ? 119 PRO A HG2  1  
ATOM 1775  H HG3  . PRO A 1 119 ? -28.444 -7.914  -9.971  1.00 0.00 ? 119 PRO A HG3  1  
ATOM 1776  H HD2  . PRO A 1 119 ? -26.236 -6.347  -9.942  1.00 0.00 ? 119 PRO A HD2  1  
ATOM 1777  H HD3  . PRO A 1 119 ? -27.870 -5.690  -10.167 1.00 0.00 ? 119 PRO A HD3  1  
ATOM 1778  N N    . SER A 1 120 ? -26.942 -6.440  -4.902  1.00 0.00 ? 120 SER A N    1  
ATOM 1779  C CA   . SER A 1 120 ? -26.088 -6.959  -3.840  1.00 0.00 ? 120 SER A CA   1  
ATOM 1780  C C    . SER A 1 120 ? -26.910 -7.717  -2.802  1.00 0.00 ? 120 SER A C    1  
ATOM 1781  O O    . SER A 1 120 ? -28.099 -7.455  -2.624  1.00 0.00 ? 120 SER A O    1  
ATOM 1782  C CB   . SER A 1 120 ? -25.325 -5.816  -3.166  1.00 0.00 ? 120 SER A CB   1  
ATOM 1783  O OG   . SER A 1 120 ? -24.318 -6.314  -2.302  1.00 0.00 ? 120 SER A OG   1  
ATOM 1784  H H    . SER A 1 120 ? -27.558 -5.703  -4.704  1.00 0.00 ? 120 SER A H    1  
ATOM 1785  H HA   . SER A 1 120 ? -25.378 -7.639  -4.287  1.00 0.00 ? 120 SER A HA   1  
ATOM 1786  H HB2  . SER A 1 120 ? -24.861 -5.201  -3.922  1.00 0.00 ? 120 SER A HB2  1  
ATOM 1787  H HB3  . SER A 1 120 ? -26.015 -5.218  -2.589  1.00 0.00 ? 120 SER A HB3  1  
ATOM 1788  H HG   . SER A 1 120 ? -24.526 -6.074  -1.396  1.00 0.00 ? 120 SER A HG   1  
ATOM 1789  N N    . SER A 1 121 ? -26.267 -8.660  -2.121  1.00 0.00 ? 121 SER A N    1  
ATOM 1790  C CA   . SER A 1 121 ? -26.938 -9.461  -1.104  1.00 0.00 ? 121 SER A CA   1  
ATOM 1791  C C    . SER A 1 121 ? -27.403 -8.586  0.057   1.00 0.00 ? 121 SER A C    1  
ATOM 1792  O O    . SER A 1 121 ? -26.725 -7.634  0.442   1.00 0.00 ? 121 SER A O    1  
ATOM 1793  C CB   . SER A 1 121 ? -26.004 -10.557 -0.589  1.00 0.00 ? 121 SER A CB   1  
ATOM 1794  O OG   . SER A 1 121 ? -26.736 -11.698 -0.175  1.00 0.00 ? 121 SER A OG   1  
ATOM 1795  H H    . SER A 1 121 ? -25.318 -8.823  -2.309  1.00 0.00 ? 121 SER A H    1  
ATOM 1796  H HA   . SER A 1 121 ? -27.802 -9.921  -1.561  1.00 0.00 ? 121 SER A HA   1  
ATOM 1797  H HB2  . SER A 1 121 ? -25.324 -10.846 -1.376  1.00 0.00 ? 121 SER A HB2  1  
ATOM 1798  H HB3  . SER A 1 121 ? -25.441 -10.180 0.253   1.00 0.00 ? 121 SER A HB3  1  
ATOM 1799  H HG   . SER A 1 121 ? -26.576 -11.860 0.757   1.00 0.00 ? 121 SER A HG   1  
ATOM 1800  N N    . GLY A 1 122 ? -28.566 -8.917  0.610   1.00 0.00 ? 122 GLY A N    1  
ATOM 1801  C CA   . GLY A 1 122 ? -29.102 -8.152  1.721   1.00 0.00 ? 122 GLY A CA   1  
ATOM 1802  C C    . GLY A 1 122 ? -30.415 -8.714  2.231   1.00 0.00 ? 122 GLY A C    1  
ATOM 1803  O O    . GLY A 1 122 ? -30.650 -8.761  3.438   1.00 0.00 ? 122 GLY A O    1  
ATOM 1804  H H    . GLY A 1 122 ? -29.063 -9.686  0.262   1.00 0.00 ? 122 GLY A H    1  
ATOM 1805  H HA2  . GLY A 1 122 ? -28.384 -8.156  2.527   1.00 0.00 ? 122 GLY A HA2  1  
ATOM 1806  H HA3  . GLY A 1 122 ? -29.261 -7.134  1.399   1.00 0.00 ? 122 GLY A HA3  1  
ATOM 1807  N N    . GLY A 1 1   ? 2.699   38.117  -6.104  1.00 0.00 ? 1   GLY A N    2  
ATOM 1808  C CA   . GLY A 1 1   ? 3.539   38.569  -5.010  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1809  C C    . GLY A 1 1   ? 4.094   37.420  -4.192  1.00 0.00 ? 1   GLY A C    2  
ATOM 1810  O O    . GLY A 1 1   ? 3.388   36.452  -3.911  1.00 0.00 ? 1   GLY A O    2  
ATOM 1811  H H1   . GLY A 1 1   ? 2.928   37.297  -6.588  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1812  H HA2  . GLY A 1 1   ? 4.362   39.140  -5.415  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1813  H HA3  . GLY A 1 1   ? 2.956   39.208  -4.363  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1814  N N    . SER A 1 2   ? 5.363   37.526  -3.810  1.00 0.00 ? 2   SER A N    2  
ATOM 1815  C CA   . SER A 1 2   ? 6.014   36.485  -3.024  1.00 0.00 ? 2   SER A CA   2  
ATOM 1816  C C    . SER A 1 2   ? 6.427   37.016  -1.655  1.00 0.00 ? 2   SER A C    2  
ATOM 1817  O O    . SER A 1 2   ? 6.551   38.225  -1.457  1.00 0.00 ? 2   SER A O    2  
ATOM 1818  C CB   . SER A 1 2   ? 7.239   35.947  -3.766  1.00 0.00 ? 2   SER A CB   2  
ATOM 1819  O OG   . SER A 1 2   ? 6.906   35.566  -5.090  1.00 0.00 ? 2   SER A OG   2  
ATOM 1820  H H    . SER A 1 2   ? 5.873   38.323  -4.065  1.00 0.00 ? 2   SER A H    2  
ATOM 1821  H HA   . SER A 1 2   ? 5.305   35.681  -2.886  1.00 0.00 ? 2   SER A HA   2  
ATOM 1822  H HB2  . SER A 1 2   ? 7.998   36.713  -3.805  1.00 0.00 ? 2   SER A HB2  2  
ATOM 1823  H HB3  . SER A 1 2   ? 7.623   35.084  -3.241  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1824  H HG   . SER A 1 2   ? 5.980   35.317  -5.128  1.00 0.00 ? 2   SER A HG   2  
ATOM 1825  N N    . SER A 1 3   ? 6.639   36.103  -0.712  1.00 0.00 ? 3   SER A N    2  
ATOM 1826  C CA   . SER A 1 3   ? 7.035   36.478  0.640   1.00 0.00 ? 3   SER A CA   2  
ATOM 1827  C C    . SER A 1 3   ? 8.515   36.187  0.874   1.00 0.00 ? 3   SER A C    2  
ATOM 1828  O O    . SER A 1 3   ? 8.996   35.091  0.589   1.00 0.00 ? 3   SER A O    2  
ATOM 1829  C CB   . SER A 1 3   ? 6.187   35.728  1.669   1.00 0.00 ? 3   SER A CB   2  
ATOM 1830  O OG   . SER A 1 3   ? 6.404   34.330  1.586   1.00 0.00 ? 3   SER A OG   2  
ATOM 1831  H H    . SER A 1 3   ? 6.524   35.154  -0.931  1.00 0.00 ? 3   SER A H    2  
ATOM 1832  H HA   . SER A 1 3   ? 6.867   37.539  0.753   1.00 0.00 ? 3   SER A HA   2  
ATOM 1833  H HB2  . SER A 1 3   ? 6.450   36.062  2.661   1.00 0.00 ? 3   SER A HB2  2  
ATOM 1834  H HB3  . SER A 1 3   ? 5.142   35.930  1.486   1.00 0.00 ? 3   SER A HB3  2  
ATOM 1835  H HG   . SER A 1 3   ? 5.567   33.885  1.433   1.00 0.00 ? 3   SER A HG   2  
ATOM 1836  N N    . GLY A 1 4   ? 9.231   37.178  1.395   1.00 0.00 ? 4   GLY A N    2  
ATOM 1837  C CA   . GLY A 1 4   ? 10.649  37.010  1.658   1.00 0.00 ? 4   GLY A CA   2  
ATOM 1838  C C    . GLY A 1 4   ? 11.505  37.326  0.448   1.00 0.00 ? 4   GLY A C    2  
ATOM 1839  O O    . GLY A 1 4   ? 10.986  37.579  -0.639  1.00 0.00 ? 4   GLY A O    2  
ATOM 1840  H H    . GLY A 1 4   ? 8.794   38.031  1.602   1.00 0.00 ? 4   GLY A H    2  
ATOM 1841  H HA2  . GLY A 1 4   ? 10.933  37.664  2.469   1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1842  H HA3  . GLY A 1 4   ? 10.829  35.987  1.955   1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1843  N N    . SER A 1 5   ? 12.820  37.314  0.637   1.00 0.00 ? 5   SER A N    2  
ATOM 1844  C CA   . SER A 1 5   ? 13.751  37.608  -0.447  1.00 0.00 ? 5   SER A CA   2  
ATOM 1845  C C    . SER A 1 5   ? 14.600  36.385  -0.781  1.00 0.00 ? 5   SER A C    2  
ATOM 1846  O O    . SER A 1 5   ? 15.805  36.494  -1.002  1.00 0.00 ? 5   SER A O    2  
ATOM 1847  C CB   . SER A 1 5   ? 14.655  38.782  -0.068  1.00 0.00 ? 5   SER A CB   2  
ATOM 1848  O OG   . SER A 1 5   ? 15.263  38.571  1.194   1.00 0.00 ? 5   SER A OG   2  
ATOM 1849  H H    . SER A 1 5   ? 13.174  37.106  1.527   1.00 0.00 ? 5   SER A H    2  
ATOM 1850  H HA   . SER A 1 5   ? 13.171  37.877  -1.318  1.00 0.00 ? 5   SER A HA   2  
ATOM 1851  H HB2  . SER A 1 5   ? 15.428  38.893  -0.813  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1852  H HB3  . SER A 1 5   ? 14.065  39.687  -0.024  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1853  H HG   . SER A 1 5   ? 15.559  39.411  1.552   1.00 0.00 ? 5   SER A HG   2  
ATOM 1854  N N    . SER A 1 6   ? 13.960  35.220  -0.814  1.00 0.00 ? 6   SER A N    2  
ATOM 1855  C CA   . SER A 1 6   ? 14.656  33.974  -1.116  1.00 0.00 ? 6   SER A CA   2  
ATOM 1856  C C    . SER A 1 6   ? 14.575  33.654  -2.606  1.00 0.00 ? 6   SER A C    2  
ATOM 1857  O O    . SER A 1 6   ? 13.545  33.872  -3.244  1.00 0.00 ? 6   SER A O    2  
ATOM 1858  C CB   . SER A 1 6   ? 14.062  32.823  -0.302  1.00 0.00 ? 6   SER A CB   2  
ATOM 1859  O OG   . SER A 1 6   ? 14.330  32.985  1.080   1.00 0.00 ? 6   SER A OG   2  
ATOM 1860  H H    . SER A 1 6   ? 12.998  35.197  -0.629  1.00 0.00 ? 6   SER A H    2  
ATOM 1861  H HA   . SER A 1 6   ? 15.693  34.100  -0.843  1.00 0.00 ? 6   SER A HA   2  
ATOM 1862  H HB2  . SER A 1 6   ? 12.993  32.796  -0.449  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1863  H HB3  . SER A 1 6   ? 14.495  31.891  -0.634  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1864  H HG   . SER A 1 6   ? 13.596  32.635  1.591   1.00 0.00 ? 6   SER A HG   2  
ATOM 1865  N N    . GLY A 1 7   ? 15.669  33.135  -3.154  1.00 0.00 ? 7   GLY A N    2  
ATOM 1866  C CA   . GLY A 1 7   ? 15.702  32.793  -4.564  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1867  C C    . GLY A 1 7   ? 14.697  31.716  -4.923  1.00 0.00 ? 7   GLY A C    2  
ATOM 1868  O O    . GLY A 1 7   ? 13.487  31.932  -4.841  1.00 0.00 ? 7   GLY A O    2  
ATOM 1869  H H    . GLY A 1 7   ? 16.461  32.983  -2.596  1.00 0.00 ? 7   GLY A H    2  
ATOM 1870  H HA2  . GLY A 1 7   ? 15.487  33.679  -5.143  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1871  H HA3  . GLY A 1 7   ? 16.692  32.442  -4.815  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1872  N N    . THR A 1 8   ? 15.197  30.552  -5.323  1.00 0.00 ? 8   THR A N    2  
ATOM 1873  C CA   . THR A 1 8   ? 14.335  29.438  -5.699  1.00 0.00 ? 8   THR A CA   2  
ATOM 1874  C C    . THR A 1 8   ? 13.401  29.056  -4.556  1.00 0.00 ? 8   THR A C    2  
ATOM 1875  O O    . THR A 1 8   ? 13.537  29.552  -3.437  1.00 0.00 ? 8   THR A O    2  
ATOM 1876  C CB   . THR A 1 8   ? 15.160  28.203  -6.108  1.00 0.00 ? 8   THR A CB   2  
ATOM 1877  O OG1  . THR A 1 8   ? 16.112  27.889  -5.086  1.00 0.00 ? 8   THR A OG1  2  
ATOM 1878  C CG2  . THR A 1 8   ? 15.883  28.446  -7.424  1.00 0.00 ? 8   THR A CG2  2  
ATOM 1879  H H    . THR A 1 8   ? 16.170  30.440  -5.368  1.00 0.00 ? 8   THR A H    2  
ATOM 1880  H HA   . THR A 1 8   ? 13.743  29.746  -6.548  1.00 0.00 ? 8   THR A HA   2  
ATOM 1881  H HB   . THR A 1 8   ? 14.488  27.366  -6.233  1.00 0.00 ? 8   THR A HB   2  
ATOM 1882  H HG1  . THR A 1 8   ? 16.912  28.402  -5.224  1.00 0.00 ? 8   THR A HG1  2  
ATOM 1883  H HG21 . THR A 1 8   ? 16.788  27.857  -7.452  1.00 0.00 ? 8   THR A HG21 2  
ATOM 1884  H HG22 . THR A 1 8   ? 16.132  29.493  -7.509  1.00 0.00 ? 8   THR A HG22 2  
ATOM 1885  H HG23 . THR A 1 8   ? 15.242  28.160  -8.244  1.00 0.00 ? 8   THR A HG23 2  
ATOM 1886  N N    . LEU A 1 9   ? 12.453  28.171  -4.844  1.00 0.00 ? 9   LEU A N    2  
ATOM 1887  C CA   . LEU A 1 9   ? 11.496  27.721  -3.840  1.00 0.00 ? 9   LEU A CA   2  
ATOM 1888  C C    . LEU A 1 9   ? 11.738  26.261  -3.473  1.00 0.00 ? 9   LEU A C    2  
ATOM 1889  O O    . LEU A 1 9   ? 11.663  25.374  -4.324  1.00 0.00 ? 9   LEU A O    2  
ATOM 1890  C CB   . LEU A 1 9   ? 10.066  27.900  -4.353  1.00 0.00 ? 9   LEU A CB   2  
ATOM 1891  C CG   . LEU A 1 9   ? 9.717   29.286  -4.896  1.00 0.00 ? 9   LEU A CG   2  
ATOM 1892  C CD1  . LEU A 1 9   ? 8.348   29.270  -5.559  1.00 0.00 ? 9   LEU A CD1  2  
ATOM 1893  C CD2  . LEU A 1 9   ? 9.760   30.322  -3.782  1.00 0.00 ? 9   LEU A CD2  2  
ATOM 1894  H H    . LEU A 1 9   ? 12.395  27.811  -5.753  1.00 0.00 ? 9   LEU A H    2  
ATOM 1895  H HA   . LEU A 1 9   ? 11.632  28.329  -2.957  1.00 0.00 ? 9   LEU A HA   2  
ATOM 1896  H HB2  . LEU A 1 9   ? 9.908   27.185  -5.146  1.00 0.00 ? 9   LEU A HB2  2  
ATOM 1897  H HB3  . LEU A 1 9   ? 9.393   27.684  -3.536  1.00 0.00 ? 9   LEU A HB3  2  
ATOM 1898  H HG   . LEU A 1 9   ? 10.445  29.567  -5.644  1.00 0.00 ? 9   LEU A HG   2  
ATOM 1899  H HD11 . LEU A 1 9   ? 7.676   29.915  -5.013  1.00 0.00 ? 9   LEU A HD11 2  
ATOM 1900  H HD12 . LEU A 1 9   ? 7.959   28.262  -5.557  1.00 0.00 ? 9   LEU A HD12 2  
ATOM 1901  H HD13 . LEU A 1 9   ? 8.436   29.620  -6.577  1.00 0.00 ? 9   LEU A HD13 2  
ATOM 1902  H HD21 . LEU A 1 9   ? 9.620   29.832  -2.830  1.00 0.00 ? 9   LEU A HD21 2  
ATOM 1903  H HD22 . LEU A 1 9   ? 8.973   31.046  -3.934  1.00 0.00 ? 9   LEU A HD22 2  
ATOM 1904  H HD23 . LEU A 1 9   ? 10.717  30.822  -3.793  1.00 0.00 ? 9   LEU A HD23 2  
ATOM 1905  N N    . THR A 1 10  ? 12.027  26.016  -2.198  1.00 0.00 ? 10  THR A N    2  
ATOM 1906  C CA   . THR A 1 10  ? 12.278  24.663  -1.718  1.00 0.00 ? 10  THR A CA   2  
ATOM 1907  C C    . THR A 1 10  ? 11.483  24.374  -0.450  1.00 0.00 ? 10  THR A C    2  
ATOM 1908  O O    . THR A 1 10  ? 11.076  25.291  0.263   1.00 0.00 ? 10  THR A O    2  
ATOM 1909  C CB   . THR A 1 10  ? 13.775  24.437  -1.434  1.00 0.00 ? 10  THR A CB   2  
ATOM 1910  O OG1  . THR A 1 10  ? 14.009  23.064  -1.100  1.00 0.00 ? 10  THR A OG1  2  
ATOM 1911  C CG2  . THR A 1 10  ? 14.251  25.329  -0.297  1.00 0.00 ? 10  THR A CG2  2  
ATOM 1912  H H    . THR A 1 10  ? 12.072  26.765  -1.567  1.00 0.00 ? 10  THR A H    2  
ATOM 1913  H HA   . THR A 1 10  ? 11.971  23.973  -2.489  1.00 0.00 ? 10  THR A HA   2  
ATOM 1914  H HB   . THR A 1 10  ? 14.336  24.684  -2.324  1.00 0.00 ? 10  THR A HB   2  
ATOM 1915  H HG1  . THR A 1 10  ? 14.954  22.911  -1.021  1.00 0.00 ? 10  THR A HG1  2  
ATOM 1916  H HG21 . THR A 1 10  ? 13.464  26.016  -0.024  1.00 0.00 ? 10  THR A HG21 2  
ATOM 1917  H HG22 . THR A 1 10  ? 15.121  25.885  -0.615  1.00 0.00 ? 10  THR A HG22 2  
ATOM 1918  H HG23 . THR A 1 10  ? 14.507  24.718  0.556   1.00 0.00 ? 10  THR A HG23 2  
ATOM 1919  N N    . VAL A 1 11  ? 11.265  23.092  -0.173  1.00 0.00 ? 11  VAL A N    2  
ATOM 1920  C CA   . VAL A 1 11  ? 10.520  22.681  1.011   1.00 0.00 ? 11  VAL A CA   2  
ATOM 1921  C C    . VAL A 1 11  ? 11.139  21.441  1.647   1.00 0.00 ? 11  VAL A C    2  
ATOM 1922  O O    . VAL A 1 11  ? 11.647  20.562  0.952   1.00 0.00 ? 11  VAL A O    2  
ATOM 1923  C CB   . VAL A 1 11  ? 9.046   22.390  0.673   1.00 0.00 ? 11  VAL A CB   2  
ATOM 1924  C CG1  . VAL A 1 11  ? 8.368   23.635  0.123   1.00 0.00 ? 11  VAL A CG1  2  
ATOM 1925  C CG2  . VAL A 1 11  ? 8.944   21.237  -0.315  1.00 0.00 ? 11  VAL A CG2  2  
ATOM 1926  H H    . VAL A 1 11  ? 11.615  22.406  -0.780  1.00 0.00 ? 11  VAL A H    2  
ATOM 1927  H HA   . VAL A 1 11  ? 10.551  23.493  1.723   1.00 0.00 ? 11  VAL A HA   2  
ATOM 1928  H HB   . VAL A 1 11  ? 8.539   22.103  1.582   1.00 0.00 ? 11  VAL A HB   2  
ATOM 1929  H HG11 . VAL A 1 11  ? 8.985   24.499  0.324   1.00 0.00 ? 11  VAL A HG11 2  
ATOM 1930  H HG12 . VAL A 1 11  ? 8.230   23.530  -0.943  1.00 0.00 ? 11  VAL A HG12 2  
ATOM 1931  H HG13 . VAL A 1 11  ? 7.407   23.762  0.600   1.00 0.00 ? 11  VAL A HG13 2  
ATOM 1932  H HG21 . VAL A 1 11  ? 9.925   21.007  -0.701  1.00 0.00 ? 11  VAL A HG21 2  
ATOM 1933  H HG22 . VAL A 1 11  ? 8.541   20.368  0.185   1.00 0.00 ? 11  VAL A HG22 2  
ATOM 1934  H HG23 . VAL A 1 11  ? 8.292   21.517  -1.130  1.00 0.00 ? 11  VAL A HG23 2  
ATOM 1935  N N    . ASN A 1 12  ? 11.091  21.377  2.973   1.00 0.00 ? 12  ASN A N    2  
ATOM 1936  C CA   . ASN A 1 12  ? 11.647  20.244  3.704   1.00 0.00 ? 12  ASN A CA   2  
ATOM 1937  C C    . ASN A 1 12  ? 10.764  19.877  4.893   1.00 0.00 ? 12  ASN A C    2  
ATOM 1938  O O    . ASN A 1 12  ? 9.935   20.673  5.333   1.00 0.00 ? 12  ASN A O    2  
ATOM 1939  C CB   . ASN A 1 12  ? 13.063  20.567  4.187   1.00 0.00 ? 12  ASN A CB   2  
ATOM 1940  C CG   . ASN A 1 12  ? 13.114  21.833  5.021   1.00 0.00 ? 12  ASN A CG   2  
ATOM 1941  O OD1  . ASN A 1 12  ? 12.082  22.429  5.329   1.00 0.00 ? 12  ASN A OD1  2  
ATOM 1942  N ND2  . ASN A 1 12  ? 14.320  22.250  5.389   1.00 0.00 ? 12  ASN A ND2  2  
ATOM 1943  H H    . ASN A 1 12  ? 10.673  22.109  3.473   1.00 0.00 ? 12  ASN A H    2  
ATOM 1944  H HA   . ASN A 1 12  ? 11.690  19.403  3.029   1.00 0.00 ? 12  ASN A HA   2  
ATOM 1945  H HB2  . ASN A 1 12  ? 13.427  19.748  4.789   1.00 0.00 ? 12  ASN A HB2  2  
ATOM 1946  H HB3  . ASN A 1 12  ? 13.709  20.694  3.331   1.00 0.00 ? 12  ASN A HB3  2  
ATOM 1947  H HD21 . ASN A 1 12  ? 15.098  21.725  5.106   1.00 0.00 ? 12  ASN A HD21 2  
ATOM 1948  H HD22 . ASN A 1 12  ? 14.383  23.065  5.929   1.00 0.00 ? 12  ASN A HD22 2  
ATOM 1949  N N    . GLY A 1 13  ? 10.948  18.666  5.408   1.00 0.00 ? 13  GLY A N    2  
ATOM 1950  C CA   . GLY A 1 13  ? 10.162  18.214  6.541   1.00 0.00 ? 13  GLY A CA   2  
ATOM 1951  C C    . GLY A 1 13  ? 9.999   16.707  6.570   1.00 0.00 ? 13  GLY A C    2  
ATOM 1952  O O    . GLY A 1 13  ? 10.714  15.971  5.890   1.00 0.00 ? 13  GLY A O    2  
ATOM 1953  H H    . GLY A 1 13  ? 11.624  18.073  5.016   1.00 0.00 ? 13  GLY A H    2  
ATOM 1954  H HA2  . GLY A 1 13  ? 10.647  18.531  7.452   1.00 0.00 ? 13  GLY A HA2  2  
ATOM 1955  H HA3  . GLY A 1 13  ? 9.183   18.669  6.490   1.00 0.00 ? 13  GLY A HA3  2  
ATOM 1956  N N    . PRO A 1 14  ? 9.039   16.227  7.375   1.00 0.00 ? 14  PRO A N    2  
ATOM 1957  C CA   . PRO A 1 14  ? 8.763   14.794  7.511   1.00 0.00 ? 14  PRO A CA   2  
ATOM 1958  C C    . PRO A 1 14  ? 8.139   14.202  6.251   1.00 0.00 ? 14  PRO A C    2  
ATOM 1959  O O    . PRO A 1 14  ? 7.724   14.918  5.340   1.00 0.00 ? 14  PRO A O    2  
ATOM 1960  C CB   . PRO A 1 14  ? 7.774   14.732  8.677   1.00 0.00 ? 14  PRO A CB   2  
ATOM 1961  C CG   . PRO A 1 14  ? 7.110   16.066  8.683   1.00 0.00 ? 14  PRO A CG   2  
ATOM 1962  C CD   . PRO A 1 14  ? 8.149   17.047  8.215   1.00 0.00 ? 14  PRO A CD   2  
ATOM 1963  H HA   . PRO A 1 14  ? 9.655   14.240  7.763   1.00 0.00 ? 14  PRO A HA   2  
ATOM 1964  H HB2  . PRO A 1 14  ? 7.062   13.936  8.507   1.00 0.00 ? 14  PRO A HB2  2  
ATOM 1965  H HB3  . PRO A 1 14  ? 8.308   14.554  9.598   1.00 0.00 ? 14  PRO A HB3  2  
ATOM 1966  H HG2  . PRO A 1 14  ? 6.269   16.060  8.007   1.00 0.00 ? 14  PRO A HG2  2  
ATOM 1967  H HG3  . PRO A 1 14  ? 6.788   16.311  9.684   1.00 0.00 ? 14  PRO A HG3  2  
ATOM 1968  H HD2  . PRO A 1 14  ? 7.690   17.835  7.636   1.00 0.00 ? 14  PRO A HD2  2  
ATOM 1969  H HD3  . PRO A 1 14  ? 8.686   17.459  9.057   1.00 0.00 ? 14  PRO A HD3  2  
ATOM 1970  N N    . PRO A 1 15  ? 8.070   12.864  6.197   1.00 0.00 ? 15  PRO A N    2  
ATOM 1971  C CA   . PRO A 1 15  ? 7.497   12.147  5.054   1.00 0.00 ? 15  PRO A CA   2  
ATOM 1972  C C    . PRO A 1 15  ? 5.986   12.326  4.955   1.00 0.00 ? 15  PRO A C    2  
ATOM 1973  O O    . PRO A 1 15  ? 5.238   11.854  5.812   1.00 0.00 ? 15  PRO A O    2  
ATOM 1974  C CB   . PRO A 1 15  ? 7.844   10.684  5.343   1.00 0.00 ? 15  PRO A CB   2  
ATOM 1975  C CG   . PRO A 1 15  ? 7.992   10.615  6.824   1.00 0.00 ? 15  PRO A CG   2  
ATOM 1976  C CD   . PRO A 1 15  ? 8.546   11.948  7.247   1.00 0.00 ? 15  PRO A CD   2  
ATOM 1977  H HA   . PRO A 1 15  ? 7.956   12.450  4.125   1.00 0.00 ? 15  PRO A HA   2  
ATOM 1978  H HB2  . PRO A 1 15  ? 7.044   10.046  4.995   1.00 0.00 ? 15  PRO A HB2  2  
ATOM 1979  H HB3  . PRO A 1 15  ? 8.764   10.423  4.842   1.00 0.00 ? 15  PRO A HB3  2  
ATOM 1980  H HG2  . PRO A 1 15  ? 7.029   10.447  7.282   1.00 0.00 ? 15  PRO A HG2  2  
ATOM 1981  H HG3  . PRO A 1 15  ? 8.678   9.824   7.088   1.00 0.00 ? 15  PRO A HG3  2  
ATOM 1982  H HD2  . PRO A 1 15  ? 8.153   12.230  8.212   1.00 0.00 ? 15  PRO A HD2  2  
ATOM 1983  H HD3  . PRO A 1 15  ? 9.625   11.917  7.271   1.00 0.00 ? 15  PRO A HD3  2  
ATOM 1984  N N    . ILE A 1 16  ? 5.544   13.011  3.906   1.00 0.00 ? 16  ILE A N    2  
ATOM 1985  C CA   . ILE A 1 16  ? 4.121   13.251  3.696   1.00 0.00 ? 16  ILE A CA   2  
ATOM 1986  C C    . ILE A 1 16  ? 3.479   12.105  2.920   1.00 0.00 ? 16  ILE A C    2  
ATOM 1987  O O    . ILE A 1 16  ? 4.029   11.631  1.925   1.00 0.00 ? 16  ILE A O    2  
ATOM 1988  C CB   . ILE A 1 16  ? 3.879   14.569  2.937   1.00 0.00 ? 16  ILE A CB   2  
ATOM 1989  C CG1  . ILE A 1 16  ? 4.551   15.734  3.666   1.00 0.00 ? 16  ILE A CG1  2  
ATOM 1990  C CG2  . ILE A 1 16  ? 2.387   14.824  2.781   1.00 0.00 ? 16  ILE A CG2  2  
ATOM 1991  C CD1  . ILE A 1 16  ? 4.941   16.875  2.752   1.00 0.00 ? 16  ILE A CD1  2  
ATOM 1992  H H    . ILE A 1 16  ? 6.189   13.362  3.258   1.00 0.00 ? 16  ILE A H    2  
ATOM 1993  H HA   . ILE A 1 16  ? 3.649   13.325  4.665   1.00 0.00 ? 16  ILE A HA   2  
ATOM 1994  H HB   . ILE A 1 16  ? 4.308   14.475  1.951   1.00 0.00 ? 16  ILE A HB   2  
ATOM 1995  H HG12 . ILE A 1 16  ? 3.875   16.122  4.411   1.00 0.00 ? 16  ILE A HG12 2  
ATOM 1996  H HG13 . ILE A 1 16  ? 5.448   15.376  4.151   1.00 0.00 ? 16  ILE A HG13 2  
ATOM 1997  H HG21 . ILE A 1 16  ? 2.046   15.460  3.585   1.00 0.00 ? 16  ILE A HG21 2  
ATOM 1998  H HG22 . ILE A 1 16  ? 2.203   15.311  1.835   1.00 0.00 ? 16  ILE A HG22 2  
ATOM 1999  H HG23 . ILE A 1 16  ? 1.856   13.885  2.814   1.00 0.00 ? 16  ILE A HG23 2  
ATOM 2000  H HD11 . ILE A 1 16  ? 4.894   17.806  3.298   1.00 0.00 ? 16  ILE A HD11 2  
ATOM 2001  H HD12 . ILE A 1 16  ? 5.945   16.720  2.389   1.00 0.00 ? 16  ILE A HD12 2  
ATOM 2002  H HD13 . ILE A 1 16  ? 4.258   16.915  1.915   1.00 0.00 ? 16  ILE A HD13 2  
ATOM 2003  N N    . ILE A 1 17  ? 2.313   11.667  3.382   1.00 0.00 ? 17  ILE A N    2  
ATOM 2004  C CA   . ILE A 1 17  ? 1.595   10.579  2.730   1.00 0.00 ? 17  ILE A CA   2  
ATOM 2005  C C    . ILE A 1 17  ? 0.185   11.008  2.338   1.00 0.00 ? 17  ILE A C    2  
ATOM 2006  O O    . ILE A 1 17  ? -0.714  11.062  3.178   1.00 0.00 ? 17  ILE A O    2  
ATOM 2007  C CB   . ILE A 1 17  ? 1.509   9.338   3.637   1.00 0.00 ? 17  ILE A CB   2  
ATOM 2008  C CG1  . ILE A 1 17  ? 2.909   8.894   4.066   1.00 0.00 ? 17  ILE A CG1  2  
ATOM 2009  C CG2  . ILE A 1 17  ? 0.785   8.207   2.921   1.00 0.00 ? 17  ILE A CG2  2  
ATOM 2010  C CD1  . ILE A 1 17  ? 2.918   8.061   5.329   1.00 0.00 ? 17  ILE A CD1  2  
ATOM 2011  H H    . ILE A 1 17  ? 1.926   12.085  4.179   1.00 0.00 ? 17  ILE A H    2  
ATOM 2012  H HA   . ILE A 1 17  ? 2.139   10.309  1.836   1.00 0.00 ? 17  ILE A HA   2  
ATOM 2013  H HB   . ILE A 1 17  ? 0.937   9.600   4.515   1.00 0.00 ? 17  ILE A HB   2  
ATOM 2014  H HG12 . ILE A 1 17  ? 3.350   8.305   3.278   1.00 0.00 ? 17  ILE A HG12 2  
ATOM 2015  H HG13 . ILE A 1 17  ? 3.518   9.769   4.240   1.00 0.00 ? 17  ILE A HG13 2  
ATOM 2016  H HG21 . ILE A 1 17  ? 1.261   8.020   1.970   1.00 0.00 ? 17  ILE A HG21 2  
ATOM 2017  H HG22 . ILE A 1 17  ? 0.827   7.313   3.526   1.00 0.00 ? 17  ILE A HG22 2  
ATOM 2018  H HG23 . ILE A 1 17  ? -0.246  8.485   2.759   1.00 0.00 ? 17  ILE A HG23 2  
ATOM 2019  H HD11 . ILE A 1 17  ? 3.123   8.697   6.178   1.00 0.00 ? 17  ILE A HD11 2  
ATOM 2020  H HD12 . ILE A 1 17  ? 1.957   7.587   5.456   1.00 0.00 ? 17  ILE A HD12 2  
ATOM 2021  H HD13 . ILE A 1 17  ? 3.686   7.304   5.254   1.00 0.00 ? 17  ILE A HD13 2  
ATOM 2022  N N    . SER A 1 18  ? -0.002  11.310  1.058   1.00 0.00 ? 18  SER A N    2  
ATOM 2023  C CA   . SER A 1 18  ? -1.302  11.736  0.555   1.00 0.00 ? 18  SER A CA   2  
ATOM 2024  C C    . SER A 1 18  ? -2.248  10.547  0.418   1.00 0.00 ? 18  SER A C    2  
ATOM 2025  O O    . SER A 1 18  ? -3.221  10.425  1.163   1.00 0.00 ? 18  SER A O    2  
ATOM 2026  C CB   . SER A 1 18  ? -1.146  12.435  -0.797  1.00 0.00 ? 18  SER A CB   2  
ATOM 2027  O OG   . SER A 1 18  ? -2.294  13.205  -1.109  1.00 0.00 ? 18  SER A OG   2  
ATOM 2028  H H    . SER A 1 18  ? 0.754   11.247  0.437   1.00 0.00 ? 18  SER A H    2  
ATOM 2029  H HA   . SER A 1 18  ? -1.720  12.434  1.265   1.00 0.00 ? 18  SER A HA   2  
ATOM 2030  H HB2  . SER A 1 18  ? -0.287  13.089  -0.764  1.00 0.00 ? 18  SER A HB2  2  
ATOM 2031  H HB3  . SER A 1 18  ? -1.004  11.693  -1.569  1.00 0.00 ? 18  SER A HB3  2  
ATOM 2032  H HG   . SER A 1 18  ? -3.043  12.884  -0.601  1.00 0.00 ? 18  SER A HG   2  
ATOM 2033  N N    . SER A 1 19  ? -1.955  9.672   -0.538  1.00 0.00 ? 19  SER A N    2  
ATOM 2034  C CA   . SER A 1 19  ? -2.781  8.494   -0.776  1.00 0.00 ? 19  SER A CA   2  
ATOM 2035  C C    . SER A 1 19  ? -2.129  7.572   -1.802  1.00 0.00 ? 19  SER A C    2  
ATOM 2036  O O    . SER A 1 19  ? -1.098  7.905   -2.389  1.00 0.00 ? 19  SER A O    2  
ATOM 2037  C CB   . SER A 1 19  ? -4.172  8.909   -1.258  1.00 0.00 ? 19  SER A CB   2  
ATOM 2038  O OG   . SER A 1 19  ? -5.022  9.209   -0.165  1.00 0.00 ? 19  SER A OG   2  
ATOM 2039  H H    . SER A 1 19  ? -1.166  9.824   -1.099  1.00 0.00 ? 19  SER A H    2  
ATOM 2040  H HA   . SER A 1 19  ? -2.877  7.962   0.159   1.00 0.00 ? 19  SER A HA   2  
ATOM 2041  H HB2  . SER A 1 19  ? -4.087  9.784   -1.883  1.00 0.00 ? 19  SER A HB2  2  
ATOM 2042  H HB3  . SER A 1 19  ? -4.609  8.101   -1.827  1.00 0.00 ? 19  SER A HB3  2  
ATOM 2043  H HG   . SER A 1 19  ? -5.726  8.557   -0.118  1.00 0.00 ? 19  SER A HG   2  
ATOM 2044  N N    . THR A 1 20  ? -2.737  6.409   -2.014  1.00 0.00 ? 20  THR A N    2  
ATOM 2045  C CA   . THR A 1 20  ? -2.217  5.437   -2.967  1.00 0.00 ? 20  THR A CA   2  
ATOM 2046  C C    . THR A 1 20  ? -3.138  5.303   -4.174  1.00 0.00 ? 20  THR A C    2  
ATOM 2047  O O    . THR A 1 20  ? -4.327  5.612   -4.096  1.00 0.00 ? 20  THR A O    2  
ATOM 2048  C CB   . THR A 1 20  ? -2.038  4.052   -2.317  1.00 0.00 ? 20  THR A CB   2  
ATOM 2049  O OG1  . THR A 1 20  ? -3.318  3.472   -2.040  1.00 0.00 ? 20  THR A OG1  2  
ATOM 2050  C CG2  . THR A 1 20  ? -1.235  4.159   -1.029  1.00 0.00 ? 20  THR A CG2  2  
ATOM 2051  H H    . THR A 1 20  ? -3.555  6.200   -1.516  1.00 0.00 ? 20  THR A H    2  
ATOM 2052  H HA   . THR A 1 20  ? -1.249  5.782   -3.301  1.00 0.00 ? 20  THR A HA   2  
ATOM 2053  H HB   . THR A 1 20  ? -1.503  3.414   -3.005  1.00 0.00 ? 20  THR A HB   2  
ATOM 2054  H HG1  . THR A 1 20  ? -3.199  2.642   -1.571  1.00 0.00 ? 20  THR A HG1  2  
ATOM 2055  H HG21 . THR A 1 20  ? -0.243  3.764   -1.190  1.00 0.00 ? 20  THR A HG21 2  
ATOM 2056  H HG22 . THR A 1 20  ? -1.726  3.593   -0.251  1.00 0.00 ? 20  THR A HG22 2  
ATOM 2057  H HG23 . THR A 1 20  ? -1.167  5.194   -0.733  1.00 0.00 ? 20  THR A HG23 2  
ATOM 2058  N N    . GLN A 1 21  ? -2.581  4.841   -5.289  1.00 0.00 ? 21  GLN A N    2  
ATOM 2059  C CA   . GLN A 1 21  ? -3.355  4.667   -6.513  1.00 0.00 ? 21  GLN A CA   2  
ATOM 2060  C C    . GLN A 1 21  ? -4.057  3.313   -6.526  1.00 0.00 ? 21  GLN A C    2  
ATOM 2061  O O    . GLN A 1 21  ? -3.937  2.548   -7.483  1.00 0.00 ? 21  GLN A O    2  
ATOM 2062  C CB   . GLN A 1 21  ? -2.447  4.795   -7.738  1.00 0.00 ? 21  GLN A CB   2  
ATOM 2063  C CG   . GLN A 1 21  ? -2.127  6.234   -8.110  1.00 0.00 ? 21  GLN A CG   2  
ATOM 2064  C CD   . GLN A 1 21  ? -1.591  6.366   -9.521  1.00 0.00 ? 21  GLN A CD   2  
ATOM 2065  O OE1  . GLN A 1 21  ? -1.679  5.434   -10.321 1.00 0.00 ? 21  GLN A OE1  2  
ATOM 2066  N NE2  . GLN A 1 21  ? -1.031  7.529   -9.836  1.00 0.00 ? 21  GLN A NE2  2  
ATOM 2067  H H    . GLN A 1 21  ? -1.629  4.612   -5.289  1.00 0.00 ? 21  GLN A H    2  
ATOM 2068  H HA   . GLN A 1 21  ? -4.101  5.446   -6.547  1.00 0.00 ? 21  GLN A HA   2  
ATOM 2069  H HB2  . GLN A 1 21  ? -1.518  4.283   -7.538  1.00 0.00 ? 21  GLN A HB2  2  
ATOM 2070  H HB3  . GLN A 1 21  ? -2.932  4.328   -8.581  1.00 0.00 ? 21  GLN A HB3  2  
ATOM 2071  H HG2  . GLN A 1 21  ? -3.029  6.823   -8.027  1.00 0.00 ? 21  GLN A HG2  2  
ATOM 2072  H HG3  . GLN A 1 21  ? -1.386  6.614   -7.421  1.00 0.00 ? 21  GLN A HG3  2  
ATOM 2073  H HE21 . GLN A 1 21  ? -0.994  8.226   -9.147  1.00 0.00 ? 21  GLN A HE21 2  
ATOM 2074  H HE22 . GLN A 1 21  ? -0.675  7.641   -10.741 1.00 0.00 ? 21  GLN A HE22 2  
ATOM 2075  N N    . THR A 1 22  ? -4.790  3.022   -5.456  1.00 0.00 ? 22  THR A N    2  
ATOM 2076  C CA   . THR A 1 22  ? -5.510  1.760   -5.342  1.00 0.00 ? 22  THR A CA   2  
ATOM 2077  C C    . THR A 1 22  ? -6.259  1.437   -6.630  1.00 0.00 ? 22  THR A C    2  
ATOM 2078  O O    . THR A 1 22  ? -6.377  2.281   -7.518  1.00 0.00 ? 22  THR A O    2  
ATOM 2079  C CB   . THR A 1 22  ? -6.512  1.788   -4.173  1.00 0.00 ? 22  THR A CB   2  
ATOM 2080  O OG1  . THR A 1 22  ? -7.388  2.913   -4.305  1.00 0.00 ? 22  THR A OG1  2  
ATOM 2081  C CG2  . THR A 1 22  ? -5.785  1.859   -2.839  1.00 0.00 ? 22  THR A CG2  2  
ATOM 2082  H H    . THR A 1 22  ? -4.846  3.673   -4.725  1.00 0.00 ? 22  THR A H    2  
ATOM 2083  H HA   . THR A 1 22  ? -4.788  0.980   -5.152  1.00 0.00 ? 22  THR A HA   2  
ATOM 2084  H HB   . THR A 1 22  ? -7.098  0.880   -4.199  1.00 0.00 ? 22  THR A HB   2  
ATOM 2085  H HG1  . THR A 1 22  ? -8.014  2.750   -5.014  1.00 0.00 ? 22  THR A HG1  2  
ATOM 2086  H HG21 . THR A 1 22  ? -4.733  1.669   -2.992  1.00 0.00 ? 22  THR A HG21 2  
ATOM 2087  H HG22 . THR A 1 22  ? -6.191  1.117   -2.167  1.00 0.00 ? 22  THR A HG22 2  
ATOM 2088  H HG23 . THR A 1 22  ? -5.914  2.841   -2.410  1.00 0.00 ? 22  THR A HG23 2  
ATOM 2089  N N    . GLN A 1 23  ? -6.763  0.211   -6.725  1.00 0.00 ? 23  GLN A N    2  
ATOM 2090  C CA   . GLN A 1 23  ? -7.501  -0.222  -7.905  1.00 0.00 ? 23  GLN A CA   2  
ATOM 2091  C C    . GLN A 1 23  ? -8.444  -1.372  -7.566  1.00 0.00 ? 23  GLN A C    2  
ATOM 2092  O O    . GLN A 1 23  ? -8.560  -1.772  -6.408  1.00 0.00 ? 23  GLN A O    2  
ATOM 2093  C CB   . GLN A 1 23  ? -6.532  -0.650  -9.009  1.00 0.00 ? 23  GLN A CB   2  
ATOM 2094  C CG   . GLN A 1 23  ? -5.794  -1.943  -8.703  1.00 0.00 ? 23  GLN A CG   2  
ATOM 2095  C CD   . GLN A 1 23  ? -4.927  -1.841  -7.464  1.00 0.00 ? 23  GLN A CD   2  
ATOM 2096  O OE1  . GLN A 1 23  ? -3.853  -1.239  -7.492  1.00 0.00 ? 23  GLN A OE1  2  
ATOM 2097  N NE2  . GLN A 1 23  ? -5.389  -2.430  -6.368  1.00 0.00 ? 23  GLN A NE2  2  
ATOM 2098  H H    . GLN A 1 23  ? -6.636  -0.416  -5.984  1.00 0.00 ? 23  GLN A H    2  
ATOM 2099  H HA   . GLN A 1 23  ? -8.085  0.615   -8.256  1.00 0.00 ? 23  GLN A HA   2  
ATOM 2100  H HB2  . GLN A 1 23  ? -7.087  -0.785  -9.926  1.00 0.00 ? 23  GLN A HB2  2  
ATOM 2101  H HB3  . GLN A 1 23  ? -5.801  0.131   -9.152  1.00 0.00 ? 23  GLN A HB3  2  
ATOM 2102  H HG2  . GLN A 1 23  ? -6.519  -2.730  -8.553  1.00 0.00 ? 23  GLN A HG2  2  
ATOM 2103  H HG3  . GLN A 1 23  ? -5.165  -2.191  -9.546  1.00 0.00 ? 23  GLN A HG3  2  
ATOM 2104  H HE21 . GLN A 1 23  ? -6.252  -2.893  -6.420  1.00 0.00 ? 23  GLN A HE21 2  
ATOM 2105  H HE22 . GLN A 1 23  ? -4.849  -2.381  -5.553  1.00 0.00 ? 23  GLN A HE22 2  
ATOM 2106  N N    . HIS A 1 24  ? -9.117  -1.899  -8.585  1.00 0.00 ? 24  HIS A N    2  
ATOM 2107  C CA   . HIS A 1 24  ? -10.050 -3.004  -8.394  1.00 0.00 ? 24  HIS A CA   2  
ATOM 2108  C C    . HIS A 1 24  ? -9.338  -4.346  -8.529  1.00 0.00 ? 24  HIS A C    2  
ATOM 2109  O O    . HIS A 1 24  ? -9.794  -5.232  -9.252  1.00 0.00 ? 24  HIS A O    2  
ATOM 2110  C CB   . HIS A 1 24  ? -11.192 -2.915  -9.408  1.00 0.00 ? 24  HIS A CB   2  
ATOM 2111  C CG   . HIS A 1 24  ? -10.806 -3.358  -10.785 1.00 0.00 ? 24  HIS A CG   2  
ATOM 2112  N ND1  . HIS A 1 24  ? -9.801  -2.759  -11.515 1.00 0.00 ? 24  HIS A ND1  2  
ATOM 2113  C CD2  . HIS A 1 24  ? -11.296 -4.350  -11.566 1.00 0.00 ? 24  HIS A CD2  2  
ATOM 2114  C CE1  . HIS A 1 24  ? -9.690  -3.362  -12.685 1.00 0.00 ? 24  HIS A CE1  2  
ATOM 2115  N NE2  . HIS A 1 24  ? -10.586 -4.331  -12.741 1.00 0.00 ? 24  HIS A NE2  2  
ATOM 2116  H H    . HIS A 1 24  ? -8.981  -1.537  -9.485  1.00 0.00 ? 24  HIS A H    2  
ATOM 2117  H HA   . HIS A 1 24  ? -10.458 -2.925  -7.398  1.00 0.00 ? 24  HIS A HA   2  
ATOM 2118  H HB2  . HIS A 1 24  ? -12.008 -3.538  -9.075  1.00 0.00 ? 24  HIS A HB2  2  
ATOM 2119  H HB3  . HIS A 1 24  ? -11.530 -1.890  -9.470  1.00 0.00 ? 24  HIS A HB3  2  
ATOM 2120  H HD1  . HIS A 1 24  ? -9.252  -2.004  -11.219 1.00 0.00 ? 24  HIS A HD1  2  
ATOM 2121  H HD2  . HIS A 1 24  ? -12.097 -5.030  -11.312 1.00 0.00 ? 24  HIS A HD2  2  
ATOM 2122  H HE1  . HIS A 1 24  ? -8.987  -3.107  -13.464 1.00 0.00 ? 24  HIS A HE1  2  
ATOM 2123  H HE2  . HIS A 1 24  ? -10.776 -4.879  -13.531 1.00 0.00 ? 24  HIS A HE2  2  
ATOM 2124  N N    . ALA A 1 25  ? -8.217  -4.489  -7.830  1.00 0.00 ? 25  ALA A N    2  
ATOM 2125  C CA   . ALA A 1 25  ? -7.443  -5.723  -7.871  1.00 0.00 ? 25  ALA A CA   2  
ATOM 2126  C C    . ALA A 1 25  ? -8.356  -6.941  -7.966  1.00 0.00 ? 25  ALA A C    2  
ATOM 2127  O O    . ALA A 1 25  ? -9.139  -7.216  -7.056  1.00 0.00 ? 25  ALA A O    2  
ATOM 2128  C CB   . ALA A 1 25  ? -6.549  -5.827  -6.644  1.00 0.00 ? 25  ALA A CB   2  
ATOM 2129  H H    . ALA A 1 25  ? -7.904  -3.747  -7.271  1.00 0.00 ? 25  ALA A H    2  
ATOM 2130  H HA   . ALA A 1 25  ? -6.810  -5.691  -8.745  1.00 0.00 ? 25  ALA A HA   2  
ATOM 2131  H HB1  . ALA A 1 25  ? -5.707  -6.465  -6.866  1.00 0.00 ? 25  ALA A HB1  2  
ATOM 2132  H HB2  . ALA A 1 25  ? -6.195  -4.843  -6.373  1.00 0.00 ? 25  ALA A HB2  2  
ATOM 2133  H HB3  . ALA A 1 25  ? -7.112  -6.246  -5.823  1.00 0.00 ? 25  ALA A HB3  2  
ATOM 2134  N N    . LEU A 1 26  ? -8.251  -7.668  -9.073  1.00 0.00 ? 26  LEU A N    2  
ATOM 2135  C CA   . LEU A 1 26  ? -9.069  -8.857  -9.288  1.00 0.00 ? 26  LEU A CA   2  
ATOM 2136  C C    . LEU A 1 26  ? -8.479  -10.061 -8.562  1.00 0.00 ? 26  LEU A C    2  
ATOM 2137  O O    . LEU A 1 26  ? -7.348  -10.014 -8.076  1.00 0.00 ? 26  LEU A O    2  
ATOM 2138  C CB   . LEU A 1 26  ? -9.186  -9.156  -10.784 1.00 0.00 ? 26  LEU A CB   2  
ATOM 2139  C CG   . LEU A 1 26  ? -10.051 -8.191  -11.595 1.00 0.00 ? 26  LEU A CG   2  
ATOM 2140  C CD1  . LEU A 1 26  ? -9.975  -8.524  -13.078 1.00 0.00 ? 26  LEU A CD1  2  
ATOM 2141  C CD2  . LEU A 1 26  ? -11.493 -8.232  -11.111 1.00 0.00 ? 26  LEU A CD2  2  
ATOM 2142  H H    . LEU A 1 26  ? -7.609  -7.399  -9.763  1.00 0.00 ? 26  LEU A H    2  
ATOM 2143  H HA   . LEU A 1 26  ? -10.053 -8.658  -8.891  1.00 0.00 ? 26  LEU A HA   2  
ATOM 2144  H HB2  . LEU A 1 26  ? -8.191  -9.139  -11.203 1.00 0.00 ? 26  LEU A HB2  2  
ATOM 2145  H HB3  . LEU A 1 26  ? -9.604  -10.146 -10.891 1.00 0.00 ? 26  LEU A HB3  2  
ATOM 2146  H HG   . LEU A 1 26  ? -9.680  -7.184  -11.461 1.00 0.00 ? 26  LEU A HG   2  
ATOM 2147  H HD11 . LEU A 1 26  ? -10.295 -9.543  -13.234 1.00 0.00 ? 26  LEU A HD11 2  
ATOM 2148  H HD12 . LEU A 1 26  ? -8.958  -8.408  -13.421 1.00 0.00 ? 26  LEU A HD12 2  
ATOM 2149  H HD13 . LEU A 1 26  ? -10.619 -7.854  -13.630 1.00 0.00 ? 26  LEU A HD13 2  
ATOM 2150  H HD21 . LEU A 1 26  ? -11.530 -7.951  -10.069 1.00 0.00 ? 26  LEU A HD21 2  
ATOM 2151  H HD22 . LEU A 1 26  ? -11.884 -9.232  -11.228 1.00 0.00 ? 26  LEU A HD22 2  
ATOM 2152  H HD23 . LEU A 1 26  ? -12.088 -7.542  -11.691 1.00 0.00 ? 26  LEU A HD23 2  
ATOM 2153  N N    . HIS A 1 27  ? -9.251  -11.141 -8.494  1.00 0.00 ? 27  HIS A N    2  
ATOM 2154  C CA   . HIS A 1 27  ? -8.804  -12.360 -7.830  1.00 0.00 ? 27  HIS A CA   2  
ATOM 2155  C C    . HIS A 1 27  ? -7.610  -12.969 -8.558  1.00 0.00 ? 27  HIS A C    2  
ATOM 2156  O O    . HIS A 1 27  ? -6.640  -13.396 -7.933  1.00 0.00 ? 27  HIS A O    2  
ATOM 2157  C CB   . HIS A 1 27  ? -9.945  -13.375 -7.759  1.00 0.00 ? 27  HIS A CB   2  
ATOM 2158  C CG   . HIS A 1 27  ? -9.820  -14.339 -6.618  1.00 0.00 ? 27  HIS A CG   2  
ATOM 2159  N ND1  . HIS A 1 27  ? -9.700  -15.701 -6.794  1.00 0.00 ? 27  HIS A ND1  2  
ATOM 2160  C CD2  . HIS A 1 27  ? -9.794  -14.129 -5.281  1.00 0.00 ? 27  HIS A CD2  2  
ATOM 2161  C CE1  . HIS A 1 27  ? -9.608  -16.289 -5.614  1.00 0.00 ? 27  HIS A CE1  2  
ATOM 2162  N NE2  . HIS A 1 27  ? -9.662  -15.357 -4.680  1.00 0.00 ? 27  HIS A NE2  2  
ATOM 2163  H H    . HIS A 1 27  ? -10.142 -11.118 -8.901  1.00 0.00 ? 27  HIS A H    2  
ATOM 2164  H HA   . HIS A 1 27  ? -8.503  -12.100 -6.826  1.00 0.00 ? 27  HIS A HA   2  
ATOM 2165  H HB2  . HIS A 1 27  ? -10.881 -12.848 -7.645  1.00 0.00 ? 27  HIS A HB2  2  
ATOM 2166  H HB3  . HIS A 1 27  ? -9.968  -13.946 -8.676  1.00 0.00 ? 27  HIS A HB3  2  
ATOM 2167  H HD1  . HIS A 1 27  ? -9.687  -16.168 -7.655  1.00 0.00 ? 27  HIS A HD1  2  
ATOM 2168  H HD2  . HIS A 1 27  ? -9.864  -13.174 -4.780  1.00 0.00 ? 27  HIS A HD2  2  
ATOM 2169  H HE1  . HIS A 1 27  ? -9.506  -17.350 -5.443  1.00 0.00 ? 27  HIS A HE1  2  
ATOM 2170  H HE2  . HIS A 1 27  ? -9.701  -15.526 -3.716  1.00 0.00 ? 27  HIS A HE2  2  
ATOM 2171  N N    . GLY A 1 28  ? -7.688  -13.007 -9.885  1.00 0.00 ? 28  GLY A N    2  
ATOM 2172  C CA   . GLY A 1 28  ? -6.608  -13.566 -10.676 1.00 0.00 ? 28  GLY A CA   2  
ATOM 2173  C C    . GLY A 1 28  ? -5.637  -12.509 -11.162 1.00 0.00 ? 28  GLY A C    2  
ATOM 2174  O O    . GLY A 1 28  ? -5.393  -12.386 -12.361 1.00 0.00 ? 28  GLY A O    2  
ATOM 2175  H H    . GLY A 1 28  ? -8.486  -12.652 -10.330 1.00 0.00 ? 28  GLY A H    2  
ATOM 2176  H HA2  . GLY A 1 28  ? -6.071  -14.285 -10.076 1.00 0.00 ? 28  GLY A HA2  2  
ATOM 2177  H HA3  . GLY A 1 28  ? -7.030  -14.072 -11.533 1.00 0.00 ? 28  GLY A HA3  2  
ATOM 2178  N N    . GLU A 1 29  ? -5.083  -11.743 -10.227 1.00 0.00 ? 29  GLU A N    2  
ATOM 2179  C CA   . GLU A 1 29  ? -4.135  -10.689 -10.568 1.00 0.00 ? 29  GLU A CA   2  
ATOM 2180  C C    . GLU A 1 29  ? -3.305  -10.289 -9.351  1.00 0.00 ? 29  GLU A C    2  
ATOM 2181  O O    . GLU A 1 29  ? -3.543  -10.763 -8.240  1.00 0.00 ? 29  GLU A O    2  
ATOM 2182  C CB   . GLU A 1 29  ? -4.873  -9.467  -11.120 1.00 0.00 ? 29  GLU A CB   2  
ATOM 2183  C CG   . GLU A 1 29  ? -5.375  -9.651  -12.542 1.00 0.00 ? 29  GLU A CG   2  
ATOM 2184  C CD   . GLU A 1 29  ? -5.678  -8.333  -13.228 1.00 0.00 ? 29  GLU A CD   2  
ATOM 2185  O OE1  . GLU A 1 29  ? -6.781  -7.790  -13.010 1.00 0.00 ? 29  GLU A OE1  2  
ATOM 2186  O OE2  . GLU A 1 29  ? -4.812  -7.846  -13.984 1.00 0.00 ? 29  GLU A OE2  2  
ATOM 2187  H H    . GLU A 1 29  ? -5.317  -11.890 -9.287  1.00 0.00 ? 29  GLU A H    2  
ATOM 2188  H HA   . GLU A 1 29  ? -3.472  -11.072 -11.329 1.00 0.00 ? 29  GLU A HA   2  
ATOM 2189  H HB2  . GLU A 1 29  ? -5.720  -9.256  -10.485 1.00 0.00 ? 29  GLU A HB2  2  
ATOM 2190  H HB3  . GLU A 1 29  ? -4.203  -8.620  -11.104 1.00 0.00 ? 29  GLU A HB3  2  
ATOM 2191  H HG2  . GLU A 1 29  ? -4.620  -10.171 -13.113 1.00 0.00 ? 29  GLU A HG2  2  
ATOM 2192  H HG3  . GLU A 1 29  ? -6.277  -10.244 -12.518 1.00 0.00 ? 29  GLU A HG3  2  
ATOM 2193  N N    . LYS A 1 30  ? -2.331  -9.412  -9.569  1.00 0.00 ? 30  LYS A N    2  
ATOM 2194  C CA   . LYS A 1 30  ? -1.465  -8.946  -8.491  1.00 0.00 ? 30  LYS A CA   2  
ATOM 2195  C C    . LYS A 1 30  ? -1.948  -7.605  -7.948  1.00 0.00 ? 30  LYS A C    2  
ATOM 2196  O O    . LYS A 1 30  ? -2.219  -6.678  -8.709  1.00 0.00 ? 30  LYS A O    2  
ATOM 2197  C CB   . LYS A 1 30  ? -0.023  -8.819  -8.987  1.00 0.00 ? 30  LYS A CB   2  
ATOM 2198  C CG   . LYS A 1 30  ? 0.616   -10.149 -9.346  1.00 0.00 ? 30  LYS A CG   2  
ATOM 2199  C CD   . LYS A 1 30  ? 2.120   -10.122 -9.129  1.00 0.00 ? 30  LYS A CD   2  
ATOM 2200  C CE   . LYS A 1 30  ? 2.856   -9.672  -10.381 1.00 0.00 ? 30  LYS A CE   2  
ATOM 2201  N NZ   . LYS A 1 30  ? 2.831   -8.192  -10.538 1.00 0.00 ? 30  LYS A NZ   2  
ATOM 2202  H H    . LYS A 1 30  ? -2.190  -9.070  -10.477 1.00 0.00 ? 30  LYS A H    2  
ATOM 2203  H HA   . LYS A 1 30  ? -1.501  -9.677  -7.698  1.00 0.00 ? 30  LYS A HA   2  
ATOM 2204  H HB2  . LYS A 1 30  ? -0.011  -8.189  -9.864  1.00 0.00 ? 30  LYS A HB2  2  
ATOM 2205  H HB3  . LYS A 1 30  ? 0.571   -8.355  -8.213  1.00 0.00 ? 30  LYS A HB3  2  
ATOM 2206  H HG2  . LYS A 1 30  ? 0.188   -10.923 -8.727  1.00 0.00 ? 30  LYS A HG2  2  
ATOM 2207  H HG3  . LYS A 1 30  ? 0.416   -10.365 -10.386 1.00 0.00 ? 30  LYS A HG3  2  
ATOM 2208  H HD2  . LYS A 1 30  ? 2.347   -9.436  -8.326  1.00 0.00 ? 30  LYS A HD2  2  
ATOM 2209  H HD3  . LYS A 1 30  ? 2.454   -11.114 -8.862  1.00 0.00 ? 30  LYS A HD3  2  
ATOM 2210  H HE2  . LYS A 1 30  ? 3.882   -10.001 -10.318 1.00 0.00 ? 30  LYS A HE2  2  
ATOM 2211  H HE3  . LYS A 1 30  ? 2.386   -10.125 -11.242 1.00 0.00 ? 30  LYS A HE3  2  
ATOM 2212  H HZ1  . LYS A 1 30  ? 1.924   -7.812  -10.199 1.00 0.00 ? 30  LYS A HZ1  2  
ATOM 2213  H HZ2  . LYS A 1 30  ? 2.948   -7.936  -11.539 1.00 0.00 ? 30  LYS A HZ2  2  
ATOM 2214  H HZ3  . LYS A 1 30  ? 3.602   -7.761  -9.989  1.00 0.00 ? 30  LYS A HZ3  2  
ATOM 2215  N N    . GLY A 1 31  ? -2.050  -7.510  -6.625  1.00 0.00 ? 31  GLY A N    2  
ATOM 2216  C CA   . GLY A 1 31  ? -2.498  -6.278  -6.003  1.00 0.00 ? 31  GLY A CA   2  
ATOM 2217  C C    . GLY A 1 31  ? -1.375  -5.276  -5.826  1.00 0.00 ? 31  GLY A C    2  
ATOM 2218  O O    . GLY A 1 31  ? -0.657  -5.310  -4.826  1.00 0.00 ? 31  GLY A O    2  
ATOM 2219  H H    . GLY A 1 31  ? -1.820  -8.283  -6.068  1.00 0.00 ? 31  GLY A H    2  
ATOM 2220  H HA2  . GLY A 1 31  ? -3.267  -5.836  -6.618  1.00 0.00 ? 31  GLY A HA2  2  
ATOM 2221  H HA3  . GLY A 1 31  ? -2.915  -6.509  -5.034  1.00 0.00 ? 31  GLY A HA3  2  
ATOM 2222  N N    . GLN A 1 32  ? -1.221  -4.384  -6.799  1.00 0.00 ? 32  GLN A N    2  
ATOM 2223  C CA   . GLN A 1 32  ? -0.174  -3.370  -6.746  1.00 0.00 ? 32  GLN A CA   2  
ATOM 2224  C C    . GLN A 1 32  ? -0.698  -2.079  -6.124  1.00 0.00 ? 32  GLN A C    2  
ATOM 2225  O O    . GLN A 1 32  ? -1.542  -1.397  -6.706  1.00 0.00 ? 32  GLN A O    2  
ATOM 2226  C CB   . GLN A 1 32  ? 0.366   -3.091  -8.150  1.00 0.00 ? 32  GLN A CB   2  
ATOM 2227  C CG   . GLN A 1 32  ? 1.770   -2.508  -8.156  1.00 0.00 ? 32  GLN A CG   2  
ATOM 2228  C CD   . GLN A 1 32  ? 2.338   -2.370  -9.555  1.00 0.00 ? 32  GLN A CD   2  
ATOM 2229  O OE1  . GLN A 1 32  ? 1.887   -1.537  -10.342 1.00 0.00 ? 32  GLN A OE1  2  
ATOM 2230  N NE2  . GLN A 1 32  ? 3.335   -3.188  -9.872  1.00 0.00 ? 32  GLN A NE2  2  
ATOM 2231  H H    . GLN A 1 32  ? -1.824  -4.409  -7.570  1.00 0.00 ? 32  GLN A H    2  
ATOM 2232  H HA   . GLN A 1 32  ? 0.627   -3.752  -6.131  1.00 0.00 ? 32  GLN A HA   2  
ATOM 2233  H HB2  . GLN A 1 32  ? 0.381   -4.015  -8.707  1.00 0.00 ? 32  GLN A HB2  2  
ATOM 2234  H HB3  . GLN A 1 32  ? -0.292  -2.392  -8.644  1.00 0.00 ? 32  GLN A HB3  2  
ATOM 2235  H HG2  . GLN A 1 32  ? 1.742   -1.530  -7.698  1.00 0.00 ? 32  GLN A HG2  2  
ATOM 2236  H HG3  . GLN A 1 32  ? 2.417   -3.155  -7.582  1.00 0.00 ? 32  GLN A HG3  2  
ATOM 2237  H HE21 . GLN A 1 32  ? 3.643   -3.827  -9.195  1.00 0.00 ? 32  GLN A HE21 2  
ATOM 2238  H HE22 . GLN A 1 32  ? 3.721   -3.121  -10.770 1.00 0.00 ? 32  GLN A HE22 2  
ATOM 2239  N N    . ILE A 1 33  ? -0.192  -1.751  -4.940  1.00 0.00 ? 33  ILE A N    2  
ATOM 2240  C CA   . ILE A 1 33  ? -0.608  -0.543  -4.240  1.00 0.00 ? 33  ILE A CA   2  
ATOM 2241  C C    . ILE A 1 33  ? 0.563   0.416   -4.054  1.00 0.00 ? 33  ILE A C    2  
ATOM 2242  O O    . ILE A 1 33  ? 1.454   0.175   -3.238  1.00 0.00 ? 33  ILE A O    2  
ATOM 2243  C CB   . ILE A 1 33  ? -1.214  -0.870  -2.862  1.00 0.00 ? 33  ILE A CB   2  
ATOM 2244  C CG1  . ILE A 1 33  ? -2.251  -1.988  -2.989  1.00 0.00 ? 33  ILE A CG1  2  
ATOM 2245  C CG2  . ILE A 1 33  ? -1.840  0.374   -2.250  1.00 0.00 ? 33  ILE A CG2  2  
ATOM 2246  C CD1  . ILE A 1 33  ? -2.597  -2.643  -1.671  1.00 0.00 ? 33  ILE A CD1  2  
ATOM 2247  H H    . ILE A 1 33  ? 0.478   -2.336  -4.528  1.00 0.00 ? 33  ILE A H    2  
ATOM 2248  H HA   . ILE A 1 33  ? -1.366  -0.056  -4.838  1.00 0.00 ? 33  ILE A HA   2  
ATOM 2249  H HB   . ILE A 1 33  ? -0.417  -1.199  -2.213  1.00 0.00 ? 33  ILE A HB   2  
ATOM 2250  H HG12 . ILE A 1 33  ? -3.159  -1.582  -3.406  1.00 0.00 ? 33  ILE A HG12 2  
ATOM 2251  H HG13 . ILE A 1 33  ? -1.867  -2.751  -3.650  1.00 0.00 ? 33  ILE A HG13 2  
ATOM 2252  H HG21 . ILE A 1 33  ? -1.306  1.250   -2.589  1.00 0.00 ? 33  ILE A HG21 2  
ATOM 2253  H HG22 . ILE A 1 33  ? -2.873  0.444   -2.555  1.00 0.00 ? 33  ILE A HG22 2  
ATOM 2254  H HG23 . ILE A 1 33  ? -1.785  0.313   -1.174  1.00 0.00 ? 33  ILE A HG23 2  
ATOM 2255  H HD11 . ILE A 1 33  ? -3.337  -3.413  -1.834  1.00 0.00 ? 33  ILE A HD11 2  
ATOM 2256  H HD12 . ILE A 1 33  ? -1.709  -3.082  -1.242  1.00 0.00 ? 33  ILE A HD12 2  
ATOM 2257  H HD13 . ILE A 1 33  ? -2.994  -1.901  -0.993  1.00 0.00 ? 33  ILE A HD13 2  
ATOM 2258  N N    . LYS A 1 34  ? 0.555   1.506   -4.814  1.00 0.00 ? 34  LYS A N    2  
ATOM 2259  C CA   . LYS A 1 34  ? 1.615   2.504   -4.731  1.00 0.00 ? 34  LYS A CA   2  
ATOM 2260  C C    . LYS A 1 34  ? 1.160   3.714   -3.922  1.00 0.00 ? 34  LYS A C    2  
ATOM 2261  O O    . LYS A 1 34  ? 0.137   4.328   -4.227  1.00 0.00 ? 34  LYS A O    2  
ATOM 2262  C CB   . LYS A 1 34  ? 2.038   2.945   -6.134  1.00 0.00 ? 34  LYS A CB   2  
ATOM 2263  C CG   . LYS A 1 34  ? 0.874   3.356   -7.020  1.00 0.00 ? 34  LYS A CG   2  
ATOM 2264  C CD   . LYS A 1 34  ? 1.291   4.401   -8.040  1.00 0.00 ? 34  LYS A CD   2  
ATOM 2265  C CE   . LYS A 1 34  ? 2.136   3.792   -9.149  1.00 0.00 ? 34  LYS A CE   2  
ATOM 2266  N NZ   . LYS A 1 34  ? 1.967   4.519   -10.438 1.00 0.00 ? 34  LYS A NZ   2  
ATOM 2267  H H    . LYS A 1 34  ? -0.182  1.643   -5.445  1.00 0.00 ? 34  LYS A H    2  
ATOM 2268  H HA   . LYS A 1 34  ? 2.460   2.051   -4.236  1.00 0.00 ? 34  LYS A HA   2  
ATOM 2269  H HB2  . LYS A 1 34  ? 2.710   3.786   -6.047  1.00 0.00 ? 34  LYS A HB2  2  
ATOM 2270  H HB3  . LYS A 1 34  ? 2.558   2.128   -6.614  1.00 0.00 ? 34  LYS A HB3  2  
ATOM 2271  H HG2  . LYS A 1 34  ? 0.507   2.485   -7.542  1.00 0.00 ? 34  LYS A HG2  2  
ATOM 2272  H HG3  . LYS A 1 34  ? 0.089   3.764   -6.400  1.00 0.00 ? 34  LYS A HG3  2  
ATOM 2273  H HD2  . LYS A 1 34  ? 0.406   4.839   -8.477  1.00 0.00 ? 34  LYS A HD2  2  
ATOM 2274  H HD3  . LYS A 1 34  ? 1.866   5.169   -7.542  1.00 0.00 ? 34  LYS A HD3  2  
ATOM 2275  H HE2  . LYS A 1 34  ? 3.174   3.833   -8.856  1.00 0.00 ? 34  LYS A HE2  2  
ATOM 2276  H HE3  . LYS A 1 34  ? 1.840   2.762   -9.284  1.00 0.00 ? 34  LYS A HE3  2  
ATOM 2277  H HZ1  . LYS A 1 34  ? 1.336   5.335   -10.307 1.00 0.00 ? 34  LYS A HZ1  2  
ATOM 2278  H HZ2  . LYS A 1 34  ? 1.553   3.887   -11.152 1.00 0.00 ? 34  LYS A HZ2  2  
ATOM 2279  H HZ3  . LYS A 1 34  ? 2.888   4.857   -10.781 1.00 0.00 ? 34  LYS A HZ3  2  
ATOM 2280  N N    . CYS A 1 35  ? 1.927   4.052   -2.891  1.00 0.00 ? 35  CYS A N    2  
ATOM 2281  C CA   . CYS A 1 35  ? 1.603   5.190   -2.037  1.00 0.00 ? 35  CYS A CA   2  
ATOM 2282  C C    . CYS A 1 35  ? 2.349   6.440   -2.491  1.00 0.00 ? 35  CYS A C    2  
ATOM 2283  O O    . CYS A 1 35  ? 3.572   6.427   -2.636  1.00 0.00 ? 35  CYS A O    2  
ATOM 2284  C CB   . CYS A 1 35  ? 1.947   4.876   -0.581  1.00 0.00 ? 35  CYS A CB   2  
ATOM 2285  S SG   . CYS A 1 35  ? 0.973   5.806   0.625   1.00 0.00 ? 35  CYS A SG   2  
ATOM 2286  H H    . CYS A 1 35  ? 2.729   3.524   -2.698  1.00 0.00 ? 35  CYS A H    2  
ATOM 2287  H HA   . CYS A 1 35  ? 0.542   5.371   -2.116  1.00 0.00 ? 35  CYS A HA   2  
ATOM 2288  H HB2  . CYS A 1 35  ? 1.779   3.825   -0.397  1.00 0.00 ? 35  CYS A HB2  2  
ATOM 2289  H HB3  . CYS A 1 35  ? 2.989   5.102   -0.409  1.00 0.00 ? 35  CYS A HB3  2  
ATOM 2290  H HG   . CYS A 1 35  ? 0.078   4.983   1.149   1.00 0.00 ? 35  CYS A HG   2  
ATOM 2291  N N    . PHE A 1 36  ? 1.606   7.518   -2.716  1.00 0.00 ? 36  PHE A N    2  
ATOM 2292  C CA   . PHE A 1 36  ? 2.197   8.776   -3.157  1.00 0.00 ? 36  PHE A CA   2  
ATOM 2293  C C    . PHE A 1 36  ? 2.820   9.525   -1.983  1.00 0.00 ? 36  PHE A C    2  
ATOM 2294  O O    . PHE A 1 36  ? 2.174   10.363  -1.354  1.00 0.00 ? 36  PHE A O    2  
ATOM 2295  C CB   . PHE A 1 36  ? 1.139   9.652   -3.831  1.00 0.00 ? 36  PHE A CB   2  
ATOM 2296  C CG   . PHE A 1 36  ? 1.045   9.444   -5.316  1.00 0.00 ? 36  PHE A CG   2  
ATOM 2297  C CD1  . PHE A 1 36  ? 1.503   8.271   -5.894  1.00 0.00 ? 36  PHE A CD1  2  
ATOM 2298  C CD2  . PHE A 1 36  ? 0.499   10.421  -6.133  1.00 0.00 ? 36  PHE A CD2  2  
ATOM 2299  C CE1  . PHE A 1 36  ? 1.418   8.075   -7.260  1.00 0.00 ? 36  PHE A CE1  2  
ATOM 2300  C CE2  . PHE A 1 36  ? 0.411   10.230  -7.499  1.00 0.00 ? 36  PHE A CE2  2  
ATOM 2301  C CZ   . PHE A 1 36  ? 0.872   9.057   -8.063  1.00 0.00 ? 36  PHE A CZ   2  
ATOM 2302  H H    . PHE A 1 36  ? 0.636   7.466   -2.583  1.00 0.00 ? 36  PHE A H    2  
ATOM 2303  H HA   . PHE A 1 36  ? 2.970   8.545   -3.873  1.00 0.00 ? 36  PHE A HA   2  
ATOM 2304  H HB2  . PHE A 1 36  ? 0.173   9.431   -3.404  1.00 0.00 ? 36  PHE A HB2  2  
ATOM 2305  H HB3  . PHE A 1 36  ? 1.377   10.691  -3.655  1.00 0.00 ? 36  PHE A HB3  2  
ATOM 2306  H HD1  . PHE A 1 36  ? 1.931   7.502   -5.266  1.00 0.00 ? 36  PHE A HD1  2  
ATOM 2307  H HD2  . PHE A 1 36  ? 0.139   11.339  -5.693  1.00 0.00 ? 36  PHE A HD2  2  
ATOM 2308  H HE1  . PHE A 1 36  ? 1.779   7.157   -7.697  1.00 0.00 ? 36  PHE A HE1  2  
ATOM 2309  H HE2  . PHE A 1 36  ? -0.016  11.000  -8.125  1.00 0.00 ? 36  PHE A HE2  2  
ATOM 2310  H HZ   . PHE A 1 36  ? 0.803   8.906   -9.130  1.00 0.00 ? 36  PHE A HZ   2  
ATOM 2311  N N    . ILE A 1 37  ? 4.080   9.215   -1.693  1.00 0.00 ? 37  ILE A N    2  
ATOM 2312  C CA   . ILE A 1 37  ? 4.791   9.858   -0.595  1.00 0.00 ? 37  ILE A CA   2  
ATOM 2313  C C    . ILE A 1 37  ? 5.586   11.063  -1.086  1.00 0.00 ? 37  ILE A C    2  
ATOM 2314  O O    . ILE A 1 37  ? 6.695   10.920  -1.602  1.00 0.00 ? 37  ILE A O    2  
ATOM 2315  C CB   . ILE A 1 37  ? 5.749   8.877   0.106   1.00 0.00 ? 37  ILE A CB   2  
ATOM 2316  C CG1  . ILE A 1 37  ? 5.016   7.582   0.462   1.00 0.00 ? 37  ILE A CG1  2  
ATOM 2317  C CG2  . ILE A 1 37  ? 6.342   9.516   1.353   1.00 0.00 ? 37  ILE A CG2  2  
ATOM 2318  C CD1  . ILE A 1 37  ? 5.939   6.466   0.898   1.00 0.00 ? 37  ILE A CD1  2  
ATOM 2319  H H    . ILE A 1 37  ? 4.541   8.538   -2.231  1.00 0.00 ? 37  ILE A H    2  
ATOM 2320  H HA   . ILE A 1 37  ? 4.059   10.192  0.125   1.00 0.00 ? 37  ILE A HA   2  
ATOM 2321  H HB   . ILE A 1 37  ? 6.557   8.650   -0.572  1.00 0.00 ? 37  ILE A HB   2  
ATOM 2322  H HG12 . ILE A 1 37  ? 4.327   7.775   1.269   1.00 0.00 ? 37  ILE A HG12 2  
ATOM 2323  H HG13 . ILE A 1 37  ? 4.466   7.239   -0.402  1.00 0.00 ? 37  ILE A HG13 2  
ATOM 2324  H HG21 . ILE A 1 37  ? 5.548   9.767   2.041   1.00 0.00 ? 37  ILE A HG21 2  
ATOM 2325  H HG22 . ILE A 1 37  ? 7.020   8.821   1.825   1.00 0.00 ? 37  ILE A HG22 2  
ATOM 2326  H HG23 . ILE A 1 37  ? 6.877   10.412  1.079   1.00 0.00 ? 37  ILE A HG23 2  
ATOM 2327  H HD11 . ILE A 1 37  ? 6.965   6.765   0.744   1.00 0.00 ? 37  ILE A HD11 2  
ATOM 2328  H HD12 . ILE A 1 37  ? 5.778   6.253   1.944   1.00 0.00 ? 37  ILE A HD12 2  
ATOM 2329  H HD13 . ILE A 1 37  ? 5.733   5.579   0.315   1.00 0.00 ? 37  ILE A HD13 2  
ATOM 2330  N N    . ARG A 1 38  ? 5.012   12.250  -0.922  1.00 0.00 ? 38  ARG A N    2  
ATOM 2331  C CA   . ARG A 1 38  ? 5.667   13.481  -1.348  1.00 0.00 ? 38  ARG A CA   2  
ATOM 2332  C C    . ARG A 1 38  ? 6.705   13.928  -0.322  1.00 0.00 ? 38  ARG A C    2  
ATOM 2333  O O    . ARG A 1 38  ? 6.786   15.107  0.021   1.00 0.00 ? 38  ARG A O    2  
ATOM 2334  C CB   . ARG A 1 38  ? 4.633   14.589  -1.557  1.00 0.00 ? 38  ARG A CB   2  
ATOM 2335  C CG   . ARG A 1 38  ? 3.818   14.428  -2.831  1.00 0.00 ? 38  ARG A CG   2  
ATOM 2336  C CD   . ARG A 1 38  ? 2.590   13.560  -2.600  1.00 0.00 ? 38  ARG A CD   2  
ATOM 2337  N NE   . ARG A 1 38  ? 1.582   13.752  -3.639  1.00 0.00 ? 38  ARG A NE   2  
ATOM 2338  C CZ   . ARG A 1 38  ? 0.928   14.894  -3.827  1.00 0.00 ? 38  ARG A CZ   2  
ATOM 2339  N NH1  . ARG A 1 38  ? 1.177   15.939  -3.051  1.00 0.00 ? 38  ARG A NH1  2  
ATOM 2340  N NH2  . ARG A 1 38  ? 0.025   14.991  -4.794  1.00 0.00 ? 38  ARG A NH2  2  
ATOM 2341  H H    . ARG A 1 38  ? 4.127   12.300  -0.505  1.00 0.00 ? 38  ARG A H    2  
ATOM 2342  H HA   . ARG A 1 38  ? 6.166   13.284  -2.285  1.00 0.00 ? 38  ARG A HA   2  
ATOM 2343  H HB2  . ARG A 1 38  ? 3.952   14.593  -0.719  1.00 0.00 ? 38  ARG A HB2  2  
ATOM 2344  H HB3  . ARG A 1 38  ? 5.144   15.538  -1.601  1.00 0.00 ? 38  ARG A HB3  2  
ATOM 2345  H HG2  . ARG A 1 38  ? 3.498   15.403  -3.168  1.00 0.00 ? 38  ARG A HG2  2  
ATOM 2346  H HG3  . ARG A 1 38  ? 4.437   13.968  -3.587  1.00 0.00 ? 38  ARG A HG3  2  
ATOM 2347  H HD2  . ARG A 1 38  ? 2.894   12.524  -2.594  1.00 0.00 ? 38  ARG A HD2  2  
ATOM 2348  H HD3  . ARG A 1 38  ? 2.161   13.815  -1.643  1.00 0.00 ? 38  ARG A HD3  2  
ATOM 2349  H HE   . ARG A 1 38  ? 1.383   12.993  -4.225  1.00 0.00 ? 38  ARG A HE   2  
ATOM 2350  H HH11 . ARG A 1 38  ? 1.858   15.869  -2.322  1.00 0.00 ? 38  ARG A HH11 2  
ATOM 2351  H HH12 . ARG A 1 38  ? 0.684   16.798  -3.195  1.00 0.00 ? 38  ARG A HH12 2  
ATOM 2352  H HH21 . ARG A 1 38  ? -0.165  14.204  -5.382  1.00 0.00 ? 38  ARG A HH21 2  
ATOM 2353  H HH22 . ARG A 1 38  ? -0.466  15.850  -4.935  1.00 0.00 ? 38  ARG A HH22 2  
ATOM 2354  N N    . SER A 1 39  ? 7.497   12.977  0.163   1.00 0.00 ? 39  SER A N    2  
ATOM 2355  C CA   . SER A 1 39  ? 8.527   13.271  1.152   1.00 0.00 ? 39  SER A CA   2  
ATOM 2356  C C    . SER A 1 39  ? 9.740   13.922  0.496   1.00 0.00 ? 39  SER A C    2  
ATOM 2357  O O    . SER A 1 39  ? 10.114  13.579  -0.626  1.00 0.00 ? 39  SER A O    2  
ATOM 2358  C CB   . SER A 1 39  ? 8.950   11.991  1.876   1.00 0.00 ? 39  SER A CB   2  
ATOM 2359  O OG   . SER A 1 39  ? 9.876   12.272  2.911   1.00 0.00 ? 39  SER A OG   2  
ATOM 2360  H H    . SER A 1 39  ? 7.384   12.055  -0.150  1.00 0.00 ? 39  SER A H    2  
ATOM 2361  H HA   . SER A 1 39  ? 8.109   13.959  1.872   1.00 0.00 ? 39  SER A HA   2  
ATOM 2362  H HB2  . SER A 1 39  ? 8.079   11.519  2.306   1.00 0.00 ? 39  SER A HB2  2  
ATOM 2363  H HB3  . SER A 1 39  ? 9.411   11.317  1.168   1.00 0.00 ? 39  SER A HB3  2  
ATOM 2364  H HG   . SER A 1 39  ? 9.883   11.547  3.540   1.00 0.00 ? 39  SER A HG   2  
ATOM 2365  N N    . THR A 1 40  ? 10.354  14.865  1.204   1.00 0.00 ? 40  THR A N    2  
ATOM 2366  C CA   . THR A 1 40  ? 11.524  15.567  0.692   1.00 0.00 ? 40  THR A CA   2  
ATOM 2367  C C    . THR A 1 40  ? 12.304  16.232  1.820   1.00 0.00 ? 40  THR A C    2  
ATOM 2368  O O    . THR A 1 40  ? 11.900  17.261  2.364   1.00 0.00 ? 40  THR A O    2  
ATOM 2369  C CB   . THR A 1 40  ? 11.129  16.636  -0.344  1.00 0.00 ? 40  THR A CB   2  
ATOM 2370  O OG1  . THR A 1 40  ? 10.453  16.023  -1.447  1.00 0.00 ? 40  THR A OG1  2  
ATOM 2371  C CG2  . THR A 1 40  ? 12.356  17.381  -0.847  1.00 0.00 ? 40  THR A CG2  2  
ATOM 2372  H H    . THR A 1 40  ? 10.009  15.095  2.093   1.00 0.00 ? 40  THR A H    2  
ATOM 2373  H HA   . THR A 1 40  ? 12.161  14.842  0.206   1.00 0.00 ? 40  THR A HA   2  
ATOM 2374  H HB   . THR A 1 40  ? 10.464  17.344  0.128   1.00 0.00 ? 40  THR A HB   2  
ATOM 2375  H HG1  . THR A 1 40  ? 9.597   16.441  -1.570  1.00 0.00 ? 40  THR A HG1  2  
ATOM 2376  H HG21 . THR A 1 40  ? 12.675  18.095  -0.101  1.00 0.00 ? 40  THR A HG21 2  
ATOM 2377  H HG22 . THR A 1 40  ? 12.112  17.901  -1.761  1.00 0.00 ? 40  THR A HG22 2  
ATOM 2378  H HG23 . THR A 1 40  ? 13.153  16.677  -1.034  1.00 0.00 ? 40  THR A HG23 2  
ATOM 2379  N N    . PRO A 1 41  ? 13.448  15.634  2.183   1.00 0.00 ? 41  PRO A N    2  
ATOM 2380  C CA   . PRO A 1 41  ? 13.938  14.409  1.544   1.00 0.00 ? 41  PRO A CA   2  
ATOM 2381  C C    . PRO A 1 41  ? 13.082  13.195  1.885   1.00 0.00 ? 41  PRO A C    2  
ATOM 2382  O O    . PRO A 1 41  ? 12.226  13.237  2.769   1.00 0.00 ? 41  PRO A O    2  
ATOM 2383  C CB   . PRO A 1 41  ? 15.347  14.248  2.119   1.00 0.00 ? 41  PRO A CB   2  
ATOM 2384  C CG   . PRO A 1 41  ? 15.306  14.960  3.427   1.00 0.00 ? 41  PRO A CG   2  
ATOM 2385  C CD   . PRO A 1 41  ? 14.352  16.108  3.244   1.00 0.00 ? 41  PRO A CD   2  
ATOM 2386  H HA   . PRO A 1 41  ? 13.996  14.518  0.470   1.00 0.00 ? 41  PRO A HA   2  
ATOM 2387  H HB2  . PRO A 1 41  ? 15.569  13.198  2.246   1.00 0.00 ? 41  PRO A HB2  2  
ATOM 2388  H HB3  . PRO A 1 41  ? 16.067  14.695  1.450   1.00 0.00 ? 41  PRO A HB3  2  
ATOM 2389  H HG2  . PRO A 1 41  ? 14.947  14.293  4.197   1.00 0.00 ? 41  PRO A HG2  2  
ATOM 2390  H HG3  . PRO A 1 41  ? 16.291  15.327  3.676   1.00 0.00 ? 41  PRO A HG3  2  
ATOM 2391  H HD2  . PRO A 1 41  ? 13.808  16.296  4.158   1.00 0.00 ? 41  PRO A HD2  2  
ATOM 2392  H HD3  . PRO A 1 41  ? 14.884  16.994  2.930   1.00 0.00 ? 41  PRO A HD3  2  
ATOM 2393  N N    . PRO A 1 42  ? 13.315  12.085  1.169   1.00 0.00 ? 42  PRO A N    2  
ATOM 2394  C CA   . PRO A 1 42  ? 12.575  10.837  1.379   1.00 0.00 ? 42  PRO A CA   2  
ATOM 2395  C C    . PRO A 1 42  ? 12.925  10.172  2.706   1.00 0.00 ? 42  PRO A C    2  
ATOM 2396  O O    . PRO A 1 42  ? 13.926  10.497  3.345   1.00 0.00 ? 42  PRO A O    2  
ATOM 2397  C CB   . PRO A 1 42  ? 13.020  9.959   0.207   1.00 0.00 ? 42  PRO A CB   2  
ATOM 2398  C CG   . PRO A 1 42  ? 14.362  10.484  -0.171  1.00 0.00 ? 42  PRO A CG   2  
ATOM 2399  C CD   . PRO A 1 42  ? 14.319  11.963  0.099   1.00 0.00 ? 42  PRO A CD   2  
ATOM 2400  H HA   . PRO A 1 42  ? 11.508  10.995  1.327   1.00 0.00 ? 42  PRO A HA   2  
ATOM 2401  H HB2  . PRO A 1 42  ? 13.075  8.928   0.527   1.00 0.00 ? 42  PRO A HB2  2  
ATOM 2402  H HB3  . PRO A 1 42  ? 12.316  10.053  -0.606  1.00 0.00 ? 42  PRO A HB3  2  
ATOM 2403  H HG2  . PRO A 1 42  ? 15.124  10.015  0.432   1.00 0.00 ? 42  PRO A HG2  2  
ATOM 2404  H HG3  . PRO A 1 42  ? 14.546  10.300  -1.220  1.00 0.00 ? 42  PRO A HG3  2  
ATOM 2405  H HD2  . PRO A 1 42  ? 15.284  12.313  0.434   1.00 0.00 ? 42  PRO A HD2  2  
ATOM 2406  H HD3  . PRO A 1 42  ? 14.007  12.499  -0.785  1.00 0.00 ? 42  PRO A HD3  2  
ATOM 2407  N N    . PRO A 1 43  ? 12.082  9.220   3.131   1.00 0.00 ? 43  PRO A N    2  
ATOM 2408  C CA   . PRO A 1 43  ? 12.282  8.489   4.386   1.00 0.00 ? 43  PRO A CA   2  
ATOM 2409  C C    . PRO A 1 43  ? 13.476  7.542   4.321   1.00 0.00 ? 43  PRO A C    2  
ATOM 2410  O O    . PRO A 1 43  ? 13.777  6.978   3.268   1.00 0.00 ? 43  PRO A O    2  
ATOM 2411  C CB   . PRO A 1 43  ? 10.981  7.699   4.548   1.00 0.00 ? 43  PRO A CB   2  
ATOM 2412  C CG   . PRO A 1 43  ? 10.460  7.540   3.162   1.00 0.00 ? 43  PRO A CG   2  
ATOM 2413  C CD   . PRO A 1 43  ? 10.869  8.782   2.420   1.00 0.00 ? 43  PRO A CD   2  
ATOM 2414  H HA   . PRO A 1 43  ? 12.403  9.161   5.222   1.00 0.00 ? 43  PRO A HA   2  
ATOM 2415  H HB2  . PRO A 1 43  ? 11.193  6.741   5.004   1.00 0.00 ? 43  PRO A HB2  2  
ATOM 2416  H HB3  . PRO A 1 43  ? 10.293  8.254   5.167   1.00 0.00 ? 43  PRO A HB3  2  
ATOM 2417  H HG2  . PRO A 1 43  ? 10.898  6.667   2.702   1.00 0.00 ? 43  PRO A HG2  2  
ATOM 2418  H HG3  . PRO A 1 43  ? 9.383   7.454   3.183   1.00 0.00 ? 43  PRO A HG3  2  
ATOM 2419  H HD2  . PRO A 1 43  ? 11.089  8.550   1.389   1.00 0.00 ? 43  PRO A HD2  2  
ATOM 2420  H HD3  . PRO A 1 43  ? 10.094  9.532   2.483   1.00 0.00 ? 43  PRO A HD3  2  
ATOM 2421  N N    . ASP A 1 44  ? 14.152  7.370   5.452   1.00 0.00 ? 44  ASP A N    2  
ATOM 2422  C CA   . ASP A 1 44  ? 15.312  6.490   5.524   1.00 0.00 ? 44  ASP A CA   2  
ATOM 2423  C C    . ASP A 1 44  ? 14.881  5.034   5.667   1.00 0.00 ? 44  ASP A C    2  
ATOM 2424  O O    . ASP A 1 44  ? 15.667  4.117   5.429   1.00 0.00 ? 44  ASP A O    2  
ATOM 2425  C CB   . ASP A 1 44  ? 16.209  6.888   6.697   1.00 0.00 ? 44  ASP A CB   2  
ATOM 2426  C CG   . ASP A 1 44  ? 17.216  7.956   6.319   1.00 0.00 ? 44  ASP A CG   2  
ATOM 2427  O OD1  . ASP A 1 44  ? 18.260  7.606   5.731   1.00 0.00 ? 44  ASP A OD1  2  
ATOM 2428  O OD2  . ASP A 1 44  ? 16.960  9.143   6.613   1.00 0.00 ? 44  ASP A OD2  2  
ATOM 2429  H H    . ASP A 1 44  ? 13.863  7.847   6.258   1.00 0.00 ? 44  ASP A H    2  
ATOM 2430  H HA   . ASP A 1 44  ? 15.868  6.598   4.604   1.00 0.00 ? 44  ASP A HA   2  
ATOM 2431  H HB2  . ASP A 1 44  ? 15.594  7.267   7.500   1.00 0.00 ? 44  ASP A HB2  2  
ATOM 2432  H HB3  . ASP A 1 44  ? 16.747  6.017   7.041   1.00 0.00 ? 44  ASP A HB3  2  
ATOM 2433  N N    . ARG A 1 45  ? 13.628  4.829   6.060   1.00 0.00 ? 45  ARG A N    2  
ATOM 2434  C CA   . ARG A 1 45  ? 13.093  3.484   6.238   1.00 0.00 ? 45  ARG A CA   2  
ATOM 2435  C C    . ARG A 1 45  ? 11.584  3.465   6.012   1.00 0.00 ? 45  ARG A C    2  
ATOM 2436  O O    . ARG A 1 45  ? 10.898  4.460   6.248   1.00 0.00 ? 45  ARG A O    2  
ATOM 2437  C CB   . ARG A 1 45  ? 13.416  2.965   7.640   1.00 0.00 ? 45  ARG A CB   2  
ATOM 2438  C CG   . ARG A 1 45  ? 12.529  1.814   8.083   1.00 0.00 ? 45  ARG A CG   2  
ATOM 2439  C CD   . ARG A 1 45  ? 12.770  1.452   9.540   1.00 0.00 ? 45  ARG A CD   2  
ATOM 2440  N NE   . ARG A 1 45  ? 12.402  2.540   10.442  1.00 0.00 ? 45  ARG A NE   2  
ATOM 2441  C CZ   . ARG A 1 45  ? 12.428  2.438   11.766  1.00 0.00 ? 45  ARG A CZ   2  
ATOM 2442  N NH1  . ARG A 1 45  ? 12.804  1.303   12.339  1.00 0.00 ? 45  ARG A NH1  2  
ATOM 2443  N NH2  . ARG A 1 45  ? 12.079  3.472   12.520  1.00 0.00 ? 45  ARG A NH2  2  
ATOM 2444  H H    . ARG A 1 45  ? 13.049  5.600   6.234   1.00 0.00 ? 45  ARG A H    2  
ATOM 2445  H HA   . ARG A 1 45  ? 13.563  2.841   5.509   1.00 0.00 ? 45  ARG A HA   2  
ATOM 2446  H HB2  . ARG A 1 45  ? 14.442  2.628   7.660   1.00 0.00 ? 45  ARG A HB2  2  
ATOM 2447  H HB3  . ARG A 1 45  ? 13.298  3.774   8.346   1.00 0.00 ? 45  ARG A HB3  2  
ATOM 2448  H HG2  . ARG A 1 45  ? 11.494  2.101   7.962   1.00 0.00 ? 45  ARG A HG2  2  
ATOM 2449  H HG3  . ARG A 1 45  ? 12.740  0.952   7.467   1.00 0.00 ? 45  ARG A HG3  2  
ATOM 2450  H HD2  . ARG A 1 45  ? 12.181  0.581   9.783   1.00 0.00 ? 45  ARG A HD2  2  
ATOM 2451  H HD3  . ARG A 1 45  ? 13.818  1.227   9.672   1.00 0.00 ? 45  ARG A HD3  2  
ATOM 2452  H HE   . ARG A 1 45  ? 12.121  3.388   10.040  1.00 0.00 ? 45  ARG A HE   2  
ATOM 2453  H HH11 . ARG A 1 45  ? 13.069  0.522   11.774  1.00 0.00 ? 45  ARG A HH11 2  
ATOM 2454  H HH12 . ARG A 1 45  ? 12.824  1.228   13.337  1.00 0.00 ? 45  ARG A HH12 2  
ATOM 2455  H HH21 . ARG A 1 45  ? 11.795  4.329   12.092  1.00 0.00 ? 45  ARG A HH21 2  
ATOM 2456  H HH22 . ARG A 1 45  ? 12.099  3.394   13.516  1.00 0.00 ? 45  ARG A HH22 2  
ATOM 2457  N N    . ILE A 1 46  ? 11.074  2.327   5.552   1.00 0.00 ? 46  ILE A N    2  
ATOM 2458  C CA   . ILE A 1 46  ? 9.647   2.179   5.295   1.00 0.00 ? 46  ILE A CA   2  
ATOM 2459  C C    . ILE A 1 46  ? 9.186   0.751   5.566   1.00 0.00 ? 46  ILE A C    2  
ATOM 2460  O O    . ILE A 1 46  ? 9.921   -0.206  5.328   1.00 0.00 ? 46  ILE A O    2  
ATOM 2461  C CB   . ILE A 1 46  ? 9.295   2.553   3.843   1.00 0.00 ? 46  ILE A CB   2  
ATOM 2462  C CG1  . ILE A 1 46  ? 9.795   3.963   3.521   1.00 0.00 ? 46  ILE A CG1  2  
ATOM 2463  C CG2  . ILE A 1 46  ? 7.794   2.454   3.620   1.00 0.00 ? 46  ILE A CG2  2  
ATOM 2464  C CD1  . ILE A 1 46  ? 9.607   4.354   2.072   1.00 0.00 ? 46  ILE A CD1  2  
ATOM 2465  H H    . ILE A 1 46  ? 11.672  1.569   5.383   1.00 0.00 ? 46  ILE A H    2  
ATOM 2466  H HA   . ILE A 1 46  ? 9.118   2.849   5.957   1.00 0.00 ? 46  ILE A HA   2  
ATOM 2467  H HB   . ILE A 1 46  ? 9.780   1.848   3.185   1.00 0.00 ? 46  ILE A HB   2  
ATOM 2468  H HG12 . ILE A 1 46  ? 9.260   4.675   4.129   1.00 0.00 ? 46  ILE A HG12 2  
ATOM 2469  H HG13 . ILE A 1 46  ? 10.850  4.023   3.748   1.00 0.00 ? 46  ILE A HG13 2  
ATOM 2470  H HG21 . ILE A 1 46  ? 7.303   3.289   4.097   1.00 0.00 ? 46  ILE A HG21 2  
ATOM 2471  H HG22 . ILE A 1 46  ? 7.586   2.472   2.561   1.00 0.00 ? 46  ILE A HG22 2  
ATOM 2472  H HG23 . ILE A 1 46  ? 7.426   1.531   4.043   1.00 0.00 ? 46  ILE A HG23 2  
ATOM 2473  H HD11 . ILE A 1 46  ? 8.979   3.626   1.581   1.00 0.00 ? 46  ILE A HD11 2  
ATOM 2474  H HD12 . ILE A 1 46  ? 9.141   5.327   2.019   1.00 0.00 ? 46  ILE A HD12 2  
ATOM 2475  H HD13 . ILE A 1 46  ? 10.569  4.389   1.581   1.00 0.00 ? 46  ILE A HD13 2  
ATOM 2476  N N    . ALA A 1 47  ? 7.961   0.615   6.064   1.00 0.00 ? 47  ALA A N    2  
ATOM 2477  C CA   . ALA A 1 47  ? 7.399   -0.695  6.365   1.00 0.00 ? 47  ALA A CA   2  
ATOM 2478  C C    . ALA A 1 47  ? 5.921   -0.757  5.995   1.00 0.00 ? 47  ALA A C    2  
ATOM 2479  O O    . ALA A 1 47  ? 5.190   0.220   6.158   1.00 0.00 ? 47  ALA A O    2  
ATOM 2480  C CB   . ALA A 1 47  ? 7.591   -1.028  7.837   1.00 0.00 ? 47  ALA A CB   2  
ATOM 2481  H H    . ALA A 1 47  ? 7.422   1.416   6.233   1.00 0.00 ? 47  ALA A H    2  
ATOM 2482  H HA   . ALA A 1 47  ? 7.936   -1.430  5.782   1.00 0.00 ? 47  ALA A HA   2  
ATOM 2483  H HB1  . ALA A 1 47  ? 7.528   -0.121  8.421   1.00 0.00 ? 47  ALA A HB1  2  
ATOM 2484  H HB2  . ALA A 1 47  ? 6.821   -1.715  8.154   1.00 0.00 ? 47  ALA A HB2  2  
ATOM 2485  H HB3  . ALA A 1 47  ? 8.560   -1.481  7.980   1.00 0.00 ? 47  ALA A HB3  2  
ATOM 2486  N N    . TRP A 1 48  ? 5.488   -1.909  5.496   1.00 0.00 ? 48  TRP A N    2  
ATOM 2487  C CA   . TRP A 1 48  ? 4.096   -2.096  5.102   1.00 0.00 ? 48  TRP A CA   2  
ATOM 2488  C C    . TRP A 1 48  ? 3.417   -3.138  5.984   1.00 0.00 ? 48  TRP A C    2  
ATOM 2489  O O    . TRP A 1 48  ? 3.510   -4.338  5.726   1.00 0.00 ? 48  TRP A O    2  
ATOM 2490  C CB   . TRP A 1 48  ? 4.012   -2.518  3.635   1.00 0.00 ? 48  TRP A CB   2  
ATOM 2491  C CG   . TRP A 1 48  ? 3.986   -1.360  2.684   1.00 0.00 ? 48  TRP A CG   2  
ATOM 2492  C CD1  . TRP A 1 48  ? 5.061   -0.666  2.208   1.00 0.00 ? 48  TRP A CD1  2  
ATOM 2493  C CD2  . TRP A 1 48  ? 2.826   -0.761  2.095   1.00 0.00 ? 48  TRP A CD2  2  
ATOM 2494  N NE1  . TRP A 1 48  ? 4.640   0.329   1.359   1.00 0.00 ? 48  TRP A NE1  2  
ATOM 2495  C CE2  . TRP A 1 48  ? 3.273   0.292   1.272   1.00 0.00 ? 48  TRP A CE2  2  
ATOM 2496  C CE3  . TRP A 1 48  ? 1.454   -1.011  2.182   1.00 0.00 ? 48  TRP A CE3  2  
ATOM 2497  C CZ2  . TRP A 1 48  ? 2.396   1.091   0.544   1.00 0.00 ? 48  TRP A CZ2  2  
ATOM 2498  C CZ3  . TRP A 1 48  ? 0.585   -0.217  1.459   1.00 0.00 ? 48  TRP A CZ3  2  
ATOM 2499  C CH2  . TRP A 1 48  ? 1.058   0.823   0.648   1.00 0.00 ? 48  TRP A CH2  2  
ATOM 2500  H H    . TRP A 1 48  ? 6.119   -2.651  5.389   1.00 0.00 ? 48  TRP A H    2  
ATOM 2501  H HA   . TRP A 1 48  ? 3.588   -1.151  5.225   1.00 0.00 ? 48  TRP A HA   2  
ATOM 2502  H HB2  . TRP A 1 48  ? 4.869   -3.129  3.392   1.00 0.00 ? 48  TRP A HB2  2  
ATOM 2503  H HB3  . TRP A 1 48  ? 3.110   -3.094  3.485   1.00 0.00 ? 48  TRP A HB3  2  
ATOM 2504  H HD1  . TRP A 1 48  ? 6.086   -0.878  2.470   1.00 0.00 ? 48  TRP A HD1  2  
ATOM 2505  H HE1  . TRP A 1 48  ? 5.224   0.962   0.890   1.00 0.00 ? 48  TRP A HE1  2  
ATOM 2506  H HE3  . TRP A 1 48  ? 1.070   -1.808  2.801   1.00 0.00 ? 48  TRP A HE3  2  
ATOM 2507  H HZ2  . TRP A 1 48  ? 2.746   1.896   -0.086  1.00 0.00 ? 48  TRP A HZ2  2  
ATOM 2508  H HZ3  . TRP A 1 48  ? -0.479  -0.396  1.513   1.00 0.00 ? 48  TRP A HZ3  2  
ATOM 2509  H HH2  . TRP A 1 48  ? 0.343   1.418   0.101   1.00 0.00 ? 48  TRP A HH2  2  
ATOM 2510  N N    . SER A 1 49  ? 2.733   -2.672  7.024   1.00 0.00 ? 49  SER A N    2  
ATOM 2511  C CA   . SER A 1 49  ? 2.041   -3.566  7.946   1.00 0.00 ? 49  SER A CA   2  
ATOM 2512  C C    . SER A 1 49  ? 0.535   -3.328  7.905   1.00 0.00 ? 49  SER A C    2  
ATOM 2513  O O    . SER A 1 49  ? 0.075   -2.186  7.937   1.00 0.00 ? 49  SER A O    2  
ATOM 2514  C CB   . SER A 1 49  ? 2.561   -3.366  9.371   1.00 0.00 ? 49  SER A CB   2  
ATOM 2515  O OG   . SER A 1 49  ? 2.023   -2.190  9.950   1.00 0.00 ? 49  SER A OG   2  
ATOM 2516  H H    . SER A 1 49  ? 2.696   -1.705  7.177   1.00 0.00 ? 49  SER A H    2  
ATOM 2517  H HA   . SER A 1 49  ? 2.242   -4.581  7.638   1.00 0.00 ? 49  SER A HA   2  
ATOM 2518  H HB2  . SER A 1 49  ? 2.279   -4.213  9.977   1.00 0.00 ? 49  SER A HB2  2  
ATOM 2519  H HB3  . SER A 1 49  ? 3.639   -3.282  9.349   1.00 0.00 ? 49  SER A HB3  2  
ATOM 2520  H HG   . SER A 1 49  ? 2.260   -2.153  10.880  1.00 0.00 ? 49  SER A HG   2  
ATOM 2521  N N    . TRP A 1 50  ? -0.227  -4.413  7.832   1.00 0.00 ? 50  TRP A N    2  
ATOM 2522  C CA   . TRP A 1 50  ? -1.682  -4.324  7.786   1.00 0.00 ? 50  TRP A CA   2  
ATOM 2523  C C    . TRP A 1 50  ? -2.293  -4.685  9.136   1.00 0.00 ? 50  TRP A C    2  
ATOM 2524  O O    . TRP A 1 50  ? -2.813  -3.822  9.844   1.00 0.00 ? 50  TRP A O    2  
ATOM 2525  C CB   . TRP A 1 50  ? -2.236  -5.246  6.699   1.00 0.00 ? 50  TRP A CB   2  
ATOM 2526  C CG   . TRP A 1 50  ? -1.412  -6.480  6.490   1.00 0.00 ? 50  TRP A CG   2  
ATOM 2527  C CD1  . TRP A 1 50  ? -1.706  -7.744  6.916   1.00 0.00 ? 50  TRP A CD1  2  
ATOM 2528  C CD2  . TRP A 1 50  ? -0.158  -6.567  5.805   1.00 0.00 ? 50  TRP A CD2  2  
ATOM 2529  N NE1  . TRP A 1 50  ? -0.710  -8.611  6.537   1.00 0.00 ? 50  TRP A NE1  2  
ATOM 2530  C CE2  . TRP A 1 50  ? 0.251   -7.914  5.853   1.00 0.00 ? 50  TRP A CE2  2  
ATOM 2531  C CE3  . TRP A 1 50  ? 0.659   -5.638  5.153   1.00 0.00 ? 50  TRP A CE3  2  
ATOM 2532  C CZ2  . TRP A 1 50  ? 1.440   -8.352  5.276   1.00 0.00 ? 50  TRP A CZ2  2  
ATOM 2533  C CZ3  . TRP A 1 50  ? 1.839   -6.075  4.581   1.00 0.00 ? 50  TRP A CZ3  2  
ATOM 2534  C CH2  . TRP A 1 50  ? 2.220   -7.422  4.645   1.00 0.00 ? 50  TRP A CH2  2  
ATOM 2535  H H    . TRP A 1 50  ? 0.199   -5.296  7.810   1.00 0.00 ? 50  TRP A H    2  
ATOM 2536  H HA   . TRP A 1 50  ? -1.943  -3.303  7.548   1.00 0.00 ? 50  TRP A HA   2  
ATOM 2537  H HB2  . TRP A 1 50  ? -3.234  -5.554  6.971   1.00 0.00 ? 50  TRP A HB2  2  
ATOM 2538  H HB3  . TRP A 1 50  ? -2.272  -4.706  5.764   1.00 0.00 ? 50  TRP A HB3  2  
ATOM 2539  H HD1  . TRP A 1 50  ? -2.593  -8.007  7.471   1.00 0.00 ? 50  TRP A HD1  2  
ATOM 2540  H HE1  . TRP A 1 50  ? -0.692  -9.573  6.725   1.00 0.00 ? 50  TRP A HE1  2  
ATOM 2541  H HE3  . TRP A 1 50  ? 0.382   -4.596  5.094   1.00 0.00 ? 50  TRP A HE3  2  
ATOM 2542  H HZ2  . TRP A 1 50  ? 1.747   -9.387  5.316   1.00 0.00 ? 50  TRP A HZ2  2  
ATOM 2543  H HZ3  . TRP A 1 50  ? 2.483   -5.372  4.074   1.00 0.00 ? 50  TRP A HZ3  2  
ATOM 2544  H HH2  . TRP A 1 50  ? 3.150   -7.718  4.185   1.00 0.00 ? 50  TRP A HH2  2  
ATOM 2545  N N    . LYS A 1 51  ? -2.226  -5.964  9.488   1.00 0.00 ? 51  LYS A N    2  
ATOM 2546  C CA   . LYS A 1 51  ? -2.771  -6.440  10.754  1.00 0.00 ? 51  LYS A CA   2  
ATOM 2547  C C    . LYS A 1 51  ? -1.659  -6.668  11.773  1.00 0.00 ? 51  LYS A C    2  
ATOM 2548  O O    . LYS A 1 51  ? -1.482  -5.877  12.698  1.00 0.00 ? 51  LYS A O    2  
ATOM 2549  C CB   . LYS A 1 51  ? -3.556  -7.736  10.540  1.00 0.00 ? 51  LYS A CB   2  
ATOM 2550  C CG   . LYS A 1 51  ? -4.840  -7.547  9.752   1.00 0.00 ? 51  LYS A CG   2  
ATOM 2551  C CD   . LYS A 1 51  ? -6.012  -7.226  10.665  1.00 0.00 ? 51  LYS A CD   2  
ATOM 2552  C CE   . LYS A 1 51  ? -6.135  -5.729  10.908  1.00 0.00 ? 51  LYS A CE   2  
ATOM 2553  N NZ   . LYS A 1 51  ? -7.462  -5.367  11.477  1.00 0.00 ? 51  LYS A NZ   2  
ATOM 2554  H H    . LYS A 1 51  ? -1.799  -6.605  8.880   1.00 0.00 ? 51  LYS A H    2  
ATOM 2555  H HA   . LYS A 1 51  ? -3.440  -5.682  11.132  1.00 0.00 ? 51  LYS A HA   2  
ATOM 2556  H HB2  . LYS A 1 51  ? -2.931  -8.437  10.007  1.00 0.00 ? 51  LYS A HB2  2  
ATOM 2557  H HB3  . LYS A 1 51  ? -3.808  -8.153  11.504  1.00 0.00 ? 51  LYS A HB3  2  
ATOM 2558  H HG2  . LYS A 1 51  ? -4.708  -6.733  9.055   1.00 0.00 ? 51  LYS A HG2  2  
ATOM 2559  H HG3  . LYS A 1 51  ? -5.057  -8.456  9.210   1.00 0.00 ? 51  LYS A HG3  2  
ATOM 2560  H HD2  . LYS A 1 51  ? -6.923  -7.580  10.205  1.00 0.00 ? 51  LYS A HD2  2  
ATOM 2561  H HD3  . LYS A 1 51  ? -5.866  -7.725  11.612  1.00 0.00 ? 51  LYS A HD3  2  
ATOM 2562  H HE2  . LYS A 1 51  ? -5.362  -5.425  11.598  1.00 0.00 ? 51  LYS A HE2  2  
ATOM 2563  H HE3  . LYS A 1 51  ? -6.002  -5.213  9.969   1.00 0.00 ? 51  LYS A HE3  2  
ATOM 2564  H HZ1  . LYS A 1 51  ? -7.878  -6.187  11.963  1.00 0.00 ? 51  LYS A HZ1  2  
ATOM 2565  H HZ2  . LYS A 1 51  ? -8.106  -5.065  10.718  1.00 0.00 ? 51  LYS A HZ2  2  
ATOM 2566  H HZ3  . LYS A 1 51  ? -7.359  -4.589  12.159  1.00 0.00 ? 51  LYS A HZ3  2  
ATOM 2567  N N    . GLU A 1 52  ? -0.914  -7.755  11.595  1.00 0.00 ? 52  GLU A N    2  
ATOM 2568  C CA   . GLU A 1 52  ? 0.181   -8.085  12.500  1.00 0.00 ? 52  GLU A CA   2  
ATOM 2569  C C    . GLU A 1 52  ? 1.480   -8.295  11.728  1.00 0.00 ? 52  GLU A C    2  
ATOM 2570  O O    . GLU A 1 52  ? 2.561   -8.346  12.314  1.00 0.00 ? 52  GLU A O    2  
ATOM 2571  C CB   . GLU A 1 52  ? -0.156  -9.342  13.305  1.00 0.00 ? 52  GLU A CB   2  
ATOM 2572  C CG   . GLU A 1 52  ? -1.009  -9.069  14.533  1.00 0.00 ? 52  GLU A CG   2  
ATOM 2573  C CD   . GLU A 1 52  ? -0.571  -7.826  15.282  1.00 0.00 ? 52  GLU A CD   2  
ATOM 2574  O OE1  . GLU A 1 52  ? 0.650   -7.643  15.468  1.00 0.00 ? 52  GLU A OE1  2  
ATOM 2575  O OE2  . GLU A 1 52  ? -1.451  -7.035  15.683  1.00 0.00 ? 52  GLU A OE2  2  
ATOM 2576  H H    . GLU A 1 52  ? -1.105  -8.347  10.839  1.00 0.00 ? 52  GLU A H    2  
ATOM 2577  H HA   . GLU A 1 52  ? 0.310   -7.257  13.181  1.00 0.00 ? 52  GLU A HA   2  
ATOM 2578  H HB2  . GLU A 1 52  ? -0.689  -10.032 12.668  1.00 0.00 ? 52  GLU A HB2  2  
ATOM 2579  H HB3  . GLU A 1 52  ? 0.765   -9.804  13.629  1.00 0.00 ? 52  GLU A HB3  2  
ATOM 2580  H HG2  . GLU A 1 52  ? -2.034  -8.940  14.221  1.00 0.00 ? 52  GLU A HG2  2  
ATOM 2581  H HG3  . GLU A 1 52  ? -0.940  -9.916  15.199  1.00 0.00 ? 52  GLU A HG3  2  
ATOM 2582  N N    . ASN A 1 53  ? 1.366   -8.416  10.410  1.00 0.00 ? 53  ASN A N    2  
ATOM 2583  C CA   . ASN A 1 53  ? 2.531   -8.621  9.557   1.00 0.00 ? 53  ASN A CA   2  
ATOM 2584  C C    . ASN A 1 53  ? 3.181   -7.290  9.194   1.00 0.00 ? 53  ASN A C    2  
ATOM 2585  O O    . ASN A 1 53  ? 2.503   -6.269  9.071   1.00 0.00 ? 53  ASN A O    2  
ATOM 2586  C CB   . ASN A 1 53  ? 2.131   -9.370  8.284   1.00 0.00 ? 53  ASN A CB   2  
ATOM 2587  C CG   . ASN A 1 53  ? 2.070   -10.871 8.491   1.00 0.00 ? 53  ASN A CG   2  
ATOM 2588  O OD1  . ASN A 1 53  ? 3.101   -11.541 8.562   1.00 0.00 ? 53  ASN A OD1  2  
ATOM 2589  N ND2  . ASN A 1 53  ? 0.859   -11.407 8.588   1.00 0.00 ? 53  ASN A ND2  2  
ATOM 2590  H H    . ASN A 1 53  ? 0.476   -8.366  10.000  1.00 0.00 ? 53  ASN A H    2  
ATOM 2591  H HA   . ASN A 1 53  ? 3.242   -9.218  10.107  1.00 0.00 ? 53  ASN A HA   2  
ATOM 2592  H HB2  . ASN A 1 53  ? 1.156   -9.031  7.965   1.00 0.00 ? 53  ASN A HB2  2  
ATOM 2593  H HB3  . ASN A 1 53  ? 2.852   -9.161  7.508   1.00 0.00 ? 53  ASN A HB3  2  
ATOM 2594  H HD21 . ASN A 1 53  ? 0.083   -10.812 8.522   1.00 0.00 ? 53  ASN A HD21 2  
ATOM 2595  H HD22 . ASN A 1 53  ? 0.791   -12.375 8.723   1.00 0.00 ? 53  ASN A HD22 2  
ATOM 2596  N N    . VAL A 1 54  ? 4.499   -7.308  9.023   1.00 0.00 ? 54  VAL A N    2  
ATOM 2597  C CA   . VAL A 1 54  ? 5.241   -6.103  8.672   1.00 0.00 ? 54  VAL A CA   2  
ATOM 2598  C C    . VAL A 1 54  ? 6.303   -6.399  7.619   1.00 0.00 ? 54  VAL A C    2  
ATOM 2599  O O    . VAL A 1 54  ? 7.300   -7.066  7.897   1.00 0.00 ? 54  VAL A O    2  
ATOM 2600  C CB   . VAL A 1 54  ? 5.918   -5.481  9.908   1.00 0.00 ? 54  VAL A CB   2  
ATOM 2601  C CG1  . VAL A 1 54  ? 6.509   -4.122  9.567   1.00 0.00 ? 54  VAL A CG1  2  
ATOM 2602  C CG2  . VAL A 1 54  ? 4.928   -5.368  11.057  1.00 0.00 ? 54  VAL A CG2  2  
ATOM 2603  H H    . VAL A 1 54  ? 4.983   -8.152  9.135   1.00 0.00 ? 54  VAL A H    2  
ATOM 2604  H HA   . VAL A 1 54  ? 4.541   -5.384  8.272   1.00 0.00 ? 54  VAL A HA   2  
ATOM 2605  H HB   . VAL A 1 54  ? 6.723   -6.132  10.217  1.00 0.00 ? 54  VAL A HB   2  
ATOM 2606  H HG11 . VAL A 1 54  ? 7.280   -4.243  8.820   1.00 0.00 ? 54  VAL A HG11 2  
ATOM 2607  H HG12 . VAL A 1 54  ? 5.732   -3.478  9.183   1.00 0.00 ? 54  VAL A HG12 2  
ATOM 2608  H HG13 . VAL A 1 54  ? 6.936   -3.682  10.456  1.00 0.00 ? 54  VAL A HG13 2  
ATOM 2609  H HG21 . VAL A 1 54  ? 4.133   -4.692  10.781  1.00 0.00 ? 54  VAL A HG21 2  
ATOM 2610  H HG22 . VAL A 1 54  ? 4.513   -6.342  11.273  1.00 0.00 ? 54  VAL A HG22 2  
ATOM 2611  H HG23 . VAL A 1 54  ? 5.434   -4.990  11.933  1.00 0.00 ? 54  VAL A HG23 2  
ATOM 2612  N N    . LEU A 1 55  ? 6.083   -5.897  6.409   1.00 0.00 ? 55  LEU A N    2  
ATOM 2613  C CA   . LEU A 1 55  ? 7.022   -6.107  5.312   1.00 0.00 ? 55  LEU A CA   2  
ATOM 2614  C C    . LEU A 1 55  ? 7.860   -4.856  5.066   1.00 0.00 ? 55  LEU A C    2  
ATOM 2615  O O    . LEU A 1 55  ? 7.350   -3.836  4.604   1.00 0.00 ? 55  LEU A O    2  
ATOM 2616  C CB   . LEU A 1 55  ? 6.269   -6.488  4.036   1.00 0.00 ? 55  LEU A CB   2  
ATOM 2617  C CG   . LEU A 1 55  ? 7.093   -7.190  2.956   1.00 0.00 ? 55  LEU A CG   2  
ATOM 2618  C CD1  . LEU A 1 55  ? 7.769   -8.430  3.521   1.00 0.00 ? 55  LEU A CD1  2  
ATOM 2619  C CD2  . LEU A 1 55  ? 6.214   -7.555  1.768   1.00 0.00 ? 55  LEU A CD2  2  
ATOM 2620  H H    . LEU A 1 55  ? 5.271   -5.373  6.248   1.00 0.00 ? 55  LEU A H    2  
ATOM 2621  H HA   . LEU A 1 55  ? 7.679   -6.917  5.589   1.00 0.00 ? 55  LEU A HA   2  
ATOM 2622  H HB2  . LEU A 1 55  ? 5.460   -7.146  4.314   1.00 0.00 ? 55  LEU A HB2  2  
ATOM 2623  H HB3  . LEU A 1 55  ? 5.864   -5.582  3.609   1.00 0.00 ? 55  LEU A HB3  2  
ATOM 2624  H HG   . LEU A 1 55  ? 7.865   -6.519  2.608   1.00 0.00 ? 55  LEU A HG   2  
ATOM 2625  H HD11 . LEU A 1 55  ? 8.570   -8.133  4.181   1.00 0.00 ? 55  LEU A HD11 2  
ATOM 2626  H HD12 . LEU A 1 55  ? 8.170   -9.022  2.712   1.00 0.00 ? 55  LEU A HD12 2  
ATOM 2627  H HD13 . LEU A 1 55  ? 7.046   -9.015  4.071   1.00 0.00 ? 55  LEU A HD13 2  
ATOM 2628  H HD21 . LEU A 1 55  ? 5.634   -6.693  1.472   1.00 0.00 ? 55  LEU A HD21 2  
ATOM 2629  H HD22 . LEU A 1 55  ? 5.548   -8.359  2.047   1.00 0.00 ? 55  LEU A HD22 2  
ATOM 2630  H HD23 . LEU A 1 55  ? 6.836   -7.871  0.944   1.00 0.00 ? 55  LEU A HD23 2  
ATOM 2631  N N    . GLU A 1 56  ? 9.150   -4.944  5.377   1.00 0.00 ? 56  GLU A N    2  
ATOM 2632  C CA   . GLU A 1 56  ? 10.058  -3.819  5.189   1.00 0.00 ? 56  GLU A CA   2  
ATOM 2633  C C    . GLU A 1 56  ? 10.551  -3.754  3.746   1.00 0.00 ? 56  GLU A C    2  
ATOM 2634  O O    . GLU A 1 56  ? 10.455  -2.715  3.092   1.00 0.00 ? 56  GLU A O    2  
ATOM 2635  C CB   . GLU A 1 56  ? 11.250  -3.932  6.142   1.00 0.00 ? 56  GLU A CB   2  
ATOM 2636  C CG   . GLU A 1 56  ? 10.861  -3.890  7.610   1.00 0.00 ? 56  GLU A CG   2  
ATOM 2637  C CD   . GLU A 1 56  ? 12.022  -4.213  8.531   1.00 0.00 ? 56  GLU A CD   2  
ATOM 2638  O OE1  . GLU A 1 56  ? 12.559  -5.336  8.437   1.00 0.00 ? 56  GLU A OE1  2  
ATOM 2639  O OE2  . GLU A 1 56  ? 12.393  -3.341  9.344   1.00 0.00 ? 56  GLU A OE2  2  
ATOM 2640  H H    . GLU A 1 56  ? 9.498   -5.784  5.743   1.00 0.00 ? 56  GLU A H    2  
ATOM 2641  H HA   . GLU A 1 56  ? 9.516   -2.913  5.412   1.00 0.00 ? 56  GLU A HA   2  
ATOM 2642  H HB2  . GLU A 1 56  ? 11.761  -4.864  5.952   1.00 0.00 ? 56  GLU A HB2  2  
ATOM 2643  H HB3  . GLU A 1 56  ? 11.929  -3.115  5.948   1.00 0.00 ? 56  GLU A HB3  2  
ATOM 2644  H HG2  . GLU A 1 56  ? 10.500  -2.900  7.846   1.00 0.00 ? 56  GLU A HG2  2  
ATOM 2645  H HG3  . GLU A 1 56  ? 10.074  -4.609  7.782   1.00 0.00 ? 56  GLU A HG3  2  
ATOM 2646  N N    . SER A 1 57  ? 11.081  -4.871  3.257   1.00 0.00 ? 57  SER A N    2  
ATOM 2647  C CA   . SER A 1 57  ? 11.593  -4.940  1.893   1.00 0.00 ? 57  SER A CA   2  
ATOM 2648  C C    . SER A 1 57  ? 11.801  -6.390  1.465   1.00 0.00 ? 57  SER A C    2  
ATOM 2649  O O    . SER A 1 57  ? 12.298  -7.211  2.234   1.00 0.00 ? 57  SER A O    2  
ATOM 2650  C CB   . SER A 1 57  ? 12.910  -4.169  1.781   1.00 0.00 ? 57  SER A CB   2  
ATOM 2651  O OG   . SER A 1 57  ? 13.892  -4.708  2.649   1.00 0.00 ? 57  SER A OG   2  
ATOM 2652  H H    . SER A 1 57  ? 11.129  -5.666  3.828   1.00 0.00 ? 57  SER A H    2  
ATOM 2653  H HA   . SER A 1 57  ? 10.863  -4.486  1.241   1.00 0.00 ? 57  SER A HA   2  
ATOM 2654  H HB2  . SER A 1 57  ? 13.273  -4.228  0.766   1.00 0.00 ? 57  SER A HB2  2  
ATOM 2655  H HB3  . SER A 1 57  ? 12.742  -3.135  2.044   1.00 0.00 ? 57  SER A HB3  2  
ATOM 2656  H HG   . SER A 1 57  ? 14.254  -4.008  3.197   1.00 0.00 ? 57  SER A HG   2  
ATOM 2657  N N    . GLY A 1 58  ? 11.416  -6.696  0.229   1.00 0.00 ? 58  GLY A N    2  
ATOM 2658  C CA   . GLY A 1 58  ? 11.568  -8.046  -0.282  1.00 0.00 ? 58  GLY A CA   2  
ATOM 2659  C C    . GLY A 1 58  ? 10.240  -8.684  -0.637  1.00 0.00 ? 58  GLY A C    2  
ATOM 2660  O O    . GLY A 1 58  ? 9.289   -7.994  -1.006  1.00 0.00 ? 58  GLY A O    2  
ATOM 2661  H H    . GLY A 1 58  ? 11.026  -6.000  -0.340  1.00 0.00 ? 58  GLY A H    2  
ATOM 2662  H HA2  . GLY A 1 58  ? 12.190  -8.017  -1.164  1.00 0.00 ? 58  GLY A HA2  2  
ATOM 2663  H HA3  . GLY A 1 58  ? 12.055  -8.650  0.470   1.00 0.00 ? 58  GLY A HA3  2  
ATOM 2664  N N    . THR A 1 59  ? 10.173  -10.007 -0.528  1.00 0.00 ? 59  THR A N    2  
ATOM 2665  C CA   . THR A 1 59  ? 8.952   -10.739 -0.843  1.00 0.00 ? 59  THR A CA   2  
ATOM 2666  C C    . THR A 1 59  ? 8.620   -11.750 0.249   1.00 0.00 ? 59  THR A C    2  
ATOM 2667  O O    . THR A 1 59  ? 9.399   -12.663 0.521   1.00 0.00 ? 59  THR A O    2  
ATOM 2668  C CB   . THR A 1 59  ? 9.071   -11.476 -2.190  1.00 0.00 ? 59  THR A CB   2  
ATOM 2669  O OG1  . THR A 1 59  ? 9.403   -10.548 -3.229  1.00 0.00 ? 59  THR A OG1  2  
ATOM 2670  C CG2  . THR A 1 59  ? 7.772   -12.188 -2.535  1.00 0.00 ? 59  THR A CG2  2  
ATOM 2671  H H    . THR A 1 59  ? 10.964  -10.502 -0.228  1.00 0.00 ? 59  THR A H    2  
ATOM 2672  H HA   . THR A 1 59  ? 8.145   -10.025 -0.917  1.00 0.00 ? 59  THR A HA   2  
ATOM 2673  H HB   . THR A 1 59  ? 9.858   -12.213 -2.112  1.00 0.00 ? 59  THR A HB   2  
ATOM 2674  H HG1  . THR A 1 59  ? 10.291  -10.211 -3.086  1.00 0.00 ? 59  THR A HG1  2  
ATOM 2675  H HG21 . THR A 1 59  ? 6.936   -11.545 -2.299  1.00 0.00 ? 59  THR A HG21 2  
ATOM 2676  H HG22 . THR A 1 59  ? 7.698   -13.100 -1.961  1.00 0.00 ? 59  THR A HG22 2  
ATOM 2677  H HG23 . THR A 1 59  ? 7.758   -12.422 -3.588  1.00 0.00 ? 59  THR A HG23 2  
ATOM 2678  N N    . SER A 1 60  ? 7.458   -11.581 0.871   1.00 0.00 ? 60  SER A N    2  
ATOM 2679  C CA   . SER A 1 60  ? 7.024   -12.477 1.936   1.00 0.00 ? 60  SER A CA   2  
ATOM 2680  C C    . SER A 1 60  ? 5.681   -13.116 1.595   1.00 0.00 ? 60  SER A C    2  
ATOM 2681  O O    . SER A 1 60  ? 4.635   -12.473 1.678   1.00 0.00 ? 60  SER A O    2  
ATOM 2682  C CB   . SER A 1 60  ? 6.918   -11.718 3.260   1.00 0.00 ? 60  SER A CB   2  
ATOM 2683  O OG   . SER A 1 60  ? 7.008   -12.601 4.364   1.00 0.00 ? 60  SER A OG   2  
ATOM 2684  H H    . SER A 1 60  ? 6.880   -10.834 0.610   1.00 0.00 ? 60  SER A H    2  
ATOM 2685  H HA   . SER A 1 60  ? 7.764   -13.256 2.037   1.00 0.00 ? 60  SER A HA   2  
ATOM 2686  H HB2  . SER A 1 60  ? 7.719   -10.998 3.324   1.00 0.00 ? 60  SER A HB2  2  
ATOM 2687  H HB3  . SER A 1 60  ? 5.968   -11.204 3.302   1.00 0.00 ? 60  SER A HB3  2  
ATOM 2688  H HG   . SER A 1 60  ? 6.144   -12.695 4.771   1.00 0.00 ? 60  SER A HG   2  
ATOM 2689  N N    . GLY A 1 61  ? 5.719   -14.389 1.210   1.00 0.00 ? 61  GLY A N    2  
ATOM 2690  C CA   . GLY A 1 61  ? 4.500   -15.095 0.861   1.00 0.00 ? 61  GLY A CA   2  
ATOM 2691  C C    . GLY A 1 61  ? 3.812   -14.500 -0.352  1.00 0.00 ? 61  GLY A C    2  
ATOM 2692  O O    . GLY A 1 61  ? 4.197   -14.775 -1.489  1.00 0.00 ? 61  GLY A O    2  
ATOM 2693  H H    . GLY A 1 61  ? 6.582   -14.851 1.162   1.00 0.00 ? 61  GLY A H    2  
ATOM 2694  H HA2  . GLY A 1 61  ? 4.741   -16.127 0.655   1.00 0.00 ? 61  GLY A HA2  2  
ATOM 2695  H HA3  . GLY A 1 61  ? 3.821   -15.054 1.700   1.00 0.00 ? 61  GLY A HA3  2  
ATOM 2696  N N    . ARG A 1 62  ? 2.791   -13.685 -0.111  1.00 0.00 ? 62  ARG A N    2  
ATOM 2697  C CA   . ARG A 1 62  ? 2.047   -13.052 -1.194  1.00 0.00 ? 62  ARG A CA   2  
ATOM 2698  C C    . ARG A 1 62  ? 2.134   -11.532 -1.098  1.00 0.00 ? 62  ARG A C    2  
ATOM 2699  O O    . ARG A 1 62  ? 1.132   -10.832 -1.251  1.00 0.00 ? 62  ARG A O    2  
ATOM 2700  C CB   . ARG A 1 62  ? 0.582   -13.493 -1.160  1.00 0.00 ? 62  ARG A CB   2  
ATOM 2701  C CG   . ARG A 1 62  ? 0.355   -14.893 -1.706  1.00 0.00 ? 62  ARG A CG   2  
ATOM 2702  C CD   . ARG A 1 62  ? -1.105  -15.120 -2.066  1.00 0.00 ? 62  ARG A CD   2  
ATOM 2703  N NE   . ARG A 1 62  ? -1.928  -15.369 -0.886  1.00 0.00 ? 62  ARG A NE   2  
ATOM 2704  C CZ   . ARG A 1 62  ? -1.898  -16.505 -0.196  1.00 0.00 ? 62  ARG A CZ   2  
ATOM 2705  N NH1  . ARG A 1 62  ? -1.092  -17.489 -0.568  1.00 0.00 ? 62  ARG A NH1  2  
ATOM 2706  N NH2  . ARG A 1 62  ? -2.677  -16.656 0.868   1.00 0.00 ? 62  ARG A NH2  2  
ATOM 2707  H H    . ARG A 1 62  ? 2.532   -13.504 0.816   1.00 0.00 ? 62  ARG A H    2  
ATOM 2708  H HA   . ARG A 1 62  ? 2.487   -13.368 -2.128  1.00 0.00 ? 62  ARG A HA   2  
ATOM 2709  H HB2  . ARG A 1 62  ? 0.235   -13.469 -0.137  1.00 0.00 ? 62  ARG A HB2  2  
ATOM 2710  H HB3  . ARG A 1 62  ? -0.003  -12.801 -1.746  1.00 0.00 ? 62  ARG A HB3  2  
ATOM 2711  H HG2  . ARG A 1 62  ? 0.957   -15.025 -2.593  1.00 0.00 ? 62  ARG A HG2  2  
ATOM 2712  H HG3  . ARG A 1 62  ? 0.648   -15.614 -0.958  1.00 0.00 ? 62  ARG A HG3  2  
ATOM 2713  H HD2  . ARG A 1 62  ? -1.478  -14.242 -2.574  1.00 0.00 ? 62  ARG A HD2  2  
ATOM 2714  H HD3  . ARG A 1 62  ? -1.171  -15.972 -2.726  1.00 0.00 ? 62  ARG A HD3  2  
ATOM 2715  H HE   . ARG A 1 62  ? -2.531  -14.655 -0.594  1.00 0.00 ? 62  ARG A HE   2  
ATOM 2716  H HH11 . ARG A 1 62  ? -0.503  -17.377 -1.368  1.00 0.00 ? 62  ARG A HH11 2  
ATOM 2717  H HH12 . ARG A 1 62  ? -1.071  -18.342 -0.046  1.00 0.00 ? 62  ARG A HH12 2  
ATOM 2718  H HH21 . ARG A 1 62  ? -3.286  -15.916 1.151   1.00 0.00 ? 62  ARG A HH21 2  
ATOM 2719  H HH22 . ARG A 1 62  ? -2.654  -17.511 1.385   1.00 0.00 ? 62  ARG A HH22 2  
ATOM 2720  N N    . TYR A 1 63  ? 3.336   -11.028 -0.843  1.00 0.00 ? 63  TYR A N    2  
ATOM 2721  C CA   . TYR A 1 63  ? 3.553   -9.591  -0.723  1.00 0.00 ? 63  TYR A CA   2  
ATOM 2722  C C    . TYR A 1 63  ? 4.963   -9.215  -1.169  1.00 0.00 ? 63  TYR A C    2  
ATOM 2723  O O    . TYR A 1 63  ? 5.932   -9.911  -0.863  1.00 0.00 ? 63  TYR A O    2  
ATOM 2724  C CB   . TYR A 1 63  ? 3.324   -9.138  0.720   1.00 0.00 ? 63  TYR A CB   2  
ATOM 2725  C CG   . TYR A 1 63  ? 1.897   -9.306  1.188   1.00 0.00 ? 63  TYR A CG   2  
ATOM 2726  C CD1  . TYR A 1 63  ? 0.906   -8.416  0.792   1.00 0.00 ? 63  TYR A CD1  2  
ATOM 2727  C CD2  . TYR A 1 63  ? 1.538   -10.355 2.025   1.00 0.00 ? 63  TYR A CD2  2  
ATOM 2728  C CE1  . TYR A 1 63  ? -0.400  -8.565  1.218   1.00 0.00 ? 63  TYR A CE1  2  
ATOM 2729  C CE2  . TYR A 1 63  ? 0.235   -10.513 2.455   1.00 0.00 ? 63  TYR A CE2  2  
ATOM 2730  C CZ   . TYR A 1 63  ? -0.730  -9.615  2.049   1.00 0.00 ? 63  TYR A CZ   2  
ATOM 2731  O OH   . TYR A 1 63  ? -2.030  -9.768  2.474   1.00 0.00 ? 63  TYR A OH   2  
ATOM 2732  H H    . TYR A 1 63  ? 4.096   -11.637 -0.731  1.00 0.00 ? 63  TYR A H    2  
ATOM 2733  H HA   . TYR A 1 63  ? 2.840   -9.094  -1.364  1.00 0.00 ? 63  TYR A HA   2  
ATOM 2734  H HB2  . TYR A 1 63  ? 3.958   -9.715  1.376   1.00 0.00 ? 63  TYR A HB2  2  
ATOM 2735  H HB3  . TYR A 1 63  ? 3.582   -8.093  0.806   1.00 0.00 ? 63  TYR A HB3  2  
ATOM 2736  H HD1  . TYR A 1 63  ? 1.168   -7.595  0.140   1.00 0.00 ? 63  TYR A HD1  2  
ATOM 2737  H HD2  . TYR A 1 63  ? 2.297   -11.057 2.341   1.00 0.00 ? 63  TYR A HD2  2  
ATOM 2738  H HE1  . TYR A 1 63  ? -1.156  -7.863  0.900   1.00 0.00 ? 63  TYR A HE1  2  
ATOM 2739  H HE2  . TYR A 1 63  ? -0.025  -11.335 3.106   1.00 0.00 ? 63  TYR A HE2  2  
ATOM 2740  H HH   . TYR A 1 63  ? -2.110  -10.587 2.970   1.00 0.00 ? 63  TYR A HH   2  
ATOM 2741  N N    . THR A 1 64  ? 5.071   -8.106  -1.895  1.00 0.00 ? 64  THR A N    2  
ATOM 2742  C CA   . THR A 1 64  ? 6.360   -7.635  -2.384  1.00 0.00 ? 64  THR A CA   2  
ATOM 2743  C C    . THR A 1 64  ? 6.458   -6.116  -2.302  1.00 0.00 ? 64  THR A C    2  
ATOM 2744  O O    . THR A 1 64  ? 5.783   -5.399  -3.042  1.00 0.00 ? 64  THR A O    2  
ATOM 2745  C CB   . THR A 1 64  ? 6.604   -8.076  -3.839  1.00 0.00 ? 64  THR A CB   2  
ATOM 2746  O OG1  . THR A 1 64  ? 6.289   -9.465  -3.990  1.00 0.00 ? 64  THR A OG1  2  
ATOM 2747  C CG2  . THR A 1 64  ? 8.050   -7.832  -4.244  1.00 0.00 ? 64  THR A CG2  2  
ATOM 2748  H H    . THR A 1 64  ? 4.262   -7.594  -2.106  1.00 0.00 ? 64  THR A H    2  
ATOM 2749  H HA   . THR A 1 64  ? 7.131   -8.069  -1.764  1.00 0.00 ? 64  THR A HA   2  
ATOM 2750  H HB   . THR A 1 64  ? 5.962   -7.497  -4.487  1.00 0.00 ? 64  THR A HB   2  
ATOM 2751  H HG1  . THR A 1 64  ? 6.093   -9.651  -4.911  1.00 0.00 ? 64  THR A HG1  2  
ATOM 2752  H HG21 . THR A 1 64  ? 8.708   -8.212  -3.475  1.00 0.00 ? 64  THR A HG21 2  
ATOM 2753  H HG22 . THR A 1 64  ? 8.215   -6.772  -4.368  1.00 0.00 ? 64  THR A HG22 2  
ATOM 2754  H HG23 . THR A 1 64  ? 8.254   -8.340  -5.174  1.00 0.00 ? 64  THR A HG23 2  
ATOM 2755  N N    . VAL A 1 65  ? 7.303   -5.629  -1.398  1.00 0.00 ? 65  VAL A N    2  
ATOM 2756  C CA   . VAL A 1 65  ? 7.490   -4.194  -1.221  1.00 0.00 ? 65  VAL A CA   2  
ATOM 2757  C C    . VAL A 1 65  ? 8.604   -3.671  -2.120  1.00 0.00 ? 65  VAL A C    2  
ATOM 2758  O O    . VAL A 1 65  ? 9.624   -4.333  -2.310  1.00 0.00 ? 65  VAL A O    2  
ATOM 2759  C CB   . VAL A 1 65  ? 7.820   -3.848  0.243   1.00 0.00 ? 65  VAL A CB   2  
ATOM 2760  C CG1  . VAL A 1 65  ? 8.282   -2.403  0.359   1.00 0.00 ? 65  VAL A CG1  2  
ATOM 2761  C CG2  . VAL A 1 65  ? 6.615   -4.104  1.135   1.00 0.00 ? 65  VAL A CG2  2  
ATOM 2762  H H    . VAL A 1 65  ? 7.813   -6.251  -0.838  1.00 0.00 ? 65  VAL A H    2  
ATOM 2763  H HA   . VAL A 1 65  ? 6.565   -3.702  -1.486  1.00 0.00 ? 65  VAL A HA   2  
ATOM 2764  H HB   . VAL A 1 65  ? 8.627   -4.487  0.570   1.00 0.00 ? 65  VAL A HB   2  
ATOM 2765  H HG11 . VAL A 1 65  ? 9.146   -2.250  -0.271  1.00 0.00 ? 65  VAL A HG11 2  
ATOM 2766  H HG12 . VAL A 1 65  ? 7.485   -1.744  0.046   1.00 0.00 ? 65  VAL A HG12 2  
ATOM 2767  H HG13 . VAL A 1 65  ? 8.543   -2.190  1.385   1.00 0.00 ? 65  VAL A HG13 2  
ATOM 2768  H HG21 . VAL A 1 65  ? 5.747   -4.292  0.521   1.00 0.00 ? 65  VAL A HG21 2  
ATOM 2769  H HG22 . VAL A 1 65  ? 6.807   -4.964  1.761   1.00 0.00 ? 65  VAL A HG22 2  
ATOM 2770  H HG23 . VAL A 1 65  ? 6.437   -3.240  1.758   1.00 0.00 ? 65  VAL A HG23 2  
ATOM 2771  N N    . GLU A 1 66  ? 8.402   -2.477  -2.670  1.00 0.00 ? 66  GLU A N    2  
ATOM 2772  C CA   . GLU A 1 66  ? 9.391   -1.865  -3.549  1.00 0.00 ? 66  GLU A CA   2  
ATOM 2773  C C    . GLU A 1 66  ? 9.210   -0.350  -3.601  1.00 0.00 ? 66  GLU A C    2  
ATOM 2774  O O    . GLU A 1 66  ? 8.234   0.151   -4.160  1.00 0.00 ? 66  GLU A O    2  
ATOM 2775  C CB   . GLU A 1 66  ? 9.286   -2.451  -4.958  1.00 0.00 ? 66  GLU A CB   2  
ATOM 2776  C CG   . GLU A 1 66  ? 9.688   -3.913  -5.041  1.00 0.00 ? 66  GLU A CG   2  
ATOM 2777  C CD   . GLU A 1 66  ? 9.846   -4.395  -6.470  1.00 0.00 ? 66  GLU A CD   2  
ATOM 2778  O OE1  . GLU A 1 66  ? 8.868   -4.296  -7.241  1.00 0.00 ? 66  GLU A OE1  2  
ATOM 2779  O OE2  . GLU A 1 66  ? 10.947  -4.871  -6.819  1.00 0.00 ? 66  GLU A OE2  2  
ATOM 2780  H H    . GLU A 1 66  ? 7.569   -1.998  -2.480  1.00 0.00 ? 66  GLU A H    2  
ATOM 2781  H HA   . GLU A 1 66  ? 10.370  -2.084  -3.151  1.00 0.00 ? 66  GLU A HA   2  
ATOM 2782  H HB2  . GLU A 1 66  ? 8.264   -2.359  -5.298  1.00 0.00 ? 66  GLU A HB2  2  
ATOM 2783  H HB3  . GLU A 1 66  ? 9.926   -1.885  -5.619  1.00 0.00 ? 66  GLU A HB3  2  
ATOM 2784  H HG2  . GLU A 1 66  ? 10.629  -4.044  -4.528  1.00 0.00 ? 66  GLU A HG2  2  
ATOM 2785  H HG3  . GLU A 1 66  ? 8.929   -4.510  -4.558  1.00 0.00 ? 66  GLU A HG3  2  
ATOM 2786  N N    . THR A 1 67  ? 10.157  0.374   -3.013  1.00 0.00 ? 67  THR A N    2  
ATOM 2787  C CA   . THR A 1 67  ? 10.102  1.830   -2.990  1.00 0.00 ? 67  THR A CA   2  
ATOM 2788  C C    . THR A 1 67  ? 10.814  2.427   -4.199  1.00 0.00 ? 67  THR A C    2  
ATOM 2789  O O    . THR A 1 67  ? 11.883  1.960   -4.594  1.00 0.00 ? 67  THR A O    2  
ATOM 2790  C CB   . THR A 1 67  ? 10.735  2.396   -1.705  1.00 0.00 ? 67  THR A CB   2  
ATOM 2791  O OG1  . THR A 1 67  ? 10.537  1.484   -0.619  1.00 0.00 ? 67  THR A OG1  2  
ATOM 2792  C CG2  . THR A 1 67  ? 10.132  3.748   -1.355  1.00 0.00 ? 67  THR A CG2  2  
ATOM 2793  H H    . THR A 1 67  ? 10.910  -0.084  -2.585  1.00 0.00 ? 67  THR A H    2  
ATOM 2794  H HA   . THR A 1 67  ? 9.063   2.125   -3.015  1.00 0.00 ? 67  THR A HA   2  
ATOM 2795  H HB   . THR A 1 67  ? 11.795  2.523   -1.870  1.00 0.00 ? 67  THR A HB   2  
ATOM 2796  H HG1  . THR A 1 67  ? 9.707   1.017   -0.740  1.00 0.00 ? 67  THR A HG1  2  
ATOM 2797  H HG21 . THR A 1 67  ? 9.535   3.655   -0.459  1.00 0.00 ? 67  THR A HG21 2  
ATOM 2798  H HG22 . THR A 1 67  ? 9.508   4.086   -2.169  1.00 0.00 ? 67  THR A HG22 2  
ATOM 2799  H HG23 . THR A 1 67  ? 10.923  4.462   -1.187  1.00 0.00 ? 67  THR A HG23 2  
ATOM 2800  N N    . ILE A 1 68  ? 10.216  3.460   -4.782  1.00 0.00 ? 68  ILE A N    2  
ATOM 2801  C CA   . ILE A 1 68  ? 10.795  4.121   -5.945  1.00 0.00 ? 68  ILE A CA   2  
ATOM 2802  C C    . ILE A 1 68  ? 11.067  5.594   -5.662  1.00 0.00 ? 68  ILE A C    2  
ATOM 2803  O O    . ILE A 1 68  ? 10.724  6.105   -4.596  1.00 0.00 ? 68  ILE A O    2  
ATOM 2804  C CB   . ILE A 1 68  ? 9.874   4.007   -7.174  1.00 0.00 ? 68  ILE A CB   2  
ATOM 2805  C CG1  . ILE A 1 68  ? 9.087   2.696   -7.130  1.00 0.00 ? 68  ILE A CG1  2  
ATOM 2806  C CG2  . ILE A 1 68  ? 10.687  4.101   -8.456  1.00 0.00 ? 68  ILE A CG2  2  
ATOM 2807  C CD1  . ILE A 1 68  ? 7.956   2.635   -8.132  1.00 0.00 ? 68  ILE A CD1  2  
ATOM 2808  H H    . ILE A 1 68  ? 9.366   3.786   -4.421  1.00 0.00 ? 68  ILE A H    2  
ATOM 2809  H HA   . ILE A 1 68  ? 11.730  3.631   -6.175  1.00 0.00 ? 68  ILE A HA   2  
ATOM 2810  H HB   . ILE A 1 68  ? 9.181   4.835   -7.154  1.00 0.00 ? 68  ILE A HB   2  
ATOM 2811  H HG12 . ILE A 1 68  ? 9.756   1.875   -7.336  1.00 0.00 ? 68  ILE A HG12 2  
ATOM 2812  H HG13 . ILE A 1 68  ? 8.665   2.571   -6.143  1.00 0.00 ? 68  ILE A HG13 2  
ATOM 2813  H HG21 . ILE A 1 68  ? 11.683  3.723   -8.279  1.00 0.00 ? 68  ILE A HG21 2  
ATOM 2814  H HG22 . ILE A 1 68  ? 10.212  3.513   -9.227  1.00 0.00 ? 68  ILE A HG22 2  
ATOM 2815  H HG23 . ILE A 1 68  ? 10.744  5.132   -8.772  1.00 0.00 ? 68  ILE A HG23 2  
ATOM 2816  H HD11 . ILE A 1 68  ? 7.849   1.623   -8.494  1.00 0.00 ? 68  ILE A HD11 2  
ATOM 2817  H HD12 . ILE A 1 68  ? 7.038   2.949   -7.659  1.00 0.00 ? 68  ILE A HD12 2  
ATOM 2818  H HD13 . ILE A 1 68  ? 8.176   3.292   -8.962  1.00 0.00 ? 68  ILE A HD13 2  
ATOM 2819  N N    . SER A 1 69  ? 11.684  6.272   -6.624  1.00 0.00 ? 69  SER A N    2  
ATOM 2820  C CA   . SER A 1 69  ? 12.004  7.687   -6.477  1.00 0.00 ? 69  SER A CA   2  
ATOM 2821  C C    . SER A 1 69  ? 11.395  8.503   -7.614  1.00 0.00 ? 69  SER A C    2  
ATOM 2822  O O    . SER A 1 69  ? 11.763  8.340   -8.778  1.00 0.00 ? 69  SER A O    2  
ATOM 2823  C CB   . SER A 1 69  ? 13.520  7.889   -6.446  1.00 0.00 ? 69  SER A CB   2  
ATOM 2824  O OG   . SER A 1 69  ? 14.127  7.379   -7.620  1.00 0.00 ? 69  SER A OG   2  
ATOM 2825  H H    . SER A 1 69  ? 11.932  5.809   -7.451  1.00 0.00 ? 69  SER A H    2  
ATOM 2826  H HA   . SER A 1 69  ? 11.585  8.027   -5.542  1.00 0.00 ? 69  SER A HA   2  
ATOM 2827  H HB2  . SER A 1 69  ? 13.739  8.943   -6.370  1.00 0.00 ? 69  SER A HB2  2  
ATOM 2828  H HB3  . SER A 1 69  ? 13.931  7.373   -5.589  1.00 0.00 ? 69  SER A HB3  2  
ATOM 2829  H HG   . SER A 1 69  ? 13.449  7.038   -8.209  1.00 0.00 ? 69  SER A HG   2  
ATOM 2830  N N    . THR A 1 70  ? 10.460  9.382   -7.268  1.00 0.00 ? 70  THR A N    2  
ATOM 2831  C CA   . THR A 1 70  ? 9.798   10.222  -8.258  1.00 0.00 ? 70  THR A CA   2  
ATOM 2832  C C    . THR A 1 70  ? 10.144  11.693  -8.051  1.00 0.00 ? 70  THR A C    2  
ATOM 2833  O O    . THR A 1 70  ? 10.820  12.050  -7.087  1.00 0.00 ? 70  THR A O    2  
ATOM 2834  C CB   . THR A 1 70  ? 8.268   10.055  -8.204  1.00 0.00 ? 70  THR A CB   2  
ATOM 2835  O OG1  . THR A 1 70  ? 7.785   10.380  -6.896  1.00 0.00 ? 70  THR A OG1  2  
ATOM 2836  C CG2  . THR A 1 70  ? 7.867   8.630   -8.558  1.00 0.00 ? 70  THR A CG2  2  
ATOM 2837  H H    . THR A 1 70  ? 10.209  9.466   -6.325  1.00 0.00 ? 70  THR A H    2  
ATOM 2838  H HA   . THR A 1 70  ? 10.138  9.917   -9.237  1.00 0.00 ? 70  THR A HA   2  
ATOM 2839  H HB   . THR A 1 70  ? 7.821   10.727  -8.923  1.00 0.00 ? 70  THR A HB   2  
ATOM 2840  H HG1  . THR A 1 70  ? 7.279   11.196  -6.936  1.00 0.00 ? 70  THR A HG1  2  
ATOM 2841  H HG21 . THR A 1 70  ? 7.923   8.011   -7.676  1.00 0.00 ? 70  THR A HG21 2  
ATOM 2842  H HG22 . THR A 1 70  ? 8.537   8.245   -9.312  1.00 0.00 ? 70  THR A HG22 2  
ATOM 2843  H HG23 . THR A 1 70  ? 6.856   8.625   -8.938  1.00 0.00 ? 70  THR A HG23 2  
ATOM 2844  N N    . GLU A 1 71  ? 9.675   12.540  -8.961  1.00 0.00 ? 71  GLU A N    2  
ATOM 2845  C CA   . GLU A 1 71  ? 9.937   13.972  -8.877  1.00 0.00 ? 71  GLU A CA   2  
ATOM 2846  C C    . GLU A 1 71  ? 9.371   14.553  -7.584  1.00 0.00 ? 71  GLU A C    2  
ATOM 2847  O O    . GLU A 1 71  ? 10.048  15.303  -6.881  1.00 0.00 ? 71  GLU A O    2  
ATOM 2848  C CB   . GLU A 1 71  ? 9.331   14.696  -10.081 1.00 0.00 ? 71  GLU A CB   2  
ATOM 2849  C CG   . GLU A 1 71  ? 7.856   14.399  -10.291 1.00 0.00 ? 71  GLU A CG   2  
ATOM 2850  C CD   . GLU A 1 71  ? 7.408   14.647  -11.718 1.00 0.00 ? 71  GLU A CD   2  
ATOM 2851  O OE1  . GLU A 1 71  ? 7.153   15.819  -12.066 1.00 0.00 ? 71  GLU A OE1  2  
ATOM 2852  O OE2  . GLU A 1 71  ? 7.312   13.668  -12.488 1.00 0.00 ? 71  GLU A OE2  2  
ATOM 2853  H H    . GLU A 1 71  ? 9.142   12.194  -9.707  1.00 0.00 ? 71  GLU A H    2  
ATOM 2854  H HA   . GLU A 1 71  ? 11.006  14.115  -8.884  1.00 0.00 ? 71  GLU A HA   2  
ATOM 2855  H HB2  . GLU A 1 71  ? 9.447   15.760  -9.943  1.00 0.00 ? 71  GLU A HB2  2  
ATOM 2856  H HB3  . GLU A 1 71  ? 9.866   14.398  -10.971 1.00 0.00 ? 71  GLU A HB3  2  
ATOM 2857  H HG2  . GLU A 1 71  ? 7.671   13.364  -10.047 1.00 0.00 ? 71  GLU A HG2  2  
ATOM 2858  H HG3  . GLU A 1 71  ? 7.277   15.031  -9.633  1.00 0.00 ? 71  GLU A HG3  2  
ATOM 2859  N N    . GLU A 1 72  ? 8.126   14.200  -7.278  1.00 0.00 ? 72  GLU A N    2  
ATOM 2860  C CA   . GLU A 1 72  ? 7.470   14.688  -6.071  1.00 0.00 ? 72  GLU A CA   2  
ATOM 2861  C C    . GLU A 1 72  ? 8.199   14.202  -4.821  1.00 0.00 ? 72  GLU A C    2  
ATOM 2862  O O    . GLU A 1 72  ? 8.250   14.899  -3.809  1.00 0.00 ? 72  GLU A O    2  
ATOM 2863  C CB   . GLU A 1 72  ? 6.011   14.227  -6.035  1.00 0.00 ? 72  GLU A CB   2  
ATOM 2864  C CG   . GLU A 1 72  ? 5.202   14.675  -7.240  1.00 0.00 ? 72  GLU A CG   2  
ATOM 2865  C CD   . GLU A 1 72  ? 3.727   14.834  -6.926  1.00 0.00 ? 72  GLU A CD   2  
ATOM 2866  O OE1  . GLU A 1 72  ? 3.107   13.849  -6.473  1.00 0.00 ? 72  GLU A OE1  2  
ATOM 2867  O OE2  . GLU A 1 72  ? 3.192   15.943  -7.134  1.00 0.00 ? 72  GLU A OE2  2  
ATOM 2868  H H    . GLU A 1 72  ? 7.638   13.599  -7.879  1.00 0.00 ? 72  GLU A H    2  
ATOM 2869  H HA   . GLU A 1 72  ? 7.496   15.767  -6.092  1.00 0.00 ? 72  GLU A HA   2  
ATOM 2870  H HB2  . GLU A 1 72  ? 5.988   13.148  -5.993  1.00 0.00 ? 72  GLU A HB2  2  
ATOM 2871  H HB3  . GLU A 1 72  ? 5.543   14.622  -5.146  1.00 0.00 ? 72  GLU A HB3  2  
ATOM 2872  H HG2  . GLU A 1 72  ? 5.585   15.625  -7.582  1.00 0.00 ? 72  GLU A HG2  2  
ATOM 2873  H HG3  . GLU A 1 72  ? 5.311   13.941  -8.025  1.00 0.00 ? 72  GLU A HG3  2  
ATOM 2874  N N    . GLY A 1 73  ? 8.761   13.000  -4.901  1.00 0.00 ? 73  GLY A N    2  
ATOM 2875  C CA   . GLY A 1 73  ? 9.479   12.440  -3.770  1.00 0.00 ? 73  GLY A CA   2  
ATOM 2876  C C    . GLY A 1 73  ? 9.754   10.959  -3.934  1.00 0.00 ? 73  GLY A C    2  
ATOM 2877  O O    . GLY A 1 73  ? 10.785  10.568  -4.480  1.00 0.00 ? 73  GLY A O    2  
ATOM 2878  H H    . GLY A 1 73  ? 8.688   12.489  -5.734  1.00 0.00 ? 73  GLY A H    2  
ATOM 2879  H HA2  . GLY A 1 73  ? 10.419  12.961  -3.661  1.00 0.00 ? 73  GLY A HA2  2  
ATOM 2880  H HA3  . GLY A 1 73  ? 8.891   12.589  -2.876  1.00 0.00 ? 73  GLY A HA3  2  
ATOM 2881  N N    . VAL A 1 74  ? 8.829   10.131  -3.457  1.00 0.00 ? 74  VAL A N    2  
ATOM 2882  C CA   . VAL A 1 74  ? 8.977   8.683   -3.552  1.00 0.00 ? 74  VAL A CA   2  
ATOM 2883  C C    . VAL A 1 74  ? 7.623   8.003   -3.720  1.00 0.00 ? 74  VAL A C    2  
ATOM 2884  O O    . VAL A 1 74  ? 6.579   8.651   -3.654  1.00 0.00 ? 74  VAL A O    2  
ATOM 2885  C CB   . VAL A 1 74  ? 9.678   8.108   -2.308  1.00 0.00 ? 74  VAL A CB   2  
ATOM 2886  C CG1  . VAL A 1 74  ? 11.186  8.087   -2.506  1.00 0.00 ? 74  VAL A CG1  2  
ATOM 2887  C CG2  . VAL A 1 74  ? 9.306   8.908   -1.069  1.00 0.00 ? 74  VAL A CG2  2  
ATOM 2888  H H    . VAL A 1 74  ? 8.029   10.502  -3.032  1.00 0.00 ? 74  VAL A H    2  
ATOM 2889  H HA   . VAL A 1 74  ? 9.588   8.466   -4.417  1.00 0.00 ? 74  VAL A HA   2  
ATOM 2890  H HB   . VAL A 1 74  ? 9.342   7.091   -2.168  1.00 0.00 ? 74  VAL A HB   2  
ATOM 2891  H HG11 . VAL A 1 74  ? 11.409  7.944   -3.553  1.00 0.00 ? 74  VAL A HG11 2  
ATOM 2892  H HG12 . VAL A 1 74  ? 11.607  9.024   -2.172  1.00 0.00 ? 74  VAL A HG12 2  
ATOM 2893  H HG13 . VAL A 1 74  ? 11.613  7.276   -1.934  1.00 0.00 ? 74  VAL A HG13 2  
ATOM 2894  H HG21 . VAL A 1 74  ? 9.243   8.246   -0.219  1.00 0.00 ? 74  VAL A HG21 2  
ATOM 2895  H HG22 . VAL A 1 74  ? 10.061  9.659   -0.885  1.00 0.00 ? 74  VAL A HG22 2  
ATOM 2896  H HG23 . VAL A 1 74  ? 8.352   9.389   -1.223  1.00 0.00 ? 74  VAL A HG23 2  
ATOM 2897  N N    . ILE A 1 75  ? 7.649   6.692   -3.937  1.00 0.00 ? 75  ILE A N    2  
ATOM 2898  C CA   . ILE A 1 75  ? 6.424   5.923   -4.113  1.00 0.00 ? 75  ILE A CA   2  
ATOM 2899  C C    . ILE A 1 75  ? 6.629   4.464   -3.718  1.00 0.00 ? 75  ILE A C    2  
ATOM 2900  O O    . ILE A 1 75  ? 7.266   3.699   -4.441  1.00 0.00 ? 75  ILE A O    2  
ATOM 2901  C CB   . ILE A 1 75  ? 5.924   5.984   -5.568  1.00 0.00 ? 75  ILE A CB   2  
ATOM 2902  C CG1  . ILE A 1 75  ? 5.595   7.427   -5.957  1.00 0.00 ? 75  ILE A CG1  2  
ATOM 2903  C CG2  . ILE A 1 75  ? 4.706   5.091   -5.748  1.00 0.00 ? 75  ILE A CG2  2  
ATOM 2904  C CD1  . ILE A 1 75  ? 4.839   7.543   -7.262  1.00 0.00 ? 75  ILE A CD1  2  
ATOM 2905  H H    . ILE A 1 75  ? 8.513   6.231   -3.979  1.00 0.00 ? 75  ILE A H    2  
ATOM 2906  H HA   . ILE A 1 75  ? 5.666   6.354   -3.475  1.00 0.00 ? 75  ILE A HA   2  
ATOM 2907  H HB   . ILE A 1 75  ? 6.709   5.615   -6.210  1.00 0.00 ? 75  ILE A HB   2  
ATOM 2908  H HG12 . ILE A 1 75  ? 4.991   7.873   -5.184  1.00 0.00 ? 75  ILE A HG12 2  
ATOM 2909  H HG13 . ILE A 1 75  ? 6.516   7.984   -6.056  1.00 0.00 ? 75  ILE A HG13 2  
ATOM 2910  H HG21 . ILE A 1 75  ? 4.421   5.077   -6.790  1.00 0.00 ? 75  ILE A HG21 2  
ATOM 2911  H HG22 . ILE A 1 75  ? 4.946   4.088   -5.428  1.00 0.00 ? 75  ILE A HG22 2  
ATOM 2912  H HG23 . ILE A 1 75  ? 3.888   5.472   -5.156  1.00 0.00 ? 75  ILE A HG23 2  
ATOM 2913  H HD11 . ILE A 1 75  ? 4.734   8.585   -7.526  1.00 0.00 ? 75  ILE A HD11 2  
ATOM 2914  H HD12 . ILE A 1 75  ? 5.380   7.027   -8.040  1.00 0.00 ? 75  ILE A HD12 2  
ATOM 2915  H HD13 . ILE A 1 75  ? 3.859   7.101   -7.151  1.00 0.00 ? 75  ILE A HD13 2  
ATOM 2916  N N    . SER A 1 76  ? 6.082   4.086   -2.567  1.00 0.00 ? 76  SER A N    2  
ATOM 2917  C CA   . SER A 1 76  ? 6.206   2.719   -2.075  1.00 0.00 ? 76  SER A CA   2  
ATOM 2918  C C    . SER A 1 76  ? 5.147   1.817   -2.702  1.00 0.00 ? 76  SER A C    2  
ATOM 2919  O O    . SER A 1 76  ? 3.967   1.893   -2.359  1.00 0.00 ? 76  SER A O    2  
ATOM 2920  C CB   . SER A 1 76  ? 6.080   2.690   -0.551  1.00 0.00 ? 76  SER A CB   2  
ATOM 2921  O OG   . SER A 1 76  ? 6.724   1.550   -0.007  1.00 0.00 ? 76  SER A OG   2  
ATOM 2922  H H    . SER A 1 76  ? 5.585   4.742   -2.035  1.00 0.00 ? 76  SER A H    2  
ATOM 2923  H HA   . SER A 1 76  ? 7.184   2.354   -2.354  1.00 0.00 ? 76  SER A HA   2  
ATOM 2924  H HB2  . SER A 1 76  ? 6.534   3.577   -0.137  1.00 0.00 ? 76  SER A HB2  2  
ATOM 2925  H HB3  . SER A 1 76  ? 5.034   2.661   -0.280  1.00 0.00 ? 76  SER A HB3  2  
ATOM 2926  H HG   . SER A 1 76  ? 7.420   1.262   -0.602  1.00 0.00 ? 76  SER A HG   2  
ATOM 2927  N N    . THR A 1 77  ? 5.578   0.962   -3.624  1.00 0.00 ? 77  THR A N    2  
ATOM 2928  C CA   . THR A 1 77  ? 4.669   0.046   -4.301  1.00 0.00 ? 77  THR A CA   2  
ATOM 2929  C C    . THR A 1 77  ? 4.671   -1.325  -3.634  1.00 0.00 ? 77  THR A C    2  
ATOM 2930  O O    . THR A 1 77  ? 5.730   -1.897  -3.371  1.00 0.00 ? 77  THR A O    2  
ATOM 2931  C CB   . THR A 1 77  ? 5.040   -0.119  -5.787  1.00 0.00 ? 77  THR A CB   2  
ATOM 2932  O OG1  . THR A 1 77  ? 5.456   1.139   -6.331  1.00 0.00 ? 77  THR A OG1  2  
ATOM 2933  C CG2  . THR A 1 77  ? 3.861   -0.656  -6.583  1.00 0.00 ? 77  THR A CG2  2  
ATOM 2934  H H    . THR A 1 77  ? 6.530   0.948   -3.855  1.00 0.00 ? 77  THR A H    2  
ATOM 2935  H HA   . THR A 1 77  ? 3.673   0.462   -4.245  1.00 0.00 ? 77  THR A HA   2  
ATOM 2936  H HB   . THR A 1 77  ? 5.857   -0.823  -5.862  1.00 0.00 ? 77  THR A HB   2  
ATOM 2937  H HG1  . THR A 1 77  ? 4.683   1.648   -6.587  1.00 0.00 ? 77  THR A HG1  2  
ATOM 2938  H HG21 . THR A 1 77  ? 4.222   -1.302  -7.370  1.00 0.00 ? 77  THR A HG21 2  
ATOM 2939  H HG22 . THR A 1 77  ? 3.313   0.168   -7.016  1.00 0.00 ? 77  THR A HG22 2  
ATOM 2940  H HG23 . THR A 1 77  ? 3.210   -1.217  -5.929  1.00 0.00 ? 77  THR A HG23 2  
ATOM 2941  N N    . LEU A 1 78  ? 3.480   -1.847  -3.362  1.00 0.00 ? 78  LEU A N    2  
ATOM 2942  C CA   . LEU A 1 78  ? 3.345   -3.153  -2.726  1.00 0.00 ? 78  LEU A CA   2  
ATOM 2943  C C    . LEU A 1 78  ? 2.487   -4.086  -3.574  1.00 0.00 ? 78  LEU A C    2  
ATOM 2944  O O    . LEU A 1 78  ? 1.262   -3.963  -3.607  1.00 0.00 ? 78  LEU A O    2  
ATOM 2945  C CB   . LEU A 1 78  ? 2.730   -3.001  -1.333  1.00 0.00 ? 78  LEU A CB   2  
ATOM 2946  C CG   . LEU A 1 78  ? 2.189   -4.282  -0.696  1.00 0.00 ? 78  LEU A CG   2  
ATOM 2947  C CD1  . LEU A 1 78  ? 3.314   -5.071  -0.045  1.00 0.00 ? 78  LEU A CD1  2  
ATOM 2948  C CD2  . LEU A 1 78  ? 1.106   -3.954  0.323   1.00 0.00 ? 78  LEU A CD2  2  
ATOM 2949  H H    . LEU A 1 78  ? 2.672   -1.344  -3.595  1.00 0.00 ? 78  LEU A H    2  
ATOM 2950  H HA   . LEU A 1 78  ? 4.332   -3.579  -2.630  1.00 0.00 ? 78  LEU A HA   2  
ATOM 2951  H HB2  . LEU A 1 78  ? 3.489   -2.602  -0.678  1.00 0.00 ? 78  LEU A HB2  2  
ATOM 2952  H HB3  . LEU A 1 78  ? 1.914   -2.297  -1.408  1.00 0.00 ? 78  LEU A HB3  2  
ATOM 2953  H HG   . LEU A 1 78  ? 1.749   -4.901  -1.465  1.00 0.00 ? 78  LEU A HG   2  
ATOM 2954  H HD11 . LEU A 1 78  ? 3.549   -4.637  0.915   1.00 0.00 ? 78  LEU A HD11 2  
ATOM 2955  H HD12 . LEU A 1 78  ? 4.188   -5.040  -0.678  1.00 0.00 ? 78  LEU A HD12 2  
ATOM 2956  H HD13 . LEU A 1 78  ? 3.003   -6.097  0.089   1.00 0.00 ? 78  LEU A HD13 2  
ATOM 2957  H HD21 . LEU A 1 78  ? 1.129   -4.683  1.119   1.00 0.00 ? 78  LEU A HD21 2  
ATOM 2958  H HD22 . LEU A 1 78  ? 0.140   -3.978  -0.159  1.00 0.00 ? 78  LEU A HD22 2  
ATOM 2959  H HD23 . LEU A 1 78  ? 1.282   -2.970  0.730   1.00 0.00 ? 78  LEU A HD23 2  
ATOM 2960  N N    . THR A 1 79  ? 3.139   -5.022  -4.258  1.00 0.00 ? 79  THR A N    2  
ATOM 2961  C CA   . THR A 1 79  ? 2.436   -5.977  -5.105  1.00 0.00 ? 79  THR A CA   2  
ATOM 2962  C C    . THR A 1 79  ? 2.073   -7.238  -4.329  1.00 0.00 ? 79  THR A C    2  
ATOM 2963  O O    . THR A 1 79  ? 2.853   -7.717  -3.505  1.00 0.00 ? 79  THR A O    2  
ATOM 2964  C CB   . THR A 1 79  ? 3.283   -6.369  -6.331  1.00 0.00 ? 79  THR A CB   2  
ATOM 2965  O OG1  . THR A 1 79  ? 3.709   -5.193  -7.028  1.00 0.00 ? 79  THR A OG1  2  
ATOM 2966  C CG2  . THR A 1 79  ? 2.490   -7.263  -7.273  1.00 0.00 ? 79  THR A CG2  2  
ATOM 2967  H H    . THR A 1 79  ? 4.115   -5.069  -4.190  1.00 0.00 ? 79  THR A H    2  
ATOM 2968  H HA   . THR A 1 79  ? 1.529   -5.508  -5.456  1.00 0.00 ? 79  THR A HA   2  
ATOM 2969  H HB   . THR A 1 79  ? 4.153   -6.912  -5.990  1.00 0.00 ? 79  THR A HB   2  
ATOM 2970  H HG1  . THR A 1 79  ? 3.967   -4.520  -6.393  1.00 0.00 ? 79  THR A HG1  2  
ATOM 2971  H HG21 . THR A 1 79  ? 2.162   -8.144  -6.741  1.00 0.00 ? 79  THR A HG21 2  
ATOM 2972  H HG22 . THR A 1 79  ? 3.116   -7.556  -8.103  1.00 0.00 ? 79  THR A HG22 2  
ATOM 2973  H HG23 . THR A 1 79  ? 1.631   -6.724  -7.642  1.00 0.00 ? 79  THR A HG23 2  
ATOM 2974  N N    . ILE A 1 80  ? 0.886   -7.771  -4.598  1.00 0.00 ? 80  ILE A N    2  
ATOM 2975  C CA   . ILE A 1 80  ? 0.422   -8.978  -3.925  1.00 0.00 ? 80  ILE A CA   2  
ATOM 2976  C C    . ILE A 1 80  ? 0.147   -10.095 -4.926  1.00 0.00 ? 80  ILE A C    2  
ATOM 2977  O O    . ILE A 1 80  ? -0.904  -10.125 -5.565  1.00 0.00 ? 80  ILE A O    2  
ATOM 2978  C CB   . ILE A 1 80  ? -0.856  -8.711  -3.108  1.00 0.00 ? 80  ILE A CB   2  
ATOM 2979  C CG1  . ILE A 1 80  ? -0.653  -7.511  -2.180  1.00 0.00 ? 80  ILE A CG1  2  
ATOM 2980  C CG2  . ILE A 1 80  ? -1.242  -9.946  -2.309  1.00 0.00 ? 80  ILE A CG2  2  
ATOM 2981  C CD1  . ILE A 1 80  ? -1.928  -6.750  -1.888  1.00 0.00 ? 80  ILE A CD1  2  
ATOM 2982  H H    . ILE A 1 80  ? 0.310   -7.344  -5.264  1.00 0.00 ? 80  ILE A H    2  
ATOM 2983  H HA   . ILE A 1 80  ? 1.198   -9.300  -3.246  1.00 0.00 ? 80  ILE A HA   2  
ATOM 2984  H HB   . ILE A 1 80  ? -1.658  -8.492  -3.797  1.00 0.00 ? 80  ILE A HB   2  
ATOM 2985  H HG12 . ILE A 1 80  ? -0.251  -7.855  -1.241  1.00 0.00 ? 80  ILE A HG12 2  
ATOM 2986  H HG13 . ILE A 1 80  ? 0.046   -6.826  -2.638  1.00 0.00 ? 80  ILE A HG13 2  
ATOM 2987  H HG21 . ILE A 1 80  ? -2.294  -10.151 -2.449  1.00 0.00 ? 80  ILE A HG21 2  
ATOM 2988  H HG22 . ILE A 1 80  ? -0.664  -10.791 -2.651  1.00 0.00 ? 80  ILE A HG22 2  
ATOM 2989  H HG23 . ILE A 1 80  ? -1.045  -9.774  -1.262  1.00 0.00 ? 80  ILE A HG23 2  
ATOM 2990  H HD11 . ILE A 1 80  ? -2.763  -7.256  -2.349  1.00 0.00 ? 80  ILE A HD11 2  
ATOM 2991  H HD12 . ILE A 1 80  ? -2.081  -6.699  -0.821  1.00 0.00 ? 80  ILE A HD12 2  
ATOM 2992  H HD13 . ILE A 1 80  ? -1.849  -5.750  -2.289  1.00 0.00 ? 80  ILE A HD13 2  
ATOM 2993  N N    . SER A 1 81  ? 1.100   -11.012 -5.057  1.00 0.00 ? 81  SER A N    2  
ATOM 2994  C CA   . SER A 1 81  ? 0.963   -12.131 -5.982  1.00 0.00 ? 81  SER A CA   2  
ATOM 2995  C C    . SER A 1 81  ? -0.260  -12.975 -5.635  1.00 0.00 ? 81  SER A C    2  
ATOM 2996  O O    . SER A 1 81  ? -0.499  -13.291 -4.471  1.00 0.00 ? 81  SER A O    2  
ATOM 2997  C CB   . SER A 1 81  ? 2.221   -13.000 -5.955  1.00 0.00 ? 81  SER A CB   2  
ATOM 2998  O OG   . SER A 1 81  ? 2.228   -13.921 -7.033  1.00 0.00 ? 81  SER A OG   2  
ATOM 2999  H H    . SER A 1 81  ? 1.917   -10.933 -4.520  1.00 0.00 ? 81  SER A H    2  
ATOM 3000  H HA   . SER A 1 81  ? 0.836   -11.726 -6.975  1.00 0.00 ? 81  SER A HA   2  
ATOM 3001  H HB2  . SER A 1 81  ? 3.093   -12.369 -6.032  1.00 0.00 ? 81  SER A HB2  2  
ATOM 3002  H HB3  . SER A 1 81  ? 2.256   -13.550 -5.026  1.00 0.00 ? 81  SER A HB3  2  
ATOM 3003  H HG   . SER A 1 81  ? 1.410   -13.840 -7.528  1.00 0.00 ? 81  SER A HG   2  
ATOM 3004  N N    . ASN A 1 82  ? -1.030  -13.337 -6.656  1.00 0.00 ? 82  ASN A N    2  
ATOM 3005  C CA   . ASN A 1 82  ? -2.228  -14.145 -6.461  1.00 0.00 ? 82  ASN A CA   2  
ATOM 3006  C C    . ASN A 1 82  ? -3.062  -13.609 -5.301  1.00 0.00 ? 82  ASN A C    2  
ATOM 3007  O O    . ASN A 1 82  ? -3.411  -14.349 -4.380  1.00 0.00 ? 82  ASN A O    2  
ATOM 3008  C CB   . ASN A 1 82  ? -1.849  -15.604 -6.199  1.00 0.00 ? 82  ASN A CB   2  
ATOM 3009  C CG   . ASN A 1 82  ? -1.062  -16.211 -7.345  1.00 0.00 ? 82  ASN A CG   2  
ATOM 3010  O OD1  . ASN A 1 82  ? -1.230  -15.824 -8.502  1.00 0.00 ? 82  ASN A OD1  2  
ATOM 3011  N ND2  . ASN A 1 82  ? -0.198  -17.168 -7.028  1.00 0.00 ? 82  ASN A ND2  2  
ATOM 3012  H H    . ASN A 1 82  ? -0.787  -13.055 -7.563  1.00 0.00 ? 82  ASN A H    2  
ATOM 3013  H HA   . ASN A 1 82  ? -2.815  -14.091 -7.365  1.00 0.00 ? 82  ASN A HA   2  
ATOM 3014  H HB2  . ASN A 1 82  ? -1.244  -15.657 -5.305  1.00 0.00 ? 82  ASN A HB2  2  
ATOM 3015  H HB3  . ASN A 1 82  ? -2.748  -16.184 -6.056  1.00 0.00 ? 82  ASN A HB3  2  
ATOM 3016  H HD21 . ASN A 1 82  ? -0.117  -17.425 -6.086  1.00 0.00 ? 82  ASN A HD21 2  
ATOM 3017  H HD22 . ASN A 1 82  ? 0.324   -17.577 -7.749  1.00 0.00 ? 82  ASN A HD22 2  
ATOM 3018  N N    . ILE A 1 83  ? -3.379  -12.320 -5.353  1.00 0.00 ? 83  ILE A N    2  
ATOM 3019  C CA   . ILE A 1 83  ? -4.172  -11.685 -4.308  1.00 0.00 ? 83  ILE A CA   2  
ATOM 3020  C C    . ILE A 1 83  ? -5.398  -12.525 -3.963  1.00 0.00 ? 83  ILE A C    2  
ATOM 3021  O O    . ILE A 1 83  ? -5.945  -13.224 -4.816  1.00 0.00 ? 83  ILE A O    2  
ATOM 3022  C CB   . ILE A 1 83  ? -4.631  -10.276 -4.726  1.00 0.00 ? 83  ILE A CB   2  
ATOM 3023  C CG1  . ILE A 1 83  ? -5.028  -9.459  -3.495  1.00 0.00 ? 83  ILE A CG1  2  
ATOM 3024  C CG2  . ILE A 1 83  ? -5.791  -10.366 -5.706  1.00 0.00 ? 83  ILE A CG2  2  
ATOM 3025  C CD1  . ILE A 1 83  ? -5.340  -8.012  -3.806  1.00 0.00 ? 83  ILE A CD1  2  
ATOM 3026  H H    . ILE A 1 83  ? -3.071  -11.782 -6.112  1.00 0.00 ? 83  ILE A H    2  
ATOM 3027  H HA   . ILE A 1 83  ? -3.552  -11.594 -3.428  1.00 0.00 ? 83  ILE A HA   2  
ATOM 3028  H HB   . ILE A 1 83  ? -3.808  -9.787  -5.224  1.00 0.00 ? 83  ILE A HB   2  
ATOM 3029  H HG12 . ILE A 1 83  ? -5.905  -9.898  -3.047  1.00 0.00 ? 83  ILE A HG12 2  
ATOM 3030  H HG13 . ILE A 1 83  ? -4.216  -9.478  -2.782  1.00 0.00 ? 83  ILE A HG13 2  
ATOM 3031  H HG21 . ILE A 1 83  ? -5.623  -9.685  -6.527  1.00 0.00 ? 83  ILE A HG21 2  
ATOM 3032  H HG22 . ILE A 1 83  ? -5.865  -11.374 -6.085  1.00 0.00 ? 83  ILE A HG22 2  
ATOM 3033  H HG23 . ILE A 1 83  ? -6.709  -10.102 -5.202  1.00 0.00 ? 83  ILE A HG23 2  
ATOM 3034  H HD11 . ILE A 1 83  ? -4.418  -7.464  -3.936  1.00 0.00 ? 83  ILE A HD11 2  
ATOM 3035  H HD12 . ILE A 1 83  ? -5.925  -7.955  -4.711  1.00 0.00 ? 83  ILE A HD12 2  
ATOM 3036  H HD13 . ILE A 1 83  ? -5.900  -7.581  -2.988  1.00 0.00 ? 83  ILE A HD13 2  
ATOM 3037  N N    . VAL A 1 84  ? -5.826  -12.449 -2.706  1.00 0.00 ? 84  VAL A N    2  
ATOM 3038  C CA   . VAL A 1 84  ? -6.989  -13.200 -2.248  1.00 0.00 ? 84  VAL A CA   2  
ATOM 3039  C C    . VAL A 1 84  ? -8.053  -12.269 -1.677  1.00 0.00 ? 84  VAL A C    2  
ATOM 3040  O O    . VAL A 1 84  ? -7.762  -11.134 -1.302  1.00 0.00 ? 84  VAL A O    2  
ATOM 3041  C CB   . VAL A 1 84  ? -6.601  -14.237 -1.178  1.00 0.00 ? 84  VAL A CB   2  
ATOM 3042  C CG1  . VAL A 1 84  ? -5.703  -15.310 -1.774  1.00 0.00 ? 84  VAL A CG1  2  
ATOM 3043  C CG2  . VAL A 1 84  ? -5.923  -13.557 0.002   1.00 0.00 ? 84  VAL A CG2  2  
ATOM 3044  H H    . VAL A 1 84  ? -5.348  -11.875 -2.073  1.00 0.00 ? 84  VAL A H    2  
ATOM 3045  H HA   . VAL A 1 84  ? -7.402  -13.726 -3.097  1.00 0.00 ? 84  VAL A HA   2  
ATOM 3046  H HB   . VAL A 1 84  ? -7.504  -14.712 -0.822  1.00 0.00 ? 84  VAL A HB   2  
ATOM 3047  H HG11 . VAL A 1 84  ? -5.765  -16.205 -1.173  1.00 0.00 ? 84  VAL A HG11 2  
ATOM 3048  H HG12 . VAL A 1 84  ? -6.023  -15.529 -2.782  1.00 0.00 ? 84  VAL A HG12 2  
ATOM 3049  H HG13 . VAL A 1 84  ? -4.682  -14.957 -1.788  1.00 0.00 ? 84  VAL A HG13 2  
ATOM 3050  H HG21 . VAL A 1 84  ? -4.955  -13.189 -0.304  1.00 0.00 ? 84  VAL A HG21 2  
ATOM 3051  H HG22 . VAL A 1 84  ? -6.531  -12.730 0.340   1.00 0.00 ? 84  VAL A HG22 2  
ATOM 3052  H HG23 . VAL A 1 84  ? -5.802  -14.267 0.806   1.00 0.00 ? 84  VAL A HG23 2  
ATOM 3053  N N    . ARG A 1 85  ? -9.287  -12.759 -1.614  1.00 0.00 ? 85  ARG A N    2  
ATOM 3054  C CA   . ARG A 1 85  ? -10.396 -11.971 -1.090  1.00 0.00 ? 85  ARG A CA   2  
ATOM 3055  C C    . ARG A 1 85  ? -10.038 -11.362 0.263   1.00 0.00 ? 85  ARG A C    2  
ATOM 3056  O O    . ARG A 1 85  ? -10.536 -10.298 0.627   1.00 0.00 ? 85  ARG A O    2  
ATOM 3057  C CB   . ARG A 1 85  ? -11.648 -12.840 -0.955  1.00 0.00 ? 85  ARG A CB   2  
ATOM 3058  C CG   . ARG A 1 85  ? -12.514 -12.858 -2.204  1.00 0.00 ? 85  ARG A CG   2  
ATOM 3059  C CD   . ARG A 1 85  ? -13.678 -13.825 -2.060  1.00 0.00 ? 85  ARG A CD   2  
ATOM 3060  N NE   . ARG A 1 85  ? -14.711 -13.592 -3.067  1.00 0.00 ? 85  ARG A NE   2  
ATOM 3061  C CZ   . ARG A 1 85  ? -15.977 -13.966 -2.921  1.00 0.00 ? 85  ARG A CZ   2  
ATOM 3062  N NH1  . ARG A 1 85  ? -16.365 -14.587 -1.816  1.00 0.00 ? 85  ARG A NH1  2  
ATOM 3063  N NH2  . ARG A 1 85  ? -16.858 -13.719 -3.882  1.00 0.00 ? 85  ARG A NH2  2  
ATOM 3064  H H    . ARG A 1 85  ? -9.456  -13.671 -1.929  1.00 0.00 ? 85  ARG A H    2  
ATOM 3065  H HA   . ARG A 1 85  ? -10.596 -11.173 -1.788  1.00 0.00 ? 85  ARG A HA   2  
ATOM 3066  H HB2  . ARG A 1 85  ? -11.346 -13.854 -0.738  1.00 0.00 ? 85  ARG A HB2  2  
ATOM 3067  H HB3  . ARG A 1 85  ? -12.243 -12.466 -0.135  1.00 0.00 ? 85  ARG A HB3  2  
ATOM 3068  H HG2  . ARG A 1 85  ? -12.904 -11.865 -2.374  1.00 0.00 ? 85  ARG A HG2  2  
ATOM 3069  H HG3  . ARG A 1 85  ? -11.908 -13.158 -3.046  1.00 0.00 ? 85  ARG A HG3  2  
ATOM 3070  H HD2  . ARG A 1 85  ? -13.307 -14.833 -2.166  1.00 0.00 ? 85  ARG A HD2  2  
ATOM 3071  H HD3  . ARG A 1 85  ? -14.111 -13.702 -1.078  1.00 0.00 ? 85  ARG A HD3  2  
ATOM 3072  H HE   . ARG A 1 85  ? -14.445 -13.135 -3.891  1.00 0.00 ? 85  ARG A HE   2  
ATOM 3073  H HH11 . ARG A 1 85  ? -15.704 -14.774 -1.090  1.00 0.00 ? 85  ARG A HH11 2  
ATOM 3074  H HH12 . ARG A 1 85  ? -17.319 -14.867 -1.708  1.00 0.00 ? 85  ARG A HH12 2  
ATOM 3075  H HH21 . ARG A 1 85  ? -16.569 -13.251 -4.716  1.00 0.00 ? 85  ARG A HH21 2  
ATOM 3076  H HH22 . ARG A 1 85  ? -17.810 -14.001 -3.772  1.00 0.00 ? 85  ARG A HH22 2  
ATOM 3077  N N    . ALA A 1 86  ? -9.171  -12.046 1.003   1.00 0.00 ? 86  ALA A N    2  
ATOM 3078  C CA   . ALA A 1 86  ? -8.745  -11.573 2.314   1.00 0.00 ? 86  ALA A CA   2  
ATOM 3079  C C    . ALA A 1 86  ? -7.982  -10.257 2.202   1.00 0.00 ? 86  ALA A C    2  
ATOM 3080  O O    . ALA A 1 86  ? -8.117  -9.376  3.050   1.00 0.00 ? 86  ALA A O    2  
ATOM 3081  C CB   . ALA A 1 86  ? -7.889  -12.625 3.003   1.00 0.00 ? 86  ALA A CB   2  
ATOM 3082  H H    . ALA A 1 86  ? -8.808  -12.889 0.658   1.00 0.00 ? 86  ALA A H    2  
ATOM 3083  H HA   . ALA A 1 86  ? -9.629  -11.414 2.915   1.00 0.00 ? 86  ALA A HA   2  
ATOM 3084  H HB1  . ALA A 1 86  ? -6.997  -12.800 2.419   1.00 0.00 ? 86  ALA A HB1  2  
ATOM 3085  H HB2  . ALA A 1 86  ? -7.613  -12.276 3.987   1.00 0.00 ? 86  ALA A HB2  2  
ATOM 3086  H HB3  . ALA A 1 86  ? -8.449  -13.544 3.090   1.00 0.00 ? 86  ALA A HB3  2  
ATOM 3087  N N    . ASP A 1 87  ? -7.179  -10.133 1.150   1.00 0.00 ? 87  ASP A N    2  
ATOM 3088  C CA   . ASP A 1 87  ? -6.394  -8.925  0.927   1.00 0.00 ? 87  ASP A CA   2  
ATOM 3089  C C    . ASP A 1 87  ? -7.292  -7.692  0.886   1.00 0.00 ? 87  ASP A C    2  
ATOM 3090  O O    . ASP A 1 87  ? -6.839  -6.573  1.125   1.00 0.00 ? 87  ASP A O    2  
ATOM 3091  C CB   . ASP A 1 87  ? -5.604  -9.038  -0.378  1.00 0.00 ? 87  ASP A CB   2  
ATOM 3092  C CG   . ASP A 1 87  ? -4.232  -9.650  -0.173  1.00 0.00 ? 87  ASP A CG   2  
ATOM 3093  O OD1  . ASP A 1 87  ? -4.150  -10.724 0.458   1.00 0.00 ? 87  ASP A OD1  2  
ATOM 3094  O OD2  . ASP A 1 87  ? -3.240  -9.054  -0.643  1.00 0.00 ? 87  ASP A OD2  2  
ATOM 3095  H H    . ASP A 1 87  ? -7.114  -10.871 0.508   1.00 0.00 ? 87  ASP A H    2  
ATOM 3096  H HA   . ASP A 1 87  ? -5.701  -8.822  1.748   1.00 0.00 ? 87  ASP A HA   2  
ATOM 3097  H HB2  . ASP A 1 87  ? -6.154  -9.658  -1.072  1.00 0.00 ? 87  ASP A HB2  2  
ATOM 3098  H HB3  . ASP A 1 87  ? -5.480  -8.053  -0.803  1.00 0.00 ? 87  ASP A HB3  2  
ATOM 3099  N N    . PHE A 1 88  ? -8.568  -7.906  0.582   1.00 0.00 ? 88  PHE A N    2  
ATOM 3100  C CA   . PHE A 1 88  ? -9.530  -6.813  0.508   1.00 0.00 ? 88  PHE A CA   2  
ATOM 3101  C C    . PHE A 1 88  ? -10.081 -6.478  1.891   1.00 0.00 ? 88  PHE A C    2  
ATOM 3102  O O    . PHE A 1 88  ? -10.244 -5.309  2.239   1.00 0.00 ? 88  PHE A O    2  
ATOM 3103  C CB   . PHE A 1 88  ? -10.678 -7.178  -0.435  1.00 0.00 ? 88  PHE A CB   2  
ATOM 3104  C CG   . PHE A 1 88  ? -10.218 -7.724  -1.757  1.00 0.00 ? 88  PHE A CG   2  
ATOM 3105  C CD1  . PHE A 1 88  ? -9.201  -7.102  -2.462  1.00 0.00 ? 88  PHE A CD1  2  
ATOM 3106  C CD2  . PHE A 1 88  ? -10.802 -8.860  -2.293  1.00 0.00 ? 88  PHE A CD2  2  
ATOM 3107  C CE1  . PHE A 1 88  ? -8.774  -7.602  -3.678  1.00 0.00 ? 88  PHE A CE1  2  
ATOM 3108  C CE2  . PHE A 1 88  ? -10.379 -9.365  -3.509  1.00 0.00 ? 88  PHE A CE2  2  
ATOM 3109  C CZ   . PHE A 1 88  ? -9.365  -8.735  -4.202  1.00 0.00 ? 88  PHE A CZ   2  
ATOM 3110  H H    . PHE A 1 88  ? -8.870  -8.822  0.402   1.00 0.00 ? 88  PHE A H    2  
ATOM 3111  H HA   . PHE A 1 88  ? -9.017  -5.947  0.119   1.00 0.00 ? 88  PHE A HA   2  
ATOM 3112  H HB2  . PHE A 1 88  ? -11.297 -7.928  0.035   1.00 0.00 ? 88  PHE A HB2  2  
ATOM 3113  H HB3  . PHE A 1 88  ? -11.271 -6.297  -0.628  1.00 0.00 ? 88  PHE A HB3  2  
ATOM 3114  H HD1  . PHE A 1 88  ? -8.738  -6.215  -2.053  1.00 0.00 ? 88  PHE A HD1  2  
ATOM 3115  H HD2  . PHE A 1 88  ? -11.596 -9.354  -1.753  1.00 0.00 ? 88  PHE A HD2  2  
ATOM 3116  H HE1  . PHE A 1 88  ? -7.981  -7.106  -4.218  1.00 0.00 ? 88  PHE A HE1  2  
ATOM 3117  H HE2  . PHE A 1 88  ? -10.843 -10.251 -3.916  1.00 0.00 ? 88  PHE A HE2  2  
ATOM 3118  H HZ   . PHE A 1 88  ? -9.033  -9.127  -5.152  1.00 0.00 ? 88  PHE A HZ   2  
ATOM 3119  N N    . GLN A 1 89  ? -10.365 -7.514  2.675   1.00 0.00 ? 89  GLN A N    2  
ATOM 3120  C CA   . GLN A 1 89  ? -10.899 -7.330  4.019   1.00 0.00 ? 89  GLN A CA   2  
ATOM 3121  C C    . GLN A 1 89  ? -9.817  -6.828  4.970   1.00 0.00 ? 89  GLN A C    2  
ATOM 3122  O O    . GLN A 1 89  ? -10.109 -6.164  5.965   1.00 0.00 ? 89  GLN A O    2  
ATOM 3123  C CB   . GLN A 1 89  ? -11.484 -8.643  4.542   1.00 0.00 ? 89  GLN A CB   2  
ATOM 3124  C CG   . GLN A 1 89  ? -12.583 -9.213  3.659   1.00 0.00 ? 89  GLN A CG   2  
ATOM 3125  C CD   . GLN A 1 89  ? -13.120 -10.533 4.176   1.00 0.00 ? 89  GLN A CD   2  
ATOM 3126  O OE1  . GLN A 1 89  ? -12.376 -11.501 4.335   1.00 0.00 ? 89  GLN A OE1  2  
ATOM 3127  N NE2  . GLN A 1 89  ? -14.421 -10.579 4.442   1.00 0.00 ? 89  GLN A NE2  2  
ATOM 3128  H H    . GLN A 1 89  ? -10.213 -8.422  2.341   1.00 0.00 ? 89  GLN A H    2  
ATOM 3129  H HA   . GLN A 1 89  ? -11.684 -6.592  3.966   1.00 0.00 ? 89  GLN A HA   2  
ATOM 3130  H HB2  . GLN A 1 89  ? -10.693 -9.373  4.613   1.00 0.00 ? 89  GLN A HB2  2  
ATOM 3131  H HB3  . GLN A 1 89  ? -11.896 -8.473  5.526   1.00 0.00 ? 89  GLN A HB3  2  
ATOM 3132  H HG2  . GLN A 1 89  ? -13.396 -8.504  3.614   1.00 0.00 ? 89  GLN A HG2  2  
ATOM 3133  H HG3  . GLN A 1 89  ? -12.185 -9.367  2.667   1.00 0.00 ? 89  GLN A HG3  2  
ATOM 3134  H HE21 . GLN A 1 89  ? -14.953 -9.770  4.291   1.00 0.00 ? 89  GLN A HE21 2  
ATOM 3135  H HE22 . GLN A 1 89  ? -14.795 -11.420 4.777   1.00 0.00 ? 89  GLN A HE22 2  
ATOM 3136  N N    . THR A 1 90  ? -8.565  -7.149  4.657   1.00 0.00 ? 90  THR A N    2  
ATOM 3137  C CA   . THR A 1 90  ? -7.440  -6.731  5.484   1.00 0.00 ? 90  THR A CA   2  
ATOM 3138  C C    . THR A 1 90  ? -7.060  -5.282  5.205   1.00 0.00 ? 90  THR A C    2  
ATOM 3139  O O    . THR A 1 90  ? -6.891  -4.886  4.051   1.00 0.00 ? 90  THR A O    2  
ATOM 3140  C CB   . THR A 1 90  ? -6.209  -7.627  5.250   1.00 0.00 ? 90  THR A CB   2  
ATOM 3141  O OG1  . THR A 1 90  ? -6.512  -8.980  5.611   1.00 0.00 ? 90  THR A OG1  2  
ATOM 3142  C CG2  . THR A 1 90  ? -5.020  -7.135  6.062   1.00 0.00 ? 90  THR A CG2  2  
ATOM 3143  H H    . THR A 1 90  ? -8.397  -7.679  3.851   1.00 0.00 ? 90  THR A H    2  
ATOM 3144  H HA   . THR A 1 90  ? -7.735  -6.823  6.519   1.00 0.00 ? 90  THR A HA   2  
ATOM 3145  H HB   . THR A 1 90  ? -5.950  -7.591  4.202   1.00 0.00 ? 90  THR A HB   2  
ATOM 3146  H HG1  . THR A 1 90  ? -6.403  -9.090  6.559   1.00 0.00 ? 90  THR A HG1  2  
ATOM 3147  H HG21 . THR A 1 90  ? -5.269  -6.195  6.531   1.00 0.00 ? 90  THR A HG21 2  
ATOM 3148  H HG22 . THR A 1 90  ? -4.171  -6.998  5.409   1.00 0.00 ? 90  THR A HG22 2  
ATOM 3149  H HG23 . THR A 1 90  ? -4.777  -7.863  6.821   1.00 0.00 ? 90  THR A HG23 2  
ATOM 3150  N N    . ILE A 1 91  ? -6.926  -4.495  6.267   1.00 0.00 ? 91  ILE A N    2  
ATOM 3151  C CA   . ILE A 1 91  ? -6.563  -3.089  6.135   1.00 0.00 ? 91  ILE A CA   2  
ATOM 3152  C C    . ILE A 1 91  ? -5.056  -2.923  5.973   1.00 0.00 ? 91  ILE A C    2  
ATOM 3153  O O    . ILE A 1 91  ? -4.272  -3.533  6.701   1.00 0.00 ? 91  ILE A O    2  
ATOM 3154  C CB   . ILE A 1 91  ? -7.031  -2.271  7.352   1.00 0.00 ? 91  ILE A CB   2  
ATOM 3155  C CG1  . ILE A 1 91  ? -8.547  -2.069  7.307   1.00 0.00 ? 91  ILE A CG1  2  
ATOM 3156  C CG2  . ILE A 1 91  ? -6.315  -0.929  7.396   1.00 0.00 ? 91  ILE A CG2  2  
ATOM 3157  C CD1  . ILE A 1 91  ? -9.329  -3.242  7.856   1.00 0.00 ? 91  ILE A CD1  2  
ATOM 3158  H H    . ILE A 1 91  ? -7.073  -4.869  7.160   1.00 0.00 ? 91  ILE A H    2  
ATOM 3159  H HA   . ILE A 1 91  ? -7.054  -2.700  5.254   1.00 0.00 ? 91  ILE A HA   2  
ATOM 3160  H HB   . ILE A 1 91  ? -6.775  -2.818  8.246   1.00 0.00 ? 91  ILE A HB   2  
ATOM 3161  H HG12 . ILE A 1 91  ? -8.806  -1.198  7.887   1.00 0.00 ? 91  ILE A HG12 2  
ATOM 3162  H HG13 . ILE A 1 91  ? -8.852  -1.917  6.281   1.00 0.00 ? 91  ILE A HG13 2  
ATOM 3163  H HG21 . ILE A 1 91  ? -6.966  -0.187  7.832   1.00 0.00 ? 91  ILE A HG21 2  
ATOM 3164  H HG22 . ILE A 1 91  ? -5.421  -1.019  7.995   1.00 0.00 ? 91  ILE A HG22 2  
ATOM 3165  H HG23 . ILE A 1 91  ? -6.048  -0.630  6.393   1.00 0.00 ? 91  ILE A HG23 2  
ATOM 3166  H HD11 . ILE A 1 91  ? -10.071 -3.550  7.134   1.00 0.00 ? 91  ILE A HD11 2  
ATOM 3167  H HD12 . ILE A 1 91  ? -8.657  -4.062  8.056   1.00 0.00 ? 91  ILE A HD12 2  
ATOM 3168  H HD13 . ILE A 1 91  ? -9.821  -2.948  8.772   1.00 0.00 ? 91  ILE A HD13 2  
ATOM 3169  N N    . TYR A 1 92  ? -4.658  -2.092  5.016   1.00 0.00 ? 92  TYR A N    2  
ATOM 3170  C CA   . TYR A 1 92  ? -3.244  -1.845  4.759   1.00 0.00 ? 92  TYR A CA   2  
ATOM 3171  C C    . TYR A 1 92  ? -2.805  -0.513  5.358   1.00 0.00 ? 92  TYR A C    2  
ATOM 3172  O O    . TYR A 1 92  ? -3.577  0.444   5.402   1.00 0.00 ? 92  TYR A O    2  
ATOM 3173  C CB   . TYR A 1 92  ? -2.969  -1.856  3.254   1.00 0.00 ? 92  TYR A CB   2  
ATOM 3174  C CG   . TYR A 1 92  ? -3.233  -3.193  2.599   1.00 0.00 ? 92  TYR A CG   2  
ATOM 3175  C CD1  . TYR A 1 92  ? -2.369  -4.265  2.792   1.00 0.00 ? 92  TYR A CD1  2  
ATOM 3176  C CD2  . TYR A 1 92  ? -4.344  -3.385  1.788   1.00 0.00 ? 92  TYR A CD2  2  
ATOM 3177  C CE1  . TYR A 1 92  ? -2.606  -5.488  2.195   1.00 0.00 ? 92  TYR A CE1  2  
ATOM 3178  C CE2  . TYR A 1 92  ? -4.589  -4.605  1.189   1.00 0.00 ? 92  TYR A CE2  2  
ATOM 3179  C CZ   . TYR A 1 92  ? -3.717  -5.654  1.395   1.00 0.00 ? 92  TYR A CZ   2  
ATOM 3180  O OH   . TYR A 1 92  ? -3.957  -6.870  0.799   1.00 0.00 ? 92  TYR A OH   2  
ATOM 3181  H H    . TYR A 1 92  ? -5.330  -1.635  4.469   1.00 0.00 ? 92  TYR A H    2  
ATOM 3182  H HA   . TYR A 1 92  ? -2.678  -2.640  5.223   1.00 0.00 ? 92  TYR A HA   2  
ATOM 3183  H HB2  . TYR A 1 92  ? -3.599  -1.123  2.775   1.00 0.00 ? 92  TYR A HB2  2  
ATOM 3184  H HB3  . TYR A 1 92  ? -1.933  -1.601  3.082   1.00 0.00 ? 92  TYR A HB3  2  
ATOM 3185  H HD1  . TYR A 1 92  ? -1.500  -4.133  3.419   1.00 0.00 ? 92  TYR A HD1  2  
ATOM 3186  H HD2  . TYR A 1 92  ? -5.025  -2.561  1.628   1.00 0.00 ? 92  TYR A HD2  2  
ATOM 3187  H HE1  . TYR A 1 92  ? -1.924  -6.310  2.357   1.00 0.00 ? 92  TYR A HE1  2  
ATOM 3188  H HE2  . TYR A 1 92  ? -5.459  -4.734  0.562   1.00 0.00 ? 92  TYR A HE2  2  
ATOM 3189  H HH   . TYR A 1 92  ? -4.072  -7.541  1.476   1.00 0.00 ? 92  TYR A HH   2  
ATOM 3190  N N    . ASN A 1 93  ? -1.560  -0.460  5.818   1.00 0.00 ? 93  ASN A N    2  
ATOM 3191  C CA   . ASN A 1 93  ? -1.016  0.755   6.415   1.00 0.00 ? 93  ASN A CA   2  
ATOM 3192  C C    . ASN A 1 93  ? 0.458   0.923   6.061   1.00 0.00 ? 93  ASN A C    2  
ATOM 3193  O O    . ASN A 1 93  ? 1.273   0.035   6.314   1.00 0.00 ? 93  ASN A O    2  
ATOM 3194  C CB   . ASN A 1 93  ? -1.187  0.721   7.935   1.00 0.00 ? 93  ASN A CB   2  
ATOM 3195  C CG   . ASN A 1 93  ? -2.539  1.245   8.377   1.00 0.00 ? 93  ASN A CG   2  
ATOM 3196  O OD1  . ASN A 1 93  ? -2.824  2.437   8.259   1.00 0.00 ? 93  ASN A OD1  2  
ATOM 3197  N ND2  . ASN A 1 93  ? -3.381  0.355   8.889   1.00 0.00 ? 93  ASN A ND2  2  
ATOM 3198  H H    . ASN A 1 93  ? -0.992  -1.256  5.755   1.00 0.00 ? 93  ASN A H    2  
ATOM 3199  H HA   . ASN A 1 93  ? -1.568  1.594   6.018   1.00 0.00 ? 93  ASN A HA   2  
ATOM 3200  H HB2  . ASN A 1 93  ? -1.087  -0.298  8.280   1.00 0.00 ? 93  ASN A HB2  2  
ATOM 3201  H HB3  . ASN A 1 93  ? -0.419  1.328   8.391   1.00 0.00 ? 93  ASN A HB3  2  
ATOM 3202  H HD21 . ASN A 1 93  ? -3.086  -0.578  8.953   1.00 0.00 ? 93  ASN A HD21 2  
ATOM 3203  H HD22 . ASN A 1 93  ? -4.262  0.666   9.183   1.00 0.00 ? 93  ASN A HD22 2  
ATOM 3204  N N    . CYS A 1 94  ? 0.793   2.067   5.475   1.00 0.00 ? 94  CYS A N    2  
ATOM 3205  C CA   . CYS A 1 94  ? 2.170   2.352   5.086   1.00 0.00 ? 94  CYS A CA   2  
ATOM 3206  C C    . CYS A 1 94  ? 2.805   3.364   6.034   1.00 0.00 ? 94  CYS A C    2  
ATOM 3207  O O    . CYS A 1 94  ? 2.336   4.497   6.155   1.00 0.00 ? 94  CYS A O    2  
ATOM 3208  C CB   . CYS A 1 94  ? 2.218   2.878   3.651   1.00 0.00 ? 94  CYS A CB   2  
ATOM 3209  S SG   . CYS A 1 94  ? 3.878   3.305   3.076   1.00 0.00 ? 94  CYS A SG   2  
ATOM 3210  H H    . CYS A 1 94  ? 0.099   2.736   5.299   1.00 0.00 ? 94  CYS A H    2  
ATOM 3211  H HA   . CYS A 1 94  ? 2.727   1.429   5.140   1.00 0.00 ? 94  CYS A HA   2  
ATOM 3212  H HB2  . CYS A 1 94  ? 1.824   2.124   2.985   1.00 0.00 ? 94  CYS A HB2  2  
ATOM 3213  H HB3  . CYS A 1 94  ? 1.606   3.765   3.581   1.00 0.00 ? 94  CYS A HB3  2  
ATOM 3214  H HG   . CYS A 1 94  ? 4.716   3.138   4.087   1.00 0.00 ? 94  CYS A HG   2  
ATOM 3215  N N    . THR A 1 95  ? 3.874   2.949   6.706   1.00 0.00 ? 95  THR A N    2  
ATOM 3216  C CA   . THR A 1 95  ? 4.571   3.818   7.645   1.00 0.00 ? 95  THR A CA   2  
ATOM 3217  C C    . THR A 1 95  ? 5.997   4.096   7.182   1.00 0.00 ? 95  THR A C    2  
ATOM 3218  O O    . THR A 1 95  ? 6.720   3.183   6.785   1.00 0.00 ? 95  THR A O    2  
ATOM 3219  C CB   . THR A 1 95  ? 4.613   3.203   9.056   1.00 0.00 ? 95  THR A CB   2  
ATOM 3220  O OG1  . THR A 1 95  ? 3.311   2.734   9.424   1.00 0.00 ? 95  THR A OG1  2  
ATOM 3221  C CG2  . THR A 1 95  ? 5.098   4.221   10.077  1.00 0.00 ? 95  THR A CG2  2  
ATOM 3222  H H    . THR A 1 95  ? 4.200   2.036   6.566   1.00 0.00 ? 95  THR A H    2  
ATOM 3223  H HA   . THR A 1 95  ? 4.032   4.753   7.698   1.00 0.00 ? 95  THR A HA   2  
ATOM 3224  H HB   . THR A 1 95  ? 5.299   2.368   9.048   1.00 0.00 ? 95  THR A HB   2  
ATOM 3225  H HG1  . THR A 1 95  ? 2.675   3.448   9.332   1.00 0.00 ? 95  THR A HG1  2  
ATOM 3226  H HG21 . THR A 1 95  ? 5.383   5.131   9.570   1.00 0.00 ? 95  THR A HG21 2  
ATOM 3227  H HG22 . THR A 1 95  ? 5.950   3.821   10.607  1.00 0.00 ? 95  THR A HG22 2  
ATOM 3228  H HG23 . THR A 1 95  ? 4.305   4.433   10.778  1.00 0.00 ? 95  THR A HG23 2  
ATOM 3229  N N    . ALA A 1 96  ? 6.396   5.363   7.237   1.00 0.00 ? 96  ALA A N    2  
ATOM 3230  C CA   . ALA A 1 96  ? 7.737   5.760   6.826   1.00 0.00 ? 96  ALA A CA   2  
ATOM 3231  C C    . ALA A 1 96  ? 8.476   6.456   7.964   1.00 0.00 ? 96  ALA A C    2  
ATOM 3232  O O    . ALA A 1 96  ? 7.863   6.898   8.935   1.00 0.00 ? 96  ALA A O    2  
ATOM 3233  C CB   . ALA A 1 96  ? 7.668   6.667   5.606   1.00 0.00 ? 96  ALA A CB   2  
ATOM 3234  H H    . ALA A 1 96  ? 5.774   6.046   7.563   1.00 0.00 ? 96  ALA A H    2  
ATOM 3235  H HA   . ALA A 1 96  ? 8.279   4.867   6.550   1.00 0.00 ? 96  ALA A HA   2  
ATOM 3236  H HB1  . ALA A 1 96  ? 6.689   6.588   5.155   1.00 0.00 ? 96  ALA A HB1  2  
ATOM 3237  H HB2  . ALA A 1 96  ? 7.846   7.688   5.906   1.00 0.00 ? 96  ALA A HB2  2  
ATOM 3238  H HB3  . ALA A 1 96  ? 8.418   6.365   4.891   1.00 0.00 ? 96  ALA A HB3  2  
ATOM 3239  N N    . TRP A 1 97  ? 9.794   6.550   7.836   1.00 0.00 ? 97  TRP A N    2  
ATOM 3240  C CA   . TRP A 1 97  ? 10.617  7.192   8.855   1.00 0.00 ? 97  TRP A CA   2  
ATOM 3241  C C    . TRP A 1 97  ? 11.708  8.044   8.216   1.00 0.00 ? 97  TRP A C    2  
ATOM 3242  O O    . TRP A 1 97  ? 12.478  7.562   7.386   1.00 0.00 ? 97  TRP A O    2  
ATOM 3243  C CB   . TRP A 1 97  ? 11.245  6.140   9.771   1.00 0.00 ? 97  TRP A CB   2  
ATOM 3244  C CG   . TRP A 1 97  ? 10.257  5.486   10.689  1.00 0.00 ? 97  TRP A CG   2  
ATOM 3245  C CD1  . TRP A 1 97  ? 9.860   5.932   11.917  1.00 0.00 ? 97  TRP A CD1  2  
ATOM 3246  C CD2  . TRP A 1 97  ? 9.543   4.268   10.451  1.00 0.00 ? 97  TRP A CD2  2  
ATOM 3247  N NE1  . TRP A 1 97  ? 8.942   5.064   12.458  1.00 0.00 ? 97  TRP A NE1  2  
ATOM 3248  C CE2  . TRP A 1 97  ? 8.730   4.035   11.578  1.00 0.00 ? 97  TRP A CE2  2  
ATOM 3249  C CE3  . TRP A 1 97  ? 9.509   3.352   9.396   1.00 0.00 ? 97  TRP A CE3  2  
ATOM 3250  C CZ2  . TRP A 1 97  ? 7.896   2.925   11.677  1.00 0.00 ? 97  TRP A CZ2  2  
ATOM 3251  C CZ3  . TRP A 1 97  ? 8.681   2.250   9.497   1.00 0.00 ? 97  TRP A CZ3  2  
ATOM 3252  C CH2  . TRP A 1 97  ? 7.883   2.044   10.630  1.00 0.00 ? 97  TRP A CH2  2  
ATOM 3253  H H    . TRP A 1 97  ? 10.226  6.178   7.038   1.00 0.00 ? 97  TRP A H    2  
ATOM 3254  H HA   . TRP A 1 97  ? 9.975   7.831   9.443   1.00 0.00 ? 97  TRP A HA   2  
ATOM 3255  H HB2  . TRP A 1 97  ? 11.698  5.369   9.166   1.00 0.00 ? 97  TRP A HB2  2  
ATOM 3256  H HB3  . TRP A 1 97  ? 12.005  6.610   10.378  1.00 0.00 ? 97  TRP A HB3  2  
ATOM 3257  H HD1  . TRP A 1 97  ? 10.224  6.834   12.383  1.00 0.00 ? 97  TRP A HD1  2  
ATOM 3258  H HE1  . TRP A 1 97  ? 8.508   5.166   13.331  1.00 0.00 ? 97  TRP A HE1  2  
ATOM 3259  H HE3  . TRP A 1 97  ? 10.117  3.493   8.515   1.00 0.00 ? 97  TRP A HE3  2  
ATOM 3260  H HZ2  . TRP A 1 97  ? 7.274   2.753   12.544  1.00 0.00 ? 97  TRP A HZ2  2  
ATOM 3261  H HZ3  . TRP A 1 97  ? 8.643   1.531   8.692   1.00 0.00 ? 97  TRP A HZ3  2  
ATOM 3262  H HH2  . TRP A 1 97  ? 7.252   1.170   10.666  1.00 0.00 ? 97  TRP A HH2  2  
ATOM 3263  N N    . ASN A 1 98  ? 11.769  9.312   8.609   1.00 0.00 ? 98  ASN A N    2  
ATOM 3264  C CA   . ASN A 1 98  ? 12.767  10.231  8.074   1.00 0.00 ? 98  ASN A CA   2  
ATOM 3265  C C    . ASN A 1 98  ? 13.425  11.032  9.193   1.00 0.00 ? 98  ASN A C    2  
ATOM 3266  O O    . ASN A 1 98  ? 12.897  11.119  10.302  1.00 0.00 ? 98  ASN A O    2  
ATOM 3267  C CB   . ASN A 1 98  ? 12.125  11.181  7.061   1.00 0.00 ? 98  ASN A CB   2  
ATOM 3268  C CG   . ASN A 1 98  ? 13.138  11.773  6.100   1.00 0.00 ? 98  ASN A CG   2  
ATOM 3269  O OD1  . ASN A 1 98  ? 14.299  11.363  6.074   1.00 0.00 ? 98  ASN A OD1  2  
ATOM 3270  N ND2  . ASN A 1 98  ? 12.702  12.743  5.305   1.00 0.00 ? 98  ASN A ND2  2  
ATOM 3271  H H    . ASN A 1 98  ? 11.128  9.638   9.275   1.00 0.00 ? 98  ASN A H    2  
ATOM 3272  H HA   . ASN A 1 98  ? 13.524  9.644   7.574   1.00 0.00 ? 98  ASN A HA   2  
ATOM 3273  H HB2  . ASN A 1 98  ? 11.387  10.639  6.486   1.00 0.00 ? 98  ASN A HB2  2  
ATOM 3274  H HB3  . ASN A 1 98  ? 11.642  11.989  7.590   1.00 0.00 ? 98  ASN A HB3  2  
ATOM 3275  H HD21 . ASN A 1 98  ? 11.765  13.019  5.382   1.00 0.00 ? 98  ASN A HD21 2  
ATOM 3276  H HD22 . ASN A 1 98  ? 13.336  13.144  4.674   1.00 0.00 ? 98  ASN A HD22 2  
ATOM 3277  N N    . SER A 1 99  ? 14.581  11.617  8.894   1.00 0.00 ? 99  SER A N    2  
ATOM 3278  C CA   . SER A 1 99  ? 15.313  12.409  9.876   1.00 0.00 ? 99  SER A CA   2  
ATOM 3279  C C    . SER A 1 99  ? 14.445  13.543  10.415  1.00 0.00 ? 99  SER A C    2  
ATOM 3280  O O    . SER A 1 99  ? 14.751  14.135  11.450  1.00 0.00 ? 99  SER A O    2  
ATOM 3281  C CB   . SER A 1 99  ? 16.588  12.980  9.253   1.00 0.00 ? 99  SER A CB   2  
ATOM 3282  O OG   . SER A 1 99  ? 17.404  13.595  10.235  1.00 0.00 ? 99  SER A OG   2  
ATOM 3283  H H    . SER A 1 99  ? 14.951  11.511  7.993   1.00 0.00 ? 99  SER A H    2  
ATOM 3284  H HA   . SER A 1 99  ? 15.582  11.757  10.694  1.00 0.00 ? 99  SER A HA   2  
ATOM 3285  H HB2  . SER A 1 99  ? 17.147  12.182  8.788   1.00 0.00 ? 99  SER A HB2  2  
ATOM 3286  H HB3  . SER A 1 99  ? 16.324  13.716  8.509   1.00 0.00 ? 99  SER A HB3  2  
ATOM 3287  H HG   . SER A 1 99  ? 17.469  13.022  11.003  1.00 0.00 ? 99  SER A HG   2  
ATOM 3288  N N    . PHE A 1 100 ? 13.362  13.839  9.705   1.00 0.00 ? 100 PHE A N    2  
ATOM 3289  C CA   . PHE A 1 100 ? 12.450  14.902  10.110  1.00 0.00 ? 100 PHE A CA   2  
ATOM 3290  C C    . PHE A 1 100 ? 11.385  14.371  11.066  1.00 0.00 ? 100 PHE A C    2  
ATOM 3291  O O    . PHE A 1 100 ? 11.168  14.926  12.142  1.00 0.00 ? 100 PHE A O    2  
ATOM 3292  C CB   . PHE A 1 100 ? 11.783  15.527  8.883   1.00 0.00 ? 100 PHE A CB   2  
ATOM 3293  C CG   . PHE A 1 100 ? 12.592  16.626  8.256   1.00 0.00 ? 100 PHE A CG   2  
ATOM 3294  C CD1  . PHE A 1 100 ? 12.564  17.909  8.778   1.00 0.00 ? 100 PHE A CD1  2  
ATOM 3295  C CD2  . PHE A 1 100 ? 13.381  16.376  7.144   1.00 0.00 ? 100 PHE A CD2  2  
ATOM 3296  C CE1  . PHE A 1 100 ? 13.308  18.923  8.203   1.00 0.00 ? 100 PHE A CE1  2  
ATOM 3297  C CE2  . PHE A 1 100 ? 14.127  17.386  6.566   1.00 0.00 ? 100 PHE A CE2  2  
ATOM 3298  C CZ   . PHE A 1 100 ? 14.089  18.661  7.096   1.00 0.00 ? 100 PHE A CZ   2  
ATOM 3299  H H    . PHE A 1 100 ? 13.171  13.331  8.889   1.00 0.00 ? 100 PHE A H    2  
ATOM 3300  H HA   . PHE A 1 100 ? 13.028  15.658  10.619  1.00 0.00 ? 100 PHE A HA   2  
ATOM 3301  H HB2  . PHE A 1 100 ? 11.630  14.762  8.137   1.00 0.00 ? 100 PHE A HB2  2  
ATOM 3302  H HB3  . PHE A 1 100 ? 10.828  15.939  9.172   1.00 0.00 ? 100 PHE A HB3  2  
ATOM 3303  H HD1  . PHE A 1 100 ? 11.952  18.116  9.645   1.00 0.00 ? 100 PHE A HD1  2  
ATOM 3304  H HD2  . PHE A 1 100 ? 13.411  15.380  6.729   1.00 0.00 ? 100 PHE A HD2  2  
ATOM 3305  H HE1  . PHE A 1 100 ? 13.276  19.919  8.620   1.00 0.00 ? 100 PHE A HE1  2  
ATOM 3306  H HE2  . PHE A 1 100 ? 14.737  17.178  5.700   1.00 0.00 ? 100 PHE A HE2  2  
ATOM 3307  H HZ   . PHE A 1 100 ? 14.672  19.451  6.646   1.00 0.00 ? 100 PHE A HZ   2  
ATOM 3308  N N    . GLY A 1 101 ? 10.723  13.290  10.663  1.00 0.00 ? 101 GLY A N    2  
ATOM 3309  C CA   . GLY A 1 101 ? 9.688   12.702  11.493  1.00 0.00 ? 101 GLY A CA   2  
ATOM 3310  C C    . GLY A 1 101 ? 9.155   11.403  10.921  1.00 0.00 ? 101 GLY A C    2  
ATOM 3311  O O    . GLY A 1 101 ? 9.922   10.554  10.469  1.00 0.00 ? 101 GLY A O    2  
ATOM 3312  H H    . GLY A 1 101 ? 10.939  12.890  9.794   1.00 0.00 ? 101 GLY A H    2  
ATOM 3313  H HA2  . GLY A 1 101 ? 10.096  12.510  12.474  1.00 0.00 ? 101 GLY A HA2  2  
ATOM 3314  H HA3  . GLY A 1 101 ? 8.873   13.404  11.584  1.00 0.00 ? 101 GLY A HA3  2  
ATOM 3315  N N    . SER A 1 102 ? 7.835   11.248  10.941  1.00 0.00 ? 102 SER A N    2  
ATOM 3316  C CA   . SER A 1 102 ? 7.199   10.041  10.425  1.00 0.00 ? 102 SER A CA   2  
ATOM 3317  C C    . SER A 1 102 ? 5.741   10.308  10.062  1.00 0.00 ? 102 SER A C    2  
ATOM 3318  O O    . SER A 1 102 ? 5.205   11.379  10.347  1.00 0.00 ? 102 SER A O    2  
ATOM 3319  C CB   . SER A 1 102 ? 7.281   8.915   11.457  1.00 0.00 ? 102 SER A CB   2  
ATOM 3320  O OG   . SER A 1 102 ? 6.649   9.287   12.669  1.00 0.00 ? 102 SER A OG   2  
ATOM 3321  H H    . SER A 1 102 ? 7.275   11.961  11.314  1.00 0.00 ? 102 SER A H    2  
ATOM 3322  H HA   . SER A 1 102 ? 7.731   9.742   9.534   1.00 0.00 ? 102 SER A HA   2  
ATOM 3323  H HB2  . SER A 1 102 ? 6.794   8.035   11.066  1.00 0.00 ? 102 SER A HB2  2  
ATOM 3324  H HB3  . SER A 1 102 ? 8.319   8.691   11.660  1.00 0.00 ? 102 SER A HB3  2  
ATOM 3325  H HG   . SER A 1 102 ? 7.259   9.800   13.205  1.00 0.00 ? 102 SER A HG   2  
ATOM 3326  N N    . ASP A 1 103 ? 5.107   9.327   9.431   1.00 0.00 ? 103 ASP A N    2  
ATOM 3327  C CA   . ASP A 1 103 ? 3.711   9.453   9.029   1.00 0.00 ? 103 ASP A CA   2  
ATOM 3328  C C    . ASP A 1 103 ? 3.142   8.102   8.606   1.00 0.00 ? 103 ASP A C    2  
ATOM 3329  O O    . ASP A 1 103 ? 3.887   7.175   8.287   1.00 0.00 ? 103 ASP A O    2  
ATOM 3330  C CB   . ASP A 1 103 ? 3.577   10.458  7.883   1.00 0.00 ? 103 ASP A CB   2  
ATOM 3331  C CG   . ASP A 1 103 ? 3.671   11.894  8.358   1.00 0.00 ? 103 ASP A CG   2  
ATOM 3332  O OD1  . ASP A 1 103 ? 2.676   12.400  8.920   1.00 0.00 ? 103 ASP A OD1  2  
ATOM 3333  O OD2  . ASP A 1 103 ? 4.739   12.512  8.170   1.00 0.00 ? 103 ASP A OD2  2  
ATOM 3334  H H    . ASP A 1 103 ? 5.588   8.496   9.231   1.00 0.00 ? 103 ASP A H    2  
ATOM 3335  H HA   . ASP A 1 103 ? 3.152   9.814   9.879   1.00 0.00 ? 103 ASP A HA   2  
ATOM 3336  H HB2  . ASP A 1 103 ? 4.366   10.283  7.166   1.00 0.00 ? 103 ASP A HB2  2  
ATOM 3337  H HB3  . ASP A 1 103 ? 2.620   10.318  7.400   1.00 0.00 ? 103 ASP A HB3  2  
ATOM 3338  N N    . THR A 1 104 ? 1.817   7.997   8.607   1.00 0.00 ? 104 THR A N    2  
ATOM 3339  C CA   . THR A 1 104 ? 1.148   6.759   8.226   1.00 0.00 ? 104 THR A CA   2  
ATOM 3340  C C    . THR A 1 104 ? -0.165  7.043   7.505   1.00 0.00 ? 104 THR A C    2  
ATOM 3341  O O    . THR A 1 104 ? -0.707  8.144   7.595   1.00 0.00 ? 104 THR A O    2  
ATOM 3342  C CB   . THR A 1 104 ? 0.866   5.873   9.454   1.00 0.00 ? 104 THR A CB   2  
ATOM 3343  O OG1  . THR A 1 104 ? 2.068   5.683   10.208  1.00 0.00 ? 104 THR A OG1  2  
ATOM 3344  C CG2  . THR A 1 104 ? 0.309   4.522   9.029   1.00 0.00 ? 104 THR A CG2  2  
ATOM 3345  H H    . THR A 1 104 ? 1.277   8.771   8.871   1.00 0.00 ? 104 THR A H    2  
ATOM 3346  H HA   . THR A 1 104 ? 1.804   6.217   7.560   1.00 0.00 ? 104 THR A HA   2  
ATOM 3347  H HB   . THR A 1 104 ? 0.133   6.368   10.076  1.00 0.00 ? 104 THR A HB   2  
ATOM 3348  H HG1  . THR A 1 104 ? 1.845   5.438   11.110  1.00 0.00 ? 104 THR A HG1  2  
ATOM 3349  H HG21 . THR A 1 104 ? 0.278   3.861   9.883   1.00 0.00 ? 104 THR A HG21 2  
ATOM 3350  H HG22 . THR A 1 104 ? 0.942   4.096   8.266   1.00 0.00 ? 104 THR A HG22 2  
ATOM 3351  H HG23 . THR A 1 104 ? -0.689  4.651   8.639   1.00 0.00 ? 104 THR A HG23 2  
ATOM 3352  N N    . GLU A 1 105 ? -0.671  6.042   6.791   1.00 0.00 ? 105 GLU A N    2  
ATOM 3353  C CA   . GLU A 1 105 ? -1.921  6.186   6.055   1.00 0.00 ? 105 GLU A CA   2  
ATOM 3354  C C    . GLU A 1 105 ? -2.616  4.837   5.894   1.00 0.00 ? 105 GLU A C    2  
ATOM 3355  O O    . GLU A 1 105 ? -1.963  3.805   5.738   1.00 0.00 ? 105 GLU A O    2  
ATOM 3356  C CB   . GLU A 1 105 ? -1.661  6.804   4.680   1.00 0.00 ? 105 GLU A CB   2  
ATOM 3357  C CG   . GLU A 1 105 ? -2.905  6.911   3.815   1.00 0.00 ? 105 GLU A CG   2  
ATOM 3358  C CD   . GLU A 1 105 ? -3.909  7.910   4.358   1.00 0.00 ? 105 GLU A CD   2  
ATOM 3359  O OE1  . GLU A 1 105 ? -4.378  7.720   5.499   1.00 0.00 ? 105 GLU A OE1  2  
ATOM 3360  O OE2  . GLU A 1 105 ? -4.225  8.882   3.640   1.00 0.00 ? 105 GLU A OE2  2  
ATOM 3361  H H    . GLU A 1 105 ? -0.192  5.188   6.758   1.00 0.00 ? 105 GLU A H    2  
ATOM 3362  H HA   . GLU A 1 105 ? -2.564  6.844   6.619   1.00 0.00 ? 105 GLU A HA   2  
ATOM 3363  H HB2  . GLU A 1 105 ? -1.255  7.796   4.815   1.00 0.00 ? 105 GLU A HB2  2  
ATOM 3364  H HB3  . GLU A 1 105 ? -0.936  6.198   4.157   1.00 0.00 ? 105 GLU A HB3  2  
ATOM 3365  H HG2  . GLU A 1 105 ? -2.613  7.221   2.823   1.00 0.00 ? 105 GLU A HG2  2  
ATOM 3366  H HG3  . GLU A 1 105 ? -3.377  5.941   3.763   1.00 0.00 ? 105 GLU A HG3  2  
ATOM 3367  N N    . ILE A 1 106 ? -3.944  4.854   5.935   1.00 0.00 ? 106 ILE A N    2  
ATOM 3368  C CA   . ILE A 1 106 ? -4.728  3.633   5.794   1.00 0.00 ? 106 ILE A CA   2  
ATOM 3369  C C    . ILE A 1 106 ? -5.256  3.480   4.372   1.00 0.00 ? 106 ILE A C    2  
ATOM 3370  O O    . ILE A 1 106 ? -5.500  4.469   3.680   1.00 0.00 ? 106 ILE A O    2  
ATOM 3371  C CB   . ILE A 1 106 ? -5.914  3.609   6.776   1.00 0.00 ? 106 ILE A CB   2  
ATOM 3372  C CG1  . ILE A 1 106 ? -5.436  3.920   8.195   1.00 0.00 ? 106 ILE A CG1  2  
ATOM 3373  C CG2  . ILE A 1 106 ? -6.612  2.257   6.731   1.00 0.00 ? 106 ILE A CG2  2  
ATOM 3374  C CD1  . ILE A 1 106 ? -6.509  4.520   9.077   1.00 0.00 ? 106 ILE A CD1  2  
ATOM 3375  H H    . ILE A 1 106 ? -4.408  5.707   6.063   1.00 0.00 ? 106 ILE A H    2  
ATOM 3376  H HA   . ILE A 1 106 ? -4.083  2.795   6.019   1.00 0.00 ? 106 ILE A HA   2  
ATOM 3377  H HB   . ILE A 1 106 ? -6.622  4.363   6.469   1.00 0.00 ? 106 ILE A HB   2  
ATOM 3378  H HG12 . ILE A 1 106 ? -5.095  3.009   8.662   1.00 0.00 ? 106 ILE A HG12 2  
ATOM 3379  H HG13 . ILE A 1 106 ? -4.616  4.622   8.145   1.00 0.00 ? 106 ILE A HG13 2  
ATOM 3380  H HG21 . ILE A 1 106 ? -5.890  1.474   6.909   1.00 0.00 ? 106 ILE A HG21 2  
ATOM 3381  H HG22 . ILE A 1 106 ? -7.376  2.221   7.493   1.00 0.00 ? 106 ILE A HG22 2  
ATOM 3382  H HG23 . ILE A 1 106 ? -7.063  2.117   5.760   1.00 0.00 ? 106 ILE A HG23 2  
ATOM 3383  H HD11 . ILE A 1 106 ? -6.607  3.931   9.977   1.00 0.00 ? 106 ILE A HD11 2  
ATOM 3384  H HD12 . ILE A 1 106 ? -6.239  5.532   9.336   1.00 0.00 ? 106 ILE A HD12 2  
ATOM 3385  H HD13 . ILE A 1 106 ? -7.450  4.523   8.546   1.00 0.00 ? 106 ILE A HD13 2  
ATOM 3386  N N    . ILE A 1 107 ? -5.433  2.235   3.943   1.00 0.00 ? 107 ILE A N    2  
ATOM 3387  C CA   . ILE A 1 107 ? -5.936  1.954   2.604   1.00 0.00 ? 107 ILE A CA   2  
ATOM 3388  C C    . ILE A 1 107 ? -6.804  0.700   2.595   1.00 0.00 ? 107 ILE A C    2  
ATOM 3389  O O    . ILE A 1 107 ? -6.306  -0.413  2.764   1.00 0.00 ? 107 ILE A O    2  
ATOM 3390  C CB   . ILE A 1 107 ? -4.785  1.775   1.596   1.00 0.00 ? 107 ILE A CB   2  
ATOM 3391  C CG1  . ILE A 1 107 ? -3.941  3.049   1.522   1.00 0.00 ? 107 ILE A CG1  2  
ATOM 3392  C CG2  . ILE A 1 107 ? -5.334  1.415   0.223   1.00 0.00 ? 107 ILE A CG2  2  
ATOM 3393  C CD1  . ILE A 1 107 ? -2.802  3.078   2.517   1.00 0.00 ? 107 ILE A CD1  2  
ATOM 3394  H H    . ILE A 1 107 ? -5.221  1.489   4.540   1.00 0.00 ? 107 ILE A H    2  
ATOM 3395  H HA   . ILE A 1 107 ? -6.536  2.796   2.289   1.00 0.00 ? 107 ILE A HA   2  
ATOM 3396  H HB   . ILE A 1 107 ? -4.164  0.959   1.934   1.00 0.00 ? 107 ILE A HB   2  
ATOM 3397  H HG12 . ILE A 1 107 ? -3.519  3.136   0.533   1.00 0.00 ? 107 ILE A HG12 2  
ATOM 3398  H HG13 . ILE A 1 107 ? -4.574  3.903   1.715   1.00 0.00 ? 107 ILE A HG13 2  
ATOM 3399  H HG21 . ILE A 1 107 ? -4.719  0.646   -0.220  1.00 0.00 ? 107 ILE A HG21 2  
ATOM 3400  H HG22 . ILE A 1 107 ? -6.345  1.052   0.325   1.00 0.00 ? 107 ILE A HG22 2  
ATOM 3401  H HG23 . ILE A 1 107 ? -5.327  2.291   -0.408  1.00 0.00 ? 107 ILE A HG23 2  
ATOM 3402  H HD11 . ILE A 1 107 ? -2.460  4.094   2.643   1.00 0.00 ? 107 ILE A HD11 2  
ATOM 3403  H HD12 . ILE A 1 107 ? -3.142  2.691   3.465   1.00 0.00 ? 107 ILE A HD12 2  
ATOM 3404  H HD13 . ILE A 1 107 ? -1.988  2.468   2.150   1.00 0.00 ? 107 ILE A HD13 2  
ATOM 3405  N N    . ARG A 1 108 ? -8.104  0.888   2.395   1.00 0.00 ? 108 ARG A N    2  
ATOM 3406  C CA   . ARG A 1 108 ? -9.042  -0.228  2.364   1.00 0.00 ? 108 ARG A CA   2  
ATOM 3407  C C    . ARG A 1 108 ? -9.223  -0.746  0.940   1.00 0.00 ? 108 ARG A C    2  
ATOM 3408  O O    . ARG A 1 108 ? -10.004 -0.197  0.162   1.00 0.00 ? 108 ARG A O    2  
ATOM 3409  C CB   . ARG A 1 108 ? -10.394 0.198   2.938   1.00 0.00 ? 108 ARG A CB   2  
ATOM 3410  C CG   . ARG A 1 108 ? -10.460 0.130   4.455   1.00 0.00 ? 108 ARG A CG   2  
ATOM 3411  C CD   . ARG A 1 108 ? -9.254  0.799   5.096   1.00 0.00 ? 108 ARG A CD   2  
ATOM 3412  N NE   . ARG A 1 108 ? -9.548  1.287   6.440   1.00 0.00 ? 108 ARG A NE   2  
ATOM 3413  C CZ   . ARG A 1 108 ? -10.312 2.346   6.686   1.00 0.00 ? 108 ARG A CZ   2  
ATOM 3414  N NH1  . ARG A 1 108 ? -10.856 3.022   5.684   1.00 0.00 ? 108 ARG A NH1  2  
ATOM 3415  N NH2  . ARG A 1 108 ? -10.534 2.729   7.937   1.00 0.00 ? 108 ARG A NH2  2  
ATOM 3416  H H    . ARG A 1 108 ? -8.441  1.799   2.267   1.00 0.00 ? 108 ARG A H    2  
ATOM 3417  H HA   . ARG A 1 108 ? -8.635  -1.020  2.974   1.00 0.00 ? 108 ARG A HA   2  
ATOM 3418  H HB2  . ARG A 1 108 ? -10.596 1.216   2.636   1.00 0.00 ? 108 ARG A HB2  2  
ATOM 3419  H HB3  . ARG A 1 108 ? -11.161 -0.447  2.537   1.00 0.00 ? 108 ARG A HB3  2  
ATOM 3420  H HG2  . ARG A 1 108 ? -11.356 0.632   4.790   1.00 0.00 ? 108 ARG A HG2  2  
ATOM 3421  H HG3  . ARG A 1 108 ? -10.490 -0.906  4.758   1.00 0.00 ? 108 ARG A HG3  2  
ATOM 3422  H HD2  . ARG A 1 108 ? -8.449  0.081   5.152   1.00 0.00 ? 108 ARG A HD2  2  
ATOM 3423  H HD3  . ARG A 1 108 ? -8.951  1.631   4.478   1.00 0.00 ? 108 ARG A HD3  2  
ATOM 3424  H HE   . ARG A 1 108 ? -9.157  0.802   7.195   1.00 0.00 ? 108 ARG A HE   2  
ATOM 3425  H HH11 . ARG A 1 108 ? -10.692 2.735   4.741   1.00 0.00 ? 108 ARG A HH11 2  
ATOM 3426  H HH12 . ARG A 1 108 ? -11.432 3.818   5.872   1.00 0.00 ? 108 ARG A HH12 2  
ATOM 3427  H HH21 . ARG A 1 108 ? -10.126 2.221   8.695   1.00 0.00 ? 108 ARG A HH21 2  
ATOM 3428  H HH22 . ARG A 1 108 ? -11.109 3.525   8.121   1.00 0.00 ? 108 ARG A HH22 2  
ATOM 3429  N N    . LEU A 1 109 ? -8.494  -1.805  0.604   1.00 0.00 ? 109 LEU A N    2  
ATOM 3430  C CA   . LEU A 1 109 ? -8.573  -2.398  -0.726  1.00 0.00 ? 109 LEU A CA   2  
ATOM 3431  C C    . LEU A 1 109 ? -9.887  -3.152  -0.909  1.00 0.00 ? 109 LEU A C    2  
ATOM 3432  O O    . LEU A 1 109 ? -10.182 -4.095  -0.176  1.00 0.00 ? 109 LEU A O    2  
ATOM 3433  C CB   . LEU A 1 109 ? -7.393  -3.344  -0.956  1.00 0.00 ? 109 LEU A CB   2  
ATOM 3434  C CG   . LEU A 1 109 ? -7.194  -3.832  -2.391  1.00 0.00 ? 109 LEU A CG   2  
ATOM 3435  C CD1  . LEU A 1 109 ? -6.934  -2.659  -3.323  1.00 0.00 ? 109 LEU A CD1  2  
ATOM 3436  C CD2  . LEU A 1 109 ? -6.050  -4.833  -2.459  1.00 0.00 ? 109 LEU A CD2  2  
ATOM 3437  H H    . LEU A 1 109 ? -7.889  -2.199  1.267   1.00 0.00 ? 109 LEU A H    2  
ATOM 3438  H HA   . LEU A 1 109 ? -8.528  -1.597  -1.449  1.00 0.00 ? 109 LEU A HA   2  
ATOM 3439  H HB2  . LEU A 1 109 ? -6.494  -2.829  -0.654  1.00 0.00 ? 109 LEU A HB2  2  
ATOM 3440  H HB3  . LEU A 1 109 ? -7.538  -4.211  -0.327  1.00 0.00 ? 109 LEU A HB3  2  
ATOM 3441  H HG   . LEU A 1 109 ? -8.095  -4.329  -2.724  1.00 0.00 ? 109 LEU A HG   2  
ATOM 3442  H HD11 . LEU A 1 109 ? -6.774  -1.765  -2.740  1.00 0.00 ? 109 LEU A HD11 2  
ATOM 3443  H HD12 . LEU A 1 109 ? -7.786  -2.518  -3.971  1.00 0.00 ? 109 LEU A HD12 2  
ATOM 3444  H HD13 . LEU A 1 109 ? -6.057  -2.861  -3.921  1.00 0.00 ? 109 LEU A HD13 2  
ATOM 3445  H HD21 . LEU A 1 109 ? -5.715  -4.927  -3.482  1.00 0.00 ? 109 LEU A HD21 2  
ATOM 3446  H HD22 . LEU A 1 109 ? -6.391  -5.795  -2.103  1.00 0.00 ? 109 LEU A HD22 2  
ATOM 3447  H HD23 . LEU A 1 109 ? -5.233  -4.489  -1.843  1.00 0.00 ? 109 LEU A HD23 2  
ATOM 3448  N N    . LYS A 1 110 ? -10.672 -2.730  -1.895  1.00 0.00 ? 110 LYS A N    2  
ATOM 3449  C CA   . LYS A 1 110 ? -11.953 -3.366  -2.178  1.00 0.00 ? 110 LYS A CA   2  
ATOM 3450  C C    . LYS A 1 110 ? -11.820 -4.374  -3.316  1.00 0.00 ? 110 LYS A C    2  
ATOM 3451  O O    . LYS A 1 110 ? -10.989 -4.209  -4.209  1.00 0.00 ? 110 LYS A O    2  
ATOM 3452  C CB   . LYS A 1 110 ? -13.002 -2.311  -2.537  1.00 0.00 ? 110 LYS A CB   2  
ATOM 3453  C CG   . LYS A 1 110 ? -13.243 -1.294  -1.435  1.00 0.00 ? 110 LYS A CG   2  
ATOM 3454  C CD   . LYS A 1 110 ? -14.583 -0.597  -1.603  1.00 0.00 ? 110 LYS A CD   2  
ATOM 3455  C CE   . LYS A 1 110 ? -14.828 0.415   -0.495  1.00 0.00 ? 110 LYS A CE   2  
ATOM 3456  N NZ   . LYS A 1 110 ? -16.280 0.605   -0.228  1.00 0.00 ? 110 LYS A NZ   2  
ATOM 3457  H H    . LYS A 1 110 ? -10.383 -1.972  -2.446  1.00 0.00 ? 110 LYS A H    2  
ATOM 3458  H HA   . LYS A 1 110 ? -12.269 -3.887  -1.287  1.00 0.00 ? 110 LYS A HA   2  
ATOM 3459  H HB2  . LYS A 1 110 ? -12.676 -1.783  -3.421  1.00 0.00 ? 110 LYS A HB2  2  
ATOM 3460  H HB3  . LYS A 1 110 ? -13.937 -2.809  -2.751  1.00 0.00 ? 110 LYS A HB3  2  
ATOM 3461  H HG2  . LYS A 1 110 ? -13.231 -1.801  -0.481  1.00 0.00 ? 110 LYS A HG2  2  
ATOM 3462  H HG3  . LYS A 1 110 ? -12.456 -0.554  -1.462  1.00 0.00 ? 110 LYS A HG3  2  
ATOM 3463  H HD2  . LYS A 1 110 ? -14.595 -0.083  -2.553  1.00 0.00 ? 110 LYS A HD2  2  
ATOM 3464  H HD3  . LYS A 1 110 ? -15.370 -1.338  -1.583  1.00 0.00 ? 110 LYS A HD3  2  
ATOM 3465  H HE2  . LYS A 1 110 ? -14.347 0.066   0.406   1.00 0.00 ? 110 LYS A HE2  2  
ATOM 3466  H HE3  . LYS A 1 110 ? -14.397 1.361   -0.788  1.00 0.00 ? 110 LYS A HE3  2  
ATOM 3467  H HZ1  . LYS A 1 110 ? -16.493 1.617   -0.115  1.00 0.00 ? 110 LYS A HZ1  2  
ATOM 3468  H HZ2  . LYS A 1 110 ? -16.552 0.106   0.643   1.00 0.00 ? 110 LYS A HZ2  2  
ATOM 3469  H HZ3  . LYS A 1 110 ? -16.841 0.229   -1.019  1.00 0.00 ? 110 LYS A HZ3  2  
ATOM 3470  N N    . GLU A 1 111 ? -12.645 -5.416  -3.278  1.00 0.00 ? 111 GLU A N    2  
ATOM 3471  C CA   . GLU A 1 111 ? -12.619 -6.448  -4.307  1.00 0.00 ? 111 GLU A CA   2  
ATOM 3472  C C    . GLU A 1 111 ? -12.799 -5.839  -5.694  1.00 0.00 ? 111 GLU A C    2  
ATOM 3473  O O    . GLU A 1 111 ? -12.001 -6.084  -6.598  1.00 0.00 ? 111 GLU A O    2  
ATOM 3474  C CB   . GLU A 1 111 ? -13.713 -7.486  -4.048  1.00 0.00 ? 111 GLU A CB   2  
ATOM 3475  C CG   . GLU A 1 111 ? -13.886 -8.484  -5.180  1.00 0.00 ? 111 GLU A CG   2  
ATOM 3476  C CD   . GLU A 1 111 ? -12.939 -9.663  -5.068  1.00 0.00 ? 111 GLU A CD   2  
ATOM 3477  O OE1  . GLU A 1 111 ? -13.074 -10.444 -4.104  1.00 0.00 ? 111 GLU A OE1  2  
ATOM 3478  O OE2  . GLU A 1 111 ? -12.061 -9.803  -5.946  1.00 0.00 ? 111 GLU A OE2  2  
ATOM 3479  H H    . GLU A 1 111 ? -13.286 -5.492  -2.540  1.00 0.00 ? 111 GLU A H    2  
ATOM 3480  H HA   . GLU A 1 111 ? -11.656 -6.936  -4.263  1.00 0.00 ? 111 GLU A HA   2  
ATOM 3481  H HB2  . GLU A 1 111 ? -13.470 -8.031  -3.148  1.00 0.00 ? 111 GLU A HB2  2  
ATOM 3482  H HB3  . GLU A 1 111 ? -14.652 -6.972  -3.903  1.00 0.00 ? 111 GLU A HB3  2  
ATOM 3483  H HG2  . GLU A 1 111 ? -14.900 -8.855  -5.165  1.00 0.00 ? 111 GLU A HG2  2  
ATOM 3484  H HG3  . GLU A 1 111 ? -13.702 -7.981  -6.118  1.00 0.00 ? 111 GLU A HG3  2  
ATOM 3485  N N    . GLN A 1 112 ? -13.852 -5.045  -5.853  1.00 0.00 ? 112 GLN A N    2  
ATOM 3486  C CA   . GLN A 1 112 ? -14.138 -4.401  -7.130  1.00 0.00 ? 112 GLN A CA   2  
ATOM 3487  C C    . GLN A 1 112 ? -14.992 -3.154  -6.932  1.00 0.00 ? 112 GLN A C    2  
ATOM 3488  O O    . GLN A 1 112 ? -15.686 -3.018  -5.925  1.00 0.00 ? 112 GLN A O    2  
ATOM 3489  C CB   . GLN A 1 112 ? -14.849 -5.377  -8.069  1.00 0.00 ? 112 GLN A CB   2  
ATOM 3490  C CG   . GLN A 1 112 ? -14.911 -4.898  -9.510  1.00 0.00 ? 112 GLN A CG   2  
ATOM 3491  C CD   . GLN A 1 112 ? -15.187 -6.024  -10.488 1.00 0.00 ? 112 GLN A CD   2  
ATOM 3492  O OE1  . GLN A 1 112 ? -14.419 -6.982  -10.582 1.00 0.00 ? 112 GLN A OE1  2  
ATOM 3493  N NE2  . GLN A 1 112 ? -16.288 -5.914  -11.222 1.00 0.00 ? 112 GLN A NE2  2  
ATOM 3494  H H    . GLN A 1 112 ? -14.452 -4.888  -5.094  1.00 0.00 ? 112 GLN A H    2  
ATOM 3495  H HA   . GLN A 1 112 ? -13.197 -4.111  -7.572  1.00 0.00 ? 112 GLN A HA   2  
ATOM 3496  H HB2  . GLN A 1 112 ? -14.328 -6.323  -8.048  1.00 0.00 ? 112 GLN A HB2  2  
ATOM 3497  H HB3  . GLN A 1 112 ? -15.860 -5.524  -7.718  1.00 0.00 ? 112 GLN A HB3  2  
ATOM 3498  H HG2  . GLN A 1 112 ? -15.699 -4.165  -9.599  1.00 0.00 ? 112 GLN A HG2  2  
ATOM 3499  H HG3  . GLN A 1 112 ? -13.966 -4.443  -9.766  1.00 0.00 ? 112 GLN A HG3  2  
ATOM 3500  H HE21 . GLN A 1 112 ? -16.852 -5.122  -11.094 1.00 0.00 ? 112 GLN A HE21 2  
ATOM 3501  H HE22 . GLN A 1 112 ? -16.491 -6.626  -11.862 1.00 0.00 ? 112 GLN A HE22 2  
ATOM 3502  N N    . GLY A 1 113 ? -14.937 -2.244  -7.900  1.00 0.00 ? 113 GLY A N    2  
ATOM 3503  C CA   . GLY A 1 113 ? -15.710 -1.019  -7.813  1.00 0.00 ? 113 GLY A CA   2  
ATOM 3504  C C    . GLY A 1 113 ? -17.129 -1.262  -7.337  1.00 0.00 ? 113 GLY A C    2  
ATOM 3505  O O    . GLY A 1 113 ? -17.635 -2.380  -7.419  1.00 0.00 ? 113 GLY A O    2  
ATOM 3506  H H    . GLY A 1 113 ? -14.366 -2.406  -8.680  1.00 0.00 ? 113 GLY A H    2  
ATOM 3507  H HA2  . GLY A 1 113 ? -15.221 -0.346  -7.124  1.00 0.00 ? 113 GLY A HA2  2  
ATOM 3508  H HA3  . GLY A 1 113 ? -15.744 -0.558  -8.789  1.00 0.00 ? 113 GLY A HA3  2  
ATOM 3509  N N    . SER A 1 114 ? -17.771 -0.211  -6.837  1.00 0.00 ? 114 SER A N    2  
ATOM 3510  C CA   . SER A 1 114 ? -19.138 -0.316  -6.341  1.00 0.00 ? 114 SER A CA   2  
ATOM 3511  C C    . SER A 1 114 ? -19.836 1.040   -6.379  1.00 0.00 ? 114 SER A C    2  
ATOM 3512  O O    . SER A 1 114 ? -19.452 1.967   -5.667  1.00 0.00 ? 114 SER A O    2  
ATOM 3513  C CB   . SER A 1 114 ? -19.145 -0.865  -4.913  1.00 0.00 ? 114 SER A CB   2  
ATOM 3514  O OG   . SER A 1 114 ? -18.866 -2.255  -4.899  1.00 0.00 ? 114 SER A OG   2  
ATOM 3515  H H    . SER A 1 114 ? -17.313 0.655   -6.798  1.00 0.00 ? 114 SER A H    2  
ATOM 3516  H HA   . SER A 1 114 ? -19.672 -1.001  -6.983  1.00 0.00 ? 114 SER A HA   2  
ATOM 3517  H HB2  . SER A 1 114 ? -18.394 -0.354  -4.330  1.00 0.00 ? 114 SER A HB2  2  
ATOM 3518  H HB3  . SER A 1 114 ? -20.117 -0.701  -4.471  1.00 0.00 ? 114 SER A HB3  2  
ATOM 3519  H HG   . SER A 1 114 ? -17.925 -2.391  -4.764  1.00 0.00 ? 114 SER A HG   2  
ATOM 3520  N N    . GLU A 1 115 ? -20.864 1.146   -7.216  1.00 0.00 ? 115 GLU A N    2  
ATOM 3521  C CA   . GLU A 1 115 ? -21.615 2.389   -7.348  1.00 0.00 ? 115 GLU A CA   2  
ATOM 3522  C C    . GLU A 1 115 ? -21.859 3.025   -5.983  1.00 0.00 ? 115 GLU A C    2  
ATOM 3523  O O    . GLU A 1 115 ? -22.380 2.382   -5.072  1.00 0.00 ? 115 GLU A O    2  
ATOM 3524  C CB   . GLU A 1 115 ? -22.950 2.132   -8.050  1.00 0.00 ? 115 GLU A CB   2  
ATOM 3525  C CG   . GLU A 1 115 ? -23.659 3.400   -8.492  1.00 0.00 ? 115 GLU A CG   2  
ATOM 3526  C CD   . GLU A 1 115 ? -24.722 3.139   -9.542  1.00 0.00 ? 115 GLU A CD   2  
ATOM 3527  O OE1  . GLU A 1 115 ? -25.590 2.273   -9.304  1.00 0.00 ? 115 GLU A OE1  2  
ATOM 3528  O OE2  . GLU A 1 115 ? -24.685 3.798   -10.602 1.00 0.00 ? 115 GLU A OE2  2  
ATOM 3529  H H    . GLU A 1 115 ? -21.122 0.371   -7.757  1.00 0.00 ? 115 GLU A H    2  
ATOM 3530  H HA   . GLU A 1 115 ? -21.029 3.068   -7.949  1.00 0.00 ? 115 GLU A HA   2  
ATOM 3531  H HB2  . GLU A 1 115 ? -22.773 1.519   -8.922  1.00 0.00 ? 115 GLU A HB2  2  
ATOM 3532  H HB3  . GLU A 1 115 ? -23.601 1.598   -7.373  1.00 0.00 ? 115 GLU A HB3  2  
ATOM 3533  H HG2  . GLU A 1 115 ? -24.129 3.854   -7.633  1.00 0.00 ? 115 GLU A HG2  2  
ATOM 3534  H HG3  . GLU A 1 115 ? -22.929 4.082   -8.903  1.00 0.00 ? 115 GLU A HG3  2  
ATOM 3535  N N    . MET A 1 116 ? -21.479 4.291   -5.850  1.00 0.00 ? 116 MET A N    2  
ATOM 3536  C CA   . MET A 1 116 ? -21.657 5.015   -4.596  1.00 0.00 ? 116 MET A CA   2  
ATOM 3537  C C    . MET A 1 116 ? -23.112 4.960   -4.139  1.00 0.00 ? 116 MET A C    2  
ATOM 3538  O O    . MET A 1 116 ? -24.021 4.794   -4.951  1.00 0.00 ? 116 MET A O    2  
ATOM 3539  C CB   . MET A 1 116 ? -21.215 6.471   -4.756  1.00 0.00 ? 116 MET A CB   2  
ATOM 3540  C CG   . MET A 1 116 ? -21.314 7.280   -3.473  1.00 0.00 ? 116 MET A CG   2  
ATOM 3541  S SD   . MET A 1 116 ? -20.246 8.732   -3.483  1.00 0.00 ? 116 MET A SD   2  
ATOM 3542  C CE   . MET A 1 116 ? -19.134 8.345   -2.133  1.00 0.00 ? 116 MET A CE   2  
ATOM 3543  H H    . MET A 1 116 ? -21.070 4.751   -6.613  1.00 0.00 ? 116 MET A H    2  
ATOM 3544  H HA   . MET A 1 116 ? -21.039 4.540   -3.849  1.00 0.00 ? 116 MET A HA   2  
ATOM 3545  H HB2  . MET A 1 116 ? -20.188 6.488   -5.089  1.00 0.00 ? 116 MET A HB2  2  
ATOM 3546  H HB3  . MET A 1 116 ? -21.835 6.944   -5.502  1.00 0.00 ? 116 MET A HB3  2  
ATOM 3547  H HG2  . MET A 1 116 ? -22.336 7.604   -3.345  1.00 0.00 ? 116 MET A HG2  2  
ATOM 3548  H HG3  . MET A 1 116 ? -21.032 6.648   -2.643  1.00 0.00 ? 116 MET A HG3  2  
ATOM 3549  H HE1  . MET A 1 116 ? -19.449 7.427   -1.659  1.00 0.00 ? 116 MET A HE1  2  
ATOM 3550  H HE2  . MET A 1 116 ? -18.131 8.227   -2.516  1.00 0.00 ? 116 MET A HE2  2  
ATOM 3551  H HE3  . MET A 1 116 ? -19.152 9.148   -1.411  1.00 0.00 ? 116 MET A HE3  2  
ATOM 3552  N N    . SER A 1 117 ? -23.323 5.101   -2.834  1.00 0.00 ? 117 SER A N    2  
ATOM 3553  C CA   . SER A 1 117 ? -24.666 5.063   -2.269  1.00 0.00 ? 117 SER A CA   2  
ATOM 3554  C C    . SER A 1 117 ? -24.864 6.192   -1.262  1.00 0.00 ? 117 SER A C    2  
ATOM 3555  O O    . SER A 1 117 ? -23.901 6.806   -0.804  1.00 0.00 ? 117 SER A O    2  
ATOM 3556  C CB   . SER A 1 117 ? -24.922 3.713   -1.596  1.00 0.00 ? 117 SER A CB   2  
ATOM 3557  O OG   . SER A 1 117 ? -23.942 3.442   -0.608  1.00 0.00 ? 117 SER A OG   2  
ATOM 3558  H H    . SER A 1 117 ? -22.556 5.231   -2.238  1.00 0.00 ? 117 SER A H    2  
ATOM 3559  H HA   . SER A 1 117 ? -25.370 5.191   -3.078  1.00 0.00 ? 117 SER A HA   2  
ATOM 3560  H HB2  . SER A 1 117 ? -25.894 3.725   -1.128  1.00 0.00 ? 117 SER A HB2  2  
ATOM 3561  H HB3  . SER A 1 117 ? -24.890 2.931   -2.341  1.00 0.00 ? 117 SER A HB3  2  
ATOM 3562  H HG   . SER A 1 117 ? -24.164 3.911   0.199   1.00 0.00 ? 117 SER A HG   2  
ATOM 3563  N N    . GLY A 1 118 ? -26.121 6.459   -0.921  1.00 0.00 ? 118 GLY A N    2  
ATOM 3564  C CA   . GLY A 1 118 ? -26.423 7.513   0.030   1.00 0.00 ? 118 GLY A CA   2  
ATOM 3565  C C    . GLY A 1 118 ? -27.484 8.468   -0.481  1.00 0.00 ? 118 GLY A C    2  
ATOM 3566  O O    . GLY A 1 118 ? -28.271 8.138   -1.369  1.00 0.00 ? 118 GLY A O    2  
ATOM 3567  H H    . GLY A 1 118 ? -26.849 5.936   -1.318  1.00 0.00 ? 118 GLY A H    2  
ATOM 3568  H HA2  . GLY A 1 118 ? -26.770 7.065   0.950   1.00 0.00 ? 118 GLY A HA2  2  
ATOM 3569  H HA3  . GLY A 1 118 ? -25.520 8.071   0.231   1.00 0.00 ? 118 GLY A HA3  2  
ATOM 3570  N N    . PRO A 1 119 ? -27.516 9.682   0.088   1.00 0.00 ? 119 PRO A N    2  
ATOM 3571  C CA   . PRO A 1 119 ? -28.485 10.712  -0.299  1.00 0.00 ? 119 PRO A CA   2  
ATOM 3572  C C    . PRO A 1 119 ? -28.217 11.265  -1.695  1.00 0.00 ? 119 PRO A C    2  
ATOM 3573  O O    . PRO A 1 119 ? -29.146 11.613  -2.424  1.00 0.00 ? 119 PRO A O    2  
ATOM 3574  C CB   . PRO A 1 119 ? -28.284 11.803  0.756   1.00 0.00 ? 119 PRO A CB   2  
ATOM 3575  C CG   . PRO A 1 119 ? -26.882 11.620  1.226   1.00 0.00 ? 119 PRO A CG   2  
ATOM 3576  C CD   . PRO A 1 119 ? -26.609 10.143  1.152   1.00 0.00 ? 119 PRO A CD   2  
ATOM 3577  H HA   . PRO A 1 119 ? -29.499 10.342  -0.248  1.00 0.00 ? 119 PRO A HA   2  
ATOM 3578  H HB2  . PRO A 1 119 ? -28.427 12.774  0.304   1.00 0.00 ? 119 PRO A HB2  2  
ATOM 3579  H HB3  . PRO A 1 119 ? -28.991 11.666  1.560   1.00 0.00 ? 119 PRO A HB3  2  
ATOM 3580  H HG2  . PRO A 1 119 ? -26.205 12.160  0.582   1.00 0.00 ? 119 PRO A HG2  2  
ATOM 3581  H HG3  . PRO A 1 119 ? -26.789 11.967  2.245   1.00 0.00 ? 119 PRO A HG3  2  
ATOM 3582  H HD2  . PRO A 1 119 ? -25.578 9.963   0.885   1.00 0.00 ? 119 PRO A HD2  2  
ATOM 3583  H HD3  . PRO A 1 119 ? -26.846 9.668   2.092   1.00 0.00 ? 119 PRO A HD3  2  
ATOM 3584  N N    . SER A 1 120 ? -26.942 11.342  -2.061  1.00 0.00 ? 120 SER A N    2  
ATOM 3585  C CA   . SER A 1 120 ? -26.552 11.856  -3.369  1.00 0.00 ? 120 SER A CA   2  
ATOM 3586  C C    . SER A 1 120 ? -26.655 10.767  -4.433  1.00 0.00 ? 120 SER A C    2  
ATOM 3587  O O    . SER A 1 120 ? -26.844 9.593   -4.118  1.00 0.00 ? 120 SER A O    2  
ATOM 3588  C CB   . SER A 1 120 ? -25.124 12.404  -3.320  1.00 0.00 ? 120 SER A CB   2  
ATOM 3589  O OG   . SER A 1 120 ? -24.173 11.356  -3.394  1.00 0.00 ? 120 SER A OG   2  
ATOM 3590  H H    . SER A 1 120 ? -26.247 11.049  -1.435  1.00 0.00 ? 120 SER A H    2  
ATOM 3591  H HA   . SER A 1 120 ? -27.228 12.658  -3.625  1.00 0.00 ? 120 SER A HA   2  
ATOM 3592  H HB2  . SER A 1 120 ? -24.970 13.074  -4.152  1.00 0.00 ? 120 SER A HB2  2  
ATOM 3593  H HB3  . SER A 1 120 ? -24.979 12.941  -2.393  1.00 0.00 ? 120 SER A HB3  2  
ATOM 3594  H HG   . SER A 1 120 ? -24.154 11.003  -4.287  1.00 0.00 ? 120 SER A HG   2  
ATOM 3595  N N    . SER A 1 121 ? -26.528 11.168  -5.694  1.00 0.00 ? 121 SER A N    2  
ATOM 3596  C CA   . SER A 1 121 ? -26.611 10.228  -6.806  1.00 0.00 ? 121 SER A CA   2  
ATOM 3597  C C    . SER A 1 121 ? -25.362 10.308  -7.679  1.00 0.00 ? 121 SER A C    2  
ATOM 3598  O O    . SER A 1 121 ? -24.773 9.289   -8.034  1.00 0.00 ? 121 SER A O    2  
ATOM 3599  C CB   . SER A 1 121 ? -27.855 10.512  -7.650  1.00 0.00 ? 121 SER A CB   2  
ATOM 3600  O OG   . SER A 1 121 ? -29.035 10.396  -6.873  1.00 0.00 ? 121 SER A OG   2  
ATOM 3601  H H    . SER A 1 121 ? -26.379 12.118  -5.881  1.00 0.00 ? 121 SER A H    2  
ATOM 3602  H HA   . SER A 1 121 ? -26.685 9.233   -6.394  1.00 0.00 ? 121 SER A HA   2  
ATOM 3603  H HB2  . SER A 1 121 ? -27.797 11.514  -8.047  1.00 0.00 ? 121 SER A HB2  2  
ATOM 3604  H HB3  . SER A 1 121 ? -27.903 9.804   -8.465  1.00 0.00 ? 121 SER A HB3  2  
ATOM 3605  H HG   . SER A 1 121 ? -28.919 9.707   -6.215  1.00 0.00 ? 121 SER A HG   2  
ATOM 3606  N N    . GLY A 1 122 ? -24.964 11.530  -8.021  1.00 0.00 ? 122 GLY A N    2  
ATOM 3607  C CA   . GLY A 1 122 ? -23.788 11.722  -8.849  1.00 0.00 ? 122 GLY A CA   2  
ATOM 3608  C C    . GLY A 1 122 ? -24.025 11.326  -10.293 1.00 0.00 ? 122 GLY A C    2  
ATOM 3609  O O    . GLY A 1 122 ? -23.926 12.157  -11.196 1.00 0.00 ? 122 GLY A O    2  
ATOM 3610  H H    . GLY A 1 122 ? -25.473 12.307  -7.709  1.00 0.00 ? 122 GLY A H    2  
ATOM 3611  H HA2  . GLY A 1 122 ? -23.503 12.763  -8.814  1.00 0.00 ? 122 GLY A HA2  2  
ATOM 3612  H HA3  . GLY A 1 122 ? -22.981 11.125  -8.452  1.00 0.00 ? 122 GLY A HA3  2  
ATOM 3613  N N    . GLY A 1 1   ? 23.239  50.156  -2.023  1.00 0.00 ? 1   GLY A N    3  
ATOM 3614  C CA   . GLY A 1 1   ? 23.402  49.215  -3.115  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3615  C C    . GLY A 1 1   ? 22.211  48.288  -3.264  1.00 0.00 ? 1   GLY A C    3  
ATOM 3616  O O    . GLY A 1 1   ? 21.711  47.746  -2.278  1.00 0.00 ? 1   GLY A O    3  
ATOM 3617  H H1   . GLY A 1 1   ? 23.606  51.062  -2.100  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3618  H HA2  . GLY A 1 1   ? 23.533  49.766  -4.034  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3619  H HA3  . GLY A 1 1   ? 24.285  48.620  -2.934  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3620  N N    . SER A 1 2   ? 21.756  48.107  -4.499  1.00 0.00 ? 2   SER A N    3  
ATOM 3621  C CA   . SER A 1 2   ? 20.613  47.244  -4.773  1.00 0.00 ? 2   SER A CA   3  
ATOM 3622  C C    . SER A 1 2   ? 20.970  45.779  -4.542  1.00 0.00 ? 2   SER A C    3  
ATOM 3623  O O    . SER A 1 2   ? 22.146  45.416  -4.489  1.00 0.00 ? 2   SER A O    3  
ATOM 3624  C CB   . SER A 1 2   ? 20.130  47.442  -6.211  1.00 0.00 ? 2   SER A CB   3  
ATOM 3625  O OG   . SER A 1 2   ? 19.839  48.805  -6.468  1.00 0.00 ? 2   SER A OG   3  
ATOM 3626  H H    . SER A 1 2   ? 22.197  48.567  -5.244  1.00 0.00 ? 2   SER A H    3  
ATOM 3627  H HA   . SER A 1 2   ? 19.819  47.520  -4.095  1.00 0.00 ? 2   SER A HA   3  
ATOM 3628  H HB2  . SER A 1 2   ? 20.899  47.116  -6.895  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3629  H HB3  . SER A 1 2   ? 19.235  46.858  -6.372  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3630  H HG   . SER A 1 2   ? 20.650  49.318  -6.434  1.00 0.00 ? 2   SER A HG   3  
ATOM 3631  N N    . SER A 1 3   ? 19.948  44.941  -4.406  1.00 0.00 ? 3   SER A N    3  
ATOM 3632  C CA   . SER A 1 3   ? 20.153  43.515  -4.177  1.00 0.00 ? 3   SER A CA   3  
ATOM 3633  C C    . SER A 1 3   ? 19.345  42.684  -5.168  1.00 0.00 ? 3   SER A C    3  
ATOM 3634  O O    . SER A 1 3   ? 19.867  41.763  -5.795  1.00 0.00 ? 3   SER A O    3  
ATOM 3635  C CB   . SER A 1 3   ? 19.760  43.146  -2.745  1.00 0.00 ? 3   SER A CB   3  
ATOM 3636  O OG   . SER A 1 3   ? 18.409  43.483  -2.483  1.00 0.00 ? 3   SER A OG   3  
ATOM 3637  H H    . SER A 1 3   ? 19.033  45.290  -4.458  1.00 0.00 ? 3   SER A H    3  
ATOM 3638  H HA   . SER A 1 3   ? 21.202  43.304  -4.319  1.00 0.00 ? 3   SER A HA   3  
ATOM 3639  H HB2  . SER A 1 3   ? 19.888  42.084  -2.602  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3640  H HB3  . SER A 1 3   ? 20.393  43.681  -2.052  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3641  H HG   . SER A 1 3   ? 17.900  42.681  -2.344  1.00 0.00 ? 3   SER A HG   3  
ATOM 3642  N N    . GLY A 1 4   ? 18.064  43.016  -5.305  1.00 0.00 ? 4   GLY A N    3  
ATOM 3643  C CA   . GLY A 1 4   ? 17.203  42.292  -6.221  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3644  C C    . GLY A 1 4   ? 16.419  41.192  -5.532  1.00 0.00 ? 4   GLY A C    3  
ATOM 3645  O O    . GLY A 1 4   ? 16.072  41.310  -4.357  1.00 0.00 ? 4   GLY A O    3  
ATOM 3646  H H    . GLY A 1 4   ? 17.702  43.760  -4.779  1.00 0.00 ? 4   GLY A H    3  
ATOM 3647  H HA2  . GLY A 1 4   ? 16.510  42.986  -6.672  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3648  H HA3  . GLY A 1 4   ? 17.812  41.851  -6.997  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3649  N N    . SER A 1 5   ? 16.137  40.120  -6.266  1.00 0.00 ? 5   SER A N    3  
ATOM 3650  C CA   . SER A 1 5   ? 15.383  38.997  -5.720  1.00 0.00 ? 5   SER A CA   3  
ATOM 3651  C C    . SER A 1 5   ? 15.924  37.672  -6.249  1.00 0.00 ? 5   SER A C    3  
ATOM 3652  O O    . SER A 1 5   ? 16.208  37.536  -7.439  1.00 0.00 ? 5   SER A O    3  
ATOM 3653  C CB   . SER A 1 5   ? 13.900  39.132  -6.071  1.00 0.00 ? 5   SER A CB   3  
ATOM 3654  O OG   . SER A 1 5   ? 13.716  39.247  -7.471  1.00 0.00 ? 5   SER A OG   3  
ATOM 3655  H H    . SER A 1 5   ? 16.441  40.085  -7.197  1.00 0.00 ? 5   SER A H    3  
ATOM 3656  H HA   . SER A 1 5   ? 15.494  39.015  -4.646  1.00 0.00 ? 5   SER A HA   3  
ATOM 3657  H HB2  . SER A 1 5   ? 13.369  38.261  -5.720  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3658  H HB3  . SER A 1 5   ? 13.499  40.015  -5.593  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3659  H HG   . SER A 1 5   ? 12.913  39.742  -7.649  1.00 0.00 ? 5   SER A HG   3  
ATOM 3660  N N    . SER A 1 6   ? 16.063  36.698  -5.355  1.00 0.00 ? 6   SER A N    3  
ATOM 3661  C CA   . SER A 1 6   ? 16.573  35.384  -5.729  1.00 0.00 ? 6   SER A CA   3  
ATOM 3662  C C    . SER A 1 6   ? 16.496  34.416  -4.553  1.00 0.00 ? 6   SER A C    3  
ATOM 3663  O O    . SER A 1 6   ? 17.128  34.627  -3.518  1.00 0.00 ? 6   SER A O    3  
ATOM 3664  C CB   . SER A 1 6   ? 18.018  35.496  -6.219  1.00 0.00 ? 6   SER A CB   3  
ATOM 3665  O OG   . SER A 1 6   ? 18.889  35.857  -5.161  1.00 0.00 ? 6   SER A OG   3  
ATOM 3666  H H    . SER A 1 6   ? 15.819  36.869  -4.421  1.00 0.00 ? 6   SER A H    3  
ATOM 3667  H HA   . SER A 1 6   ? 15.958  35.006  -6.532  1.00 0.00 ? 6   SER A HA   3  
ATOM 3668  H HB2  . SER A 1 6   ? 18.334  34.544  -6.620  1.00 0.00 ? 6   SER A HB2  3  
ATOM 3669  H HB3  . SER A 1 6   ? 18.077  36.249  -6.992  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3670  H HG   . SER A 1 6   ? 19.205  36.753  -5.299  1.00 0.00 ? 6   SER A HG   3  
ATOM 3671  N N    . GLY A 1 7   ? 15.716  33.352  -4.720  1.00 0.00 ? 7   GLY A N    3  
ATOM 3672  C CA   . GLY A 1 7   ? 15.570  32.367  -3.664  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3673  C C    . GLY A 1 7   ? 15.050  31.039  -4.179  1.00 0.00 ? 7   GLY A C    3  
ATOM 3674  O O    . GLY A 1 7   ? 13.866  30.905  -4.489  1.00 0.00 ? 7   GLY A O    3  
ATOM 3675  H H    . GLY A 1 7   ? 15.236  33.236  -5.566  1.00 0.00 ? 7   GLY A H    3  
ATOM 3676  H HA2  . GLY A 1 7   ? 16.531  32.209  -3.198  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3677  H HA3  . GLY A 1 7   ? 14.880  32.748  -2.925  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3678  N N    . THR A 1 8   ? 15.937  30.054  -4.272  1.00 0.00 ? 8   THR A N    3  
ATOM 3679  C CA   . THR A 1 8   ? 15.563  28.731  -4.755  1.00 0.00 ? 8   THR A CA   3  
ATOM 3680  C C    . THR A 1 8   ? 14.445  28.133  -3.909  1.00 0.00 ? 8   THR A C    3  
ATOM 3681  O O    . THR A 1 8   ? 14.633  27.847  -2.725  1.00 0.00 ? 8   THR A O    3  
ATOM 3682  C CB   . THR A 1 8   ? 16.766  27.769  -4.750  1.00 0.00 ? 8   THR A CB   3  
ATOM 3683  O OG1  . THR A 1 8   ? 17.934  28.443  -5.232  1.00 0.00 ? 8   THR A OG1  3  
ATOM 3684  C CG2  . THR A 1 8   ? 16.486  26.548  -5.612  1.00 0.00 ? 8   THR A CG2  3  
ATOM 3685  H H    . THR A 1 8   ? 16.866  30.222  -4.009  1.00 0.00 ? 8   THR A H    3  
ATOM 3686  H HA   . THR A 1 8   ? 15.215  28.834  -5.773  1.00 0.00 ? 8   THR A HA   3  
ATOM 3687  H HB   . THR A 1 8   ? 16.941  27.442  -3.735  1.00 0.00 ? 8   THR A HB   3  
ATOM 3688  H HG1  . THR A 1 8   ? 18.538  27.802  -5.613  1.00 0.00 ? 8   THR A HG1  3  
ATOM 3689  H HG21 . THR A 1 8   ? 16.879  26.711  -6.605  1.00 0.00 ? 8   THR A HG21 3  
ATOM 3690  H HG22 . THR A 1 8   ? 15.420  26.383  -5.669  1.00 0.00 ? 8   THR A HG22 3  
ATOM 3691  H HG23 . THR A 1 8   ? 16.962  25.683  -5.175  1.00 0.00 ? 8   THR A HG23 3  
ATOM 3692  N N    . LEU A 1 9   ? 13.281  27.945  -4.522  1.00 0.00 ? 9   LEU A N    3  
ATOM 3693  C CA   . LEU A 1 9   ? 12.132  27.379  -3.824  1.00 0.00 ? 9   LEU A CA   3  
ATOM 3694  C C    . LEU A 1 9   ? 12.402  25.936  -3.410  1.00 0.00 ? 9   LEU A C    3  
ATOM 3695  O O    . LEU A 1 9   ? 12.728  25.090  -4.244  1.00 0.00 ? 9   LEU A O    3  
ATOM 3696  C CB   . LEU A 1 9   ? 10.889  27.442  -4.714  1.00 0.00 ? 9   LEU A CB   3  
ATOM 3697  C CG   . LEU A 1 9   ? 10.712  28.722  -5.531  1.00 0.00 ? 9   LEU A CG   3  
ATOM 3698  C CD1  . LEU A 1 9   ? 9.437   28.657  -6.356  1.00 0.00 ? 9   LEU A CD1  3  
ATOM 3699  C CD2  . LEU A 1 9   ? 10.697  29.940  -4.618  1.00 0.00 ? 9   LEU A CD2  3  
ATOM 3700  H H    . LEU A 1 9   ? 13.192  28.191  -5.466  1.00 0.00 ? 9   LEU A H    3  
ATOM 3701  H HA   . LEU A 1 9   ? 11.960  27.969  -2.936  1.00 0.00 ? 9   LEU A HA   3  
ATOM 3702  H HB2  . LEU A 1 9   ? 10.934  26.613  -5.404  1.00 0.00 ? 9   LEU A HB2  3  
ATOM 3703  H HB3  . LEU A 1 9   ? 10.022  27.332  -4.077  1.00 0.00 ? 9   LEU A HB3  3  
ATOM 3704  H HG   . LEU A 1 9   ? 11.546  28.824  -6.212  1.00 0.00 ? 9   LEU A HG   3  
ATOM 3705  H HD11 . LEU A 1 9   ? 9.659   28.910  -7.382  1.00 0.00 ? 9   LEU A HD11 3  
ATOM 3706  H HD12 . LEU A 1 9   ? 8.716   29.357  -5.961  1.00 0.00 ? 9   LEU A HD12 3  
ATOM 3707  H HD13 . LEU A 1 9   ? 9.030   27.658  -6.311  1.00 0.00 ? 9   LEU A HD13 3  
ATOM 3708  H HD21 . LEU A 1 9   ? 11.695  30.347  -4.545  1.00 0.00 ? 9   LEU A HD21 3  
ATOM 3709  H HD22 . LEU A 1 9   ? 10.355  29.648  -3.635  1.00 0.00 ? 9   LEU A HD22 3  
ATOM 3710  H HD23 . LEU A 1 9   ? 10.032  30.686  -5.025  1.00 0.00 ? 9   LEU A HD23 3  
ATOM 3711  N N    . THR A 1 10  ? 12.262  25.660  -2.117  1.00 0.00 ? 10  THR A N    3  
ATOM 3712  C CA   . THR A 1 10  ? 12.490  24.320  -1.592  1.00 0.00 ? 10  THR A CA   3  
ATOM 3713  C C    . THR A 1 10  ? 12.036  24.213  -0.141  1.00 0.00 ? 10  THR A C    3  
ATOM 3714  O O    . THR A 1 10  ? 12.059  25.195  0.601   1.00 0.00 ? 10  THR A O    3  
ATOM 3715  C CB   . THR A 1 10  ? 13.977  23.926  -1.683  1.00 0.00 ? 10  THR A CB   3  
ATOM 3716  O OG1  . THR A 1 10  ? 14.146  22.559  -1.294  1.00 0.00 ? 10  THR A OG1  3  
ATOM 3717  C CG2  . THR A 1 10  ? 14.829  24.821  -0.796  1.00 0.00 ? 10  THR A CG2  3  
ATOM 3718  H H    . THR A 1 10  ? 12.000  26.377  -1.503  1.00 0.00 ? 10  THR A H    3  
ATOM 3719  H HA   . THR A 1 10  ? 11.918  23.625  -2.191  1.00 0.00 ? 10  THR A HA   3  
ATOM 3720  H HB   . THR A 1 10  ? 14.303  24.044  -2.707  1.00 0.00 ? 10  THR A HB   3  
ATOM 3721  H HG1  . THR A 1 10  ? 14.048  22.483  -0.341  1.00 0.00 ? 10  THR A HG1  3  
ATOM 3722  H HG21 . THR A 1 10  ? 14.523  25.849  -0.922  1.00 0.00 ? 10  THR A HG21 3  
ATOM 3723  H HG22 . THR A 1 10  ? 15.868  24.717  -1.072  1.00 0.00 ? 10  THR A HG22 3  
ATOM 3724  H HG23 . THR A 1 10  ? 14.700  24.531  0.236   1.00 0.00 ? 10  THR A HG23 3  
ATOM 3725  N N    . VAL A 1 11  ? 11.623  23.014  0.258   1.00 0.00 ? 11  VAL A N    3  
ATOM 3726  C CA   . VAL A 1 11  ? 11.165  22.778  1.622   1.00 0.00 ? 11  VAL A CA   3  
ATOM 3727  C C    . VAL A 1 11  ? 11.549  21.382  2.097   1.00 0.00 ? 11  VAL A C    3  
ATOM 3728  O O    . VAL A 1 11  ? 11.432  20.408  1.354   1.00 0.00 ? 11  VAL A O    3  
ATOM 3729  C CB   . VAL A 1 11  ? 9.638   22.946  1.738   1.00 0.00 ? 11  VAL A CB   3  
ATOM 3730  C CG1  . VAL A 1 11  ? 9.234   24.381  1.436   1.00 0.00 ? 11  VAL A CG1  3  
ATOM 3731  C CG2  . VAL A 1 11  ? 8.924   21.975  0.809   1.00 0.00 ? 11  VAL A CG2  3  
ATOM 3732  H H    . VAL A 1 11  ? 11.628  22.270  -0.380  1.00 0.00 ? 11  VAL A H    3  
ATOM 3733  H HA   . VAL A 1 11  ? 11.636  23.509  2.263   1.00 0.00 ? 11  VAL A HA   3  
ATOM 3734  H HB   . VAL A 1 11  ? 9.347   22.719  2.753   1.00 0.00 ? 11  VAL A HB   3  
ATOM 3735  H HG11 . VAL A 1 11  ? 9.764   24.727  0.561   1.00 0.00 ? 11  VAL A HG11 3  
ATOM 3736  H HG12 . VAL A 1 11  ? 8.170   24.425  1.255   1.00 0.00 ? 11  VAL A HG12 3  
ATOM 3737  H HG13 . VAL A 1 11  ? 9.482   25.009  2.279   1.00 0.00 ? 11  VAL A HG13 3  
ATOM 3738  H HG21 . VAL A 1 11  ? 8.857   21.008  1.283   1.00 0.00 ? 11  VAL A HG21 3  
ATOM 3739  H HG22 . VAL A 1 11  ? 7.930   22.343  0.599   1.00 0.00 ? 11  VAL A HG22 3  
ATOM 3740  H HG23 . VAL A 1 11  ? 9.477   21.887  -0.114  1.00 0.00 ? 11  VAL A HG23 3  
ATOM 3741  N N    . ASN A 1 12  ? 12.009  21.292  3.341   1.00 0.00 ? 12  ASN A N    3  
ATOM 3742  C CA   . ASN A 1 12  ? 12.412  20.013  3.917   1.00 0.00 ? 12  ASN A CA   3  
ATOM 3743  C C    . ASN A 1 12  ? 11.681  19.755  5.231   1.00 0.00 ? 12  ASN A C    3  
ATOM 3744  O O    . ASN A 1 12  ? 11.511  20.659  6.047   1.00 0.00 ? 12  ASN A O    3  
ATOM 3745  C CB   . ASN A 1 12  ? 13.924  19.988  4.147   1.00 0.00 ? 12  ASN A CB   3  
ATOM 3746  C CG   . ASN A 1 12  ? 14.486  21.363  4.449   1.00 0.00 ? 12  ASN A CG   3  
ATOM 3747  O OD1  . ASN A 1 12  ? 14.830  22.119  3.541   1.00 0.00 ? 12  ASN A OD1  3  
ATOM 3748  N ND2  . ASN A 1 12  ? 14.583  21.694  5.732   1.00 0.00 ? 12  ASN A ND2  3  
ATOM 3749  H H    . ASN A 1 12  ? 12.080  22.104  3.885   1.00 0.00 ? 12  ASN A H    3  
ATOM 3750  H HA   . ASN A 1 12  ? 12.150  19.237  3.214   1.00 0.00 ? 12  ASN A HA   3  
ATOM 3751  H HB2  . ASN A 1 12  ? 14.144  19.339  4.982   1.00 0.00 ? 12  ASN A HB2  3  
ATOM 3752  H HB3  . ASN A 1 12  ? 14.411  19.606  3.262   1.00 0.00 ? 12  ASN A HB3  3  
ATOM 3753  H HD21 . ASN A 1 12  ? 14.290  21.041  6.402   1.00 0.00 ? 12  ASN A HD21 3  
ATOM 3754  H HD22 . ASN A 1 12  ? 14.942  22.577  5.956   1.00 0.00 ? 12  ASN A HD22 3  
ATOM 3755  N N    . GLY A 1 13  ? 11.252  18.512  5.429   1.00 0.00 ? 13  GLY A N    3  
ATOM 3756  C CA   . GLY A 1 13  ? 10.546  18.156  6.645   1.00 0.00 ? 13  GLY A CA   3  
ATOM 3757  C C    . GLY A 1 13  ? 10.225  16.676  6.717   1.00 0.00 ? 13  GLY A C    3  
ATOM 3758  O O    . GLY A 1 13  ? 10.834  15.853  6.034   1.00 0.00 ? 13  GLY A O    3  
ATOM 3759  H H    . GLY A 1 13  ? 11.416  17.831  4.743   1.00 0.00 ? 13  GLY A H    3  
ATOM 3760  H HA2  . GLY A 1 13  ? 11.157  18.423  7.495   1.00 0.00 ? 13  GLY A HA2  3  
ATOM 3761  H HA3  . GLY A 1 13  ? 9.623   18.715  6.689   1.00 0.00 ? 13  GLY A HA3  3  
ATOM 3762  N N    . PRO A 1 14  ? 9.247   16.319  7.564   1.00 0.00 ? 14  PRO A N    3  
ATOM 3763  C CA   . PRO A 1 14  ? 8.825   14.927  7.744   1.00 0.00 ? 14  PRO A CA   3  
ATOM 3764  C C    . PRO A 1 14  ? 8.099   14.378  6.520   1.00 0.00 ? 14  PRO A C    3  
ATOM 3765  O O    . PRO A 1 14  ? 7.635   15.124  5.657   1.00 0.00 ? 14  PRO A O    3  
ATOM 3766  C CB   . PRO A 1 14  ? 7.875   14.996  8.942   1.00 0.00 ? 14  PRO A CB   3  
ATOM 3767  C CG   . PRO A 1 14  ? 7.358   16.393  8.935   1.00 0.00 ? 14  PRO A CG   3  
ATOM 3768  C CD   . PRO A 1 14  ? 8.479   17.247  8.410   1.00 0.00 ? 14  PRO A CD   3  
ATOM 3769  H HA   . PRO A 1 14  ? 9.661   14.286  7.982   1.00 0.00 ? 14  PRO A HA   3  
ATOM 3770  H HB2  . PRO A 1 14  ? 7.077   14.278  8.814   1.00 0.00 ? 14  PRO A HB2  3  
ATOM 3771  H HB3  . PRO A 1 14  ? 8.419   14.782  9.850   1.00 0.00 ? 14  PRO A HB3  3  
ATOM 3772  H HG2  . PRO A 1 14  ? 6.498   16.463  8.286   1.00 0.00 ? 14  PRO A HG2  3  
ATOM 3773  H HG3  . PRO A 1 14  ? 7.097   16.693  9.939   1.00 0.00 ? 14  PRO A HG3  3  
ATOM 3774  H HD2  . PRO A 1 14  ? 8.087   18.067  7.826   1.00 0.00 ? 14  PRO A HD2  3  
ATOM 3775  H HD3  . PRO A 1 14  ? 9.084   17.617  9.224   1.00 0.00 ? 14  PRO A HD3  3  
ATOM 3776  N N    . PRO A 1 15  ? 7.997   13.043  6.440   1.00 0.00 ? 15  PRO A N    3  
ATOM 3777  C CA   . PRO A 1 15  ? 7.328   12.366  5.326   1.00 0.00 ? 15  PRO A CA   3  
ATOM 3778  C C    . PRO A 1 15  ? 5.818   12.578  5.341   1.00 0.00 ? 15  PRO A C    3  
ATOM 3779  O O    . PRO A 1 15  ? 5.165   12.381  6.366   1.00 0.00 ? 15  PRO A O    3  
ATOM 3780  C CB   . PRO A 1 15  ? 7.663   10.890  5.556   1.00 0.00 ? 15  PRO A CB   3  
ATOM 3781  C CG   . PRO A 1 15  ? 7.915   10.782  7.020   1.00 0.00 ? 15  PRO A CG   3  
ATOM 3782  C CD   . PRO A 1 15  ? 8.527   12.093  7.432   1.00 0.00 ? 15  PRO A CD   3  
ATOM 3783  H HA   . PRO A 1 15  ? 7.725   12.682  4.373   1.00 0.00 ? 15  PRO A HA   3  
ATOM 3784  H HB2  . PRO A 1 15  ? 6.826   10.277  5.253   1.00 0.00 ? 15  PRO A HB2  3  
ATOM 3785  H HB3  . PRO A 1 15  ? 8.538   10.622  4.984   1.00 0.00 ? 15  PRO A HB3  3  
ATOM 3786  H HG2  . PRO A 1 15  ? 6.985   10.622  7.543   1.00 0.00 ? 15  PRO A HG2  3  
ATOM 3787  H HG3  . PRO A 1 15  ? 8.601   9.971   7.216   1.00 0.00 ? 15  PRO A HG3  3  
ATOM 3788  H HD2  . PRO A 1 15  ? 8.211   12.360  8.430   1.00 0.00 ? 15  PRO A HD2  3  
ATOM 3789  H HD3  . PRO A 1 15  ? 9.605   12.040  7.377   1.00 0.00 ? 15  PRO A HD3  3  
ATOM 3790  N N    . ILE A 1 16  ? 5.270   12.980  4.199   1.00 0.00 ? 16  ILE A N    3  
ATOM 3791  C CA   . ILE A 1 16  ? 3.837   13.218  4.082   1.00 0.00 ? 16  ILE A CA   3  
ATOM 3792  C C    . ILE A 1 16  ? 3.204   12.272  3.067   1.00 0.00 ? 16  ILE A C    3  
ATOM 3793  O O    . ILE A 1 16  ? 3.415   12.408  1.862   1.00 0.00 ? 16  ILE A O    3  
ATOM 3794  C CB   . ILE A 1 16  ? 3.539   14.671  3.668   1.00 0.00 ? 16  ILE A CB   3  
ATOM 3795  C CG1  . ILE A 1 16  ? 4.250   15.648  4.607   1.00 0.00 ? 16  ILE A CG1  3  
ATOM 3796  C CG2  . ILE A 1 16  ? 2.039   14.924  3.668   1.00 0.00 ? 16  ILE A CG2  3  
ATOM 3797  C CD1  . ILE A 1 16  ? 4.594   16.969  3.956   1.00 0.00 ? 16  ILE A CD1  3  
ATOM 3798  H H    . ILE A 1 16  ? 5.844   13.120  3.417   1.00 0.00 ? 16  ILE A H    3  
ATOM 3799  H HA   . ILE A 1 16  ? 3.390   13.041  5.050   1.00 0.00 ? 16  ILE A HA   3  
ATOM 3800  H HB   . ILE A 1 16  ? 3.905   14.817  2.663   1.00 0.00 ? 16  ILE A HB   3  
ATOM 3801  H HG12 . ILE A 1 16  ? 3.613   15.852  5.453   1.00 0.00 ? 16  ILE A HG12 3  
ATOM 3802  H HG13 . ILE A 1 16  ? 5.169   15.198  4.953   1.00 0.00 ? 16  ILE A HG13 3  
ATOM 3803  H HG21 . ILE A 1 16  ? 1.517   13.994  3.838   1.00 0.00 ? 16  ILE A HG21 3  
ATOM 3804  H HG22 . ILE A 1 16  ? 1.792   15.623  4.453   1.00 0.00 ? 16  ILE A HG22 3  
ATOM 3805  H HG23 . ILE A 1 16  ? 1.743   15.335  2.714   1.00 0.00 ? 16  ILE A HG23 3  
ATOM 3806  H HD11 . ILE A 1 16  ? 5.618   17.226  4.181   1.00 0.00 ? 16  ILE A HD11 3  
ATOM 3807  H HD12 . ILE A 1 16  ? 4.469   16.888  2.887   1.00 0.00 ? 16  ILE A HD12 3  
ATOM 3808  H HD13 . ILE A 1 16  ? 3.938   17.739  4.337   1.00 0.00 ? 16  ILE A HD13 3  
ATOM 3809  N N    . ILE A 1 17  ? 2.428   11.314  3.563   1.00 0.00 ? 17  ILE A N    3  
ATOM 3810  C CA   . ILE A 1 17  ? 1.762   10.347  2.699   1.00 0.00 ? 17  ILE A CA   3  
ATOM 3811  C C    . ILE A 1 17  ? 0.344   10.795  2.364   1.00 0.00 ? 17  ILE A C    3  
ATOM 3812  O O    . ILE A 1 17  ? -0.563  10.690  3.189   1.00 0.00 ? 17  ILE A O    3  
ATOM 3813  C CB   . ILE A 1 17  ? 1.707   8.953   3.352   1.00 0.00 ? 17  ILE A CB   3  
ATOM 3814  C CG1  . ILE A 1 17  ? 3.113   8.493   3.743   1.00 0.00 ? 17  ILE A CG1  3  
ATOM 3815  C CG2  . ILE A 1 17  ? 1.059   7.952   2.408   1.00 0.00 ? 17  ILE A CG2  3  
ATOM 3816  C CD1  . ILE A 1 17  ? 3.127   7.482   4.867   1.00 0.00 ? 17  ILE A CD1  3  
ATOM 3817  H H    . ILE A 1 17  ? 2.299   11.257  4.533   1.00 0.00 ? 17  ILE A H    3  
ATOM 3818  H HA   . ILE A 1 17  ? 2.331   10.272  1.784   1.00 0.00 ? 17  ILE A HA   3  
ATOM 3819  H HB   . ILE A 1 17  ? 1.098   9.020   4.240   1.00 0.00 ? 17  ILE A HB   3  
ATOM 3820  H HG12 . ILE A 1 17  ? 3.589   8.042   2.886   1.00 0.00 ? 17  ILE A HG12 3  
ATOM 3821  H HG13 . ILE A 1 17  ? 3.689   9.351   4.059   1.00 0.00 ? 17  ILE A HG13 3  
ATOM 3822  H HG21 . ILE A 1 17  ? 0.440   8.477   1.695   1.00 0.00 ? 17  ILE A HG21 3  
ATOM 3823  H HG22 . ILE A 1 17  ? 1.827   7.405   1.882   1.00 0.00 ? 17  ILE A HG22 3  
ATOM 3824  H HG23 . ILE A 1 17  ? 0.451   7.263   2.975   1.00 0.00 ? 17  ILE A HG23 3  
ATOM 3825  H HD11 . ILE A 1 17  ? 3.181   7.997   5.815   1.00 0.00 ? 17  ILE A HD11 3  
ATOM 3826  H HD12 . ILE A 1 17  ? 2.227   6.888   4.830   1.00 0.00 ? 17  ILE A HD12 3  
ATOM 3827  H HD13 . ILE A 1 17  ? 3.988   6.837   4.760   1.00 0.00 ? 17  ILE A HD13 3  
ATOM 3828  N N    . SER A 1 18  ? 0.159   11.294  1.145   1.00 0.00 ? 18  SER A N    3  
ATOM 3829  C CA   . SER A 1 18  ? -1.149  11.760  0.700   1.00 0.00 ? 18  SER A CA   3  
ATOM 3830  C C    . SER A 1 18  ? -2.126  10.595  0.574   1.00 0.00 ? 18  SER A C    3  
ATOM 3831  O O    . SER A 1 18  ? -3.067  10.472  1.359   1.00 0.00 ? 18  SER A O    3  
ATOM 3832  C CB   . SER A 1 18  ? -1.026  12.485  -0.641  1.00 0.00 ? 18  SER A CB   3  
ATOM 3833  O OG   . SER A 1 18  ? -0.743  11.574  -1.690  1.00 0.00 ? 18  SER A OG   3  
ATOM 3834  H H    . SER A 1 18  ? 0.922   11.351  0.532   1.00 0.00 ? 18  SER A H    3  
ATOM 3835  H HA   . SER A 1 18  ? -1.524  12.451  1.440   1.00 0.00 ? 18  SER A HA   3  
ATOM 3836  H HB2  . SER A 1 18  ? -1.954  12.990  -0.861  1.00 0.00 ? 18  SER A HB2  3  
ATOM 3837  H HB3  . SER A 1 18  ? -0.226  13.209  -0.584  1.00 0.00 ? 18  SER A HB3  3  
ATOM 3838  H HG   . SER A 1 18  ? 0.194   11.365  -1.688  1.00 0.00 ? 18  SER A HG   3  
ATOM 3839  N N    . SER A 1 19  ? -1.897  9.743   -0.420  1.00 0.00 ? 19  SER A N    3  
ATOM 3840  C CA   . SER A 1 19  ? -2.758  8.590   -0.652  1.00 0.00 ? 19  SER A CA   3  
ATOM 3841  C C    . SER A 1 19  ? -2.200  7.711   -1.767  1.00 0.00 ? 19  SER A C    3  
ATOM 3842  O O    . SER A 1 19  ? -1.160  8.014   -2.352  1.00 0.00 ? 19  SER A O    3  
ATOM 3843  C CB   . SER A 1 19  ? -4.174  9.048   -1.009  1.00 0.00 ? 19  SER A CB   3  
ATOM 3844  O OG   . SER A 1 19  ? -4.951  9.257   0.158   1.00 0.00 ? 19  SER A OG   3  
ATOM 3845  H H    . SER A 1 19  ? -1.130  9.895   -1.012  1.00 0.00 ? 19  SER A H    3  
ATOM 3846  H HA   . SER A 1 19  ? -2.795  8.014   0.260   1.00 0.00 ? 19  SER A HA   3  
ATOM 3847  H HB2  . SER A 1 19  ? -4.121  9.973   -1.562  1.00 0.00 ? 19  SER A HB2  3  
ATOM 3848  H HB3  . SER A 1 19  ? -4.652  8.292   -1.615  1.00 0.00 ? 19  SER A HB3  3  
ATOM 3849  H HG   . SER A 1 19  ? -5.799  8.817   0.061   1.00 0.00 ? 19  SER A HG   3  
ATOM 3850  N N    . THR A 1 20  ? -2.900  6.618   -2.057  1.00 0.00 ? 20  THR A N    3  
ATOM 3851  C CA   . THR A 1 20  ? -2.476  5.693   -3.101  1.00 0.00 ? 20  THR A CA   3  
ATOM 3852  C C    . THR A 1 20  ? -3.220  5.956   -4.405  1.00 0.00 ? 20  THR A C    3  
ATOM 3853  O O    . THR A 1 20  ? -4.134  6.779   -4.452  1.00 0.00 ? 20  THR A O    3  
ATOM 3854  C CB   . THR A 1 20  ? -2.703  4.229   -2.680  1.00 0.00 ? 20  THR A CB   3  
ATOM 3855  O OG1  . THR A 1 20  ? -4.006  4.081   -2.105  1.00 0.00 ? 20  THR A OG1  3  
ATOM 3856  C CG2  . THR A 1 20  ? -1.647  3.784   -1.679  1.00 0.00 ? 20  THR A CG2  3  
ATOM 3857  H H    . THR A 1 20  ? -3.721  6.431   -1.556  1.00 0.00 ? 20  THR A H    3  
ATOM 3858  H HA   . THR A 1 20  ? -1.418  5.839   -3.265  1.00 0.00 ? 20  THR A HA   3  
ATOM 3859  H HB   . THR A 1 20  ? -2.632  3.603   -3.558  1.00 0.00 ? 20  THR A HB   3  
ATOM 3860  H HG1  . THR A 1 20  ? -4.004  4.434   -1.212  1.00 0.00 ? 20  THR A HG1  3  
ATOM 3861  H HG21 . THR A 1 20  ? -1.319  4.634   -1.100  1.00 0.00 ? 20  THR A HG21 3  
ATOM 3862  H HG22 . THR A 1 20  ? -0.806  3.361   -2.207  1.00 0.00 ? 20  THR A HG22 3  
ATOM 3863  H HG23 . THR A 1 20  ? -2.069  3.041   -1.019  1.00 0.00 ? 20  THR A HG23 3  
ATOM 3864  N N    . GLN A 1 21  ? -2.822  5.253   -5.460  1.00 0.00 ? 21  GLN A N    3  
ATOM 3865  C CA   . GLN A 1 21  ? -3.453  5.412   -6.765  1.00 0.00 ? 21  GLN A CA   3  
ATOM 3866  C C    . GLN A 1 21  ? -4.160  4.128   -7.188  1.00 0.00 ? 21  GLN A C    3  
ATOM 3867  O O    . GLN A 1 21  ? -5.377  4.110   -7.378  1.00 0.00 ? 21  GLN A O    3  
ATOM 3868  C CB   . GLN A 1 21  ? -2.411  5.803   -7.814  1.00 0.00 ? 21  GLN A CB   3  
ATOM 3869  C CG   . GLN A 1 21  ? -2.999  6.041   -9.196  1.00 0.00 ? 21  GLN A CG   3  
ATOM 3870  C CD   . GLN A 1 21  ? -3.537  4.772   -9.828  1.00 0.00 ? 21  GLN A CD   3  
ATOM 3871  O OE1  . GLN A 1 21  ? -2.786  3.836   -10.103 1.00 0.00 ? 21  GLN A OE1  3  
ATOM 3872  N NE2  . GLN A 1 21  ? -4.843  4.735   -10.061 1.00 0.00 ? 21  GLN A NE2  3  
ATOM 3873  H H    . GLN A 1 21  ? -2.088  4.613   -5.359  1.00 0.00 ? 21  GLN A H    3  
ATOM 3874  H HA   . GLN A 1 21  ? -4.185  6.201   -6.685  1.00 0.00 ? 21  GLN A HA   3  
ATOM 3875  H HB2  . GLN A 1 21  ? -1.919  6.709   -7.495  1.00 0.00 ? 21  GLN A HB2  3  
ATOM 3876  H HB3  . GLN A 1 21  ? -1.679  5.013   -7.890  1.00 0.00 ? 21  GLN A HB3  3  
ATOM 3877  H HG2  . GLN A 1 21  ? -3.807  6.753   -9.112  1.00 0.00 ? 21  GLN A HG2  3  
ATOM 3878  H HG3  . GLN A 1 21  ? -2.229  6.446   -9.835  1.00 0.00 ? 21  GLN A HG3  3  
ATOM 3879  H HE21 . GLN A 1 21  ? -5.379  5.519   -9.817  1.00 0.00 ? 21  GLN A HE21 3  
ATOM 3880  H HE22 . GLN A 1 21  ? -5.217  3.928   -10.470 1.00 0.00 ? 21  GLN A HE22 3  
ATOM 3881  N N    . THR A 1 22  ? -3.390  3.054   -7.333  1.00 0.00 ? 22  THR A N    3  
ATOM 3882  C CA   . THR A 1 22  ? -3.942  1.766   -7.735  1.00 0.00 ? 22  THR A CA   3  
ATOM 3883  C C    . THR A 1 22  ? -5.332  1.556   -7.145  1.00 0.00 ? 22  THR A C    3  
ATOM 3884  O O    . THR A 1 22  ? -6.335  1.635   -7.855  1.00 0.00 ? 22  THR A O    3  
ATOM 3885  C CB   . THR A 1 22  ? -3.031  0.604   -7.298  1.00 0.00 ? 22  THR A CB   3  
ATOM 3886  O OG1  . THR A 1 22  ? -1.712  0.791   -7.823  1.00 0.00 ? 22  THR A OG1  3  
ATOM 3887  C CG2  . THR A 1 22  ? -3.588  -0.729  -7.776  1.00 0.00 ? 22  THR A CG2  3  
ATOM 3888  H H    . THR A 1 22  ? -2.428  3.132   -7.166  1.00 0.00 ? 22  THR A H    3  
ATOM 3889  H HA   . THR A 1 22  ? -4.013  1.756   -8.813  1.00 0.00 ? 22  THR A HA   3  
ATOM 3890  H HB   . THR A 1 22  ? -2.982  0.591   -6.219  1.00 0.00 ? 22  THR A HB   3  
ATOM 3891  H HG1  . THR A 1 22  ? -1.760  1.307   -8.632  1.00 0.00 ? 22  THR A HG1  3  
ATOM 3892  H HG21 . THR A 1 22  ? -2.820  -1.270  -8.308  1.00 0.00 ? 22  THR A HG21 3  
ATOM 3893  H HG22 . THR A 1 22  ? -4.426  -0.554  -8.433  1.00 0.00 ? 22  THR A HG22 3  
ATOM 3894  H HG23 . THR A 1 22  ? -3.912  -1.309  -6.925  1.00 0.00 ? 22  THR A HG23 3  
ATOM 3895  N N    . GLN A 1 23  ? -5.385  1.290   -5.844  1.00 0.00 ? 23  GLN A N    3  
ATOM 3896  C CA   . GLN A 1 23  ? -6.653  1.069   -5.161  1.00 0.00 ? 23  GLN A CA   3  
ATOM 3897  C C    . GLN A 1 23  ? -7.616  0.279   -6.042  1.00 0.00 ? 23  GLN A C    3  
ATOM 3898  O O    . GLN A 1 23  ? -8.818  0.545   -6.059  1.00 0.00 ? 23  GLN A O    3  
ATOM 3899  C CB   . GLN A 1 23  ? -7.284  2.405   -4.766  1.00 0.00 ? 23  GLN A CB   3  
ATOM 3900  C CG   . GLN A 1 23  ? -6.839  2.908   -3.402  1.00 0.00 ? 23  GLN A CG   3  
ATOM 3901  C CD   . GLN A 1 23  ? -7.752  2.447   -2.284  1.00 0.00 ? 23  GLN A CD   3  
ATOM 3902  O OE1  . GLN A 1 23  ? -8.488  3.243   -1.699  1.00 0.00 ? 23  GLN A OE1  3  
ATOM 3903  N NE2  . GLN A 1 23  ? -7.710  1.155   -1.980  1.00 0.00 ? 23  GLN A NE2  3  
ATOM 3904  H H    . GLN A 1 23  ? -4.551  1.240   -5.333  1.00 0.00 ? 23  GLN A H    3  
ATOM 3905  H HA   . GLN A 1 23  ? -6.453  0.498   -4.267  1.00 0.00 ? 23  GLN A HA   3  
ATOM 3906  H HB2  . GLN A 1 23  ? -7.018  3.147   -5.504  1.00 0.00 ? 23  GLN A HB2  3  
ATOM 3907  H HB3  . GLN A 1 23  ? -8.358  2.292   -4.751  1.00 0.00 ? 23  GLN A HB3  3  
ATOM 3908  H HG2  . GLN A 1 23  ? -5.842  2.543   -3.206  1.00 0.00 ? 23  GLN A HG2  3  
ATOM 3909  H HG3  . GLN A 1 23  ? -6.829  3.988   -3.418  1.00 0.00 ? 23  GLN A HG3  3  
ATOM 3910  H HE21 . GLN A 1 23  ? -7.099  0.580   -2.487  1.00 0.00 ? 23  GLN A HE21 3  
ATOM 3911  H HE22 . GLN A 1 23  ? -8.289  0.830   -1.260  1.00 0.00 ? 23  GLN A HE22 3  
ATOM 3912  N N    . HIS A 1 24  ? -7.080  -0.693  -6.773  1.00 0.00 ? 24  HIS A N    3  
ATOM 3913  C CA   . HIS A 1 24  ? -7.892  -1.522  -7.657  1.00 0.00 ? 24  HIS A CA   3  
ATOM 3914  C C    . HIS A 1 24  ? -7.170  -2.822  -7.997  1.00 0.00 ? 24  HIS A C    3  
ATOM 3915  O O    . HIS A 1 24  ? -5.985  -2.817  -8.329  1.00 0.00 ? 24  HIS A O    3  
ATOM 3916  C CB   . HIS A 1 24  ? -8.227  -0.760  -8.939  1.00 0.00 ? 24  HIS A CB   3  
ATOM 3917  C CG   . HIS A 1 24  ? -7.210  -0.936  -10.024 1.00 0.00 ? 24  HIS A CG   3  
ATOM 3918  N ND1  . HIS A 1 24  ? -6.349  0.066   -10.419 1.00 0.00 ? 24  HIS A ND1  3  
ATOM 3919  C CD2  . HIS A 1 24  ? -6.916  -2.008  -10.797 1.00 0.00 ? 24  HIS A CD2  3  
ATOM 3920  C CE1  . HIS A 1 24  ? -5.572  -0.380  -11.389 1.00 0.00 ? 24  HIS A CE1  3  
ATOM 3921  N NE2  . HIS A 1 24  ? -5.896  -1.637  -11.637 1.00 0.00 ? 24  HIS A NE2  3  
ATOM 3922  H H    . HIS A 1 24  ? -6.115  -0.857  -6.716  1.00 0.00 ? 24  HIS A H    3  
ATOM 3923  H HA   . HIS A 1 24  ? -8.809  -1.759  -7.139  1.00 0.00 ? 24  HIS A HA   3  
ATOM 3924  H HB2  . HIS A 1 24  ? -9.178  -1.106  -9.317  1.00 0.00 ? 24  HIS A HB2  3  
ATOM 3925  H HB3  . HIS A 1 24  ? -8.296  0.295   -8.716  1.00 0.00 ? 24  HIS A HB3  3  
ATOM 3926  H HD1  . HIS A 1 24  ? -6.315  0.971   -10.045 1.00 0.00 ? 24  HIS A HD1  3  
ATOM 3927  H HD2  . HIS A 1 24  ? -7.396  -2.976  -10.761 1.00 0.00 ? 24  HIS A HD2  3  
ATOM 3928  H HE1  . HIS A 1 24  ? -4.803  0.185   -11.894 1.00 0.00 ? 24  HIS A HE1  3  
ATOM 3929  H HE2  . HIS A 1 24  ? -5.533  -2.179  -12.368 1.00 0.00 ? 24  HIS A HE2  3  
ATOM 3930  N N    . ALA A 1 25  ? -7.892  -3.934  -7.912  1.00 0.00 ? 25  ALA A N    3  
ATOM 3931  C CA   . ALA A 1 25  ? -7.321  -5.241  -8.213  1.00 0.00 ? 25  ALA A CA   3  
ATOM 3932  C C    . ALA A 1 25  ? -8.407  -6.240  -8.596  1.00 0.00 ? 25  ALA A C    3  
ATOM 3933  O O    . ALA A 1 25  ? -9.545  -6.144  -8.134  1.00 0.00 ? 25  ALA A O    3  
ATOM 3934  C CB   . ALA A 1 25  ? -6.525  -5.755  -7.022  1.00 0.00 ? 25  ALA A CB   3  
ATOM 3935  H H    . ALA A 1 25  ? -8.832  -3.874  -7.642  1.00 0.00 ? 25  ALA A H    3  
ATOM 3936  H HA   . ALA A 1 25  ? -6.642  -5.125  -9.045  1.00 0.00 ? 25  ALA A HA   3  
ATOM 3937  H HB1  . ALA A 1 25  ? -7.204  -6.133  -6.272  1.00 0.00 ? 25  ALA A HB1  3  
ATOM 3938  H HB2  . ALA A 1 25  ? -5.867  -6.549  -7.345  1.00 0.00 ? 25  ALA A HB2  3  
ATOM 3939  H HB3  . ALA A 1 25  ? -5.939  -4.949  -6.606  1.00 0.00 ? 25  ALA A HB3  3  
ATOM 3940  N N    . LEU A 1 26  ? -8.050  -7.199  -9.444  1.00 0.00 ? 26  LEU A N    3  
ATOM 3941  C CA   . LEU A 1 26  ? -8.995  -8.216  -9.891  1.00 0.00 ? 26  LEU A CA   3  
ATOM 3942  C C    . LEU A 1 26  ? -8.546  -9.606  -9.452  1.00 0.00 ? 26  LEU A C    3  
ATOM 3943  O O    . LEU A 1 26  ? -7.455  -10.057 -9.802  1.00 0.00 ? 26  LEU A O    3  
ATOM 3944  C CB   . LEU A 1 26  ? -9.142  -8.171  -11.413 1.00 0.00 ? 26  LEU A CB   3  
ATOM 3945  C CG   . LEU A 1 26  ? -9.486  -6.808  -12.014 1.00 0.00 ? 26  LEU A CG   3  
ATOM 3946  C CD1  . LEU A 1 26  ? -9.392  -6.855  -13.531 1.00 0.00 ? 26  LEU A CD1  3  
ATOM 3947  C CD2  . LEU A 1 26  ? -10.876 -6.368  -11.577 1.00 0.00 ? 26  LEU A CD2  3  
ATOM 3948  H H    . LEU A 1 26  ? -7.130  -7.224  -9.778  1.00 0.00 ? 26  LEU A H    3  
ATOM 3949  H HA   . LEU A 1 26  ? -9.952  -8.001  -9.438  1.00 0.00 ? 26  LEU A HA   3  
ATOM 3950  H HB2  . LEU A 1 26  ? -8.208  -8.496  -11.844 1.00 0.00 ? 26  LEU A HB2  3  
ATOM 3951  H HB3  . LEU A 1 26  ? -9.925  -8.863  -11.689 1.00 0.00 ? 26  LEU A HB3  3  
ATOM 3952  H HG   . LEU A 1 26  ? -8.775  -6.075  -11.659 1.00 0.00 ? 26  LEU A HG   3  
ATOM 3953  H HD11 . LEU A 1 26  ? -8.686  -7.616  -13.825 1.00 0.00 ? 26  LEU A HD11 3  
ATOM 3954  H HD12 . LEU A 1 26  ? -9.062  -5.895  -13.901 1.00 0.00 ? 26  LEU A HD12 3  
ATOM 3955  H HD13 . LEU A 1 26  ? -10.363 -7.085  -13.945 1.00 0.00 ? 26  LEU A HD13 3  
ATOM 3956  H HD21 . LEU A 1 26  ? -10.885 -5.298  -11.432 1.00 0.00 ? 26  LEU A HD21 3  
ATOM 3957  H HD22 . LEU A 1 26  ? -11.134 -6.859  -10.649 1.00 0.00 ? 26  LEU A HD22 3  
ATOM 3958  H HD23 . LEU A 1 26  ? -11.594 -6.635  -12.338 1.00 0.00 ? 26  LEU A HD23 3  
ATOM 3959  N N    . HIS A 1 27  ? -9.396  -10.283 -8.686  1.00 0.00 ? 27  HIS A N    3  
ATOM 3960  C CA   . HIS A 1 27  ? -9.088  -11.624 -8.202  1.00 0.00 ? 27  HIS A CA   3  
ATOM 3961  C C    . HIS A 1 27  ? -8.391  -12.445 -9.282  1.00 0.00 ? 27  HIS A C    3  
ATOM 3962  O O    . HIS A 1 27  ? -9.038  -12.998 -10.170 1.00 0.00 ? 27  HIS A O    3  
ATOM 3963  C CB   . HIS A 1 27  ? -10.366 -12.332 -7.751  1.00 0.00 ? 27  HIS A CB   3  
ATOM 3964  C CG   . HIS A 1 27  ? -11.285 -12.684 -8.880  1.00 0.00 ? 27  HIS A CG   3  
ATOM 3965  N ND1  . HIS A 1 27  ? -12.217 -11.808 -9.393  1.00 0.00 ? 27  HIS A ND1  3  
ATOM 3966  C CD2  . HIS A 1 27  ? -11.410 -13.826 -9.597  1.00 0.00 ? 27  HIS A CD2  3  
ATOM 3967  C CE1  . HIS A 1 27  ? -12.878 -12.395 -10.375 1.00 0.00 ? 27  HIS A CE1  3  
ATOM 3968  N NE2  . HIS A 1 27  ? -12.406 -13.620 -10.520 1.00 0.00 ? 27  HIS A NE2  3  
ATOM 3969  H H    . HIS A 1 27  ? -10.250 -9.870  -8.440  1.00 0.00 ? 27  HIS A H    3  
ATOM 3970  H HA   . HIS A 1 27  ? -8.424  -11.527 -7.356  1.00 0.00 ? 27  HIS A HA   3  
ATOM 3971  H HB2  . HIS A 1 27  ? -10.101 -13.247 -7.242  1.00 0.00 ? 27  HIS A HB2  3  
ATOM 3972  H HB3  . HIS A 1 27  ? -10.906 -11.690 -7.071  1.00 0.00 ? 27  HIS A HB3  3  
ATOM 3973  H HD1  . HIS A 1 27  ? -12.373 -10.892 -9.082  1.00 0.00 ? 27  HIS A HD1  3  
ATOM 3974  H HD2  . HIS A 1 27  ? -10.833 -14.731 -9.468  1.00 0.00 ? 27  HIS A HD2  3  
ATOM 3975  H HE1  . HIS A 1 27  ? -13.667 -11.949 -10.961 1.00 0.00 ? 27  HIS A HE1  3  
ATOM 3976  H HE2  . HIS A 1 27  ? -12.777 -14.300 -11.120 1.00 0.00 ? 27  HIS A HE2  3  
ATOM 3977  N N    . GLY A 1 28  ? -7.066  -12.518 -9.201  1.00 0.00 ? 28  GLY A N    3  
ATOM 3978  C CA   . GLY A 1 28  ? -6.303  -13.272 -10.178 1.00 0.00 ? 28  GLY A CA   3  
ATOM 3979  C C    . GLY A 1 28  ? -4.954  -12.645 -10.471 1.00 0.00 ? 28  GLY A C    3  
ATOM 3980  O O    . GLY A 1 28  ? -3.938  -13.337 -10.517 1.00 0.00 ? 28  GLY A O    3  
ATOM 3981  H H    . GLY A 1 28  ? -6.602  -12.056 -8.471  1.00 0.00 ? 28  GLY A H    3  
ATOM 3982  H HA2  . GLY A 1 28  ? -6.149  -14.273 -9.804  1.00 0.00 ? 28  GLY A HA2  3  
ATOM 3983  H HA3  . GLY A 1 28  ? -6.869  -13.325 -11.096 1.00 0.00 ? 28  GLY A HA3  3  
ATOM 3984  N N    . GLU A 1 29  ? -4.945  -11.330 -10.670 1.00 0.00 ? 29  GLU A N    3  
ATOM 3985  C CA   . GLU A 1 29  ? -3.711  -10.611 -10.962 1.00 0.00 ? 29  GLU A CA   3  
ATOM 3986  C C    . GLU A 1 29  ? -3.036  -10.145 -9.676  1.00 0.00 ? 29  GLU A C    3  
ATOM 3987  O O    . GLU A 1 29  ? -3.580  -10.301 -8.583  1.00 0.00 ? 29  GLU A O    3  
ATOM 3988  C CB   . GLU A 1 29  ? -3.997  -9.410  -11.866 1.00 0.00 ? 29  GLU A CB   3  
ATOM 3989  C CG   . GLU A 1 29  ? -5.059  -8.473  -11.316 1.00 0.00 ? 29  GLU A CG   3  
ATOM 3990  C CD   . GLU A 1 29  ? -4.930  -7.062  -11.856 1.00 0.00 ? 29  GLU A CD   3  
ATOM 3991  O OE1  . GLU A 1 29  ? -3.897  -6.415  -11.585 1.00 0.00 ? 29  GLU A OE1  3  
ATOM 3992  O OE2  . GLU A 1 29  ? -5.863  -6.605  -12.549 1.00 0.00 ? 29  GLU A OE2  3  
ATOM 3993  H H    . GLU A 1 29  ? -5.788  -10.833 -10.620 1.00 0.00 ? 29  GLU A H    3  
ATOM 3994  H HA   . GLU A 1 29  ? -3.047  -11.288 -11.478 1.00 0.00 ? 29  GLU A HA   3  
ATOM 3995  H HB2  . GLU A 1 29  ? -3.084  -8.848  -11.997 1.00 0.00 ? 29  GLU A HB2  3  
ATOM 3996  H HB3  . GLU A 1 29  ? -4.328  -9.770  -12.829 1.00 0.00 ? 29  GLU A HB3  3  
ATOM 3997  H HG2  . GLU A 1 29  ? -6.033  -8.856  -11.584 1.00 0.00 ? 29  GLU A HG2  3  
ATOM 3998  H HG3  . GLU A 1 29  ? -4.971  -8.441  -10.240 1.00 0.00 ? 29  GLU A HG3  3  
ATOM 3999  N N    . LYS A 1 30  ? -1.845  -9.572  -9.814  1.00 0.00 ? 30  LYS A N    3  
ATOM 4000  C CA   . LYS A 1 30  ? -1.093  -9.081  -8.665  1.00 0.00 ? 30  LYS A CA   3  
ATOM 4001  C C    . LYS A 1 30  ? -1.680  -7.771  -8.151  1.00 0.00 ? 30  LYS A C    3  
ATOM 4002  O O    . LYS A 1 30  ? -1.561  -6.730  -8.796  1.00 0.00 ? 30  LYS A O    3  
ATOM 4003  C CB   . LYS A 1 30  ? 0.378   -8.882  -9.039  1.00 0.00 ? 30  LYS A CB   3  
ATOM 4004  C CG   . LYS A 1 30  ? 1.087   -10.169 -9.422  1.00 0.00 ? 30  LYS A CG   3  
ATOM 4005  C CD   . LYS A 1 30  ? 2.570   -10.107 -9.096  1.00 0.00 ? 30  LYS A CD   3  
ATOM 4006  C CE   . LYS A 1 30  ? 3.268   -11.419 -9.419  1.00 0.00 ? 30  LYS A CE   3  
ATOM 4007  N NZ   . LYS A 1 30  ? 3.775   -11.447 -10.820 1.00 0.00 ? 30  LYS A NZ   3  
ATOM 4008  H H    . LYS A 1 30  ? -1.462  -9.476  -10.712 1.00 0.00 ? 30  LYS A H    3  
ATOM 4009  H HA   . LYS A 1 30  ? -1.160  -9.823  -7.884  1.00 0.00 ? 30  LYS A HA   3  
ATOM 4010  H HB2  . LYS A 1 30  ? 0.435   -8.201  -9.876  1.00 0.00 ? 30  LYS A HB2  3  
ATOM 4011  H HB3  . LYS A 1 30  ? 0.895   -8.447  -8.196  1.00 0.00 ? 30  LYS A HB3  3  
ATOM 4012  H HG2  . LYS A 1 30  ? 0.645   -10.990 -8.878  1.00 0.00 ? 30  LYS A HG2  3  
ATOM 4013  H HG3  . LYS A 1 30  ? 0.968   -10.333 -10.484 1.00 0.00 ? 30  LYS A HG3  3  
ATOM 4014  H HD2  . LYS A 1 30  ? 3.025   -9.318  -9.676  1.00 0.00 ? 30  LYS A HD2  3  
ATOM 4015  H HD3  . LYS A 1 30  ? 2.689   -9.895  -8.043  1.00 0.00 ? 30  LYS A HD3  3  
ATOM 4016  H HE2  . LYS A 1 30  ? 4.099   -11.546 -8.743  1.00 0.00 ? 30  LYS A HE2  3  
ATOM 4017  H HE3  . LYS A 1 30  ? 2.566   -12.228 -9.283  1.00 0.00 ? 30  LYS A HE3  3  
ATOM 4018  H HZ1  . LYS A 1 30  ? 3.065   -11.044 -11.464 1.00 0.00 ? 30  LYS A HZ1  3  
ATOM 4019  H HZ2  . LYS A 1 30  ? 3.972   -12.426 -11.108 1.00 0.00 ? 30  LYS A HZ2  3  
ATOM 4020  H HZ3  . LYS A 1 30  ? 4.651   -10.892 -10.894 1.00 0.00 ? 30  LYS A HZ3  3  
ATOM 4021  N N    . GLY A 1 31  ? -2.312  -7.829  -6.982  1.00 0.00 ? 31  GLY A N    3  
ATOM 4022  C CA   . GLY A 1 31  ? -2.906  -6.639  -6.400  1.00 0.00 ? 31  GLY A CA   3  
ATOM 4023  C C    . GLY A 1 31  ? -1.866  -5.633  -5.949  1.00 0.00 ? 31  GLY A C    3  
ATOM 4024  O O    . GLY A 1 31  ? -1.515  -5.581  -4.771  1.00 0.00 ? 31  GLY A O    3  
ATOM 4025  H H    . GLY A 1 31  ? -2.375  -8.686  -6.512  1.00 0.00 ? 31  GLY A H    3  
ATOM 4026  H HA2  . GLY A 1 31  ? -3.547  -6.174  -7.134  1.00 0.00 ? 31  GLY A HA2  3  
ATOM 4027  H HA3  . GLY A 1 31  ? -3.502  -6.929  -5.548  1.00 0.00 ? 31  GLY A HA3  3  
ATOM 4028  N N    . GLN A 1 32  ? -1.371  -4.834  -6.889  1.00 0.00 ? 32  GLN A N    3  
ATOM 4029  C CA   . GLN A 1 32  ? -0.363  -3.827  -6.581  1.00 0.00 ? 32  GLN A CA   3  
ATOM 4030  C C    . GLN A 1 32  ? -0.991  -2.620  -5.891  1.00 0.00 ? 32  GLN A C    3  
ATOM 4031  O O    . GLN A 1 32  ? -2.188  -2.367  -6.032  1.00 0.00 ? 32  GLN A O    3  
ATOM 4032  C CB   . GLN A 1 32  ? 0.353   -3.383  -7.858  1.00 0.00 ? 32  GLN A CB   3  
ATOM 4033  C CG   . GLN A 1 32  ? 1.708   -2.743  -7.606  1.00 0.00 ? 32  GLN A CG   3  
ATOM 4034  C CD   . GLN A 1 32  ? 2.486   -2.500  -8.884  1.00 0.00 ? 32  GLN A CD   3  
ATOM 4035  O OE1  . GLN A 1 32  ? 2.740   -1.356  -9.262  1.00 0.00 ? 32  GLN A OE1  3  
ATOM 4036  N NE2  . GLN A 1 32  ? 2.870   -3.578  -9.557  1.00 0.00 ? 32  GLN A NE2  3  
ATOM 4037  H H    . GLN A 1 32  ? -1.690  -4.924  -7.810  1.00 0.00 ? 32  GLN A H    3  
ATOM 4038  H HA   . GLN A 1 32  ? 0.358   -4.273  -5.912  1.00 0.00 ? 32  GLN A HA   3  
ATOM 4039  H HB2  . GLN A 1 32  ? 0.498   -4.245  -8.493  1.00 0.00 ? 32  GLN A HB2  3  
ATOM 4040  H HB3  . GLN A 1 32  ? -0.269  -2.667  -8.375  1.00 0.00 ? 32  GLN A HB3  3  
ATOM 4041  H HG2  . GLN A 1 32  ? 1.557   -1.795  -7.110  1.00 0.00 ? 32  GLN A HG2  3  
ATOM 4042  H HG3  . GLN A 1 32  ? 2.286   -3.394  -6.967  1.00 0.00 ? 32  GLN A HG3  3  
ATOM 4043  H HE21 . GLN A 1 32  ? 2.631   -4.458  -9.197  1.00 0.00 ? 32  GLN A HE21 3  
ATOM 4044  H HE22 . GLN A 1 32  ? 3.373   -3.451  -10.387 1.00 0.00 ? 32  GLN A HE22 3  
ATOM 4045  N N    . ILE A 1 33  ? -0.177  -1.880  -5.146  1.00 0.00 ? 33  ILE A N    3  
ATOM 4046  C CA   . ILE A 1 33  ? -0.654  -0.701  -4.435  1.00 0.00 ? 33  ILE A CA   3  
ATOM 4047  C C    . ILE A 1 33  ? 0.390   0.411   -4.452  1.00 0.00 ? 33  ILE A C    3  
ATOM 4048  O O    . ILE A 1 33  ? 1.412   0.328   -3.771  1.00 0.00 ? 33  ILE A O    3  
ATOM 4049  C CB   . ILE A 1 33  ? -1.013  -1.030  -2.974  1.00 0.00 ? 33  ILE A CB   3  
ATOM 4050  C CG1  . ILE A 1 33  ? -2.043  -2.160  -2.922  1.00 0.00 ? 33  ILE A CG1  3  
ATOM 4051  C CG2  . ILE A 1 33  ? -1.541  0.209   -2.266  1.00 0.00 ? 33  ILE A CG2  3  
ATOM 4052  C CD1  . ILE A 1 33  ? -2.259  -2.717  -1.532  1.00 0.00 ? 33  ILE A CD1  3  
ATOM 4053  H H    . ILE A 1 33  ? 0.766   -2.133  -5.073  1.00 0.00 ? 33  ILE A H    3  
ATOM 4054  H HA   . ILE A 1 33  ? -1.546  -0.350  -4.934  1.00 0.00 ? 33  ILE A HA   3  
ATOM 4055  H HB   . ILE A 1 33  ? -0.114  -1.348  -2.469  1.00 0.00 ? 33  ILE A HB   3  
ATOM 4056  H HG12 . ILE A 1 33  ? -2.991  -1.792  -3.282  1.00 0.00 ? 33  ILE A HG12 3  
ATOM 4057  H HG13 . ILE A 1 33  ? -1.712  -2.969  -3.557  1.00 0.00 ? 33  ILE A HG13 3  
ATOM 4058  H HG21 . ILE A 1 33  ? -2.336  0.646   -2.852  1.00 0.00 ? 33  ILE A HG21 3  
ATOM 4059  H HG22 . ILE A 1 33  ? -1.921  -0.068  -1.294  1.00 0.00 ? 33  ILE A HG22 3  
ATOM 4060  H HG23 . ILE A 1 33  ? -0.743  0.926   -2.151  1.00 0.00 ? 33  ILE A HG23 3  
ATOM 4061  H HD11 . ILE A 1 33  ? -2.579  -1.925  -0.872  1.00 0.00 ? 33  ILE A HD11 3  
ATOM 4062  H HD12 . ILE A 1 33  ? -3.015  -3.487  -1.566  1.00 0.00 ? 33  ILE A HD12 3  
ATOM 4063  H HD13 . ILE A 1 33  ? -1.333  -3.138  -1.166  1.00 0.00 ? 33  ILE A HD13 3  
ATOM 4064  N N    . LYS A 1 34  ? 0.125   1.452   -5.234  1.00 0.00 ? 34  LYS A N    3  
ATOM 4065  C CA   . LYS A 1 34  ? 1.039   2.583   -5.339  1.00 0.00 ? 34  LYS A CA   3  
ATOM 4066  C C    . LYS A 1 34  ? 0.676   3.671   -4.333  1.00 0.00 ? 34  LYS A C    3  
ATOM 4067  O O    . LYS A 1 34  ? -0.461  4.143   -4.299  1.00 0.00 ? 34  LYS A O    3  
ATOM 4068  C CB   . LYS A 1 34  ? 1.013   3.157   -6.757  1.00 0.00 ? 34  LYS A CB   3  
ATOM 4069  C CG   . LYS A 1 34  ? 2.147   4.126   -7.042  1.00 0.00 ? 34  LYS A CG   3  
ATOM 4070  C CD   . LYS A 1 34  ? 2.145   4.577   -8.493  1.00 0.00 ? 34  LYS A CD   3  
ATOM 4071  C CE   . LYS A 1 34  ? 2.849   3.570   -9.390  1.00 0.00 ? 34  LYS A CE   3  
ATOM 4072  N NZ   . LYS A 1 34  ? 2.699   3.912   -10.832 1.00 0.00 ? 34  LYS A NZ   3  
ATOM 4073  H H    . LYS A 1 34  ? -0.707  1.460   -5.753  1.00 0.00 ? 34  LYS A H    3  
ATOM 4074  H HA   . LYS A 1 34  ? 2.034   2.227   -5.121  1.00 0.00 ? 34  LYS A HA   3  
ATOM 4075  H HB2  . LYS A 1 34  ? 1.079   2.342   -7.463  1.00 0.00 ? 34  LYS A HB2  3  
ATOM 4076  H HB3  . LYS A 1 34  ? 0.078   3.676   -6.906  1.00 0.00 ? 34  LYS A HB3  3  
ATOM 4077  H HG2  . LYS A 1 34  ? 2.036   4.993   -6.407  1.00 0.00 ? 34  LYS A HG2  3  
ATOM 4078  H HG3  . LYS A 1 34  ? 3.088   3.639   -6.827  1.00 0.00 ? 34  LYS A HG3  3  
ATOM 4079  H HD2  . LYS A 1 34  ? 1.123   4.685   -8.826  1.00 0.00 ? 34  LYS A HD2  3  
ATOM 4080  H HD3  . LYS A 1 34  ? 2.652   5.528   -8.566  1.00 0.00 ? 34  LYS A HD3  3  
ATOM 4081  H HE2  . LYS A 1 34  ? 3.899   3.557   -9.140  1.00 0.00 ? 34  LYS A HE2  3  
ATOM 4082  H HE3  . LYS A 1 34  ? 2.425   2.593   -9.214  1.00 0.00 ? 34  LYS A HE3  3  
ATOM 4083  H HZ1  . LYS A 1 34  ? 2.799   3.056   -11.414 1.00 0.00 ? 34  LYS A HZ1  3  
ATOM 4084  H HZ2  . LYS A 1 34  ? 3.428   4.597   -11.115 1.00 0.00 ? 34  LYS A HZ2  3  
ATOM 4085  H HZ3  . LYS A 1 34  ? 1.761   4.328   -11.005 1.00 0.00 ? 34  LYS A HZ3  3  
ATOM 4086  N N    . CYS A 1 35  ? 1.648   4.064   -3.517  1.00 0.00 ? 35  CYS A N    3  
ATOM 4087  C CA   . CYS A 1 35  ? 1.430   5.097   -2.511  1.00 0.00 ? 35  CYS A CA   3  
ATOM 4088  C C    . CYS A 1 35  ? 2.181   6.375   -2.871  1.00 0.00 ? 35  CYS A C    3  
ATOM 4089  O O    . CYS A 1 35  ? 3.397   6.358   -3.068  1.00 0.00 ? 35  CYS A O    3  
ATOM 4090  C CB   . CYS A 1 35  ? 1.875   4.600   -1.135  1.00 0.00 ? 35  CYS A CB   3  
ATOM 4091  S SG   . CYS A 1 35  ? 0.946   5.311   0.244   1.00 0.00 ? 35  CYS A SG   3  
ATOM 4092  H H    . CYS A 1 35  ? 2.533   3.650   -3.593  1.00 0.00 ? 35  CYS A H    3  
ATOM 4093  H HA   . CYS A 1 35  ? 0.373   5.313   -2.481  1.00 0.00 ? 35  CYS A HA   3  
ATOM 4094  H HB2  . CYS A 1 35  ? 1.756   3.528   -1.092  1.00 0.00 ? 35  CYS A HB2  3  
ATOM 4095  H HB3  . CYS A 1 35  ? 2.917   4.845   -0.992  1.00 0.00 ? 35  CYS A HB3  3  
ATOM 4096  H HG   . CYS A 1 35  ? 1.175   4.570   1.317   1.00 0.00 ? 35  CYS A HG   3  
ATOM 4097  N N    . PHE A 1 36  ? 1.450   7.481   -2.958  1.00 0.00 ? 36  PHE A N    3  
ATOM 4098  C CA   . PHE A 1 36  ? 2.047   8.767   -3.298  1.00 0.00 ? 36  PHE A CA   3  
ATOM 4099  C C    . PHE A 1 36  ? 2.640   9.435   -2.061  1.00 0.00 ? 36  PHE A C    3  
ATOM 4100  O O    . PHE A 1 36  ? 1.987   10.252  -1.411  1.00 0.00 ? 36  PHE A O    3  
ATOM 4101  C CB   . PHE A 1 36  ? 1.002   9.685   -3.937  1.00 0.00 ? 36  PHE A CB   3  
ATOM 4102  C CG   . PHE A 1 36  ? 0.912   9.544   -5.429  1.00 0.00 ? 36  PHE A CG   3  
ATOM 4103  C CD1  . PHE A 1 36  ? 1.356   8.391   -6.057  1.00 0.00 ? 36  PHE A CD1  3  
ATOM 4104  C CD2  . PHE A 1 36  ? 0.383   10.563  -6.204  1.00 0.00 ? 36  PHE A CD2  3  
ATOM 4105  C CE1  . PHE A 1 36  ? 1.274   8.257   -7.430  1.00 0.00 ? 36  PHE A CE1  3  
ATOM 4106  C CE2  . PHE A 1 36  ? 0.298   10.435  -7.578  1.00 0.00 ? 36  PHE A CE2  3  
ATOM 4107  C CZ   . PHE A 1 36  ? 0.745   9.281   -8.192  1.00 0.00 ? 36  PHE A CZ   3  
ATOM 4108  H H    . PHE A 1 36  ? 0.485   7.430   -2.791  1.00 0.00 ? 36  PHE A H    3  
ATOM 4109  H HA   . PHE A 1 36  ? 2.838   8.587   -4.010  1.00 0.00 ? 36  PHE A HA   3  
ATOM 4110  H HB2  . PHE A 1 36  ? 0.032   9.457   -3.523  1.00 0.00 ? 36  PHE A HB2  3  
ATOM 4111  H HB3  . PHE A 1 36  ? 1.252   10.712  -3.714  1.00 0.00 ? 36  PHE A HB3  3  
ATOM 4112  H HD1  . PHE A 1 36  ? 1.771   7.589   -5.462  1.00 0.00 ? 36  PHE A HD1  3  
ATOM 4113  H HD2  . PHE A 1 36  ? 0.034   11.466  -5.726  1.00 0.00 ? 36  PHE A HD2  3  
ATOM 4114  H HE1  . PHE A 1 36  ? 1.624   7.354   -7.907  1.00 0.00 ? 36  PHE A HE1  3  
ATOM 4115  H HE2  . PHE A 1 36  ? -0.116  11.237  -8.171  1.00 0.00 ? 36  PHE A HE2  3  
ATOM 4116  H HZ   . PHE A 1 36  ? 0.679   9.179   -9.265  1.00 0.00 ? 36  PHE A HZ   3  
ATOM 4117  N N    . ILE A 1 37  ? 3.881   9.082   -1.743  1.00 0.00 ? 37  ILE A N    3  
ATOM 4118  C CA   . ILE A 1 37  ? 4.562   9.648   -0.585  1.00 0.00 ? 37  ILE A CA   3  
ATOM 4119  C C    . ILE A 1 37  ? 5.301   10.929  -0.954  1.00 0.00 ? 37  ILE A C    3  
ATOM 4120  O O    . ILE A 1 37  ? 6.375   10.888  -1.555  1.00 0.00 ? 37  ILE A O    3  
ATOM 4121  C CB   . ILE A 1 37  ? 5.563   8.648   0.023   1.00 0.00 ? 37  ILE A CB   3  
ATOM 4122  C CG1  . ILE A 1 37  ? 4.865   7.325   0.345   1.00 0.00 ? 37  ILE A CG1  3  
ATOM 4123  C CG2  . ILE A 1 37  ? 6.204   9.233   1.272   1.00 0.00 ? 37  ILE A CG2  3  
ATOM 4124  C CD1  . ILE A 1 37  ? 5.744   6.342   1.086   1.00 0.00 ? 37  ILE A CD1  3  
ATOM 4125  H H    . ILE A 1 37  ? 4.349   8.427   -2.300  1.00 0.00 ? 37  ILE A H    3  
ATOM 4126  H HA   . ILE A 1 37  ? 3.815   9.877   0.161   1.00 0.00 ? 37  ILE A HA   3  
ATOM 4127  H HB   . ILE A 1 37  ? 6.343   8.468   -0.702  1.00 0.00 ? 37  ILE A HB   3  
ATOM 4128  H HG12 . ILE A 1 37  ? 3.999   7.522   0.957   1.00 0.00 ? 37  ILE A HG12 3  
ATOM 4129  H HG13 . ILE A 1 37  ? 4.549   6.859   -0.578  1.00 0.00 ? 37  ILE A HG13 3  
ATOM 4130  H HG21 . ILE A 1 37  ? 6.586   10.219  1.053   1.00 0.00 ? 37  ILE A HG21 3  
ATOM 4131  H HG22 . ILE A 1 37  ? 5.465   9.301   2.057   1.00 0.00 ? 37  ILE A HG22 3  
ATOM 4132  H HG23 . ILE A 1 37  ? 7.014   8.596   1.594   1.00 0.00 ? 37  ILE A HG23 3  
ATOM 4133  H HD11 . ILE A 1 37  ? 6.643   6.162   0.516   1.00 0.00 ? 37  ILE A HD11 3  
ATOM 4134  H HD12 . ILE A 1 37  ? 6.004   6.748   2.052   1.00 0.00 ? 37  ILE A HD12 3  
ATOM 4135  H HD13 . ILE A 1 37  ? 5.210   5.412   1.219   1.00 0.00 ? 37  ILE A HD13 3  
ATOM 4136  N N    . ARG A 1 38  ? 4.720   12.067  -0.588  1.00 0.00 ? 38  ARG A N    3  
ATOM 4137  C CA   . ARG A 1 38  ? 5.324   13.362  -0.879  1.00 0.00 ? 38  ARG A CA   3  
ATOM 4138  C C    . ARG A 1 38  ? 6.409   13.697  0.139   1.00 0.00 ? 38  ARG A C    3  
ATOM 4139  O O    . ARG A 1 38  ? 6.367   14.745  0.784   1.00 0.00 ? 38  ARG A O    3  
ATOM 4140  C CB   . ARG A 1 38  ? 4.256   14.457  -0.883  1.00 0.00 ? 38  ARG A CB   3  
ATOM 4141  C CG   . ARG A 1 38  ? 3.106   14.184  -1.838  1.00 0.00 ? 38  ARG A CG   3  
ATOM 4142  C CD   . ARG A 1 38  ? 2.279   15.435  -2.086  1.00 0.00 ? 38  ARG A CD   3  
ATOM 4143  N NE   . ARG A 1 38  ? 3.031   16.454  -2.814  1.00 0.00 ? 38  ARG A NE   3  
ATOM 4144  C CZ   . ARG A 1 38  ? 2.669   17.730  -2.877  1.00 0.00 ? 38  ARG A CZ   3  
ATOM 4145  N NH1  . ARG A 1 38  ? 1.571   18.143  -2.257  1.00 0.00 ? 38  ARG A NH1  3  
ATOM 4146  N NH2  . ARG A 1 38  ? 3.405   18.598  -3.559  1.00 0.00 ? 38  ARG A NH2  3  
ATOM 4147  H H    . ARG A 1 38  ? 3.865   12.036  -0.111  1.00 0.00 ? 38  ARG A H    3  
ATOM 4148  H HA   . ARG A 1 38  ? 5.773   13.305  -1.860  1.00 0.00 ? 38  ARG A HA   3  
ATOM 4149  H HB2  . ARG A 1 38  ? 3.852   14.553  0.114   1.00 0.00 ? 38  ARG A HB2  3  
ATOM 4150  H HB3  . ARG A 1 38  ? 4.717   15.391  -1.167  1.00 0.00 ? 38  ARG A HB3  3  
ATOM 4151  H HG2  . ARG A 1 38  ? 3.507   13.839  -2.780  1.00 0.00 ? 38  ARG A HG2  3  
ATOM 4152  H HG3  . ARG A 1 38  ? 2.472   13.421  -1.414  1.00 0.00 ? 38  ARG A HG3  3  
ATOM 4153  H HD2  . ARG A 1 38  ? 1.406   15.165  -2.662  1.00 0.00 ? 38  ARG A HD2  3  
ATOM 4154  H HD3  . ARG A 1 38  ? 1.970   15.841  -1.134  1.00 0.00 ? 38  ARG A HD3  3  
ATOM 4155  H HE   . ARG A 1 38  ? 3.845   16.171  -3.279  1.00 0.00 ? 38  ARG A HE   3  
ATOM 4156  H HH11 . ARG A 1 38  ? 1.015   17.492  -1.741  1.00 0.00 ? 38  ARG A HH11 3  
ATOM 4157  H HH12 . ARG A 1 38  ? 1.302   19.105  -2.305  1.00 0.00 ? 38  ARG A HH12 3  
ATOM 4158  H HH21 . ARG A 1 38  ? 4.233   18.290  -4.027  1.00 0.00 ? 38  ARG A HH21 3  
ATOM 4159  H HH22 . ARG A 1 38  ? 3.132   19.558  -3.606  1.00 0.00 ? 38  ARG A HH22 3  
ATOM 4160  N N    . SER A 1 39  ? 7.380   12.800  0.280   1.00 0.00 ? 39  SER A N    3  
ATOM 4161  C CA   . SER A 1 39  ? 8.474   12.999  1.223   1.00 0.00 ? 39  SER A CA   3  
ATOM 4162  C C    . SER A 1 39  ? 9.658   13.684  0.546   1.00 0.00 ? 39  SER A C    3  
ATOM 4163  O O    . SER A 1 39  ? 10.135  13.238  -0.498  1.00 0.00 ? 39  SER A O    3  
ATOM 4164  C CB   . SER A 1 39  ? 8.916   11.659  1.814   1.00 0.00 ? 39  SER A CB   3  
ATOM 4165  O OG   . SER A 1 39  ? 7.917   11.123  2.665   1.00 0.00 ? 39  SER A OG   3  
ATOM 4166  H H    . SER A 1 39  ? 7.358   11.984  -0.263  1.00 0.00 ? 39  SER A H    3  
ATOM 4167  H HA   . SER A 1 39  ? 8.114   13.633  2.020   1.00 0.00 ? 39  SER A HA   3  
ATOM 4168  H HB2  . SER A 1 39  ? 9.102   10.959  1.014   1.00 0.00 ? 39  SER A HB2  3  
ATOM 4169  H HB3  . SER A 1 39  ? 9.821   11.802  2.386   1.00 0.00 ? 39  SER A HB3  3  
ATOM 4170  H HG   . SER A 1 39  ? 8.018   10.170  2.716   1.00 0.00 ? 39  SER A HG   3  
ATOM 4171  N N    . THR A 1 40  ? 10.128  14.772  1.149   1.00 0.00 ? 40  THR A N    3  
ATOM 4172  C CA   . THR A 1 40  ? 11.254  15.520  0.605   1.00 0.00 ? 40  THR A CA   3  
ATOM 4173  C C    . THR A 1 40  ? 12.023  16.235  1.710   1.00 0.00 ? 40  THR A C    3  
ATOM 4174  O O    . THR A 1 40  ? 11.582  17.251  2.249   1.00 0.00 ? 40  THR A O    3  
ATOM 4175  C CB   . THR A 1 40  ? 10.790  16.556  -0.436  1.00 0.00 ? 40  THR A CB   3  
ATOM 4176  O OG1  . THR A 1 40  ? 10.132  15.897  -1.524  1.00 0.00 ? 40  THR A OG1  3  
ATOM 4177  C CG2  . THR A 1 40  ? 11.970  17.360  -0.962  1.00 0.00 ? 40  THR A CG2  3  
ATOM 4178  H H    . THR A 1 40  ? 9.705   15.077  1.978   1.00 0.00 ? 40  THR A H    3  
ATOM 4179  H HA   . THR A 1 40  ? 11.915  14.820  0.115   1.00 0.00 ? 40  THR A HA   3  
ATOM 4180  H HB   . THR A 1 40  ? 10.094  17.234  0.039   1.00 0.00 ? 40  THR A HB   3  
ATOM 4181  H HG1  . THR A 1 40  ? 9.470   16.483  -1.899  1.00 0.00 ? 40  THR A HG1  3  
ATOM 4182  H HG21 . THR A 1 40  ? 12.323  18.029  -0.190  1.00 0.00 ? 40  THR A HG21 3  
ATOM 4183  H HG22 . THR A 1 40  ? 11.659  17.935  -1.821  1.00 0.00 ? 40  THR A HG22 3  
ATOM 4184  H HG23 . THR A 1 40  ? 12.765  16.688  -1.246  1.00 0.00 ? 40  THR A HG23 3  
ATOM 4185  N N    . PRO A 1 41  ? 13.201  15.696  2.057   1.00 0.00 ? 41  PRO A N    3  
ATOM 4186  C CA   . PRO A 1 41  ? 13.736  14.487  1.423   1.00 0.00 ? 41  PRO A CA   3  
ATOM 4187  C C    . PRO A 1 41  ? 12.943  13.239  1.795   1.00 0.00 ? 41  PRO A C    3  
ATOM 4188  O O    . PRO A 1 41  ? 12.107  13.251  2.698   1.00 0.00 ? 41  PRO A O    3  
ATOM 4189  C CB   . PRO A 1 41  ? 15.162  14.399  1.972   1.00 0.00 ? 41  PRO A CB   3  
ATOM 4190  C CG   . PRO A 1 41  ? 15.112  15.124  3.273   1.00 0.00 ? 41  PRO A CG   3  
ATOM 4191  C CD   . PRO A 1 41  ? 14.102  16.224  3.095   1.00 0.00 ? 41  PRO A CD   3  
ATOM 4192  H HA   . PRO A 1 41  ? 13.768  14.584  0.347   1.00 0.00 ? 41  PRO A HA   3  
ATOM 4193  H HB2  . PRO A 1 41  ? 15.435  13.362  2.107   1.00 0.00 ? 41  PRO A HB2  3  
ATOM 4194  H HB3  . PRO A 1 41  ? 15.846  14.871  1.284   1.00 0.00 ? 41  PRO A HB3  3  
ATOM 4195  H HG2  . PRO A 1 41  ? 14.799  14.452  4.057   1.00 0.00 ? 41  PRO A HG2  3  
ATOM 4196  H HG3  . PRO A 1 41  ? 16.083  15.540  3.498   1.00 0.00 ? 41  PRO A HG3  3  
ATOM 4197  H HD2  . PRO A 1 41  ? 13.568  16.399  4.017   1.00 0.00 ? 41  PRO A HD2  3  
ATOM 4198  H HD3  . PRO A 1 41  ? 14.586  17.130  2.760   1.00 0.00 ? 41  PRO A HD3  3  
ATOM 4199  N N    . PRO A 1 42  ? 13.211  12.133  1.084   1.00 0.00 ? 42  PRO A N    3  
ATOM 4200  C CA   . PRO A 1 42  ? 12.534  10.855  1.323   1.00 0.00 ? 42  PRO A CA   3  
ATOM 4201  C C    . PRO A 1 42  ? 12.943  10.221  2.647   1.00 0.00 ? 42  PRO A C    3  
ATOM 4202  O O    . PRO A 1 42  ? 13.964  10.570  3.242   1.00 0.00 ? 42  PRO A O    3  
ATOM 4203  C CB   . PRO A 1 42  ? 12.992  9.986   0.149   1.00 0.00 ? 42  PRO A CB   3  
ATOM 4204  C CG   . PRO A 1 42  ? 14.300  10.568  -0.265  1.00 0.00 ? 42  PRO A CG   3  
ATOM 4205  C CD   . PRO A 1 42  ? 14.195  12.046  -0.008  1.00 0.00 ? 42  PRO A CD   3  
ATOM 4206  H HA   . PRO A 1 42  ? 11.459  10.964  1.294   1.00 0.00 ? 42  PRO A HA   3  
ATOM 4207  H HB2  . PRO A 1 42  ? 13.101  8.962   0.477   1.00 0.00 ? 42  PRO A HB2  3  
ATOM 4208  H HB3  . PRO A 1 42  ? 12.266  10.039  -0.648  1.00 0.00 ? 42  PRO A HB3  3  
ATOM 4209  H HG2  . PRO A 1 42  ? 15.095  10.140  0.325   1.00 0.00 ? 42  PRO A HG2  3  
ATOM 4210  H HG3  . PRO A 1 42  ? 14.467  10.382  -1.316  1.00 0.00 ? 42  PRO A HG3  3  
ATOM 4211  H HD2  . PRO A 1 42  ? 15.151  12.443  0.302   1.00 0.00 ? 42  PRO A HD2  3  
ATOM 4212  H HD3  . PRO A 1 42  ? 13.839  12.558  -0.889  1.00 0.00 ? 42  PRO A HD3  3  
ATOM 4213  N N    . PRO A 1 43  ? 12.131  9.265   3.123   1.00 0.00 ? 43  PRO A N    3  
ATOM 4214  C CA   . PRO A 1 43  ? 12.390  8.561   4.383   1.00 0.00 ? 43  PRO A CA   3  
ATOM 4215  C C    . PRO A 1 43  ? 13.593  7.629   4.289   1.00 0.00 ? 43  PRO A C    3  
ATOM 4216  O O    . PRO A 1 43  ? 13.961  7.182   3.203   1.00 0.00 ? 43  PRO A O    3  
ATOM 4217  C CB   . PRO A 1 43  ? 11.107  7.757   4.610   1.00 0.00 ? 43  PRO A CB   3  
ATOM 4218  C CG   . PRO A 1 43  ? 10.535  7.565   3.248   1.00 0.00 ? 43  PRO A CG   3  
ATOM 4219  C CD   . PRO A 1 43  ? 10.898  8.798   2.468   1.00 0.00 ? 43  PRO A CD   3  
ATOM 4220  H HA   . PRO A 1 43  ? 12.534  9.252   5.201   1.00 0.00 ? 43  PRO A HA   3  
ATOM 4221  H HB2  . PRO A 1 43  ? 11.349  6.812   5.075   1.00 0.00 ? 43  PRO A HB2  3  
ATOM 4222  H HB3  . PRO A 1 43  ? 10.436  8.316   5.244   1.00 0.00 ? 43  PRO A HB3  3  
ATOM 4223  H HG2  . PRO A 1 43  ? 10.967  6.689   2.788   1.00 0.00 ? 43  PRO A HG2  3  
ATOM 4224  H HG3  . PRO A 1 43  ? 9.461   7.465   3.312   1.00 0.00 ? 43  PRO A HG3  3  
ATOM 4225  H HD2  . PRO A 1 43  ? 11.082  8.549   1.433   1.00 0.00 ? 43  PRO A HD2  3  
ATOM 4226  H HD3  . PRO A 1 43  ? 10.116  9.538   2.547   1.00 0.00 ? 43  PRO A HD3  3  
ATOM 4227  N N    . ASP A 1 44  ? 14.202  7.340   5.434   1.00 0.00 ? 44  ASP A N    3  
ATOM 4228  C CA   . ASP A 1 44  ? 15.363  6.460   5.481   1.00 0.00 ? 44  ASP A CA   3  
ATOM 4229  C C    . ASP A 1 44  ? 14.935  5.004   5.640   1.00 0.00 ? 44  ASP A C    3  
ATOM 4230  O O    . ASP A 1 44  ? 15.690  4.086   5.317   1.00 0.00 ? 44  ASP A O    3  
ATOM 4231  C CB   . ASP A 1 44  ? 16.288  6.860   6.632   1.00 0.00 ? 44  ASP A CB   3  
ATOM 4232  C CG   . ASP A 1 44  ? 17.184  8.030   6.274   1.00 0.00 ? 44  ASP A CG   3  
ATOM 4233  O OD1  . ASP A 1 44  ? 17.613  8.112   5.105   1.00 0.00 ? 44  ASP A OD1  3  
ATOM 4234  O OD2  . ASP A 1 44  ? 17.457  8.862   7.165   1.00 0.00 ? 44  ASP A OD2  3  
ATOM 4235  H H    . ASP A 1 44  ? 13.862  7.728   6.267   1.00 0.00 ? 44  ASP A H    3  
ATOM 4236  H HA   . ASP A 1 44  ? 15.898  6.565   4.549   1.00 0.00 ? 44  ASP A HA   3  
ATOM 4237  H HB2  . ASP A 1 44  ? 15.688  7.139   7.487   1.00 0.00 ? 44  ASP A HB2  3  
ATOM 4238  H HB3  . ASP A 1 44  ? 16.911  6.019   6.894   1.00 0.00 ? 44  ASP A HB3  3  
ATOM 4239  N N    . ARG A 1 45  ? 13.721  4.800   6.139   1.00 0.00 ? 45  ARG A N    3  
ATOM 4240  C CA   . ARG A 1 45  ? 13.194  3.457   6.343   1.00 0.00 ? 45  ARG A CA   3  
ATOM 4241  C C    . ARG A 1 45  ? 11.677  3.437   6.178   1.00 0.00 ? 45  ARG A C    3  
ATOM 4242  O O    . ARG A 1 45  ? 10.996  4.413   6.494   1.00 0.00 ? 45  ARG A O    3  
ATOM 4243  C CB   . ARG A 1 45  ? 13.574  2.942   7.732   1.00 0.00 ? 45  ARG A CB   3  
ATOM 4244  C CG   . ARG A 1 45  ? 12.744  1.753   8.189   1.00 0.00 ? 45  ARG A CG   3  
ATOM 4245  C CD   . ARG A 1 45  ? 12.998  1.425   9.652   1.00 0.00 ? 45  ARG A CD   3  
ATOM 4246  N NE   . ARG A 1 45  ? 12.570  2.506   10.537  1.00 0.00 ? 45  ARG A NE   3  
ATOM 4247  C CZ   . ARG A 1 45  ? 12.645  2.443   11.862  1.00 0.00 ? 45  ARG A CZ   3  
ATOM 4248  N NH1  . ARG A 1 45  ? 13.129  1.359   12.452  1.00 0.00 ? 45  ARG A NH1  3  
ATOM 4249  N NH2  . ARG A 1 45  ? 12.236  3.468   12.599  1.00 0.00 ? 45  ARG A NH2  3  
ATOM 4250  H H    . ARG A 1 45  ? 13.166  5.572   6.378   1.00 0.00 ? 45  ARG A H    3  
ATOM 4251  H HA   . ARG A 1 45  ? 13.633  2.811   5.597   1.00 0.00 ? 45  ARG A HA   3  
ATOM 4252  H HB2  . ARG A 1 45  ? 14.612  2.645   7.722   1.00 0.00 ? 45  ARG A HB2  3  
ATOM 4253  H HB3  . ARG A 1 45  ? 13.443  3.740   8.447   1.00 0.00 ? 45  ARG A HB3  3  
ATOM 4254  H HG2  . ARG A 1 45  ? 11.697  1.985   8.060   1.00 0.00 ? 45  ARG A HG2  3  
ATOM 4255  H HG3  . ARG A 1 45  ? 13.001  0.894   7.587   1.00 0.00 ? 45  ARG A HG3  3  
ATOM 4256  H HD2  . ARG A 1 45  ? 12.454  0.528   9.906   1.00 0.00 ? 45  ARG A HD2  3  
ATOM 4257  H HD3  . ARG A 1 45  ? 14.055  1.256   9.791   1.00 0.00 ? 45  ARG A HD3  3  
ATOM 4258  H HE   . ARG A 1 45  ? 12.210  3.316   10.122  1.00 0.00 ? 45  ARG A HE   3  
ATOM 4259  H HH11 . ARG A 1 45  ? 13.439  0.586   11.898  1.00 0.00 ? 45  ARG A HH11 3  
ATOM 4260  H HH12 . ARG A 1 45  ? 13.185  1.315   13.450  1.00 0.00 ? 45  ARG A HH12 3  
ATOM 4261  H HH21 . ARG A 1 45  ? 11.871  4.287   12.158  1.00 0.00 ? 45  ARG A HH21 3  
ATOM 4262  H HH22 . ARG A 1 45  ? 12.293  3.420   13.596  1.00 0.00 ? 45  ARG A HH22 3  
ATOM 4263  N N    . ILE A 1 46  ? 11.155  2.320   5.683   1.00 0.00 ? 46  ILE A N    3  
ATOM 4264  C CA   . ILE A 1 46  ? 9.719   2.174   5.477   1.00 0.00 ? 46  ILE A CA   3  
ATOM 4265  C C    . ILE A 1 46  ? 9.254   0.765   5.830   1.00 0.00 ? 46  ILE A C    3  
ATOM 4266  O O    . ILE A 1 46  ? 9.977   -0.209  5.622   1.00 0.00 ? 46  ILE A O    3  
ATOM 4267  C CB   . ILE A 1 46  ? 9.325   2.483   4.021   1.00 0.00 ? 46  ILE A CB   3  
ATOM 4268  C CG1  . ILE A 1 46  ? 9.485   3.977   3.732   1.00 0.00 ? 46  ILE A CG1  3  
ATOM 4269  C CG2  . ILE A 1 46  ? 7.895   2.037   3.754   1.00 0.00 ? 46  ILE A CG2  3  
ATOM 4270  C CD1  . ILE A 1 46  ? 9.413   4.318   2.260   1.00 0.00 ? 46  ILE A CD1  3  
ATOM 4271  H H    . ILE A 1 46  ? 11.749  1.577   5.450   1.00 0.00 ? 46  ILE A H    3  
ATOM 4272  H HA   . ILE A 1 46  ? 9.217   2.880   6.123   1.00 0.00 ? 46  ILE A HA   3  
ATOM 4273  H HB   . ILE A 1 46  ? 9.978   1.925   3.368   1.00 0.00 ? 46  ILE A HB   3  
ATOM 4274  H HG12 . ILE A 1 46  ? 8.703   4.521   4.237   1.00 0.00 ? 46  ILE A HG12 3  
ATOM 4275  H HG13 . ILE A 1 46  ? 10.445  4.306   4.103   1.00 0.00 ? 46  ILE A HG13 3  
ATOM 4276  H HG21 . ILE A 1 46  ? 7.229   2.525   4.450   1.00 0.00 ? 46  ILE A HG21 3  
ATOM 4277  H HG22 . ILE A 1 46  ? 7.618   2.303   2.745   1.00 0.00 ? 46  ILE A HG22 3  
ATOM 4278  H HG23 . ILE A 1 46  ? 7.822   0.967   3.877   1.00 0.00 ? 46  ILE A HG23 3  
ATOM 4279  H HD11 . ILE A 1 46  ? 8.473   3.972   1.856   1.00 0.00 ? 46  ILE A HD11 3  
ATOM 4280  H HD12 . ILE A 1 46  ? 9.488   5.388   2.134   1.00 0.00 ? 46  ILE A HD12 3  
ATOM 4281  H HD13 . ILE A 1 46  ? 10.227  3.836   1.738   1.00 0.00 ? 46  ILE A HD13 3  
ATOM 4282  N N    . ALA A 1 47  ? 8.041   0.665   6.364   1.00 0.00 ? 47  ALA A N    3  
ATOM 4283  C CA   . ALA A 1 47  ? 7.478   -0.625  6.743   1.00 0.00 ? 47  ALA A CA   3  
ATOM 4284  C C    . ALA A 1 47  ? 6.017   -0.732  6.317   1.00 0.00 ? 47  ALA A C    3  
ATOM 4285  O O    . ALA A 1 47  ? 5.211   0.152   6.606   1.00 0.00 ? 47  ALA A O    3  
ATOM 4286  C CB   . ALA A 1 47  ? 7.609   -0.838  8.244   1.00 0.00 ? 47  ALA A CB   3  
ATOM 4287  H H    . ALA A 1 47  ? 7.513   1.478   6.506   1.00 0.00 ? 47  ALA A H    3  
ATOM 4288  H HA   . ALA A 1 47  ? 8.045   -1.397  6.243   1.00 0.00 ? 47  ALA A HA   3  
ATOM 4289  H HB1  . ALA A 1 47  ? 6.934   -0.172  8.761   1.00 0.00 ? 47  ALA A HB1  3  
ATOM 4290  H HB2  . ALA A 1 47  ? 7.361   -1.861  8.484   1.00 0.00 ? 47  ALA A HB2  3  
ATOM 4291  H HB3  . ALA A 1 47  ? 8.624   -0.632  8.549   1.00 0.00 ? 47  ALA A HB3  3  
ATOM 4292  N N    . TRP A 1 48  ? 5.685   -1.818  5.629   1.00 0.00 ? 48  TRP A N    3  
ATOM 4293  C CA   . TRP A 1 48  ? 4.321   -2.039  5.162   1.00 0.00 ? 48  TRP A CA   3  
ATOM 4294  C C    . TRP A 1 48  ? 3.601   -3.053  6.045   1.00 0.00 ? 48  TRP A C    3  
ATOM 4295  O O    . TRP A 1 48  ? 3.734   -4.262  5.853   1.00 0.00 ? 48  TRP A O    3  
ATOM 4296  C CB   . TRP A 1 48  ? 4.328   -2.523  3.711   1.00 0.00 ? 48  TRP A CB   3  
ATOM 4297  C CG   . TRP A 1 48  ? 4.267   -1.406  2.713   1.00 0.00 ? 48  TRP A CG   3  
ATOM 4298  C CD1  . TRP A 1 48  ? 5.320   -0.698  2.210   1.00 0.00 ? 48  TRP A CD1  3  
ATOM 4299  C CD2  . TRP A 1 48  ? 3.090   -0.870  2.099   1.00 0.00 ? 48  TRP A CD2  3  
ATOM 4300  N NE1  . TRP A 1 48  ? 4.869   0.247   1.320   1.00 0.00 ? 48  TRP A NE1  3  
ATOM 4301  C CE2  . TRP A 1 48  ? 3.505   0.161   1.233   1.00 0.00 ? 48  TRP A CE2  3  
ATOM 4302  C CE3  . TRP A 1 48  ? 1.727   -1.161  2.194   1.00 0.00 ? 48  TRP A CE3  3  
ATOM 4303  C CZ2  . TRP A 1 48  ? 2.604   0.900   0.471   1.00 0.00 ? 48  TRP A CZ2  3  
ATOM 4304  C CZ3  . TRP A 1 48  ? 0.834   -0.427  1.437   1.00 0.00 ? 48  TRP A CZ3  3  
ATOM 4305  C CH2  . TRP A 1 48  ? 1.276   0.594   0.584   1.00 0.00 ? 48  TRP A CH2  3  
ATOM 4306  H H    . TRP A 1 48  ? 6.373   -2.487  5.429   1.00 0.00 ? 48  TRP A H    3  
ATOM 4307  H HA   . TRP A 1 48  ? 3.796   -1.097  5.216   1.00 0.00 ? 48  TRP A HA   3  
ATOM 4308  H HB2  . TRP A 1 48  ? 5.233   -3.083  3.529   1.00 0.00 ? 48  TRP A HB2  3  
ATOM 4309  H HB3  . TRP A 1 48  ? 3.474   -3.164  3.549   1.00 0.00 ? 48  TRP A HB3  3  
ATOM 4310  H HD1  . TRP A 1 48  ? 6.351   -0.866  2.482   1.00 0.00 ? 48  TRP A HD1  3  
ATOM 4311  H HE1  . TRP A 1 48  ? 5.434   0.878   0.826   1.00 0.00 ? 48  TRP A HE1  3  
ATOM 4312  H HE3  . TRP A 1 48  ? 1.367   -1.944  2.845   1.00 0.00 ? 48  TRP A HE3  3  
ATOM 4313  H HZ2  . TRP A 1 48  ? 2.929   1.689   -0.191  1.00 0.00 ? 48  TRP A HZ2  3  
ATOM 4314  H HZ3  . TRP A 1 48  ? -0.224  -0.637  1.498   1.00 0.00 ? 48  TRP A HZ3  3  
ATOM 4315  H HH2  . TRP A 1 48  ? 0.543   1.142   0.012   1.00 0.00 ? 48  TRP A HH2  3  
ATOM 4316  N N    . SER A 1 49  ? 2.840   -2.553  7.013   1.00 0.00 ? 49  SER A N    3  
ATOM 4317  C CA   . SER A 1 49  ? 2.102   -3.417  7.928   1.00 0.00 ? 49  SER A CA   3  
ATOM 4318  C C    . SER A 1 49  ? 0.601   -3.165  7.821   1.00 0.00 ? 49  SER A C    3  
ATOM 4319  O O    . SER A 1 49  ? 0.147   -2.022  7.868   1.00 0.00 ? 49  SER A O    3  
ATOM 4320  C CB   . SER A 1 49  ? 2.568   -3.187  9.367   1.00 0.00 ? 49  SER A CB   3  
ATOM 4321  O OG   . SER A 1 49  ? 2.128   -1.930  9.851   1.00 0.00 ? 49  SER A OG   3  
ATOM 4322  H H    . SER A 1 49  ? 2.774   -1.581  7.115   1.00 0.00 ? 49  SER A H    3  
ATOM 4323  H HA   . SER A 1 49  ? 2.304   -4.441  7.652   1.00 0.00 ? 49  SER A HA   3  
ATOM 4324  H HB2  . SER A 1 49  ? 2.167   -3.963  10.001  1.00 0.00 ? 49  SER A HB2  3  
ATOM 4325  H HB3  . SER A 1 49  ? 3.647   -3.215  9.402   1.00 0.00 ? 49  SER A HB3  3  
ATOM 4326  H HG   . SER A 1 49  ? 1.340   -2.050  10.386  1.00 0.00 ? 49  SER A HG   3  
ATOM 4327  N N    . TRP A 1 50  ? -0.164  -4.241  7.676   1.00 0.00 ? 50  TRP A N    3  
ATOM 4328  C CA   . TRP A 1 50  ? -1.614  -4.138  7.562   1.00 0.00 ? 50  TRP A CA   3  
ATOM 4329  C C    . TRP A 1 50  ? -2.285  -4.381  8.910   1.00 0.00 ? 50  TRP A C    3  
ATOM 4330  O O    . TRP A 1 50  ? -2.780  -3.450  9.545   1.00 0.00 ? 50  TRP A O    3  
ATOM 4331  C CB   . TRP A 1 50  ? -2.138  -5.139  6.530   1.00 0.00 ? 50  TRP A CB   3  
ATOM 4332  C CG   . TRP A 1 50  ? -1.293  -6.372  6.418   1.00 0.00 ? 50  TRP A CG   3  
ATOM 4333  C CD1  . TRP A 1 50  ? -1.598  -7.619  6.883   1.00 0.00 ? 50  TRP A CD1  3  
ATOM 4334  C CD2  . TRP A 1 50  ? -0.005  -6.475  5.802   1.00 0.00 ? 50  TRP A CD2  3  
ATOM 4335  N NE1  . TRP A 1 50  ? -0.577  -8.492  6.593   1.00 0.00 ? 50  TRP A NE1  3  
ATOM 4336  C CE2  . TRP A 1 50  ? 0.412   -7.815  5.929   1.00 0.00 ? 50  TRP A CE2  3  
ATOM 4337  C CE3  . TRP A 1 50  ? 0.836   -5.567  5.153   1.00 0.00 ? 50  TRP A CE3  3  
ATOM 4338  C CZ2  . TRP A 1 50  ? 1.632   -8.265  5.433   1.00 0.00 ? 50  TRP A CZ2  3  
ATOM 4339  C CZ3  . TRP A 1 50  ? 2.047   -6.015  4.661   1.00 0.00 ? 50  TRP A CZ3  3  
ATOM 4340  C CH2  . TRP A 1 50  ? 2.436   -7.354  4.803   1.00 0.00 ? 50  TRP A CH2  3  
ATOM 4341  H H    . TRP A 1 50  ? 0.257   -5.126  7.645   1.00 0.00 ? 50  TRP A H    3  
ATOM 4342  H HA   . TRP A 1 50  ? -1.850  -3.137  7.231   1.00 0.00 ? 50  TRP A HA   3  
ATOM 4343  H HB2  . TRP A 1 50  ? -3.136  -5.442  6.807   1.00 0.00 ? 50  TRP A HB2  3  
ATOM 4344  H HB3  . TRP A 1 50  ? -2.166  -4.663  5.561   1.00 0.00 ? 50  TRP A HB3  3  
ATOM 4345  H HD1  . TRP A 1 50  ? -2.511  -7.868  7.402   1.00 0.00 ? 50  TRP A HD1  3  
ATOM 4346  H HE1  . TRP A 1 50  ? -0.561  -9.445  6.823   1.00 0.00 ? 50  TRP A HE1  3  
ATOM 4347  H HE3  . TRP A 1 50  ? 0.554   -4.531  5.034   1.00 0.00 ? 50  TRP A HE3  3  
ATOM 4348  H HZ2  . TRP A 1 50  ? 1.946   -9.294  5.534   1.00 0.00 ? 50  TRP A HZ2  3  
ATOM 4349  H HZ3  . TRP A 1 50  ? 2.711   -5.328  4.157   1.00 0.00 ? 50  TRP A HZ3  3  
ATOM 4350  H HH2  . TRP A 1 50  ? 3.391   -7.660  4.404   1.00 0.00 ? 50  TRP A HH2  3  
ATOM 4351  N N    . LYS A 1 51  ? -2.298  -5.638  9.341   1.00 0.00 ? 51  LYS A N    3  
ATOM 4352  C CA   . LYS A 1 51  ? -2.907  -6.003  10.615  1.00 0.00 ? 51  LYS A CA   3  
ATOM 4353  C C    . LYS A 1 51  ? -1.840  -6.254  11.676  1.00 0.00 ? 51  LYS A C    3  
ATOM 4354  O O    . LYS A 1 51  ? -1.717  -5.494  12.636  1.00 0.00 ? 51  LYS A O    3  
ATOM 4355  C CB   . LYS A 1 51  ? -3.778  -7.251  10.448  1.00 0.00 ? 51  LYS A CB   3  
ATOM 4356  C CG   . LYS A 1 51  ? -4.968  -7.042  9.528   1.00 0.00 ? 51  LYS A CG   3  
ATOM 4357  C CD   . LYS A 1 51  ? -6.141  -7.923  9.925   1.00 0.00 ? 51  LYS A CD   3  
ATOM 4358  C CE   . LYS A 1 51  ? -5.698  -9.353  10.195  1.00 0.00 ? 51  LYS A CE   3  
ATOM 4359  N NZ   . LYS A 1 51  ? -6.791  -10.169 10.792  1.00 0.00 ? 51  LYS A NZ   3  
ATOM 4360  H H    . LYS A 1 51  ? -1.887  -6.337  8.789   1.00 0.00 ? 51  LYS A H    3  
ATOM 4361  H HA   . LYS A 1 51  ? -3.528  -5.181  10.934  1.00 0.00 ? 51  LYS A HA   3  
ATOM 4362  H HB2  . LYS A 1 51  ? -3.171  -8.047  10.042  1.00 0.00 ? 51  LYS A HB2  3  
ATOM 4363  H HB3  . LYS A 1 51  ? -4.147  -7.549  11.418  1.00 0.00 ? 51  LYS A HB3  3  
ATOM 4364  H HG2  . LYS A 1 51  ? -5.275  -6.008  9.579   1.00 0.00 ? 51  LYS A HG2  3  
ATOM 4365  H HG3  . LYS A 1 51  ? -4.676  -7.283  8.515   1.00 0.00 ? 51  LYS A HG3  3  
ATOM 4366  H HD2  . LYS A 1 51  ? -6.593  -7.523  10.821  1.00 0.00 ? 51  LYS A HD2  3  
ATOM 4367  H HD3  . LYS A 1 51  ? -6.866  -7.925  9.124   1.00 0.00 ? 51  LYS A HD3  3  
ATOM 4368  H HE2  . LYS A 1 51  ? -5.392  -9.803  9.263   1.00 0.00 ? 51  LYS A HE2  3  
ATOM 4369  H HE3  . LYS A 1 51  ? -4.861  -9.334  10.877  1.00 0.00 ? 51  LYS A HE3  3  
ATOM 4370  H HZ1  . LYS A 1 51  ? -6.447  -10.660 11.641  1.00 0.00 ? 51  LYS A HZ1  3  
ATOM 4371  H HZ2  . LYS A 1 51  ? -7.124  -10.877 10.107  1.00 0.00 ? 51  LYS A HZ2  3  
ATOM 4372  H HZ3  . LYS A 1 51  ? -7.590  -9.558  11.057  1.00 0.00 ? 51  LYS A HZ3  3  
ATOM 4373  N N    . GLU A 1 52  ? -1.070  -7.322  11.494  1.00 0.00 ? 52  GLU A N    3  
ATOM 4374  C CA   . GLU A 1 52  ? -0.013  -7.671  12.436  1.00 0.00 ? 52  GLU A CA   3  
ATOM 4375  C C    . GLU A 1 52  ? 1.315   -7.876  11.713  1.00 0.00 ? 52  GLU A C    3  
ATOM 4376  O O    . GLU A 1 52  ? 2.384   -7.691  12.292  1.00 0.00 ? 52  GLU A O    3  
ATOM 4377  C CB   . GLU A 1 52  ? -0.387  -8.937  13.210  1.00 0.00 ? 52  GLU A CB   3  
ATOM 4378  C CG   . GLU A 1 52  ? -1.428  -8.705  14.291  1.00 0.00 ? 52  GLU A CG   3  
ATOM 4379  C CD   . GLU A 1 52  ? -2.149  -9.979  14.690  1.00 0.00 ? 52  GLU A CD   3  
ATOM 4380  O OE1  . GLU A 1 52  ? -2.850  -10.557 13.834  1.00 0.00 ? 52  GLU A OE1  3  
ATOM 4381  O OE2  . GLU A 1 52  ? -2.010  -10.397 15.859  1.00 0.00 ? 52  GLU A OE2  3  
ATOM 4382  H H    . GLU A 1 52  ? -1.217  -7.890  10.708  1.00 0.00 ? 52  GLU A H    3  
ATOM 4383  H HA   . GLU A 1 52  ? 0.093   -6.853  13.133  1.00 0.00 ? 52  GLU A HA   3  
ATOM 4384  H HB2  . GLU A 1 52  ? -0.774  -9.668  12.515  1.00 0.00 ? 52  GLU A HB2  3  
ATOM 4385  H HB3  . GLU A 1 52  ? 0.503   -9.335  13.676  1.00 0.00 ? 52  GLU A HB3  3  
ATOM 4386  H HG2  . GLU A 1 52  ? -0.939  -8.299  15.163  1.00 0.00 ? 52  GLU A HG2  3  
ATOM 4387  H HG3  . GLU A 1 52  ? -2.157  -7.997  13.925  1.00 0.00 ? 52  GLU A HG3  3  
ATOM 4388  N N    . ASN A 1 53  ? 1.237   -8.261  10.443  1.00 0.00 ? 53  ASN A N    3  
ATOM 4389  C CA   . ASN A 1 53  ? 2.432   -8.494  9.640   1.00 0.00 ? 53  ASN A CA   3  
ATOM 4390  C C    . ASN A 1 53  ? 3.093   -7.174  9.254   1.00 0.00 ? 53  ASN A C    3  
ATOM 4391  O O    . ASN A 1 53  ? 2.439   -6.132  9.199   1.00 0.00 ? 53  ASN A O    3  
ATOM 4392  C CB   . ASN A 1 53  ? 2.079   -9.287  8.381   1.00 0.00 ? 53  ASN A CB   3  
ATOM 4393  C CG   . ASN A 1 53  ? 1.831   -10.755 8.673   1.00 0.00 ? 53  ASN A CG   3  
ATOM 4394  O OD1  . ASN A 1 53  ? 2.715   -11.593 8.491   1.00 0.00 ? 53  ASN A OD1  3  
ATOM 4395  N ND2  . ASN A 1 53  ? 0.625   -11.072 9.127   1.00 0.00 ? 53  ASN A ND2  3  
ATOM 4396  H H    . ASN A 1 53  ? 0.355   -8.393  10.036  1.00 0.00 ? 53  ASN A H    3  
ATOM 4397  H HA   . ASN A 1 53  ? 3.124   -9.069  10.236  1.00 0.00 ? 53  ASN A HA   3  
ATOM 4398  H HB2  . ASN A 1 53  ? 1.185   -8.872  7.940   1.00 0.00 ? 53  ASN A HB2  3  
ATOM 4399  H HB3  . ASN A 1 53  ? 2.892   -9.212  7.675   1.00 0.00 ? 53  ASN A HB3  3  
ATOM 4400  H HD21 . ASN A 1 53  ? -0.029  -10.352 9.247   1.00 0.00 ? 53  ASN A HD21 3  
ATOM 4401  H HD22 . ASN A 1 53  ? 0.438   -12.013 9.325   1.00 0.00 ? 53  ASN A HD22 3  
ATOM 4402  N N    . VAL A 1 54  ? 4.394   -7.225  8.988   1.00 0.00 ? 54  VAL A N    3  
ATOM 4403  C CA   . VAL A 1 54  ? 5.144   -6.035  8.605   1.00 0.00 ? 54  VAL A CA   3  
ATOM 4404  C C    . VAL A 1 54  ? 6.220   -6.370  7.579   1.00 0.00 ? 54  VAL A C    3  
ATOM 4405  O O    . VAL A 1 54  ? 7.089   -7.208  7.825   1.00 0.00 ? 54  VAL A O    3  
ATOM 4406  C CB   . VAL A 1 54  ? 5.804   -5.371  9.828   1.00 0.00 ? 54  VAL A CB   3  
ATOM 4407  C CG1  . VAL A 1 54  ? 6.464   -4.059  9.432   1.00 0.00 ? 54  VAL A CG1  3  
ATOM 4408  C CG2  . VAL A 1 54  ? 4.781   -5.151  10.932  1.00 0.00 ? 54  VAL A CG2  3  
ATOM 4409  H H    . VAL A 1 54  ? 4.860   -8.085  9.049   1.00 0.00 ? 54  VAL A H    3  
ATOM 4410  H HA   . VAL A 1 54  ? 4.451   -5.330  8.169   1.00 0.00 ? 54  VAL A HA   3  
ATOM 4411  H HB   . VAL A 1 54  ? 6.570   -6.034  10.203  1.00 0.00 ? 54  VAL A HB   3  
ATOM 4412  H HG11 . VAL A 1 54  ? 5.806   -3.237  9.677   1.00 0.00 ? 54  VAL A HG11 3  
ATOM 4413  H HG12 . VAL A 1 54  ? 7.396   -3.948  9.967   1.00 0.00 ? 54  VAL A HG12 3  
ATOM 4414  H HG13 . VAL A 1 54  ? 6.657   -4.060  8.369   1.00 0.00 ? 54  VAL A HG13 3  
ATOM 4415  H HG21 . VAL A 1 54  ? 5.058   -4.282  11.510  1.00 0.00 ? 54  VAL A HG21 3  
ATOM 4416  H HG22 . VAL A 1 54  ? 3.806   -4.995  10.494  1.00 0.00 ? 54  VAL A HG22 3  
ATOM 4417  H HG23 . VAL A 1 54  ? 4.752   -6.018  11.575  1.00 0.00 ? 54  VAL A HG23 3  
ATOM 4418  N N    . LEU A 1 55  ? 6.158   -5.709  6.428   1.00 0.00 ? 55  LEU A N    3  
ATOM 4419  C CA   . LEU A 1 55  ? 7.129   -5.936  5.363   1.00 0.00 ? 55  LEU A CA   3  
ATOM 4420  C C    . LEU A 1 55  ? 7.886   -4.653  5.034   1.00 0.00 ? 55  LEU A C    3  
ATOM 4421  O O    . LEU A 1 55  ? 7.314   -3.704  4.498   1.00 0.00 ? 55  LEU A O    3  
ATOM 4422  C CB   . LEU A 1 55  ? 6.427   -6.462  4.110   1.00 0.00 ? 55  LEU A CB   3  
ATOM 4423  C CG   . LEU A 1 55  ? 7.324   -7.136  3.071   1.00 0.00 ? 55  LEU A CG   3  
ATOM 4424  C CD1  . LEU A 1 55  ? 8.045   -8.328  3.681   1.00 0.00 ? 55  LEU A CD1  3  
ATOM 4425  C CD2  . LEU A 1 55  ? 6.508   -7.566  1.860   1.00 0.00 ? 55  LEU A CD2  3  
ATOM 4426  H H    . LEU A 1 55  ? 5.444   -5.054  6.290   1.00 0.00 ? 55  LEU A H    3  
ATOM 4427  H HA   . LEU A 1 55  ? 7.834   -6.677  5.709   1.00 0.00 ? 55  LEU A HA   3  
ATOM 4428  H HB2  . LEU A 1 55  ? 5.686   -7.182  4.424   1.00 0.00 ? 55  LEU A HB2  3  
ATOM 4429  H HB3  . LEU A 1 55  ? 5.934   -5.627  3.632   1.00 0.00 ? 55  LEU A HB3  3  
ATOM 4430  H HG   . LEU A 1 55  ? 8.071   -6.429  2.737   1.00 0.00 ? 55  LEU A HG   3  
ATOM 4431  H HD11 . LEU A 1 55  ? 8.438   -8.952  2.893   1.00 0.00 ? 55  LEU A HD11 3  
ATOM 4432  H HD12 . LEU A 1 55  ? 7.352   -8.899  4.281   1.00 0.00 ? 55  LEU A HD12 3  
ATOM 4433  H HD13 . LEU A 1 55  ? 8.856   -7.978  4.302   1.00 0.00 ? 55  LEU A HD13 3  
ATOM 4434  H HD21 . LEU A 1 55  ? 6.159   -8.579  2.003   1.00 0.00 ? 55  LEU A HD21 3  
ATOM 4435  H HD22 . LEU A 1 55  ? 7.125   -7.520  0.975   1.00 0.00 ? 55  LEU A HD22 3  
ATOM 4436  H HD23 . LEU A 1 55  ? 5.661   -6.906  1.744   1.00 0.00 ? 55  LEU A HD23 3  
ATOM 4437  N N    . GLU A 1 56  ? 9.175   -4.634  5.357   1.00 0.00 ? 56  GLU A N    3  
ATOM 4438  C CA   . GLU A 1 56  ? 10.011  -3.468  5.094   1.00 0.00 ? 56  GLU A CA   3  
ATOM 4439  C C    . GLU A 1 56  ? 10.590  -3.520  3.683   1.00 0.00 ? 56  GLU A C    3  
ATOM 4440  O O    . GLU A 1 56  ? 10.606  -2.517  2.970   1.00 0.00 ? 56  GLU A O    3  
ATOM 4441  C CB   . GLU A 1 56  ? 11.143  -3.383  6.119   1.00 0.00 ? 56  GLU A CB   3  
ATOM 4442  C CG   . GLU A 1 56  ? 10.664  -3.101  7.533   1.00 0.00 ? 56  GLU A CG   3  
ATOM 4443  C CD   . GLU A 1 56  ? 11.762  -2.551  8.423   1.00 0.00 ? 56  GLU A CD   3  
ATOM 4444  O OE1  . GLU A 1 56  ? 12.062  -1.343  8.315   1.00 0.00 ? 56  GLU A OE1  3  
ATOM 4445  O OE2  . GLU A 1 56  ? 12.321  -3.327  9.225   1.00 0.00 ? 56  GLU A OE2  3  
ATOM 4446  H H    . GLU A 1 56  ? 9.574   -5.422  5.782   1.00 0.00 ? 56  GLU A H    3  
ATOM 4447  H HA   . GLU A 1 56  ? 9.390   -2.589  5.183   1.00 0.00 ? 56  GLU A HA   3  
ATOM 4448  H HB2  . GLU A 1 56  ? 11.681  -4.319  6.122   1.00 0.00 ? 56  GLU A HB2  3  
ATOM 4449  H HB3  . GLU A 1 56  ? 11.818  -2.592  5.826   1.00 0.00 ? 56  GLU A HB3  3  
ATOM 4450  H HG2  . GLU A 1 56  ? 9.861   -2.381  7.491   1.00 0.00 ? 56  GLU A HG2  3  
ATOM 4451  H HG3  . GLU A 1 56  ? 10.298  -4.021  7.966   1.00 0.00 ? 56  GLU A HG3  3  
ATOM 4452  N N    . SER A 1 57  ? 11.064  -4.697  3.288   1.00 0.00 ? 57  SER A N    3  
ATOM 4453  C CA   . SER A 1 57  ? 11.649  -4.880  1.964   1.00 0.00 ? 57  SER A CA   3  
ATOM 4454  C C    . SER A 1 57  ? 11.851  -6.362  1.660   1.00 0.00 ? 57  SER A C    3  
ATOM 4455  O O    . SER A 1 57  ? 12.315  -7.123  2.508   1.00 0.00 ? 57  SER A O    3  
ATOM 4456  C CB   . SER A 1 57  ? 12.984  -4.141  1.867   1.00 0.00 ? 57  SER A CB   3  
ATOM 4457  O OG   . SER A 1 57  ? 14.013  -4.856  2.529   1.00 0.00 ? 57  SER A OG   3  
ATOM 4458  H H    . SER A 1 57  ? 11.023  -5.460  3.902   1.00 0.00 ? 57  SER A H    3  
ATOM 4459  H HA   . SER A 1 57  ? 10.964  -4.467  1.240   1.00 0.00 ? 57  SER A HA   3  
ATOM 4460  H HB2  . SER A 1 57  ? 13.254  -4.025  0.828   1.00 0.00 ? 57  SER A HB2  3  
ATOM 4461  H HB3  . SER A 1 57  ? 12.888  -3.167  2.324   1.00 0.00 ? 57  SER A HB3  3  
ATOM 4462  H HG   . SER A 1 57  ? 14.312  -5.578  1.970   1.00 0.00 ? 57  SER A HG   3  
ATOM 4463  N N    . GLY A 1 58  ? 11.499  -6.763  0.443   1.00 0.00 ? 58  GLY A N    3  
ATOM 4464  C CA   . GLY A 1 58  ? 11.649  -8.151  0.047   1.00 0.00 ? 58  GLY A CA   3  
ATOM 4465  C C    . GLY A 1 58  ? 10.325  -8.800  -0.305  1.00 0.00 ? 58  GLY A C    3  
ATOM 4466  O O    . GLY A 1 58  ? 9.310   -8.118  -0.453  1.00 0.00 ? 58  GLY A O    3  
ATOM 4467  H H    . GLY A 1 58  ? 11.135  -6.111  -0.192  1.00 0.00 ? 58  GLY A H    3  
ATOM 4468  H HA2  . GLY A 1 58  ? 12.302  -8.201  -0.812  1.00 0.00 ? 58  GLY A HA2  3  
ATOM 4469  H HA3  . GLY A 1 58  ? 12.100  -8.699  0.861   1.00 0.00 ? 58  GLY A HA3  3  
ATOM 4470  N N    . THR A 1 59  ? 10.333  -10.123 -0.440  1.00 0.00 ? 59  THR A N    3  
ATOM 4471  C CA   . THR A 1 59  ? 9.125   -10.864 -0.779  1.00 0.00 ? 59  THR A CA   3  
ATOM 4472  C C    . THR A 1 59  ? 8.723   -11.806 0.350   1.00 0.00 ? 59  THR A C    3  
ATOM 4473  O O    . THR A 1 59  ? 9.335   -12.857 0.541   1.00 0.00 ? 59  THR A O    3  
ATOM 4474  C CB   . THR A 1 59  ? 9.311   -11.680 -2.072  1.00 0.00 ? 59  THR A CB   3  
ATOM 4475  O OG1  . THR A 1 59  ? 9.591   -10.802 -3.169  1.00 0.00 ? 59  THR A OG1  3  
ATOM 4476  C CG2  . THR A 1 59  ? 8.067   -12.500 -2.378  1.00 0.00 ? 59  THR A CG2  3  
ATOM 4477  H H    . THR A 1 59  ? 11.173  -10.610 -0.309  1.00 0.00 ? 59  THR A H    3  
ATOM 4478  H HA   . THR A 1 59  ? 8.330   -10.150 -0.939  1.00 0.00 ? 59  THR A HA   3  
ATOM 4479  H HB   . THR A 1 59  ? 10.145  -12.354 -1.938  1.00 0.00 ? 59  THR A HB   3  
ATOM 4480  H HG1  . THR A 1 59  ? 10.034  -10.015 -2.844  1.00 0.00 ? 59  THR A HG1  3  
ATOM 4481  H HG21 . THR A 1 59  ? 7.378   -12.433 -1.549  1.00 0.00 ? 59  THR A HG21 3  
ATOM 4482  H HG22 . THR A 1 59  ? 8.345   -13.532 -2.533  1.00 0.00 ? 59  THR A HG22 3  
ATOM 4483  H HG23 . THR A 1 59  ? 7.594   -12.117 -3.270  1.00 0.00 ? 59  THR A HG23 3  
ATOM 4484  N N    . SER A 1 60  ? 7.691   -11.424 1.094   1.00 0.00 ? 60  SER A N    3  
ATOM 4485  C CA   . SER A 1 60  ? 7.209   -12.235 2.207   1.00 0.00 ? 60  SER A CA   3  
ATOM 4486  C C    . SER A 1 60  ? 5.961   -13.017 1.808   1.00 0.00 ? 60  SER A C    3  
ATOM 4487  O O    . SER A 1 60  ? 4.850   -12.489 1.832   1.00 0.00 ? 60  SER A O    3  
ATOM 4488  C CB   . SER A 1 60  ? 6.905   -11.349 3.417   1.00 0.00 ? 60  SER A CB   3  
ATOM 4489  O OG   . SER A 1 60  ? 5.816   -10.481 3.153   1.00 0.00 ? 60  SER A OG   3  
ATOM 4490  H H    . SER A 1 60  ? 7.244   -10.575 0.892   1.00 0.00 ? 60  SER A H    3  
ATOM 4491  H HA   . SER A 1 60  ? 7.989   -12.934 2.470   1.00 0.00 ? 60  SER A HA   3  
ATOM 4492  H HB2  . SER A 1 60  ? 6.657   -11.972 4.262   1.00 0.00 ? 60  SER A HB2  3  
ATOM 4493  H HB3  . SER A 1 60  ? 7.776   -10.754 3.651   1.00 0.00 ? 60  SER A HB3  3  
ATOM 4494  H HG   . SER A 1 60  ? 5.603   -9.985  3.946   1.00 0.00 ? 60  SER A HG   3  
ATOM 4495  N N    . GLY A 1 61  ? 6.153   -14.281 1.443   1.00 0.00 ? 61  GLY A N    3  
ATOM 4496  C CA   . GLY A 1 61  ? 5.036   -15.116 1.044   1.00 0.00 ? 61  GLY A CA   3  
ATOM 4497  C C    . GLY A 1 61  ? 4.307   -14.570 -0.168  1.00 0.00 ? 61  GLY A C    3  
ATOM 4498  O O    . GLY A 1 61  ? 4.739   -14.771 -1.303  1.00 0.00 ? 61  GLY A O    3  
ATOM 4499  H H    . GLY A 1 61  ? 7.062   -14.648 1.444   1.00 0.00 ? 61  GLY A H    3  
ATOM 4500  H HA2  . GLY A 1 61  ? 5.403   -16.105 0.815   1.00 0.00 ? 61  GLY A HA2  3  
ATOM 4501  H HA3  . GLY A 1 61  ? 4.340   -15.183 1.868   1.00 0.00 ? 61  GLY A HA3  3  
ATOM 4502  N N    . ARG A 1 62  ? 3.197   -13.879 0.073   1.00 0.00 ? 62  ARG A N    3  
ATOM 4503  C CA   . ARG A 1 62  ? 2.406   -13.306 -1.009  1.00 0.00 ? 62  ARG A CA   3  
ATOM 4504  C C    . ARG A 1 62  ? 2.424   -11.781 -0.946  1.00 0.00 ? 62  ARG A C    3  
ATOM 4505  O O    . ARG A 1 62  ? 1.391   -11.131 -1.110  1.00 0.00 ? 62  ARG A O    3  
ATOM 4506  C CB   . ARG A 1 62  ? 0.964   -13.812 -0.938  1.00 0.00 ? 62  ARG A CB   3  
ATOM 4507  C CG   . ARG A 1 62  ? 0.844   -15.324 -1.045  1.00 0.00 ? 62  ARG A CG   3  
ATOM 4508  C CD   . ARG A 1 62  ? 0.632   -15.765 -2.485  1.00 0.00 ? 62  ARG A CD   3  
ATOM 4509  N NE   . ARG A 1 62  ? -0.785  -15.857 -2.827  1.00 0.00 ? 62  ARG A NE   3  
ATOM 4510  C CZ   . ARG A 1 62  ? -1.531  -16.929 -2.585  1.00 0.00 ? 62  ARG A CZ   3  
ATOM 4511  N NH1  . ARG A 1 62  ? -0.998  -17.994 -2.002  1.00 0.00 ? 62  ARG A NH1  3  
ATOM 4512  N NH2  . ARG A 1 62  ? -2.813  -16.937 -2.925  1.00 0.00 ? 62  ARG A NH2  3  
ATOM 4513  H H    . ARG A 1 62  ? 2.904   -13.753 0.999   1.00 0.00 ? 62  ARG A H    3  
ATOM 4514  H HA   . ARG A 1 62  ? 2.843   -13.621 -1.944  1.00 0.00 ? 62  ARG A HA   3  
ATOM 4515  H HB2  . ARG A 1 62  ? 0.532   -13.505 0.003   1.00 0.00 ? 62  ARG A HB2  3  
ATOM 4516  H HB3  . ARG A 1 62  ? 0.400   -13.370 -1.745  1.00 0.00 ? 62  ARG A HB3  3  
ATOM 4517  H HG2  . ARG A 1 62  ? 1.751   -15.775 -0.672  1.00 0.00 ? 62  ARG A HG2  3  
ATOM 4518  H HG3  . ARG A 1 62  ? 0.004   -15.651 -0.450  1.00 0.00 ? 62  ARG A HG3  3  
ATOM 4519  H HD2  . ARG A 1 62  ? 1.105   -15.049 -3.140  1.00 0.00 ? 62  ARG A HD2  3  
ATOM 4520  H HD3  . ARG A 1 62  ? 1.090   -16.734 -2.621  1.00 0.00 ? 62  ARG A HD3  3  
ATOM 4521  H HE   . ARG A 1 62  ? -1.199  -15.082 -3.258  1.00 0.00 ? 62  ARG A HE   3  
ATOM 4522  H HH11 . ARG A 1 62  ? -0.032  -17.991 -1.744  1.00 0.00 ? 62  ARG A HH11 3  
ATOM 4523  H HH12 . ARG A 1 62  ? -1.562  -18.800 -1.820  1.00 0.00 ? 62  ARG A HH12 3  
ATOM 4524  H HH21 . ARG A 1 62  ? -3.219  -16.136 -3.364  1.00 0.00 ? 62  ARG A HH21 3  
ATOM 4525  H HH22 . ARG A 1 62  ? -3.374  -17.744 -2.743  1.00 0.00 ? 62  ARG A HH22 3  
ATOM 4526  N N    . TYR A 1 63  ? 3.603   -11.218 -0.709  1.00 0.00 ? 63  TYR A N    3  
ATOM 4527  C CA   . TYR A 1 63  ? 3.756   -9.771  -0.622  1.00 0.00 ? 63  TYR A CA   3  
ATOM 4528  C C    . TYR A 1 63  ? 5.154   -9.343  -1.056  1.00 0.00 ? 63  TYR A C    3  
ATOM 4529  O O    . TYR A 1 63  ? 6.148   -9.982  -0.709  1.00 0.00 ? 63  TYR A O    3  
ATOM 4530  C CB   . TYR A 1 63  ? 3.484   -9.293  0.806   1.00 0.00 ? 63  TYR A CB   3  
ATOM 4531  C CG   . TYR A 1 63  ? 2.072   -9.560  1.276   1.00 0.00 ? 63  TYR A CG   3  
ATOM 4532  C CD1  . TYR A 1 63  ? 1.015   -8.768  0.847   1.00 0.00 ? 63  TYR A CD1  3  
ATOM 4533  C CD2  . TYR A 1 63  ? 1.795   -10.606 2.147   1.00 0.00 ? 63  TYR A CD2  3  
ATOM 4534  C CE1  . TYR A 1 63  ? -0.277  -9.008  1.274   1.00 0.00 ? 63  TYR A CE1  3  
ATOM 4535  C CE2  . TYR A 1 63  ? 0.507   -10.855 2.579   1.00 0.00 ? 63  TYR A CE2  3  
ATOM 4536  C CZ   . TYR A 1 63  ? -0.526  -10.053 2.140   1.00 0.00 ? 63  TYR A CZ   3  
ATOM 4537  O OH   . TYR A 1 63  ? -1.811  -10.296 2.567   1.00 0.00 ? 63  TYR A OH   3  
ATOM 4538  H H    . TYR A 1 63  ? 4.390   -11.789 -0.587  1.00 0.00 ? 63  TYR A H    3  
ATOM 4539  H HA   . TYR A 1 63  ? 3.032   -9.320  -1.285  1.00 0.00 ? 63  TYR A HA   3  
ATOM 4540  H HB2  . TYR A 1 63  ? 4.158   -9.797  1.481   1.00 0.00 ? 63  TYR A HB2  3  
ATOM 4541  H HB3  . TYR A 1 63  ? 3.656   -8.228  0.861   1.00 0.00 ? 63  TYR A HB3  3  
ATOM 4542  H HD1  . TYR A 1 63  ? 1.213   -7.951  0.168   1.00 0.00 ? 63  TYR A HD1  3  
ATOM 4543  H HD2  . TYR A 1 63  ? 2.606   -11.233 2.490   1.00 0.00 ? 63  TYR A HD2  3  
ATOM 4544  H HE1  . TYR A 1 63  ? -1.086  -8.380  0.930   1.00 0.00 ? 63  TYR A HE1  3  
ATOM 4545  H HE2  . TYR A 1 63  ? 0.311   -11.673 3.257   1.00 0.00 ? 63  TYR A HE2  3  
ATOM 4546  H HH   . TYR A 1 63  ? -1.787  -10.776 3.398   1.00 0.00 ? 63  TYR A HH   3  
ATOM 4547  N N    . THR A 1 64  ? 5.224   -8.255  -1.817  1.00 0.00 ? 64  THR A N    3  
ATOM 4548  C CA   . THR A 1 64  ? 6.499   -7.741  -2.300  1.00 0.00 ? 64  THR A CA   3  
ATOM 4549  C C    . THR A 1 64  ? 6.531   -6.217  -2.252  1.00 0.00 ? 64  THR A C    3  
ATOM 4550  O O    . THR A 1 64  ? 5.803   -5.548  -2.985  1.00 0.00 ? 64  THR A O    3  
ATOM 4551  C CB   . THR A 1 64  ? 6.782   -8.204  -3.741  1.00 0.00 ? 64  THR A CB   3  
ATOM 4552  O OG1  . THR A 1 64  ? 6.661   -9.628  -3.831  1.00 0.00 ? 64  THR A OG1  3  
ATOM 4553  C CG2  . THR A 1 64  ? 8.175   -7.779  -4.183  1.00 0.00 ? 64  THR A CG2  3  
ATOM 4554  H H    . THR A 1 64  ? 4.397   -7.789  -2.060  1.00 0.00 ? 64  THR A H    3  
ATOM 4555  H HA   . THR A 1 64  ? 7.279   -8.128  -1.660  1.00 0.00 ? 64  THR A HA   3  
ATOM 4556  H HB   . THR A 1 64  ? 6.057   -7.746  -4.399  1.00 0.00 ? 64  THR A HB   3  
ATOM 4557  H HG1  . THR A 1 64  ? 7.520   -10.032 -3.683  1.00 0.00 ? 64  THR A HG1  3  
ATOM 4558  H HG21 . THR A 1 64  ? 8.225   -7.776  -5.261  1.00 0.00 ? 64  THR A HG21 3  
ATOM 4559  H HG22 . THR A 1 64  ? 8.904   -8.472  -3.790  1.00 0.00 ? 64  THR A HG22 3  
ATOM 4560  H HG23 . THR A 1 64  ? 8.383   -6.788  -3.810  1.00 0.00 ? 64  THR A HG23 3  
ATOM 4561  N N    . VAL A 1 65  ? 7.380   -5.675  -1.385  1.00 0.00 ? 65  VAL A N    3  
ATOM 4562  C CA   . VAL A 1 65  ? 7.508   -4.230  -1.243  1.00 0.00 ? 65  VAL A CA   3  
ATOM 4563  C C    . VAL A 1 65  ? 8.577   -3.678  -2.179  1.00 0.00 ? 65  VAL A C    3  
ATOM 4564  O O    . VAL A 1 65  ? 9.646   -4.268  -2.332  1.00 0.00 ? 65  VAL A O    3  
ATOM 4565  C CB   . VAL A 1 65  ? 7.857   -3.837  0.205   1.00 0.00 ? 65  VAL A CB   3  
ATOM 4566  C CG1  . VAL A 1 65  ? 8.246   -2.368  0.281   1.00 0.00 ? 65  VAL A CG1  3  
ATOM 4567  C CG2  . VAL A 1 65  ? 6.690   -4.137  1.134   1.00 0.00 ? 65  VAL A CG2  3  
ATOM 4568  H H    . VAL A 1 65  ? 7.934   -6.261  -0.828  1.00 0.00 ? 65  VAL A H    3  
ATOM 4569  H HA   . VAL A 1 65  ? 6.557   -3.783  -1.495  1.00 0.00 ? 65  VAL A HA   3  
ATOM 4570  H HB   . VAL A 1 65  ? 8.704   -4.427  0.523   1.00 0.00 ? 65  VAL A HB   3  
ATOM 4571  H HG11 . VAL A 1 65  ? 8.024   -1.888  -0.660  1.00 0.00 ? 65  VAL A HG11 3  
ATOM 4572  H HG12 . VAL A 1 65  ? 7.688   -1.888  1.072   1.00 0.00 ? 65  VAL A HG12 3  
ATOM 4573  H HG13 . VAL A 1 65  ? 9.303   -2.286  0.486   1.00 0.00 ? 65  VAL A HG13 3  
ATOM 4574  H HG21 . VAL A 1 65  ? 6.837   -3.624  2.073   1.00 0.00 ? 65  VAL A HG21 3  
ATOM 4575  H HG22 . VAL A 1 65  ? 5.771   -3.797  0.679   1.00 0.00 ? 65  VAL A HG22 3  
ATOM 4576  H HG23 . VAL A 1 65  ? 6.633   -5.200  1.310   1.00 0.00 ? 65  VAL A HG23 3  
ATOM 4577  N N    . GLU A 1 66  ? 8.281   -2.542  -2.802  1.00 0.00 ? 66  GLU A N    3  
ATOM 4578  C CA   . GLU A 1 66  ? 9.218   -1.911  -3.724  1.00 0.00 ? 66  GLU A CA   3  
ATOM 4579  C C    . GLU A 1 66  ? 9.059   -0.393  -3.708  1.00 0.00 ? 66  GLU A C    3  
ATOM 4580  O O    . GLU A 1 66  ? 8.049   0.143   -4.167  1.00 0.00 ? 66  GLU A O    3  
ATOM 4581  C CB   . GLU A 1 66  ? 9.007   -2.441  -5.144  1.00 0.00 ? 66  GLU A CB   3  
ATOM 4582  C CG   . GLU A 1 66  ? 9.291   -3.927  -5.287  1.00 0.00 ? 66  GLU A CG   3  
ATOM 4583  C CD   . GLU A 1 66  ? 9.303   -4.382  -6.734  1.00 0.00 ? 66  GLU A CD   3  
ATOM 4584  O OE1  . GLU A 1 66  ? 8.213   -4.663  -7.275  1.00 0.00 ? 66  GLU A OE1  3  
ATOM 4585  O OE2  . GLU A 1 66  ? 10.400  -4.456  -7.324  1.00 0.00 ? 66  GLU A OE2  3  
ATOM 4586  H H    . GLU A 1 66  ? 7.413   -2.119  -2.639  1.00 0.00 ? 66  GLU A H    3  
ATOM 4587  H HA   . GLU A 1 66  ? 10.218  -2.159  -3.403  1.00 0.00 ? 66  GLU A HA   3  
ATOM 4588  H HB2  . GLU A 1 66  ? 7.982   -2.262  -5.433  1.00 0.00 ? 66  GLU A HB2  3  
ATOM 4589  H HB3  . GLU A 1 66  ? 9.660   -1.904  -5.816  1.00 0.00 ? 66  GLU A HB3  3  
ATOM 4590  H HG2  . GLU A 1 66  ? 10.256  -4.139  -4.852  1.00 0.00 ? 66  GLU A HG2  3  
ATOM 4591  H HG3  . GLU A 1 66  ? 8.529   -4.479  -4.757  1.00 0.00 ? 66  GLU A HG3  3  
ATOM 4592  N N    . THR A 1 67  ? 10.063  0.296   -3.175  1.00 0.00 ? 67  THR A N    3  
ATOM 4593  C CA   . THR A 1 67  ? 10.035  1.751   -3.096  1.00 0.00 ? 67  THR A CA   3  
ATOM 4594  C C    . THR A 1 67  ? 10.670  2.381   -4.331  1.00 0.00 ? 67  THR A C    3  
ATOM 4595  O O    . THR A 1 67  ? 11.540  1.784   -4.965  1.00 0.00 ? 67  THR A O    3  
ATOM 4596  C CB   . THR A 1 67  ? 10.768  2.260   -1.840  1.00 0.00 ? 67  THR A CB   3  
ATOM 4597  O OG1  . THR A 1 67  ? 10.364  1.499   -0.696  1.00 0.00 ? 67  THR A OG1  3  
ATOM 4598  C CG2  . THR A 1 67  ? 10.477  3.734   -1.604  1.00 0.00 ? 67  THR A CG2  3  
ATOM 4599  H H    . THR A 1 67  ? 10.841  -0.188  -2.826  1.00 0.00 ? 67  THR A H    3  
ATOM 4600  H HA   . THR A 1 67  ? 9.002   2.062   -3.035  1.00 0.00 ? 67  THR A HA   3  
ATOM 4601  H HB   . THR A 1 67  ? 11.832  2.137   -1.988  1.00 0.00 ? 67  THR A HB   3  
ATOM 4602  H HG1  . THR A 1 67  ? 9.469   1.176   -0.825  1.00 0.00 ? 67  THR A HG1  3  
ATOM 4603  H HG21 . THR A 1 67  ? 9.521   3.987   -2.038  1.00 0.00 ? 67  THR A HG21 3  
ATOM 4604  H HG22 . THR A 1 67  ? 11.251  4.331   -2.063  1.00 0.00 ? 67  THR A HG22 3  
ATOM 4605  H HG23 . THR A 1 67  ? 10.453  3.930   -0.543  1.00 0.00 ? 67  THR A HG23 3  
ATOM 4606  N N    . ILE A 1 68  ? 10.229  3.589   -4.665  1.00 0.00 ? 68  ILE A N    3  
ATOM 4607  C CA   . ILE A 1 68  ? 10.756  4.299   -5.824  1.00 0.00 ? 68  ILE A CA   3  
ATOM 4608  C C    . ILE A 1 68  ? 10.886  5.792   -5.541  1.00 0.00 ? 68  ILE A C    3  
ATOM 4609  O O    . ILE A 1 68  ? 10.237  6.322   -4.639  1.00 0.00 ? 68  ILE A O    3  
ATOM 4610  C CB   . ILE A 1 68  ? 9.863   4.099   -7.062  1.00 0.00 ? 68  ILE A CB   3  
ATOM 4611  C CG1  . ILE A 1 68  ? 9.387   2.647   -7.145  1.00 0.00 ? 68  ILE A CG1  3  
ATOM 4612  C CG2  . ILE A 1 68  ? 10.614  4.489   -8.326  1.00 0.00 ? 68  ILE A CG2  3  
ATOM 4613  C CD1  . ILE A 1 68  ? 8.202   2.451   -8.064  1.00 0.00 ? 68  ILE A CD1  3  
ATOM 4614  H H    . ILE A 1 68  ? 9.534   4.012   -4.120  1.00 0.00 ? 68  ILE A H    3  
ATOM 4615  H HA   . ILE A 1 68  ? 11.736  3.899   -6.043  1.00 0.00 ? 68  ILE A HA   3  
ATOM 4616  H HB   . ILE A 1 68  ? 9.005   4.746   -6.968  1.00 0.00 ? 68  ILE A HB   3  
ATOM 4617  H HG12 . ILE A 1 68  ? 10.194  2.031   -7.509  1.00 0.00 ? 68  ILE A HG12 3  
ATOM 4618  H HG13 . ILE A 1 68  ? 9.102   2.313   -6.158  1.00 0.00 ? 68  ILE A HG13 3  
ATOM 4619  H HG21 . ILE A 1 68  ? 11.657  4.230   -8.219  1.00 0.00 ? 68  ILE A HG21 3  
ATOM 4620  H HG22 . ILE A 1 68  ? 10.198  3.960   -9.170  1.00 0.00 ? 68  ILE A HG22 3  
ATOM 4621  H HG23 . ILE A 1 68  ? 10.522  5.553   -8.486  1.00 0.00 ? 68  ILE A HG23 3  
ATOM 4622  H HD11 . ILE A 1 68  ? 8.098   3.312   -8.707  1.00 0.00 ? 68  ILE A HD11 3  
ATOM 4623  H HD12 . ILE A 1 68  ? 8.355   1.568   -8.666  1.00 0.00 ? 68  ILE A HD12 3  
ATOM 4624  H HD13 . ILE A 1 68  ? 7.305   2.333   -7.474  1.00 0.00 ? 68  ILE A HD13 3  
ATOM 4625  N N    . SER A 1 69  ? 11.727  6.466   -6.318  1.00 0.00 ? 69  SER A N    3  
ATOM 4626  C CA   . SER A 1 69  ? 11.944  7.898   -6.150  1.00 0.00 ? 69  SER A CA   3  
ATOM 4627  C C    . SER A 1 69  ? 11.333  8.679   -7.310  1.00 0.00 ? 69  SER A C    3  
ATOM 4628  O O    . SER A 1 69  ? 11.667  8.451   -8.473  1.00 0.00 ? 69  SER A O    3  
ATOM 4629  C CB   . SER A 1 69  ? 13.440  8.201   -6.048  1.00 0.00 ? 69  SER A CB   3  
ATOM 4630  O OG   . SER A 1 69  ? 14.001  7.613   -4.888  1.00 0.00 ? 69  SER A OG   3  
ATOM 4631  H H    . SER A 1 69  ? 12.216  5.987   -7.020  1.00 0.00 ? 69  SER A H    3  
ATOM 4632  H HA   . SER A 1 69  ? 11.460  8.201   -5.233  1.00 0.00 ? 69  SER A HA   3  
ATOM 4633  H HB2  . SER A 1 69  ? 13.944  7.806   -6.917  1.00 0.00 ? 69  SER A HB2  3  
ATOM 4634  H HB3  . SER A 1 69  ? 13.585  9.270   -6.002  1.00 0.00 ? 69  SER A HB3  3  
ATOM 4635  H HG   . SER A 1 69  ? 13.478  6.850   -4.630  1.00 0.00 ? 69  SER A HG   3  
ATOM 4636  N N    . THR A 1 70  ? 10.434  9.603   -6.984  1.00 0.00 ? 70  THR A N    3  
ATOM 4637  C CA   . THR A 1 70  ? 9.775   10.419  -7.997  1.00 0.00 ? 70  THR A CA   3  
ATOM 4638  C C    . THR A 1 70  ? 10.136  11.891  -7.837  1.00 0.00 ? 70  THR A C    3  
ATOM 4639  O O    . THR A 1 70  ? 10.729  12.289  -6.836  1.00 0.00 ? 70  THR A O    3  
ATOM 4640  C CB   . THR A 1 70  ? 8.244   10.267  -7.931  1.00 0.00 ? 70  THR A CB   3  
ATOM 4641  O OG1  . THR A 1 70  ? 7.763   10.697  -6.652  1.00 0.00 ? 70  THR A OG1  3  
ATOM 4642  C CG2  . THR A 1 70  ? 7.832   8.822   -8.173  1.00 0.00 ? 70  THR A CG2  3  
ATOM 4643  H H    . THR A 1 70  ? 10.210  9.738   -6.040  1.00 0.00 ? 70  THR A H    3  
ATOM 4644  H HA   . THR A 1 70  ? 10.108  10.079  -8.967  1.00 0.00 ? 70  THR A HA   3  
ATOM 4645  H HB   . THR A 1 70  ? 7.802   10.885  -8.700  1.00 0.00 ? 70  THR A HB   3  
ATOM 4646  H HG1  . THR A 1 70  ? 6.803   10.696  -6.654  1.00 0.00 ? 70  THR A HG1  3  
ATOM 4647  H HG21 . THR A 1 70  ? 8.616   8.310   -8.711  1.00 0.00 ? 70  THR A HG21 3  
ATOM 4648  H HG22 . THR A 1 70  ? 6.922   8.800   -8.753  1.00 0.00 ? 70  THR A HG22 3  
ATOM 4649  H HG23 . THR A 1 70  ? 7.667   8.332   -7.225  1.00 0.00 ? 70  THR A HG23 3  
ATOM 4650  N N    . GLU A 1 71  ? 9.772   12.696  -8.832  1.00 0.00 ? 71  GLU A N    3  
ATOM 4651  C CA   . GLU A 1 71  ? 10.059  14.125  -8.800  1.00 0.00 ? 71  GLU A CA   3  
ATOM 4652  C C    . GLU A 1 71  ? 9.319   14.803  -7.650  1.00 0.00 ? 71  GLU A C    3  
ATOM 4653  O O    . GLU A 1 71  ? 9.828   15.742  -7.040  1.00 0.00 ? 71  GLU A O    3  
ATOM 4654  C CB   . GLU A 1 71  ? 9.665   14.776  -10.128 1.00 0.00 ? 71  GLU A CB   3  
ATOM 4655  C CG   . GLU A 1 71  ? 8.195   14.612  -10.474 1.00 0.00 ? 71  GLU A CG   3  
ATOM 4656  C CD   . GLU A 1 71  ? 7.904   14.901  -11.934 1.00 0.00 ? 71  GLU A CD   3  
ATOM 4657  O OE1  . GLU A 1 71  ? 8.222   14.042  -12.783 1.00 0.00 ? 71  GLU A OE1  3  
ATOM 4658  O OE2  . GLU A 1 71  ? 7.359   15.986  -12.227 1.00 0.00 ? 71  GLU A OE2  3  
ATOM 4659  H H    . GLU A 1 71  ? 9.302   12.319  -9.604  1.00 0.00 ? 71  GLU A H    3  
ATOM 4660  H HA   . GLU A 1 71  ? 11.121  14.247  -8.651  1.00 0.00 ? 71  GLU A HA   3  
ATOM 4661  H HB2  . GLU A 1 71  ? 9.887   15.832  -10.077 1.00 0.00 ? 71  GLU A HB2  3  
ATOM 4662  H HB3  . GLU A 1 71  ? 10.252  14.332  -10.919 1.00 0.00 ? 71  GLU A HB3  3  
ATOM 4663  H HG2  . GLU A 1 71  ? 7.899   13.596  -10.259 1.00 0.00 ? 71  GLU A HG2  3  
ATOM 4664  H HG3  . GLU A 1 71  ? 7.617   15.291  -9.865  1.00 0.00 ? 71  GLU A HG3  3  
ATOM 4665  N N    . GLU A 1 72  ? 8.115   14.318  -7.361  1.00 0.00 ? 72  GLU A N    3  
ATOM 4666  C CA   . GLU A 1 72  ? 7.305   14.878  -6.286  1.00 0.00 ? 72  GLU A CA   3  
ATOM 4667  C C    . GLU A 1 72  ? 7.765   14.354  -4.929  1.00 0.00 ? 72  GLU A C    3  
ATOM 4668  O O    . GLU A 1 72  ? 7.414   14.906  -3.887  1.00 0.00 ? 72  GLU A O    3  
ATOM 4669  C CB   . GLU A 1 72  ? 5.828   14.541  -6.501  1.00 0.00 ? 72  GLU A CB   3  
ATOM 4670  C CG   . GLU A 1 72  ? 5.548   13.049  -6.564  1.00 0.00 ? 72  GLU A CG   3  
ATOM 4671  C CD   . GLU A 1 72  ? 4.199   12.734  -7.181  1.00 0.00 ? 72  GLU A CD   3  
ATOM 4672  O OE1  . GLU A 1 72  ? 3.170   13.124  -6.590  1.00 0.00 ? 72  GLU A OE1  3  
ATOM 4673  O OE2  . GLU A 1 72  ? 4.173   12.098  -8.255  1.00 0.00 ? 72  GLU A OE2  3  
ATOM 4674  H H    . GLU A 1 72  ? 7.764   13.568  -7.884  1.00 0.00 ? 72  GLU A H    3  
ATOM 4675  H HA   . GLU A 1 72  ? 7.426   15.951  -6.304  1.00 0.00 ? 72  GLU A HA   3  
ATOM 4676  H HB2  . GLU A 1 72  ? 5.253   14.961  -5.689  1.00 0.00 ? 72  GLU A HB2  3  
ATOM 4677  H HB3  . GLU A 1 72  ? 5.502   14.986  -7.429  1.00 0.00 ? 72  GLU A HB3  3  
ATOM 4678  H HG2  . GLU A 1 72  ? 6.316   12.576  -7.156  1.00 0.00 ? 72  GLU A HG2  3  
ATOM 4679  H HG3  . GLU A 1 72  ? 5.570   12.649  -5.561  1.00 0.00 ? 72  GLU A HG3  3  
ATOM 4680  N N    . GLY A 1 73  ? 8.554   13.284  -4.950  1.00 0.00 ? 73  GLY A N    3  
ATOM 4681  C CA   . GLY A 1 73  ? 9.049   12.702  -3.716  1.00 0.00 ? 73  GLY A CA   3  
ATOM 4682  C C    . GLY A 1 73  ? 9.423   11.242  -3.873  1.00 0.00 ? 73  GLY A C    3  
ATOM 4683  O O    . GLY A 1 73  ? 10.461  10.917  -4.449  1.00 0.00 ? 73  GLY A O    3  
ATOM 4684  H H    . GLY A 1 73  ? 8.801   12.886  -5.811  1.00 0.00 ? 73  GLY A H    3  
ATOM 4685  H HA2  . GLY A 1 73  ? 9.920   13.254  -3.395  1.00 0.00 ? 73  GLY A HA2  3  
ATOM 4686  H HA3  . GLY A 1 73  ? 8.283   12.786  -2.960  1.00 0.00 ? 73  GLY A HA3  3  
ATOM 4687  N N    . VAL A 1 74  ? 8.575   10.357  -3.358  1.00 0.00 ? 74  VAL A N    3  
ATOM 4688  C CA   . VAL A 1 74  ? 8.822   8.922   -3.443  1.00 0.00 ? 74  VAL A CA   3  
ATOM 4689  C C    . VAL A 1 74  ? 7.514   8.144   -3.531  1.00 0.00 ? 74  VAL A C    3  
ATOM 4690  O O    . VAL A 1 74  ? 6.430   8.714   -3.397  1.00 0.00 ? 74  VAL A O    3  
ATOM 4691  C CB   . VAL A 1 74  ? 9.626   8.418   -2.230  1.00 0.00 ? 74  VAL A CB   3  
ATOM 4692  C CG1  . VAL A 1 74  ? 11.119  8.488   -2.512  1.00 0.00 ? 74  VAL A CG1  3  
ATOM 4693  C CG2  . VAL A 1 74  ? 9.272   9.220   -0.986  1.00 0.00 ? 74  VAL A CG2  3  
ATOM 4694  H H    . VAL A 1 74  ? 7.764   10.676  -2.911  1.00 0.00 ? 74  VAL A H    3  
ATOM 4695  H HA   . VAL A 1 74  ? 9.401   8.735   -4.335  1.00 0.00 ? 74  VAL A HA   3  
ATOM 4696  H HB   . VAL A 1 74  ? 9.363   7.386   -2.053  1.00 0.00 ? 74  VAL A HB   3  
ATOM 4697  H HG11 . VAL A 1 74  ? 11.666  8.268   -1.607  1.00 0.00 ? 74  VAL A HG11 3  
ATOM 4698  H HG12 . VAL A 1 74  ? 11.375  7.767   -3.274  1.00 0.00 ? 74  VAL A HG12 3  
ATOM 4699  H HG13 . VAL A 1 74  ? 11.374  9.480   -2.854  1.00 0.00 ? 74  VAL A HG13 3  
ATOM 4700  H HG21 . VAL A 1 74  ? 9.291   10.274  -1.221  1.00 0.00 ? 74  VAL A HG21 3  
ATOM 4701  H HG22 . VAL A 1 74  ? 8.283   8.944   -0.648  1.00 0.00 ? 74  VAL A HG22 3  
ATOM 4702  H HG23 . VAL A 1 74  ? 9.989   9.012   -0.207  1.00 0.00 ? 74  VAL A HG23 3  
ATOM 4703  N N    . ILE A 1 75  ? 7.622   6.839   -3.755  1.00 0.00 ? 75  ILE A N    3  
ATOM 4704  C CA   . ILE A 1 75  ? 6.448   5.982   -3.859  1.00 0.00 ? 75  ILE A CA   3  
ATOM 4705  C C    . ILE A 1 75  ? 6.769   4.555   -3.428  1.00 0.00 ? 75  ILE A C    3  
ATOM 4706  O O    . ILE A 1 75  ? 7.753   3.966   -3.877  1.00 0.00 ? 75  ILE A O    3  
ATOM 4707  C CB   . ILE A 1 75  ? 5.892   5.960   -5.295  1.00 0.00 ? 75  ILE A CB   3  
ATOM 4708  C CG1  . ILE A 1 75  ? 5.392   7.350   -5.693  1.00 0.00 ? 75  ILE A CG1  3  
ATOM 4709  C CG2  . ILE A 1 75  ? 4.775   4.934   -5.416  1.00 0.00 ? 75  ILE A CG2  3  
ATOM 4710  C CD1  . ILE A 1 75  ? 4.725   7.386   -7.050  1.00 0.00 ? 75  ILE A CD1  3  
ATOM 4711  H H    . ILE A 1 75  ? 8.513   6.443   -3.852  1.00 0.00 ? 75  ILE A H    3  
ATOM 4712  H HA   . ILE A 1 75  ? 5.686   6.381   -3.206  1.00 0.00 ? 75  ILE A HA   3  
ATOM 4713  H HB   . ILE A 1 75  ? 6.690   5.668   -5.962  1.00 0.00 ? 75  ILE A HB   3  
ATOM 4714  H HG12 . ILE A 1 75  ? 4.675   7.690   -4.963  1.00 0.00 ? 75  ILE A HG12 3  
ATOM 4715  H HG13 . ILE A 1 75  ? 6.229   8.033   -5.716  1.00 0.00 ? 75  ILE A HG13 3  
ATOM 4716  H HG21 . ILE A 1 75  ? 3.860   5.431   -5.704  1.00 0.00 ? 75  ILE A HG21 3  
ATOM 4717  H HG22 . ILE A 1 75  ? 5.038   4.202   -6.165  1.00 0.00 ? 75  ILE A HG22 3  
ATOM 4718  H HG23 . ILE A 1 75  ? 4.634   4.442   -4.465  1.00 0.00 ? 75  ILE A HG23 3  
ATOM 4719  H HD11 . ILE A 1 75  ? 4.564   6.377   -7.400  1.00 0.00 ? 75  ILE A HD11 3  
ATOM 4720  H HD12 . ILE A 1 75  ? 3.777   7.897   -6.973  1.00 0.00 ? 75  ILE A HD12 3  
ATOM 4721  H HD13 . ILE A 1 75  ? 5.360   7.911   -7.750  1.00 0.00 ? 75  ILE A HD13 3  
ATOM 4722  N N    . SER A 1 76  ? 5.931   4.003   -2.556  1.00 0.00 ? 76  SER A N    3  
ATOM 4723  C CA   . SER A 1 76  ? 6.126   2.645   -2.063  1.00 0.00 ? 76  SER A CA   3  
ATOM 4724  C C    . SER A 1 76  ? 5.075   1.701   -2.639  1.00 0.00 ? 76  SER A C    3  
ATOM 4725  O O    . SER A 1 76  ? 3.920   1.704   -2.212  1.00 0.00 ? 76  SER A O    3  
ATOM 4726  C CB   . SER A 1 76  ? 6.066   2.621   -0.534  1.00 0.00 ? 76  SER A CB   3  
ATOM 4727  O OG   . SER A 1 76  ? 6.867   1.577   -0.008  1.00 0.00 ? 76  SER A OG   3  
ATOM 4728  H H    . SER A 1 76  ? 5.165   4.523   -2.235  1.00 0.00 ? 76  SER A H    3  
ATOM 4729  H HA   . SER A 1 76  ? 7.104   2.314   -2.381  1.00 0.00 ? 76  SER A HA   3  
ATOM 4730  H HB2  . SER A 1 76  ? 6.425   3.563   -0.148  1.00 0.00 ? 76  SER A HB2  3  
ATOM 4731  H HB3  . SER A 1 76  ? 5.044   2.469   -0.219  1.00 0.00 ? 76  SER A HB3  3  
ATOM 4732  H HG   . SER A 1 76  ? 7.649   1.950   0.406   1.00 0.00 ? 76  SER A HG   3  
ATOM 4733  N N    . THR A 1 77  ? 5.484   0.893   -3.613  1.00 0.00 ? 77  THR A N    3  
ATOM 4734  C CA   . THR A 1 77  ? 4.579   -0.055  -4.249  1.00 0.00 ? 77  THR A CA   3  
ATOM 4735  C C    . THR A 1 77  ? 4.635   -1.415  -3.561  1.00 0.00 ? 77  THR A C    3  
ATOM 4736  O O    . THR A 1 77  ? 5.715   -1.938  -3.284  1.00 0.00 ? 77  THR A O    3  
ATOM 4737  C CB   . THR A 1 77  ? 4.912   -0.234  -5.742  1.00 0.00 ? 77  THR A CB   3  
ATOM 4738  O OG1  . THR A 1 77  ? 5.155   1.041   -6.346  1.00 0.00 ? 77  THR A OG1  3  
ATOM 4739  C CG2  . THR A 1 77  ? 3.777   -0.938  -6.470  1.00 0.00 ? 77  THR A CG2  3  
ATOM 4740  H H    . THR A 1 77  ? 6.417   0.938   -3.909  1.00 0.00 ? 77  THR A H    3  
ATOM 4741  H HA   . THR A 1 77  ? 3.575   0.337   -4.170  1.00 0.00 ? 77  THR A HA   3  
ATOM 4742  H HB   . THR A 1 77  ? 5.804   -0.839  -5.827  1.00 0.00 ? 77  THR A HB   3  
ATOM 4743  H HG1  . THR A 1 77  ? 6.077   1.283   -6.226  1.00 0.00 ? 77  THR A HG1  3  
ATOM 4744  H HG21 . THR A 1 77  ? 3.016   -0.217  -6.732  1.00 0.00 ? 77  THR A HG21 3  
ATOM 4745  H HG22 . THR A 1 77  ? 3.351   -1.693  -5.827  1.00 0.00 ? 77  THR A HG22 3  
ATOM 4746  H HG23 . THR A 1 77  ? 4.157   -1.401  -7.367  1.00 0.00 ? 77  THR A HG23 3  
ATOM 4747  N N    . LEU A 1 78  ? 3.465   -1.983  -3.290  1.00 0.00 ? 78  LEU A N    3  
ATOM 4748  C CA   . LEU A 1 78  ? 3.380   -3.283  -2.634  1.00 0.00 ? 78  LEU A CA   3  
ATOM 4749  C C    . LEU A 1 78  ? 2.614   -4.280  -3.499  1.00 0.00 ? 78  LEU A C    3  
ATOM 4750  O O    . LEU A 1 78  ? 1.393   -4.193  -3.632  1.00 0.00 ? 78  LEU A O    3  
ATOM 4751  C CB   . LEU A 1 78  ? 2.701   -3.146  -1.271  1.00 0.00 ? 78  LEU A CB   3  
ATOM 4752  C CG   . LEU A 1 78  ? 2.110   -4.428  -0.683  1.00 0.00 ? 78  LEU A CG   3  
ATOM 4753  C CD1  . LEU A 1 78  ? 3.214   -5.329  -0.150  1.00 0.00 ? 78  LEU A CD1  3  
ATOM 4754  C CD2  . LEU A 1 78  ? 1.110   -4.099  0.416   1.00 0.00 ? 78  LEU A CD2  3  
ATOM 4755  H H    . LEU A 1 78  ? 2.639   -1.518  -3.535  1.00 0.00 ? 78  LEU A H    3  
ATOM 4756  H HA   . LEU A 1 78  ? 4.386   -3.648  -2.491  1.00 0.00 ? 78  LEU A HA   3  
ATOM 4757  H HB2  . LEU A 1 78  ? 3.433   -2.770  -0.573  1.00 0.00 ? 78  LEU A HB2  3  
ATOM 4758  H HB3  . LEU A 1 78  ? 1.900   -2.427  -1.372  1.00 0.00 ? 78  LEU A HB3  3  
ATOM 4759  H HG   . LEU A 1 78  ? 1.588   -4.966  -1.462  1.00 0.00 ? 78  LEU A HG   3  
ATOM 4760  H HD11 . LEU A 1 78  ? 3.802   -5.703  -0.974  1.00 0.00 ? 78  LEU A HD11 3  
ATOM 4761  H HD12 . LEU A 1 78  ? 2.774   -6.158  0.384   1.00 0.00 ? 78  LEU A HD12 3  
ATOM 4762  H HD13 . LEU A 1 78  ? 3.847   -4.765  0.519   1.00 0.00 ? 78  LEU A HD13 3  
ATOM 4763  H HD21 . LEU A 1 78  ? 1.050   -4.927  1.107   1.00 0.00 ? 78  LEU A HD21 3  
ATOM 4764  H HD22 . LEU A 1 78  ? 0.138   -3.926  -0.022  1.00 0.00 ? 78  LEU A HD22 3  
ATOM 4765  H HD23 . LEU A 1 78  ? 1.432   -3.213  0.942   1.00 0.00 ? 78  LEU A HD23 3  
ATOM 4766  N N    . THR A 1 79  ? 3.340   -5.228  -4.084  1.00 0.00 ? 79  THR A N    3  
ATOM 4767  C CA   . THR A 1 79  ? 2.729   -6.242  -4.934  1.00 0.00 ? 79  THR A CA   3  
ATOM 4768  C C    . THR A 1 79  ? 2.272   -7.444  -4.115  1.00 0.00 ? 79  THR A C    3  
ATOM 4769  O O    . THR A 1 79  ? 2.933   -7.840  -3.155  1.00 0.00 ? 79  THR A O    3  
ATOM 4770  C CB   . THR A 1 79  ? 3.704   -6.720  -6.027  1.00 0.00 ? 79  THR A CB   3  
ATOM 4771  O OG1  . THR A 1 79  ? 4.357   -5.596  -6.627  1.00 0.00 ? 79  THR A OG1  3  
ATOM 4772  C CG2  . THR A 1 79  ? 2.970   -7.516  -7.095  1.00 0.00 ? 79  THR A CG2  3  
ATOM 4773  H H    . THR A 1 79  ? 4.309   -5.244  -3.939  1.00 0.00 ? 79  THR A H    3  
ATOM 4774  H HA   . THR A 1 79  ? 1.870   -5.799  -5.416  1.00 0.00 ? 79  THR A HA   3  
ATOM 4775  H HB   . THR A 1 79  ? 4.447   -7.358  -5.570  1.00 0.00 ? 79  THR A HB   3  
ATOM 4776  H HG1  . THR A 1 79  ? 4.982   -5.219  -6.003  1.00 0.00 ? 79  THR A HG1  3  
ATOM 4777  H HG21 . THR A 1 79  ? 2.157   -6.926  -7.490  1.00 0.00 ? 79  THR A HG21 3  
ATOM 4778  H HG22 . THR A 1 79  ? 2.579   -8.425  -6.662  1.00 0.00 ? 79  THR A HG22 3  
ATOM 4779  H HG23 . THR A 1 79  ? 3.655   -7.763  -7.893  1.00 0.00 ? 79  THR A HG23 3  
ATOM 4780  N N    . ILE A 1 80  ? 1.139   -8.021  -4.502  1.00 0.00 ? 80  ILE A N    3  
ATOM 4781  C CA   . ILE A 1 80  ? 0.595   -9.179  -3.804  1.00 0.00 ? 80  ILE A CA   3  
ATOM 4782  C C    . ILE A 1 80  ? 0.371   -10.343 -4.763  1.00 0.00 ? 80  ILE A C    3  
ATOM 4783  O O    . ILE A 1 80  ? -0.546  -10.317 -5.584  1.00 0.00 ? 80  ILE A O    3  
ATOM 4784  C CB   . ILE A 1 80  ? -0.734  -8.841  -3.104  1.00 0.00 ? 80  ILE A CB   3  
ATOM 4785  C CG1  . ILE A 1 80  ? -0.576  -7.592  -2.235  1.00 0.00 ? 80  ILE A CG1  3  
ATOM 4786  C CG2  . ILE A 1 80  ? -1.205  -10.020 -2.265  1.00 0.00 ? 80  ILE A CG2  3  
ATOM 4787  C CD1  . ILE A 1 80  ? -1.872  -6.846  -2.007  1.00 0.00 ? 80  ILE A CD1  3  
ATOM 4788  H H    . ILE A 1 80  ? 0.658   -7.659  -5.275  1.00 0.00 ? 80  ILE A H    3  
ATOM 4789  H HA   . ILE A 1 80  ? 1.309   -9.479  -3.051  1.00 0.00 ? 80  ILE A HA   3  
ATOM 4790  H HB   . ILE A 1 80  ? -1.477  -8.651  -3.863  1.00 0.00 ? 80  ILE A HB   3  
ATOM 4791  H HG12 . ILE A 1 80  ? -0.185  -7.878  -1.271  1.00 0.00 ? 80  ILE A HG12 3  
ATOM 4792  H HG13 . ILE A 1 80  ? 0.118   -6.916  -2.714  1.00 0.00 ? 80  ILE A HG13 3  
ATOM 4793  H HG21 . ILE A 1 80  ? -0.488  -10.824 -2.340  1.00 0.00 ? 80  ILE A HG21 3  
ATOM 4794  H HG22 . ILE A 1 80  ? -1.295  -9.714  -1.233  1.00 0.00 ? 80  ILE A HG22 3  
ATOM 4795  H HG23 . ILE A 1 80  ? -2.165  -10.358 -2.625  1.00 0.00 ? 80  ILE A HG23 3  
ATOM 4796  H HD11 . ILE A 1 80  ? -1.744  -5.809  -2.281  1.00 0.00 ? 80  ILE A HD11 3  
ATOM 4797  H HD12 . ILE A 1 80  ? -2.652  -7.285  -2.611  1.00 0.00 ? 80  ILE A HD12 3  
ATOM 4798  H HD13 . ILE A 1 80  ? -2.146  -6.910  -0.964  1.00 0.00 ? 80  ILE A HD13 3  
ATOM 4799  N N    . SER A 1 81  ? 1.213   -11.365 -4.651  1.00 0.00 ? 81  SER A N    3  
ATOM 4800  C CA   . SER A 1 81  ? 1.108   -12.539 -5.510  1.00 0.00 ? 81  SER A CA   3  
ATOM 4801  C C    . SER A 1 81  ? -0.186  -13.299 -5.236  1.00 0.00 ? 81  SER A C    3  
ATOM 4802  O O    . SER A 1 81  ? -0.569  -13.500 -4.084  1.00 0.00 ? 81  SER A O    3  
ATOM 4803  C CB   . SER A 1 81  ? 2.309   -13.462 -5.296  1.00 0.00 ? 81  SER A CB   3  
ATOM 4804  O OG   . SER A 1 81  ? 2.337   -14.496 -6.265  1.00 0.00 ? 81  SER A OG   3  
ATOM 4805  H H    . SER A 1 81  ? 1.924   -11.327 -3.977  1.00 0.00 ? 81  SER A H    3  
ATOM 4806  H HA   . SER A 1 81  ? 1.103   -12.201 -6.535  1.00 0.00 ? 81  SER A HA   3  
ATOM 4807  H HB2  . SER A 1 81  ? 3.220   -12.888 -5.374  1.00 0.00 ? 81  SER A HB2  3  
ATOM 4808  H HB3  . SER A 1 81  ? 2.247   -13.908 -4.314  1.00 0.00 ? 81  SER A HB3  3  
ATOM 4809  H HG   . SER A 1 81  ? 2.871   -14.220 -7.013  1.00 0.00 ? 81  SER A HG   3  
ATOM 4810  N N    . ASN A 1 82  ? -0.856  -13.718 -6.305  1.00 0.00 ? 82  ASN A N    3  
ATOM 4811  C CA   . ASN A 1 82  ? -2.109  -14.455 -6.181  1.00 0.00 ? 82  ASN A CA   3  
ATOM 4812  C C    . ASN A 1 82  ? -2.991  -13.849 -5.094  1.00 0.00 ? 82  ASN A C    3  
ATOM 4813  O O    . ASN A 1 82  ? -3.426  -14.544 -4.175  1.00 0.00 ? 82  ASN A O    3  
ATOM 4814  C CB   . ASN A 1 82  ? -1.830  -15.926 -5.866  1.00 0.00 ? 82  ASN A CB   3  
ATOM 4815  C CG   . ASN A 1 82  ? -1.661  -16.763 -7.119  1.00 0.00 ? 82  ASN A CG   3  
ATOM 4816  O OD1  . ASN A 1 82  ? -2.617  -16.989 -7.862  1.00 0.00 ? 82  ASN A OD1  3  
ATOM 4817  N ND2  . ASN A 1 82  ? -0.441  -17.229 -7.359  1.00 0.00 ? 82  ASN A ND2  3  
ATOM 4818  H H    . ASN A 1 82  ? -0.500  -13.527 -7.198  1.00 0.00 ? 82  ASN A H    3  
ATOM 4819  H HA   . ASN A 1 82  ? -2.626  -14.390 -7.126  1.00 0.00 ? 82  ASN A HA   3  
ATOM 4820  H HB2  . ASN A 1 82  ? -0.923  -15.998 -5.284  1.00 0.00 ? 82  ASN A HB2  3  
ATOM 4821  H HB3  . ASN A 1 82  ? -2.653  -16.328 -5.294  1.00 0.00 ? 82  ASN A HB3  3  
ATOM 4822  H HD21 . ASN A 1 82  ? 0.272   -17.010 -6.723  1.00 0.00 ? 82  ASN A HD21 3  
ATOM 4823  H HD22 . ASN A 1 82  ? -0.303  -17.773 -8.163  1.00 0.00 ? 82  ASN A HD22 3  
ATOM 4824  N N    . ILE A 1 83  ? -3.251  -12.551 -5.206  1.00 0.00 ? 83  ILE A N    3  
ATOM 4825  C CA   . ILE A 1 83  ? -4.083  -11.852 -4.234  1.00 0.00 ? 83  ILE A CA   3  
ATOM 4826  C C    . ILE A 1 83  ? -5.376  -12.616 -3.967  1.00 0.00 ? 83  ILE A C    3  
ATOM 4827  O O    . ILE A 1 83  ? -5.942  -13.234 -4.869  1.00 0.00 ? 83  ILE A O    3  
ATOM 4828  C CB   . ILE A 1 83  ? -4.430  -10.429 -4.710  1.00 0.00 ? 83  ILE A CB   3  
ATOM 4829  C CG1  . ILE A 1 83  ? -4.795  -9.544  -3.516  1.00 0.00 ? 83  ILE A CG1  3  
ATOM 4830  C CG2  . ILE A 1 83  ? -5.571  -10.469 -5.715  1.00 0.00 ? 83  ILE A CG2  3  
ATOM 4831  C CD1  . ILE A 1 83  ? -5.281  -8.167  -3.911  1.00 0.00 ? 83  ILE A CD1  3  
ATOM 4832  H H    . ILE A 1 83  ? -2.876  -12.051 -5.961  1.00 0.00 ? 83  ILE A H    3  
ATOM 4833  H HA   . ILE A 1 83  ? -3.525  -11.776 -3.312  1.00 0.00 ? 83  ILE A HA   3  
ATOM 4834  H HB   . ILE A 1 83  ? -3.562  -10.017 -5.202  1.00 0.00 ? 83  ILE A HB   3  
ATOM 4835  H HG12 . ILE A 1 83  ? -5.578  -10.021 -2.948  1.00 0.00 ? 83  ILE A HG12 3  
ATOM 4836  H HG13 . ILE A 1 83  ? -3.924  -9.421  -2.888  1.00 0.00 ? 83  ILE A HG13 3  
ATOM 4837  H HG21 . ILE A 1 83  ? -6.497  -10.219 -5.219  1.00 0.00 ? 83  ILE A HG21 3  
ATOM 4838  H HG22 . ILE A 1 83  ? -5.381  -9.755  -6.502  1.00 0.00 ? 83  ILE A HG22 3  
ATOM 4839  H HG23 . ILE A 1 83  ? -5.644  -11.460 -6.137  1.00 0.00 ? 83  ILE A HG23 3  
ATOM 4840  H HD11 . ILE A 1 83  ? -4.494  -7.446  -3.748  1.00 0.00 ? 83  ILE A HD11 3  
ATOM 4841  H HD12 . ILE A 1 83  ? -5.560  -8.168  -4.954  1.00 0.00 ? 83  ILE A HD12 3  
ATOM 4842  H HD13 . ILE A 1 83  ? -6.140  -7.903  -3.310  1.00 0.00 ? 83  ILE A HD13 3  
ATOM 4843  N N    . VAL A 1 84  ? -5.840  -12.567 -2.722  1.00 0.00 ? 84  VAL A N    3  
ATOM 4844  C CA   . VAL A 1 84  ? -7.068  -13.251 -2.337  1.00 0.00 ? 84  VAL A CA   3  
ATOM 4845  C C    . VAL A 1 84  ? -8.096  -12.268 -1.788  1.00 0.00 ? 84  VAL A C    3  
ATOM 4846  O O    . VAL A 1 84  ? -7.741  -11.217 -1.254  1.00 0.00 ? 84  VAL A O    3  
ATOM 4847  C CB   . VAL A 1 84  ? -6.797  -14.337 -1.279  1.00 0.00 ? 84  VAL A CB   3  
ATOM 4848  C CG1  . VAL A 1 84  ? -5.872  -15.408 -1.837  1.00 0.00 ? 84  VAL A CG1  3  
ATOM 4849  C CG2  . VAL A 1 84  ? -6.210  -13.718 -0.019  1.00 0.00 ? 84  VAL A CG2  3  
ATOM 4850  H H    . VAL A 1 84  ? -5.344  -12.058 -2.048  1.00 0.00 ? 84  VAL A H    3  
ATOM 4851  H HA   . VAL A 1 84  ? -7.474  -13.729 -3.216  1.00 0.00 ? 84  VAL A HA   3  
ATOM 4852  H HB   . VAL A 1 84  ? -7.736  -14.803 -1.021  1.00 0.00 ? 84  VAL A HB   3  
ATOM 4853  H HG11 . VAL A 1 84  ? -5.952  -15.426 -2.914  1.00 0.00 ? 84  VAL A HG11 3  
ATOM 4854  H HG12 . VAL A 1 84  ? -4.853  -15.188 -1.554  1.00 0.00 ? 84  VAL A HG12 3  
ATOM 4855  H HG13 . VAL A 1 84  ? -6.156  -16.371 -1.440  1.00 0.00 ? 84  VAL A HG13 3  
ATOM 4856  H HG21 . VAL A 1 84  ? -5.343  -14.284 0.289   1.00 0.00 ? 84  VAL A HG21 3  
ATOM 4857  H HG22 . VAL A 1 84  ? -5.919  -12.697 -0.221  1.00 0.00 ? 84  VAL A HG22 3  
ATOM 4858  H HG23 . VAL A 1 84  ? -6.949  -13.733 0.768   1.00 0.00 ? 84  VAL A HG23 3  
ATOM 4859  N N    . ARG A 1 85  ? -9.371  -12.617 -1.924  1.00 0.00 ? 85  ARG A N    3  
ATOM 4860  C CA   . ARG A 1 85  ? -10.451 -11.764 -1.442  1.00 0.00 ? 85  ARG A CA   3  
ATOM 4861  C C    . ARG A 1 85  ? -10.096 -11.146 -0.093  1.00 0.00 ? 85  ARG A C    3  
ATOM 4862  O O    . ARG A 1 85  ? -10.429 -9.993  0.180   1.00 0.00 ? 85  ARG A O    3  
ATOM 4863  C CB   . ARG A 1 85  ? -11.748 -12.567 -1.321  1.00 0.00 ? 85  ARG A CB   3  
ATOM 4864  C CG   . ARG A 1 85  ? -12.590 -12.558 -2.587  1.00 0.00 ? 85  ARG A CG   3  
ATOM 4865  C CD   . ARG A 1 85  ? -13.686 -13.611 -2.535  1.00 0.00 ? 85  ARG A CD   3  
ATOM 4866  N NE   . ARG A 1 85  ? -14.755 -13.243 -1.610  1.00 0.00 ? 85  ARG A NE   3  
ATOM 4867  C CZ   . ARG A 1 85  ? -15.935 -13.852 -1.571  1.00 0.00 ? 85  ARG A CZ   3  
ATOM 4868  N NH1  . ARG A 1 85  ? -16.196 -14.853 -2.401  1.00 0.00 ? 85  ARG A NH1  3  
ATOM 4869  N NH2  . ARG A 1 85  ? -16.857 -13.461 -0.701  1.00 0.00 ? 85  ARG A NH2  3  
ATOM 4870  H H    . ARG A 1 85  ? -9.591  -13.467 -2.359  1.00 0.00 ? 85  ARG A H    3  
ATOM 4871  H HA   . ARG A 1 85  ? -10.595 -10.972 -2.161  1.00 0.00 ? 85  ARG A HA   3  
ATOM 4872  H HB2  . ARG A 1 85  ? -11.502 -13.593 -1.087  1.00 0.00 ? 85  ARG A HB2  3  
ATOM 4873  H HB3  . ARG A 1 85  ? -12.339 -12.154 -0.518  1.00 0.00 ? 85  ARG A HB3  3  
ATOM 4874  H HG2  . ARG A 1 85  ? -13.046 -11.585 -2.697  1.00 0.00 ? 85  ARG A HG2  3  
ATOM 4875  H HG3  . ARG A 1 85  ? -11.951 -12.756 -3.434  1.00 0.00 ? 85  ARG A HG3  3  
ATOM 4876  H HD2  . ARG A 1 85  ? -14.103 -13.726 -3.524  1.00 0.00 ? 85  ARG A HD2  3  
ATOM 4877  H HD3  . ARG A 1 85  ? -13.252 -14.547 -2.216  1.00 0.00 ? 85  ARG A HD3  3  
ATOM 4878  H HE   . ARG A 1 85  ? -14.583 -12.507 -0.987  1.00 0.00 ? 85  ARG A HE   3  
ATOM 4879  H HH11 . ARG A 1 85  ? -15.502 -15.151 -3.057  1.00 0.00 ? 85  ARG A HH11 3  
ATOM 4880  H HH12 . ARG A 1 85  ? -17.085 -15.310 -2.369  1.00 0.00 ? 85  ARG A HH12 3  
ATOM 4881  H HH21 . ARG A 1 85  ? -16.663 -12.707 -0.074  1.00 0.00 ? 85  ARG A HH21 3  
ATOM 4882  H HH22 . ARG A 1 85  ? -17.744 -13.919 -0.673  1.00 0.00 ? 85  ARG A HH22 3  
ATOM 4883  N N    . ALA A 1 86  ? -9.419  -11.922 0.747   1.00 0.00 ? 86  ALA A N    3  
ATOM 4884  C CA   . ALA A 1 86  ? -9.017  -11.450 2.067   1.00 0.00 ? 86  ALA A CA   3  
ATOM 4885  C C    . ALA A 1 86  ? -8.255  -10.133 1.971   1.00 0.00 ? 86  ALA A C    3  
ATOM 4886  O O    . ALA A 1 86  ? -8.510  -9.200  2.733   1.00 0.00 ? 86  ALA A O    3  
ATOM 4887  C CB   . ALA A 1 86  ? -8.170  -12.502 2.768   1.00 0.00 ? 86  ALA A CB   3  
ATOM 4888  H H    . ALA A 1 86  ? -9.182  -12.832 0.473   1.00 0.00 ? 86  ALA A H    3  
ATOM 4889  H HA   . ALA A 1 86  ? -9.912  -11.295 2.653   1.00 0.00 ? 86  ALA A HA   3  
ATOM 4890  H HB1  . ALA A 1 86  ? -8.220  -12.349 3.836   1.00 0.00 ? 86  ALA A HB1  3  
ATOM 4891  H HB2  . ALA A 1 86  ? -8.544  -13.485 2.526   1.00 0.00 ? 86  ALA A HB2  3  
ATOM 4892  H HB3  . ALA A 1 86  ? -7.145  -12.416 2.439   1.00 0.00 ? 86  ALA A HB3  3  
ATOM 4893  N N    . ASP A 1 87  ? -7.320  -10.063 1.030   1.00 0.00 ? 87  ASP A N    3  
ATOM 4894  C CA   . ASP A 1 87  ? -6.521  -8.858  0.834   1.00 0.00 ? 87  ASP A CA   3  
ATOM 4895  C C    . ASP A 1 87  ? -7.390  -7.608  0.933   1.00 0.00 ? 87  ASP A C    3  
ATOM 4896  O O    . ASP A 1 87  ? -6.935  -6.558  1.388   1.00 0.00 ? 87  ASP A O    3  
ATOM 4897  C CB   . ASP A 1 87  ? -5.820  -8.901  -0.525  1.00 0.00 ? 87  ASP A CB   3  
ATOM 4898  C CG   . ASP A 1 87  ? -4.464  -9.576  -0.455  1.00 0.00 ? 87  ASP A CG   3  
ATOM 4899  O OD1  . ASP A 1 87  ? -4.410  -10.759 -0.059  1.00 0.00 ? 87  ASP A OD1  3  
ATOM 4900  O OD2  . ASP A 1 87  ? -3.457  -8.922  -0.796  1.00 0.00 ? 87  ASP A OD2  3  
ATOM 4901  H H    . ASP A 1 87  ? -7.164  -10.839 0.453   1.00 0.00 ? 87  ASP A H    3  
ATOM 4902  H HA   . ASP A 1 87  ? -5.775  -8.825  1.613   1.00 0.00 ? 87  ASP A HA   3  
ATOM 4903  H HB2  . ASP A 1 87  ? -6.437  -9.447  -1.224  1.00 0.00 ? 87  ASP A HB2  3  
ATOM 4904  H HB3  . ASP A 1 87  ? -5.682  -7.892  -0.883  1.00 0.00 ? 87  ASP A HB3  3  
ATOM 4905  N N    . PHE A 1 88  ? -8.641  -7.728  0.502   1.00 0.00 ? 88  PHE A N    3  
ATOM 4906  C CA   . PHE A 1 88  ? -9.573  -6.607  0.539   1.00 0.00 ? 88  PHE A CA   3  
ATOM 4907  C C    . PHE A 1 88  ? -10.076 -6.365  1.959   1.00 0.00 ? 88  PHE A C    3  
ATOM 4908  O O    . PHE A 1 88  ? -10.194 -5.222  2.401   1.00 0.00 ? 88  PHE A O    3  
ATOM 4909  C CB   . PHE A 1 88  ? -10.756 -6.868  -0.395  1.00 0.00 ? 88  PHE A CB   3  
ATOM 4910  C CG   . PHE A 1 88  ? -10.348 -7.344  -1.760  1.00 0.00 ? 88  PHE A CG   3  
ATOM 4911  C CD1  . PHE A 1 88  ? -9.435  -6.625  -2.515  1.00 0.00 ? 88  PHE A CD1  3  
ATOM 4912  C CD2  . PHE A 1 88  ? -10.877 -8.510  -2.288  1.00 0.00 ? 88  PHE A CD2  3  
ATOM 4913  C CE1  . PHE A 1 88  ? -9.057  -7.060  -3.771  1.00 0.00 ? 88  PHE A CE1  3  
ATOM 4914  C CE2  . PHE A 1 88  ? -10.503 -8.951  -3.543  1.00 0.00 ? 88  PHE A CE2  3  
ATOM 4915  C CZ   . PHE A 1 88  ? -9.593  -8.225  -4.286  1.00 0.00 ? 88  PHE A CZ   3  
ATOM 4916  H H    . PHE A 1 88  ? -8.945  -8.590  0.149   1.00 0.00 ? 88  PHE A H    3  
ATOM 4917  H HA   . PHE A 1 88  ? -9.046  -5.727  0.202   1.00 0.00 ? 88  PHE A HA   3  
ATOM 4918  H HB2  . PHE A 1 88  ? -11.392 -7.622  0.042   1.00 0.00 ? 88  PHE A HB2  3  
ATOM 4919  H HB3  . PHE A 1 88  ? -11.318 -5.954  -0.516  1.00 0.00 ? 88  PHE A HB3  3  
ATOM 4920  H HD1  . PHE A 1 88  ? -9.016  -5.713  -2.113  1.00 0.00 ? 88  PHE A HD1  3  
ATOM 4921  H HD2  . PHE A 1 88  ? -11.589 -9.079  -1.709  1.00 0.00 ? 88  PHE A HD2  3  
ATOM 4922  H HE1  . PHE A 1 88  ? -8.346  -6.490  -4.349  1.00 0.00 ? 88  PHE A HE1  3  
ATOM 4923  H HE2  . PHE A 1 88  ? -10.923 -9.862  -3.944  1.00 0.00 ? 88  PHE A HE2  3  
ATOM 4924  H HZ   . PHE A 1 88  ? -9.298  -8.567  -5.267  1.00 0.00 ? 88  PHE A HZ   3  
ATOM 4925  N N    . GLN A 1 89  ? -10.371 -7.450  2.669   1.00 0.00 ? 89  GLN A N    3  
ATOM 4926  C CA   . GLN A 1 89  ? -10.863 -7.356  4.038   1.00 0.00 ? 89  GLN A CA   3  
ATOM 4927  C C    . GLN A 1 89  ? -9.770  -6.852  4.976   1.00 0.00 ? 89  GLN A C    3  
ATOM 4928  O O    . GLN A 1 89  ? -10.048 -6.163  5.958   1.00 0.00 ? 89  GLN A O    3  
ATOM 4929  C CB   . GLN A 1 89  ? -11.372 -8.718  4.514   1.00 0.00 ? 89  GLN A CB   3  
ATOM 4930  C CG   . GLN A 1 89  ? -12.408 -9.337  3.590   1.00 0.00 ? 89  GLN A CG   3  
ATOM 4931  C CD   . GLN A 1 89  ? -13.714 -8.568  3.579   1.00 0.00 ? 89  GLN A CD   3  
ATOM 4932  O OE1  . GLN A 1 89  ? -13.781 -7.441  3.086   1.00 0.00 ? 89  GLN A OE1  3  
ATOM 4933  N NE2  . GLN A 1 89  ? -14.762 -9.173  4.125   1.00 0.00 ? 89  GLN A NE2  3  
ATOM 4934  H H    . GLN A 1 89  ? -10.256 -8.333  2.262   1.00 0.00 ? 89  GLN A H    3  
ATOM 4935  H HA   . GLN A 1 89  ? -11.681 -6.652  4.049   1.00 0.00 ? 89  GLN A HA   3  
ATOM 4936  H HB2  . GLN A 1 89  ? -10.535 -9.396  4.588   1.00 0.00 ? 89  GLN A HB2  3  
ATOM 4937  H HB3  . GLN A 1 89  ? -11.817 -8.601  5.491   1.00 0.00 ? 89  GLN A HB3  3  
ATOM 4938  H HG2  . GLN A 1 89  ? -12.011 -9.355  2.586   1.00 0.00 ? 89  GLN A HG2  3  
ATOM 4939  H HG3  . GLN A 1 89  ? -12.604 -10.347 3.917   1.00 0.00 ? 89  GLN A HG3  3  
ATOM 4940  H HE21 . GLN A 1 89  ? -14.635 -10.070 4.500   1.00 0.00 ? 89  GLN A HE21 3  
ATOM 4941  H HE22 . GLN A 1 89  ? -15.619 -8.699  4.133   1.00 0.00 ? 89  GLN A HE22 3  
ATOM 4942  N N    . THR A 1 90  ? -8.525  -7.201  4.667   1.00 0.00 ? 90  THR A N    3  
ATOM 4943  C CA   . THR A 1 90  ? -7.390  -6.786  5.482   1.00 0.00 ? 90  THR A CA   3  
ATOM 4944  C C    . THR A 1 90  ? -7.099  -5.301  5.302   1.00 0.00 ? 90  THR A C    3  
ATOM 4945  O O    . THR A 1 90  ? -7.219  -4.764  4.201   1.00 0.00 ? 90  THR A O    3  
ATOM 4946  C CB   . THR A 1 90  ? -6.124  -7.592  5.134   1.00 0.00 ? 90  THR A CB   3  
ATOM 4947  O OG1  . THR A 1 90  ? -6.386  -8.994  5.262   1.00 0.00 ? 90  THR A OG1  3  
ATOM 4948  C CG2  . THR A 1 90  ? -4.968  -7.202  6.043   1.00 0.00 ? 90  THR A CG2  3  
ATOM 4949  H H    . THR A 1 90  ? -8.367  -7.752  3.871   1.00 0.00 ? 90  THR A H    3  
ATOM 4950  H HA   . THR A 1 90  ? -7.637  -6.972  6.517   1.00 0.00 ? 90  THR A HA   3  
ATOM 4951  H HB   . THR A 1 90  ? -5.848  -7.376  4.112   1.00 0.00 ? 90  THR A HB   3  
ATOM 4952  H HG1  . THR A 1 90  ? -5.554  -9.470  5.322   1.00 0.00 ? 90  THR A HG1  3  
ATOM 4953  H HG21 . THR A 1 90  ? -4.140  -6.855  5.443   1.00 0.00 ? 90  THR A HG21 3  
ATOM 4954  H HG22 . THR A 1 90  ? -4.660  -8.060  6.621   1.00 0.00 ? 90  THR A HG22 3  
ATOM 4955  H HG23 . THR A 1 90  ? -5.285  -6.414  6.709   1.00 0.00 ? 90  THR A HG23 3  
ATOM 4956  N N    . ILE A 1 91  ? -6.714  -4.642  6.391   1.00 0.00 ? 91  ILE A N    3  
ATOM 4957  C CA   . ILE A 1 91  ? -6.404  -3.219  6.352   1.00 0.00 ? 91  ILE A CA   3  
ATOM 4958  C C    . ILE A 1 91  ? -4.911  -2.987  6.146   1.00 0.00 ? 91  ILE A C    3  
ATOM 4959  O O    . ILE A 1 91  ? -4.085  -3.462  6.926   1.00 0.00 ? 91  ILE A O    3  
ATOM 4960  C CB   . ILE A 1 91  ? -6.848  -2.510  7.645   1.00 0.00 ? 91  ILE A CB   3  
ATOM 4961  C CG1  . ILE A 1 91  ? -8.360  -2.649  7.835   1.00 0.00 ? 91  ILE A CG1  3  
ATOM 4962  C CG2  . ILE A 1 91  ? -6.445  -1.043  7.611   1.00 0.00 ? 91  ILE A CG2  3  
ATOM 4963  C CD1  . ILE A 1 91  ? -8.761  -3.883  8.613   1.00 0.00 ? 91  ILE A CD1  3  
ATOM 4964  H H    . ILE A 1 91  ? -6.637  -5.125  7.240   1.00 0.00 ? 91  ILE A H    3  
ATOM 4965  H HA   . ILE A 1 91  ? -6.943  -2.783  5.523   1.00 0.00 ? 91  ILE A HA   3  
ATOM 4966  H HB   . ILE A 1 91  ? -6.344  -2.978  8.477   1.00 0.00 ? 91  ILE A HB   3  
ATOM 4967  H HG12 . ILE A 1 91  ? -8.730  -1.787  8.368   1.00 0.00 ? 91  ILE A HG12 3  
ATOM 4968  H HG13 . ILE A 1 91  ? -8.834  -2.698  6.865   1.00 0.00 ? 91  ILE A HG13 3  
ATOM 4969  H HG21 . ILE A 1 91  ? -6.740  -0.568  8.534   1.00 0.00 ? 91  ILE A HG21 3  
ATOM 4970  H HG22 . ILE A 1 91  ? -5.375  -0.967  7.494   1.00 0.00 ? 91  ILE A HG22 3  
ATOM 4971  H HG23 . ILE A 1 91  ? -6.934  -0.555  6.782   1.00 0.00 ? 91  ILE A HG23 3  
ATOM 4972  H HD11 . ILE A 1 91  ? -8.002  -4.643  8.499   1.00 0.00 ? 91  ILE A HD11 3  
ATOM 4973  H HD12 . ILE A 1 91  ? -8.867  -3.632  9.657   1.00 0.00 ? 91  ILE A HD12 3  
ATOM 4974  H HD13 . ILE A 1 91  ? -9.702  -4.256  8.235   1.00 0.00 ? 91  ILE A HD13 3  
ATOM 4975  N N    . TYR A 1 92  ? -4.572  -2.254  5.092   1.00 0.00 ? 92  TYR A N    3  
ATOM 4976  C CA   . TYR A 1 92  ? -3.178  -1.959  4.782   1.00 0.00 ? 92  TYR A CA   3  
ATOM 4977  C C    . TYR A 1 92  ? -2.763  -0.611  5.364   1.00 0.00 ? 92  TYR A C    3  
ATOM 4978  O O    . TYR A 1 92  ? -3.574  0.309   5.467   1.00 0.00 ? 92  TYR A O    3  
ATOM 4979  C CB   . TYR A 1 92  ? -2.958  -1.963  3.268   1.00 0.00 ? 92  TYR A CB   3  
ATOM 4980  C CG   . TYR A 1 92  ? -3.128  -3.325  2.635   1.00 0.00 ? 92  TYR A CG   3  
ATOM 4981  C CD1  . TYR A 1 92  ? -2.180  -4.323  2.822   1.00 0.00 ? 92  TYR A CD1  3  
ATOM 4982  C CD2  . TYR A 1 92  ? -4.236  -3.613  1.848   1.00 0.00 ? 92  TYR A CD2  3  
ATOM 4983  C CE1  . TYR A 1 92  ? -2.331  -5.569  2.245   1.00 0.00 ? 92  TYR A CE1  3  
ATOM 4984  C CE2  . TYR A 1 92  ? -4.396  -4.857  1.268   1.00 0.00 ? 92  TYR A CE2  3  
ATOM 4985  C CZ   . TYR A 1 92  ? -3.441  -5.831  1.469   1.00 0.00 ? 92  TYR A CZ   3  
ATOM 4986  O OH   . TYR A 1 92  ? -3.596  -7.071  0.892   1.00 0.00 ? 92  TYR A OH   3  
ATOM 4987  H H    . TYR A 1 92  ? -5.275  -1.903  4.506   1.00 0.00 ? 92  TYR A H    3  
ATOM 4988  H HA   . TYR A 1 92  ? -2.568  -2.733  5.226   1.00 0.00 ? 92  TYR A HA   3  
ATOM 4989  H HB2  . TYR A 1 92  ? -3.666  -1.292  2.807   1.00 0.00 ? 92  TYR A HB2  3  
ATOM 4990  H HB3  . TYR A 1 92  ? -1.955  -1.621  3.056   1.00 0.00 ? 92  TYR A HB3  3  
ATOM 4991  H HD1  . TYR A 1 92  ? -1.312  -4.115  3.431   1.00 0.00 ? 92  TYR A HD1  3  
ATOM 4992  H HD2  . TYR A 1 92  ? -4.982  -2.847  1.692   1.00 0.00 ? 92  TYR A HD2  3  
ATOM 4993  H HE1  . TYR A 1 92  ? -1.583  -6.333  2.403   1.00 0.00 ? 92  TYR A HE1  3  
ATOM 4994  H HE2  . TYR A 1 92  ? -5.265  -5.062  0.660   1.00 0.00 ? 92  TYR A HE2  3  
ATOM 4995  H HH   . TYR A 1 92  ? -4.197  -7.003  0.146   1.00 0.00 ? 92  TYR A HH   3  
ATOM 4996  N N    . ASN A 1 93  ? -1.494  -0.503  5.744   1.00 0.00 ? 93  ASN A N    3  
ATOM 4997  C CA   . ASN A 1 93  ? -0.970  0.732   6.316   1.00 0.00 ? 93  ASN A CA   3  
ATOM 4998  C C    . ASN A 1 93  ? 0.517   0.884   6.013   1.00 0.00 ? 93  ASN A C    3  
ATOM 4999  O O    . ASN A 1 93  ? 1.306   -0.031  6.251   1.00 0.00 ? 93  ASN A O    3  
ATOM 5000  C CB   . ASN A 1 93  ? -1.199  0.754   7.829   1.00 0.00 ? 93  ASN A CB   3  
ATOM 5001  C CG   . ASN A 1 93  ? -2.545  1.345   8.202   1.00 0.00 ? 93  ASN A CG   3  
ATOM 5002  O OD1  . ASN A 1 93  ? -2.758  2.552   8.091   1.00 0.00 ? 93  ASN A OD1  3  
ATOM 5003  N ND2  . ASN A 1 93  ? -3.461  0.493   8.647   1.00 0.00 ? 93  ASN A ND2  3  
ATOM 5004  H H    . ASN A 1 93  ? -0.896  -1.272  5.637   1.00 0.00 ? 93  ASN A H    3  
ATOM 5005  H HA   . ASN A 1 93  ? -1.503  1.557   5.869   1.00 0.00 ? 93  ASN A HA   3  
ATOM 5006  H HB2  . ASN A 1 93  ? -1.153  -0.256  8.209   1.00 0.00 ? 93  ASN A HB2  3  
ATOM 5007  H HB3  . ASN A 1 93  ? -0.425  1.345   8.296   1.00 0.00 ? 93  ASN A HB3  3  
ATOM 5008  H HD21 . ASN A 1 93  ? -3.221  -0.455  8.709   1.00 0.00 ? 93  ASN A HD21 3  
ATOM 5009  H HD22 . ASN A 1 93  ? -4.341  0.848   8.894   1.00 0.00 ? 93  ASN A HD22 3  
ATOM 5010  N N    . CYS A 1 94  ? 0.892   2.045   5.487   1.00 0.00 ? 94  CYS A N    3  
ATOM 5011  C CA   . CYS A 1 94  ? 2.285   2.317   5.151   1.00 0.00 ? 94  CYS A CA   3  
ATOM 5012  C C    . CYS A 1 94  ? 2.887   3.338   6.111   1.00 0.00 ? 94  CYS A C    3  
ATOM 5013  O O    . CYS A 1 94  ? 2.346   4.429   6.294   1.00 0.00 ? 94  CYS A O    3  
ATOM 5014  C CB   . CYS A 1 94  ? 2.394   2.826   3.713   1.00 0.00 ? 94  CYS A CB   3  
ATOM 5015  S SG   . CYS A 1 94  ? 4.056   2.703   3.010   1.00 0.00 ? 94  CYS A SG   3  
ATOM 5016  H H    . CYS A 1 94  ? 0.217   2.735   5.321   1.00 0.00 ? 94  CYS A H    3  
ATOM 5017  H HA   . CYS A 1 94  ? 2.834   1.392   5.239   1.00 0.00 ? 94  CYS A HA   3  
ATOM 5018  H HB2  . CYS A 1 94  ? 1.729   2.252   3.085   1.00 0.00 ? 94  CYS A HB2  3  
ATOM 5019  H HB3  . CYS A 1 94  ? 2.099   3.864   3.683   1.00 0.00 ? 94  CYS A HB3  3  
ATOM 5020  H HG   . CYS A 1 94  ? 4.926   2.752   4.007   1.00 0.00 ? 94  CYS A HG   3  
ATOM 5021  N N    . THR A 1 95  ? 4.009   2.976   6.725   1.00 0.00 ? 95  THR A N    3  
ATOM 5022  C CA   . THR A 1 95  ? 4.683   3.858   7.669   1.00 0.00 ? 95  THR A CA   3  
ATOM 5023  C C    . THR A 1 95  ? 6.082   4.219   7.182   1.00 0.00 ? 95  THR A C    3  
ATOM 5024  O O    . THR A 1 95  ? 6.811   3.369   6.672   1.00 0.00 ? 95  THR A O    3  
ATOM 5025  C CB   . THR A 1 95  ? 4.788   3.214   9.064   1.00 0.00 ? 95  THR A CB   3  
ATOM 5026  O OG1  . THR A 1 95  ? 3.504   2.737   9.481   1.00 0.00 ? 95  THR A OG1  3  
ATOM 5027  C CG2  . THR A 1 95  ? 5.321   4.211   10.082  1.00 0.00 ? 95  THR A CG2  3  
ATOM 5028  H H    . THR A 1 95  ? 4.392   2.093   6.538   1.00 0.00 ? 95  THR A H    3  
ATOM 5029  H HA   . THR A 1 95  ? 4.098   4.762   7.756   1.00 0.00 ? 95  THR A HA   3  
ATOM 5030  H HB   . THR A 1 95  ? 5.473   2.379   9.007   1.00 0.00 ? 95  THR A HB   3  
ATOM 5031  H HG1  . THR A 1 95  ? 3.613   2.123   10.211  1.00 0.00 ? 95  THR A HG1  3  
ATOM 5032  H HG21 . THR A 1 95  ? 4.543   4.917   10.335  1.00 0.00 ? 95  THR A HG21 3  
ATOM 5033  H HG22 . THR A 1 95  ? 6.164   4.738   9.663   1.00 0.00 ? 95  THR A HG22 3  
ATOM 5034  H HG23 . THR A 1 95  ? 5.631   3.684   10.972  1.00 0.00 ? 95  THR A HG23 3  
ATOM 5035  N N    . ALA A 1 96  ? 6.451   5.486   7.342   1.00 0.00 ? 96  ALA A N    3  
ATOM 5036  C CA   . ALA A 1 96  ? 7.763   5.959   6.921   1.00 0.00 ? 96  ALA A CA   3  
ATOM 5037  C C    . ALA A 1 96  ? 8.552   6.514   8.102   1.00 0.00 ? 96  ALA A C    3  
ATOM 5038  O O    . ALA A 1 96  ? 7.983   6.829   9.147   1.00 0.00 ? 96  ALA A O    3  
ATOM 5039  C CB   . ALA A 1 96  ? 7.621   7.016   5.836   1.00 0.00 ? 96  ALA A CB   3  
ATOM 5040  H H    . ALA A 1 96  ? 5.825   6.117   7.755   1.00 0.00 ? 96  ALA A H    3  
ATOM 5041  H HA   . ALA A 1 96  ? 8.302   5.120   6.504   1.00 0.00 ? 96  ALA A HA   3  
ATOM 5042  H HB1  . ALA A 1 96  ? 6.620   7.423   5.861   1.00 0.00 ? 96  ALA A HB1  3  
ATOM 5043  H HB2  . ALA A 1 96  ? 8.336   7.806   6.007   1.00 0.00 ? 96  ALA A HB2  3  
ATOM 5044  H HB3  . ALA A 1 96  ? 7.803   6.567   4.871   1.00 0.00 ? 96  ALA A HB3  3  
ATOM 5045  N N    . TRP A 1 97  ? 9.864   6.630   7.929   1.00 0.00 ? 97  TRP A N    3  
ATOM 5046  C CA   . TRP A 1 97  ? 10.731  7.146   8.983   1.00 0.00 ? 97  TRP A CA   3  
ATOM 5047  C C    . TRP A 1 97  ? 11.858  7.988   8.396   1.00 0.00 ? 97  TRP A C    3  
ATOM 5048  O O    . TRP A 1 97  ? 12.673  7.493   7.618   1.00 0.00 ? 97  TRP A O    3  
ATOM 5049  C CB   . TRP A 1 97  ? 11.311  5.994   9.804   1.00 0.00 ? 97  TRP A CB   3  
ATOM 5050  C CG   . TRP A 1 97  ? 10.321  5.377   10.745  1.00 0.00 ? 97  TRP A CG   3  
ATOM 5051  C CD1  . TRP A 1 97  ? 9.932   5.863   11.960  1.00 0.00 ? 97  TRP A CD1  3  
ATOM 5052  C CD2  . TRP A 1 97  ? 9.595   4.159   10.546  1.00 0.00 ? 97  TRP A CD2  3  
ATOM 5053  N NE1  . TRP A 1 97  ? 9.009   5.020   12.530  1.00 0.00 ? 97  TRP A NE1  3  
ATOM 5054  C CE2  . TRP A 1 97  ? 8.784   3.967   11.682  1.00 0.00 ? 97  TRP A CE2  3  
ATOM 5055  C CE3  . TRP A 1 97  ? 9.550   3.212   9.520   1.00 0.00 ? 97  TRP A CE3  3  
ATOM 5056  C CZ2  . TRP A 1 97  ? 7.941   2.868   11.818  1.00 0.00 ? 97  TRP A CZ2  3  
ATOM 5057  C CZ3  . TRP A 1 97  ? 8.713   2.121   9.656   1.00 0.00 ? 97  TRP A CZ3  3  
ATOM 5058  C CH2  . TRP A 1 97  ? 7.917   1.957   10.797  1.00 0.00 ? 97  TRP A CH2  3  
ATOM 5059  H H    . TRP A 1 97  ? 10.259  6.362   7.073   1.00 0.00 ? 97  TRP A H    3  
ATOM 5060  H HA   . TRP A 1 97  ? 10.130  7.770   9.628   1.00 0.00 ? 97  TRP A HA   3  
ATOM 5061  H HB2  . TRP A 1 97  ? 11.661  5.223   9.135   1.00 0.00 ? 97  TRP A HB2  3  
ATOM 5062  H HB3  . TRP A 1 97  ? 12.142  6.362   10.389  1.00 0.00 ? 97  TRP A HB3  3  
ATOM 5063  H HD1  . TRP A 1 97  ? 10.306  6.776   12.398  1.00 0.00 ? 97  TRP A HD1  3  
ATOM 5064  H HE1  . TRP A 1 97  ? 8.579   5.152   13.401  1.00 0.00 ? 97  TRP A HE1  3  
ATOM 5065  H HE3  . TRP A 1 97  ? 10.156  3.322   8.632   1.00 0.00 ? 97  TRP A HE3  3  
ATOM 5066  H HZ2  . TRP A 1 97  ? 7.321   2.727   12.691  1.00 0.00 ? 97  TRP A HZ2  3  
ATOM 5067  H HZ3  . TRP A 1 97  ? 8.665   1.379   8.872   1.00 0.00 ? 97  TRP A HZ3  3  
ATOM 5068  H HH2  . TRP A 1 97  ? 7.278   1.089   10.861  1.00 0.00 ? 97  TRP A HH2  3  
ATOM 5069  N N    . ASN A 1 98  ? 11.900  9.261   8.774   1.00 0.00 ? 98  ASN A N    3  
ATOM 5070  C CA   . ASN A 1 98  ? 12.929  10.171  8.283   1.00 0.00 ? 98  ASN A CA   3  
ATOM 5071  C C    . ASN A 1 98  ? 13.536  10.974  9.430   1.00 0.00 ? 98  ASN A C    3  
ATOM 5072  O O    . ASN A 1 98  ? 12.893  11.193  10.457  1.00 0.00 ? 98  ASN A O    3  
ATOM 5073  C CB   . ASN A 1 98  ? 12.343  11.120  7.236   1.00 0.00 ? 98  ASN A CB   3  
ATOM 5074  C CG   . ASN A 1 98  ? 13.393  11.638  6.273   1.00 0.00 ? 98  ASN A CG   3  
ATOM 5075  O OD1  . ASN A 1 98  ? 14.318  10.916  5.899   1.00 0.00 ? 98  ASN A OD1  3  
ATOM 5076  N ND2  . ASN A 1 98  ? 13.256  12.895  5.867   1.00 0.00 ? 98  ASN A ND2  3  
ATOM 5077  H H    . ASN A 1 98  ? 11.222  9.597   9.397   1.00 0.00 ? 98  ASN A H    3  
ATOM 5078  H HA   . ASN A 1 98  ? 13.705  9.577   7.824   1.00 0.00 ? 98  ASN A HA   3  
ATOM 5079  H HB2  . ASN A 1 98  ? 11.588  10.597  6.667   1.00 0.00 ? 98  ASN A HB2  3  
ATOM 5080  H HB3  . ASN A 1 98  ? 11.891  11.964  7.736   1.00 0.00 ? 98  ASN A HB3  3  
ATOM 5081  H HD21 . ASN A 1 98  ? 12.495  13.411  6.207   1.00 0.00 ? 98  ASN A HD21 3  
ATOM 5082  H HD22 . ASN A 1 98  ? 13.921  13.255  5.244   1.00 0.00 ? 98  ASN A HD22 3  
ATOM 5083  N N    . SER A 1 99  ? 14.778  11.410  9.247   1.00 0.00 ? 99  SER A N    3  
ATOM 5084  C CA   . SER A 1 99  ? 15.474  12.186  10.267  1.00 0.00 ? 99  SER A CA   3  
ATOM 5085  C C    . SER A 1 99  ? 14.566  13.272  10.837  1.00 0.00 ? 99  SER A C    3  
ATOM 5086  O O    . SER A 1 99  ? 14.763  13.734  11.961  1.00 0.00 ? 99  SER A O    3  
ATOM 5087  C CB   . SER A 1 99  ? 16.739  12.818  9.682   1.00 0.00 ? 99  SER A CB   3  
ATOM 5088  O OG   . SER A 1 99  ? 17.699  11.828  9.355   1.00 0.00 ? 99  SER A OG   3  
ATOM 5089  H H    . SER A 1 99  ? 15.238  11.203  8.406   1.00 0.00 ? 99  SER A H    3  
ATOM 5090  H HA   . SER A 1 99  ? 15.753  11.512  11.063  1.00 0.00 ? 99  SER A HA   3  
ATOM 5091  H HB2  . SER A 1 99  ? 16.485  13.365  8.787   1.00 0.00 ? 99  SER A HB2  3  
ATOM 5092  H HB3  . SER A 1 99  ? 17.169  13.493  10.408  1.00 0.00 ? 99  SER A HB3  3  
ATOM 5093  H HG   . SER A 1 99  ? 17.348  11.256  8.669   1.00 0.00 ? 99  SER A HG   3  
ATOM 5094  N N    . PHE A 1 100 ? 13.572  13.674  10.053  1.00 0.00 ? 100 PHE A N    3  
ATOM 5095  C CA   . PHE A 1 100 ? 12.633  14.706  10.478  1.00 0.00 ? 100 PHE A CA   3  
ATOM 5096  C C    . PHE A 1 100 ? 11.566  14.124  11.400  1.00 0.00 ? 100 PHE A C    3  
ATOM 5097  O O    . PHE A 1 100 ? 11.330  14.634  12.495  1.00 0.00 ? 100 PHE A O    3  
ATOM 5098  C CB   . PHE A 1 100 ? 11.972  15.357  9.261   1.00 0.00 ? 100 PHE A CB   3  
ATOM 5099  C CG   . PHE A 1 100 ? 12.860  16.338  8.550   1.00 0.00 ? 100 PHE A CG   3  
ATOM 5100  C CD1  . PHE A 1 100 ? 13.050  17.613  9.055   1.00 0.00 ? 100 PHE A CD1  3  
ATOM 5101  C CD2  . PHE A 1 100 ? 13.504  15.984  7.375   1.00 0.00 ? 100 PHE A CD2  3  
ATOM 5102  C CE1  . PHE A 1 100 ? 13.867  18.518  8.403   1.00 0.00 ? 100 PHE A CE1  3  
ATOM 5103  C CE2  . PHE A 1 100 ? 14.322  16.884  6.719   1.00 0.00 ? 100 PHE A CE2  3  
ATOM 5104  C CZ   . PHE A 1 100 ? 14.503  18.153  7.233   1.00 0.00 ? 100 PHE A CZ   3  
ATOM 5105  H H    . PHE A 1 100 ? 13.466  13.267  9.167   1.00 0.00 ? 100 PHE A H    3  
ATOM 5106  H HA   . PHE A 1 100 ? 13.189  15.456  11.019  1.00 0.00 ? 100 PHE A HA   3  
ATOM 5107  H HB2  . PHE A 1 100 ? 11.697  14.588  8.556   1.00 0.00 ? 100 PHE A HB2  3  
ATOM 5108  H HB3  . PHE A 1 100 ? 11.085  15.882  9.580   1.00 0.00 ? 100 PHE A HB3  3  
ATOM 5109  H HD1  . PHE A 1 100 ? 12.553  17.900  9.971   1.00 0.00 ? 100 PHE A HD1  3  
ATOM 5110  H HD2  . PHE A 1 100 ? 13.363  14.992  6.971   1.00 0.00 ? 100 PHE A HD2  3  
ATOM 5111  H HE1  . PHE A 1 100 ? 14.006  19.510  8.808   1.00 0.00 ? 100 PHE A HE1  3  
ATOM 5112  H HE2  . PHE A 1 100 ? 14.818  16.596  5.804   1.00 0.00 ? 100 PHE A HE2  3  
ATOM 5113  H HZ   . PHE A 1 100 ? 15.142  18.858  6.722   1.00 0.00 ? 100 PHE A HZ   3  
ATOM 5114  N N    . GLY A 1 101 ? 10.922  13.052  10.948  1.00 0.00 ? 101 GLY A N    3  
ATOM 5115  C CA   . GLY A 1 101 ? 9.886   12.419  11.743  1.00 0.00 ? 101 GLY A CA   3  
ATOM 5116  C C    . GLY A 1 101 ? 9.354   11.154  11.100  1.00 0.00 ? 101 GLY A C    3  
ATOM 5117  O O    . GLY A 1 101 ? 10.124  10.281  10.699  1.00 0.00 ? 101 GLY A O    3  
ATOM 5118  H H    . GLY A 1 101 ? 11.152  12.689  10.067  1.00 0.00 ? 101 GLY A H    3  
ATOM 5119  H HA2  . GLY A 1 101 ? 10.292  12.174  12.713  1.00 0.00 ? 101 GLY A HA2  3  
ATOM 5120  H HA3  . GLY A 1 101 ? 9.070   13.115  11.871  1.00 0.00 ? 101 GLY A HA3  3  
ATOM 5121  N N    . SER A 1 102 ? 8.032   11.053  11.002  1.00 0.00 ? 102 SER A N    3  
ATOM 5122  C CA   . SER A 1 102 ? 7.397   9.882   10.408  1.00 0.00 ? 102 SER A CA   3  
ATOM 5123  C C    . SER A 1 102 ? 5.919   10.145  10.136  1.00 0.00 ? 102 SER A C    3  
ATOM 5124  O O    . SER A 1 102 ? 5.357   11.135  10.606  1.00 0.00 ? 102 SER A O    3  
ATOM 5125  C CB   . SER A 1 102 ? 7.550   8.670   11.329  1.00 0.00 ? 102 SER A CB   3  
ATOM 5126  O OG   . SER A 1 102 ? 7.070   8.955   12.631  1.00 0.00 ? 102 SER A OG   3  
ATOM 5127  H H    . SER A 1 102 ? 7.471   11.782  11.340  1.00 0.00 ? 102 SER A H    3  
ATOM 5128  H HA   . SER A 1 102 ? 7.892   9.676   9.470   1.00 0.00 ? 102 SER A HA   3  
ATOM 5129  H HB2  . SER A 1 102 ? 6.989   7.841   10.925  1.00 0.00 ? 102 SER A HB2  3  
ATOM 5130  H HB3  . SER A 1 102 ? 8.594   8.400   11.393  1.00 0.00 ? 102 SER A HB3  3  
ATOM 5131  H HG   . SER A 1 102 ? 7.718   8.671   13.280  1.00 0.00 ? 102 SER A HG   3  
ATOM 5132  N N    . ASP A 1 103 ? 5.296   9.252   9.376   1.00 0.00 ? 103 ASP A N    3  
ATOM 5133  C CA   . ASP A 1 103 ? 3.882   9.386   9.041   1.00 0.00 ? 103 ASP A CA   3  
ATOM 5134  C C    . ASP A 1 103 ? 3.286   8.037   8.653   1.00 0.00 ? 103 ASP A C    3  
ATOM 5135  O O    . ASP A 1 103 ? 4.010   7.063   8.440   1.00 0.00 ? 103 ASP A O    3  
ATOM 5136  C CB   . ASP A 1 103 ? 3.699   10.387  7.900   1.00 0.00 ? 103 ASP A CB   3  
ATOM 5137  C CG   . ASP A 1 103 ? 3.516   11.807  8.398   1.00 0.00 ? 103 ASP A CG   3  
ATOM 5138  O OD1  . ASP A 1 103 ? 4.528   12.445  8.753   1.00 0.00 ? 103 ASP A OD1  3  
ATOM 5139  O OD2  . ASP A 1 103 ? 2.360   12.279  8.434   1.00 0.00 ? 103 ASP A OD2  3  
ATOM 5140  H H    . ASP A 1 103 ? 5.798   8.484   9.031   1.00 0.00 ? 103 ASP A H    3  
ATOM 5141  H HA   . ASP A 1 103 ? 3.368   9.754   9.916   1.00 0.00 ? 103 ASP A HA   3  
ATOM 5142  H HB2  . ASP A 1 103 ? 4.570   10.359  7.261   1.00 0.00 ? 103 ASP A HB2  3  
ATOM 5143  H HB3  . ASP A 1 103 ? 2.827   10.111  7.324   1.00 0.00 ? 103 ASP A HB3  3  
ATOM 5144  N N    . THR A 1 104 ? 1.961   7.985   8.562   1.00 0.00 ? 104 THR A N    3  
ATOM 5145  C CA   . THR A 1 104 ? 1.267   6.755   8.201   1.00 0.00 ? 104 THR A CA   3  
ATOM 5146  C C    . THR A 1 104 ? -0.036  7.054   7.467   1.00 0.00 ? 104 THR A C    3  
ATOM 5147  O O    . THR A 1 104 ? -0.547  8.172   7.522   1.00 0.00 ? 104 THR A O    3  
ATOM 5148  C CB   . THR A 1 104 ? 0.957   5.899   9.444   1.00 0.00 ? 104 THR A CB   3  
ATOM 5149  O OG1  . THR A 1 104 ? 2.143   5.727   10.228  1.00 0.00 ? 104 THR A OG1  3  
ATOM 5150  C CG2  . THR A 1 104 ? 0.408   4.539   9.041   1.00 0.00 ? 104 THR A CG2  3  
ATOM 5151  H H    . THR A 1 104 ? 1.438   8.794   8.743   1.00 0.00 ? 104 THR A H    3  
ATOM 5152  H HA   . THR A 1 104 ? 1.913   6.186   7.550   1.00 0.00 ? 104 THR A HA   3  
ATOM 5153  H HB   . THR A 1 104 ? 0.213   6.411   10.038  1.00 0.00 ? 104 THR A HB   3  
ATOM 5154  H HG1  . THR A 1 104 ? 2.576   4.908   9.977   1.00 0.00 ? 104 THR A HG1  3  
ATOM 5155  H HG21 . THR A 1 104 ? 0.405   3.884   9.899   1.00 0.00 ? 104 THR A HG21 3  
ATOM 5156  H HG22 . THR A 1 104 ? 1.028   4.116   8.266   1.00 0.00 ? 104 THR A HG22 3  
ATOM 5157  H HG23 . THR A 1 104 ? -0.601  4.654   8.673   1.00 0.00 ? 104 THR A HG23 3  
ATOM 5158  N N    . GLU A 1 105 ? -0.568  6.047   6.781   1.00 0.00 ? 105 GLU A N    3  
ATOM 5159  C CA   . GLU A 1 105 ? -1.811  6.204   6.036   1.00 0.00 ? 105 GLU A CA   3  
ATOM 5160  C C    . GLU A 1 105 ? -2.546  4.872   5.918   1.00 0.00 ? 105 GLU A C    3  
ATOM 5161  O O    . GLU A 1 105 ? -1.926  3.822   5.747   1.00 0.00 ? 105 GLU A O    3  
ATOM 5162  C CB   . GLU A 1 105 ? -1.529  6.769   4.643   1.00 0.00 ? 105 GLU A CB   3  
ATOM 5163  C CG   . GLU A 1 105 ? -2.763  6.860   3.761   1.00 0.00 ? 105 GLU A CG   3  
ATOM 5164  C CD   . GLU A 1 105 ? -3.908  7.592   4.434   1.00 0.00 ? 105 GLU A CD   3  
ATOM 5165  O OE1  . GLU A 1 105 ? -3.634  8.479   5.270   1.00 0.00 ? 105 GLU A OE1  3  
ATOM 5166  O OE2  . GLU A 1 105 ? -5.077  7.280   4.125   1.00 0.00 ? 105 GLU A OE2  3  
ATOM 5167  H H    . GLU A 1 105 ? -0.113  5.179   6.776   1.00 0.00 ? 105 GLU A H    3  
ATOM 5168  H HA   . GLU A 1 105 ? -2.436  6.899   6.577   1.00 0.00 ? 105 GLU A HA   3  
ATOM 5169  H HB2  . GLU A 1 105 ? -1.112  7.760   4.747   1.00 0.00 ? 105 GLU A HB2  3  
ATOM 5170  H HB3  . GLU A 1 105 ? -0.807  6.135   4.150   1.00 0.00 ? 105 GLU A HB3  3  
ATOM 5171  H HG2  . GLU A 1 105 ? -2.504  7.384   2.854   1.00 0.00 ? 105 GLU A HG2  3  
ATOM 5172  H HG3  . GLU A 1 105 ? -3.090  5.859   3.517   1.00 0.00 ? 105 GLU A HG3  3  
ATOM 5173  N N    . ILE A 1 106 ? -3.871  4.923   6.010   1.00 0.00 ? 106 ILE A N    3  
ATOM 5174  C CA   . ILE A 1 106 ? -4.690  3.721   5.913   1.00 0.00 ? 106 ILE A CA   3  
ATOM 5175  C C    . ILE A 1 106 ? -5.224  3.533   4.497   1.00 0.00 ? 106 ILE A C    3  
ATOM 5176  O O    . ILE A 1 106 ? -5.757  4.466   3.895   1.00 0.00 ? 106 ILE A O    3  
ATOM 5177  C CB   . ILE A 1 106 ? -5.875  3.767   6.895   1.00 0.00 ? 106 ILE A CB   3  
ATOM 5178  C CG1  . ILE A 1 106 ? -5.371  3.934   8.330   1.00 0.00 ? 106 ILE A CG1  3  
ATOM 5179  C CG2  . ILE A 1 106 ? -6.718  2.507   6.766   1.00 0.00 ? 106 ILE A CG2  3  
ATOM 5180  C CD1  . ILE A 1 106 ? -6.418  4.475   9.279   1.00 0.00 ? 106 ILE A CD1  3  
ATOM 5181  H H    . ILE A 1 106 ? -4.307  5.789   6.146   1.00 0.00 ? 106 ILE A H    3  
ATOM 5182  H HA   . ILE A 1 106 ? -4.070  2.874   6.167   1.00 0.00 ? 106 ILE A HA   3  
ATOM 5183  H HB   . ILE A 1 106 ? -6.494  4.613   6.637   1.00 0.00 ? 106 ILE A HB   3  
ATOM 5184  H HG12 . ILE A 1 106 ? -5.048  2.976   8.704   1.00 0.00 ? 106 ILE A HG12 3  
ATOM 5185  H HG13 . ILE A 1 106 ? -4.535  4.618   8.332   1.00 0.00 ? 106 ILE A HG13 3  
ATOM 5186  H HG21 . ILE A 1 106 ? -7.504  2.672   6.044   1.00 0.00 ? 106 ILE A HG21 3  
ATOM 5187  H HG22 . ILE A 1 106 ? -6.095  1.689   6.438   1.00 0.00 ? 106 ILE A HG22 3  
ATOM 5188  H HG23 . ILE A 1 106 ? -7.154  2.266   7.724   1.00 0.00 ? 106 ILE A HG23 3  
ATOM 5189  H HD11 . ILE A 1 106 ? -6.080  4.348   10.297  1.00 0.00 ? 106 ILE A HD11 3  
ATOM 5190  H HD12 . ILE A 1 106 ? -6.578  5.523   9.079   1.00 0.00 ? 106 ILE A HD12 3  
ATOM 5191  H HD13 . ILE A 1 106 ? -7.344  3.936   9.138   1.00 0.00 ? 106 ILE A HD13 3  
ATOM 5192  N N    . ILE A 1 107 ? -5.078  2.322   3.971   1.00 0.00 ? 107 ILE A N    3  
ATOM 5193  C CA   . ILE A 1 107 ? -5.548  2.011   2.627   1.00 0.00 ? 107 ILE A CA   3  
ATOM 5194  C C    . ILE A 1 107 ? -6.322  0.697   2.606   1.00 0.00 ? 107 ILE A C    3  
ATOM 5195  O O    . ILE A 1 107 ? -5.807  -0.345  3.012   1.00 0.00 ? 107 ILE A O    3  
ATOM 5196  C CB   . ILE A 1 107 ? -4.380  1.922   1.628   1.00 0.00 ? 107 ILE A CB   3  
ATOM 5197  C CG1  . ILE A 1 107 ? -3.600  3.239   1.603   1.00 0.00 ? 107 ILE A CG1  3  
ATOM 5198  C CG2  . ILE A 1 107 ? -4.896  1.580   0.238   1.00 0.00 ? 107 ILE A CG2  3  
ATOM 5199  C CD1  . ILE A 1 107 ? -2.470  3.291   2.607   1.00 0.00 ? 107 ILE A CD1  3  
ATOM 5200  H H    . ILE A 1 107 ? -4.645  1.620   4.500   1.00 0.00 ? 107 ILE A H    3  
ATOM 5201  H HA   . ILE A 1 107 ? -6.206  2.808   2.312   1.00 0.00 ? 107 ILE A HA   3  
ATOM 5202  H HB   . ILE A 1 107 ? -3.722  1.129   1.947   1.00 0.00 ? 107 ILE A HB   3  
ATOM 5203  H HG12 . ILE A 1 107 ? -3.178  3.381   0.621   1.00 0.00 ? 107 ILE A HG12 3  
ATOM 5204  H HG13 . ILE A 1 107 ? -4.277  4.053   1.821   1.00 0.00 ? 107 ILE A HG13 3  
ATOM 5205  H HG21 . ILE A 1 107 ? -4.889  2.467   -0.377  1.00 0.00 ? 107 ILE A HG21 3  
ATOM 5206  H HG22 . ILE A 1 107 ? -4.259  0.829   -0.206  1.00 0.00 ? 107 ILE A HG22 3  
ATOM 5207  H HG23 . ILE A 1 107 ? -5.904  1.200   0.312   1.00 0.00 ? 107 ILE A HG23 3  
ATOM 5208  H HD11 . ILE A 1 107 ? -1.660  2.660   2.271   1.00 0.00 ? 107 ILE A HD11 3  
ATOM 5209  H HD12 . ILE A 1 107 ? -2.120  4.307   2.704   1.00 0.00 ? 107 ILE A HD12 3  
ATOM 5210  H HD13 . ILE A 1 107 ? -2.824  2.939   3.566   1.00 0.00 ? 107 ILE A HD13 3  
ATOM 5211  N N    . ARG A 1 108 ? -7.560  0.753   2.127   1.00 0.00 ? 108 ARG A N    3  
ATOM 5212  C CA   . ARG A 1 108 ? -8.405  -0.433  2.052   1.00 0.00 ? 108 ARG A CA   3  
ATOM 5213  C C    . ARG A 1 108 ? -8.658  -0.829  0.600   1.00 0.00 ? 108 ARG A C    3  
ATOM 5214  O O    . ARG A 1 108 ? -9.552  -0.290  -0.055  1.00 0.00 ? 108 ARG A O    3  
ATOM 5215  C CB   . ARG A 1 108 ? -9.736  -0.183  2.763   1.00 0.00 ? 108 ARG A CB   3  
ATOM 5216  C CG   . ARG A 1 108 ? -9.667  -0.374  4.270   1.00 0.00 ? 108 ARG A CG   3  
ATOM 5217  C CD   . ARG A 1 108 ? -11.010 -0.804  4.839   1.00 0.00 ? 108 ARG A CD   3  
ATOM 5218  N NE   . ARG A 1 108 ? -11.840 0.341   5.206   1.00 0.00 ? 108 ARG A NE   3  
ATOM 5219  C CZ   . ARG A 1 108 ? -11.592 1.123   6.251   1.00 0.00 ? 108 ARG A CZ   3  
ATOM 5220  N NH1  . ARG A 1 108 ? -10.543 0.886   7.027   1.00 0.00 ? 108 ARG A NH1  3  
ATOM 5221  N NH2  . ARG A 1 108 ? -12.394 2.146   6.520   1.00 0.00 ? 108 ARG A NH2  3  
ATOM 5222  H H    . ARG A 1 108 ? -7.915  1.613   1.818   1.00 0.00 ? 108 ARG A H    3  
ATOM 5223  H HA   . ARG A 1 108 ? -7.888  -1.241  2.548   1.00 0.00 ? 108 ARG A HA   3  
ATOM 5224  H HB2  . ARG A 1 108 ? -10.052 0.830   2.565   1.00 0.00 ? 108 ARG A HB2  3  
ATOM 5225  H HB3  . ARG A 1 108 ? -10.474 -0.865  2.369   1.00 0.00 ? 108 ARG A HB3  3  
ATOM 5226  H HG2  . ARG A 1 108 ? -8.934  -1.135  4.493   1.00 0.00 ? 108 ARG A HG2  3  
ATOM 5227  H HG3  . ARG A 1 108 ? -9.373  0.558   4.728   1.00 0.00 ? 108 ARG A HG3  3  
ATOM 5228  H HD2  . ARG A 1 108 ? -11.530 -1.390  4.096   1.00 0.00 ? 108 ARG A HD2  3  
ATOM 5229  H HD3  . ARG A 1 108 ? -10.837 -1.408  5.717   1.00 0.00 ? 108 ARG A HD3  3  
ATOM 5230  H HE   . ARG A 1 108 ? -12.620 0.534   4.646   1.00 0.00 ? 108 ARG A HE   3  
ATOM 5231  H HH11 . ARG A 1 108 ? -9.937  0.117   6.825   1.00 0.00 ? 108 ARG A HH11 3  
ATOM 5232  H HH12 . ARG A 1 108 ? -10.358 1.478   7.812   1.00 0.00 ? 108 ARG A HH12 3  
ATOM 5233  H HH21 . ARG A 1 108 ? -13.185 2.327   5.937   1.00 0.00 ? 108 ARG A HH21 3  
ATOM 5234  H HH22 . ARG A 1 108 ? -12.206 2.734   7.306   1.00 0.00 ? 108 ARG A HH22 3  
ATOM 5235  N N    . LEU A 1 109 ? -7.866  -1.772  0.103   1.00 0.00 ? 109 LEU A N    3  
ATOM 5236  C CA   . LEU A 1 109 ? -8.003  -2.240  -1.272  1.00 0.00 ? 109 LEU A CA   3  
ATOM 5237  C C    . LEU A 1 109 ? -9.412  -2.766  -1.530  1.00 0.00 ? 109 LEU A C    3  
ATOM 5238  O O    . LEU A 1 109 ? -9.996  -3.447  -0.687  1.00 0.00 ? 109 LEU A O    3  
ATOM 5239  C CB   . LEU A 1 109 ? -6.976  -3.335  -1.564  1.00 0.00 ? 109 LEU A CB   3  
ATOM 5240  C CG   . LEU A 1 109 ? -6.627  -3.553  -3.037  1.00 0.00 ? 109 LEU A CG   3  
ATOM 5241  C CD1  . LEU A 1 109 ? -6.078  -2.274  -3.650  1.00 0.00 ? 109 LEU A CD1  3  
ATOM 5242  C CD2  . LEU A 1 109 ? -5.627  -4.690  -3.185  1.00 0.00 ? 109 LEU A CD2  3  
ATOM 5243  H H    . LEU A 1 109 ? -7.172  -2.163  0.672   1.00 0.00 ? 109 LEU A H    3  
ATOM 5244  H HA   . LEU A 1 109 ? -7.820  -1.401  -1.927  1.00 0.00 ? 109 LEU A HA   3  
ATOM 5245  H HB2  . LEU A 1 109 ? -6.066  -3.082  -1.043  1.00 0.00 ? 109 LEU A HB2  3  
ATOM 5246  H HB3  . LEU A 1 109 ? -7.366  -4.265  -1.174  1.00 0.00 ? 109 LEU A HB3  3  
ATOM 5247  H HG   . LEU A 1 109 ? -7.524  -3.822  -3.577  1.00 0.00 ? 109 LEU A HG   3  
ATOM 5248  H HD11 . LEU A 1 109 ? -6.062  -1.495  -2.903  1.00 0.00 ? 109 LEU A HD11 3  
ATOM 5249  H HD12 . LEU A 1 109 ? -6.707  -1.971  -4.474  1.00 0.00 ? 109 LEU A HD12 3  
ATOM 5250  H HD13 . LEU A 1 109 ? -5.074  -2.450  -4.010  1.00 0.00 ? 109 LEU A HD13 3  
ATOM 5251  H HD21 . LEU A 1 109 ? -6.148  -5.635  -3.139  1.00 0.00 ? 109 LEU A HD21 3  
ATOM 5252  H HD22 . LEU A 1 109 ? -4.903  -4.639  -2.385  1.00 0.00 ? 109 LEU A HD22 3  
ATOM 5253  H HD23 . LEU A 1 109 ? -5.122  -4.603  -4.136  1.00 0.00 ? 109 LEU A HD23 3  
ATOM 5254  N N    . LYS A 1 110 ? -9.951  -2.447  -2.702  1.00 0.00 ? 110 LYS A N    3  
ATOM 5255  C CA   . LYS A 1 110 ? -11.290 -2.890  -3.074  1.00 0.00 ? 110 LYS A CA   3  
ATOM 5256  C C    . LYS A 1 110 ? -11.278 -3.572  -4.438  1.00 0.00 ? 110 LYS A C    3  
ATOM 5257  O O    . LYS A 1 110 ? -10.249 -3.611  -5.113  1.00 0.00 ? 110 LYS A O    3  
ATOM 5258  C CB   . LYS A 1 110 ? -12.255 -1.702  -3.095  1.00 0.00 ? 110 LYS A CB   3  
ATOM 5259  C CG   . LYS A 1 110 ? -12.542 -1.127  -1.718  1.00 0.00 ? 110 LYS A CG   3  
ATOM 5260  C CD   . LYS A 1 110 ? -13.492 -2.014  -0.931  1.00 0.00 ? 110 LYS A CD   3  
ATOM 5261  C CE   . LYS A 1 110 ? -13.686 -1.502  0.488   1.00 0.00 ? 110 LYS A CE   3  
ATOM 5262  N NZ   . LYS A 1 110 ? -12.585 -1.940  1.390   1.00 0.00 ? 110 LYS A NZ   3  
ATOM 5263  H H    . LYS A 1 110 ? -9.436  -1.901  -3.332  1.00 0.00 ? 110 LYS A H    3  
ATOM 5264  H HA   . LYS A 1 110 ? -11.623 -3.600  -2.332  1.00 0.00 ? 110 LYS A HA   3  
ATOM 5265  H HB2  . LYS A 1 110 ? -11.831 -0.920  -3.707  1.00 0.00 ? 110 LYS A HB2  3  
ATOM 5266  H HB3  . LYS A 1 110 ? -13.190 -2.021  -3.531  1.00 0.00 ? 110 LYS A HB3  3  
ATOM 5267  H HG2  . LYS A 1 110 ? -11.614 -1.040  -1.173  1.00 0.00 ? 110 LYS A HG2  3  
ATOM 5268  H HG3  . LYS A 1 110 ? -12.988 -0.149  -1.832  1.00 0.00 ? 110 LYS A HG3  3  
ATOM 5269  H HD2  . LYS A 1 110 ? -14.451 -2.032  -1.429  1.00 0.00 ? 110 LYS A HD2  3  
ATOM 5270  H HD3  . LYS A 1 110 ? -13.087 -3.015  -0.892  1.00 0.00 ? 110 LYS A HD3  3  
ATOM 5271  H HE2  . LYS A 1 110 ? -13.715 -0.424  0.467   1.00 0.00 ? 110 LYS A HE2  3  
ATOM 5272  H HE3  . LYS A 1 110 ? -14.624 -1.880  0.868   1.00 0.00 ? 110 LYS A HE3  3  
ATOM 5273  H HZ1  . LYS A 1 110 ? -12.600 -1.382  2.268   1.00 0.00 ? 110 LYS A HZ1  3  
ATOM 5274  H HZ2  . LYS A 1 110 ? -11.666 -1.806  0.923   1.00 0.00 ? 110 LYS A HZ2  3  
ATOM 5275  H HZ3  . LYS A 1 110 ? -12.698 -2.946  1.630   1.00 0.00 ? 110 LYS A HZ3  3  
ATOM 5276  N N    . GLU A 1 111 ? -12.427 -4.108  -4.837  1.00 0.00 ? 111 GLU A N    3  
ATOM 5277  C CA   . GLU A 1 111 ? -12.547 -4.788  -6.121  1.00 0.00 ? 111 GLU A CA   3  
ATOM 5278  C C    . GLU A 1 111 ? -12.063 -3.892  -7.258  1.00 0.00 ? 111 GLU A C    3  
ATOM 5279  O O    . GLU A 1 111 ? -11.423 -4.360  -8.200  1.00 0.00 ? 111 GLU A O    3  
ATOM 5280  C CB   . GLU A 1 111 ? -13.998 -5.205  -6.369  1.00 0.00 ? 111 GLU A CB   3  
ATOM 5281  C CG   . GLU A 1 111 ? -14.337 -6.582  -5.822  1.00 0.00 ? 111 GLU A CG   3  
ATOM 5282  C CD   . GLU A 1 111 ? -15.496 -7.231  -6.553  1.00 0.00 ? 111 GLU A CD   3  
ATOM 5283  O OE1  . GLU A 1 111 ? -15.362 -7.491  -7.767  1.00 0.00 ? 111 GLU A OE1  3  
ATOM 5284  O OE2  . GLU A 1 111 ? -16.538 -7.479  -5.910  1.00 0.00 ? 111 GLU A OE2  3  
ATOM 5285  H H    . GLU A 1 111 ? -13.212 -4.044  -4.254  1.00 0.00 ? 111 GLU A H    3  
ATOM 5286  H HA   . GLU A 1 111 ? -11.929 -5.672  -6.087  1.00 0.00 ? 111 GLU A HA   3  
ATOM 5287  H HB2  . GLU A 1 111 ? -14.652 -4.484  -5.903  1.00 0.00 ? 111 GLU A HB2  3  
ATOM 5288  H HB3  . GLU A 1 111 ? -14.182 -5.209  -7.433  1.00 0.00 ? 111 GLU A HB3  3  
ATOM 5289  H HG2  . GLU A 1 111 ? -13.469 -7.217  -5.919  1.00 0.00 ? 111 GLU A HG2  3  
ATOM 5290  H HG3  . GLU A 1 111 ? -14.597 -6.486  -4.778  1.00 0.00 ? 111 GLU A HG3  3  
ATOM 5291  N N    . GLN A 1 112 ? -12.374 -2.604  -7.163  1.00 0.00 ? 112 GLN A N    3  
ATOM 5292  C CA   . GLN A 1 112 ? -11.972 -1.643  -8.183  1.00 0.00 ? 112 GLN A CA   3  
ATOM 5293  C C    . GLN A 1 112 ? -12.193 -0.213  -7.702  1.00 0.00 ? 112 GLN A C    3  
ATOM 5294  O O    . GLN A 1 112 ? -12.950 0.026   -6.763  1.00 0.00 ? 112 GLN A O    3  
ATOM 5295  C CB   . GLN A 1 112 ? -12.752 -1.886  -9.477  1.00 0.00 ? 112 GLN A CB   3  
ATOM 5296  C CG   . GLN A 1 112 ? -12.082 -1.301  -10.710 1.00 0.00 ? 112 GLN A CG   3  
ATOM 5297  C CD   . GLN A 1 112 ? -12.653 -1.852  -12.001 1.00 0.00 ? 112 GLN A CD   3  
ATOM 5298  O OE1  . GLN A 1 112 ? -13.288 -1.130  -12.771 1.00 0.00 ? 112 GLN A OE1  3  
ATOM 5299  N NE2  . GLN A 1 112 ? -12.430 -3.138  -12.246 1.00 0.00 ? 112 GLN A NE2  3  
ATOM 5300  H H    . GLN A 1 112 ? -12.886 -2.292  -6.388  1.00 0.00 ? 112 GLN A H    3  
ATOM 5301  H HA   . GLN A 1 112 ? -10.919 -1.786  -8.376  1.00 0.00 ? 112 GLN A HA   3  
ATOM 5302  H HB2  . GLN A 1 112 ? -12.861 -2.950  -9.623  1.00 0.00 ? 112 GLN A HB2  3  
ATOM 5303  H HB3  . GLN A 1 112 ? -13.731 -1.440  -9.381  1.00 0.00 ? 112 GLN A HB3  3  
ATOM 5304  H HG2  . GLN A 1 112 ? -12.217 -0.229  -10.703 1.00 0.00 ? 112 GLN A HG2  3  
ATOM 5305  H HG3  . GLN A 1 112 ? -11.027 -1.530  -10.673 1.00 0.00 ? 112 GLN A HG3  3  
ATOM 5306  H HE21 . GLN A 1 112 ? -11.917 -3.652  -11.587 1.00 0.00 ? 112 GLN A HE21 3  
ATOM 5307  H HE22 . GLN A 1 112 ? -12.788 -3.520  -13.073 1.00 0.00 ? 112 GLN A HE22 3  
ATOM 5308  N N    . GLY A 1 113 ? -11.526 0.735   -8.354  1.00 0.00 ? 113 GLY A N    3  
ATOM 5309  C CA   . GLY A 1 113 ? -11.663 2.130   -7.977  1.00 0.00 ? 113 GLY A CA   3  
ATOM 5310  C C    . GLY A 1 113 ? -12.839 2.801   -8.659  1.00 0.00 ? 113 GLY A C    3  
ATOM 5311  O O    . GLY A 1 113 ? -12.681 3.835   -9.308  1.00 0.00 ? 113 GLY A O    3  
ATOM 5312  H H    . GLY A 1 113 ? -10.935 0.485   -9.095  1.00 0.00 ? 113 GLY A H    3  
ATOM 5313  H HA2  . GLY A 1 113 ? -11.796 2.192   -6.908  1.00 0.00 ? 113 GLY A HA2  3  
ATOM 5314  H HA3  . GLY A 1 113 ? -10.758 2.654   -8.248  1.00 0.00 ? 113 GLY A HA3  3  
ATOM 5315  N N    . SER A 1 114 ? -14.021 2.212   -8.512  1.00 0.00 ? 114 SER A N    3  
ATOM 5316  C CA   . SER A 1 114 ? -15.228 2.757   -9.123  1.00 0.00 ? 114 SER A CA   3  
ATOM 5317  C C    . SER A 1 114 ? -15.805 3.885   -8.273  1.00 0.00 ? 114 SER A C    3  
ATOM 5318  O O    . SER A 1 114 ? -16.149 4.949   -8.787  1.00 0.00 ? 114 SER A O    3  
ATOM 5319  C CB   . SER A 1 114 ? -16.273 1.655   -9.307  1.00 0.00 ? 114 SER A CB   3  
ATOM 5320  O OG   . SER A 1 114 ? -17.322 2.085   -10.158 1.00 0.00 ? 114 SER A OG   3  
ATOM 5321  H H    . SER A 1 114 ? -14.082 1.390   -7.982  1.00 0.00 ? 114 SER A H    3  
ATOM 5322  H HA   . SER A 1 114 ? -14.960 3.152   -10.091 1.00 0.00 ? 114 SER A HA   3  
ATOM 5323  H HB2  . SER A 1 114 ? -15.805 0.787   -9.743  1.00 0.00 ? 114 SER A HB2  3  
ATOM 5324  H HB3  . SER A 1 114 ? -16.691 1.394   -8.345  1.00 0.00 ? 114 SER A HB3  3  
ATOM 5325  H HG   . SER A 1 114 ? -18.039 1.447   -10.129 1.00 0.00 ? 114 SER A HG   3  
ATOM 5326  N N    . GLU A 1 115 ? -15.907 3.643   -6.970  1.00 0.00 ? 115 GLU A N    3  
ATOM 5327  C CA   . GLU A 1 115 ? -16.444 4.638   -6.049  1.00 0.00 ? 115 GLU A CA   3  
ATOM 5328  C C    . GLU A 1 115 ? -15.470 4.900   -4.904  1.00 0.00 ? 115 GLU A C    3  
ATOM 5329  O O    . GLU A 1 115 ? -14.843 3.977   -4.385  1.00 0.00 ? 115 GLU A O    3  
ATOM 5330  C CB   . GLU A 1 115 ? -17.791 4.176   -5.491  1.00 0.00 ? 115 GLU A CB   3  
ATOM 5331  C CG   . GLU A 1 115 ? -18.349 5.088   -4.412  1.00 0.00 ? 115 GLU A CG   3  
ATOM 5332  C CD   . GLU A 1 115 ? -19.642 4.565   -3.817  1.00 0.00 ? 115 GLU A CD   3  
ATOM 5333  O OE1  . GLU A 1 115 ? -20.669 4.574   -4.527  1.00 0.00 ? 115 GLU A OE1  3  
ATOM 5334  O OE2  . GLU A 1 115 ? -19.626 4.147   -2.640  1.00 0.00 ? 115 GLU A OE2  3  
ATOM 5335  H H    . GLU A 1 115 ? -15.616 2.775   -6.620  1.00 0.00 ? 115 GLU A H    3  
ATOM 5336  H HA   . GLU A 1 115 ? -16.589 5.556   -6.599  1.00 0.00 ? 115 GLU A HA   3  
ATOM 5337  H HB2  . GLU A 1 115 ? -18.506 4.130   -6.300  1.00 0.00 ? 115 GLU A HB2  3  
ATOM 5338  H HB3  . GLU A 1 115 ? -17.673 3.187   -5.071  1.00 0.00 ? 115 GLU A HB3  3  
ATOM 5339  H HG2  . GLU A 1 115 ? -17.619 5.179   -3.622  1.00 0.00 ? 115 GLU A HG2  3  
ATOM 5340  H HG3  . GLU A 1 115 ? -18.536 6.061   -4.842  1.00 0.00 ? 115 GLU A HG3  3  
ATOM 5341  N N    . MET A 1 116 ? -15.349 6.166   -4.516  1.00 0.00 ? 116 MET A N    3  
ATOM 5342  C CA   . MET A 1 116 ? -14.452 6.550   -3.432  1.00 0.00 ? 116 MET A CA   3  
ATOM 5343  C C    . MET A 1 116 ? -14.881 5.906   -2.117  1.00 0.00 ? 116 MET A C    3  
ATOM 5344  O O    . MET A 1 116 ? -15.788 6.393   -1.444  1.00 0.00 ? 116 MET A O    3  
ATOM 5345  C CB   . MET A 1 116 ? -14.422 8.072   -3.281  1.00 0.00 ? 116 MET A CB   3  
ATOM 5346  C CG   . MET A 1 116 ? -13.395 8.563   -2.273  1.00 0.00 ? 116 MET A CG   3  
ATOM 5347  S SD   . MET A 1 116 ? -11.704 8.158   -2.751  1.00 0.00 ? 116 MET A SD   3  
ATOM 5348  C CE   . MET A 1 116 ? -10.938 7.955   -1.145  1.00 0.00 ? 116 MET A CE   3  
ATOM 5349  H H    . MET A 1 116 ? -15.875 6.858   -4.968  1.00 0.00 ? 116 MET A H    3  
ATOM 5350  H HA   . MET A 1 116 ? -13.461 6.202   -3.683  1.00 0.00 ? 116 MET A HA   3  
ATOM 5351  H HB2  . MET A 1 116 ? -14.192 8.512   -4.240  1.00 0.00 ? 116 MET A HB2  3  
ATOM 5352  H HB3  . MET A 1 116 ? -15.396 8.410   -2.963  1.00 0.00 ? 116 MET A HB3  3  
ATOM 5353  H HG2  . MET A 1 116 ? -13.481 9.635   -2.184  1.00 0.00 ? 116 MET A HG2  3  
ATOM 5354  H HG3  . MET A 1 116 ? -13.604 8.106   -1.317  1.00 0.00 ? 116 MET A HG3  3  
ATOM 5355  H HE1  . MET A 1 116 ? -10.399 7.019   -1.119  1.00 0.00 ? 116 MET A HE1  3  
ATOM 5356  H HE2  . MET A 1 116 ? -10.252 8.770   -0.968  1.00 0.00 ? 116 MET A HE2  3  
ATOM 5357  H HE3  . MET A 1 116 ? -11.701 7.954   -0.380  1.00 0.00 ? 116 MET A HE3  3  
ATOM 5358  N N    . SER A 1 117 ? -14.223 4.808   -1.759  1.00 0.00 ? 117 SER A N    3  
ATOM 5359  C CA   . SER A 1 117 ? -14.539 4.095   -0.527  1.00 0.00 ? 117 SER A CA   3  
ATOM 5360  C C    . SER A 1 117 ? -13.887 4.772   0.675   1.00 0.00 ? 117 SER A C    3  
ATOM 5361  O O    . SER A 1 117 ? -12.723 5.167   0.623   1.00 0.00 ? 117 SER A O    3  
ATOM 5362  C CB   . SER A 1 117 ? -14.076 2.640   -0.621  1.00 0.00 ? 117 SER A CB   3  
ATOM 5363  O OG   . SER A 1 117 ? -14.764 1.824   0.312   1.00 0.00 ? 117 SER A OG   3  
ATOM 5364  H H    . SER A 1 117 ? -13.509 4.468   -2.338  1.00 0.00 ? 117 SER A H    3  
ATOM 5365  H HA   . SER A 1 117 ? -15.611 4.115   -0.398  1.00 0.00 ? 117 SER A HA   3  
ATOM 5366  H HB2  . SER A 1 117 ? -14.267 2.268   -1.616  1.00 0.00 ? 117 SER A HB2  3  
ATOM 5367  H HB3  . SER A 1 117 ? -13.017 2.588   -0.414  1.00 0.00 ? 117 SER A HB3  3  
ATOM 5368  H HG   . SER A 1 117 ? -15.371 1.246   -0.155  1.00 0.00 ? 117 SER A HG   3  
ATOM 5369  N N    . GLY A 1 118 ? -14.648 4.901   1.758   1.00 0.00 ? 118 GLY A N    3  
ATOM 5370  C CA   . GLY A 1 118 ? -14.128 5.530   2.959   1.00 0.00 ? 118 GLY A CA   3  
ATOM 5371  C C    . GLY A 1 118 ? -15.215 6.188   3.785   1.00 0.00 ? 118 GLY A C    3  
ATOM 5372  O O    . GLY A 1 118 ? -16.392 6.175   3.426   1.00 0.00 ? 118 GLY A O    3  
ATOM 5373  H H    . GLY A 1 118 ? -15.569 4.567   1.742   1.00 0.00 ? 118 GLY A H    3  
ATOM 5374  H HA2  . GLY A 1 118 ? -13.636 4.780   3.561   1.00 0.00 ? 118 GLY A HA2  3  
ATOM 5375  H HA3  . GLY A 1 118 ? -13.405 6.280   2.674   1.00 0.00 ? 118 GLY A HA3  3  
ATOM 5376  N N    . PRO A 1 119 ? -14.822 6.780   4.923   1.00 0.00 ? 119 PRO A N    3  
ATOM 5377  C CA   . PRO A 1 119 ? -15.756 7.457   5.827   1.00 0.00 ? 119 PRO A CA   3  
ATOM 5378  C C    . PRO A 1 119 ? -16.308 8.747   5.231   1.00 0.00 ? 119 PRO A C    3  
ATOM 5379  O O    . PRO A 1 119 ? -15.789 9.833   5.489   1.00 0.00 ? 119 PRO A O    3  
ATOM 5380  C CB   . PRO A 1 119 ? -14.901 7.760   7.059   1.00 0.00 ? 119 PRO A CB   3  
ATOM 5381  C CG   . PRO A 1 119 ? -13.504 7.824   6.545   1.00 0.00 ? 119 PRO A CG   3  
ATOM 5382  C CD   . PRO A 1 119 ? -13.434 6.835   5.414   1.00 0.00 ? 119 PRO A CD   3  
ATOM 5383  H HA   . PRO A 1 119 ? -16.576 6.811   6.106   1.00 0.00 ? 119 PRO A HA   3  
ATOM 5384  H HB2  . PRO A 1 119 ? -15.207 8.703   7.490   1.00 0.00 ? 119 PRO A HB2  3  
ATOM 5385  H HB3  . PRO A 1 119 ? -15.018 6.971   7.787   1.00 0.00 ? 119 PRO A HB3  3  
ATOM 5386  H HG2  . PRO A 1 119 ? -13.289 8.819   6.187   1.00 0.00 ? 119 PRO A HG2  3  
ATOM 5387  H HG3  . PRO A 1 119 ? -12.812 7.547   7.327   1.00 0.00 ? 119 PRO A HG3  3  
ATOM 5388  H HD2  . PRO A 1 119 ? -12.766 7.190   4.643   1.00 0.00 ? 119 PRO A HD2  3  
ATOM 5389  H HD3  . PRO A 1 119 ? -13.116 5.869   5.776   1.00 0.00 ? 119 PRO A HD3  3  
ATOM 5390  N N    . SER A 1 120 ? -17.363 8.621   4.432   1.00 0.00 ? 120 SER A N    3  
ATOM 5391  C CA   . SER A 1 120 ? -17.983 9.778   3.796   1.00 0.00 ? 120 SER A CA   3  
ATOM 5392  C C    . SER A 1 120 ? -18.854 10.542  4.789   1.00 0.00 ? 120 SER A C    3  
ATOM 5393  O O    . SER A 1 120 ? -20.040 10.250  4.944   1.00 0.00 ? 120 SER A O    3  
ATOM 5394  C CB   . SER A 1 120 ? -18.824 9.337   2.597   1.00 0.00 ? 120 SER A CB   3  
ATOM 5395  O OG   . SER A 1 120 ? -19.302 10.456  1.871   1.00 0.00 ? 120 SER A OG   3  
ATOM 5396  H H    . SER A 1 120 ? -17.731 7.729   4.264   1.00 0.00 ? 120 SER A H    3  
ATOM 5397  H HA   . SER A 1 120 ? -17.194 10.430  3.452   1.00 0.00 ? 120 SER A HA   3  
ATOM 5398  H HB2  . SER A 1 120 ? -18.220 8.730   1.940   1.00 0.00 ? 120 SER A HB2  3  
ATOM 5399  H HB3  . SER A 1 120 ? -19.669 8.761   2.945   1.00 0.00 ? 120 SER A HB3  3  
ATOM 5400  H HG   . SER A 1 120 ? -19.363 11.215  2.455   1.00 0.00 ? 120 SER A HG   3  
ATOM 5401  N N    . SER A 1 121 ? -18.256 11.522  5.459   1.00 0.00 ? 121 SER A N    3  
ATOM 5402  C CA   . SER A 1 121 ? -18.975 12.326  6.441   1.00 0.00 ? 121 SER A CA   3  
ATOM 5403  C C    . SER A 1 121 ? -19.604 11.441  7.513   1.00 0.00 ? 121 SER A C    3  
ATOM 5404  O O    . SER A 1 121 ? -20.590 11.817  8.144   1.00 0.00 ? 121 SER A O    3  
ATOM 5405  C CB   . SER A 1 121 ? -20.057 13.160  5.753   1.00 0.00 ? 121 SER A CB   3  
ATOM 5406  O OG   . SER A 1 121 ? -19.553 14.425  5.359   1.00 0.00 ? 121 SER A OG   3  
ATOM 5407  H H    . SER A 1 121 ? -17.308 11.706  5.291   1.00 0.00 ? 121 SER A H    3  
ATOM 5408  H HA   . SER A 1 121 ? -18.264 12.990  6.910   1.00 0.00 ? 121 SER A HA   3  
ATOM 5409  H HB2  . SER A 1 121 ? -20.409 12.638  4.877   1.00 0.00 ? 121 SER A HB2  3  
ATOM 5410  H HB3  . SER A 1 121 ? -20.880 13.311  6.437   1.00 0.00 ? 121 SER A HB3  3  
ATOM 5411  H HG   . SER A 1 121 ? -18.606 14.360  5.212   1.00 0.00 ? 121 SER A HG   3  
ATOM 5412  N N    . GLY A 1 122 ? -19.024 10.261  7.712   1.00 0.00 ? 122 GLY A N    3  
ATOM 5413  C CA   . GLY A 1 122 ? -19.540 9.340   8.707   1.00 0.00 ? 122 GLY A CA   3  
ATOM 5414  C C    . GLY A 1 122 ? -18.520 9.014   9.780   1.00 0.00 ? 122 GLY A C    3  
ATOM 5415  O O    . GLY A 1 122 ? -18.618 7.984   10.447  1.00 0.00 ? 122 GLY A O    3  
ATOM 5416  H H    . GLY A 1 122 ? -18.240 10.014  7.178   1.00 0.00 ? 122 GLY A H    3  
ATOM 5417  H HA2  . GLY A 1 122 ? -20.409 9.780   9.173   1.00 0.00 ? 122 GLY A HA2  3  
ATOM 5418  H HA3  . GLY A 1 122 ? -19.833 8.423   8.216   1.00 0.00 ? 122 GLY A HA3  3  
ATOM 5419  N N    . GLY A 1 1   ? -11.241 33.471  -5.897  1.00 0.00 ? 1   GLY A N    4  
ATOM 5420  C CA   . GLY A 1 1   ? -9.807  33.347  -6.077  1.00 0.00 ? 1   GLY A CA   4  
ATOM 5421  C C    . GLY A 1 1   ? -9.046  34.524  -5.502  1.00 0.00 ? 1   GLY A C    4  
ATOM 5422  O O    . GLY A 1 1   ? -9.228  34.881  -4.338  1.00 0.00 ? 1   GLY A O    4  
ATOM 5423  H H1   . GLY A 1 1   ? -11.608 34.244  -5.419  1.00 0.00 ? 1   GLY A H1   4  
ATOM 5424  H HA2  . GLY A 1 1   ? -9.471  32.442  -5.592  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5425  H HA3  . GLY A 1 1   ? -9.593  33.277  -7.134  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5426  N N    . SER A 1 2   ? -8.189  35.129  -6.318  1.00 0.00 ? 2   SER A N    4  
ATOM 5427  C CA   . SER A 1 2   ? -7.393  36.271  -5.881  1.00 0.00 ? 2   SER A CA   4  
ATOM 5428  C C    . SER A 1 2   ? -6.483  35.885  -4.718  1.00 0.00 ? 2   SER A C    4  
ATOM 5429  O O    . SER A 1 2   ? -6.340  36.636  -3.753  1.00 0.00 ? 2   SER A O    4  
ATOM 5430  C CB   . SER A 1 2   ? -8.305  37.427  -5.468  1.00 0.00 ? 2   SER A CB   4  
ATOM 5431  O OG   . SER A 1 2   ? -7.573  38.635  -5.345  1.00 0.00 ? 2   SER A OG   4  
ATOM 5432  H H    . SER A 1 2   ? -8.088  34.799  -7.235  1.00 0.00 ? 2   SER A H    4  
ATOM 5433  H HA   . SER A 1 2   ? -6.781  36.585  -6.713  1.00 0.00 ? 2   SER A HA   4  
ATOM 5434  H HB2  . SER A 1 2   ? -9.073  37.561  -6.215  1.00 0.00 ? 2   SER A HB2  4  
ATOM 5435  H HB3  . SER A 1 2   ? -8.763  37.199  -4.517  1.00 0.00 ? 2   SER A HB3  4  
ATOM 5436  H HG   . SER A 1 2   ? -6.814  38.610  -5.932  1.00 0.00 ? 2   SER A HG   4  
ATOM 5437  N N    . SER A 1 3   ? -5.871  34.710  -4.818  1.00 0.00 ? 3   SER A N    4  
ATOM 5438  C CA   . SER A 1 3   ? -4.978  34.222  -3.774  1.00 0.00 ? 3   SER A CA   4  
ATOM 5439  C C    . SER A 1 3   ? -3.727  35.089  -3.680  1.00 0.00 ? 3   SER A C    4  
ATOM 5440  O O    . SER A 1 3   ? -3.372  35.573  -2.606  1.00 0.00 ? 3   SER A O    4  
ATOM 5441  C CB   . SER A 1 3   ? -4.586  32.768  -4.047  1.00 0.00 ? 3   SER A CB   4  
ATOM 5442  O OG   . SER A 1 3   ? -4.245  32.097  -2.847  1.00 0.00 ? 3   SER A OG   4  
ATOM 5443  H H    . SER A 1 3   ? -6.026  34.157  -5.613  1.00 0.00 ? 3   SER A H    4  
ATOM 5444  H HA   . SER A 1 3   ? -5.508  34.272  -2.835  1.00 0.00 ? 3   SER A HA   4  
ATOM 5445  H HB2  . SER A 1 3   ? -5.415  32.255  -4.510  1.00 0.00 ? 3   SER A HB2  4  
ATOM 5446  H HB3  . SER A 1 3   ? -3.734  32.747  -4.712  1.00 0.00 ? 3   SER A HB3  4  
ATOM 5447  H HG   . SER A 1 3   ? -3.428  31.609  -2.973  1.00 0.00 ? 3   SER A HG   4  
ATOM 5448  N N    . GLY A 1 4   ? -3.061  35.282  -4.815  1.00 0.00 ? 4   GLY A N    4  
ATOM 5449  C CA   . GLY A 1 4   ? -1.856  36.091  -4.840  1.00 0.00 ? 4   GLY A CA   4  
ATOM 5450  C C    . GLY A 1 4   ? -0.666  35.376  -4.231  1.00 0.00 ? 4   GLY A C    4  
ATOM 5451  O O    . GLY A 1 4   ? -0.634  35.124  -3.027  1.00 0.00 ? 4   GLY A O    4  
ATOM 5452  H H    . GLY A 1 4   ? -3.391  34.871  -5.642  1.00 0.00 ? 4   GLY A H    4  
ATOM 5453  H HA2  . GLY A 1 4   ? -1.627  36.343  -5.865  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5454  H HA3  . GLY A 1 4   ? -2.036  37.001  -4.287  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5455  N N    . SER A 1 5   ? 0.315   35.048  -5.066  1.00 0.00 ? 5   SER A N    4  
ATOM 5456  C CA   . SER A 1 5   ? 1.511   34.353  -4.604  1.00 0.00 ? 5   SER A CA   4  
ATOM 5457  C C    . SER A 1 5   ? 2.667   34.553  -5.580  1.00 0.00 ? 5   SER A C    4  
ATOM 5458  O O    . SER A 1 5   ? 2.471   34.577  -6.795  1.00 0.00 ? 5   SER A O    4  
ATOM 5459  C CB   . SER A 1 5   ? 1.225   32.860  -4.433  1.00 0.00 ? 5   SER A CB   4  
ATOM 5460  O OG   . SER A 1 5   ? 0.932   32.251  -5.678  1.00 0.00 ? 5   SER A OG   4  
ATOM 5461  H H    . SER A 1 5   ? 0.231   35.276  -6.015  1.00 0.00 ? 5   SER A H    4  
ATOM 5462  H HA   . SER A 1 5   ? 1.788   34.770  -3.647  1.00 0.00 ? 5   SER A HA   4  
ATOM 5463  H HB2  . SER A 1 5   ? 2.091   32.377  -4.005  1.00 0.00 ? 5   SER A HB2  4  
ATOM 5464  H HB3  . SER A 1 5   ? 0.379   32.732  -3.774  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5465  H HG   . SER A 1 5   ? 1.656   32.406  -6.289  1.00 0.00 ? 5   SER A HG   4  
ATOM 5466  N N    . SER A 1 6   ? 3.872   34.697  -5.038  1.00 0.00 ? 6   SER A N    4  
ATOM 5467  C CA   . SER A 1 6   ? 5.060   34.898  -5.860  1.00 0.00 ? 6   SER A CA   4  
ATOM 5468  C C    . SER A 1 6   ? 5.641   33.562  -6.313  1.00 0.00 ? 6   SER A C    4  
ATOM 5469  O O    . SER A 1 6   ? 6.856   33.374  -6.329  1.00 0.00 ? 6   SER A O    4  
ATOM 5470  C CB   . SER A 1 6   ? 6.115   35.688  -5.083  1.00 0.00 ? 6   SER A CB   4  
ATOM 5471  O OG   . SER A 1 6   ? 5.732   37.045  -4.938  1.00 0.00 ? 6   SER A OG   4  
ATOM 5472  H H    . SER A 1 6   ? 3.964   34.668  -4.063  1.00 0.00 ? 6   SER A H    4  
ATOM 5473  H HA   . SER A 1 6   ? 4.768   35.465  -6.731  1.00 0.00 ? 6   SER A HA   4  
ATOM 5474  H HB2  . SER A 1 6   ? 6.236   35.254  -4.102  1.00 0.00 ? 6   SER A HB2  4  
ATOM 5475  H HB3  . SER A 1 6   ? 7.055   35.647  -5.614  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5476  H HG   . SER A 1 6   ? 6.065   37.385  -4.104  1.00 0.00 ? 6   SER A HG   4  
ATOM 5477  N N    . GLY A 1 7   ? 4.760   32.636  -6.681  1.00 0.00 ? 7   GLY A N    4  
ATOM 5478  C CA   . GLY A 1 7   ? 5.203   31.328  -7.129  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5479  C C    . GLY A 1 7   ? 5.225   30.308  -6.009  1.00 0.00 ? 7   GLY A C    4  
ATOM 5480  O O    . GLY A 1 7   ? 4.246   30.156  -5.277  1.00 0.00 ? 7   GLY A O    4  
ATOM 5481  H H    . GLY A 1 7   ? 3.803   32.842  -6.648  1.00 0.00 ? 7   GLY A H    4  
ATOM 5482  H HA2  . GLY A 1 7   ? 4.537   30.982  -7.905  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5483  H HA3  . GLY A 1 7   ? 6.199   31.419  -7.538  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5484  N N    . THR A 1 8   ? 6.345   29.604  -5.873  1.00 0.00 ? 8   THR A N    4  
ATOM 5485  C CA   . THR A 1 8   ? 6.490   28.591  -4.836  1.00 0.00 ? 8   THR A CA   4  
ATOM 5486  C C    . THR A 1 8   ? 7.935   28.492  -4.361  1.00 0.00 ? 8   THR A C    4  
ATOM 5487  O O    . THR A 1 8   ? 8.852   28.974  -5.028  1.00 0.00 ? 8   THR A O    4  
ATOM 5488  C CB   . THR A 1 8   ? 6.030   27.208  -5.334  1.00 0.00 ? 8   THR A CB   4  
ATOM 5489  O OG1  . THR A 1 8   ? 5.849   26.322  -4.223  1.00 0.00 ? 8   THR A OG1  4  
ATOM 5490  C CG2  . THR A 1 8   ? 7.044   26.615  -6.300  1.00 0.00 ? 8   THR A CG2  4  
ATOM 5491  H H    . THR A 1 8   ? 7.090   29.771  -6.487  1.00 0.00 ? 8   THR A H    4  
ATOM 5492  H HA   . THR A 1 8   ? 5.866   28.876  -4.001  1.00 0.00 ? 8   THR A HA   4  
ATOM 5493  H HB   . THR A 1 8   ? 5.087   27.323  -5.850  1.00 0.00 ? 8   THR A HB   4  
ATOM 5494  H HG1  . THR A 1 8   ? 4.911   26.226  -4.039  1.00 0.00 ? 8   THR A HG1  4  
ATOM 5495  H HG21 . THR A 1 8   ? 7.350   25.641  -5.949  1.00 0.00 ? 8   THR A HG21 4  
ATOM 5496  H HG22 . THR A 1 8   ? 7.906   27.264  -6.360  1.00 0.00 ? 8   THR A HG22 4  
ATOM 5497  H HG23 . THR A 1 8   ? 6.596   26.521  -7.278  1.00 0.00 ? 8   THR A HG23 4  
ATOM 5498  N N    . LEU A 1 9   ? 8.133   27.865  -3.207  1.00 0.00 ? 9   LEU A N    4  
ATOM 5499  C CA   . LEU A 1 9   ? 9.468   27.703  -2.643  1.00 0.00 ? 9   LEU A CA   4  
ATOM 5500  C C    . LEU A 1 9   ? 9.638   26.313  -2.037  1.00 0.00 ? 9   LEU A C    4  
ATOM 5501  O O    . LEU A 1 9   ? 8.762   25.823  -1.324  1.00 0.00 ? 9   LEU A O    4  
ATOM 5502  C CB   . LEU A 1 9   ? 9.727   28.771  -1.579  1.00 0.00 ? 9   LEU A CB   4  
ATOM 5503  C CG   . LEU A 1 9   ? 10.311  30.092  -2.082  1.00 0.00 ? 9   LEU A CG   4  
ATOM 5504  C CD1  . LEU A 1 9   ? 9.206   31.000  -2.600  1.00 0.00 ? 9   LEU A CD1  4  
ATOM 5505  C CD2  . LEU A 1 9   ? 11.098  30.782  -0.978  1.00 0.00 ? 9   LEU A CD2  4  
ATOM 5506  H H    . LEU A 1 9   ? 7.363   27.502  -2.722  1.00 0.00 ? 9   LEU A H    4  
ATOM 5507  H HA   . LEU A 1 9   ? 10.183  27.823  -3.444  1.00 0.00 ? 9   LEU A HA   4  
ATOM 5508  H HB2  . LEU A 1 9   ? 8.789   28.988  -1.093  1.00 0.00 ? 9   LEU A HB2  4  
ATOM 5509  H HB3  . LEU A 1 9   ? 10.417  28.357  -0.858  1.00 0.00 ? 9   LEU A HB3  4  
ATOM 5510  H HG   . LEU A 1 9   ? 10.988  29.890  -2.901  1.00 0.00 ? 9   LEU A HG   4  
ATOM 5511  H HD11 . LEU A 1 9   ? 9.502   32.031  -2.479  1.00 0.00 ? 9   LEU A HD11 4  
ATOM 5512  H HD12 . LEU A 1 9   ? 8.299   30.818  -2.043  1.00 0.00 ? 9   LEU A HD12 4  
ATOM 5513  H HD13 . LEU A 1 9   ? 9.033   30.795  -3.646  1.00 0.00 ? 9   LEU A HD13 4  
ATOM 5514  H HD21 . LEU A 1 9   ? 11.784  31.492  -1.416  1.00 0.00 ? 9   LEU A HD21 4  
ATOM 5515  H HD22 . LEU A 1 9   ? 11.653  30.044  -0.417  1.00 0.00 ? 9   LEU A HD22 4  
ATOM 5516  H HD23 . LEU A 1 9   ? 10.416  31.299  -0.319  1.00 0.00 ? 9   LEU A HD23 4  
ATOM 5517  N N    . THR A 1 10  ? 10.773  25.683  -2.324  1.00 0.00 ? 10  THR A N    4  
ATOM 5518  C CA   . THR A 1 10  ? 11.059  24.350  -1.807  1.00 0.00 ? 10  THR A CA   4  
ATOM 5519  C C    . THR A 1 10  ? 10.969  24.320  -0.286  1.00 0.00 ? 10  THR A C    4  
ATOM 5520  O O    . THR A 1 10  ? 11.123  25.347  0.376   1.00 0.00 ? 10  THR A O    4  
ATOM 5521  C CB   . THR A 1 10  ? 12.457  23.869  -2.238  1.00 0.00 ? 10  THR A CB   4  
ATOM 5522  O OG1  . THR A 1 10  ? 12.674  22.528  -1.785  1.00 0.00 ? 10  THR A OG1  4  
ATOM 5523  C CG2  . THR A 1 10  ? 13.539  24.780  -1.678  1.00 0.00 ? 10  THR A CG2  4  
ATOM 5524  H H    . THR A 1 10  ? 11.432  26.125  -2.898  1.00 0.00 ? 10  THR A H    4  
ATOM 5525  H HA   . THR A 1 10  ? 10.325  23.670  -2.215  1.00 0.00 ? 10  THR A HA   4  
ATOM 5526  H HB   . THR A 1 10  ? 12.512  23.890  -3.317  1.00 0.00 ? 10  THR A HB   4  
ATOM 5527  H HG1  . THR A 1 10  ? 12.525  22.482  -0.837  1.00 0.00 ? 10  THR A HG1  4  
ATOM 5528  H HG21 . THR A 1 10  ? 13.170  25.276  -0.792  1.00 0.00 ? 10  THR A HG21 4  
ATOM 5529  H HG22 . THR A 1 10  ? 13.807  25.518  -2.419  1.00 0.00 ? 10  THR A HG22 4  
ATOM 5530  H HG23 . THR A 1 10  ? 14.409  24.192  -1.425  1.00 0.00 ? 10  THR A HG23 4  
ATOM 5531  N N    . VAL A 1 11  ? 10.721  23.136  0.265   1.00 0.00 ? 11  VAL A N    4  
ATOM 5532  C CA   . VAL A 1 11  ? 10.613  22.972  1.709   1.00 0.00 ? 11  VAL A CA   4  
ATOM 5533  C C    . VAL A 1 11  ? 11.178  21.627  2.153   1.00 0.00 ? 11  VAL A C    4  
ATOM 5534  O O    . VAL A 1 11  ? 11.160  20.656  1.398   1.00 0.00 ? 11  VAL A O    4  
ATOM 5535  C CB   . VAL A 1 11  ? 9.151   23.083  2.179   1.00 0.00 ? 11  VAL A CB   4  
ATOM 5536  C CG1  . VAL A 1 11  ? 8.649   24.511  2.031   1.00 0.00 ? 11  VAL A CG1  4  
ATOM 5537  C CG2  . VAL A 1 11  ? 8.268   22.116  1.404   1.00 0.00 ? 11  VAL A CG2  4  
ATOM 5538  H H    . VAL A 1 11  ? 10.609  22.354  -0.315  1.00 0.00 ? 11  VAL A H    4  
ATOM 5539  H HA   . VAL A 1 11  ? 11.181  23.762  2.179   1.00 0.00 ? 11  VAL A HA   4  
ATOM 5540  H HB   . VAL A 1 11  ? 9.109   22.816  3.225   1.00 0.00 ? 11  VAL A HB   4  
ATOM 5541  H HG11 . VAL A 1 11  ? 7.788   24.657  2.667   1.00 0.00 ? 11  VAL A HG11 4  
ATOM 5542  H HG12 . VAL A 1 11  ? 9.431   25.199  2.318   1.00 0.00 ? 11  VAL A HG12 4  
ATOM 5543  H HG13 . VAL A 1 11  ? 8.371   24.690  1.003   1.00 0.00 ? 11  VAL A HG13 4  
ATOM 5544  H HG21 . VAL A 1 11  ? 7.946   21.320  2.060   1.00 0.00 ? 11  VAL A HG21 4  
ATOM 5545  H HG22 . VAL A 1 11  ? 7.404   22.642  1.025   1.00 0.00 ? 11  VAL A HG22 4  
ATOM 5546  H HG23 . VAL A 1 11  ? 8.826   21.700  0.579   1.00 0.00 ? 11  VAL A HG23 4  
ATOM 5547  N N    . ASN A 1 12  ? 11.678  21.578  3.384   1.00 0.00 ? 12  ASN A N    4  
ATOM 5548  C CA   . ASN A 1 12  ? 12.248  20.352  3.929   1.00 0.00 ? 12  ASN A CA   4  
ATOM 5549  C C    . ASN A 1 12  ? 11.605  20.001  5.267   1.00 0.00 ? 12  ASN A C    4  
ATOM 5550  O O    . ASN A 1 12  ? 11.664  20.778  6.219   1.00 0.00 ? 12  ASN A O    4  
ATOM 5551  C CB   . ASN A 1 12  ? 13.761  20.500  4.101   1.00 0.00 ? 12  ASN A CB   4  
ATOM 5552  C CG   . ASN A 1 12  ? 14.420  21.135  2.892   1.00 0.00 ? 12  ASN A CG   4  
ATOM 5553  O OD1  . ASN A 1 12  ? 14.468  20.542  1.814   1.00 0.00 ? 12  ASN A OD1  4  
ATOM 5554  N ND2  . ASN A 1 12  ? 14.933  22.348  3.067   1.00 0.00 ? 12  ASN A ND2  4  
ATOM 5555  H H    . ASN A 1 12  ? 11.663  22.386  3.938   1.00 0.00 ? 12  ASN A H    4  
ATOM 5556  H HA   . ASN A 1 12  ? 12.051  19.554  3.228   1.00 0.00 ? 12  ASN A HA   4  
ATOM 5557  H HB2  . ASN A 1 12  ? 13.960  21.121  4.963   1.00 0.00 ? 12  ASN A HB2  4  
ATOM 5558  H HB3  . ASN A 1 12  ? 14.197  19.525  4.256   1.00 0.00 ? 12  ASN A HB3  4  
ATOM 5559  H HD21 . ASN A 1 12  ? 14.859  22.759  3.953   1.00 0.00 ? 12  ASN A HD21 4  
ATOM 5560  H HD22 . ASN A 1 12  ? 15.365  22.782  2.302   1.00 0.00 ? 12  ASN A HD22 4  
ATOM 5561  N N    . GLY A 1 13  ? 10.990  18.824  5.332   1.00 0.00 ? 13  GLY A N    4  
ATOM 5562  C CA   . GLY A 1 13  ? 10.345  18.390  6.557   1.00 0.00 ? 13  GLY A CA   4  
ATOM 5563  C C    . GLY A 1 13  ? 10.131  16.890  6.601   1.00 0.00 ? 13  GLY A C    4  
ATOM 5564  O O    . GLY A 1 13  ? 10.808  16.125  5.914   1.00 0.00 ? 13  GLY A O    4  
ATOM 5565  H H    . GLY A 1 13  ? 10.974  18.245  4.541   1.00 0.00 ? 13  GLY A H    4  
ATOM 5566  H HA2  . GLY A 1 13  ? 10.959  18.680  7.397   1.00 0.00 ? 13  GLY A HA2  4  
ATOM 5567  H HA3  . GLY A 1 13  ? 9.386   18.881  6.639   1.00 0.00 ? 13  GLY A HA3  4  
ATOM 5568  N N    . PRO A 1 14  ? 9.169   16.449  7.425   1.00 0.00 ? 14  PRO A N    4  
ATOM 5569  C CA   . PRO A 1 14  ? 8.846   15.027  7.576   1.00 0.00 ? 14  PRO A CA   4  
ATOM 5570  C C    . PRO A 1 14  ? 8.181   14.449  6.331   1.00 0.00 ? 14  PRO A C    4  
ATOM 5571  O O    . PRO A 1 14  ? 7.689   15.174  5.467   1.00 0.00 ? 14  PRO A O    4  
ATOM 5572  C CB   . PRO A 1 14  ? 7.875   15.007  8.759   1.00 0.00 ? 14  PRO A CB   4  
ATOM 5573  C CG   . PRO A 1 14  ? 7.258   16.363  8.766   1.00 0.00 ? 14  PRO A CG   4  
ATOM 5574  C CD   . PRO A 1 14  ? 8.322   17.305  8.273   1.00 0.00 ? 14  PRO A CD   4  
ATOM 5575  H HA   . PRO A 1 14  ? 9.723   14.444  7.817   1.00 0.00 ? 14  PRO A HA   4  
ATOM 5576  H HB2  . PRO A 1 14  ? 7.134   14.235  8.607   1.00 0.00 ? 14  PRO A HB2  4  
ATOM 5577  H HB3  . PRO A 1 14  ? 8.419   14.817  9.672   1.00 0.00 ? 14  PRO A HB3  4  
ATOM 5578  H HG2  . PRO A 1 14  ? 6.406   16.382  8.105   1.00 0.00 ? 14  PRO A HG2  4  
ATOM 5579  H HG3  . PRO A 1 14  ? 6.962   16.626  9.771   1.00 0.00 ? 14  PRO A HG3  4  
ATOM 5580  H HD2  . PRO A 1 14  ? 7.881   18.104  7.696   1.00 0.00 ? 14  PRO A HD2  4  
ATOM 5581  H HD3  . PRO A 1 14  ? 8.887   17.703  9.103   1.00 0.00 ? 14  PRO A HD3  4  
ATOM 5582  N N    . PRO A 1 15  ? 8.163   13.111  6.237   1.00 0.00 ? 15  PRO A N    4  
ATOM 5583  C CA   . PRO A 1 15  ? 7.559   12.406  5.102   1.00 0.00 ? 15  PRO A CA   4  
ATOM 5584  C C    . PRO A 1 15  ? 6.039   12.525  5.087   1.00 0.00 ? 15  PRO A C    4  
ATOM 5585  O O    . PRO A 1 15  ? 5.379   12.283  6.098   1.00 0.00 ? 15  PRO A O    4  
ATOM 5586  C CB   . PRO A 1 15  ? 7.979   10.951  5.324   1.00 0.00 ? 15  PRO A CB   4  
ATOM 5587  C CG   . PRO A 1 15  ? 8.208   10.843  6.792   1.00 0.00 ? 15  PRO A CG   4  
ATOM 5588  C CD   . PRO A 1 15  ? 8.730   12.184  7.230   1.00 0.00 ? 15  PRO A CD   4  
ATOM 5589  H HA   . PRO A 1 15  ? 7.956   12.757  4.160   1.00 0.00 ? 15  PRO A HA   4  
ATOM 5590  H HB2  . PRO A 1 15  ? 7.188   10.291  4.997   1.00 0.00 ? 15  PRO A HB2  4  
ATOM 5591  H HB3  . PRO A 1 15  ? 8.881   10.744  4.768   1.00 0.00 ? 15  PRO A HB3  4  
ATOM 5592  H HG2  . PRO A 1 15  ? 7.279   10.620  7.294   1.00 0.00 ? 15  PRO A HG2  4  
ATOM 5593  H HG3  . PRO A 1 15  ? 8.939   10.073  6.994   1.00 0.00 ? 15  PRO A HG3  4  
ATOM 5594  H HD2  . PRO A 1 15  ? 8.378   12.420  8.223   1.00 0.00 ? 15  PRO A HD2  4  
ATOM 5595  H HD3  . PRO A 1 15  ? 9.809   12.198  7.197   1.00 0.00 ? 15  PRO A HD3  4  
ATOM 5596  N N    . ILE A 1 16  ? 5.491   12.899  3.936   1.00 0.00 ? 16  ILE A N    4  
ATOM 5597  C CA   . ILE A 1 16  ? 4.048   13.048  3.791   1.00 0.00 ? 16  ILE A CA   4  
ATOM 5598  C C    . ILE A 1 16  ? 3.469   11.956  2.899   1.00 0.00 ? 16  ILE A C    4  
ATOM 5599  O O    . ILE A 1 16  ? 4.013   11.656  1.835   1.00 0.00 ? 16  ILE A O    4  
ATOM 5600  C CB   . ILE A 1 16  ? 3.681   14.424  3.204   1.00 0.00 ? 16  ILE A CB   4  
ATOM 5601  C CG1  . ILE A 1 16  ? 4.176   15.543  4.121   1.00 0.00 ? 16  ILE A CG1  4  
ATOM 5602  C CG2  . ILE A 1 16  ? 2.177   14.527  2.998   1.00 0.00 ? 16  ILE A CG2  4  
ATOM 5603  C CD1  . ILE A 1 16  ? 4.513   16.822  3.386   1.00 0.00 ? 16  ILE A CD1  4  
ATOM 5604  H H    . ILE A 1 16  ? 6.070   13.078  3.167   1.00 0.00 ? 16  ILE A H    4  
ATOM 5605  H HA   . ILE A 1 16  ? 3.604   12.968  4.773   1.00 0.00 ? 16  ILE A HA   4  
ATOM 5606  H HB   . ILE A 1 16  ? 4.159   14.518  2.241   1.00 0.00 ? 16  ILE A HB   4  
ATOM 5607  H HG12 . ILE A 1 16  ? 3.412   15.770  4.847   1.00 0.00 ? 16  ILE A HG12 4  
ATOM 5608  H HG13 . ILE A 1 16  ? 5.067   15.210  4.634   1.00 0.00 ? 16  ILE A HG13 4  
ATOM 5609  H HG21 . ILE A 1 16  ? 1.681   13.756  3.569   1.00 0.00 ? 16  ILE A HG21 4  
ATOM 5610  H HG22 . ILE A 1 16  ? 1.834   15.496  3.329   1.00 0.00 ? 16  ILE A HG22 4  
ATOM 5611  H HG23 . ILE A 1 16  ? 1.947   14.402  1.950   1.00 0.00 ? 16  ILE A HG23 4  
ATOM 5612  H HD11 . ILE A 1 16  ? 5.566   17.034  3.495   1.00 0.00 ? 16  ILE A HD11 4  
ATOM 5613  H HD12 . ILE A 1 16  ? 4.273   16.710  2.340   1.00 0.00 ? 16  ILE A HD12 4  
ATOM 5614  H HD13 . ILE A 1 16  ? 3.938   17.637  3.802   1.00 0.00 ? 16  ILE A HD13 4  
ATOM 5615  N N    . ILE A 1 17  ? 2.363   11.365  3.337   1.00 0.00 ? 17  ILE A N    4  
ATOM 5616  C CA   . ILE A 1 17  ? 1.708   10.308  2.576   1.00 0.00 ? 17  ILE A CA   4  
ATOM 5617  C C    . ILE A 1 17  ? 0.287   10.706  2.192   1.00 0.00 ? 17  ILE A C    4  
ATOM 5618  O O    . ILE A 1 17  ? -0.643  10.567  2.986   1.00 0.00 ? 17  ILE A O    4  
ATOM 5619  C CB   . ILE A 1 17  ? 1.663   8.989   3.370   1.00 0.00 ? 17  ILE A CB   4  
ATOM 5620  C CG1  . ILE A 1 17  ? 3.035   8.685   3.975   1.00 0.00 ? 17  ILE A CG1  4  
ATOM 5621  C CG2  . ILE A 1 17  ? 1.210   7.847   2.473   1.00 0.00 ? 17  ILE A CG2  4  
ATOM 5622  C CD1  . ILE A 1 17  ? 3.006   7.592   5.021   1.00 0.00 ? 17  ILE A CD1  4  
ATOM 5623  H H    . ILE A 1 17  ? 1.977   11.648  4.192   1.00 0.00 ? 17  ILE A H    4  
ATOM 5624  H HA   . ILE A 1 17  ? 2.281   10.143  1.675   1.00 0.00 ? 17  ILE A HA   4  
ATOM 5625  H HB   . ILE A 1 17  ? 0.943   9.098   4.166   1.00 0.00 ? 17  ILE A HB   4  
ATOM 5626  H HG12 . ILE A 1 17  ? 3.708   8.375   3.191   1.00 0.00 ? 17  ILE A HG12 4  
ATOM 5627  H HG13 . ILE A 1 17  ? 3.421   9.581   4.441   1.00 0.00 ? 17  ILE A HG13 4  
ATOM 5628  H HG21 . ILE A 1 17  ? 1.116   6.944   3.059   1.00 0.00 ? 17  ILE A HG21 4  
ATOM 5629  H HG22 . ILE A 1 17  ? 0.253   8.091   2.036   1.00 0.00 ? 17  ILE A HG22 4  
ATOM 5630  H HG23 . ILE A 1 17  ? 1.936   7.693   1.689   1.00 0.00 ? 17  ILE A HG23 4  
ATOM 5631  H HD11 . ILE A 1 17  ? 4.009   7.228   5.189   1.00 0.00 ? 17  ILE A HD11 4  
ATOM 5632  H HD12 . ILE A 1 17  ? 2.605   7.986   5.942   1.00 0.00 ? 17  ILE A HD12 4  
ATOM 5633  H HD13 . ILE A 1 17  ? 2.383   6.780   4.675   1.00 0.00 ? 17  ILE A HD13 4  
ATOM 5634  N N    . SER A 1 18  ? 0.127   11.200  0.969   1.00 0.00 ? 18  SER A N    4  
ATOM 5635  C CA   . SER A 1 18  ? -1.181  11.620  0.479   1.00 0.00 ? 18  SER A CA   4  
ATOM 5636  C C    . SER A 1 18  ? -2.149  10.441  0.437   1.00 0.00 ? 18  SER A C    4  
ATOM 5637  O O    . SER A 1 18  ? -3.089  10.368  1.228   1.00 0.00 ? 18  SER A O    4  
ATOM 5638  C CB   . SER A 1 18  ? -1.052  12.240  -0.914  1.00 0.00 ? 18  SER A CB   4  
ATOM 5639  O OG   . SER A 1 18  ? -2.078  13.189  -1.146  1.00 0.00 ? 18  SER A OG   4  
ATOM 5640  H H    . SER A 1 18  ? 0.908   11.286  0.382   1.00 0.00 ? 18  SER A H    4  
ATOM 5641  H HA   . SER A 1 18  ? -1.567  12.363  1.161   1.00 0.00 ? 18  SER A HA   4  
ATOM 5642  H HB2  . SER A 1 18  ? -0.096  12.733  -0.999  1.00 0.00 ? 18  SER A HB2  4  
ATOM 5643  H HB3  . SER A 1 18  ? -1.123  11.461  -1.659  1.00 0.00 ? 18  SER A HB3  4  
ATOM 5644  H HG   . SER A 1 18  ? -2.145  13.365  -2.087  1.00 0.00 ? 18  SER A HG   4  
ATOM 5645  N N    . SER A 1 19  ? -1.911  9.522   -0.493  1.00 0.00 ? 19  SER A N    4  
ATOM 5646  C CA   . SER A 1 19  ? -2.764  8.348   -0.643  1.00 0.00 ? 19  SER A CA   4  
ATOM 5647  C C    . SER A 1 19  ? -2.167  7.368   -1.649  1.00 0.00 ? 19  SER A C    4  
ATOM 5648  O O    . SER A 1 19  ? -1.112  7.622   -2.230  1.00 0.00 ? 19  SER A O    4  
ATOM 5649  C CB   . SER A 1 19  ? -4.167  8.764   -1.089  1.00 0.00 ? 19  SER A CB   4  
ATOM 5650  O OG   . SER A 1 19  ? -4.955  9.168   0.017   1.00 0.00 ? 19  SER A OG   4  
ATOM 5651  H H    . SER A 1 19  ? -1.146  9.637   -1.095  1.00 0.00 ? 19  SER A H    4  
ATOM 5652  H HA   . SER A 1 19  ? -2.831  7.862   0.319   1.00 0.00 ? 19  SER A HA   4  
ATOM 5653  H HB2  . SER A 1 19  ? -4.092  9.589   -1.782  1.00 0.00 ? 19  SER A HB2  4  
ATOM 5654  H HB3  . SER A 1 19  ? -4.650  7.928   -1.575  1.00 0.00 ? 19  SER A HB3  4  
ATOM 5655  H HG   . SER A 1 19  ? -5.588  9.832   -0.266  1.00 0.00 ? 19  SER A HG   4  
ATOM 5656  N N    . THR A 1 20  ? -2.852  6.247   -1.850  1.00 0.00 ? 20  THR A N    4  
ATOM 5657  C CA   . THR A 1 20  ? -2.391  5.227   -2.784  1.00 0.00 ? 20  THR A CA   4  
ATOM 5658  C C    . THR A 1 20  ? -3.298  5.151   -4.007  1.00 0.00 ? 20  THR A C    4  
ATOM 5659  O O    . THR A 1 20  ? -4.437  5.616   -3.975  1.00 0.00 ? 20  THR A O    4  
ATOM 5660  C CB   . THR A 1 20  ? -2.330  3.840   -2.117  1.00 0.00 ? 20  THR A CB   4  
ATOM 5661  O OG1  . THR A 1 20  ? -3.620  3.486   -1.605  1.00 0.00 ? 20  THR A OG1  4  
ATOM 5662  C CG2  . THR A 1 20  ? -1.310  3.826   -0.989  1.00 0.00 ? 20  THR A CG2  4  
ATOM 5663  H H    . THR A 1 20  ? -3.686  6.102   -1.357  1.00 0.00 ? 20  THR A H    4  
ATOM 5664  H HA   . THR A 1 20  ? -1.394  5.494   -3.104  1.00 0.00 ? 20  THR A HA   4  
ATOM 5665  H HB   . THR A 1 20  ? -2.034  3.113   -2.859  1.00 0.00 ? 20  THR A HB   4  
ATOM 5666  H HG1  . THR A 1 20  ? -3.628  2.554   -1.374  1.00 0.00 ? 20  THR A HG1  4  
ATOM 5667  H HG21 . THR A 1 20  ? -0.336  3.581   -1.387  1.00 0.00 ? 20  THR A HG21 4  
ATOM 5668  H HG22 . THR A 1 20  ? -1.595  3.088   -0.254  1.00 0.00 ? 20  THR A HG22 4  
ATOM 5669  H HG23 . THR A 1 20  ? -1.273  4.801   -0.525  1.00 0.00 ? 20  THR A HG23 4  
ATOM 5670  N N    . GLN A 1 21  ? -2.786  4.561   -5.082  1.00 0.00 ? 21  GLN A N    4  
ATOM 5671  C CA   . GLN A 1 21  ? -3.552  4.425   -6.316  1.00 0.00 ? 21  GLN A CA   4  
ATOM 5672  C C    . GLN A 1 21  ? -3.944  2.971   -6.555  1.00 0.00 ? 21  GLN A C    4  
ATOM 5673  O O    . GLN A 1 21  ? -3.774  2.443   -7.655  1.00 0.00 ? 21  GLN A O    4  
ATOM 5674  C CB   . GLN A 1 21  ? -2.744  4.950   -7.503  1.00 0.00 ? 21  GLN A CB   4  
ATOM 5675  C CG   . GLN A 1 21  ? -2.804  6.461   -7.660  1.00 0.00 ? 21  GLN A CG   4  
ATOM 5676  C CD   . GLN A 1 21  ? -4.206  6.963   -7.939  1.00 0.00 ? 21  GLN A CD   4  
ATOM 5677  O OE1  . GLN A 1 21  ? -4.735  7.802   -7.209  1.00 0.00 ? 21  GLN A OE1  4  
ATOM 5678  N NE2  . GLN A 1 21  ? -4.818  6.453   -9.002  1.00 0.00 ? 21  GLN A NE2  4  
ATOM 5679  H H    . GLN A 1 21  ? -1.873  4.211   -5.046  1.00 0.00 ? 21  GLN A H    4  
ATOM 5680  H HA   . GLN A 1 21  ? -4.450  5.015   -6.215  1.00 0.00 ? 21  GLN A HA   4  
ATOM 5681  H HB2  . GLN A 1 21  ? -1.711  4.663   -7.375  1.00 0.00 ? 21  GLN A HB2  4  
ATOM 5682  H HB3  . GLN A 1 21  ? -3.124  4.501   -8.409  1.00 0.00 ? 21  GLN A HB3  4  
ATOM 5683  H HG2  . GLN A 1 21  ? -2.449  6.919   -6.749  1.00 0.00 ? 21  GLN A HG2  4  
ATOM 5684  H HG3  . GLN A 1 21  ? -2.163  6.750   -8.480  1.00 0.00 ? 21  GLN A HG3  4  
ATOM 5685  H HE21 . GLN A 1 21  ? -4.336  5.788   -9.538  1.00 0.00 ? 21  GLN A HE21 4  
ATOM 5686  H HE22 . GLN A 1 21  ? -5.725  6.759   -9.205  1.00 0.00 ? 21  GLN A HE22 4  
ATOM 5687  N N    . THR A 1 22  ? -4.469  2.326   -5.518  1.00 0.00 ? 22  THR A N    4  
ATOM 5688  C CA   . THR A 1 22  ? -4.884  0.932   -5.614  1.00 0.00 ? 22  THR A CA   4  
ATOM 5689  C C    . THR A 1 22  ? -5.748  0.700   -6.849  1.00 0.00 ? 22  THR A C    4  
ATOM 5690  O O    . THR A 1 22  ? -6.083  1.641   -7.568  1.00 0.00 ? 22  THR A O    4  
ATOM 5691  C CB   . THR A 1 22  ? -5.667  0.491   -4.363  1.00 0.00 ? 22  THR A CB   4  
ATOM 5692  O OG1  . THR A 1 22  ? -6.798  1.347   -4.166  1.00 0.00 ? 22  THR A OG1  4  
ATOM 5693  C CG2  . THR A 1 22  ? -4.778  0.524   -3.129  1.00 0.00 ? 22  THR A CG2  4  
ATOM 5694  H H    . THR A 1 22  ? -4.579  2.800   -4.667  1.00 0.00 ? 22  THR A H    4  
ATOM 5695  H HA   . THR A 1 22  ? -3.994  0.324   -5.690  1.00 0.00 ? 22  THR A HA   4  
ATOM 5696  H HB   . THR A 1 22  ? -6.013  -0.522  -4.513  1.00 0.00 ? 22  THR A HB   4  
ATOM 5697  H HG1  . THR A 1 22  ? -7.036  1.353   -3.235  1.00 0.00 ? 22  THR A HG1  4  
ATOM 5698  H HG21 . THR A 1 22  ? -4.928  -0.378  -2.553  1.00 0.00 ? 22  THR A HG21 4  
ATOM 5699  H HG22 . THR A 1 22  ? -5.031  1.383   -2.526  1.00 0.00 ? 22  THR A HG22 4  
ATOM 5700  H HG23 . THR A 1 22  ? -3.744  0.588   -3.433  1.00 0.00 ? 22  THR A HG23 4  
ATOM 5701  N N    . GLN A 1 23  ? -6.107  -0.557  -7.086  1.00 0.00 ? 23  GLN A N    4  
ATOM 5702  C CA   . GLN A 1 23  ? -6.933  -0.912  -8.234  1.00 0.00 ? 23  GLN A CA   4  
ATOM 5703  C C    . GLN A 1 23  ? -8.019  -1.906  -7.838  1.00 0.00 ? 23  GLN A C    4  
ATOM 5704  O O    . GLN A 1 23  ? -8.113  -2.308  -6.677  1.00 0.00 ? 23  GLN A O    4  
ATOM 5705  C CB   . GLN A 1 23  ? -6.067  -1.502  -9.349  1.00 0.00 ? 23  GLN A CB   4  
ATOM 5706  C CG   . GLN A 1 23  ? -5.525  -2.886  -9.031  1.00 0.00 ? 23  GLN A CG   4  
ATOM 5707  C CD   . GLN A 1 23  ? -4.695  -2.910  -7.763  1.00 0.00 ? 23  GLN A CD   4  
ATOM 5708  O OE1  . GLN A 1 23  ? -3.466  -2.834  -7.809  1.00 0.00 ? 23  GLN A OE1  4  
ATOM 5709  N NE2  . GLN A 1 23  ? -5.362  -3.015  -6.620  1.00 0.00 ? 23  GLN A NE2  4  
ATOM 5710  H H    . GLN A 1 23  ? -5.809  -1.263  -6.476  1.00 0.00 ? 23  GLN A H    4  
ATOM 5711  H HA   . GLN A 1 23  ? -7.403  -0.010  -8.595  1.00 0.00 ? 23  GLN A HA   4  
ATOM 5712  H HB2  . GLN A 1 23  ? -6.658  -1.568  -10.250 1.00 0.00 ? 23  GLN A HB2  4  
ATOM 5713  H HB3  . GLN A 1 23  ? -5.230  -0.843  -9.525  1.00 0.00 ? 23  GLN A HB3  4  
ATOM 5714  H HG2  . GLN A 1 23  ? -6.355  -3.565  -8.911  1.00 0.00 ? 23  GLN A HG2  4  
ATOM 5715  H HG3  . GLN A 1 23  ? -4.908  -3.214  -9.854  1.00 0.00 ? 23  GLN A HG3  4  
ATOM 5716  H HE21 . GLN A 1 23  ? -6.341  -3.072  -6.659  1.00 0.00 ? 23  GLN A HE21 4  
ATOM 5717  H HE22 . GLN A 1 23  ? -4.851  -3.034  -5.785  1.00 0.00 ? 23  GLN A HE22 4  
ATOM 5718  N N    . HIS A 1 24  ? -8.837  -2.300  -8.808  1.00 0.00 ? 24  HIS A N    4  
ATOM 5719  C CA   . HIS A 1 24  ? -9.917  -3.248  -8.560  1.00 0.00 ? 24  HIS A CA   4  
ATOM 5720  C C    . HIS A 1 24  ? -9.392  -4.681  -8.556  1.00 0.00 ? 24  HIS A C    4  
ATOM 5721  O O    . HIS A 1 24  ? -10.020 -5.583  -9.109  1.00 0.00 ? 24  HIS A O    4  
ATOM 5722  C CB   . HIS A 1 24  ? -11.011 -3.096  -9.617  1.00 0.00 ? 24  HIS A CB   4  
ATOM 5723  C CG   . HIS A 1 24  ? -10.495 -3.138  -11.023 1.00 0.00 ? 24  HIS A CG   4  
ATOM 5724  N ND1  . HIS A 1 24  ? -9.833  -2.082  -11.613 1.00 0.00 ? 24  HIS A ND1  4  
ATOM 5725  C CD2  . HIS A 1 24  ? -10.546 -4.117  -11.956 1.00 0.00 ? 24  HIS A CD2  4  
ATOM 5726  C CE1  . HIS A 1 24  ? -9.500  -2.409  -12.849 1.00 0.00 ? 24  HIS A CE1  4  
ATOM 5727  N NE2  . HIS A 1 24  ? -9.921  -3.639  -13.082 1.00 0.00 ? 24  HIS A NE2  4  
ATOM 5728  H H    . HIS A 1 24  ? -8.711  -1.944  -9.713  1.00 0.00 ? 24  HIS A H    4  
ATOM 5729  H HA   . HIS A 1 24  ? -10.334 -3.029  -7.589  1.00 0.00 ? 24  HIS A HA   4  
ATOM 5730  H HB2  . HIS A 1 24  ? -11.726 -3.897  -9.503  1.00 0.00 ? 24  HIS A HB2  4  
ATOM 5731  H HB3  . HIS A 1 24  ? -11.512 -2.149  -9.475  1.00 0.00 ? 24  HIS A HB3  4  
ATOM 5732  H HD1  . HIS A 1 24  ? -9.638  -1.220  -11.190 1.00 0.00 ? 24  HIS A HD1  4  
ATOM 5733  H HD2  . HIS A 1 24  ? -10.995 -5.093  -11.838 1.00 0.00 ? 24  HIS A HD2  4  
ATOM 5734  H HE1  . HIS A 1 24  ? -8.974  -1.779  -13.550 1.00 0.00 ? 24  HIS A HE1  4  
ATOM 5735  H HE2  . HIS A 1 24  ? -9.880  -4.095  -13.948 1.00 0.00 ? 24  HIS A HE2  4  
ATOM 5736  N N    . ALA A 1 25  ? -8.237  -4.881  -7.931  1.00 0.00 ? 25  ALA A N    4  
ATOM 5737  C CA   . ALA A 1 25  ? -7.628  -6.203  -7.855  1.00 0.00 ? 25  ALA A CA   4  
ATOM 5738  C C    . ALA A 1 25  ? -8.683  -7.281  -7.628  1.00 0.00 ? 25  ALA A C    4  
ATOM 5739  O O    . ALA A 1 25  ? -9.697  -7.043  -6.968  1.00 0.00 ? 25  ALA A O    4  
ATOM 5740  C CB   . ALA A 1 25  ? -6.585  -6.242  -6.748  1.00 0.00 ? 25  ALA A CB   4  
ATOM 5741  H H    . ALA A 1 25  ? -7.784  -4.121  -7.510  1.00 0.00 ? 25  ALA A H    4  
ATOM 5742  H HA   . ALA A 1 25  ? -7.129  -6.396  -8.794  1.00 0.00 ? 25  ALA A HA   4  
ATOM 5743  H HB1  . ALA A 1 25  ? -6.380  -5.235  -6.414  1.00 0.00 ? 25  ALA A HB1  4  
ATOM 5744  H HB2  . ALA A 1 25  ? -6.959  -6.827  -5.921  1.00 0.00 ? 25  ALA A HB2  4  
ATOM 5745  H HB3  . ALA A 1 25  ? -5.678  -6.689  -7.124  1.00 0.00 ? 25  ALA A HB3  4  
ATOM 5746  N N    . LEU A 1 26  ? -8.440  -8.465  -8.177  1.00 0.00 ? 26  LEU A N    4  
ATOM 5747  C CA   . LEU A 1 26  ? -9.370  -9.580  -8.035  1.00 0.00 ? 26  LEU A CA   4  
ATOM 5748  C C    . LEU A 1 26  ? -8.623  -10.881 -7.758  1.00 0.00 ? 26  LEU A C    4  
ATOM 5749  O O    . LEU A 1 26  ? -7.393  -10.904 -7.706  1.00 0.00 ? 26  LEU A O    4  
ATOM 5750  C CB   . LEU A 1 26  ? -10.220 -9.726  -9.299  1.00 0.00 ? 26  LEU A CB   4  
ATOM 5751  C CG   . LEU A 1 26  ? -11.008 -8.487  -9.724  1.00 0.00 ? 26  LEU A CG   4  
ATOM 5752  C CD1  . LEU A 1 26  ? -11.778 -8.758  -11.007 1.00 0.00 ? 26  LEU A CD1  4  
ATOM 5753  C CD2  . LEU A 1 26  ? -11.954 -8.050  -8.615  1.00 0.00 ? 26  LEU A CD2  4  
ATOM 5754  H H    . LEU A 1 26  ? -7.616  -8.595  -8.691  1.00 0.00 ? 26  LEU A H    4  
ATOM 5755  H HA   . LEU A 1 26  ? -10.018 -9.366  -7.198  1.00 0.00 ? 26  LEU A HA   4  
ATOM 5756  H HB2  . LEU A 1 26  ? -9.561  -9.994  -10.110 1.00 0.00 ? 26  LEU A HB2  4  
ATOM 5757  H HB3  . LEU A 1 26  ? -10.926 -10.527 -9.131  1.00 0.00 ? 26  LEU A HB3  4  
ATOM 5758  H HG   . LEU A 1 26  ? -10.318 -7.677  -9.915  1.00 0.00 ? 26  LEU A HG   4  
ATOM 5759  H HD11 . LEU A 1 26  ? -12.401 -7.908  -11.240 1.00 0.00 ? 26  LEU A HD11 4  
ATOM 5760  H HD12 . LEU A 1 26  ? -12.396 -9.634  -10.878 1.00 0.00 ? 26  LEU A HD12 4  
ATOM 5761  H HD13 . LEU A 1 26  ? -11.081 -8.927  -11.816 1.00 0.00 ? 26  LEU A HD13 4  
ATOM 5762  H HD21 . LEU A 1 26  ? -11.723 -7.035  -8.324  1.00 0.00 ? 26  LEU A HD21 4  
ATOM 5763  H HD22 . LEU A 1 26  ? -11.837 -8.704  -7.763  1.00 0.00 ? 26  LEU A HD22 4  
ATOM 5764  H HD23 . LEU A 1 26  ? -12.973 -8.099  -8.970  1.00 0.00 ? 26  LEU A HD23 4  
ATOM 5765  N N    . HIS A 1 27  ? -9.375  -11.963 -7.582  1.00 0.00 ? 27  HIS A N    4  
ATOM 5766  C CA   . HIS A 1 27  ? -8.783  -13.269 -7.313  1.00 0.00 ? 27  HIS A CA   4  
ATOM 5767  C C    . HIS A 1 27  ? -7.965  -13.751 -8.507  1.00 0.00 ? 27  HIS A C    4  
ATOM 5768  O O    . HIS A 1 27  ? -8.461  -14.498 -9.350  1.00 0.00 ? 27  HIS A O    4  
ATOM 5769  C CB   . HIS A 1 27  ? -9.874  -14.288 -6.982  1.00 0.00 ? 27  HIS A CB   4  
ATOM 5770  C CG   . HIS A 1 27  ? -10.771 -14.603 -8.139  1.00 0.00 ? 27  HIS A CG   4  
ATOM 5771  N ND1  . HIS A 1 27  ? -11.115 -15.890 -8.496  1.00 0.00 ? 27  HIS A ND1  4  
ATOM 5772  C CD2  . HIS A 1 27  ? -11.396 -13.789 -9.022  1.00 0.00 ? 27  HIS A CD2  4  
ATOM 5773  C CE1  . HIS A 1 27  ? -11.912 -15.854 -9.549  1.00 0.00 ? 27  HIS A CE1  4  
ATOM 5774  N NE2  . HIS A 1 27  ? -12.099 -14.591 -9.888  1.00 0.00 ? 27  HIS A NE2  4  
ATOM 5775  H H    . HIS A 1 27  ? -10.350 -11.882 -7.635  1.00 0.00 ? 27  HIS A H    4  
ATOM 5776  H HA   . HIS A 1 27  ? -8.128  -13.167 -6.462  1.00 0.00 ? 27  HIS A HA   4  
ATOM 5777  H HB2  . HIS A 1 27  ? -9.411  -15.210 -6.661  1.00 0.00 ? 27  HIS A HB2  4  
ATOM 5778  H HB3  . HIS A 1 27  ? -10.488 -13.902 -6.181  1.00 0.00 ? 27  HIS A HB3  4  
ATOM 5779  H HD1  . HIS A 1 27  ? -10.818 -16.707 -8.046  1.00 0.00 ? 27  HIS A HD1  4  
ATOM 5780  H HD2  . HIS A 1 27  ? -11.351 -12.709 -9.043  1.00 0.00 ? 27  HIS A HD2  4  
ATOM 5781  H HE1  . HIS A 1 27  ? -12.340 -16.711 -10.048 1.00 0.00 ? 27  HIS A HE1  4  
ATOM 5782  H HE2  . HIS A 1 27  ? -12.579 -14.286 -10.685 1.00 0.00 ? 27  HIS A HE2  4  
ATOM 5783  N N    . GLY A 1 28  ? -6.710  -13.318 -8.573  1.00 0.00 ? 28  GLY A N    4  
ATOM 5784  C CA   . GLY A 1 28  ? -5.845  -13.715 -9.668  1.00 0.00 ? 28  GLY A CA   4  
ATOM 5785  C C    . GLY A 1 28  ? -4.710  -12.736 -9.894  1.00 0.00 ? 28  GLY A C    4  
ATOM 5786  O O    . GLY A 1 28  ? -3.572  -12.995 -9.504  1.00 0.00 ? 28  GLY A O    4  
ATOM 5787  H H    . GLY A 1 28  ? -6.369  -12.724 -7.872  1.00 0.00 ? 28  GLY A H    4  
ATOM 5788  H HA2  . GLY A 1 28  ? -5.429  -14.688 -9.450  1.00 0.00 ? 28  GLY A HA2  4  
ATOM 5789  H HA3  . GLY A 1 28  ? -6.433  -13.781 -10.571 1.00 0.00 ? 28  GLY A HA3  4  
ATOM 5790  N N    . GLU A 1 29  ? -5.019  -11.610 -10.529 1.00 0.00 ? 29  GLU A N    4  
ATOM 5791  C CA   . GLU A 1 29  ? -4.015  -10.591 -10.809 1.00 0.00 ? 29  GLU A CA   4  
ATOM 5792  C C    . GLU A 1 29  ? -3.273  -10.194 -9.536  1.00 0.00 ? 29  GLU A C    4  
ATOM 5793  O O    . GLU A 1 29  ? -3.572  -10.689 -8.449  1.00 0.00 ? 29  GLU A O    4  
ATOM 5794  C CB   . GLU A 1 29  ? -4.668  -9.358  -11.436 1.00 0.00 ? 29  GLU A CB   4  
ATOM 5795  C CG   . GLU A 1 29  ? -5.809  -8.786  -10.610 1.00 0.00 ? 29  GLU A CG   4  
ATOM 5796  C CD   . GLU A 1 29  ? -7.115  -9.523  -10.831 1.00 0.00 ? 29  GLU A CD   4  
ATOM 5797  O OE1  . GLU A 1 29  ? -7.371  -10.507 -10.106 1.00 0.00 ? 29  GLU A OE1  4  
ATOM 5798  O OE2  . GLU A 1 29  ? -7.882  -9.117  -11.729 1.00 0.00 ? 29  GLU A OE2  4  
ATOM 5799  H H    . GLU A 1 29  ? -5.945  -11.462 -10.816 1.00 0.00 ? 29  GLU A H    4  
ATOM 5800  H HA   . GLU A 1 29  ? -3.306  -11.007 -11.509 1.00 0.00 ? 29  GLU A HA   4  
ATOM 5801  H HB2  . GLU A 1 29  ? -3.919  -8.590  -11.557 1.00 0.00 ? 29  GLU A HB2  4  
ATOM 5802  H HB3  . GLU A 1 29  ? -5.056  -9.626  -12.408 1.00 0.00 ? 29  GLU A HB3  4  
ATOM 5803  H HG2  . GLU A 1 29  ? -5.548  -8.854  -9.565  1.00 0.00 ? 29  GLU A HG2  4  
ATOM 5804  H HG3  . GLU A 1 29  ? -5.947  -7.750  -10.879 1.00 0.00 ? 29  GLU A HG3  4  
ATOM 5805  N N    . LYS A 1 30  ? -2.302  -9.298  -9.678  1.00 0.00 ? 30  LYS A N    4  
ATOM 5806  C CA   . LYS A 1 30  ? -1.516  -8.833  -8.542  1.00 0.00 ? 30  LYS A CA   4  
ATOM 5807  C C    . LYS A 1 30  ? -2.015  -7.476  -8.054  1.00 0.00 ? 30  LYS A C    4  
ATOM 5808  O O    . LYS A 1 30  ? -1.987  -6.492  -8.792  1.00 0.00 ? 30  LYS A O    4  
ATOM 5809  C CB   . LYS A 1 30  ? -0.037  -8.738  -8.923  1.00 0.00 ? 30  LYS A CB   4  
ATOM 5810  C CG   . LYS A 1 30  ? 0.607   -10.085 -9.199  1.00 0.00 ? 30  LYS A CG   4  
ATOM 5811  C CD   . LYS A 1 30  ? 2.092   -10.070 -8.876  1.00 0.00 ? 30  LYS A CD   4  
ATOM 5812  C CE   . LYS A 1 30  ? 2.723   -11.437 -9.088  1.00 0.00 ? 30  LYS A CE   4  
ATOM 5813  N NZ   . LYS A 1 30  ? 3.048   -11.681 -10.521 1.00 0.00 ? 30  LYS A NZ   4  
ATOM 5814  H H    . LYS A 1 30  ? -2.110  -8.940  -10.571 1.00 0.00 ? 30  LYS A H    4  
ATOM 5815  H HA   . LYS A 1 30  ? -1.629  -9.552  -7.744  1.00 0.00 ? 30  LYS A HA   4  
ATOM 5816  H HB2  . LYS A 1 30  ? 0.055   -8.130  -9.810  1.00 0.00 ? 30  LYS A HB2  4  
ATOM 5817  H HB3  . LYS A 1 30  ? 0.501   -8.264  -8.114  1.00 0.00 ? 30  LYS A HB3  4  
ATOM 5818  H HG2  . LYS A 1 30  ? 0.126   -10.836 -8.590  1.00 0.00 ? 30  LYS A HG2  4  
ATOM 5819  H HG3  . LYS A 1 30  ? 0.478   -10.329 -10.244 1.00 0.00 ? 30  LYS A HG3  4  
ATOM 5820  H HD2  . LYS A 1 30  ? 2.584   -9.355  -9.518  1.00 0.00 ? 30  LYS A HD2  4  
ATOM 5821  H HD3  . LYS A 1 30  ? 2.224   -9.779  -7.843  1.00 0.00 ? 30  LYS A HD3  4  
ATOM 5822  H HE2  . LYS A 1 30  ? 3.631   -11.494 -8.508  1.00 0.00 ? 30  LYS A HE2  4  
ATOM 5823  H HE3  . LYS A 1 30  ? 2.032   -12.195 -8.751  1.00 0.00 ? 30  LYS A HE3  4  
ATOM 5824  H HZ1  . LYS A 1 30  ? 3.064   -12.703 -10.715 1.00 0.00 ? 30  LYS A HZ1  4  
ATOM 5825  H HZ2  . LYS A 1 30  ? 3.980   -11.282 -10.750 1.00 0.00 ? 30  LYS A HZ2  4  
ATOM 5826  H HZ3  . LYS A 1 30  ? 2.333   -11.235 -11.131 1.00 0.00 ? 30  LYS A HZ3  4  
ATOM 5827  N N    . GLY A 1 31  ? -2.469  -7.431  -6.805  1.00 0.00 ? 31  GLY A N    4  
ATOM 5828  C CA   . GLY A 1 31  ? -2.966  -6.190  -6.241  1.00 0.00 ? 31  GLY A CA   4  
ATOM 5829  C C    . GLY A 1 31  ? -1.851  -5.220  -5.903  1.00 0.00 ? 31  GLY A C    4  
ATOM 5830  O O    . GLY A 1 31  ? -1.301  -5.257  -4.802  1.00 0.00 ? 31  GLY A O    4  
ATOM 5831  H H    . GLY A 1 31  ? -2.467  -8.248  -6.263  1.00 0.00 ? 31  GLY A H    4  
ATOM 5832  H HA2  . GLY A 1 31  ? -3.630  -5.724  -6.953  1.00 0.00 ? 31  GLY A HA2  4  
ATOM 5833  H HA3  . GLY A 1 31  ? -3.518  -6.413  -5.340  1.00 0.00 ? 31  GLY A HA3  4  
ATOM 5834  N N    . GLN A 1 32  ? -1.517  -4.351  -6.851  1.00 0.00 ? 32  GLN A N    4  
ATOM 5835  C CA   . GLN A 1 32  ? -0.458  -3.369  -6.647  1.00 0.00 ? 32  GLN A CA   4  
ATOM 5836  C C    . GLN A 1 32  ? -0.993  -2.133  -5.931  1.00 0.00 ? 32  GLN A C    4  
ATOM 5837  O O    . GLN A 1 32  ? -2.095  -1.666  -6.218  1.00 0.00 ? 32  GLN A O    4  
ATOM 5838  C CB   . GLN A 1 32  ? 0.160   -2.969  -7.988  1.00 0.00 ? 32  GLN A CB   4  
ATOM 5839  C CG   . GLN A 1 32  ? 1.513   -2.289  -7.856  1.00 0.00 ? 32  GLN A CG   4  
ATOM 5840  C CD   . GLN A 1 32  ? 2.204   -2.100  -9.192  1.00 0.00 ? 32  GLN A CD   4  
ATOM 5841  O OE1  . GLN A 1 32  ? 1.752   -1.322  -10.033 1.00 0.00 ? 32  GLN A OE1  4  
ATOM 5842  N NE2  . GLN A 1 32  ? 3.307   -2.811  -9.395  1.00 0.00 ? 32  GLN A NE2  4  
ATOM 5843  H H    . GLN A 1 32  ? -1.992  -4.371  -7.707  1.00 0.00 ? 32  GLN A H    4  
ATOM 5844  H HA   . GLN A 1 32  ? 0.303   -3.824  -6.033  1.00 0.00 ? 32  GLN A HA   4  
ATOM 5845  H HB2  . GLN A 1 32  ? 0.283   -3.854  -8.593  1.00 0.00 ? 32  GLN A HB2  4  
ATOM 5846  H HB3  . GLN A 1 32  ? -0.512  -2.289  -8.492  1.00 0.00 ? 32  GLN A HB3  4  
ATOM 5847  H HG2  . GLN A 1 32  ? 1.373   -1.320  -7.401  1.00 0.00 ? 32  GLN A HG2  4  
ATOM 5848  H HG3  . GLN A 1 32  ? 2.145   -2.895  -7.223  1.00 0.00 ? 32  GLN A HG3  4  
ATOM 5849  H HE21 . GLN A 1 32  ? 3.607   -3.412  -8.681  1.00 0.00 ? 32  GLN A HE21 4  
ATOM 5850  H HE22 . GLN A 1 32  ? 3.773   -2.709  -10.250 1.00 0.00 ? 32  GLN A HE22 4  
ATOM 5851  N N    . ILE A 1 33  ? -0.205  -1.609  -4.999  1.00 0.00 ? 33  ILE A N    4  
ATOM 5852  C CA   . ILE A 1 33  ? -0.599  -0.426  -4.242  1.00 0.00 ? 33  ILE A CA   4  
ATOM 5853  C C    . ILE A 1 33  ? 0.483   0.647   -4.296  1.00 0.00 ? 33  ILE A C    4  
ATOM 5854  O O    . ILE A 1 33  ? 1.461   0.596   -3.549  1.00 0.00 ? 33  ILE A O    4  
ATOM 5855  C CB   . ILE A 1 33  ? -0.891  -0.772  -2.770  1.00 0.00 ? 33  ILE A CB   4  
ATOM 5856  C CG1  . ILE A 1 33  ? -1.922  -1.899  -2.683  1.00 0.00 ? 33  ILE A CG1  4  
ATOM 5857  C CG2  . ILE A 1 33  ? -1.382  0.460   -2.025  1.00 0.00 ? 33  ILE A CG2  4  
ATOM 5858  C CD1  . ILE A 1 33  ? -2.027  -2.517  -1.306  1.00 0.00 ? 33  ILE A CD1  4  
ATOM 5859  H H    . ILE A 1 33  ? 0.662   -2.026  -4.815  1.00 0.00 ? 33  ILE A H    4  
ATOM 5860  H HA   . ILE A 1 33  ? -1.503  -0.034  -4.686  1.00 0.00 ? 33  ILE A HA   4  
ATOM 5861  H HB   . ILE A 1 33  ? 0.029   -1.098  -2.311  1.00 0.00 ? 33  ILE A HB   4  
ATOM 5862  H HG12 . ILE A 1 33  ? -2.893  -1.512  -2.947  1.00 0.00 ? 33  ILE A HG12 4  
ATOM 5863  H HG13 . ILE A 1 33  ? -1.649  -2.680  -3.378  1.00 0.00 ? 33  ILE A HG13 4  
ATOM 5864  H HG21 . ILE A 1 33  ? -2.011  0.156   -1.201  1.00 0.00 ? 33  ILE A HG21 4  
ATOM 5865  H HG22 . ILE A 1 33  ? -0.535  1.012   -1.645  1.00 0.00 ? 33  ILE A HG22 4  
ATOM 5866  H HG23 . ILE A 1 33  ? -1.948  1.087   -2.697  1.00 0.00 ? 33  ILE A HG23 4  
ATOM 5867  H HD11 . ILE A 1 33  ? -2.860  -3.205  -1.283  1.00 0.00 ? 33  ILE A HD11 4  
ATOM 5868  H HD12 . ILE A 1 33  ? -1.115  -3.046  -1.078  1.00 0.00 ? 33  ILE A HD12 4  
ATOM 5869  H HD13 . ILE A 1 33  ? -2.185  -1.738  -0.574  1.00 0.00 ? 33  ILE A HD13 4  
ATOM 5870  N N    . LYS A 1 34  ? 0.301   1.619   -5.183  1.00 0.00 ? 34  LYS A N    4  
ATOM 5871  C CA   . LYS A 1 34  ? 1.260   2.707   -5.334  1.00 0.00 ? 34  LYS A CA   4  
ATOM 5872  C C    . LYS A 1 34  ? 0.949   3.843   -4.364  1.00 0.00 ? 34  LYS A C    4  
ATOM 5873  O O    . LYS A 1 34  ? 0.000   4.602   -4.566  1.00 0.00 ? 34  LYS A O    4  
ATOM 5874  C CB   . LYS A 1 34  ? 1.246   3.232   -6.771  1.00 0.00 ? 34  LYS A CB   4  
ATOM 5875  C CG   . LYS A 1 34  ? 2.519   3.959   -7.165  1.00 0.00 ? 34  LYS A CG   4  
ATOM 5876  C CD   . LYS A 1 34  ? 2.536   4.292   -8.648  1.00 0.00 ? 34  LYS A CD   4  
ATOM 5877  C CE   . LYS A 1 34  ? 3.087   3.138   -9.472  1.00 0.00 ? 34  LYS A CE   4  
ATOM 5878  N NZ   . LYS A 1 34  ? 2.837   3.327   -10.927 1.00 0.00 ? 34  LYS A NZ   4  
ATOM 5879  H H    . LYS A 1 34  ? -0.498  1.604   -5.751  1.00 0.00 ? 34  LYS A H    4  
ATOM 5880  H HA   . LYS A 1 34  ? 2.241   2.318   -5.111  1.00 0.00 ? 34  LYS A HA   4  
ATOM 5881  H HB2  . LYS A 1 34  ? 1.109   2.398   -7.444  1.00 0.00 ? 34  LYS A HB2  4  
ATOM 5882  H HB3  . LYS A 1 34  ? 0.416   3.914   -6.884  1.00 0.00 ? 34  LYS A HB3  4  
ATOM 5883  H HG2  . LYS A 1 34  ? 2.588   4.878   -6.601  1.00 0.00 ? 34  LYS A HG2  4  
ATOM 5884  H HG3  . LYS A 1 34  ? 3.368   3.330   -6.937  1.00 0.00 ? 34  LYS A HG3  4  
ATOM 5885  H HD2  . LYS A 1 34  ? 1.527   4.501   -8.972  1.00 0.00 ? 34  LYS A HD2  4  
ATOM 5886  H HD3  . LYS A 1 34  ? 3.154   5.164   -8.806  1.00 0.00 ? 34  LYS A HD3  4  
ATOM 5887  H HE2  . LYS A 1 34  ? 4.151   3.070   -9.304  1.00 0.00 ? 34  LYS A HE2  4  
ATOM 5888  H HE3  . LYS A 1 34  ? 2.613   2.223   -9.149  1.00 0.00 ? 34  LYS A HE3  4  
ATOM 5889  H HZ1  . LYS A 1 34  ? 3.611   3.874   -11.355 1.00 0.00 ? 34  LYS A HZ1  4  
ATOM 5890  H HZ2  . LYS A 1 34  ? 1.944   3.839   -11.073 1.00 0.00 ? 34  LYS A HZ2  4  
ATOM 5891  H HZ3  . LYS A 1 34  ? 2.776   2.404   -11.402 1.00 0.00 ? 34  LYS A HZ3  4  
ATOM 5892  N N    . CYS A 1 35  ? 1.754   3.955   -3.313  1.00 0.00 ? 35  CYS A N    4  
ATOM 5893  C CA   . CYS A 1 35  ? 1.566   4.999   -2.313  1.00 0.00 ? 35  CYS A CA   4  
ATOM 5894  C C    . CYS A 1 35  ? 2.283   6.281   -2.723  1.00 0.00 ? 35  CYS A C    4  
ATOM 5895  O O    . CYS A 1 35  ? 3.511   6.317   -2.809  1.00 0.00 ? 35  CYS A O    4  
ATOM 5896  C CB   . CYS A 1 35  ? 2.076   4.528   -0.951  1.00 0.00 ? 35  CYS A CB   4  
ATOM 5897  S SG   . CYS A 1 35  ? 1.419   5.465   0.449   1.00 0.00 ? 35  CYS A SG   4  
ATOM 5898  H H    . CYS A 1 35  ? 2.493   3.320   -3.207  1.00 0.00 ? 35  CYS A H    4  
ATOM 5899  H HA   . CYS A 1 35  ? 0.508   5.201   -2.241  1.00 0.00 ? 35  CYS A HA   4  
ATOM 5900  H HB2  . CYS A 1 35  ? 1.802   3.492   -0.810  1.00 0.00 ? 35  CYS A HB2  4  
ATOM 5901  H HB3  . CYS A 1 35  ? 3.153   4.614   -0.929  1.00 0.00 ? 35  CYS A HB3  4  
ATOM 5902  H HG   . CYS A 1 35  ? 0.243   4.948   0.770   1.00 0.00 ? 35  CYS A HG   4  
ATOM 5903  N N    . PHE A 1 36  ? 1.509   7.331   -2.977  1.00 0.00 ? 36  PHE A N    4  
ATOM 5904  C CA   . PHE A 1 36  ? 2.071   8.615   -3.381  1.00 0.00 ? 36  PHE A CA   4  
ATOM 5905  C C    . PHE A 1 36  ? 2.700   9.332   -2.190  1.00 0.00 ? 36  PHE A C    4  
ATOM 5906  O O    . PHE A 1 36  ? 2.061   10.162  -1.543  1.00 0.00 ? 36  PHE A O    4  
ATOM 5907  C CB   . PHE A 1 36  ? 0.987   9.495   -4.006  1.00 0.00 ? 36  PHE A CB   4  
ATOM 5908  C CG   . PHE A 1 36  ? 0.858   9.323   -5.492  1.00 0.00 ? 36  PHE A CG   4  
ATOM 5909  C CD1  . PHE A 1 36  ? 1.303   8.166   -6.110  1.00 0.00 ? 36  PHE A CD1  4  
ATOM 5910  C CD2  . PHE A 1 36  ? 0.293   10.320  -6.272  1.00 0.00 ? 36  PHE A CD2  4  
ATOM 5911  C CE1  . PHE A 1 36  ? 1.186   8.004   -7.478  1.00 0.00 ? 36  PHE A CE1  4  
ATOM 5912  C CE2  . PHE A 1 36  ? 0.173   10.164  -7.640  1.00 0.00 ? 36  PHE A CE2  4  
ATOM 5913  C CZ   . PHE A 1 36  ? 0.621   9.005   -8.244  1.00 0.00 ? 36  PHE A CZ   4  
ATOM 5914  H H    . PHE A 1 36  ? 0.537   7.240   -2.891  1.00 0.00 ? 36  PHE A H    4  
ATOM 5915  H HA   . PHE A 1 36  ? 2.836   8.424   -4.117  1.00 0.00 ? 36  PHE A HA   4  
ATOM 5916  H HB2  . PHE A 1 36  ? 0.034   9.252   -3.561  1.00 0.00 ? 36  PHE A HB2  4  
ATOM 5917  H HB3  . PHE A 1 36  ? 1.217   10.531  -3.809  1.00 0.00 ? 36  PHE A HB3  4  
ATOM 5918  H HD1  . PHE A 1 36  ? 1.745   7.382   -5.512  1.00 0.00 ? 36  PHE A HD1  4  
ATOM 5919  H HD2  . PHE A 1 36  ? -0.057  11.227  -5.801  1.00 0.00 ? 36  PHE A HD2  4  
ATOM 5920  H HE1  . PHE A 1 36  ? 1.537   7.097   -7.947  1.00 0.00 ? 36  PHE A HE1  4  
ATOM 5921  H HE2  . PHE A 1 36  ? -0.269  10.948  -8.236  1.00 0.00 ? 36  PHE A HE2  4  
ATOM 5922  H HZ   . PHE A 1 36  ? 0.528   8.881   -9.312  1.00 0.00 ? 36  PHE A HZ   4  
ATOM 5923  N N    . ILE A 1 37  ? 3.957   9.004   -1.907  1.00 0.00 ? 37  ILE A N    4  
ATOM 5924  C CA   . ILE A 1 37  ? 4.673   9.617   -0.795  1.00 0.00 ? 37  ILE A CA   4  
ATOM 5925  C C    . ILE A 1 37  ? 5.371   10.901  -1.231  1.00 0.00 ? 37  ILE A C    4  
ATOM 5926  O O    . ILE A 1 37  ? 6.420   10.861  -1.875  1.00 0.00 ? 37  ILE A O    4  
ATOM 5927  C CB   . ILE A 1 37  ? 5.718   8.655   -0.200  1.00 0.00 ? 37  ILE A CB   4  
ATOM 5928  C CG1  . ILE A 1 37  ? 5.073   7.306   0.128   1.00 0.00 ? 37  ILE A CG1  4  
ATOM 5929  C CG2  . ILE A 1 37  ? 6.349   9.262   1.044   1.00 0.00 ? 37  ILE A CG2  4  
ATOM 5930  C CD1  . ILE A 1 37  ? 6.037   6.303   0.721   1.00 0.00 ? 37  ILE A CD1  4  
ATOM 5931  H H    . ILE A 1 37  ? 4.413   8.336   -2.459  1.00 0.00 ? 37  ILE A H    4  
ATOM 5932  H HA   . ILE A 1 37  ? 3.953   9.855   -0.026  1.00 0.00 ? 37  ILE A HA   4  
ATOM 5933  H HB   . ILE A 1 37  ? 6.496   8.505   -0.933  1.00 0.00 ? 37  ILE A HB   4  
ATOM 5934  H HG12 . ILE A 1 37  ? 4.275   7.458   0.837   1.00 0.00 ? 37  ILE A HG12 4  
ATOM 5935  H HG13 . ILE A 1 37  ? 4.666   6.881   -0.779  1.00 0.00 ? 37  ILE A HG13 4  
ATOM 5936  H HG21 . ILE A 1 37  ? 7.157   9.918   0.754   1.00 0.00 ? 37  ILE A HG21 4  
ATOM 5937  H HG22 . ILE A 1 37  ? 5.605   9.826   1.586   1.00 0.00 ? 37  ILE A HG22 4  
ATOM 5938  H HG23 . ILE A 1 37  ? 6.734   8.474   1.674   1.00 0.00 ? 37  ILE A HG23 4  
ATOM 5939  H HD11 . ILE A 1 37  ? 6.973   6.341   0.183   1.00 0.00 ? 37  ILE A HD11 4  
ATOM 5940  H HD12 . ILE A 1 37  ? 6.209   6.540   1.761   1.00 0.00 ? 37  ILE A HD12 4  
ATOM 5941  H HD13 . ILE A 1 37  ? 5.618   5.310   0.643   1.00 0.00 ? 37  ILE A HD13 4  
ATOM 5942  N N    . ARG A 1 38  ? 4.783   12.038  -0.875  1.00 0.00 ? 38  ARG A N    4  
ATOM 5943  C CA   . ARG A 1 38  ? 5.349   13.334  -1.229  1.00 0.00 ? 38  ARG A CA   4  
ATOM 5944  C C    . ARG A 1 38  ? 6.354   13.794  -0.177  1.00 0.00 ? 38  ARG A C    4  
ATOM 5945  O O    . ARG A 1 38  ? 6.292   14.926  0.302   1.00 0.00 ? 38  ARG A O    4  
ATOM 5946  C CB   . ARG A 1 38  ? 4.239   14.376  -1.379  1.00 0.00 ? 38  ARG A CB   4  
ATOM 5947  C CG   . ARG A 1 38  ? 3.278   14.082  -2.520  1.00 0.00 ? 38  ARG A CG   4  
ATOM 5948  C CD   . ARG A 1 38  ? 2.208   15.156  -2.637  1.00 0.00 ? 38  ARG A CD   4  
ATOM 5949  N NE   . ARG A 1 38  ? 2.734   16.392  -3.209  1.00 0.00 ? 38  ARG A NE   4  
ATOM 5950  C CZ   . ARG A 1 38  ? 1.966   17.387  -3.641  1.00 0.00 ? 38  ARG A CZ   4  
ATOM 5951  N NH1  . ARG A 1 38  ? 0.646   17.290  -3.566  1.00 0.00 ? 38  ARG A NH1  4  
ATOM 5952  N NH2  . ARG A 1 38  ? 2.519   18.481  -4.149  1.00 0.00 ? 38  ARG A NH2  4  
ATOM 5953  H H    . ARG A 1 38  ? 3.949   12.005  -0.362  1.00 0.00 ? 38  ARG A H    4  
ATOM 5954  H HA   . ARG A 1 38  ? 5.859   13.226  -2.174  1.00 0.00 ? 38  ARG A HA   4  
ATOM 5955  H HB2  . ARG A 1 38  ? 3.671   14.414  -0.461  1.00 0.00 ? 38  ARG A HB2  4  
ATOM 5956  H HB3  . ARG A 1 38  ? 4.689   15.341  -1.555  1.00 0.00 ? 38  ARG A HB3  4  
ATOM 5957  H HG2  . ARG A 1 38  ? 3.835   14.042  -3.445  1.00 0.00 ? 38  ARG A HG2  4  
ATOM 5958  H HG3  . ARG A 1 38  ? 2.803   13.129  -2.341  1.00 0.00 ? 38  ARG A HG3  4  
ATOM 5959  H HD2  . ARG A 1 38  ? 1.414   14.787  -3.270  1.00 0.00 ? 38  ARG A HD2  4  
ATOM 5960  H HD3  . ARG A 1 38  ? 1.816   15.363  -1.653  1.00 0.00 ? 38  ARG A HD3  4  
ATOM 5961  H HE   . ARG A 1 38  ? 3.706   16.485  -3.274  1.00 0.00 ? 38  ARG A HE   4  
ATOM 5962  H HH11 . ARG A 1 38  ? 0.226   16.468  -3.183  1.00 0.00 ? 38  ARG A HH11 4  
ATOM 5963  H HH12 . ARG A 1 38  ? 0.070   18.041  -3.891  1.00 0.00 ? 38  ARG A HH12 4  
ATOM 5964  H HH21 . ARG A 1 38  ? 3.514   18.557  -4.207  1.00 0.00 ? 38  ARG A HH21 4  
ATOM 5965  H HH22 . ARG A 1 38  ? 1.940   19.228  -4.474  1.00 0.00 ? 38  ARG A HH22 4  
ATOM 5966  N N    . SER A 1 39  ? 7.279   12.908  0.178   1.00 0.00 ? 39  SER A N    4  
ATOM 5967  C CA   . SER A 1 39  ? 8.295   13.222  1.176   1.00 0.00 ? 39  SER A CA   4  
ATOM 5968  C C    . SER A 1 39  ? 9.483   13.935  0.537   1.00 0.00 ? 39  SER A C    4  
ATOM 5969  O O    . SER A 1 39  ? 10.000  13.504  -0.494  1.00 0.00 ? 39  SER A O    4  
ATOM 5970  C CB   . SER A 1 39  ? 8.767   11.944  1.872   1.00 0.00 ? 39  SER A CB   4  
ATOM 5971  O OG   . SER A 1 39  ? 7.686   11.272  2.493   1.00 0.00 ? 39  SER A OG   4  
ATOM 5972  H H    . SER A 1 39  ? 7.277   12.022  -0.241  1.00 0.00 ? 39  SER A H    4  
ATOM 5973  H HA   . SER A 1 39  ? 7.848   13.877  1.909   1.00 0.00 ? 39  SER A HA   4  
ATOM 5974  H HB2  . SER A 1 39  ? 9.215   11.285  1.144   1.00 0.00 ? 39  SER A HB2  4  
ATOM 5975  H HB3  . SER A 1 39  ? 9.499   12.198  2.626   1.00 0.00 ? 39  SER A HB3  4  
ATOM 5976  H HG   . SER A 1 39  ? 7.999   10.452  2.882   1.00 0.00 ? 39  SER A HG   4  
ATOM 5977  N N    . THR A 1 40  ? 9.911   15.030  1.157   1.00 0.00 ? 40  THR A N    4  
ATOM 5978  C CA   . THR A 1 40  ? 11.036  15.805  0.650   1.00 0.00 ? 40  THR A CA   4  
ATOM 5979  C C    . THR A 1 40  ? 11.796  16.480  1.786   1.00 0.00 ? 40  THR A C    4  
ATOM 5980  O O    . THR A 1 40  ? 11.348  17.470  2.363   1.00 0.00 ? 40  THR A O    4  
ATOM 5981  C CB   . THR A 1 40  ? 10.572  16.880  -0.351  1.00 0.00 ? 40  THR A CB   4  
ATOM 5982  O OG1  . THR A 1 40  ? 9.965   16.260  -1.490  1.00 0.00 ? 40  THR A OG1  4  
ATOM 5983  C CG2  . THR A 1 40  ? 11.743  17.742  -0.801  1.00 0.00 ? 40  THR A CG2  4  
ATOM 5984  H H    . THR A 1 40  ? 9.457   15.323  1.975   1.00 0.00 ? 40  THR A H    4  
ATOM 5985  H HA   . THR A 1 40  ? 11.703  15.128  0.136   1.00 0.00 ? 40  THR A HA   4  
ATOM 5986  H HB   . THR A 1 40  ? 9.844   17.514  0.136   1.00 0.00 ? 40  THR A HB   4  
ATOM 5987  H HG1  . THR A 1 40  ? 9.958   16.878  -2.225  1.00 0.00 ? 40  THR A HG1  4  
ATOM 5988  H HG21 . THR A 1 40  ? 12.657  17.359  -0.373  1.00 0.00 ? 40  THR A HG21 4  
ATOM 5989  H HG22 . THR A 1 40  ? 11.588  18.759  -0.471  1.00 0.00 ? 40  THR A HG22 4  
ATOM 5990  H HG23 . THR A 1 40  ? 11.813  17.720  -1.878  1.00 0.00 ? 40  THR A HG23 4  
ATOM 5991  N N    . PRO A 1 41  ? 12.975  15.932  2.117   1.00 0.00 ? 41  PRO A N    4  
ATOM 5992  C CA   . PRO A 1 41  ? 13.519  14.753  1.438   1.00 0.00 ? 41  PRO A CA   4  
ATOM 5993  C C    . PRO A 1 41  ? 12.731  13.486  1.756   1.00 0.00 ? 41  PRO A C    4  
ATOM 5994  O O    . PRO A 1 41  ? 11.906  13.452  2.669   1.00 0.00 ? 41  PRO A O    4  
ATOM 5995  C CB   . PRO A 1 41  ? 14.942  14.649  1.991   1.00 0.00 ? 41  PRO A CB   4  
ATOM 5996  C CG   . PRO A 1 41  ? 14.882  15.322  3.319   1.00 0.00 ? 41  PRO A CG   4  
ATOM 5997  C CD   . PRO A 1 41  ? 13.868  16.423  3.181   1.00 0.00 ? 41  PRO A CD   4  
ATOM 5998  H HA   . PRO A 1 41  ? 13.556  14.893  0.368   1.00 0.00 ? 41  PRO A HA   4  
ATOM 5999  H HB2  . PRO A 1 41  ? 15.220  13.609  2.086   1.00 0.00 ? 41  PRO A HB2  4  
ATOM 6000  H HB3  . PRO A 1 41  ? 15.628  15.151  1.325   1.00 0.00 ? 41  PRO A HB3  4  
ATOM 6001  H HG2  . PRO A 1 41  ? 14.570  14.616  4.074   1.00 0.00 ? 41  PRO A HG2  4  
ATOM 6002  H HG3  . PRO A 1 41  ? 15.850  15.733  3.566   1.00 0.00 ? 41  PRO A HG3  4  
ATOM 6003  H HD2  . PRO A 1 41  ? 13.328  16.557  4.106   1.00 0.00 ? 41  PRO A HD2  4  
ATOM 6004  H HD3  . PRO A 1 41  ? 14.349  17.344  2.885   1.00 0.00 ? 41  PRO A HD3  4  
ATOM 6005  N N    . PRO A 1 42  ? 12.989  12.419  0.986   1.00 0.00 ? 42  PRO A N    4  
ATOM 6006  C CA   . PRO A 1 42  ? 12.315  11.130  1.167   1.00 0.00 ? 42  PRO A CA   4  
ATOM 6007  C C    . PRO A 1 42  ? 12.741  10.429  2.453   1.00 0.00 ? 42  PRO A C    4  
ATOM 6008  O O    . PRO A 1 42  ? 13.800  10.704  3.016   1.00 0.00 ? 42  PRO A O    4  
ATOM 6009  C CB   . PRO A 1 42  ? 12.759  10.322  -0.055  1.00 0.00 ? 42  PRO A CB   4  
ATOM 6010  C CG   . PRO A 1 42  ? 14.061  10.925  -0.455  1.00 0.00 ? 42  PRO A CG   4  
ATOM 6011  C CD   . PRO A 1 42  ? 13.960  12.388  -0.121  1.00 0.00 ? 42  PRO A CD   4  
ATOM 6012  H HA   . PRO A 1 42  ? 11.240  11.240  1.158   1.00 0.00 ? 42  PRO A HA   4  
ATOM 6013  H HB2  . PRO A 1 42  ? 12.871  9.283   0.219   1.00 0.00 ? 42  PRO A HB2  4  
ATOM 6014  H HB3  . PRO A 1 42  ? 12.023  10.416  -0.839  1.00 0.00 ? 42  PRO A HB3  4  
ATOM 6015  H HG2  . PRO A 1 42  ? 14.864  10.467  0.102   1.00 0.00 ? 42  PRO A HG2  4  
ATOM 6016  H HG3  . PRO A 1 42  ? 14.216  10.793  -1.516  1.00 0.00 ? 42  PRO A HG3  4  
ATOM 6017  H HD2  . PRO A 1 42  ? 14.919  12.769  0.197   1.00 0.00 ? 42  PRO A HD2  4  
ATOM 6018  H HD3  . PRO A 1 42  ? 13.593  12.944  -0.971  1.00 0.00 ? 42  PRO A HD3  4  
ATOM 6019  N N    . PRO A 1 43  ? 11.898  9.500   2.929   1.00 0.00 ? 43  PRO A N    4  
ATOM 6020  C CA   . PRO A 1 43  ? 12.167  8.740   4.152   1.00 0.00 ? 43  PRO A CA   4  
ATOM 6021  C C    . PRO A 1 43  ? 13.314  7.750   3.980   1.00 0.00 ? 43  PRO A C    4  
ATOM 6022  O O    . PRO A 1 43  ? 13.608  7.315   2.866   1.00 0.00 ? 43  PRO A O    4  
ATOM 6023  C CB   . PRO A 1 43  ? 10.853  7.996   4.404   1.00 0.00 ? 43  PRO A CB   4  
ATOM 6024  C CG   . PRO A 1 43  ? 10.219  7.882   3.061   1.00 0.00 ? 43  PRO A CG   4  
ATOM 6025  C CD   . PRO A 1 43  ? 10.617  9.121   2.308   1.00 0.00 ? 43  PRO A CD   4  
ATOM 6026  H HA   . PRO A 1 43  ? 12.379  9.393   4.987   1.00 0.00 ? 43  PRO A HA   4  
ATOM 6027  H HB2  . PRO A 1 43  ? 11.062  7.024   4.827   1.00 0.00 ? 43  PRO A HB2  4  
ATOM 6028  H HB3  . PRO A 1 43  ? 10.237  8.566   5.084   1.00 0.00 ? 43  PRO A HB3  4  
ATOM 6029  H HG2  . PRO A 1 43  ? 10.586  7.002   2.555   1.00 0.00 ? 43  PRO A HG2  4  
ATOM 6030  H HG3  . PRO A 1 43  ? 9.145   7.836   3.165   1.00 0.00 ? 43  PRO A HG3  4  
ATOM 6031  H HD2  . PRO A 1 43  ? 10.747  8.900   1.259   1.00 0.00 ? 43  PRO A HD2  4  
ATOM 6032  H HD3  . PRO A 1 43  ? 9.879   9.898   2.443   1.00 0.00 ? 43  PRO A HD3  4  
ATOM 6033  N N    . ASP A 1 44  ? 13.958  7.399   5.087   1.00 0.00 ? 44  ASP A N    4  
ATOM 6034  C CA   . ASP A 1 44  ? 15.073  6.459   5.058   1.00 0.00 ? 44  ASP A CA   4  
ATOM 6035  C C    . ASP A 1 44  ? 14.594  5.039   5.343   1.00 0.00 ? 44  ASP A C    4  
ATOM 6036  O O    . ASP A 1 44  ? 15.108  4.075   4.776   1.00 0.00 ? 44  ASP A O    4  
ATOM 6037  C CB   . ASP A 1 44  ? 16.137  6.866   6.078   1.00 0.00 ? 44  ASP A CB   4  
ATOM 6038  C CG   . ASP A 1 44  ? 16.967  8.045   5.610   1.00 0.00 ? 44  ASP A CG   4  
ATOM 6039  O OD1  . ASP A 1 44  ? 17.318  8.085   4.413   1.00 0.00 ? 44  ASP A OD1  4  
ATOM 6040  O OD2  . ASP A 1 44  ? 17.267  8.927   6.442   1.00 0.00 ? 44  ASP A OD2  4  
ATOM 6041  H H    . ASP A 1 44  ? 13.677  7.781   5.945   1.00 0.00 ? 44  ASP A H    4  
ATOM 6042  H HA   . ASP A 1 44  ? 15.505  6.488   4.069   1.00 0.00 ? 44  ASP A HA   4  
ATOM 6043  H HB2  . ASP A 1 44  ? 15.653  7.136   7.006   1.00 0.00 ? 44  ASP A HB2  4  
ATOM 6044  H HB3  . ASP A 1 44  ? 16.798  6.029   6.252   1.00 0.00 ? 44  ASP A HB3  4  
ATOM 6045  N N    . ARG A 1 45  ? 13.606  4.919   6.224   1.00 0.00 ? 45  ARG A N    4  
ATOM 6046  C CA   . ARG A 1 45  ? 13.060  3.616   6.586   1.00 0.00 ? 45  ARG A CA   4  
ATOM 6047  C C    . ARG A 1 45  ? 11.570  3.543   6.262   1.00 0.00 ? 45  ARG A C    4  
ATOM 6048  O O    . ARG A 1 45  ? 10.861  4.548   6.329   1.00 0.00 ? 45  ARG A O    4  
ATOM 6049  C CB   . ARG A 1 45  ? 13.283  3.341   8.074   1.00 0.00 ? 45  ARG A CB   4  
ATOM 6050  C CG   . ARG A 1 45  ? 12.670  2.035   8.550   1.00 0.00 ? 45  ARG A CG   4  
ATOM 6051  C CD   . ARG A 1 45  ? 13.473  1.424   9.687   1.00 0.00 ? 45  ARG A CD   4  
ATOM 6052  N NE   . ARG A 1 45  ? 14.868  1.205   9.316   1.00 0.00 ? 45  ARG A NE   4  
ATOM 6053  C CZ   . ARG A 1 45  ? 15.701  0.435   10.008  1.00 0.00 ? 45  ARG A CZ   4  
ATOM 6054  N NH1  . ARG A 1 45  ? 15.282  -0.186  11.101  1.00 0.00 ? 45  ARG A NH1  4  
ATOM 6055  N NH2  . ARG A 1 45  ? 16.957  0.285   9.606   1.00 0.00 ? 45  ARG A NH2  4  
ATOM 6056  H H    . ARG A 1 45  ? 13.237  5.725   6.642   1.00 0.00 ? 45  ARG A H    4  
ATOM 6057  H HA   . ARG A 1 45  ? 13.579  2.867   6.008   1.00 0.00 ? 45  ARG A HA   4  
ATOM 6058  H HB2  . ARG A 1 45  ? 14.346  3.305   8.266   1.00 0.00 ? 45  ARG A HB2  4  
ATOM 6059  H HB3  . ARG A 1 45  ? 12.850  4.147   8.646   1.00 0.00 ? 45  ARG A HB3  4  
ATOM 6060  H HG2  . ARG A 1 45  ? 11.664  2.225   8.897   1.00 0.00 ? 45  ARG A HG2  4  
ATOM 6061  H HG3  . ARG A 1 45  ? 12.642  1.339   7.725   1.00 0.00 ? 45  ARG A HG3  4  
ATOM 6062  H HD2  . ARG A 1 45  ? 13.437  2.091   10.535  1.00 0.00 ? 45  ARG A HD2  4  
ATOM 6063  H HD3  . ARG A 1 45  ? 13.029  0.477   9.956   1.00 0.00 ? 45  ARG A HD3  4  
ATOM 6064  H HE   . ARG A 1 45  ? 15.200  1.654   8.511   1.00 0.00 ? 45  ARG A HE   4  
ATOM 6065  H HH11 . ARG A 1 45  ? 14.336  -0.075  11.406  1.00 0.00 ? 45  ARG A HH11 4  
ATOM 6066  H HH12 . ARG A 1 45  ? 15.910  -0.765  11.620  1.00 0.00 ? 45  ARG A HH12 4  
ATOM 6067  H HH21 . ARG A 1 45  ? 17.277  0.752   8.782   1.00 0.00 ? 45  ARG A HH21 4  
ATOM 6068  H HH22 . ARG A 1 45  ? 17.583  -0.294  10.127  1.00 0.00 ? 45  ARG A HH22 4  
ATOM 6069  N N    . ILE A 1 46  ? 11.104  2.350   5.912   1.00 0.00 ? 46  ILE A N    4  
ATOM 6070  C CA   . ILE A 1 46  ? 9.700   2.146   5.579   1.00 0.00 ? 46  ILE A CA   4  
ATOM 6071  C C    . ILE A 1 46  ? 9.262   0.719   5.891   1.00 0.00 ? 46  ILE A C    4  
ATOM 6072  O O    . ILE A 1 46  ? 10.053  -0.219  5.794   1.00 0.00 ? 46  ILE A O    4  
ATOM 6073  C CB   . ILE A 1 46  ? 9.425   2.442   4.093   1.00 0.00 ? 46  ILE A CB   4  
ATOM 6074  C CG1  . ILE A 1 46  ? 9.662   3.924   3.793   1.00 0.00 ? 46  ILE A CG1  4  
ATOM 6075  C CG2  . ILE A 1 46  ? 8.003   2.043   3.727   1.00 0.00 ? 46  ILE A CG2  4  
ATOM 6076  C CD1  . ILE A 1 46  ? 9.617   4.256   2.318   1.00 0.00 ? 46  ILE A CD1  4  
ATOM 6077  H H    . ILE A 1 46  ? 11.719  1.588   5.877   1.00 0.00 ? 46  ILE A H    4  
ATOM 6078  H HA   . ILE A 1 46  ? 9.113   2.830   6.176   1.00 0.00 ? 46  ILE A HA   4  
ATOM 6079  H HB   . ILE A 1 46  ? 10.103  1.849   3.499   1.00 0.00 ? 46  ILE A HB   4  
ATOM 6080  H HG12 . ILE A 1 46  ? 8.904   4.510   4.288   1.00 0.00 ? 46  ILE A HG12 4  
ATOM 6081  H HG13 . ILE A 1 46  ? 10.634  4.208   4.169   1.00 0.00 ? 46  ILE A HG13 4  
ATOM 6082  H HG21 . ILE A 1 46  ? 7.846   2.197   2.670   1.00 0.00 ? 46  ILE A HG21 4  
ATOM 6083  H HG22 . ILE A 1 46  ? 7.850   1.001   3.965   1.00 0.00 ? 46  ILE A HG22 4  
ATOM 6084  H HG23 . ILE A 1 46  ? 7.304   2.646   4.287   1.00 0.00 ? 46  ILE A HG23 4  
ATOM 6085  H HD11 . ILE A 1 46  ? 10.511  3.887   1.838   1.00 0.00 ? 46  ILE A HD11 4  
ATOM 6086  H HD12 . ILE A 1 46  ? 8.750   3.795   1.870   1.00 0.00 ? 46  ILE A HD12 4  
ATOM 6087  H HD13 . ILE A 1 46  ? 9.559   5.328   2.193   1.00 0.00 ? 46  ILE A HD13 4  
ATOM 6088  N N    . ALA A 1 47  ? 7.996   0.563   6.265   1.00 0.00 ? 47  ALA A N    4  
ATOM 6089  C CA   . ALA A 1 47  ? 7.451   -0.750  6.587   1.00 0.00 ? 47  ALA A CA   4  
ATOM 6090  C C    . ALA A 1 47  ? 5.969   -0.831  6.238   1.00 0.00 ? 47  ALA A C    4  
ATOM 6091  O O    . ALA A 1 47  ? 5.209   0.101   6.500   1.00 0.00 ? 47  ALA A O    4  
ATOM 6092  C CB   . ALA A 1 47  ? 7.666   -1.063  8.061   1.00 0.00 ? 47  ALA A CB   4  
ATOM 6093  H H    . ALA A 1 47  ? 7.414   1.349   6.324   1.00 0.00 ? 47  ALA A H    4  
ATOM 6094  H HA   . ALA A 1 47  ? 7.989   -1.486  6.006   1.00 0.00 ? 47  ALA A HA   4  
ATOM 6095  H HB1  . ALA A 1 47  ? 8.158   -0.228  8.537   1.00 0.00 ? 47  ALA A HB1  4  
ATOM 6096  H HB2  . ALA A 1 47  ? 6.711   -1.237  8.534   1.00 0.00 ? 47  ALA A HB2  4  
ATOM 6097  H HB3  . ALA A 1 47  ? 8.282   -1.945  8.155   1.00 0.00 ? 47  ALA A HB3  4  
ATOM 6098  N N    . TRP A 1 48  ? 5.566   -1.949  5.645   1.00 0.00 ? 48  TRP A N    4  
ATOM 6099  C CA   . TRP A 1 48  ? 4.174   -2.150  5.259   1.00 0.00 ? 48  TRP A CA   4  
ATOM 6100  C C    . TRP A 1 48  ? 3.486   -3.135  6.197   1.00 0.00 ? 48  TRP A C    4  
ATOM 6101  O O    . TRP A 1 48  ? 3.604   -4.349  6.032   1.00 0.00 ? 48  TRP A O    4  
ATOM 6102  C CB   . TRP A 1 48  ? 4.091   -2.656  3.818   1.00 0.00 ? 48  TRP A CB   4  
ATOM 6103  C CG   . TRP A 1 48  ? 3.994   -1.555  2.806   1.00 0.00 ? 48  TRP A CG   4  
ATOM 6104  C CD1  . TRP A 1 48  ? 5.030   -0.860  2.248   1.00 0.00 ? 48  TRP A CD1  4  
ATOM 6105  C CD2  . TRP A 1 48  ? 2.796   -1.020  2.234   1.00 0.00 ? 48  TRP A CD2  4  
ATOM 6106  N NE1  . TRP A 1 48  ? 4.547   0.074   1.364   1.00 0.00 ? 48  TRP A NE1  4  
ATOM 6107  C CE2  . TRP A 1 48  ? 3.180   -0.004  1.336   1.00 0.00 ? 48  TRP A CE2  4  
ATOM 6108  C CE3  . TRP A 1 48  ? 1.436   -1.301  2.390   1.00 0.00 ? 48  TRP A CE3  4  
ATOM 6109  C CZ2  . TRP A 1 48  ? 2.252   0.729   0.601   1.00 0.00 ? 48  TRP A CZ2  4  
ATOM 6110  C CZ3  . TRP A 1 48  ? 0.517   -0.572  1.660   1.00 0.00 ? 48  TRP A CZ3  4  
ATOM 6111  C CH2  . TRP A 1 48  ? 0.928   0.432   0.774   1.00 0.00 ? 48  TRP A CH2  4  
ATOM 6112  H H    . TRP A 1 48  ? 6.220   -2.656  5.462   1.00 0.00 ? 48  TRP A H    4  
ATOM 6113  H HA   . TRP A 1 48  ? 3.672   -1.196  5.325   1.00 0.00 ? 48  TRP A HA   4  
ATOM 6114  H HB2  . TRP A 1 48  ? 4.974   -3.236  3.595   1.00 0.00 ? 48  TRP A HB2  4  
ATOM 6115  H HB3  . TRP A 1 48  ? 3.217   -3.283  3.714   1.00 0.00 ? 48  TRP A HB3  4  
ATOM 6116  H HD1  . TRP A 1 48  ? 6.070   -1.030  2.480   1.00 0.00 ? 48  TRP A HD1  4  
ATOM 6117  H HE1  . TRP A 1 48  ? 5.094   0.694   0.837   1.00 0.00 ? 48  TRP A HE1  4  
ATOM 6118  H HE3  . TRP A 1 48  ? 1.100   -2.072  3.068   1.00 0.00 ? 48  TRP A HE3  4  
ATOM 6119  H HZ2  . TRP A 1 48  ? 2.553   1.506   -0.087  1.00 0.00 ? 48  TRP A HZ2  4  
ATOM 6120  H HZ3  . TRP A 1 48  ? -0.539  -0.775  1.769   1.00 0.00 ? 48  TRP A HZ3  4  
ATOM 6121  H HH2  . TRP A 1 48  ? 0.175   0.976   0.225   1.00 0.00 ? 48  TRP A HH2  4  
ATOM 6122  N N    . SER A 1 49  ? 2.767   -2.605  7.181   1.00 0.00 ? 49  SER A N    4  
ATOM 6123  C CA   . SER A 1 49  ? 2.063   -3.438  8.148   1.00 0.00 ? 49  SER A CA   4  
ATOM 6124  C C    . SER A 1 49  ? 0.555   -3.228  8.050   1.00 0.00 ? 49  SER A C    4  
ATOM 6125  O O    . SER A 1 49  ? 0.080   -2.096  7.954   1.00 0.00 ? 49  SER A O    4  
ATOM 6126  C CB   . SER A 1 49  ? 2.541   -3.126  9.567   1.00 0.00 ? 49  SER A CB   4  
ATOM 6127  O OG   . SER A 1 49  ? 2.014   -1.893  10.023  1.00 0.00 ? 49  SER A OG   4  
ATOM 6128  H H    . SER A 1 49  ? 2.712   -1.629  7.260   1.00 0.00 ? 49  SER A H    4  
ATOM 6129  H HA   . SER A 1 49  ? 2.286   -4.470  7.921   1.00 0.00 ? 49  SER A HA   4  
ATOM 6130  H HB2  . SER A 1 49  ? 2.218   -3.911  10.234  1.00 0.00 ? 49  SER A HB2  4  
ATOM 6131  H HB3  . SER A 1 49  ? 3.620   -3.068  9.575   1.00 0.00 ? 49  SER A HB3  4  
ATOM 6132  H HG   . SER A 1 49  ? 1.835   -1.323  9.272   1.00 0.00 ? 49  SER A HG   4  
ATOM 6133  N N    . TRP A 1 50  ? -0.192  -4.326  8.075   1.00 0.00 ? 50  TRP A N    4  
ATOM 6134  C CA   . TRP A 1 50  ? -1.647  -4.263  7.989   1.00 0.00 ? 50  TRP A CA   4  
ATOM 6135  C C    . TRP A 1 50  ? -2.287  -4.620  9.326   1.00 0.00 ? 50  TRP A C    4  
ATOM 6136  O O    . TRP A 1 50  ? -2.939  -3.787  9.956   1.00 0.00 ? 50  TRP A O    4  
ATOM 6137  C CB   . TRP A 1 50  ? -2.155  -5.206  6.898   1.00 0.00 ? 50  TRP A CB   4  
ATOM 6138  C CG   . TRP A 1 50  ? -1.295  -6.420  6.714   1.00 0.00 ? 50  TRP A CG   4  
ATOM 6139  C CD1  . TRP A 1 50  ? -1.552  -7.682  7.168   1.00 0.00 ? 50  TRP A CD1  4  
ATOM 6140  C CD2  . TRP A 1 50  ? -0.040  -6.485  6.029   1.00 0.00 ? 50  TRP A CD2  4  
ATOM 6141  N NE1  . TRP A 1 50  ? -0.531  -8.528  6.806   1.00 0.00 ? 50  TRP A NE1  4  
ATOM 6142  C CE2  . TRP A 1 50  ? 0.408   -7.819  6.106   1.00 0.00 ? 50  TRP A CE2  4  
ATOM 6143  C CE3  . TRP A 1 50  ? 0.749   -5.548  5.357   1.00 0.00 ? 50  TRP A CE3  4  
ATOM 6144  C CZ2  . TRP A 1 50  ? 1.609   -8.234  5.537   1.00 0.00 ? 50  TRP A CZ2  4  
ATOM 6145  C CZ3  . TRP A 1 50  ? 1.940   -5.962  4.793   1.00 0.00 ? 50  TRP A CZ3  4  
ATOM 6146  C CH2  . TRP A 1 50  ? 2.361   -7.296  4.885   1.00 0.00 ? 50  TRP A CH2  4  
ATOM 6147  H H    . TRP A 1 50  ? 0.245   -5.200  8.154   1.00 0.00 ? 50  TRP A H    4  
ATOM 6148  H HA   . TRP A 1 50  ? -1.919  -3.250  7.732   1.00 0.00 ? 50  TRP A HA   4  
ATOM 6149  H HB2  . TRP A 1 50  ? -3.150  -5.538  7.152   1.00 0.00 ? 50  TRP A HB2  4  
ATOM 6150  H HB3  . TRP A 1 50  ? -2.186  -4.674  5.958   1.00 0.00 ? 50  TRP A HB3  4  
ATOM 6151  H HD1  . TRP A 1 50  ? -2.431  -7.960  7.729   1.00 0.00 ? 50  TRP A HD1  4  
ATOM 6152  H HE1  . TRP A 1 50  ? -0.485  -9.485  7.015   1.00 0.00 ? 50  TRP A HE1  4  
ATOM 6153  H HE3  . TRP A 1 50  ? 0.442   -4.516  5.275   1.00 0.00 ? 50  TRP A HE3  4  
ATOM 6154  H HZ2  . TRP A 1 50  ? 1.946   -9.259  5.599   1.00 0.00 ? 50  TRP A HZ2  4  
ATOM 6155  H HZ3  . TRP A 1 50  ? 2.563   -5.252  4.269   1.00 0.00 ? 50  TRP A HZ3  4  
ATOM 6156  H HH2  . TRP A 1 50  ? 3.298   -7.574  4.429   1.00 0.00 ? 50  TRP A HH2  4  
ATOM 6157  N N    . LYS A 1 51  ? -2.097  -5.863  9.755   1.00 0.00 ? 51  LYS A N    4  
ATOM 6158  C CA   . LYS A 1 51  ? -2.655  -6.331  11.018  1.00 0.00 ? 51  LYS A CA   4  
ATOM 6159  C C    . LYS A 1 51  ? -1.549  -6.619  12.028  1.00 0.00 ? 51  LYS A C    4  
ATOM 6160  O O    . LYS A 1 51  ? -1.354  -5.864  12.980  1.00 0.00 ? 51  LYS A O    4  
ATOM 6161  C CB   . LYS A 1 51  ? -3.495  -7.591  10.793  1.00 0.00 ? 51  LYS A CB   4  
ATOM 6162  C CG   . LYS A 1 51  ? -4.712  -7.361  9.914   1.00 0.00 ? 51  LYS A CG   4  
ATOM 6163  C CD   . LYS A 1 51  ? -5.943  -7.031  10.741  1.00 0.00 ? 51  LYS A CD   4  
ATOM 6164  C CE   . LYS A 1 51  ? -6.112  -5.529  10.912  1.00 0.00 ? 51  LYS A CE   4  
ATOM 6165  N NZ   . LYS A 1 51  ? -7.293  -5.197  11.757  1.00 0.00 ? 51  LYS A NZ   4  
ATOM 6166  H H    . LYS A 1 51  ? -1.568  -6.482  9.208   1.00 0.00 ? 51  LYS A H    4  
ATOM 6167  H HA   . LYS A 1 51  ? -3.290  -5.551  11.410  1.00 0.00 ? 51  LYS A HA   4  
ATOM 6168  H HB2  . LYS A 1 51  ? -2.876  -8.343  10.326  1.00 0.00 ? 51  LYS A HB2  4  
ATOM 6169  H HB3  . LYS A 1 51  ? -3.833  -7.959  11.751  1.00 0.00 ? 51  LYS A HB3  4  
ATOM 6170  H HG2  . LYS A 1 51  ? -4.510  -6.539  9.243   1.00 0.00 ? 51  LYS A HG2  4  
ATOM 6171  H HG3  . LYS A 1 51  ? -4.904  -8.257  9.340   1.00 0.00 ? 51  LYS A HG3  4  
ATOM 6172  H HD2  . LYS A 1 51  ? -6.817  -7.426  10.244  1.00 0.00 ? 51  LYS A HD2  4  
ATOM 6173  H HD3  . LYS A 1 51  ? -5.844  -7.487  11.716  1.00 0.00 ? 51  LYS A HD3  4  
ATOM 6174  H HE2  . LYS A 1 51  ? -5.224  -5.130  11.377  1.00 0.00 ? 51  LYS A HE2  4  
ATOM 6175  H HE3  . LYS A 1 51  ? -6.240  -5.081  9.938   1.00 0.00 ? 51  LYS A HE3  4  
ATOM 6176  H HZ1  . LYS A 1 51  ? -8.171  -5.413  11.244  1.00 0.00 ? 51  LYS A HZ1  4  
ATOM 6177  H HZ2  . LYS A 1 51  ? -7.286  -4.186  11.999  1.00 0.00 ? 51  LYS A HZ2  4  
ATOM 6178  H HZ3  . LYS A 1 51  ? -7.271  -5.753  12.636  1.00 0.00 ? 51  LYS A HZ3  4  
ATOM 6179  N N    . GLU A 1 52  ? -0.826  -7.714  11.812  1.00 0.00 ? 52  GLU A N    4  
ATOM 6180  C CA   . GLU A 1 52  ? 0.261   -8.099  12.704  1.00 0.00 ? 52  GLU A CA   4  
ATOM 6181  C C    . GLU A 1 52  ? 1.564   -8.274  11.930  1.00 0.00 ? 52  GLU A C    4  
ATOM 6182  O O    . GLU A 1 52  ? 2.649   -8.268  12.510  1.00 0.00 ? 52  GLU A O    4  
ATOM 6183  C CB   . GLU A 1 52  ? -0.087  -9.396  13.438  1.00 0.00 ? 52  GLU A CB   4  
ATOM 6184  C CG   . GLU A 1 52  ? -0.935  -9.184  14.681  1.00 0.00 ? 52  GLU A CG   4  
ATOM 6185  C CD   . GLU A 1 52  ? -0.479  -7.993  15.502  1.00 0.00 ? 52  GLU A CD   4  
ATOM 6186  O OE1  . GLU A 1 52  ? 0.724   -7.924  15.830  1.00 0.00 ? 52  GLU A OE1  4  
ATOM 6187  O OE2  . GLU A 1 52  ? -1.326  -7.131  15.816  1.00 0.00 ? 52  GLU A OE2  4  
ATOM 6188  H H    . GLU A 1 52  ? -1.030  -8.276  11.036  1.00 0.00 ? 52  GLU A H    4  
ATOM 6189  H HA   . GLU A 1 52  ? 0.390   -7.310  13.429  1.00 0.00 ? 52  GLU A HA   4  
ATOM 6190  H HB2  . GLU A 1 52  ? -0.628  -10.043 12.763  1.00 0.00 ? 52  GLU A HB2  4  
ATOM 6191  H HB3  . GLU A 1 52  ? 0.830   -9.885  13.733  1.00 0.00 ? 52  GLU A HB3  4  
ATOM 6192  H HG2  . GLU A 1 52  ? -1.959  -9.022  14.379  1.00 0.00 ? 52  GLU A HG2  4  
ATOM 6193  H HG3  . GLU A 1 52  ? -0.878  -10.070 15.295  1.00 0.00 ? 52  GLU A HG3  4  
ATOM 6194  N N    . ASN A 1 53  ? 1.448   -8.430  10.615  1.00 0.00 ? 53  ASN A N    4  
ATOM 6195  C CA   . ASN A 1 53  ? 2.616   -8.608  9.760   1.00 0.00 ? 53  ASN A CA   4  
ATOM 6196  C C    . ASN A 1 53  ? 3.260   -7.264  9.433   1.00 0.00 ? 53  ASN A C    4  
ATOM 6197  O O    . ASN A 1 53  ? 2.653   -6.210  9.623   1.00 0.00 ? 53  ASN A O    4  
ATOM 6198  C CB   . ASN A 1 53  ? 2.224   -9.326  8.468   1.00 0.00 ? 53  ASN A CB   4  
ATOM 6199  C CG   . ASN A 1 53  ? 1.945   -10.801 8.687   1.00 0.00 ? 53  ASN A CG   4  
ATOM 6200  O OD1  . ASN A 1 53  ? 2.795   -11.651 8.425   1.00 0.00 ? 53  ASN A OD1  4  
ATOM 6201  N ND2  . ASN A 1 53  ? 0.747   -11.110 9.171   1.00 0.00 ? 53  ASN A ND2  4  
ATOM 6202  H H    . ASN A 1 53  ? 0.556   -8.426  10.210  1.00 0.00 ? 53  ASN A H    4  
ATOM 6203  H HA   . ASN A 1 53  ? 3.330   -9.215  10.297  1.00 0.00 ? 53  ASN A HA   4  
ATOM 6204  H HB2  . ASN A 1 53  ? 1.333   -8.867  8.064   1.00 0.00 ? 53  ASN A HB2  4  
ATOM 6205  H HB3  . ASN A 1 53  ? 3.027   -9.233  7.752   1.00 0.00 ? 53  ASN A HB3  4  
ATOM 6206  H HD21 . ASN A 1 53  ? 0.120   -10.381 9.357   1.00 0.00 ? 53  ASN A HD21 4  
ATOM 6207  H HD22 . ASN A 1 53  ? 0.541   -12.056 9.324   1.00 0.00 ? 53  ASN A HD22 4  
ATOM 6208  N N    . VAL A 1 54  ? 4.494   -7.310  8.940   1.00 0.00 ? 54  VAL A N    4  
ATOM 6209  C CA   . VAL A 1 54  ? 5.220   -6.097  8.585   1.00 0.00 ? 54  VAL A CA   4  
ATOM 6210  C C    . VAL A 1 54  ? 6.276   -6.380  7.521   1.00 0.00 ? 54  VAL A C    4  
ATOM 6211  O O    . VAL A 1 54  ? 7.269   -7.060  7.782   1.00 0.00 ? 54  VAL A O    4  
ATOM 6212  C CB   . VAL A 1 54  ? 5.903   -5.470  9.815   1.00 0.00 ? 54  VAL A CB   4  
ATOM 6213  C CG1  . VAL A 1 54  ? 6.534   -4.134  9.453   1.00 0.00 ? 54  VAL A CG1  4  
ATOM 6214  C CG2  . VAL A 1 54  ? 4.905   -5.308  10.952  1.00 0.00 ? 54  VAL A CG2  4  
ATOM 6215  H H    . VAL A 1 54  ? 4.925   -8.180  8.812   1.00 0.00 ? 54  VAL A H    4  
ATOM 6216  H HA   . VAL A 1 54  ? 4.509   -5.385  8.192   1.00 0.00 ? 54  VAL A HA   4  
ATOM 6217  H HB   . VAL A 1 54  ? 6.687   -6.136  10.145  1.00 0.00 ? 54  VAL A HB   4  
ATOM 6218  H HG11 . VAL A 1 54  ? 7.609   -4.232  9.457   1.00 0.00 ? 54  VAL A HG11 4  
ATOM 6219  H HG12 . VAL A 1 54  ? 6.201   -3.833  8.471   1.00 0.00 ? 54  VAL A HG12 4  
ATOM 6220  H HG13 . VAL A 1 54  ? 6.239   -3.389  10.178  1.00 0.00 ? 54  VAL A HG13 4  
ATOM 6221  H HG21 . VAL A 1 54  ? 4.047   -4.755  10.600  1.00 0.00 ? 54  VAL A HG21 4  
ATOM 6222  H HG22 . VAL A 1 54  ? 4.589   -6.282  11.296  1.00 0.00 ? 54  VAL A HG22 4  
ATOM 6223  H HG23 . VAL A 1 54  ? 5.370   -4.772  11.766  1.00 0.00 ? 54  VAL A HG23 4  
ATOM 6224  N N    . LEU A 1 55  ? 6.054   -5.854  6.321   1.00 0.00 ? 55  LEU A N    4  
ATOM 6225  C CA   . LEU A 1 55  ? 6.987   -6.050  5.217   1.00 0.00 ? 55  LEU A CA   4  
ATOM 6226  C C    . LEU A 1 55  ? 7.780   -4.776  4.942   1.00 0.00 ? 55  LEU A C    4  
ATOM 6227  O O    . LEU A 1 55  ? 7.229   -3.778  4.481   1.00 0.00 ? 55  LEU A O    4  
ATOM 6228  C CB   . LEU A 1 55  ? 6.232   -6.476  3.956   1.00 0.00 ? 55  LEU A CB   4  
ATOM 6229  C CG   . LEU A 1 55  ? 7.075   -7.122  2.856   1.00 0.00 ? 55  LEU A CG   4  
ATOM 6230  C CD1  . LEU A 1 55  ? 7.764   -8.374  3.377   1.00 0.00 ? 55  LEU A CD1  4  
ATOM 6231  C CD2  . LEU A 1 55  ? 6.212   -7.450  1.646   1.00 0.00 ? 55  LEU A CD2  4  
ATOM 6232  H H    . LEU A 1 55  ? 5.245   -5.322  6.174   1.00 0.00 ? 55  LEU A H    4  
ATOM 6233  H HA   . LEU A 1 55  ? 7.673   -6.834  5.498   1.00 0.00 ? 55  LEU A HA   4  
ATOM 6234  H HB2  . LEU A 1 55  ? 5.472   -7.183  4.249   1.00 0.00 ? 55  LEU A HB2  4  
ATOM 6235  H HB3  . LEU A 1 55  ? 5.761   -5.596  3.540   1.00 0.00 ? 55  LEU A HB3  4  
ATOM 6236  H HG   . LEU A 1 55  ? 7.841   -6.426  2.542   1.00 0.00 ? 55  LEU A HG   4  
ATOM 6237  H HD11 . LEU A 1 55  ? 7.048   -8.985  3.905   1.00 0.00 ? 55  LEU A HD11 4  
ATOM 6238  H HD12 . LEU A 1 55  ? 8.562   -8.092  4.048   1.00 0.00 ? 55  LEU A HD12 4  
ATOM 6239  H HD13 . LEU A 1 55  ? 8.172   -8.932  2.547   1.00 0.00 ? 55  LEU A HD13 4  
ATOM 6240  H HD21 . LEU A 1 55  ? 6.202   -8.519  1.491   1.00 0.00 ? 55  LEU A HD21 4  
ATOM 6241  H HD22 . LEU A 1 55  ? 6.617   -6.963  0.772   1.00 0.00 ? 55  LEU A HD22 4  
ATOM 6242  H HD23 . LEU A 1 55  ? 5.204   -7.103  1.818   1.00 0.00 ? 55  LEU A HD23 4  
ATOM 6243  N N    . GLU A 1 56  ? 9.078   -4.821  5.227   1.00 0.00 ? 56  GLU A N    4  
ATOM 6244  C CA   . GLU A 1 56  ? 9.947   -3.670  5.010   1.00 0.00 ? 56  GLU A CA   4  
ATOM 6245  C C    . GLU A 1 56  ? 10.444  -3.629  3.567   1.00 0.00 ? 56  GLU A C    4  
ATOM 6246  O O    . GLU A 1 56  ? 10.330  -2.608  2.889   1.00 0.00 ? 56  GLU A O    4  
ATOM 6247  C CB   . GLU A 1 56  ? 11.138  -3.714  5.970   1.00 0.00 ? 56  GLU A CB   4  
ATOM 6248  C CG   . GLU A 1 56  ? 10.742  -3.626  7.434   1.00 0.00 ? 56  GLU A CG   4  
ATOM 6249  C CD   . GLU A 1 56  ? 11.823  -2.999  8.294   1.00 0.00 ? 56  GLU A CD   4  
ATOM 6250  O OE1  . GLU A 1 56  ? 12.769  -3.718  8.677   1.00 0.00 ? 56  GLU A OE1  4  
ATOM 6251  O OE2  . GLU A 1 56  ? 11.721  -1.788  8.582   1.00 0.00 ? 56  GLU A OE2  4  
ATOM 6252  H H    . GLU A 1 56  ? 9.459   -5.646  5.593   1.00 0.00 ? 56  GLU A H    4  
ATOM 6253  H HA   . GLU A 1 56  ? 9.371   -2.778  5.205   1.00 0.00 ? 56  GLU A HA   4  
ATOM 6254  H HB2  . GLU A 1 56  ? 11.674  -4.638  5.817   1.00 0.00 ? 56  GLU A HB2  4  
ATOM 6255  H HB3  . GLU A 1 56  ? 11.795  -2.886  5.746   1.00 0.00 ? 56  GLU A HB3  4  
ATOM 6256  H HG2  . GLU A 1 56  ? 9.846   -3.029  7.517   1.00 0.00 ? 56  GLU A HG2  4  
ATOM 6257  H HG3  . GLU A 1 56  ? 10.545  -4.623  7.801   1.00 0.00 ? 56  GLU A HG3  4  
ATOM 6258  N N    . SER A 1 57  ? 10.996  -4.746  3.106   1.00 0.00 ? 57  SER A N    4  
ATOM 6259  C CA   . SER A 1 57  ? 11.514  -4.838  1.746   1.00 0.00 ? 57  SER A CA   4  
ATOM 6260  C C    . SER A 1 57  ? 11.753  -6.292  1.352   1.00 0.00 ? 57  SER A C    4  
ATOM 6261  O O    . SER A 1 57  ? 12.189  -7.104  2.166   1.00 0.00 ? 57  SER A O    4  
ATOM 6262  C CB   . SER A 1 57  ? 12.816  -4.043  1.619   1.00 0.00 ? 57  SER A CB   4  
ATOM 6263  O OG   . SER A 1 57  ? 13.859  -4.653  2.359   1.00 0.00 ? 57  SER A OG   4  
ATOM 6264  H H    . SER A 1 57  ? 11.058  -5.527  3.695   1.00 0.00 ? 57  SER A H    4  
ATOM 6265  H HA   . SER A 1 57  ? 10.777  -4.413  1.081   1.00 0.00 ? 57  SER A HA   4  
ATOM 6266  H HB2  . SER A 1 57  ? 13.107  -3.997  0.581   1.00 0.00 ? 57  SER A HB2  4  
ATOM 6267  H HB3  . SER A 1 57  ? 12.661  -3.042  1.995   1.00 0.00 ? 57  SER A HB3  4  
ATOM 6268  H HG   . SER A 1 57  ? 14.288  -5.320  1.818   1.00 0.00 ? 57  SER A HG   4  
ATOM 6269  N N    . GLY A 1 58  ? 11.463  -6.613  0.094   1.00 0.00 ? 58  GLY A N    4  
ATOM 6270  C CA   . GLY A 1 58  ? 11.651  -7.969  -0.387  1.00 0.00 ? 58  GLY A CA   4  
ATOM 6271  C C    . GLY A 1 58  ? 10.341  -8.649  -0.734  1.00 0.00 ? 58  GLY A C    4  
ATOM 6272  O O    . GLY A 1 58  ? 9.357   -7.987  -1.063  1.00 0.00 ? 58  GLY A O    4  
ATOM 6273  H H    . GLY A 1 58  ? 11.118  -5.924  -0.511  1.00 0.00 ? 58  GLY A H    4  
ATOM 6274  H HA2  . GLY A 1 58  ? 12.275  -7.943  -1.268  1.00 0.00 ? 58  GLY A HA2  4  
ATOM 6275  H HA3  . GLY A 1 58  ? 12.151  -8.545  0.379   1.00 0.00 ? 58  GLY A HA3  4  
ATOM 6276  N N    . THR A 1 59  ? 10.328  -9.977  -0.661  1.00 0.00 ? 59  THR A N    4  
ATOM 6277  C CA   . THR A 1 59  ? 9.131   -10.747 -0.972  1.00 0.00 ? 59  THR A CA   4  
ATOM 6278  C C    . THR A 1 59  ? 8.839   -11.774 0.116   1.00 0.00 ? 59  THR A C    4  
ATOM 6279  O O    . THR A 1 59  ? 9.521   -12.794 0.219   1.00 0.00 ? 59  THR A O    4  
ATOM 6280  C CB   . THR A 1 59  ? 9.265   -11.472 -2.324  1.00 0.00 ? 59  THR A CB   4  
ATOM 6281  O OG1  . THR A 1 59  ? 9.414   -10.517 -3.380  1.00 0.00 ? 59  THR A OG1  4  
ATOM 6282  C CG2  . THR A 1 59  ? 8.049   -12.347 -2.593  1.00 0.00 ? 59  THR A CG2  4  
ATOM 6283  H H    . THR A 1 59  ? 11.144  -10.448 -0.393  1.00 0.00 ? 59  THR A H    4  
ATOM 6284  H HA   . THR A 1 59  ? 8.299   -10.060 -1.037  1.00 0.00 ? 59  THR A HA   4  
ATOM 6285  H HB   . THR A 1 59  ? 10.143  -12.102 -2.292  1.00 0.00 ? 59  THR A HB   4  
ATOM 6286  H HG1  . THR A 1 59  ? 10.340  -10.275 -3.465  1.00 0.00 ? 59  THR A HG1  4  
ATOM 6287  H HG21 . THR A 1 59  ? 8.365   -13.370 -2.732  1.00 0.00 ? 59  THR A HG21 4  
ATOM 6288  H HG22 . THR A 1 59  ? 7.546   -12.000 -3.483  1.00 0.00 ? 59  THR A HG22 4  
ATOM 6289  H HG23 . THR A 1 59  ? 7.373   -12.290 -1.753  1.00 0.00 ? 59  THR A HG23 4  
ATOM 6290  N N    . SER A 1 60  ? 7.823   -11.498 0.926   1.00 0.00 ? 60  SER A N    4  
ATOM 6291  C CA   . SER A 1 60  ? 7.443   -12.397 2.010   1.00 0.00 ? 60  SER A CA   4  
ATOM 6292  C C    . SER A 1 60  ? 6.079   -13.026 1.741   1.00 0.00 ? 60  SER A C    4  
ATOM 6293  O O    . SER A 1 60  ? 5.072   -12.328 1.630   1.00 0.00 ? 60  SER A O    4  
ATOM 6294  C CB   . SER A 1 60  ? 7.416   -11.644 3.341   1.00 0.00 ? 60  SER A CB   4  
ATOM 6295  O OG   . SER A 1 60  ? 7.691   -12.514 4.425   1.00 0.00 ? 60  SER A OG   4  
ATOM 6296  H H    . SER A 1 60  ? 7.317   -10.668 0.794   1.00 0.00 ? 60  SER A H    4  
ATOM 6297  H HA   . SER A 1 60  ? 8.183   -13.181 2.065   1.00 0.00 ? 60  SER A HA   4  
ATOM 6298  H HB2  . SER A 1 60  ? 8.161   -10.863 3.325   1.00 0.00 ? 60  SER A HB2  4  
ATOM 6299  H HB3  . SER A 1 60  ? 6.439   -11.206 3.484   1.00 0.00 ? 60  SER A HB3  4  
ATOM 6300  H HG   . SER A 1 60  ? 8.631   -12.706 4.452   1.00 0.00 ? 60  SER A HG   4  
ATOM 6301  N N    . GLY A 1 61  ? 6.056   -14.352 1.638   1.00 0.00 ? 61  GLY A N    4  
ATOM 6302  C CA   . GLY A 1 61  ? 4.811   -15.054 1.383   1.00 0.00 ? 61  GLY A CA   4  
ATOM 6303  C C    . GLY A 1 61  ? 4.168   -14.637 0.075   1.00 0.00 ? 61  GLY A C    4  
ATOM 6304  O O    . GLY A 1 61  ? 4.548   -15.120 -0.992  1.00 0.00 ? 61  GLY A O    4  
ATOM 6305  H H    . GLY A 1 61  ? 6.890   -14.857 1.735   1.00 0.00 ? 61  GLY A H    4  
ATOM 6306  H HA2  . GLY A 1 61  ? 5.009   -16.115 1.353   1.00 0.00 ? 61  GLY A HA2  4  
ATOM 6307  H HA3  . GLY A 1 61  ? 4.124   -14.848 2.190   1.00 0.00 ? 61  GLY A HA3  4  
ATOM 6308  N N    . ARG A 1 62  ? 3.191   -13.741 0.157   1.00 0.00 ? 62  ARG A N    4  
ATOM 6309  C CA   . ARG A 1 62  ? 2.491   -13.262 -1.029  1.00 0.00 ? 62  ARG A CA   4  
ATOM 6310  C C    . ARG A 1 62  ? 2.482   -11.737 -1.076  1.00 0.00 ? 62  ARG A C    4  
ATOM 6311  O O    . ARG A 1 62  ? 1.485   -11.123 -1.457  1.00 0.00 ? 62  ARG A O    4  
ATOM 6312  C CB   . ARG A 1 62  ? 1.057   -13.792 -1.050  1.00 0.00 ? 62  ARG A CB   4  
ATOM 6313  C CG   . ARG A 1 62  ? 0.963   -15.284 -1.325  1.00 0.00 ? 62  ARG A CG   4  
ATOM 6314  C CD   . ARG A 1 62  ? -0.331  -15.638 -2.041  1.00 0.00 ? 62  ARG A CD   4  
ATOM 6315  N NE   . ARG A 1 62  ? -0.420  -17.066 -2.336  1.00 0.00 ? 62  ARG A NE   4  
ATOM 6316  C CZ   . ARG A 1 62  ? -0.645  -17.994 -1.413  1.00 0.00 ? 62  ARG A CZ   4  
ATOM 6317  N NH1  . ARG A 1 62  ? -0.803  -17.646 -0.143  1.00 0.00 ? 62  ARG A NH1  4  
ATOM 6318  N NH2  . ARG A 1 62  ? -0.713  -19.273 -1.759  1.00 0.00 ? 62  ARG A NH2  4  
ATOM 6319  H H    . ARG A 1 62  ? 2.933   -13.393 1.037   1.00 0.00 ? 62  ARG A H    4  
ATOM 6320  H HA   . ARG A 1 62  ? 3.016   -13.634 -1.896  1.00 0.00 ? 62  ARG A HA   4  
ATOM 6321  H HB2  . ARG A 1 62  ? 0.598   -13.595 -0.092  1.00 0.00 ? 62  ARG A HB2  4  
ATOM 6322  H HB3  . ARG A 1 62  ? 0.505   -13.271 -1.818  1.00 0.00 ? 62  ARG A HB3  4  
ATOM 6323  H HG2  . ARG A 1 62  ? 1.797   -15.580 -1.944  1.00 0.00 ? 62  ARG A HG2  4  
ATOM 6324  H HG3  . ARG A 1 62  ? 1.002   -15.816 -0.386  1.00 0.00 ? 62  ARG A HG3  4  
ATOM 6325  H HD2  . ARG A 1 62  ? -1.163  -15.357 -1.414  1.00 0.00 ? 62  ARG A HD2  4  
ATOM 6326  H HD3  . ARG A 1 62  ? -0.376  -15.085 -2.968  1.00 0.00 ? 62  ARG A HD3  4  
ATOM 6327  H HE   . ARG A 1 62  ? -0.306  -17.345 -3.268  1.00 0.00 ? 62  ARG A HE   4  
ATOM 6328  H HH11 . ARG A 1 62  ? -0.754  -16.683 0.120   1.00 0.00 ? 62  ARG A HH11 4  
ATOM 6329  H HH12 . ARG A 1 62  ? -0.974  -18.347 0.550   1.00 0.00 ? 62  ARG A HH12 4  
ATOM 6330  H HH21 . ARG A 1 62  ? -0.594  -19.539 -2.715  1.00 0.00 ? 62  ARG A HH21 4  
ATOM 6331  H HH22 . ARG A 1 62  ? -0.882  -19.971 -1.063  1.00 0.00 ? 62  ARG A HH22 4  
ATOM 6332  N N    . TYR A 1 63  ? 3.598   -11.131 -0.686  1.00 0.00 ? 63  TYR A N    4  
ATOM 6333  C CA   . TYR A 1 63  ? 3.718   -9.678  -0.681  1.00 0.00 ? 63  TYR A CA   4  
ATOM 6334  C C    . TYR A 1 63  ? 5.106   -9.244  -1.141  1.00 0.00 ? 63  TYR A C    4  
ATOM 6335  O O    . TYR A 1 63  ? 6.109   -9.879  -0.814  1.00 0.00 ? 63  TYR A O    4  
ATOM 6336  C CB   . TYR A 1 63  ? 3.436   -9.127  0.718   1.00 0.00 ? 63  TYR A CB   4  
ATOM 6337  C CG   . TYR A 1 63  ? 1.988   -9.247  1.137   1.00 0.00 ? 63  TYR A CG   4  
ATOM 6338  C CD1  . TYR A 1 63  ? 1.041   -8.330  0.702   1.00 0.00 ? 63  TYR A CD1  4  
ATOM 6339  C CD2  . TYR A 1 63  ? 1.568   -10.280 1.966   1.00 0.00 ? 63  TYR A CD2  4  
ATOM 6340  C CE1  . TYR A 1 63  ? -0.283  -8.435  1.083   1.00 0.00 ? 63  TYR A CE1  4  
ATOM 6341  C CE2  . TYR A 1 63  ? 0.246   -10.394 2.351   1.00 0.00 ? 63  TYR A CE2  4  
ATOM 6342  C CZ   . TYR A 1 63  ? -0.675  -9.469  1.907   1.00 0.00 ? 63  TYR A CZ   4  
ATOM 6343  O OH   . TYR A 1 63  ? -1.993  -9.579  2.287   1.00 0.00 ? 63  TYR A OH   4  
ATOM 6344  H H    . TYR A 1 63  ? 4.359   -11.674 -0.393  1.00 0.00 ? 63  TYR A H    4  
ATOM 6345  H HA   . TYR A 1 63  ? 2.983   -9.282  -1.367  1.00 0.00 ? 63  TYR A HA   4  
ATOM 6346  H HB2  . TYR A 1 63  ? 4.034   -9.666  1.437   1.00 0.00 ? 63  TYR A HB2  4  
ATOM 6347  H HB3  . TYR A 1 63  ? 3.704   -8.081  0.747   1.00 0.00 ? 63  TYR A HB3  4  
ATOM 6348  H HD1  . TYR A 1 63  ? 1.351   -7.521  0.056   1.00 0.00 ? 63  TYR A HD1  4  
ATOM 6349  H HD2  . TYR A 1 63  ? 2.293   -11.003 2.313   1.00 0.00 ? 63  TYR A HD2  4  
ATOM 6350  H HE1  . TYR A 1 63  ? -1.005  -7.711  0.735   1.00 0.00 ? 63  TYR A HE1  4  
ATOM 6351  H HE2  . TYR A 1 63  ? -0.061  -11.204 2.996   1.00 0.00 ? 63  TYR A HE2  4  
ATOM 6352  H HH   . TYR A 1 63  ? -2.464  -8.778  2.043   1.00 0.00 ? 63  TYR A HH   4  
ATOM 6353  N N    . THR A 1 64  ? 5.156   -8.155  -1.903  1.00 0.00 ? 64  THR A N    4  
ATOM 6354  C CA   . THR A 1 64  ? 6.420   -7.635  -2.409  1.00 0.00 ? 64  THR A CA   4  
ATOM 6355  C C    . THR A 1 64  ? 6.473   -6.115  -2.298  1.00 0.00 ? 64  THR A C    4  
ATOM 6356  O O    . THR A 1 64  ? 5.714   -5.407  -2.960  1.00 0.00 ? 64  THR A O    4  
ATOM 6357  C CB   . THR A 1 64  ? 6.645   -8.038  -3.879  1.00 0.00 ? 64  THR A CB   4  
ATOM 6358  O OG1  . THR A 1 64  ? 6.406   -9.441  -4.044  1.00 0.00 ? 64  THR A OG1  4  
ATOM 6359  C CG2  . THR A 1 64  ? 8.062   -7.705  -4.320  1.00 0.00 ? 64  THR A CG2  4  
ATOM 6360  H H    . THR A 1 64  ? 4.322   -7.693  -2.129  1.00 0.00 ? 64  THR A H    4  
ATOM 6361  H HA   . THR A 1 64  ? 7.217   -8.058  -1.815  1.00 0.00 ? 64  THR A HA   4  
ATOM 6362  H HB   . THR A 1 64  ? 5.951   -7.487  -4.498  1.00 0.00 ? 64  THR A HB   4  
ATOM 6363  H HG1  . THR A 1 64  ? 7.063   -9.938  -3.551  1.00 0.00 ? 64  THR A HG1  4  
ATOM 6364  H HG21 . THR A 1 64  ? 8.257   -6.657  -4.145  1.00 0.00 ? 64  THR A HG21 4  
ATOM 6365  H HG22 . THR A 1 64  ? 8.171   -7.920  -5.373  1.00 0.00 ? 64  THR A HG22 4  
ATOM 6366  H HG23 . THR A 1 64  ? 8.764   -8.301  -3.757  1.00 0.00 ? 64  THR A HG23 4  
ATOM 6367  N N    . VAL A 1 65  ? 7.374   -5.619  -1.456  1.00 0.00 ? 65  VAL A N    4  
ATOM 6368  C CA   . VAL A 1 65  ? 7.527   -4.183  -1.259  1.00 0.00 ? 65  VAL A CA   4  
ATOM 6369  C C    . VAL A 1 65  ? 8.619   -3.618  -2.161  1.00 0.00 ? 65  VAL A C    4  
ATOM 6370  O O    . VAL A 1 65  ? 9.672   -4.230  -2.335  1.00 0.00 ? 65  VAL A O    4  
ATOM 6371  C CB   . VAL A 1 65  ? 7.864   -3.850  0.206   1.00 0.00 ? 65  VAL A CB   4  
ATOM 6372  C CG1  . VAL A 1 65  ? 8.304   -2.400  0.337   1.00 0.00 ? 65  VAL A CG1  4  
ATOM 6373  C CG2  . VAL A 1 65  ? 6.671   -4.137  1.105   1.00 0.00 ? 65  VAL A CG2  4  
ATOM 6374  H H    . VAL A 1 65  ? 7.951   -6.234  -0.956  1.00 0.00 ? 65  VAL A H    4  
ATOM 6375  H HA   . VAL A 1 65  ? 6.588   -3.710  -1.507  1.00 0.00 ? 65  VAL A HA   4  
ATOM 6376  H HB   . VAL A 1 65  ? 8.683   -4.481  0.519   1.00 0.00 ? 65  VAL A HB   4  
ATOM 6377  H HG11 . VAL A 1 65  ? 7.491   -1.750  0.049   1.00 0.00 ? 65  VAL A HG11 4  
ATOM 6378  H HG12 . VAL A 1 65  ? 8.582   -2.199  1.361   1.00 0.00 ? 65  VAL A HG12 4  
ATOM 6379  H HG13 . VAL A 1 65  ? 9.152   -2.222  -0.308  1.00 0.00 ? 65  VAL A HG13 4  
ATOM 6380  H HG21 . VAL A 1 65  ? 6.009   -4.833  0.612   1.00 0.00 ? 65  VAL A HG21 4  
ATOM 6381  H HG22 . VAL A 1 65  ? 7.015   -4.565  2.036   1.00 0.00 ? 65  VAL A HG22 4  
ATOM 6382  H HG23 . VAL A 1 65  ? 6.142   -3.217  1.306   1.00 0.00 ? 65  VAL A HG23 4  
ATOM 6383  N N    . GLU A 1 66  ? 8.360   -2.446  -2.732  1.00 0.00 ? 66  GLU A N    4  
ATOM 6384  C CA   . GLU A 1 66  ? 9.321   -1.798  -3.616  1.00 0.00 ? 66  GLU A CA   4  
ATOM 6385  C C    . GLU A 1 66  ? 9.168   -0.281  -3.570  1.00 0.00 ? 66  GLU A C    4  
ATOM 6386  O O    . GLU A 1 66  ? 8.128   0.262   -3.946  1.00 0.00 ? 66  GLU A O    4  
ATOM 6387  C CB   . GLU A 1 66  ? 9.143   -2.296  -5.052  1.00 0.00 ? 66  GLU A CB   4  
ATOM 6388  C CG   . GLU A 1 66  ? 9.557   -3.745  -5.250  1.00 0.00 ? 66  GLU A CG   4  
ATOM 6389  C CD   . GLU A 1 66  ? 9.585   -4.150  -6.711  1.00 0.00 ? 66  GLU A CD   4  
ATOM 6390  O OE1  . GLU A 1 66  ? 8.753   -3.632  -7.485  1.00 0.00 ? 66  GLU A OE1  4  
ATOM 6391  O OE2  . GLU A 1 66  ? 10.439  -4.983  -7.080  1.00 0.00 ? 66  GLU A OE2  4  
ATOM 6392  H H    . GLU A 1 66  ? 7.502   -2.006  -2.554  1.00 0.00 ? 66  GLU A H    4  
ATOM 6393  H HA   . GLU A 1 66  ? 10.312  -2.058  -3.276  1.00 0.00 ? 66  GLU A HA   4  
ATOM 6394  H HB2  . GLU A 1 66  ? 8.103   -2.199  -5.327  1.00 0.00 ? 66  GLU A HB2  4  
ATOM 6395  H HB3  . GLU A 1 66  ? 9.739   -1.681  -5.710  1.00 0.00 ? 66  GLU A HB3  4  
ATOM 6396  H HG2  . GLU A 1 66  ? 10.544  -3.884  -4.835  1.00 0.00 ? 66  GLU A HG2  4  
ATOM 6397  H HG3  . GLU A 1 66  ? 8.856   -4.381  -4.729  1.00 0.00 ? 66  GLU A HG3  4  
ATOM 6398  N N    . THR A 1 67  ? 10.211  0.400   -3.106  1.00 0.00 ? 67  THR A N    4  
ATOM 6399  C CA   . THR A 1 67  ? 10.192  1.854   -3.008  1.00 0.00 ? 67  THR A CA   4  
ATOM 6400  C C    . THR A 1 67  ? 10.964  2.492   -4.157  1.00 0.00 ? 67  THR A C    4  
ATOM 6401  O O    . THR A 1 67  ? 12.039  2.022   -4.532  1.00 0.00 ? 67  THR A O    4  
ATOM 6402  C CB   . THR A 1 67  ? 10.791  2.335   -1.673  1.00 0.00 ? 67  THR A CB   4  
ATOM 6403  O OG1  . THR A 1 67  ? 10.561  1.357   -0.652  1.00 0.00 ? 67  THR A OG1  4  
ATOM 6404  C CG2  . THR A 1 67  ? 10.183  3.665   -1.255  1.00 0.00 ? 67  THR A CG2  4  
ATOM 6405  H H    . THR A 1 67  ? 11.011  -0.089  -2.822  1.00 0.00 ? 67  THR A H    4  
ATOM 6406  H HA   . THR A 1 67  ? 9.163   2.178   -3.054  1.00 0.00 ? 67  THR A HA   4  
ATOM 6407  H HB   . THR A 1 67  ? 11.856  2.468   -1.800  1.00 0.00 ? 67  THR A HB   4  
ATOM 6408  H HG1  . THR A 1 67  ? 9.626   1.337   -0.433  1.00 0.00 ? 67  THR A HG1  4  
ATOM 6409  H HG21 . THR A 1 67  ? 9.870   3.609   -0.222  1.00 0.00 ? 67  THR A HG21 4  
ATOM 6410  H HG22 . THR A 1 67  ? 9.329   3.882   -1.879  1.00 0.00 ? 67  THR A HG22 4  
ATOM 6411  H HG23 . THR A 1 67  ? 10.918  4.447   -1.366  1.00 0.00 ? 67  THR A HG23 4  
ATOM 6412  N N    . ILE A 1 68  ? 10.410  3.565   -4.712  1.00 0.00 ? 68  ILE A N    4  
ATOM 6413  C CA   . ILE A 1 68  ? 11.048  4.268   -5.818  1.00 0.00 ? 68  ILE A CA   4  
ATOM 6414  C C    . ILE A 1 68  ? 11.179  5.758   -5.520  1.00 0.00 ? 68  ILE A C    4  
ATOM 6415  O O    . ILE A 1 68  ? 10.596  6.263   -4.560  1.00 0.00 ? 68  ILE A O    4  
ATOM 6416  C CB   . ILE A 1 68  ? 10.262  4.086   -7.130  1.00 0.00 ? 68  ILE A CB   4  
ATOM 6417  C CG1  . ILE A 1 68  ? 9.546   2.734   -7.137  1.00 0.00 ? 68  ILE A CG1  4  
ATOM 6418  C CG2  . ILE A 1 68  ? 11.194  4.205   -8.326  1.00 0.00 ? 68  ILE A CG2  4  
ATOM 6419  C CD1  . ILE A 1 68  ? 8.547   2.585   -8.262  1.00 0.00 ? 68  ILE A CD1  4  
ATOM 6420  H H    . ILE A 1 68  ? 9.552   3.891   -4.369  1.00 0.00 ? 68  ILE A H    4  
ATOM 6421  H HA   . ILE A 1 68  ? 12.036  3.851   -5.952  1.00 0.00 ? 68  ILE A HA   4  
ATOM 6422  H HB   . ILE A 1 68  ? 9.528   4.874   -7.196  1.00 0.00 ? 68  ILE A HB   4  
ATOM 6423  H HG12 . ILE A 1 68  ? 10.277  1.947   -7.238  1.00 0.00 ? 68  ILE A HG12 4  
ATOM 6424  H HG13 . ILE A 1 68  ? 9.017   2.610   -6.203  1.00 0.00 ? 68  ILE A HG13 4  
ATOM 6425  H HG21 . ILE A 1 68  ? 10.944  5.091   -8.891  1.00 0.00 ? 68  ILE A HG21 4  
ATOM 6426  H HG22 . ILE A 1 68  ? 12.215  4.274   -7.982  1.00 0.00 ? 68  ILE A HG22 4  
ATOM 6427  H HG23 . ILE A 1 68  ? 11.085  3.335   -8.956  1.00 0.00 ? 68  ILE A HG23 4  
ATOM 6428  H HD11 . ILE A 1 68  ? 7.699   2.011   -7.918  1.00 0.00 ? 68  ILE A HD11 4  
ATOM 6429  H HD12 . ILE A 1 68  ? 8.215   3.562   -8.581  1.00 0.00 ? 68  ILE A HD12 4  
ATOM 6430  H HD13 . ILE A 1 68  ? 9.013   2.075   -9.093  1.00 0.00 ? 68  ILE A HD13 4  
ATOM 6431  N N    . SER A 1 69  ? 11.946  6.457   -6.350  1.00 0.00 ? 69  SER A N    4  
ATOM 6432  C CA   . SER A 1 69  ? 12.155  7.889   -6.174  1.00 0.00 ? 69  SER A CA   4  
ATOM 6433  C C    . SER A 1 69  ? 11.439  8.681   -7.265  1.00 0.00 ? 69  SER A C    4  
ATOM 6434  O O    . SER A 1 69  ? 11.697  8.496   -8.454  1.00 0.00 ? 69  SER A O    4  
ATOM 6435  C CB   . SER A 1 69  ? 13.650  8.214   -6.191  1.00 0.00 ? 69  SER A CB   4  
ATOM 6436  O OG   . SER A 1 69  ? 14.236  7.855   -7.431  1.00 0.00 ? 69  SER A OG   4  
ATOM 6437  H H    . SER A 1 69  ? 12.384  5.997   -7.097  1.00 0.00 ? 69  SER A H    4  
ATOM 6438  H HA   . SER A 1 69  ? 11.746  8.169   -5.215  1.00 0.00 ? 69  SER A HA   4  
ATOM 6439  H HB2  . SER A 1 69  ? 13.788  9.273   -6.035  1.00 0.00 ? 69  SER A HB2  4  
ATOM 6440  H HB3  . SER A 1 69  ? 14.144  7.666   -5.401  1.00 0.00 ? 69  SER A HB3  4  
ATOM 6441  H HG   . SER A 1 69  ? 14.872  7.149   -7.292  1.00 0.00 ? 69  SER A HG   4  
ATOM 6442  N N    . THR A 1 70  ? 10.537  9.565   -6.850  1.00 0.00 ? 70  THR A N    4  
ATOM 6443  C CA   . THR A 1 70  ? 9.782   10.384  -7.789  1.00 0.00 ? 70  THR A CA   4  
ATOM 6444  C C    . THR A 1 70  ? 10.079  11.866  -7.589  1.00 0.00 ? 70  THR A C    4  
ATOM 6445  O O    . THR A 1 70  ? 10.521  12.279  -6.518  1.00 0.00 ? 70  THR A O    4  
ATOM 6446  C CB   . THR A 1 70  ? 8.266   10.152  -7.645  1.00 0.00 ? 70  THR A CB   4  
ATOM 6447  O OG1  . THR A 1 70  ? 7.893   10.196  -6.263  1.00 0.00 ? 70  THR A OG1  4  
ATOM 6448  C CG2  . THR A 1 70  ? 7.865   8.811   -8.241  1.00 0.00 ? 70  THR A CG2  4  
ATOM 6449  H H    . THR A 1 70  ? 10.376  9.666   -5.889  1.00 0.00 ? 70  THR A H    4  
ATOM 6450  H HA   . THR A 1 70  ? 10.075  10.100  -8.790  1.00 0.00 ? 70  THR A HA   4  
ATOM 6451  H HB   . THR A 1 70  ? 7.745   10.935  -8.177  1.00 0.00 ? 70  THR A HB   4  
ATOM 6452  H HG1  . THR A 1 70  ? 7.290   10.930  -6.118  1.00 0.00 ? 70  THR A HG1  4  
ATOM 6453  H HG21 . THR A 1 70  ? 6.791   8.705   -8.199  1.00 0.00 ? 70  THR A HG21 4  
ATOM 6454  H HG22 . THR A 1 70  ? 8.328   8.014   -7.678  1.00 0.00 ? 70  THR A HG22 4  
ATOM 6455  H HG23 . THR A 1 70  ? 8.191   8.762   -9.269  1.00 0.00 ? 70  THR A HG23 4  
ATOM 6456  N N    . GLU A 1 71  ? 9.832   12.660  -8.626  1.00 0.00 ? 71  GLU A N    4  
ATOM 6457  C CA   . GLU A 1 71  ? 10.073  14.096  -8.562  1.00 0.00 ? 71  GLU A CA   4  
ATOM 6458  C C    . GLU A 1 71  ? 9.339   14.719  -7.378  1.00 0.00 ? 71  GLU A C    4  
ATOM 6459  O O    . GLU A 1 71  ? 9.800   15.700  -6.796  1.00 0.00 ? 71  GLU A O    4  
ATOM 6460  C CB   . GLU A 1 71  ? 9.629   14.769  -9.862  1.00 0.00 ? 71  GLU A CB   4  
ATOM 6461  C CG   . GLU A 1 71  ? 8.127   14.728  -10.087 1.00 0.00 ? 71  GLU A CG   4  
ATOM 6462  C CD   . GLU A 1 71  ? 7.756   14.741  -11.557 1.00 0.00 ? 71  GLU A CD   4  
ATOM 6463  O OE1  . GLU A 1 71  ? 7.739   15.836  -12.156 1.00 0.00 ? 71  GLU A OE1  4  
ATOM 6464  O OE2  . GLU A 1 71  ? 7.484   13.654  -12.109 1.00 0.00 ? 71  GLU A OE2  4  
ATOM 6465  H H    . GLU A 1 71  ? 9.479   12.270  -9.453  1.00 0.00 ? 71  GLU A H    4  
ATOM 6466  H HA   . GLU A 1 71  ? 11.134  14.249  -8.433  1.00 0.00 ? 71  GLU A HA   4  
ATOM 6467  H HB2  . GLU A 1 71  ? 9.942   15.803  -9.844  1.00 0.00 ? 71  GLU A HB2  4  
ATOM 6468  H HB3  . GLU A 1 71  ? 10.110  14.272  -10.692 1.00 0.00 ? 71  GLU A HB3  4  
ATOM 6469  H HG2  . GLU A 1 71  ? 7.733   13.828  -9.640  1.00 0.00 ? 71  GLU A HG2  4  
ATOM 6470  H HG3  . GLU A 1 71  ? 7.681   15.590  -9.611  1.00 0.00 ? 71  GLU A HG3  4  
ATOM 6471  N N    . GLU A 1 72  ? 8.194   14.141  -7.029  1.00 0.00 ? 72  GLU A N    4  
ATOM 6472  C CA   . GLU A 1 72  ? 7.396   14.641  -5.915  1.00 0.00 ? 72  GLU A CA   4  
ATOM 6473  C C    . GLU A 1 72  ? 7.913   14.095  -4.587  1.00 0.00 ? 72  GLU A C    4  
ATOM 6474  O O    . GLU A 1 72  ? 7.557   14.591  -3.519  1.00 0.00 ? 72  GLU A O    4  
ATOM 6475  C CB   . GLU A 1 72  ? 5.926   14.256  -6.100  1.00 0.00 ? 72  GLU A CB   4  
ATOM 6476  C CG   . GLU A 1 72  ? 5.699   12.758  -6.216  1.00 0.00 ? 72  GLU A CG   4  
ATOM 6477  C CD   . GLU A 1 72  ? 4.242   12.405  -6.443  1.00 0.00 ? 72  GLU A CD   4  
ATOM 6478  O OE1  . GLU A 1 72  ? 3.759   12.582  -7.581  1.00 0.00 ? 72  GLU A OE1  4  
ATOM 6479  O OE2  . GLU A 1 72  ? 3.585   11.952  -5.483  1.00 0.00 ? 72  GLU A OE2  4  
ATOM 6480  H H    . GLU A 1 72  ? 7.879   13.362  -7.531  1.00 0.00 ? 72  GLU A H    4  
ATOM 6481  H HA   . GLU A 1 72  ? 7.478   15.717  -5.905  1.00 0.00 ? 72  GLU A HA   4  
ATOM 6482  H HB2  . GLU A 1 72  ? 5.362   14.621  -5.253  1.00 0.00 ? 72  GLU A HB2  4  
ATOM 6483  H HB3  . GLU A 1 72  ? 5.554   14.726  -6.998  1.00 0.00 ? 72  GLU A HB3  4  
ATOM 6484  H HG2  . GLU A 1 72  ? 6.278   12.383  -7.047  1.00 0.00 ? 72  GLU A HG2  4  
ATOM 6485  H HG3  . GLU A 1 72  ? 6.032   12.285  -5.305  1.00 0.00 ? 72  GLU A HG3  4  
ATOM 6486  N N    . GLY A 1 73  ? 8.755   13.070  -4.663  1.00 0.00 ? 73  GLY A N    4  
ATOM 6487  C CA   . GLY A 1 73  ? 9.308   12.473  -3.461  1.00 0.00 ? 73  GLY A CA   4  
ATOM 6488  C C    . GLY A 1 73  ? 9.662   11.011  -3.650  1.00 0.00 ? 73  GLY A C    4  
ATOM 6489  O O    . GLY A 1 73  ? 10.721  10.686  -4.188  1.00 0.00 ? 73  GLY A O    4  
ATOM 6490  H H    . GLY A 1 73  ? 9.004   12.715  -5.542  1.00 0.00 ? 73  GLY A H    4  
ATOM 6491  H HA2  . GLY A 1 73  ? 10.198  13.015  -3.179  1.00 0.00 ? 73  GLY A HA2  4  
ATOM 6492  H HA3  . GLY A 1 73  ? 8.581   12.555  -2.666  1.00 0.00 ? 73  GLY A HA3  4  
ATOM 6493  N N    . VAL A 1 74  ? 8.776   10.126  -3.204  1.00 0.00 ? 74  VAL A N    4  
ATOM 6494  C CA   . VAL A 1 74  ? 9.001   8.691   -3.326  1.00 0.00 ? 74  VAL A CA   4  
ATOM 6495  C C    . VAL A 1 74  ? 7.685   7.941   -3.497  1.00 0.00 ? 74  VAL A C    4  
ATOM 6496  O O    . VAL A 1 74  ? 6.607   8.523   -3.375  1.00 0.00 ? 74  VAL A O    4  
ATOM 6497  C CB   . VAL A 1 74  ? 9.742   8.132   -2.097  1.00 0.00 ? 74  VAL A CB   4  
ATOM 6498  C CG1  . VAL A 1 74  ? 11.245  8.302   -2.257  1.00 0.00 ? 74  VAL A CG1  4  
ATOM 6499  C CG2  . VAL A 1 74  ? 9.253   8.812   -0.827  1.00 0.00 ? 74  VAL A CG2  4  
ATOM 6500  H H    . VAL A 1 74  ? 7.951   10.446  -2.784  1.00 0.00 ? 74  VAL A H    4  
ATOM 6501  H HA   . VAL A 1 74  ? 9.617   8.522   -4.198  1.00 0.00 ? 74  VAL A HA   4  
ATOM 6502  H HB   . VAL A 1 74  ? 9.527   7.077   -2.021  1.00 0.00 ? 74  VAL A HB   4  
ATOM 6503  H HG11 . VAL A 1 74  ? 11.737  8.043   -1.330  1.00 0.00 ? 74  VAL A HG11 4  
ATOM 6504  H HG12 . VAL A 1 74  ? 11.599  7.654   -3.046  1.00 0.00 ? 74  VAL A HG12 4  
ATOM 6505  H HG13 . VAL A 1 74  ? 11.467  9.329   -2.506  1.00 0.00 ? 74  VAL A HG13 4  
ATOM 6506  H HG21 . VAL A 1 74  ? 9.990   9.528   -0.495  1.00 0.00 ? 74  VAL A HG21 4  
ATOM 6507  H HG22 . VAL A 1 74  ? 8.321   9.321   -1.026  1.00 0.00 ? 74  VAL A HG22 4  
ATOM 6508  H HG23 . VAL A 1 74  ? 9.100   8.070   -0.057  1.00 0.00 ? 74  VAL A HG23 4  
ATOM 6509  N N    . ILE A 1 75  ? 7.781   6.646   -3.780  1.00 0.00 ? 75  ILE A N    4  
ATOM 6510  C CA   . ILE A 1 75  ? 6.598   5.816   -3.966  1.00 0.00 ? 75  ILE A CA   4  
ATOM 6511  C C    . ILE A 1 75  ? 6.872   4.370   -3.565  1.00 0.00 ? 75  ILE A C    4  
ATOM 6512  O O    . ILE A 1 75  ? 7.727   3.704   -4.149  1.00 0.00 ? 75  ILE A O    4  
ATOM 6513  C CB   . ILE A 1 75  ? 6.111   5.848   -5.427  1.00 0.00 ? 75  ILE A CB   4  
ATOM 6514  C CG1  . ILE A 1 75  ? 5.735   7.275   -5.831  1.00 0.00 ? 75  ILE A CG1  4  
ATOM 6515  C CG2  . ILE A 1 75  ? 4.928   4.909   -5.612  1.00 0.00 ? 75  ILE A CG2  4  
ATOM 6516  C CD1  . ILE A 1 75  ? 4.886   7.345   -7.081  1.00 0.00 ? 75  ILE A CD1  4  
ATOM 6517  H H    . ILE A 1 75  ? 8.668   6.240   -3.865  1.00 0.00 ? 75  ILE A H    4  
ATOM 6518  H HA   . ILE A 1 75  ? 5.812   6.210   -3.337  1.00 0.00 ? 75  ILE A HA   4  
ATOM 6519  H HB   . ILE A 1 75  ? 6.916   5.503   -6.058  1.00 0.00 ? 75  ILE A HB   4  
ATOM 6520  H HG12 . ILE A 1 75  ? 5.181   7.735   -5.028  1.00 0.00 ? 75  ILE A HG12 4  
ATOM 6521  H HG13 . ILE A 1 75  ? 6.638   7.840   -6.010  1.00 0.00 ? 75  ILE A HG13 4  
ATOM 6522  H HG21 . ILE A 1 75  ? 4.054   5.335   -5.141  1.00 0.00 ? 75  ILE A HG21 4  
ATOM 6523  H HG22 . ILE A 1 75  ? 4.738   4.774   -6.666  1.00 0.00 ? 75  ILE A HG22 4  
ATOM 6524  H HG23 . ILE A 1 75  ? 5.151   3.955   -5.160  1.00 0.00 ? 75  ILE A HG23 4  
ATOM 6525  H HD11 . ILE A 1 75  ? 4.000   6.742   -6.949  1.00 0.00 ? 75  ILE A HD11 4  
ATOM 6526  H HD12 . ILE A 1 75  ? 4.601   8.369   -7.266  1.00 0.00 ? 75  ILE A HD12 4  
ATOM 6527  H HD13 . ILE A 1 75  ? 5.452   6.971   -7.922  1.00 0.00 ? 75  ILE A HD13 4  
ATOM 6528  N N    . SER A 1 76  ? 6.139   3.890   -2.565  1.00 0.00 ? 76  SER A N    4  
ATOM 6529  C CA   . SER A 1 76  ? 6.304   2.524   -2.084  1.00 0.00 ? 76  SER A CA   4  
ATOM 6530  C C    . SER A 1 76  ? 5.212   1.616   -2.640  1.00 0.00 ? 76  SER A C    4  
ATOM 6531  O O    . SER A 1 76  ? 4.133   1.494   -2.059  1.00 0.00 ? 76  SER A O    4  
ATOM 6532  C CB   . SER A 1 76  ? 6.279   2.493   -0.554  1.00 0.00 ? 76  SER A CB   4  
ATOM 6533  O OG   . SER A 1 76  ? 7.033   1.402   -0.054  1.00 0.00 ? 76  SER A OG   4  
ATOM 6534  H H    . SER A 1 76  ? 5.474   4.470   -2.139  1.00 0.00 ? 76  SER A H    4  
ATOM 6535  H HA   . SER A 1 76  ? 7.263   2.165   -2.427  1.00 0.00 ? 76  SER A HA   4  
ATOM 6536  H HB2  . SER A 1 76  ? 6.699   3.410   -0.171  1.00 0.00 ? 76  SER A HB2  4  
ATOM 6537  H HB3  . SER A 1 76  ? 5.258   2.394   -0.216  1.00 0.00 ? 76  SER A HB3  4  
ATOM 6538  H HG   . SER A 1 76  ? 6.887   1.318   0.891   1.00 0.00 ? 76  SER A HG   4  
ATOM 6539  N N    . THR A 1 77  ? 5.499   0.980   -3.772  1.00 0.00 ? 77  THR A N    4  
ATOM 6540  C CA   . THR A 1 77  ? 4.542   0.084   -4.409  1.00 0.00 ? 77  THR A CA   4  
ATOM 6541  C C    . THR A 1 77  ? 4.599   -1.310  -3.793  1.00 0.00 ? 77  THR A C    4  
ATOM 6542  O O    . THR A 1 77  ? 5.676   -1.885  -3.632  1.00 0.00 ? 77  THR A O    4  
ATOM 6543  C CB   . THR A 1 77  ? 4.799   -0.026  -5.924  1.00 0.00 ? 77  THR A CB   4  
ATOM 6544  O OG1  . THR A 1 77  ? 4.967   1.279   -6.488  1.00 0.00 ? 77  THR A OG1  4  
ATOM 6545  C CG2  . THR A 1 77  ? 3.648   -0.740  -6.617  1.00 0.00 ? 77  THR A CG2  4  
ATOM 6546  H H    . THR A 1 77  ? 6.376   1.117   -4.187  1.00 0.00 ? 77  THR A H    4  
ATOM 6547  H HA   . THR A 1 77  ? 3.553   0.492   -4.261  1.00 0.00 ? 77  THR A HA   4  
ATOM 6548  H HB   . THR A 1 77  ? 5.703   -0.597  -6.080  1.00 0.00 ? 77  THR A HB   4  
ATOM 6549  H HG1  . THR A 1 77  ? 5.072   1.205   -7.440  1.00 0.00 ? 77  THR A HG1  4  
ATOM 6550  H HG21 . THR A 1 77  ? 2.997   -0.011  -7.077  1.00 0.00 ? 77  THR A HG21 4  
ATOM 6551  H HG22 . THR A 1 77  ? 3.090   -1.313  -5.891  1.00 0.00 ? 77  THR A HG22 4  
ATOM 6552  H HG23 . THR A 1 77  ? 4.039   -1.401  -7.375  1.00 0.00 ? 77  THR A HG23 4  
ATOM 6553  N N    . LEU A 1 78  ? 3.434   -1.848  -3.450  1.00 0.00 ? 78  LEU A N    4  
ATOM 6554  C CA   . LEU A 1 78  ? 3.351   -3.176  -2.852  1.00 0.00 ? 78  LEU A CA   4  
ATOM 6555  C C    . LEU A 1 78  ? 2.599   -4.138  -3.765  1.00 0.00 ? 78  LEU A C    4  
ATOM 6556  O O    . LEU A 1 78  ? 1.403   -3.974  -4.009  1.00 0.00 ? 78  LEU A O    4  
ATOM 6557  C CB   . LEU A 1 78  ? 2.658   -3.101  -1.490  1.00 0.00 ? 78  LEU A CB   4  
ATOM 6558  C CG   . LEU A 1 78  ? 2.112   -4.419  -0.941  1.00 0.00 ? 78  LEU A CG   4  
ATOM 6559  C CD1  . LEU A 1 78  ? 3.245   -5.401  -0.687  1.00 0.00 ? 78  LEU A CD1  4  
ATOM 6560  C CD2  . LEU A 1 78  ? 1.318   -4.178  0.334   1.00 0.00 ? 78  LEU A CD2  4  
ATOM 6561  H H    . LEU A 1 78  ? 2.609   -1.341  -3.603  1.00 0.00 ? 78  LEU A H    4  
ATOM 6562  H HA   . LEU A 1 78  ? 4.358   -3.541  -2.715  1.00 0.00 ? 78  LEU A HA   4  
ATOM 6563  H HB2  . LEU A 1 78  ? 3.371   -2.716  -0.777  1.00 0.00 ? 78  LEU A HB2  4  
ATOM 6564  H HB3  . LEU A 1 78  ? 1.831   -2.410  -1.578  1.00 0.00 ? 78  LEU A HB3  4  
ATOM 6565  H HG   . LEU A 1 78  ? 1.448   -4.859  -1.672  1.00 0.00 ? 78  LEU A HG   4  
ATOM 6566  H HD11 . LEU A 1 78  ? 3.366   -6.042  -1.548  1.00 0.00 ? 78  LEU A HD11 4  
ATOM 6567  H HD12 . LEU A 1 78  ? 3.014   -6.002  0.179   1.00 0.00 ? 78  LEU A HD12 4  
ATOM 6568  H HD13 . LEU A 1 78  ? 4.162   -4.856  -0.512  1.00 0.00 ? 78  LEU A HD13 4  
ATOM 6569  H HD21 . LEU A 1 78  ? 0.428   -3.612  0.101   1.00 0.00 ? 78  LEU A HD21 4  
ATOM 6570  H HD22 . LEU A 1 78  ? 1.924   -3.623  1.036   1.00 0.00 ? 78  LEU A HD22 4  
ATOM 6571  H HD23 . LEU A 1 78  ? 1.039   -5.126  0.769   1.00 0.00 ? 78  LEU A HD23 4  
ATOM 6572  N N    . THR A 1 79  ? 3.307   -5.145  -4.267  1.00 0.00 ? 79  THR A N    4  
ATOM 6573  C CA   . THR A 1 79  ? 2.707   -6.135  -5.152  1.00 0.00 ? 79  THR A CA   4  
ATOM 6574  C C    . THR A 1 79  ? 2.300   -7.386  -4.383  1.00 0.00 ? 79  THR A C    4  
ATOM 6575  O O    . THR A 1 79  ? 3.105   -7.969  -3.656  1.00 0.00 ? 79  THR A O    4  
ATOM 6576  C CB   . THR A 1 79  ? 3.671   -6.534  -6.285  1.00 0.00 ? 79  THR A CB   4  
ATOM 6577  O OG1  . THR A 1 79  ? 4.333   -5.372  -6.797  1.00 0.00 ? 79  THR A OG1  4  
ATOM 6578  C CG2  . THR A 1 79  ? 2.925   -7.235  -7.410  1.00 0.00 ? 79  THR A CG2  4  
ATOM 6579  H H    . THR A 1 79  ? 4.256   -5.223  -4.036  1.00 0.00 ? 79  THR A H    4  
ATOM 6580  H HA   . THR A 1 79  ? 1.826   -5.695  -5.596  1.00 0.00 ? 79  THR A HA   4  
ATOM 6581  H HB   . THR A 1 79  ? 4.410   -7.213  -5.885  1.00 0.00 ? 79  THR A HB   4  
ATOM 6582  H HG1  . THR A 1 79  ? 4.379   -4.702  -6.111  1.00 0.00 ? 79  THR A HG1  4  
ATOM 6583  H HG21 . THR A 1 79  ? 3.597   -7.904  -7.926  1.00 0.00 ? 79  THR A HG21 4  
ATOM 6584  H HG22 . THR A 1 79  ? 2.545   -6.500  -8.103  1.00 0.00 ? 79  THR A HG22 4  
ATOM 6585  H HG23 . THR A 1 79  ? 2.102   -7.800  -6.998  1.00 0.00 ? 79  THR A HG23 4  
ATOM 6586  N N    . ILE A 1 80  ? 1.046   -7.795  -4.547  1.00 0.00 ? 80  ILE A N    4  
ATOM 6587  C CA   . ILE A 1 80  ? 0.534   -8.979  -3.868  1.00 0.00 ? 80  ILE A CA   4  
ATOM 6588  C C    . ILE A 1 80  ? 0.269   -10.108 -4.858  1.00 0.00 ? 80  ILE A C    4  
ATOM 6589  O O    . ILE A 1 80  ? -0.631  -10.017 -5.693  1.00 0.00 ? 80  ILE A O    4  
ATOM 6590  C CB   . ILE A 1 80  ? -0.764  -8.670  -3.100  1.00 0.00 ? 80  ILE A CB   4  
ATOM 6591  C CG1  . ILE A 1 80  ? -0.569  -7.451  -2.195  1.00 0.00 ? 80  ILE A CG1  4  
ATOM 6592  C CG2  . ILE A 1 80  ? -1.197  -9.878  -2.283  1.00 0.00 ? 80  ILE A CG2  4  
ATOM 6593  C CD1  . ILE A 1 80  ? -1.835  -6.651  -1.978  1.00 0.00 ? 80  ILE A CD1  4  
ATOM 6594  H H    . ILE A 1 80  ? 0.452   -7.289  -5.139  1.00 0.00 ? 80  ILE A H    4  
ATOM 6595  H HA   . ILE A 1 80  ? 1.280   -9.305  -3.158  1.00 0.00 ? 80  ILE A HA   4  
ATOM 6596  H HB   . ILE A 1 80  ? -1.540  -8.455  -3.819  1.00 0.00 ? 80  ILE A HB   4  
ATOM 6597  H HG12 . ILE A 1 80  ? -0.215  -7.779  -1.231  1.00 0.00 ? 80  ILE A HG12 4  
ATOM 6598  H HG13 . ILE A 1 80  ? 0.166   -6.796  -2.641  1.00 0.00 ? 80  ILE A HG13 4  
ATOM 6599  H HG21 . ILE A 1 80  ? -1.077  -9.663  -1.231  1.00 0.00 ? 80  ILE A HG21 4  
ATOM 6600  H HG22 . ILE A 1 80  ? -2.233  -10.099 -2.488  1.00 0.00 ? 80  ILE A HG22 4  
ATOM 6601  H HG23 . ILE A 1 80  ? -0.588  -10.729 -2.548  1.00 0.00 ? 80  ILE A HG23 4  
ATOM 6602  H HD11 . ILE A 1 80  ? -1.942  -5.924  -2.769  1.00 0.00 ? 80  ILE A HD11 4  
ATOM 6603  H HD12 . ILE A 1 80  ? -2.686  -7.315  -1.980  1.00 0.00 ? 80  ILE A HD12 4  
ATOM 6604  H HD13 . ILE A 1 80  ? -1.779  -6.141  -1.027  1.00 0.00 ? 80  ILE A HD13 4  
ATOM 6605  N N    . SER A 1 81  ? 1.057   -11.174 -4.757  1.00 0.00 ? 81  SER A N    4  
ATOM 6606  C CA   . SER A 1 81  ? 0.909   -12.321 -5.645  1.00 0.00 ? 81  SER A CA   4  
ATOM 6607  C C    . SER A 1 81  ? -0.365  -13.096 -5.323  1.00 0.00 ? 81  SER A C    4  
ATOM 6608  O O    . SER A 1 81  ? -0.753  -13.220 -4.162  1.00 0.00 ? 81  SER A O    4  
ATOM 6609  C CB   . SER A 1 81  ? 2.124   -13.244 -5.527  1.00 0.00 ? 81  SER A CB   4  
ATOM 6610  O OG   . SER A 1 81  ? 3.326   -12.538 -5.781  1.00 0.00 ? 81  SER A OG   4  
ATOM 6611  H H    . SER A 1 81  ? 1.757   -11.187 -4.071  1.00 0.00 ? 81  SER A H    4  
ATOM 6612  H HA   . SER A 1 81  ? 0.845   -11.951 -6.657  1.00 0.00 ? 81  SER A HA   4  
ATOM 6613  H HB2  . SER A 1 81  ? 2.165   -13.655 -4.530  1.00 0.00 ? 81  SER A HB2  4  
ATOM 6614  H HB3  . SER A 1 81  ? 2.033   -14.047 -6.244  1.00 0.00 ? 81  SER A HB3  4  
ATOM 6615  H HG   . SER A 1 81  ? 3.522   -11.961 -5.040  1.00 0.00 ? 81  SER A HG   4  
ATOM 6616  N N    . ASN A 1 82  ? -1.012  -13.616 -6.361  1.00 0.00 ? 82  ASN A N    4  
ATOM 6617  C CA   . ASN A 1 82  ? -2.244  -14.378 -6.190  1.00 0.00 ? 82  ASN A CA   4  
ATOM 6618  C C    . ASN A 1 82  ? -3.072  -13.822 -5.036  1.00 0.00 ? 82  ASN A C    4  
ATOM 6619  O O    . ASN A 1 82  ? -3.446  -14.554 -4.119  1.00 0.00 ? 82  ASN A O    4  
ATOM 6620  C CB   . ASN A 1 82  ? -1.924  -15.853 -5.940  1.00 0.00 ? 82  ASN A CB   4  
ATOM 6621  C CG   . ASN A 1 82  ? -1.823  -16.650 -7.226  1.00 0.00 ? 82  ASN A CG   4  
ATOM 6622  O OD1  . ASN A 1 82  ? -2.720  -17.422 -7.564  1.00 0.00 ? 82  ASN A OD1  4  
ATOM 6623  N ND2  . ASN A 1 82  ? -0.725  -16.465 -7.951  1.00 0.00 ? 82  ASN A ND2  4  
ATOM 6624  H H    . ASN A 1 82  ? -0.654  -13.483 -7.264  1.00 0.00 ? 82  ASN A H    4  
ATOM 6625  H HA   . ASN A 1 82  ? -2.815  -14.293 -7.102  1.00 0.00 ? 82  ASN A HA   4  
ATOM 6626  H HB2  . ASN A 1 82  ? -0.981  -15.927 -5.418  1.00 0.00 ? 82  ASN A HB2  4  
ATOM 6627  H HB3  . ASN A 1 82  ? -2.703  -16.286 -5.330  1.00 0.00 ? 82  ASN A HB3  4  
ATOM 6628  H HD21 . ASN A 1 82  ? -0.052  -15.834 -7.620  1.00 0.00 ? 82  ASN A HD21 4  
ATOM 6629  H HD22 . ASN A 1 82  ? -0.634  -16.967 -8.788  1.00 0.00 ? 82  ASN A HD22 4  
ATOM 6630  N N    . ILE A 1 83  ? -3.356  -12.526 -5.089  1.00 0.00 ? 83  ILE A N    4  
ATOM 6631  C CA   . ILE A 1 83  ? -4.141  -11.872 -4.050  1.00 0.00 ? 83  ILE A CA   4  
ATOM 6632  C C    . ILE A 1 83  ? -5.413  -12.658 -3.746  1.00 0.00 ? 83  ILE A C    4  
ATOM 6633  O O    . ILE A 1 83  ? -5.976  -13.311 -4.624  1.00 0.00 ? 83  ILE A O    4  
ATOM 6634  C CB   . ILE A 1 83  ? -4.522  -10.435 -4.451  1.00 0.00 ? 83  ILE A CB   4  
ATOM 6635  C CG1  . ILE A 1 83  ? -4.892  -9.618  -3.212  1.00 0.00 ? 83  ILE A CG1  4  
ATOM 6636  C CG2  . ILE A 1 83  ? -5.674  -10.451 -5.445  1.00 0.00 ? 83  ILE A CG2  4  
ATOM 6637  C CD1  . ILE A 1 83  ? -4.709  -8.127  -3.395  1.00 0.00 ? 83  ILE A CD1  4  
ATOM 6638  H H    . ILE A 1 83  ? -3.030  -11.996 -5.846  1.00 0.00 ? 83  ILE A H    4  
ATOM 6639  H HA   . ILE A 1 83  ? -3.537  -11.827 -3.155  1.00 0.00 ? 83  ILE A HA   4  
ATOM 6640  H HB   . ILE A 1 83  ? -3.670  -9.981  -4.932  1.00 0.00 ? 83  ILE A HB   4  
ATOM 6641  H HG12 . ILE A 1 83  ? -5.927  -9.796  -2.966  1.00 0.00 ? 83  ILE A HG12 4  
ATOM 6642  H HG13 . ILE A 1 83  ? -4.271  -9.930  -2.385  1.00 0.00 ? 83  ILE A HG13 4  
ATOM 6643  H HG21 . ILE A 1 83  ? -5.474  -9.745  -6.238  1.00 0.00 ? 83  ILE A HG21 4  
ATOM 6644  H HG22 . ILE A 1 83  ? -5.775  -11.441 -5.863  1.00 0.00 ? 83  ILE A HG22 4  
ATOM 6645  H HG23 . ILE A 1 83  ? -6.589  -10.177 -4.942  1.00 0.00 ? 83  ILE A HG23 4  
ATOM 6646  H HD11 . ILE A 1 83  ? -5.429  -7.761  -4.111  1.00 0.00 ? 83  ILE A HD11 4  
ATOM 6647  H HD12 . ILE A 1 83  ? -4.854  -7.627  -2.449  1.00 0.00 ? 83  ILE A HD12 4  
ATOM 6648  H HD13 . ILE A 1 83  ? -3.710  -7.929  -3.756  1.00 0.00 ? 83  ILE A HD13 4  
ATOM 6649  N N    . VAL A 1 84  ? -5.861  -12.588 -2.497  1.00 0.00 ? 84  VAL A N    4  
ATOM 6650  C CA   . VAL A 1 84  ? -7.068  -13.289 -2.077  1.00 0.00 ? 84  VAL A CA   4  
ATOM 6651  C C    . VAL A 1 84  ? -8.096  -12.321 -1.502  1.00 0.00 ? 84  VAL A C    4  
ATOM 6652  O O    . VAL A 1 84  ? -7.740  -11.295 -0.922  1.00 0.00 ? 84  VAL A O    4  
ATOM 6653  C CB   . VAL A 1 84  ? -6.753  -14.370 -1.026  1.00 0.00 ? 84  VAL A CB   4  
ATOM 6654  C CG1  . VAL A 1 84  ? -5.835  -15.432 -1.610  1.00 0.00 ? 84  VAL A CG1  4  
ATOM 6655  C CG2  . VAL A 1 84  ? -6.133  -13.741 0.213   1.00 0.00 ? 84  VAL A CG2  4  
ATOM 6656  H H    . VAL A 1 84  ? -5.369  -12.050 -1.842  1.00 0.00 ? 84  VAL A H    4  
ATOM 6657  H HA   . VAL A 1 84  ? -7.491  -13.774 -2.945  1.00 0.00 ? 84  VAL A HA   4  
ATOM 6658  H HB   . VAL A 1 84  ? -7.679  -14.844 -0.738  1.00 0.00 ? 84  VAL A HB   4  
ATOM 6659  H HG11 . VAL A 1 84  ? -6.381  -16.358 -1.720  1.00 0.00 ? 84  VAL A HG11 4  
ATOM 6660  H HG12 . VAL A 1 84  ? -5.477  -15.107 -2.576  1.00 0.00 ? 84  VAL A HG12 4  
ATOM 6661  H HG13 . VAL A 1 84  ? -4.996  -15.587 -0.948  1.00 0.00 ? 84  VAL A HG13 4  
ATOM 6662  H HG21 . VAL A 1 84  ? -6.288  -12.673 0.190   1.00 0.00 ? 84  VAL A HG21 4  
ATOM 6663  H HG22 . VAL A 1 84  ? -6.598  -14.153 1.098   1.00 0.00 ? 84  VAL A HG22 4  
ATOM 6664  H HG23 . VAL A 1 84  ? -5.074  -13.951 0.233   1.00 0.00 ? 84  VAL A HG23 4  
ATOM 6665  N N    . ARG A 1 85  ? -9.372  -12.653 -1.668  1.00 0.00 ? 85  ARG A N    4  
ATOM 6666  C CA   . ARG A 1 85  ? -10.452 -11.812 -1.166  1.00 0.00 ? 85  ARG A CA   4  
ATOM 6667  C C    . ARG A 1 85  ? -10.084 -11.203 0.184   1.00 0.00 ? 85  ARG A C    4  
ATOM 6668  O O    . ARG A 1 85  ? -10.372 -10.037 0.449   1.00 0.00 ? 85  ARG A O    4  
ATOM 6669  C CB   . ARG A 1 85  ? -11.741 -12.624 -1.037  1.00 0.00 ? 85  ARG A CB   4  
ATOM 6670  C CG   . ARG A 1 85  ? -12.603 -12.602 -2.289  1.00 0.00 ? 85  ARG A CG   4  
ATOM 6671  C CD   . ARG A 1 85  ? -13.437 -13.867 -2.414  1.00 0.00 ? 85  ARG A CD   4  
ATOM 6672  N NE   . ARG A 1 85  ? -14.447 -13.756 -3.462  1.00 0.00 ? 85  ARG A NE   4  
ATOM 6673  C CZ   . ARG A 1 85  ? -15.185 -14.777 -3.884  1.00 0.00 ? 85  ARG A CZ   4  
ATOM 6674  N NH1  . ARG A 1 85  ? -15.025 -15.980 -3.349  1.00 0.00 ? 85  ARG A NH1  4  
ATOM 6675  N NH2  . ARG A 1 85  ? -16.084 -14.596 -4.843  1.00 0.00 ? 85  ARG A NH2  4  
ATOM 6676  H H    . ARG A 1 85  ? -9.592  -13.484 -2.139  1.00 0.00 ? 85  ARG A H    4  
ATOM 6677  H HA   . ARG A 1 85  ? -10.608 -11.014 -1.876  1.00 0.00 ? 85  ARG A HA   4  
ATOM 6678  H HB2  . ARG A 1 85  ? -11.487 -13.651 -0.820  1.00 0.00 ? 85  ARG A HB2  4  
ATOM 6679  H HB3  . ARG A 1 85  ? -12.323 -12.226 -0.219  1.00 0.00 ? 85  ARG A HB3  4  
ATOM 6680  H HG2  . ARG A 1 85  ? -13.266 -11.751 -2.243  1.00 0.00 ? 85  ARG A HG2  4  
ATOM 6681  H HG3  . ARG A 1 85  ? -11.962 -12.516 -3.154  1.00 0.00 ? 85  ARG A HG3  4  
ATOM 6682  H HD2  . ARG A 1 85  ? -12.781 -14.693 -2.646  1.00 0.00 ? 85  ARG A HD2  4  
ATOM 6683  H HD3  . ARG A 1 85  ? -13.929 -14.053 -1.471  1.00 0.00 ? 85  ARG A HD3  4  
ATOM 6684  H HE   . ARG A 1 85  ? -14.581 -12.876 -3.872  1.00 0.00 ? 85  ARG A HE   4  
ATOM 6685  H HH11 . ARG A 1 85  ? -14.349 -16.118 -2.626  1.00 0.00 ? 85  ARG A HH11 4  
ATOM 6686  H HH12 . ARG A 1 85  ? -15.583 -16.747 -3.668  1.00 0.00 ? 85  ARG A HH12 4  
ATOM 6687  H HH21 . ARG A 1 85  ? -16.207 -13.691 -5.248  1.00 0.00 ? 85  ARG A HH21 4  
ATOM 6688  H HH22 . ARG A 1 85  ? -16.638 -15.365 -5.160  1.00 0.00 ? 85  ARG A HH22 4  
ATOM 6689  N N    . ALA A 1 86  ? -9.447  -12.003 1.034   1.00 0.00 ? 86  ALA A N    4  
ATOM 6690  C CA   . ALA A 1 86  ? -9.039  -11.543 2.356   1.00 0.00 ? 86  ALA A CA   4  
ATOM 6691  C C    . ALA A 1 86  ? -8.301  -10.211 2.270   1.00 0.00 ? 86  ALA A C    4  
ATOM 6692  O O    . ALA A 1 86  ? -8.572  -9.290  3.040   1.00 0.00 ? 86  ALA A O    4  
ATOM 6693  C CB   . ALA A 1 86  ? -8.166  -12.589 3.032   1.00 0.00 ? 86  ALA A CB   4  
ATOM 6694  H H    . ALA A 1 86  ? -9.245  -12.923 0.765   1.00 0.00 ? 86  ALA A H    4  
ATOM 6695  H HA   . ALA A 1 86  ? -9.929  -11.411 2.953   1.00 0.00 ? 86  ALA A HA   4  
ATOM 6696  H HB1  . ALA A 1 86  ? -8.602  -13.567 2.889   1.00 0.00 ? 86  ALA A HB1  4  
ATOM 6697  H HB2  . ALA A 1 86  ? -7.177  -12.568 2.599   1.00 0.00 ? 86  ALA A HB2  4  
ATOM 6698  H HB3  . ALA A 1 86  ? -8.101  -12.374 4.088   1.00 0.00 ? 86  ALA A HB3  4  
ATOM 6699  N N    . ASP A 1 87  ? -7.368  -10.116 1.328   1.00 0.00 ? 87  ASP A N    4  
ATOM 6700  C CA   . ASP A 1 87  ? -6.592  -8.896  1.142   1.00 0.00 ? 87  ASP A CA   4  
ATOM 6701  C C    . ASP A 1 87  ? -7.492  -7.665  1.195   1.00 0.00 ? 87  ASP A C    4  
ATOM 6702  O O    . ASP A 1 87  ? -7.070  -6.593  1.629   1.00 0.00 ? 87  ASP A O    4  
ATOM 6703  C CB   . ASP A 1 87  ? -5.845  -8.941  -0.192  1.00 0.00 ? 87  ASP A CB   4  
ATOM 6704  C CG   . ASP A 1 87  ? -4.465  -9.554  -0.063  1.00 0.00 ? 87  ASP A CG   4  
ATOM 6705  O OD1  . ASP A 1 87  ? -4.352  -10.637 0.548   1.00 0.00 ? 87  ASP A OD1  4  
ATOM 6706  O OD2  . ASP A 1 87  ? -3.497  -8.951  -0.573  1.00 0.00 ? 87  ASP A OD2  4  
ATOM 6707  H H    . ASP A 1 87  ? -7.199  -10.885 0.745   1.00 0.00 ? 87  ASP A H    4  
ATOM 6708  H HA   . ASP A 1 87  ? -5.872  -8.835  1.944   1.00 0.00 ? 87  ASP A HA   4  
ATOM 6709  H HB2  . ASP A 1 87  ? -6.415  -9.528  -0.897  1.00 0.00 ? 87  ASP A HB2  4  
ATOM 6710  H HB3  . ASP A 1 87  ? -5.739  -7.935  -0.572  1.00 0.00 ? 87  ASP A HB3  4  
ATOM 6711  N N    . PHE A 1 88  ? -8.733  -7.827  0.748   1.00 0.00 ? 88  PHE A N    4  
ATOM 6712  C CA   . PHE A 1 88  ? -9.692  -6.728  0.742   1.00 0.00 ? 88  PHE A CA   4  
ATOM 6713  C C    . PHE A 1 88  ? -10.171 -6.417  2.157   1.00 0.00 ? 88  PHE A C    4  
ATOM 6714  O O    . PHE A 1 88  ? -10.269 -5.254  2.548   1.00 0.00 ? 88  PHE A O    4  
ATOM 6715  C CB   . PHE A 1 88  ? -10.887 -7.072  -0.149  1.00 0.00 ? 88  PHE A CB   4  
ATOM 6716  C CG   . PHE A 1 88  ? -10.496 -7.578  -1.508  1.00 0.00 ? 88  PHE A CG   4  
ATOM 6717  C CD1  . PHE A 1 88  ? -9.286  -7.213  -2.076  1.00 0.00 ? 88  PHE A CD1  4  
ATOM 6718  C CD2  . PHE A 1 88  ? -11.338 -8.419  -2.218  1.00 0.00 ? 88  PHE A CD2  4  
ATOM 6719  C CE1  . PHE A 1 88  ? -8.923  -7.677  -3.326  1.00 0.00 ? 88  PHE A CE1  4  
ATOM 6720  C CE2  . PHE A 1 88  ? -10.980 -8.887  -3.468  1.00 0.00 ? 88  PHE A CE2  4  
ATOM 6721  C CZ   . PHE A 1 88  ? -9.771  -8.514  -4.023  1.00 0.00 ? 88  PHE A CZ   4  
ATOM 6722  H H    . PHE A 1 88  ? -9.010  -8.706  0.413   1.00 0.00 ? 88  PHE A H    4  
ATOM 6723  H HA   . PHE A 1 88  ? -9.195  -5.858  0.343   1.00 0.00 ? 88  PHE A HA   4  
ATOM 6724  H HB2  . PHE A 1 88  ? -11.478 -7.837  0.332   1.00 0.00 ? 88  PHE A HB2  4  
ATOM 6725  H HB3  . PHE A 1 88  ? -11.492 -6.188  -0.284  1.00 0.00 ? 88  PHE A HB3  4  
ATOM 6726  H HD1  . PHE A 1 88  ? -8.621  -6.557  -1.532  1.00 0.00 ? 88  PHE A HD1  4  
ATOM 6727  H HD2  . PHE A 1 88  ? -12.284 -8.710  -1.785  1.00 0.00 ? 88  PHE A HD2  4  
ATOM 6728  H HE1  . PHE A 1 88  ? -7.977  -7.383  -3.758  1.00 0.00 ? 88  PHE A HE1  4  
ATOM 6729  H HE2  . PHE A 1 88  ? -11.645 -9.541  -4.011  1.00 0.00 ? 88  PHE A HE2  4  
ATOM 6730  H HZ   . PHE A 1 88  ? -9.489  -8.879  -5.000  1.00 0.00 ? 88  PHE A HZ   4  
ATOM 6731  N N    . GLN A 1 89  ? -10.469 -7.465  2.918   1.00 0.00 ? 89  GLN A N    4  
ATOM 6732  C CA   . GLN A 1 89  ? -10.939 -7.304  4.289   1.00 0.00 ? 89  GLN A CA   4  
ATOM 6733  C C    . GLN A 1 89  ? -9.830  -6.763  5.185   1.00 0.00 ? 89  GLN A C    4  
ATOM 6734  O O    . GLN A 1 89  ? -10.091 -6.044  6.150   1.00 0.00 ? 89  GLN A O    4  
ATOM 6735  C CB   . GLN A 1 89  ? -11.447 -8.639  4.837   1.00 0.00 ? 89  GLN A CB   4  
ATOM 6736  C CG   . GLN A 1 89  ? -12.502 -9.294  3.960   1.00 0.00 ? 89  GLN A CG   4  
ATOM 6737  C CD   . GLN A 1 89  ? -13.843 -8.591  4.037   1.00 0.00 ? 89  GLN A CD   4  
ATOM 6738  O OE1  . GLN A 1 89  ? -14.157 -7.935  5.031   1.00 0.00 ? 89  GLN A OE1  4  
ATOM 6739  N NE2  . GLN A 1 89  ? -14.643 -8.724  2.985   1.00 0.00 ? 89  GLN A NE2  4  
ATOM 6740  H H    . GLN A 1 89  ? -10.370 -8.367  2.550   1.00 0.00 ? 89  GLN A H    4  
ATOM 6741  H HA   . GLN A 1 89  ? -11.754 -6.596  4.279   1.00 0.00 ? 89  GLN A HA   4  
ATOM 6742  H HB2  . GLN A 1 89  ? -10.613 -9.318  4.927   1.00 0.00 ? 89  GLN A HB2  4  
ATOM 6743  H HB3  . GLN A 1 89  ? -11.875 -8.474  5.814   1.00 0.00 ? 89  GLN A HB3  4  
ATOM 6744  H HG2  . GLN A 1 89  ? -12.163 -9.276  2.935   1.00 0.00 ? 89  GLN A HG2  4  
ATOM 6745  H HG3  . GLN A 1 89  ? -12.630 -10.318 4.278   1.00 0.00 ? 89  GLN A HG3  4  
ATOM 6746  H HE21 . GLN A 1 89  ? -14.327 -9.263  2.229   1.00 0.00 ? 89  GLN A HE21 4  
ATOM 6747  H HE22 . GLN A 1 89  ? -15.516 -8.282  3.009   1.00 0.00 ? 89  GLN A HE22 4  
ATOM 6748  N N    . THR A 1 90  ? -8.589  -7.112  4.860   1.00 0.00 ? 90  THR A N    4  
ATOM 6749  C CA   . THR A 1 90  ? -7.440  -6.663  5.635   1.00 0.00 ? 90  THR A CA   4  
ATOM 6750  C C    . THR A 1 90  ? -7.135  -5.194  5.365   1.00 0.00 ? 90  THR A C    4  
ATOM 6751  O O    . THR A 1 90  ? -7.239  -4.728  4.231   1.00 0.00 ? 90  THR A O    4  
ATOM 6752  C CB   . THR A 1 90  ? -6.187  -7.503  5.321   1.00 0.00 ? 90  THR A CB   4  
ATOM 6753  O OG1  . THR A 1 90  ? -6.414  -8.872  5.673   1.00 0.00 ? 90  THR A OG1  4  
ATOM 6754  C CG2  . THR A 1 90  ? -4.977  -6.973  6.076   1.00 0.00 ? 90  THR A CG2  4  
ATOM 6755  H H    . THR A 1 90  ? -8.445  -7.687  4.079   1.00 0.00 ? 90  THR A H    4  
ATOM 6756  H HA   . THR A 1 90  ? -7.676  -6.785  6.682   1.00 0.00 ? 90  THR A HA   4  
ATOM 6757  H HB   . THR A 1 90  ? -5.987  -7.440  4.261   1.00 0.00 ? 90  THR A HB   4  
ATOM 6758  H HG1  . THR A 1 90  ? -6.614  -8.932  6.611   1.00 0.00 ? 90  THR A HG1  4  
ATOM 6759  H HG21 . THR A 1 90  ? -5.097  -7.169  7.131   1.00 0.00 ? 90  THR A HG21 4  
ATOM 6760  H HG22 . THR A 1 90  ? -4.891  -5.908  5.915   1.00 0.00 ? 90  THR A HG22 4  
ATOM 6761  H HG23 . THR A 1 90  ? -4.086  -7.465  5.717   1.00 0.00 ? 90  THR A HG23 4  
ATOM 6762  N N    . ILE A 1 91  ? -6.756  -4.471  6.414   1.00 0.00 ? 91  ILE A N    4  
ATOM 6763  C CA   . ILE A 1 91  ? -6.434  -3.055  6.288   1.00 0.00 ? 91  ILE A CA   4  
ATOM 6764  C C    . ILE A 1 91  ? -4.930  -2.844  6.150   1.00 0.00 ? 91  ILE A C    4  
ATOM 6765  O O    . ILE A 1 91  ? -4.151  -3.280  6.997   1.00 0.00 ? 91  ILE A O    4  
ATOM 6766  C CB   . ILE A 1 91  ? -6.945  -2.252  7.499   1.00 0.00 ? 91  ILE A CB   4  
ATOM 6767  C CG1  . ILE A 1 91  ? -8.451  -2.457  7.676   1.00 0.00 ? 91  ILE A CG1  4  
ATOM 6768  C CG2  . ILE A 1 91  ? -6.622  -0.775  7.329   1.00 0.00 ? 91  ILE A CG2  4  
ATOM 6769  C CD1  . ILE A 1 91  ? -8.800  -3.625  8.572   1.00 0.00 ? 91  ILE A CD1  4  
ATOM 6770  H H    . ILE A 1 91  ? -6.692  -4.900  7.292   1.00 0.00 ? 91  ILE A H    4  
ATOM 6771  H HA   . ILE A 1 91  ? -6.923  -2.680  5.400   1.00 0.00 ? 91  ILE A HA   4  
ATOM 6772  H HB   . ILE A 1 91  ? -6.434  -2.608  8.380   1.00 0.00 ? 91  ILE A HB   4  
ATOM 6773  H HG12 . ILE A 1 91  ? -8.880  -1.568  8.110   1.00 0.00 ? 91  ILE A HG12 4  
ATOM 6774  H HG13 . ILE A 1 91  ? -8.898  -2.634  6.709   1.00 0.00 ? 91  ILE A HG13 4  
ATOM 6775  H HG21 . ILE A 1 91  ? -5.647  -0.669  6.876   1.00 0.00 ? 91  ILE A HG21 4  
ATOM 6776  H HG22 . ILE A 1 91  ? -7.365  -0.316  6.694   1.00 0.00 ? 91  ILE A HG22 4  
ATOM 6777  H HG23 . ILE A 1 91  ? -6.625  -0.292  8.294   1.00 0.00 ? 91  ILE A HG23 4  
ATOM 6778  H HD11 . ILE A 1 91  ? -9.856  -3.602  8.799   1.00 0.00 ? 91  ILE A HD11 4  
ATOM 6779  H HD12 . ILE A 1 91  ? -8.559  -4.550  8.069   1.00 0.00 ? 91  ILE A HD12 4  
ATOM 6780  H HD13 . ILE A 1 91  ? -8.234  -3.557  9.490   1.00 0.00 ? 91  ILE A HD13 4  
ATOM 6781  N N    . TYR A 1 92  ? -4.530  -2.170  5.077   1.00 0.00 ? 92  TYR A N    4  
ATOM 6782  C CA   . TYR A 1 92  ? -3.119  -1.901  4.827   1.00 0.00 ? 92  TYR A CA   4  
ATOM 6783  C C    . TYR A 1 92  ? -2.722  -0.529  5.364   1.00 0.00 ? 92  TYR A C    4  
ATOM 6784  O O    . TYR A 1 92  ? -3.536  0.393   5.404   1.00 0.00 ? 92  TYR A O    4  
ATOM 6785  C CB   . TYR A 1 92  ? -2.820  -1.980  3.329   1.00 0.00 ? 92  TYR A CB   4  
ATOM 6786  C CG   . TYR A 1 92  ? -2.999  -3.365  2.749   1.00 0.00 ? 92  TYR A CG   4  
ATOM 6787  C CD1  . TYR A 1 92  ? -2.121  -4.393  3.071   1.00 0.00 ? 92  TYR A CD1  4  
ATOM 6788  C CD2  . TYR A 1 92  ? -4.044  -3.645  1.877   1.00 0.00 ? 92  TYR A CD2  4  
ATOM 6789  C CE1  . TYR A 1 92  ? -2.279  -5.659  2.543   1.00 0.00 ? 92  TYR A CE1  4  
ATOM 6790  C CE2  . TYR A 1 92  ? -4.211  -4.909  1.346   1.00 0.00 ? 92  TYR A CE2  4  
ATOM 6791  C CZ   . TYR A 1 92  ? -3.326  -5.913  1.681   1.00 0.00 ? 92  TYR A CZ   4  
ATOM 6792  O OH   . TYR A 1 92  ? -3.488  -7.173  1.152   1.00 0.00 ? 92  TYR A OH   4  
ATOM 6793  H H    . TYR A 1 92  ? -5.198  -1.847  4.438   1.00 0.00 ? 92  TYR A H    4  
ATOM 6794  H HA   . TYR A 1 92  ? -2.541  -2.656  5.340   1.00 0.00 ? 92  TYR A HA   4  
ATOM 6795  H HB2  . TYR A 1 92  ? -3.483  -1.312  2.801   1.00 0.00 ? 92  TYR A HB2  4  
ATOM 6796  H HB3  . TYR A 1 92  ? -1.798  -1.676  3.156   1.00 0.00 ? 92  TYR A HB3  4  
ATOM 6797  H HD1  . TYR A 1 92  ? -1.302  -4.191  3.746   1.00 0.00 ? 92  TYR A HD1  4  
ATOM 6798  H HD2  . TYR A 1 92  ? -4.735  -2.857  1.617   1.00 0.00 ? 92  TYR A HD2  4  
ATOM 6799  H HE1  . TYR A 1 92  ? -1.587  -6.446  2.805   1.00 0.00 ? 92  TYR A HE1  4  
ATOM 6800  H HE2  . TYR A 1 92  ? -5.030  -5.108  0.670   1.00 0.00 ? 92  TYR A HE2  4  
ATOM 6801  H HH   . TYR A 1 92  ? -4.417  -7.415  1.182   1.00 0.00 ? 92  TYR A HH   4  
ATOM 6802  N N    . ASN A 1 93  ? -1.465  -0.402  5.776   1.00 0.00 ? 93  ASN A N    4  
ATOM 6803  C CA   . ASN A 1 93  ? -0.959  0.857   6.311   1.00 0.00 ? 93  ASN A CA   4  
ATOM 6804  C C    . ASN A 1 93  ? 0.528   1.018   6.007   1.00 0.00 ? 93  ASN A C    4  
ATOM 6805  O O    . ASN A 1 93  ? 1.346   0.188   6.403   1.00 0.00 ? 93  ASN A O    4  
ATOM 6806  C CB   . ASN A 1 93  ? -1.192  0.923   7.821   1.00 0.00 ? 93  ASN A CB   4  
ATOM 6807  C CG   . ASN A 1 93  ? -2.549  1.504   8.172   1.00 0.00 ? 93  ASN A CG   4  
ATOM 6808  O OD1  . ASN A 1 93  ? -2.771  2.708   8.049   1.00 0.00 ? 93  ASN A OD1  4  
ATOM 6809  N ND2  . ASN A 1 93  ? -3.463  0.647   8.611   1.00 0.00 ? 93  ASN A ND2  4  
ATOM 6810  H H    . ASN A 1 93  ? -0.863  -1.174  5.719   1.00 0.00 ? 93  ASN A H    4  
ATOM 6811  H HA   . ASN A 1 93  ? -1.501  1.660   5.836   1.00 0.00 ? 93  ASN A HA   4  
ATOM 6812  H HB2  . ASN A 1 93  ? -1.131  -0.073  8.233   1.00 0.00 ? 93  ASN A HB2  4  
ATOM 6813  H HB3  . ASN A 1 93  ? -0.429  1.541   8.271   1.00 0.00 ? 93  ASN A HB3  4  
ATOM 6814  H HD21 . ASN A 1 93  ? -3.215  -0.299  8.683   1.00 0.00 ? 93  ASN A HD21 4  
ATOM 6815  H HD22 . ASN A 1 93  ? -4.349  0.995   8.844   1.00 0.00 ? 93  ASN A HD22 4  
ATOM 6816  N N    . CYS A 1 94  ? 0.868   2.092   5.303   1.00 0.00 ? 94  CYS A N    4  
ATOM 6817  C CA   . CYS A 1 94  ? 2.256   2.363   4.945   1.00 0.00 ? 94  CYS A CA   4  
ATOM 6818  C C    . CYS A 1 94  ? 2.871   3.388   5.892   1.00 0.00 ? 94  CYS A C    4  
ATOM 6819  O O    . CYS A 1 94  ? 2.490   4.559   5.890   1.00 0.00 ? 94  CYS A O    4  
ATOM 6820  C CB   . CYS A 1 94  ? 2.345   2.865   3.503   1.00 0.00 ? 94  CYS A CB   4  
ATOM 6821  S SG   . CYS A 1 94  ? 4.034   3.117   2.912   1.00 0.00 ? 94  CYS A SG   4  
ATOM 6822  H H    . CYS A 1 94  ? 0.170   2.717   5.015   1.00 0.00 ? 94  CYS A H    4  
ATOM 6823  H HA   . CYS A 1 94  ? 2.806   1.438   5.030   1.00 0.00 ? 94  CYS A HA   4  
ATOM 6824  H HB2  . CYS A 1 94  ? 1.873   2.146   2.850   1.00 0.00 ? 94  CYS A HB2  4  
ATOM 6825  H HB3  . CYS A 1 94  ? 1.824   3.807   3.426   1.00 0.00 ? 94  CYS A HB3  4  
ATOM 6826  H HG   . CYS A 1 94  ? 4.848   3.038   3.954   1.00 0.00 ? 94  CYS A HG   4  
ATOM 6827  N N    . THR A 1 95  ? 3.825   2.940   6.703   1.00 0.00 ? 95  THR A N    4  
ATOM 6828  C CA   . THR A 1 95  ? 4.491   3.817   7.657   1.00 0.00 ? 95  THR A CA   4  
ATOM 6829  C C    . THR A 1 95  ? 5.951   4.038   7.276   1.00 0.00 ? 95  THR A C    4  
ATOM 6830  O O    . THR A 1 95  ? 6.645   3.104   6.874   1.00 0.00 ? 95  THR A O    4  
ATOM 6831  C CB   . THR A 1 95  ? 4.427   3.245   9.086   1.00 0.00 ? 95  THR A CB   4  
ATOM 6832  O OG1  . THR A 1 95  ? 3.093   2.815   9.381   1.00 0.00 ? 95  THR A OG1  4  
ATOM 6833  C CG2  . THR A 1 95  ? 4.868   4.285   10.105  1.00 0.00 ? 95  THR A CG2  4  
ATOM 6834  H H    . THR A 1 95  ? 4.086   1.997   6.657   1.00 0.00 ? 95  THR A H    4  
ATOM 6835  H HA   . THR A 1 95  ? 3.979   4.769   7.649   1.00 0.00 ? 95  THR A HA   4  
ATOM 6836  H HB   . THR A 1 95  ? 5.093   2.396   9.148   1.00 0.00 ? 95  THR A HB   4  
ATOM 6837  H HG1  . THR A 1 95  ? 2.603   3.541   9.775   1.00 0.00 ? 95  THR A HG1  4  
ATOM 6838  H HG21 . THR A 1 95  ? 5.908   4.130   10.350  1.00 0.00 ? 95  THR A HG21 4  
ATOM 6839  H HG22 . THR A 1 95  ? 4.270   4.188   10.999  1.00 0.00 ? 95  THR A HG22 4  
ATOM 6840  H HG23 . THR A 1 95  ? 4.739   5.273   9.690   1.00 0.00 ? 95  THR A HG23 4  
ATOM 6841  N N    . ALA A 1 96  ? 6.410   5.278   7.405   1.00 0.00 ? 96  ALA A N    4  
ATOM 6842  C CA   . ALA A 1 96  ? 7.789   5.620   7.076   1.00 0.00 ? 96  ALA A CA   4  
ATOM 6843  C C    . ALA A 1 96  ? 8.500   6.243   8.272   1.00 0.00 ? 96  ALA A C    4  
ATOM 6844  O O    . ALA A 1 96  ? 7.909   6.411   9.339   1.00 0.00 ? 96  ALA A O    4  
ATOM 6845  C CB   . ALA A 1 96  ? 7.828   6.566   5.885   1.00 0.00 ? 96  ALA A CB   4  
ATOM 6846  H H    . ALA A 1 96  ? 5.809   5.979   7.730   1.00 0.00 ? 96  ALA A H    4  
ATOM 6847  H HA   . ALA A 1 96  ? 8.301   4.710   6.799   1.00 0.00 ? 96  ALA A HA   4  
ATOM 6848  H HB1  . ALA A 1 96  ? 7.757   5.995   4.970   1.00 0.00 ? 96  ALA A HB1  4  
ATOM 6849  H HB2  . ALA A 1 96  ? 6.999   7.255   5.945   1.00 0.00 ? 96  ALA A HB2  4  
ATOM 6850  H HB3  . ALA A 1 96  ? 8.756   7.117   5.894   1.00 0.00 ? 96  ALA A HB3  4  
ATOM 6851  N N    . TRP A 1 97  ? 9.771   6.582   8.088   1.00 0.00 ? 97  TRP A N    4  
ATOM 6852  C CA   . TRP A 1 97  ? 10.563  7.186   9.153   1.00 0.00 ? 97  TRP A CA   4  
ATOM 6853  C C    . TRP A 1 97  ? 11.732  7.979   8.580   1.00 0.00 ? 97  TRP A C    4  
ATOM 6854  O O    . TRP A 1 97  ? 12.602  7.423   7.911   1.00 0.00 ? 97  TRP A O    4  
ATOM 6855  C CB   . TRP A 1 97  ? 11.081  6.107   10.106  1.00 0.00 ? 97  TRP A CB   4  
ATOM 6856  C CG   . TRP A 1 97  ? 10.015  5.534   10.990  1.00 0.00 ? 97  TRP A CG   4  
ATOM 6857  C CD1  . TRP A 1 97  ? 9.626   5.999   12.214  1.00 0.00 ? 97  TRP A CD1  4  
ATOM 6858  C CD2  . TRP A 1 97  ? 9.202   4.386   10.719  1.00 0.00 ? 97  TRP A CD2  4  
ATOM 6859  N NE1  . TRP A 1 97  ? 8.621   5.211   12.720  1.00 0.00 ? 97  TRP A NE1  4  
ATOM 6860  C CE2  . TRP A 1 97  ? 8.342   4.215   11.822  1.00 0.00 ? 97  TRP A CE2  4  
ATOM 6861  C CE3  . TRP A 1 97  ? 9.115   3.489   9.652   1.00 0.00 ? 97  TRP A CE3  4  
ATOM 6862  C CZ2  . TRP A 1 97  ? 7.411   3.182   11.885  1.00 0.00 ? 97  TRP A CZ2  4  
ATOM 6863  C CZ3  . TRP A 1 97  ? 8.190   2.464   9.716   1.00 0.00 ? 97  TRP A CZ3  4  
ATOM 6864  C CH2  . TRP A 1 97  ? 7.348   2.318   10.826  1.00 0.00 ? 97  TRP A CH2  4  
ATOM 6865  H H    . TRP A 1 97  ? 10.187  6.423   7.215   1.00 0.00 ? 97  TRP A H    4  
ATOM 6866  H HA   . TRP A 1 97  ? 9.921   7.859   9.702   1.00 0.00 ? 97  TRP A HA   4  
ATOM 6867  H HB2  . TRP A 1 97  ? 11.505  5.299   9.529   1.00 0.00 ? 97  TRP A HB2  4  
ATOM 6868  H HB3  . TRP A 1 97  ? 11.846  6.533   10.739  1.00 0.00 ? 97  TRP A HB3  4  
ATOM 6869  H HD1  . TRP A 1 97  ? 10.057  6.861   12.701  1.00 0.00 ? 97  TRP A HD1  4  
ATOM 6870  H HE1  . TRP A 1 97  ? 8.176   5.342   13.583  1.00 0.00 ? 97  TRP A HE1  4  
ATOM 6871  H HE3  . TRP A 1 97  ? 9.756   3.585   8.788   1.00 0.00 ? 97  TRP A HE3  4  
ATOM 6872  H HZ2  . TRP A 1 97  ? 6.753   3.057   12.733  1.00 0.00 ? 97  TRP A HZ2  4  
ATOM 6873  H HZ3  . TRP A 1 97  ? 8.109   1.760   8.901   1.00 0.00 ? 97  TRP A HZ3  4  
ATOM 6874  H HH2  . TRP A 1 97  ? 6.640   1.503   10.834  1.00 0.00 ? 97  TRP A HH2  4  
ATOM 6875  N N    . ASN A 1 98  ? 11.746  9.281   8.847   1.00 0.00 ? 98  ASN A N    4  
ATOM 6876  C CA   . ASN A 1 98  ? 12.809  10.150  8.357   1.00 0.00 ? 98  ASN A CA   4  
ATOM 6877  C C    . ASN A 1 98  ? 13.406  10.974  9.494   1.00 0.00 ? 98  ASN A C    4  
ATOM 6878  O O    . ASN A 1 98  ? 12.803  11.111  10.558  1.00 0.00 ? 98  ASN A O    4  
ATOM 6879  C CB   . ASN A 1 98  ? 12.274  11.079  7.265   1.00 0.00 ? 98  ASN A CB   4  
ATOM 6880  C CG   . ASN A 1 98  ? 13.342  11.466  6.260   1.00 0.00 ? 98  ASN A CG   4  
ATOM 6881  O OD1  . ASN A 1 98  ? 14.182  10.647  5.884   1.00 0.00 ? 98  ASN A OD1  4  
ATOM 6882  N ND2  . ASN A 1 98  ? 13.316  12.718  5.821   1.00 0.00 ? 98  ASN A ND2  4  
ATOM 6883  H H    . ASN A 1 98  ? 11.024  9.666   9.386   1.00 0.00 ? 98  ASN A H    4  
ATOM 6884  H HA   . ASN A 1 98  ? 13.582  9.524   7.937   1.00 0.00 ? 98  ASN A HA   4  
ATOM 6885  H HB2  . ASN A 1 98  ? 11.475  10.580  6.737   1.00 0.00 ? 98  ASN A HB2  4  
ATOM 6886  H HB3  . ASN A 1 98  ? 11.892  11.979  7.722   1.00 0.00 ? 98  ASN A HB3  4  
ATOM 6887  H HD21 . ASN A 1 98  ? 12.618  13.315  6.165   1.00 0.00 ? 98  ASN A HD21 4  
ATOM 6888  H HD22 . ASN A 1 98  ? 13.994  12.995  5.170   1.00 0.00 ? 98  ASN A HD22 4  
ATOM 6889  N N    . SER A 1 99  ? 14.595  11.521  9.260   1.00 0.00 ? 99  SER A N    4  
ATOM 6890  C CA   . SER A 1 99  ? 15.275  12.329  10.265  1.00 0.00 ? 99  SER A CA   4  
ATOM 6891  C C    . SER A 1 99  ? 14.364  13.442  10.775  1.00 0.00 ? 99  SER A C    4  
ATOM 6892  O O    . SER A 1 99  ? 14.572  13.980  11.863  1.00 0.00 ? 99  SER A O    4  
ATOM 6893  C CB   . SER A 1 99  ? 16.557  12.930  9.685   1.00 0.00 ? 99  SER A CB   4  
ATOM 6894  O OG   . SER A 1 99  ? 17.431  13.359  10.714  1.00 0.00 ? 99  SER A OG   4  
ATOM 6895  H H    . SER A 1 99  ? 15.025  11.376  8.391   1.00 0.00 ? 99  SER A H    4  
ATOM 6896  H HA   . SER A 1 99  ? 15.532  11.683  11.091  1.00 0.00 ? 99  SER A HA   4  
ATOM 6897  H HB2  . SER A 1 99  ? 17.062  12.186  9.087   1.00 0.00 ? 99  SER A HB2  4  
ATOM 6898  H HB3  . SER A 1 99  ? 16.305  13.779  9.065   1.00 0.00 ? 99  SER A HB3  4  
ATOM 6899  H HG   . SER A 1 99  ? 16.922  13.558  11.504  1.00 0.00 ? 99  SER A HG   4  
ATOM 6900  N N    . PHE A 1 100 ? 13.354  13.781  9.982   1.00 0.00 ? 100 PHE A N    4  
ATOM 6901  C CA   . PHE A 1 100 ? 12.411  14.830  10.351  1.00 0.00 ? 100 PHE A CA   4  
ATOM 6902  C C    . PHE A 1 100 ? 11.318  14.282  11.264  1.00 0.00 ? 100 PHE A C    4  
ATOM 6903  O O    . PHE A 1 100 ? 11.112  14.779  12.371  1.00 0.00 ? 100 PHE A O    4  
ATOM 6904  C CB   . PHE A 1 100 ? 11.783  15.445  9.099   1.00 0.00 ? 100 PHE A CB   4  
ATOM 6905  C CG   . PHE A 1 100 ? 12.623  16.523  8.475   1.00 0.00 ? 100 PHE A CG   4  
ATOM 6906  C CD1  . PHE A 1 100 ? 12.843  17.719  9.138   1.00 0.00 ? 100 PHE A CD1  4  
ATOM 6907  C CD2  . PHE A 1 100 ? 13.191  16.340  7.224   1.00 0.00 ? 100 PHE A CD2  4  
ATOM 6908  C CE1  . PHE A 1 100 ? 13.616  18.713  8.567   1.00 0.00 ? 100 PHE A CE1  4  
ATOM 6909  C CE2  . PHE A 1 100 ? 13.965  17.330  6.648   1.00 0.00 ? 100 PHE A CE2  4  
ATOM 6910  C CZ   . PHE A 1 100 ? 14.176  18.519  7.320   1.00 0.00 ? 100 PHE A CZ   4  
ATOM 6911  H H    . PHE A 1 100 ? 13.240  13.316  9.126   1.00 0.00 ? 100 PHE A H    4  
ATOM 6912  H HA   . PHE A 1 100 ? 12.957  15.594  10.882  1.00 0.00 ? 100 PHE A HA   4  
ATOM 6913  H HB2  . PHE A 1 100 ? 11.636  14.671  8.361   1.00 0.00 ? 100 PHE A HB2  4  
ATOM 6914  H HB3  . PHE A 1 100 ? 10.827  15.876  9.358   1.00 0.00 ? 100 PHE A HB3  4  
ATOM 6915  H HD1  . PHE A 1 100 ? 12.404  17.873  10.114  1.00 0.00 ? 100 PHE A HD1  4  
ATOM 6916  H HD2  . PHE A 1 100 ? 13.026  15.412  6.697   1.00 0.00 ? 100 PHE A HD2  4  
ATOM 6917  H HE1  . PHE A 1 100 ? 13.779  19.641  9.095   1.00 0.00 ? 100 PHE A HE1  4  
ATOM 6918  H HE2  . PHE A 1 100 ? 14.402  17.176  5.673   1.00 0.00 ? 100 PHE A HE2  4  
ATOM 6919  H HZ   . PHE A 1 100 ? 14.781  19.293  6.872   1.00 0.00 ? 100 PHE A HZ   4  
ATOM 6920  N N    . GLY A 1 101 ? 10.620  13.254  10.791  1.00 0.00 ? 101 GLY A N    4  
ATOM 6921  C CA   . GLY A 1 101 ? 9.556   12.656  11.577  1.00 0.00 ? 101 GLY A CA   4  
ATOM 6922  C C    . GLY A 1 101 ? 9.034   11.372  10.963  1.00 0.00 ? 101 GLY A C    4  
ATOM 6923  O O    . GLY A 1 101 ? 9.807   10.558  10.459  1.00 0.00 ? 101 GLY A O    4  
ATOM 6924  H H    . GLY A 1 101 ? 10.828  12.900  9.902   1.00 0.00 ? 101 GLY A H    4  
ATOM 6925  H HA2  . GLY A 1 101 ? 9.931   12.443  12.567  1.00 0.00 ? 101 GLY A HA2  4  
ATOM 6926  H HA3  . GLY A 1 101 ? 8.742   13.361  11.655  1.00 0.00 ? 101 GLY A HA3  4  
ATOM 6927  N N    . SER A 1 102 ? 7.718   11.190  11.006  1.00 0.00 ? 102 SER A N    4  
ATOM 6928  C CA   . SER A 1 102 ? 7.094   9.993   10.454  1.00 0.00 ? 102 SER A CA   4  
ATOM 6929  C C    . SER A 1 102 ? 5.651   10.273  10.044  1.00 0.00 ? 102 SER A C    4  
ATOM 6930  O O    . SER A 1 102 ? 5.122   11.356  10.294  1.00 0.00 ? 102 SER A O    4  
ATOM 6931  C CB   . SER A 1 102 ? 7.134   8.855   11.474  1.00 0.00 ? 102 SER A CB   4  
ATOM 6932  O OG   . SER A 1 102 ? 6.499   9.231   12.684  1.00 0.00 ? 102 SER A OG   4  
ATOM 6933  H H    . SER A 1 102 ? 7.154   11.876  11.421  1.00 0.00 ? 102 SER A H    4  
ATOM 6934  H HA   . SER A 1 102 ? 7.654   9.701   9.578   1.00 0.00 ? 102 SER A HA   4  
ATOM 6935  H HB2  . SER A 1 102 ? 6.627   7.993   11.069  1.00 0.00 ? 102 SER A HB2  4  
ATOM 6936  H HB3  . SER A 1 102 ? 8.163   8.600   11.685  1.00 0.00 ? 102 SER A HB3  4  
ATOM 6937  H HG   . SER A 1 102 ? 6.535   10.185  12.781  1.00 0.00 ? 102 SER A HG   4  
ATOM 6938  N N    . ASP A 1 103 ? 5.021   9.289   9.413   1.00 0.00 ? 103 ASP A N    4  
ATOM 6939  C CA   . ASP A 1 103 ? 3.638   9.427   8.969   1.00 0.00 ? 103 ASP A CA   4  
ATOM 6940  C C    . ASP A 1 103 ? 3.073   8.082   8.525   1.00 0.00 ? 103 ASP A C    4  
ATOM 6941  O O    . ASP A 1 103 ? 3.819   7.172   8.160   1.00 0.00 ? 103 ASP A O    4  
ATOM 6942  C CB   . ASP A 1 103 ? 3.547   10.436  7.822   1.00 0.00 ? 103 ASP A CB   4  
ATOM 6943  C CG   . ASP A 1 103 ? 3.318   11.851  8.314   1.00 0.00 ? 103 ASP A CG   4  
ATOM 6944  O OD1  . ASP A 1 103 ? 2.941   12.017  9.493   1.00 0.00 ? 103 ASP A OD1  4  
ATOM 6945  O OD2  . ASP A 1 103 ? 3.515   12.794  7.519   1.00 0.00 ? 103 ASP A OD2  4  
ATOM 6946  H H    . ASP A 1 103 ? 5.496   8.449   9.242   1.00 0.00 ? 103 ASP A H    4  
ATOM 6947  H HA   . ASP A 1 103 ? 3.057   9.790   9.802   1.00 0.00 ? 103 ASP A HA   4  
ATOM 6948  H HB2  . ASP A 1 103 ? 4.469   10.415  7.259   1.00 0.00 ? 103 ASP A HB2  4  
ATOM 6949  H HB3  . ASP A 1 103 ? 2.728   10.161  7.174   1.00 0.00 ? 103 ASP A HB3  4  
ATOM 6950  N N    . THR A 1 104 ? 1.750   7.961   8.560   1.00 0.00 ? 104 THR A N    4  
ATOM 6951  C CA   . THR A 1 104 ? 1.084   6.726   8.164   1.00 0.00 ? 104 THR A CA   4  
ATOM 6952  C C    . THR A 1 104 ? -0.243  7.014   7.472   1.00 0.00 ? 104 THR A C    4  
ATOM 6953  O O    . THR A 1 104 ? -0.929  7.981   7.804   1.00 0.00 ? 104 THR A O    4  
ATOM 6954  C CB   . THR A 1 104 ? 0.830   5.811   9.376   1.00 0.00 ? 104 THR A CB   4  
ATOM 6955  O OG1  . THR A 1 104 ? 2.050   5.600   10.095  1.00 0.00 ? 104 THR A OG1  4  
ATOM 6956  C CG2  . THR A 1 104 ? 0.258   4.473   8.934   1.00 0.00 ? 104 THR A CG2  4  
ATOM 6957  H H    . THR A 1 104 ? 1.209   8.721   8.860   1.00 0.00 ? 104 THR A H    4  
ATOM 6958  H HA   . THR A 1 104 ? 1.732   6.204   7.475   1.00 0.00 ? 104 THR A HA   4  
ATOM 6959  H HB   . THR A 1 104 ? 0.115   6.293   10.028  1.00 0.00 ? 104 THR A HB   4  
ATOM 6960  H HG1  . THR A 1 104 ? 2.795   5.701   9.498   1.00 0.00 ? 104 THR A HG1  4  
ATOM 6961  H HG21 . THR A 1 104 ? -0.763  4.607   8.609   1.00 0.00 ? 104 THR A HG21 4  
ATOM 6962  H HG22 . THR A 1 104 ? 0.285   3.779   9.761   1.00 0.00 ? 104 THR A HG22 4  
ATOM 6963  H HG23 . THR A 1 104 ? 0.847   4.083   8.117   1.00 0.00 ? 104 THR A HG23 4  
ATOM 6964  N N    . GLU A 1 105 ? -0.600  6.169   6.510   1.00 0.00 ? 105 GLU A N    4  
ATOM 6965  C CA   . GLU A 1 105 ? -1.846  6.335   5.772   1.00 0.00 ? 105 GLU A CA   4  
ATOM 6966  C C    . GLU A 1 105 ? -2.587  5.007   5.650   1.00 0.00 ? 105 GLU A C    4  
ATOM 6967  O O    . GLU A 1 105 ? -2.008  3.995   5.253   1.00 0.00 ? 105 GLU A O    4  
ATOM 6968  C CB   . GLU A 1 105 ? -1.569  6.906   4.380   1.00 0.00 ? 105 GLU A CB   4  
ATOM 6969  C CG   . GLU A 1 105 ? -2.817  7.069   3.528   1.00 0.00 ? 105 GLU A CG   4  
ATOM 6970  C CD   . GLU A 1 105 ? -3.775  8.102   4.088   1.00 0.00 ? 105 GLU A CD   4  
ATOM 6971  O OE1  . GLU A 1 105 ? -3.569  9.305   3.824   1.00 0.00 ? 105 GLU A OE1  4  
ATOM 6972  O OE2  . GLU A 1 105 ? -4.729  7.708   4.791   1.00 0.00 ? 105 GLU A OE2  4  
ATOM 6973  H H    . GLU A 1 105 ? -0.011  5.417   6.291   1.00 0.00 ? 105 GLU A H    4  
ATOM 6974  H HA   . GLU A 1 105 ? -2.466  7.030   6.319   1.00 0.00 ? 105 GLU A HA   4  
ATOM 6975  H HB2  . GLU A 1 105 ? -1.102  7.875   4.487   1.00 0.00 ? 105 GLU A HB2  4  
ATOM 6976  H HB3  . GLU A 1 105 ? -0.889  6.246   3.862   1.00 0.00 ? 105 GLU A HB3  4  
ATOM 6977  H HG2  . GLU A 1 105 ? -2.522  7.374   2.535   1.00 0.00 ? 105 GLU A HG2  4  
ATOM 6978  H HG3  . GLU A 1 105 ? -3.327  6.118   3.475   1.00 0.00 ? 105 GLU A HG3  4  
ATOM 6979  N N    . ILE A 1 106 ? -3.871  5.018   5.994   1.00 0.00 ? 106 ILE A N    4  
ATOM 6980  C CA   . ILE A 1 106 ? -4.691  3.815   5.923   1.00 0.00 ? 106 ILE A CA   4  
ATOM 6981  C C    . ILE A 1 106 ? -5.249  3.612   4.518   1.00 0.00 ? 106 ILE A C    4  
ATOM 6982  O O    . ILE A 1 106 ? -5.639  4.571   3.850   1.00 0.00 ? 106 ILE A O    4  
ATOM 6983  C CB   . ILE A 1 106 ? -5.859  3.870   6.924   1.00 0.00 ? 106 ILE A CB   4  
ATOM 6984  C CG1  . ILE A 1 106 ? -5.334  4.104   8.342   1.00 0.00 ? 106 ILE A CG1  4  
ATOM 6985  C CG2  . ILE A 1 106 ? -6.673  2.587   6.860   1.00 0.00 ? 106 ILE A CG2  4  
ATOM 6986  C CD1  . ILE A 1 106 ? -6.398  4.568   9.312   1.00 0.00 ? 106 ILE A CD1  4  
ATOM 6987  H H    . ILE A 1 106 ? -4.275  5.855   6.303   1.00 0.00 ? 106 ILE A H    4  
ATOM 6988  H HA   . ILE A 1 106 ? -4.066  2.971   6.176   1.00 0.00 ? 106 ILE A HA   4  
ATOM 6989  H HB   . ILE A 1 106 ? -6.503  4.691   6.647   1.00 0.00 ? 106 ILE A HB   4  
ATOM 6990  H HG12 . ILE A 1 106 ? -4.919  3.184   8.722   1.00 0.00 ? 106 ILE A HG12 4  
ATOM 6991  H HG13 . ILE A 1 106 ? -4.561  4.858   8.312   1.00 0.00 ? 106 ILE A HG13 4  
ATOM 6992  H HG21 . ILE A 1 106 ? -6.666  2.206   5.849   1.00 0.00 ? 106 ILE A HG21 4  
ATOM 6993  H HG22 . ILE A 1 106 ? -6.240  1.853   7.523   1.00 0.00 ? 106 ILE A HG22 4  
ATOM 6994  H HG23 . ILE A 1 106 ? -7.690  2.789   7.161   1.00 0.00 ? 106 ILE A HG23 4  
ATOM 6995  H HD11 . ILE A 1 106 ? -6.745  5.549   9.025   1.00 0.00 ? 106 ILE A HD11 4  
ATOM 6996  H HD12 . ILE A 1 106 ? -7.225  3.874   9.299   1.00 0.00 ? 106 ILE A HD12 4  
ATOM 6997  H HD13 . ILE A 1 106 ? -5.982  4.612   10.309  1.00 0.00 ? 106 ILE A HD13 4  
ATOM 6998  N N    . ILE A 1 107 ? -5.285  2.360   4.077   1.00 0.00 ? 107 ILE A N    4  
ATOM 6999  C CA   . ILE A 1 107 ? -5.799  2.031   2.753   1.00 0.00 ? 107 ILE A CA   4  
ATOM 7000  C C    . ILE A 1 107 ? -6.661  0.775   2.794   1.00 0.00 ? 107 ILE A C    4  
ATOM 7001  O O    . ILE A 1 107 ? -6.263  -0.246  3.355   1.00 0.00 ? 107 ILE A O    4  
ATOM 7002  C CB   . ILE A 1 107 ? -4.656  1.823   1.742   1.00 0.00 ? 107 ILE A CB   4  
ATOM 7003  C CG1  . ILE A 1 107 ? -3.799  3.087   1.640   1.00 0.00 ? 107 ILE A CG1  4  
ATOM 7004  C CG2  . ILE A 1 107 ? -5.217  1.446   0.379   1.00 0.00 ? 107 ILE A CG2  4  
ATOM 7005  C CD1  . ILE A 1 107 ? -2.652  3.120   2.626   1.00 0.00 ? 107 ILE A CD1  4  
ATOM 7006  H H    . ILE A 1 107 ? -4.960  1.639   4.656   1.00 0.00 ? 107 ILE A H    4  
ATOM 7007  H HA   . ILE A 1 107 ? -6.404  2.860   2.416   1.00 0.00 ? 107 ILE A HA   4  
ATOM 7008  H HB   . ILE A 1 107 ? -4.041  1.007   2.090   1.00 0.00 ? 107 ILE A HB   4  
ATOM 7009  H HG12 . ILE A 1 107 ? -3.384  3.153   0.647   1.00 0.00 ? 107 ILE A HG12 4  
ATOM 7010  H HG13 . ILE A 1 107 ? -4.421  3.950   1.825   1.00 0.00 ? 107 ILE A HG13 4  
ATOM 7011  H HG21 . ILE A 1 107 ? -4.547  0.751   -0.106  1.00 0.00 ? 107 ILE A HG21 4  
ATOM 7012  H HG22 . ILE A 1 107 ? -6.184  0.984   0.504   1.00 0.00 ? 107 ILE A HG22 4  
ATOM 7013  H HG23 . ILE A 1 107 ? -5.316  2.333   -0.228  1.00 0.00 ? 107 ILE A HG23 4  
ATOM 7014  H HD11 . ILE A 1 107 ? -3.025  2.916   3.619   1.00 0.00 ? 107 ILE A HD11 4  
ATOM 7015  H HD12 . ILE A 1 107 ? -1.921  2.374   2.354   1.00 0.00 ? 107 ILE A HD12 4  
ATOM 7016  H HD13 . ILE A 1 107 ? -2.192  4.098   2.610   1.00 0.00 ? 107 ILE A HD13 4  
ATOM 7017  N N    . ARG A 1 108 ? -7.845  0.856   2.195   1.00 0.00 ? 108 ARG A N    4  
ATOM 7018  C CA   . ARG A 1 108 ? -8.764  -0.275  2.162   1.00 0.00 ? 108 ARG A CA   4  
ATOM 7019  C C    . ARG A 1 108 ? -8.971  -0.766  0.733   1.00 0.00 ? 108 ARG A C    4  
ATOM 7020  O O    . ARG A 1 108 ? -9.743  -0.183  -0.030  1.00 0.00 ? 108 ARG A O    4  
ATOM 7021  C CB   . ARG A 1 108 ? -10.109 0.116   2.778   1.00 0.00 ? 108 ARG A CB   4  
ATOM 7022  C CG   . ARG A 1 108 ? -10.160 -0.056  4.288   1.00 0.00 ? 108 ARG A CG   4  
ATOM 7023  C CD   . ARG A 1 108 ? -10.598 -1.460  4.674   1.00 0.00 ? 108 ARG A CD   4  
ATOM 7024  N NE   . ARG A 1 108 ? -12.030 -1.663  4.467   1.00 0.00 ? 108 ARG A NE   4  
ATOM 7025  C CZ   . ARG A 1 108 ? -12.956 -1.330  5.359   1.00 0.00 ? 108 ARG A CZ   4  
ATOM 7026  N NH1  . ARG A 1 108 ? -12.602 -0.780  6.513   1.00 0.00 ? 108 ARG A NH1  4  
ATOM 7027  N NH2  . ARG A 1 108 ? -14.239 -1.546  5.098   1.00 0.00 ? 108 ARG A NH2  4  
ATOM 7028  H H    . ARG A 1 108 ? -8.107  1.697   1.765   1.00 0.00 ? 108 ARG A H    4  
ATOM 7029  H HA   . ARG A 1 108 ? -8.330  -1.073  2.745   1.00 0.00 ? 108 ARG A HA   4  
ATOM 7030  H HB2  . ARG A 1 108 ? -10.309 1.152   2.549   1.00 0.00 ? 108 ARG A HB2  4  
ATOM 7031  H HB3  . ARG A 1 108 ? -10.883 -0.497  2.341   1.00 0.00 ? 108 ARG A HB3  4  
ATOM 7032  H HG2  . ARG A 1 108 ? -9.177  0.127   4.695   1.00 0.00 ? 108 ARG A HG2  4  
ATOM 7033  H HG3  . ARG A 1 108 ? -10.861 0.656   4.698   1.00 0.00 ? 108 ARG A HG3  4  
ATOM 7034  H HD2  . ARG A 1 108 ? -10.053 -2.171  4.072   1.00 0.00 ? 108 ARG A HD2  4  
ATOM 7035  H HD3  . ARG A 1 108 ? -10.368 -1.620  5.717   1.00 0.00 ? 108 ARG A HD3  4  
ATOM 7036  H HE   . ARG A 1 108 ? -12.313 -2.068  3.621   1.00 0.00 ? 108 ARG A HE   4  
ATOM 7037  H HH11 . ARG A 1 108 ? -11.636 -0.615  6.712   1.00 0.00 ? 108 ARG A HH11 4  
ATOM 7038  H HH12 . ARG A 1 108 ? -13.302 -0.529  7.182   1.00 0.00 ? 108 ARG A HH12 4  
ATOM 7039  H HH21 . ARG A 1 108 ? -14.509 -1.961  4.230   1.00 0.00 ? 108 ARG A HH21 4  
ATOM 7040  H HH22 . ARG A 1 108 ? -14.935 -1.295  5.770   1.00 0.00 ? 108 ARG A HH22 4  
ATOM 7041  N N    . LEU A 1 109 ? -8.277  -1.841  0.376   1.00 0.00 ? 109 LEU A N    4  
ATOM 7042  C CA   . LEU A 1 109 ? -8.384  -2.411  -0.963  1.00 0.00 ? 109 LEU A CA   4  
ATOM 7043  C C    . LEU A 1 109 ? -9.761  -3.029  -1.183  1.00 0.00 ? 109 LEU A C    4  
ATOM 7044  O O    . LEU A 1 109 ? -9.975  -4.210  -0.909  1.00 0.00 ? 109 LEU A O    4  
ATOM 7045  C CB   . LEU A 1 109 ? -7.298  -3.467  -1.177  1.00 0.00 ? 109 LEU A CB   4  
ATOM 7046  C CG   . LEU A 1 109 ? -7.131  -3.978  -2.608  1.00 0.00 ? 109 LEU A CG   4  
ATOM 7047  C CD1  . LEU A 1 109 ? -6.886  -2.819  -3.563  1.00 0.00 ? 109 LEU A CD1  4  
ATOM 7048  C CD2  . LEU A 1 109 ? -5.993  -4.985  -2.686  1.00 0.00 ? 109 LEU A CD2  4  
ATOM 7049  H H    . LEU A 1 109 ? -7.678  -2.262  1.027   1.00 0.00 ? 109 LEU A H    4  
ATOM 7050  H HA   . LEU A 1 109 ? -8.243  -1.612  -1.675  1.00 0.00 ? 109 LEU A HA   4  
ATOM 7051  H HB2  . LEU A 1 109 ? -6.357  -3.041  -0.866  1.00 0.00 ? 109 LEU A HB2  4  
ATOM 7052  H HB3  . LEU A 1 109 ? -7.533  -4.314  -0.548  1.00 0.00 ? 109 LEU A HB3  4  
ATOM 7053  H HG   . LEU A 1 109 ? -8.041  -4.475  -2.915  1.00 0.00 ? 109 LEU A HG   4  
ATOM 7054  H HD11 . LEU A 1 109 ? -7.831  -2.401  -3.872  1.00 0.00 ? 109 LEU A HD11 4  
ATOM 7055  H HD12 . LEU A 1 109 ? -6.348  -3.175  -4.429  1.00 0.00 ? 109 LEU A HD12 4  
ATOM 7056  H HD13 . LEU A 1 109 ? -6.302  -2.059  -3.064  1.00 0.00 ? 109 LEU A HD13 4  
ATOM 7057  H HD21 . LEU A 1 109 ? -6.253  -5.767  -3.384  1.00 0.00 ? 109 LEU A HD21 4  
ATOM 7058  H HD22 . LEU A 1 109 ? -5.826  -5.416  -1.709  1.00 0.00 ? 109 LEU A HD22 4  
ATOM 7059  H HD23 . LEU A 1 109 ? -5.095  -4.488  -3.020  1.00 0.00 ? 109 LEU A HD23 4  
ATOM 7060  N N    . LYS A 1 110 ? -10.692 -2.223  -1.683  1.00 0.00 ? 110 LYS A N    4  
ATOM 7061  C CA   . LYS A 1 110 ? -12.048 -2.690  -1.944  1.00 0.00 ? 110 LYS A CA   4  
ATOM 7062  C C    . LYS A 1 110 ? -12.119 -3.442  -3.269  1.00 0.00 ? 110 LYS A C    4  
ATOM 7063  O O    . LYS A 1 110 ? -11.391 -3.128  -4.211  1.00 0.00 ? 110 LYS A O    4  
ATOM 7064  C CB   . LYS A 1 110 ? -13.021 -1.509  -1.964  1.00 0.00 ? 110 LYS A CB   4  
ATOM 7065  C CG   . LYS A 1 110 ? -13.032 -0.708  -0.673  1.00 0.00 ? 110 LYS A CG   4  
ATOM 7066  C CD   . LYS A 1 110 ? -14.348 0.027   -0.483  1.00 0.00 ? 110 LYS A CD   4  
ATOM 7067  C CE   . LYS A 1 110 ? -14.247 1.078   0.611   1.00 0.00 ? 110 LYS A CE   4  
ATOM 7068  N NZ   . LYS A 1 110 ? -14.294 0.470   1.970   1.00 0.00 ? 110 LYS A NZ   4  
ATOM 7069  H H    . LYS A 1 110 ? -10.461 -1.291  -1.881  1.00 0.00 ? 110 LYS A H    4  
ATOM 7070  H HA   . LYS A 1 110 ? -12.327 -3.362  -1.147  1.00 0.00 ? 110 LYS A HA   4  
ATOM 7071  H HB2  . LYS A 1 110 ? -12.749 -0.846  -2.772  1.00 0.00 ? 110 LYS A HB2  4  
ATOM 7072  H HB3  . LYS A 1 110 ? -14.020 -1.884  -2.138  1.00 0.00 ? 110 LYS A HB3  4  
ATOM 7073  H HG2  . LYS A 1 110 ? -12.884 -1.381  0.159   1.00 0.00 ? 110 LYS A HG2  4  
ATOM 7074  H HG3  . LYS A 1 110 ? -12.228 0.014   -0.701  1.00 0.00 ? 110 LYS A HG3  4  
ATOM 7075  H HD2  . LYS A 1 110 ? -14.616 0.513   -1.409  1.00 0.00 ? 110 LYS A HD2  4  
ATOM 7076  H HD3  . LYS A 1 110 ? -15.113 -0.688  -0.215  1.00 0.00 ? 110 LYS A HD3  4  
ATOM 7077  H HE2  . LYS A 1 110 ? -13.315 1.610   0.497   1.00 0.00 ? 110 LYS A HE2  4  
ATOM 7078  H HE3  . LYS A 1 110 ? -15.071 1.768   0.506   1.00 0.00 ? 110 LYS A HE3  4  
ATOM 7079  H HZ1  . LYS A 1 110 ? -15.118 0.829   2.493   1.00 0.00 ? 110 LYS A HZ1  4  
ATOM 7080  H HZ2  . LYS A 1 110 ? -13.431 0.710   2.499   1.00 0.00 ? 110 LYS A HZ2  4  
ATOM 7081  H HZ3  . LYS A 1 110 ? -14.367 -0.564  1.897   1.00 0.00 ? 110 LYS A HZ3  4  
ATOM 7082  N N    . GLU A 1 111 ? -13.000 -4.435  -3.335  1.00 0.00 ? 111 GLU A N    4  
ATOM 7083  C CA   . GLU A 1 111 ? -13.165 -5.231  -4.546  1.00 0.00 ? 111 GLU A CA   4  
ATOM 7084  C C    . GLU A 1 111 ? -13.506 -4.342  -5.739  1.00 0.00 ? 111 GLU A C    4  
ATOM 7085  O O    . GLU A 1 111 ? -13.546 -3.117  -5.621  1.00 0.00 ? 111 GLU A O    4  
ATOM 7086  C CB   . GLU A 1 111 ? -14.260 -6.280  -4.348  1.00 0.00 ? 111 GLU A CB   4  
ATOM 7087  C CG   . GLU A 1 111 ? -13.824 -7.463  -3.500  1.00 0.00 ? 111 GLU A CG   4  
ATOM 7088  C CD   . GLU A 1 111 ? -14.984 -8.351  -3.096  1.00 0.00 ? 111 GLU A CD   4  
ATOM 7089  O OE1  . GLU A 1 111 ? -15.984 -8.399  -3.843  1.00 0.00 ? 111 GLU A OE1  4  
ATOM 7090  O OE2  . GLU A 1 111 ? -14.892 -8.999  -2.032  1.00 0.00 ? 111 GLU A OE2  4  
ATOM 7091  H H    . GLU A 1 111 ? -13.552 -4.638  -2.551  1.00 0.00 ? 111 GLU A H    4  
ATOM 7092  H HA   . GLU A 1 111 ? -12.230 -5.732  -4.743  1.00 0.00 ? 111 GLU A HA   4  
ATOM 7093  H HB2  . GLU A 1 111 ? -15.108 -5.813  -3.869  1.00 0.00 ? 111 GLU A HB2  4  
ATOM 7094  H HB3  . GLU A 1 111 ? -14.565 -6.652  -5.316  1.00 0.00 ? 111 GLU A HB3  4  
ATOM 7095  H HG2  . GLU A 1 111 ? -13.118 -8.054  -4.064  1.00 0.00 ? 111 GLU A HG2  4  
ATOM 7096  H HG3  . GLU A 1 111 ? -13.346 -7.091  -2.605  1.00 0.00 ? 111 GLU A HG3  4  
ATOM 7097  N N    . GLN A 1 112 ? -13.751 -4.968  -6.885  1.00 0.00 ? 112 GLN A N    4  
ATOM 7098  C CA   . GLN A 1 112 ? -14.088 -4.234  -8.099  1.00 0.00 ? 112 GLN A CA   4  
ATOM 7099  C C    . GLN A 1 112 ? -15.464 -3.588  -7.980  1.00 0.00 ? 112 GLN A C    4  
ATOM 7100  O O    . GLN A 1 112 ? -15.814 -2.702  -8.759  1.00 0.00 ? 112 GLN A O    4  
ATOM 7101  C CB   . GLN A 1 112 ? -14.053 -5.167  -9.311  1.00 0.00 ? 112 GLN A CB   4  
ATOM 7102  C CG   . GLN A 1 112 ? -14.897 -6.420  -9.139  1.00 0.00 ? 112 GLN A CG   4  
ATOM 7103  C CD   . GLN A 1 112 ? -14.901 -7.295  -10.376 1.00 0.00 ? 112 GLN A CD   4  
ATOM 7104  O OE1  . GLN A 1 112 ? -14.950 -6.798  -11.502 1.00 0.00 ? 112 GLN A OE1  4  
ATOM 7105  N NE2  . GLN A 1 112 ? -14.850 -8.606  -10.174 1.00 0.00 ? 112 GLN A NE2  4  
ATOM 7106  H H    . GLN A 1 112 ? -13.703 -5.946  -6.915  1.00 0.00 ? 112 GLN A H    4  
ATOM 7107  H HA   . GLN A 1 112 ? -13.349 -3.458  -8.233  1.00 0.00 ? 112 GLN A HA   4  
ATOM 7108  H HB2  . GLN A 1 112 ? -14.415 -4.630  -10.174 1.00 0.00 ? 112 GLN A HB2  4  
ATOM 7109  H HB3  . GLN A 1 112 ? -13.031 -5.470  -9.487  1.00 0.00 ? 112 GLN A HB3  4  
ATOM 7110  H HG2  . GLN A 1 112 ? -14.504 -6.993  -8.313  1.00 0.00 ? 112 GLN A HG2  4  
ATOM 7111  H HG3  . GLN A 1 112 ? -15.913 -6.125  -8.920  1.00 0.00 ? 112 GLN A HG3  4  
ATOM 7112  H HE21 . GLN A 1 112 ? -14.814 -8.931  -9.250  1.00 0.00 ? 112 GLN A HE21 4  
ATOM 7113  H HE22 . GLN A 1 112 ? -14.852 -9.196  -10.956 1.00 0.00 ? 112 GLN A HE22 4  
ATOM 7114  N N    . GLY A 1 113 ? -16.241 -4.037  -7.000  1.00 0.00 ? 113 GLY A N    4  
ATOM 7115  C CA   . GLY A 1 113 ? -17.571 -3.491  -6.797  1.00 0.00 ? 113 GLY A CA   4  
ATOM 7116  C C    . GLY A 1 113 ? -18.278 -4.114  -5.610  1.00 0.00 ? 113 GLY A C    4  
ATOM 7117  O O    . GLY A 1 113 ? -18.510 -3.451  -4.600  1.00 0.00 ? 113 GLY A O    4  
ATOM 7118  H H    . GLY A 1 113 ? -15.909 -4.745  -6.409  1.00 0.00 ? 113 GLY A H    4  
ATOM 7119  H HA2  . GLY A 1 113 ? -17.490 -2.427  -6.637  1.00 0.00 ? 113 GLY A HA2  4  
ATOM 7120  H HA3  . GLY A 1 113 ? -18.159 -3.669  -7.686  1.00 0.00 ? 113 GLY A HA3  4  
ATOM 7121  N N    . SER A 1 114 ? -18.624 -5.392  -5.733  1.00 0.00 ? 114 SER A N    4  
ATOM 7122  C CA   . SER A 1 114 ? -19.315 -6.103  -4.664  1.00 0.00 ? 114 SER A CA   4  
ATOM 7123  C C    . SER A 1 114 ? -18.832 -5.629  -3.296  1.00 0.00 ? 114 SER A C    4  
ATOM 7124  O O    . SER A 1 114 ? -17.634 -5.620  -3.019  1.00 0.00 ? 114 SER A O    4  
ATOM 7125  C CB   . SER A 1 114 ? -19.096 -7.611  -4.801  1.00 0.00 ? 114 SER A CB   4  
ATOM 7126  O OG   . SER A 1 114 ? -20.002 -8.333  -3.985  1.00 0.00 ? 114 SER A OG   4  
ATOM 7127  H H    . SER A 1 114 ? -18.412 -5.866  -6.564  1.00 0.00 ? 114 SER A H    4  
ATOM 7128  H HA   . SER A 1 114 ? -20.370 -5.891  -4.753  1.00 0.00 ? 114 SER A HA   4  
ATOM 7129  H HB2  . SER A 1 114 ? -19.246 -7.902  -5.829  1.00 0.00 ? 114 SER A HB2  4  
ATOM 7130  H HB3  . SER A 1 114 ? -18.087 -7.854  -4.500  1.00 0.00 ? 114 SER A HB3  4  
ATOM 7131  H HG   . SER A 1 114 ? -19.938 -9.270  -4.187  1.00 0.00 ? 114 SER A HG   4  
ATOM 7132  N N    . GLU A 1 115 ? -19.776 -5.237  -2.446  1.00 0.00 ? 115 GLU A N    4  
ATOM 7133  C CA   . GLU A 1 115 ? -19.446 -4.761  -1.107  1.00 0.00 ? 115 GLU A CA   4  
ATOM 7134  C C    . GLU A 1 115 ? -20.473 -5.248  -0.089  1.00 0.00 ? 115 GLU A C    4  
ATOM 7135  O O    . GLU A 1 115 ? -21.677 -5.227  -0.346  1.00 0.00 ? 115 GLU A O    4  
ATOM 7136  C CB   . GLU A 1 115 ? -19.378 -3.232  -1.087  1.00 0.00 ? 115 GLU A CB   4  
ATOM 7137  C CG   . GLU A 1 115 ? -18.777 -2.666  0.188   1.00 0.00 ? 115 GLU A CG   4  
ATOM 7138  C CD   . GLU A 1 115 ? -19.044 -1.183  0.351   1.00 0.00 ? 115 GLU A CD   4  
ATOM 7139  O OE1  . GLU A 1 115 ? -20.099 -0.714  -0.128  1.00 0.00 ? 115 GLU A OE1  4  
ATOM 7140  O OE2  . GLU A 1 115 ? -18.200 -0.490  0.956   1.00 0.00 ? 115 GLU A OE2  4  
ATOM 7141  H H    . GLU A 1 115 ? -20.714 -5.267  -2.725  1.00 0.00 ? 115 GLU A H    4  
ATOM 7142  H HA   . GLU A 1 115 ? -18.479 -5.159  -0.842  1.00 0.00 ? 115 GLU A HA   4  
ATOM 7143  H HB2  . GLU A 1 115 ? -18.778 -2.900  -1.922  1.00 0.00 ? 115 GLU A HB2  4  
ATOM 7144  H HB3  . GLU A 1 115 ? -20.378 -2.838  -1.195  1.00 0.00 ? 115 GLU A HB3  4  
ATOM 7145  H HG2  . GLU A 1 115 ? -19.203 -3.187  1.033   1.00 0.00 ? 115 GLU A HG2  4  
ATOM 7146  H HG3  . GLU A 1 115 ? -17.709 -2.825  0.170   1.00 0.00 ? 115 GLU A HG3  4  
ATOM 7147  N N    . MET A 1 116 ? -19.988 -5.687  1.068   1.00 0.00 ? 116 MET A N    4  
ATOM 7148  C CA   . MET A 1 116 ? -20.864 -6.179  2.126   1.00 0.00 ? 116 MET A CA   4  
ATOM 7149  C C    . MET A 1 116 ? -22.172 -5.394  2.158   1.00 0.00 ? 116 MET A C    4  
ATOM 7150  O O    . MET A 1 116 ? -22.181 -4.177  1.973   1.00 0.00 ? 116 MET A O    4  
ATOM 7151  C CB   . MET A 1 116 ? -20.164 -6.082  3.483   1.00 0.00 ? 116 MET A CB   4  
ATOM 7152  C CG   . MET A 1 116 ? -19.757 -4.666  3.857   1.00 0.00 ? 116 MET A CG   4  
ATOM 7153  S SD   . MET A 1 116 ? -19.483 -4.466  5.627   1.00 0.00 ? 116 MET A SD   4  
ATOM 7154  C CE   . MET A 1 116 ? -17.836 -3.762  5.638   1.00 0.00 ? 116 MET A CE   4  
ATOM 7155  H H    . MET A 1 116 ? -19.019 -5.679  1.215   1.00 0.00 ? 116 MET A H    4  
ATOM 7156  H HA   . MET A 1 116 ? -21.084 -7.215  1.918   1.00 0.00 ? 116 MET A HA   4  
ATOM 7157  H HB2  . MET A 1 116 ? -20.831 -6.455  4.246   1.00 0.00 ? 116 MET A HB2  4  
ATOM 7158  H HB3  . MET A 1 116 ? -19.275 -6.694  3.461   1.00 0.00 ? 116 MET A HB3  4  
ATOM 7159  H HG2  . MET A 1 116 ? -18.844 -4.418  3.336   1.00 0.00 ? 116 MET A HG2  4  
ATOM 7160  H HG3  . MET A 1 116 ? -20.539 -3.988  3.548   1.00 0.00 ? 116 MET A HG3  4  
ATOM 7161  H HE1  . MET A 1 116 ? -17.816 -2.901  6.289   1.00 0.00 ? 116 MET A HE1  4  
ATOM 7162  H HE2  . MET A 1 116 ? -17.132 -4.500  5.995   1.00 0.00 ? 116 MET A HE2  4  
ATOM 7163  H HE3  . MET A 1 116 ? -17.567 -3.462  4.636   1.00 0.00 ? 116 MET A HE3  4  
ATOM 7164  N N    . SER A 1 117 ? -23.274 -6.099  2.393   1.00 0.00 ? 117 SER A N    4  
ATOM 7165  C CA   . SER A 1 117 ? -24.588 -5.469  2.445   1.00 0.00 ? 117 SER A CA   4  
ATOM 7166  C C    . SER A 1 117 ? -24.627 -4.381  3.514   1.00 0.00 ? 117 SER A C    4  
ATOM 7167  O O    . SER A 1 117 ? -24.459 -4.656  4.701   1.00 0.00 ? 117 SER A O    4  
ATOM 7168  C CB   . SER A 1 117 ? -25.668 -6.515  2.726   1.00 0.00 ? 117 SER A CB   4  
ATOM 7169  O OG   . SER A 1 117 ? -26.961 -5.936  2.689   1.00 0.00 ? 117 SER A OG   4  
ATOM 7170  H H    . SER A 1 117 ? -23.201 -7.067  2.532   1.00 0.00 ? 117 SER A H    4  
ATOM 7171  H HA   . SER A 1 117 ? -24.777 -5.018  1.482   1.00 0.00 ? 117 SER A HA   4  
ATOM 7172  H HB2  . SER A 1 117 ? -25.614 -7.294  1.981   1.00 0.00 ? 117 SER A HB2  4  
ATOM 7173  H HB3  . SER A 1 117 ? -25.505 -6.942  3.706   1.00 0.00 ? 117 SER A HB3  4  
ATOM 7174  H HG   . SER A 1 117 ? -26.950 -5.166  2.116   1.00 0.00 ? 117 SER A HG   4  
ATOM 7175  N N    . GLY A 1 118 ? -24.849 -3.143  3.082   1.00 0.00 ? 118 GLY A N    4  
ATOM 7176  C CA   . GLY A 1 118 ? -24.906 -2.032  4.013   1.00 0.00 ? 118 GLY A CA   4  
ATOM 7177  C C    . GLY A 1 118 ? -24.281 -0.771  3.450   1.00 0.00 ? 118 GLY A C    4  
ATOM 7178  O O    . GLY A 1 118 ? -23.915 -0.704  2.276   1.00 0.00 ? 118 GLY A O    4  
ATOM 7179  H H    . GLY A 1 118 ? -24.975 -2.984  2.123   1.00 0.00 ? 118 GLY A H    4  
ATOM 7180  H HA2  . GLY A 1 118 ? -25.939 -1.832  4.256   1.00 0.00 ? 118 GLY A HA2  4  
ATOM 7181  H HA3  . GLY A 1 118 ? -24.381 -2.307  4.917   1.00 0.00 ? 118 GLY A HA3  4  
ATOM 7182  N N    . PRO A 1 119 ? -24.151 0.260   4.298   1.00 0.00 ? 119 PRO A N    4  
ATOM 7183  C CA   . PRO A 1 119 ? -23.567 1.544   3.900   1.00 0.00 ? 119 PRO A CA   4  
ATOM 7184  C C    . PRO A 1 119 ? -22.068 1.443   3.640   1.00 0.00 ? 119 PRO A C    4  
ATOM 7185  O O    . PRO A 1 119 ? -21.386 0.589   4.207   1.00 0.00 ? 119 PRO A O    4  
ATOM 7186  C CB   . PRO A 1 119 ? -23.841 2.447   5.106   1.00 0.00 ? 119 PRO A CB   4  
ATOM 7187  C CG   . PRO A 1 119 ? -23.958 1.513   6.260   1.00 0.00 ? 119 PRO A CG   4  
ATOM 7188  C CD   . PRO A 1 119 ? -24.565 0.251   5.712   1.00 0.00 ? 119 PRO A CD   4  
ATOM 7189  H HA   . PRO A 1 119 ? -24.056 1.949   3.027   1.00 0.00 ? 119 PRO A HA   4  
ATOM 7190  H HB2  . PRO A 1 119 ? -23.018 3.137   5.236   1.00 0.00 ? 119 PRO A HB2  4  
ATOM 7191  H HB3  . PRO A 1 119 ? -24.757 2.996   4.948   1.00 0.00 ? 119 PRO A HB3  4  
ATOM 7192  H HG2  . PRO A 1 119 ? -22.980 1.311   6.670   1.00 0.00 ? 119 PRO A HG2  4  
ATOM 7193  H HG3  . PRO A 1 119 ? -24.602 1.941   7.014   1.00 0.00 ? 119 PRO A HG3  4  
ATOM 7194  H HD2  . PRO A 1 119 ? -24.168 -0.612  6.224   1.00 0.00 ? 119 PRO A HD2  4  
ATOM 7195  H HD3  . PRO A 1 119 ? -25.641 0.281   5.798   1.00 0.00 ? 119 PRO A HD3  4  
ATOM 7196  N N    . SER A 1 120 ? -21.561 2.320   2.780   1.00 0.00 ? 120 SER A N    4  
ATOM 7197  C CA   . SER A 1 120 ? -20.142 2.327   2.442   1.00 0.00 ? 120 SER A CA   4  
ATOM 7198  C C    . SER A 1 120 ? -19.303 2.783   3.632   1.00 0.00 ? 120 SER A C    4  
ATOM 7199  O O    . SER A 1 120 ? -19.474 3.891   4.138   1.00 0.00 ? 120 SER A O    4  
ATOM 7200  C CB   . SER A 1 120 ? -19.886 3.242   1.243   1.00 0.00 ? 120 SER A CB   4  
ATOM 7201  O OG   . SER A 1 120 ? -18.497 3.409   1.016   1.00 0.00 ? 120 SER A OG   4  
ATOM 7202  H H    . SER A 1 120 ? -22.156 2.977   2.360   1.00 0.00 ? 120 SER A H    4  
ATOM 7203  H HA   . SER A 1 120 ? -19.859 1.319   2.181   1.00 0.00 ? 120 SER A HA   4  
ATOM 7204  H HB2  . SER A 1 120 ? -20.333 2.809   0.361   1.00 0.00 ? 120 SER A HB2  4  
ATOM 7205  H HB3  . SER A 1 120 ? -20.327 4.210   1.432   1.00 0.00 ? 120 SER A HB3  4  
ATOM 7206  H HG   . SER A 1 120 ? -18.359 4.128   0.395   1.00 0.00 ? 120 SER A HG   4  
ATOM 7207  N N    . SER A 1 121 ? -18.394 1.918   4.072   1.00 0.00 ? 121 SER A N    4  
ATOM 7208  C CA   . SER A 1 121 ? -17.530 2.229   5.205   1.00 0.00 ? 121 SER A CA   4  
ATOM 7209  C C    . SER A 1 121 ? -16.654 3.440   4.903   1.00 0.00 ? 121 SER A C    4  
ATOM 7210  O O    . SER A 1 121 ? -16.643 3.949   3.784   1.00 0.00 ? 121 SER A O    4  
ATOM 7211  C CB   . SER A 1 121 ? -16.653 1.023   5.550   1.00 0.00 ? 121 SER A CB   4  
ATOM 7212  O OG   . SER A 1 121 ? -17.315 0.150   6.448   1.00 0.00 ? 121 SER A OG   4  
ATOM 7213  H H    . SER A 1 121 ? -18.306 1.050   3.627   1.00 0.00 ? 121 SER A H    4  
ATOM 7214  H HA   . SER A 1 121 ? -18.161 2.457   6.051   1.00 0.00 ? 121 SER A HA   4  
ATOM 7215  H HB2  . SER A 1 121 ? -16.419 0.481   4.646   1.00 0.00 ? 121 SER A HB2  4  
ATOM 7216  H HB3  . SER A 1 121 ? -15.738 1.368   6.010   1.00 0.00 ? 121 SER A HB3  4  
ATOM 7217  H HG   . SER A 1 121 ? -18.004 -0.328  5.980   1.00 0.00 ? 121 SER A HG   4  
ATOM 7218  N N    . GLY A 1 122 ? -15.919 3.897   5.913   1.00 0.00 ? 122 GLY A N    4  
ATOM 7219  C CA   . GLY A 1 122 ? -15.049 5.046   5.737   1.00 0.00 ? 122 GLY A CA   4  
ATOM 7220  C C    . GLY A 1 122 ? -14.899 5.860   7.007   1.00 0.00 ? 122 GLY A C    4  
ATOM 7221  O O    . GLY A 1 122 ? -14.413 6.990   6.973   1.00 0.00 ? 122 GLY A O    4  
ATOM 7222  H H    . GLY A 1 122 ? -15.968 3.451   6.784   1.00 0.00 ? 122 GLY A H    4  
ATOM 7223  H HA2  . GLY A 1 122 ? -14.074 4.701   5.426   1.00 0.00 ? 122 GLY A HA2  4  
ATOM 7224  H HA3  . GLY A 1 122 ? -15.460 5.679   4.964   1.00 0.00 ? 122 GLY A HA3  4  
ATOM 7225  N N    . GLY A 1 1   ? 1.033   49.677  -6.902  1.00 0.00 ? 1   GLY A N    5  
ATOM 7226  C CA   . GLY A 1 1   ? 1.849   48.495  -7.106  1.00 0.00 ? 1   GLY A CA   5  
ATOM 7227  C C    . GLY A 1 1   ? 3.106   48.505  -6.258  1.00 0.00 ? 1   GLY A C    5  
ATOM 7228  O O    . GLY A 1 1   ? 3.460   49.528  -5.673  1.00 0.00 ? 1   GLY A O    5  
ATOM 7229  H H1   . GLY A 1 1   ? 1.384   50.429  -6.380  1.00 0.00 ? 1   GLY A H1   5  
ATOM 7230  H HA2  . GLY A 1 1   ? 1.266   47.621  -6.856  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7231  H HA3  . GLY A 1 1   ? 2.132   48.442  -8.147  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7232  N N    . SER A 1 2   ? 3.780   47.362  -6.189  1.00 0.00 ? 2   SER A N    5  
ATOM 7233  C CA   . SER A 1 2   ? 5.002   47.241  -5.401  1.00 0.00 ? 2   SER A CA   5  
ATOM 7234  C C    . SER A 1 2   ? 5.902   46.143  -5.960  1.00 0.00 ? 2   SER A C    5  
ATOM 7235  O O    . SER A 1 2   ? 5.485   45.356  -6.809  1.00 0.00 ? 2   SER A O    5  
ATOM 7236  C CB   . SER A 1 2   ? 4.664   46.944  -3.939  1.00 0.00 ? 2   SER A CB   5  
ATOM 7237  O OG   . SER A 1 2   ? 3.849   45.790  -3.828  1.00 0.00 ? 2   SER A OG   5  
ATOM 7238  H H    . SER A 1 2   ? 3.447   46.580  -6.678  1.00 0.00 ? 2   SER A H    5  
ATOM 7239  H HA   . SER A 1 2   ? 5.526   48.183  -5.457  1.00 0.00 ? 2   SER A HA   5  
ATOM 7240  H HB2  . SER A 1 2   ? 5.577   46.780  -3.387  1.00 0.00 ? 2   SER A HB2  5  
ATOM 7241  H HB3  . SER A 1 2   ? 4.134   47.786  -3.517  1.00 0.00 ? 2   SER A HB3  5  
ATOM 7242  H HG   . SER A 1 2   ? 4.027   45.200  -4.564  1.00 0.00 ? 2   SER A HG   5  
ATOM 7243  N N    . SER A 1 3   ? 7.139   46.098  -5.476  1.00 0.00 ? 3   SER A N    5  
ATOM 7244  C CA   . SER A 1 3   ? 8.101   45.100  -5.929  1.00 0.00 ? 3   SER A CA   5  
ATOM 7245  C C    . SER A 1 3   ? 7.904   43.781  -5.189  1.00 0.00 ? 3   SER A C    5  
ATOM 7246  O O    . SER A 1 3   ? 7.679   43.762  -3.979  1.00 0.00 ? 3   SER A O    5  
ATOM 7247  C CB   . SER A 1 3   ? 9.530   45.607  -5.721  1.00 0.00 ? 3   SER A CB   5  
ATOM 7248  O OG   . SER A 1 3   ? 10.001  45.285  -4.424  1.00 0.00 ? 3   SER A OG   5  
ATOM 7249  H H    . SER A 1 3   ? 7.412   46.754  -4.800  1.00 0.00 ? 3   SER A H    5  
ATOM 7250  H HA   . SER A 1 3   ? 7.937   44.936  -6.984  1.00 0.00 ? 3   SER A HA   5  
ATOM 7251  H HB2  . SER A 1 3   ? 10.181  45.150  -6.451  1.00 0.00 ? 3   SER A HB2  5  
ATOM 7252  H HB3  . SER A 1 3   ? 9.549   46.680  -5.842  1.00 0.00 ? 3   SER A HB3  5  
ATOM 7253  H HG   . SER A 1 3   ? 9.257   45.204  -3.823  1.00 0.00 ? 3   SER A HG   5  
ATOM 7254  N N    . GLY A 1 4   ? 7.991   42.677  -5.925  1.00 0.00 ? 4   GLY A N    5  
ATOM 7255  C CA   . GLY A 1 4   ? 7.820   41.368  -5.323  1.00 0.00 ? 4   GLY A CA   5  
ATOM 7256  C C    . GLY A 1 4   ? 7.039   40.419  -6.211  1.00 0.00 ? 4   GLY A C    5  
ATOM 7257  O O    . GLY A 1 4   ? 6.159   40.842  -6.960  1.00 0.00 ? 4   GLY A O    5  
ATOM 7258  H H    . GLY A 1 4   ? 8.172   42.753  -6.886  1.00 0.00 ? 4   GLY A H    5  
ATOM 7259  H HA2  . GLY A 1 4   ? 8.793   40.944  -5.128  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7260  H HA3  . GLY A 1 4   ? 7.294   41.481  -4.387  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7261  N N    . SER A 1 5   ? 7.363   39.133  -6.128  1.00 0.00 ? 5   SER A N    5  
ATOM 7262  C CA   . SER A 1 5   ? 6.689   38.121  -6.934  1.00 0.00 ? 5   SER A CA   5  
ATOM 7263  C C    . SER A 1 5   ? 6.415   36.865  -6.112  1.00 0.00 ? 5   SER A C    5  
ATOM 7264  O O    . SER A 1 5   ? 7.149   36.551  -5.175  1.00 0.00 ? 5   SER A O    5  
ATOM 7265  C CB   . SER A 1 5   ? 7.534   37.769  -8.159  1.00 0.00 ? 5   SER A CB   5  
ATOM 7266  O OG   . SER A 1 5   ? 7.898   38.933  -8.880  1.00 0.00 ? 5   SER A OG   5  
ATOM 7267  H H    . SER A 1 5   ? 8.073   38.858  -5.511  1.00 0.00 ? 5   SER A H    5  
ATOM 7268  H HA   . SER A 1 5   ? 5.747   38.534  -7.264  1.00 0.00 ? 5   SER A HA   5  
ATOM 7269  H HB2  . SER A 1 5   ? 8.433   37.263  -7.840  1.00 0.00 ? 5   SER A HB2  5  
ATOM 7270  H HB3  . SER A 1 5   ? 6.967   37.119  -8.810  1.00 0.00 ? 5   SER A HB3  5  
ATOM 7271  H HG   . SER A 1 5   ? 8.692   38.759  -9.391  1.00 0.00 ? 5   SER A HG   5  
ATOM 7272  N N    . SER A 1 6   ? 5.353   36.151  -6.471  1.00 0.00 ? 6   SER A N    5  
ATOM 7273  C CA   . SER A 1 6   ? 4.978   34.931  -5.766  1.00 0.00 ? 6   SER A CA   5  
ATOM 7274  C C    . SER A 1 6   ? 5.582   33.705  -6.443  1.00 0.00 ? 6   SER A C    5  
ATOM 7275  O O    . SER A 1 6   ? 5.855   33.716  -7.643  1.00 0.00 ? 6   SER A O    5  
ATOM 7276  C CB   . SER A 1 6   ? 3.456   34.798  -5.707  1.00 0.00 ? 6   SER A CB   5  
ATOM 7277  O OG   . SER A 1 6   ? 3.071   33.682  -4.922  1.00 0.00 ? 6   SER A OG   5  
ATOM 7278  H H    . SER A 1 6   ? 4.807   36.454  -7.227  1.00 0.00 ? 6   SER A H    5  
ATOM 7279  H HA   . SER A 1 6   ? 5.364   34.998  -4.759  1.00 0.00 ? 6   SER A HA   5  
ATOM 7280  H HB2  . SER A 1 6   ? 3.035   35.691  -5.271  1.00 0.00 ? 6   SER A HB2  5  
ATOM 7281  H HB3  . SER A 1 6   ? 3.070   34.669  -6.708  1.00 0.00 ? 6   SER A HB3  5  
ATOM 7282  H HG   . SER A 1 6   ? 3.442   32.882  -5.299  1.00 0.00 ? 6   SER A HG   5  
ATOM 7283  N N    . GLY A 1 7   ? 5.788   32.647  -5.664  1.00 0.00 ? 7   GLY A N    5  
ATOM 7284  C CA   . GLY A 1 7   ? 6.358   31.427  -6.205  1.00 0.00 ? 7   GLY A CA   5  
ATOM 7285  C C    . GLY A 1 7   ? 6.307   30.276  -5.220  1.00 0.00 ? 7   GLY A C    5  
ATOM 7286  O O    . GLY A 1 7   ? 5.954   30.461  -4.054  1.00 0.00 ? 7   GLY A O    5  
ATOM 7287  H H    . GLY A 1 7   ? 5.551   32.695  -4.715  1.00 0.00 ? 7   GLY A H    5  
ATOM 7288  H HA2  . GLY A 1 7   ? 5.811   31.150  -7.094  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7289  H HA3  . GLY A 1 7   ? 7.388   31.612  -6.472  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7290  N N    . THR A 1 8   ? 6.658   29.082  -5.687  1.00 0.00 ? 8   THR A N    5  
ATOM 7291  C CA   . THR A 1 8   ? 6.649   27.897  -4.840  1.00 0.00 ? 8   THR A CA   5  
ATOM 7292  C C    . THR A 1 8   ? 8.065   27.482  -4.458  1.00 0.00 ? 8   THR A C    5  
ATOM 7293  O O    . THR A 1 8   ? 8.705   26.701  -5.163  1.00 0.00 ? 8   THR A O    5  
ATOM 7294  C CB   . THR A 1 8   ? 5.950   26.714  -5.537  1.00 0.00 ? 8   THR A CB   5  
ATOM 7295  O OG1  . THR A 1 8   ? 4.669   27.123  -6.029  1.00 0.00 ? 8   THR A OG1  5  
ATOM 7296  C CG2  . THR A 1 8   ? 5.781   25.544  -4.579  1.00 0.00 ? 8   THR A CG2  5  
ATOM 7297  H H    . THR A 1 8   ? 6.930   28.999  -6.625  1.00 0.00 ? 8   THR A H    5  
ATOM 7298  H HA   . THR A 1 8   ? 6.098   28.134  -3.941  1.00 0.00 ? 8   THR A HA   5  
ATOM 7299  H HB   . THR A 1 8   ? 6.561   26.394  -6.369  1.00 0.00 ? 8   THR A HB   5  
ATOM 7300  H HG1  . THR A 1 8   ? 4.008   27.001  -5.343  1.00 0.00 ? 8   THR A HG1  5  
ATOM 7301  H HG21 . THR A 1 8   ? 5.275   24.735  -5.084  1.00 0.00 ? 8   THR A HG21 5  
ATOM 7302  H HG22 . THR A 1 8   ? 5.197   25.859  -3.727  1.00 0.00 ? 8   THR A HG22 5  
ATOM 7303  H HG23 . THR A 1 8   ? 6.752   25.209  -4.247  1.00 0.00 ? 8   THR A HG23 5  
ATOM 7304  N N    . LEU A 1 9   ? 8.549   28.009  -3.339  1.00 0.00 ? 9   LEU A N    5  
ATOM 7305  C CA   . LEU A 1 9   ? 9.891   27.692  -2.862  1.00 0.00 ? 9   LEU A CA   5  
ATOM 7306  C C    . LEU A 1 9   ? 9.929   26.309  -2.220  1.00 0.00 ? 9   LEU A C    5  
ATOM 7307  O O    . LEU A 1 9   ? 8.940   25.851  -1.647  1.00 0.00 ? 9   LEU A O    5  
ATOM 7308  C CB   . LEU A 1 9   ? 10.358  28.747  -1.858  1.00 0.00 ? 9   LEU A CB   5  
ATOM 7309  C CG   . LEU A 1 9   ? 10.831  30.075  -2.450  1.00 0.00 ? 9   LEU A CG   5  
ATOM 7310  C CD1  . LEU A 1 9   ? 9.661   31.032  -2.617  1.00 0.00 ? 9   LEU A CD1  5  
ATOM 7311  C CD2  . LEU A 1 9   ? 11.910  30.696  -1.573  1.00 0.00 ? 9   LEU A CD2  5  
ATOM 7312  H H    . LEU A 1 9   ? 7.992   28.625  -2.820  1.00 0.00 ? 9   LEU A H    5  
ATOM 7313  H HA   . LEU A 1 9   ? 10.555  27.699  -3.714  1.00 0.00 ? 9   LEU A HA   5  
ATOM 7314  H HB2  . LEU A 1 9   ? 9.536   28.956  -1.192  1.00 0.00 ? 9   LEU A HB2  5  
ATOM 7315  H HB3  . LEU A 1 9   ? 11.178  28.324  -1.293  1.00 0.00 ? 9   LEU A HB3  5  
ATOM 7316  H HG   . LEU A 1 9   ? 11.257  29.895  -3.427  1.00 0.00 ? 9   LEU A HG   5  
ATOM 7317  H HD11 . LEU A 1 9   ? 9.950   31.844  -3.267  1.00 0.00 ? 9   LEU A HD11 5  
ATOM 7318  H HD12 . LEU A 1 9   ? 9.378   31.426  -1.652  1.00 0.00 ? 9   LEU A HD12 5  
ATOM 7319  H HD13 . LEU A 1 9   ? 8.824   30.504  -3.049  1.00 0.00 ? 9   LEU A HD13 5  
ATOM 7320  H HD21 . LEU A 1 9   ? 12.451  31.438  -2.141  1.00 0.00 ? 9   LEU A HD21 5  
ATOM 7321  H HD22 . LEU A 1 9   ? 12.593  29.926  -1.244  1.00 0.00 ? 9   LEU A HD22 5  
ATOM 7322  H HD23 . LEU A 1 9   ? 11.451  31.162  -0.714  1.00 0.00 ? 9   LEU A HD23 5  
ATOM 7323  N N    . THR A 1 10  ? 11.078  25.648  -2.318  1.00 0.00 ? 10  THR A N    5  
ATOM 7324  C CA   . THR A 1 10  ? 11.246  24.318  -1.746  1.00 0.00 ? 10  THR A CA   5  
ATOM 7325  C C    . THR A 1 10  ? 11.090  24.348  -0.230  1.00 0.00 ? 10  THR A C    5  
ATOM 7326  O O    . THR A 1 10  ? 11.315  25.377  0.407   1.00 0.00 ? 10  THR A O    5  
ATOM 7327  C CB   . THR A 1 10  ? 12.623  23.725  -2.097  1.00 0.00 ? 10  THR A CB   5  
ATOM 7328  O OG1  . THR A 1 10  ? 12.663  22.338  -1.745  1.00 0.00 ? 10  THR A OG1  5  
ATOM 7329  C CG2  . THR A 1 10  ? 13.734  24.470  -1.372  1.00 0.00 ? 10  THR A CG2  5  
ATOM 7330  H H    . THR A 1 10  ? 11.830  26.066  -2.787  1.00 0.00 ? 10  THR A H    5  
ATOM 7331  H HA   . THR A 1 10  ? 10.484  23.677  -2.164  1.00 0.00 ? 10  THR A HA   5  
ATOM 7332  H HB   . THR A 1 10  ? 12.779  23.823  -3.162  1.00 0.00 ? 10  THR A HB   5  
ATOM 7333  H HG1  . THR A 1 10  ? 12.687  21.805  -2.544  1.00 0.00 ? 10  THR A HG1  5  
ATOM 7334  H HG21 . THR A 1 10  ? 14.682  23.998  -1.584  1.00 0.00 ? 10  THR A HG21 5  
ATOM 7335  H HG22 . THR A 1 10  ? 13.549  24.445  -0.309  1.00 0.00 ? 10  THR A HG22 5  
ATOM 7336  H HG23 . THR A 1 10  ? 13.759  25.495  -1.710  1.00 0.00 ? 10  THR A HG23 5  
ATOM 7337  N N    . VAL A 1 11  ? 10.704  23.212  0.343   1.00 0.00 ? 11  VAL A N    5  
ATOM 7338  C CA   . VAL A 1 11  ? 10.520  23.108  1.786   1.00 0.00 ? 11  VAL A CA   5  
ATOM 7339  C C    . VAL A 1 11  ? 10.920  21.727  2.293   1.00 0.00 ? 11  VAL A C    5  
ATOM 7340  O O    . VAL A 1 11  ? 10.811  20.735  1.573   1.00 0.00 ? 11  VAL A O    5  
ATOM 7341  C CB   . VAL A 1 11  ? 9.059   23.387  2.187   1.00 0.00 ? 11  VAL A CB   5  
ATOM 7342  C CG1  . VAL A 1 11  ? 8.683   24.826  1.868   1.00 0.00 ? 11  VAL A CG1  5  
ATOM 7343  C CG2  . VAL A 1 11  ? 8.120   22.414  1.488   1.00 0.00 ? 11  VAL A CG2  5  
ATOM 7344  H H    . VAL A 1 11  ? 10.540  22.426  -0.218  1.00 0.00 ? 11  VAL A H    5  
ATOM 7345  H HA   . VAL A 1 11  ? 11.148  23.850  2.257   1.00 0.00 ? 11  VAL A HA   5  
ATOM 7346  H HB   . VAL A 1 11  ? 8.965   23.241  3.253   1.00 0.00 ? 11  VAL A HB   5  
ATOM 7347  H HG11 . VAL A 1 11  ? 9.391   25.494  2.335   1.00 0.00 ? 11  VAL A HG11 5  
ATOM 7348  H HG12 . VAL A 1 11  ? 8.698   24.973  0.798   1.00 0.00 ? 11  VAL A HG12 5  
ATOM 7349  H HG13 . VAL A 1 11  ? 7.692   25.031  2.246   1.00 0.00 ? 11  VAL A HG13 5  
ATOM 7350  H HG21 . VAL A 1 11  ? 7.807   21.653  2.187   1.00 0.00 ? 11  VAL A HG21 5  
ATOM 7351  H HG22 . VAL A 1 11  ? 7.253   22.947  1.125   1.00 0.00 ? 11  VAL A HG22 5  
ATOM 7352  H HG23 . VAL A 1 11  ? 8.633   21.953  0.657   1.00 0.00 ? 11  VAL A HG23 5  
ATOM 7353  N N    . ASN A 1 12  ? 11.382  21.670  3.537   1.00 0.00 ? 12  ASN A N    5  
ATOM 7354  C CA   . ASN A 1 12  ? 11.799  20.410  4.141   1.00 0.00 ? 12  ASN A CA   5  
ATOM 7355  C C    . ASN A 1 12  ? 10.896  20.045  5.316   1.00 0.00 ? 12  ASN A C    5  
ATOM 7356  O O    . ASN A 1 12  ? 10.235  20.906  5.895   1.00 0.00 ? 12  ASN A O    5  
ATOM 7357  C CB   . ASN A 1 12  ? 13.252  20.501  4.609   1.00 0.00 ? 12  ASN A CB   5  
ATOM 7358  C CG   . ASN A 1 12  ? 14.142  21.201  3.601   1.00 0.00 ? 12  ASN A CG   5  
ATOM 7359  O OD1  . ASN A 1 12  ? 13.824  22.292  3.127   1.00 0.00 ? 12  ASN A OD1  5  
ATOM 7360  N ND2  . ASN A 1 12  ? 15.264  20.575  3.266   1.00 0.00 ? 12  ASN A ND2  5  
ATOM 7361  H H    . ASN A 1 12  ? 11.445  22.495  4.062   1.00 0.00 ? 12  ASN A H    5  
ATOM 7362  H HA   . ASN A 1 12  ? 11.720  19.640  3.389   1.00 0.00 ? 12  ASN A HA   5  
ATOM 7363  H HB2  . ASN A 1 12  ? 13.291  21.051  5.538   1.00 0.00 ? 12  ASN A HB2  5  
ATOM 7364  H HB3  . ASN A 1 12  ? 13.636  19.504  4.770   1.00 0.00 ? 12  ASN A HB3  5  
ATOM 7365  H HD21 . ASN A 1 12  ? 15.453  19.708  3.683   1.00 0.00 ? 12  ASN A HD21 5  
ATOM 7366  H HD22 . ASN A 1 12  ? 15.858  21.006  2.617   1.00 0.00 ? 12  ASN A HD22 5  
ATOM 7367  N N    . GLY A 1 13  ? 10.875  18.762  5.663   1.00 0.00 ? 13  GLY A N    5  
ATOM 7368  C CA   . GLY A 1 13  ? 10.051  18.305  6.767   1.00 0.00 ? 13  GLY A CA   5  
ATOM 7369  C C    . GLY A 1 13  ? 9.907   16.796  6.798   1.00 0.00 ? 13  GLY A C    5  
ATOM 7370  O O    . GLY A 1 13  ? 10.657  16.066  6.149   1.00 0.00 ? 13  GLY A O    5  
ATOM 7371  H H    . GLY A 1 13  ? 11.422  18.119  5.164   1.00 0.00 ? 13  GLY A H    5  
ATOM 7372  H HA2  . GLY A 1 13  ? 10.497  18.633  7.694   1.00 0.00 ? 13  GLY A HA2  5  
ATOM 7373  H HA3  . GLY A 1 13  ? 9.069   18.747  6.675   1.00 0.00 ? 13  GLY A HA3  5  
ATOM 7374  N N    . PRO A 1 14  ? 8.924   16.307  7.569   1.00 0.00 ? 14  PRO A N    5  
ATOM 7375  C CA   . PRO A 1 14  ? 8.662   14.871  7.701   1.00 0.00 ? 14  PRO A CA   5  
ATOM 7376  C C    . PRO A 1 14  ? 8.094   14.265  6.423   1.00 0.00 ? 14  PRO A C    5  
ATOM 7377  O O    . PRO A 1 14  ? 7.693   14.971  5.497   1.00 0.00 ? 14  PRO A O    5  
ATOM 7378  C CB   . PRO A 1 14  ? 7.631   14.801  8.830   1.00 0.00 ? 14  PRO A CB   5  
ATOM 7379  C CG   . PRO A 1 14  ? 6.950   16.126  8.804   1.00 0.00 ? 14  PRO A CG   5  
ATOM 7380  C CD   . PRO A 1 14  ? 7.993   17.119  8.370   1.00 0.00 ? 14  PRO A CD   5  
ATOM 7381  H HA   . PRO A 1 14  ? 9.552   14.331  7.990   1.00 0.00 ? 14  PRO A HA   5  
ATOM 7382  H HB2  . PRO A 1 14  ? 6.937   13.995  8.638   1.00 0.00 ? 14  PRO A HB2  5  
ATOM 7383  H HB3  . PRO A 1 14  ? 8.133   14.635  9.771   1.00 0.00 ? 14  PRO A HB3  5  
ATOM 7384  H HG2  . PRO A 1 14  ? 6.135   16.106  8.097   1.00 0.00 ? 14  PRO A HG2  5  
ATOM 7385  H HG3  . PRO A 1 14  ? 6.587   16.372  9.791   1.00 0.00 ? 14  PRO A HG3  5  
ATOM 7386  H HD2  . PRO A 1 14  ? 7.546   17.898  7.770   1.00 0.00 ? 14  PRO A HD2  5  
ATOM 7387  H HD3  . PRO A 1 14  ? 8.492   17.542  9.229   1.00 0.00 ? 14  PRO A HD3  5  
ATOM 7388  N N    . PRO A 1 15  ? 8.058   12.925  6.367   1.00 0.00 ? 15  PRO A N    5  
ATOM 7389  C CA   . PRO A 1 15  ? 7.540   12.195  5.207   1.00 0.00 ? 15  PRO A CA   5  
ATOM 7390  C C    . PRO A 1 15  ? 6.029   12.339  5.058   1.00 0.00 ? 15  PRO A C    5  
ATOM 7391  O O    . PRO A 1 15  ? 5.278   12.104  6.005   1.00 0.00 ? 15  PRO A O    5  
ATOM 7392  C CB   . PRO A 1 15  ? 7.911   10.741  5.508   1.00 0.00 ? 15  PRO A CB   5  
ATOM 7393  C CG   . PRO A 1 15  ? 8.011   10.676  6.993   1.00 0.00 ? 15  PRO A CG   5  
ATOM 7394  C CD   . PRO A 1 15  ? 8.520   12.021  7.433   1.00 0.00 ? 15  PRO A CD   5  
ATOM 7395  H HA   . PRO A 1 15  ? 8.022   12.509  4.292   1.00 0.00 ? 15  PRO A HA   5  
ATOM 7396  H HB2  . PRO A 1 15  ? 7.137   10.084  5.135   1.00 0.00 ? 15  PRO A HB2  5  
ATOM 7397  H HB3  . PRO A 1 15  ? 8.852   10.501  5.038   1.00 0.00 ? 15  PRO A HB3  5  
ATOM 7398  H HG2  . PRO A 1 15  ? 7.038   10.485  7.419   1.00 0.00 ? 15  PRO A HG2  5  
ATOM 7399  H HG3  . PRO A 1 15  ? 8.707   9.900   7.280   1.00 0.00 ? 15  PRO A HG3  5  
ATOM 7400  H HD2  . PRO A 1 15  ? 8.089   12.294  8.385   1.00 0.00 ? 15  PRO A HD2  5  
ATOM 7401  H HD3  . PRO A 1 15  ? 9.599   12.015  7.493   1.00 0.00 ? 15  PRO A HD3  5  
ATOM 7402  N N    . ILE A 1 16  ? 5.591   12.727  3.865   1.00 0.00 ? 16  ILE A N    5  
ATOM 7403  C CA   . ILE A 1 16  ? 4.169   12.901  3.594   1.00 0.00 ? 16  ILE A CA   5  
ATOM 7404  C C    . ILE A 1 16  ? 3.636   11.775  2.713   1.00 0.00 ? 16  ILE A C    5  
ATOM 7405  O O    . ILE A 1 16  ? 4.329   11.293  1.817   1.00 0.00 ? 16  ILE A O    5  
ATOM 7406  C CB   . ILE A 1 16  ? 3.888   14.251  2.908   1.00 0.00 ? 16  ILE A CB   5  
ATOM 7407  C CG1  . ILE A 1 16  ? 4.589   15.385  3.659   1.00 0.00 ? 16  ILE A CG1  5  
ATOM 7408  C CG2  . ILE A 1 16  ? 2.390   14.504  2.832   1.00 0.00 ? 16  ILE A CG2  5  
ATOM 7409  C CD1  . ILE A 1 16  ? 5.989   15.666  3.160   1.00 0.00 ? 16  ILE A CD1  5  
ATOM 7410  H H    . ILE A 1 16  ? 6.239   12.899  3.151   1.00 0.00 ? 16  ILE A H    5  
ATOM 7411  H HA   . ILE A 1 16  ? 3.645   12.883  4.538   1.00 0.00 ? 16  ILE A HA   5  
ATOM 7412  H HB   . ILE A 1 16  ? 4.273   14.204  1.900   1.00 0.00 ? 16  ILE A HB   5  
ATOM 7413  H HG12 . ILE A 1 16  ? 4.012   16.289  3.552   1.00 0.00 ? 16  ILE A HG12 5  
ATOM 7414  H HG13 . ILE A 1 16  ? 4.655   15.126  4.706   1.00 0.00 ? 16  ILE A HG13 5  
ATOM 7415  H HG21 . ILE A 1 16  ? 2.035   14.852  3.791   1.00 0.00 ? 16  ILE A HG21 5  
ATOM 7416  H HG22 . ILE A 1 16  ? 2.190   15.255  2.082   1.00 0.00 ? 16  ILE A HG22 5  
ATOM 7417  H HG23 . ILE A 1 16  ? 1.882   13.588  2.571   1.00 0.00 ? 16  ILE A HG23 5  
ATOM 7418  H HD11 . ILE A 1 16  ? 5.948   15.969  2.124   1.00 0.00 ? 16  ILE A HD11 5  
ATOM 7419  H HD12 . ILE A 1 16  ? 6.431   16.454  3.750   1.00 0.00 ? 16  ILE A HD12 5  
ATOM 7420  H HD13 . ILE A 1 16  ? 6.589   14.771  3.249   1.00 0.00 ? 16  ILE A HD13 5  
ATOM 7421  N N    . ILE A 1 17  ? 2.400   11.363  2.974   1.00 0.00 ? 17  ILE A N    5  
ATOM 7422  C CA   . ILE A 1 17  ? 1.773   10.296  2.204   1.00 0.00 ? 17  ILE A CA   5  
ATOM 7423  C C    . ILE A 1 17  ? 0.345   10.665  1.815   1.00 0.00 ? 17  ILE A C    5  
ATOM 7424  O O    . ILE A 1 17  ? -0.590  10.474  2.593   1.00 0.00 ? 17  ILE A O    5  
ATOM 7425  C CB   . ILE A 1 17  ? 1.753   8.971   2.989   1.00 0.00 ? 17  ILE A CB   5  
ATOM 7426  C CG1  . ILE A 1 17  ? 3.142   8.669   3.556   1.00 0.00 ? 17  ILE A CG1  5  
ATOM 7427  C CG2  . ILE A 1 17  ? 1.280   7.834   2.096   1.00 0.00 ? 17  ILE A CG2  5  
ATOM 7428  C CD1  . ILE A 1 17  ? 3.120   7.724   4.737   1.00 0.00 ? 17  ILE A CD1  5  
ATOM 7429  H H    . ILE A 1 17  ? 1.898   11.786  3.701   1.00 0.00 ? 17  ILE A H    5  
ATOM 7430  H HA   . ILE A 1 17  ? 2.353   10.150  1.304   1.00 0.00 ? 17  ILE A HA   5  
ATOM 7431  H HB   . ILE A 1 17  ? 1.054   9.072   3.804   1.00 0.00 ? 17  ILE A HB   5  
ATOM 7432  H HG12 . ILE A 1 17  ? 3.749   8.221   2.785   1.00 0.00 ? 17  ILE A HG12 5  
ATOM 7433  H HG13 . ILE A 1 17  ? 3.600   9.593   3.878   1.00 0.00 ? 17  ILE A HG13 5  
ATOM 7434  H HG21 . ILE A 1 17  ? 1.013   8.225   1.125   1.00 0.00 ? 17  ILE A HG21 5  
ATOM 7435  H HG22 . ILE A 1 17  ? 2.074   7.110   1.985   1.00 0.00 ? 17  ILE A HG22 5  
ATOM 7436  H HG23 . ILE A 1 17  ? 0.420   7.359   2.542   1.00 0.00 ? 17  ILE A HG23 5  
ATOM 7437  H HD11 . ILE A 1 17  ? 4.006   7.107   4.722   1.00 0.00 ? 17  ILE A HD11 5  
ATOM 7438  H HD12 . ILE A 1 17  ? 3.090   8.293   5.653   1.00 0.00 ? 17  ILE A HD12 5  
ATOM 7439  H HD13 . ILE A 1 17  ? 2.244   7.093   4.676   1.00 0.00 ? 17  ILE A HD13 5  
ATOM 7440  N N    . SER A 1 18  ? 0.185   11.194  0.606   1.00 0.00 ? 18  SER A N    5  
ATOM 7441  C CA   . SER A 1 18  ? -1.129  11.592  0.115   1.00 0.00 ? 18  SER A CA   5  
ATOM 7442  C C    . SER A 1 18  ? -2.078  10.398  0.073   1.00 0.00 ? 18  SER A C    5  
ATOM 7443  O O    . SER A 1 18  ? -3.007  10.301  0.874   1.00 0.00 ? 18  SER A O    5  
ATOM 7444  C CB   . SER A 1 18  ? -1.010  12.212  -1.279  1.00 0.00 ? 18  SER A CB   5  
ATOM 7445  O OG   . SER A 1 18  ? -2.016  13.186  -1.492  1.00 0.00 ? 18  SER A OG   5  
ATOM 7446  H H    . SER A 1 18  ? 0.969   11.322  0.033   1.00 0.00 ? 18  SER A H    5  
ATOM 7447  H HA   . SER A 1 18  ? -1.528  12.330  0.795   1.00 0.00 ? 18  SER A HA   5  
ATOM 7448  H HB2  . SER A 1 18  ? -0.043  12.682  -1.379  1.00 0.00 ? 18  SER A HB2  5  
ATOM 7449  H HB3  . SER A 1 18  ? -1.112  11.436  -2.024  1.00 0.00 ? 18  SER A HB3  5  
ATOM 7450  H HG   . SER A 1 18  ? -2.286  13.557  -0.649  1.00 0.00 ? 18  SER A HG   5  
ATOM 7451  N N    . SER A 1 19  ? -1.837  9.491   -0.868  1.00 0.00 ? 19  SER A N    5  
ATOM 7452  C CA   . SER A 1 19  ? -2.671  8.304   -1.019  1.00 0.00 ? 19  SER A CA   5  
ATOM 7453  C C    . SER A 1 19  ? -2.110  7.378   -2.093  1.00 0.00 ? 19  SER A C    5  
ATOM 7454  O O    . SER A 1 19  ? -1.039  7.628   -2.649  1.00 0.00 ? 19  SER A O    5  
ATOM 7455  C CB   . SER A 1 19  ? -4.105  8.705   -1.372  1.00 0.00 ? 19  SER A CB   5  
ATOM 7456  O OG   . SER A 1 19  ? -4.937  7.564   -1.497  1.00 0.00 ? 19  SER A OG   5  
ATOM 7457  H H    . SER A 1 19  ? -1.081  9.624   -1.478  1.00 0.00 ? 19  SER A H    5  
ATOM 7458  H HA   . SER A 1 19  ? -2.675  7.780   -0.074  1.00 0.00 ? 19  SER A HA   5  
ATOM 7459  H HB2  . SER A 1 19  ? -4.500  9.340   -0.595  1.00 0.00 ? 19  SER A HB2  5  
ATOM 7460  H HB3  . SER A 1 19  ? -4.105  9.240   -2.310  1.00 0.00 ? 19  SER A HB3  5  
ATOM 7461  H HG   . SER A 1 19  ? -5.640  7.748   -2.124  1.00 0.00 ? 19  SER A HG   5  
ATOM 7462  N N    . THR A 1 20  ? -2.841  6.306   -2.382  1.00 0.00 ? 20  THR A N    5  
ATOM 7463  C CA   . THR A 1 20  ? -2.417  5.341   -3.389  1.00 0.00 ? 20  THR A CA   5  
ATOM 7464  C C    . THR A 1 20  ? -3.407  5.284   -4.547  1.00 0.00 ? 20  THR A C    5  
ATOM 7465  O O    . THR A 1 20  ? -4.610  5.452   -4.355  1.00 0.00 ? 20  THR A O    5  
ATOM 7466  C CB   . THR A 1 20  ? -2.267  3.931   -2.787  1.00 0.00 ? 20  THR A CB   5  
ATOM 7467  O OG1  . THR A 1 20  ? -3.559  3.363   -2.542  1.00 0.00 ? 20  THR A OG1  5  
ATOM 7468  C CG2  . THR A 1 20  ? -1.474  3.977   -1.490  1.00 0.00 ? 20  THR A CG2  5  
ATOM 7469  H H    . THR A 1 20  ? -3.685  6.161   -1.905  1.00 0.00 ? 20  THR A H    5  
ATOM 7470  H HA   . THR A 1 20  ? -1.454  5.653   -3.765  1.00 0.00 ? 20  THR A HA   5  
ATOM 7471  H HB   . THR A 1 20  ? -1.737  3.309   -3.494  1.00 0.00 ? 20  THR A HB   5  
ATOM 7472  H HG1  . THR A 1 20  ? -3.472  2.614   -1.947  1.00 0.00 ? 20  THR A HG1  5  
ATOM 7473  H HG21 . THR A 1 20  ? -1.809  3.187   -0.834  1.00 0.00 ? 20  THR A HG21 5  
ATOM 7474  H HG22 . THR A 1 20  ? -1.626  4.932   -1.009  1.00 0.00 ? 20  THR A HG22 5  
ATOM 7475  H HG23 . THR A 1 20  ? -0.425  3.845   -1.705  1.00 0.00 ? 20  THR A HG23 5  
ATOM 7476  N N    . GLN A 1 21  ? -2.891  5.046   -5.748  1.00 0.00 ? 21  GLN A N    5  
ATOM 7477  C CA   . GLN A 1 21  ? -3.731  4.967   -6.938  1.00 0.00 ? 21  GLN A CA   5  
ATOM 7478  C C    . GLN A 1 21  ? -4.569  3.693   -6.929  1.00 0.00 ? 21  GLN A C    5  
ATOM 7479  O O    . GLN A 1 21  ? -5.790  3.741   -6.772  1.00 0.00 ? 21  GLN A O    5  
ATOM 7480  C CB   . GLN A 1 21  ? -2.869  5.016   -8.201  1.00 0.00 ? 21  GLN A CB   5  
ATOM 7481  C CG   . GLN A 1 21  ? -2.447  6.422   -8.595  1.00 0.00 ? 21  GLN A CG   5  
ATOM 7482  C CD   . GLN A 1 21  ? -2.079  7.278   -7.400  1.00 0.00 ? 21  GLN A CD   5  
ATOM 7483  O OE1  . GLN A 1 21  ? -1.352  6.839   -6.508  1.00 0.00 ? 21  GLN A OE1  5  
ATOM 7484  N NE2  . GLN A 1 21  ? -2.579  8.508   -7.375  1.00 0.00 ? 21  GLN A NE2  5  
ATOM 7485  H H    . GLN A 1 21  ? -1.924  4.920   -5.837  1.00 0.00 ? 21  GLN A H    5  
ATOM 7486  H HA   . GLN A 1 21  ? -4.393  5.819   -6.932  1.00 0.00 ? 21  GLN A HA   5  
ATOM 7487  H HB2  . GLN A 1 21  ? -1.978  4.428   -8.037  1.00 0.00 ? 21  GLN A HB2  5  
ATOM 7488  H HB3  . GLN A 1 21  ? -3.428  4.588   -9.020  1.00 0.00 ? 21  GLN A HB3  5  
ATOM 7489  H HG2  . GLN A 1 21  ? -1.590  6.357   -9.249  1.00 0.00 ? 21  GLN A HG2  5  
ATOM 7490  H HG3  . GLN A 1 21  ? -3.264  6.894   -9.121  1.00 0.00 ? 21  GLN A HG3  5  
ATOM 7491  H HE21 . GLN A 1 21  ? -3.152  8.789   -8.120  1.00 0.00 ? 21  GLN A HE21 5  
ATOM 7492  H HE22 . GLN A 1 21  ? -2.358  9.082   -6.614  1.00 0.00 ? 21  GLN A HE22 5  
ATOM 7493  N N    . THR A 1 22  ? -3.907  2.553   -7.099  1.00 0.00 ? 22  THR A N    5  
ATOM 7494  C CA   . THR A 1 22  ? -4.591  1.266   -7.112  1.00 0.00 ? 22  THR A CA   5  
ATOM 7495  C C    . THR A 1 22  ? -5.480  1.104   -5.884  1.00 0.00 ? 22  THR A C    5  
ATOM 7496  O O    . THR A 1 22  ? -4.989  0.909   -4.773  1.00 0.00 ? 22  THR A O    5  
ATOM 7497  C CB   . THR A 1 22  ? -3.589  0.098   -7.164  1.00 0.00 ? 22  THR A CB   5  
ATOM 7498  O OG1  . THR A 1 22  ? -2.645  0.309   -8.220  1.00 0.00 ? 22  THR A OG1  5  
ATOM 7499  C CG2  . THR A 1 22  ? -4.310  -1.224  -7.378  1.00 0.00 ? 22  THR A CG2  5  
ATOM 7500  H H    . THR A 1 22  ? -2.935  2.580   -7.219  1.00 0.00 ? 22  THR A H    5  
ATOM 7501  H HA   . THR A 1 22  ? -5.207  1.225   -7.998  1.00 0.00 ? 22  THR A HA   5  
ATOM 7502  H HB   . THR A 1 22  ? -3.060  0.055   -6.222  1.00 0.00 ? 22  THR A HB   5  
ATOM 7503  H HG1  . THR A 1 22  ? -2.210  -0.521  -8.431  1.00 0.00 ? 22  THR A HG1  5  
ATOM 7504  H HG21 . THR A 1 22  ? -4.591  -1.640  -6.421  1.00 0.00 ? 22  THR A HG21 5  
ATOM 7505  H HG22 . THR A 1 22  ? -3.655  -1.912  -7.891  1.00 0.00 ? 22  THR A HG22 5  
ATOM 7506  H HG23 . THR A 1 22  ? -5.196  -1.059  -7.972  1.00 0.00 ? 22  THR A HG23 5  
ATOM 7507  N N    . GLN A 1 23  ? -6.790  1.185   -6.093  1.00 0.00 ? 23  GLN A N    5  
ATOM 7508  C CA   . GLN A 1 23  ? -7.747  1.046   -5.002  1.00 0.00 ? 23  GLN A CA   5  
ATOM 7509  C C    . GLN A 1 23  ? -8.564  -0.232  -5.154  1.00 0.00 ? 23  GLN A C    5  
ATOM 7510  O O    . GLN A 1 23  ? -8.981  -0.836  -4.164  1.00 0.00 ? 23  GLN A O    5  
ATOM 7511  C CB   . GLN A 1 23  ? -8.679  2.259   -4.956  1.00 0.00 ? 23  GLN A CB   5  
ATOM 7512  C CG   . GLN A 1 23  ? -9.296  2.500   -3.588  1.00 0.00 ? 23  GLN A CG   5  
ATOM 7513  C CD   . GLN A 1 23  ? -10.536 1.663   -3.350  1.00 0.00 ? 23  GLN A CD   5  
ATOM 7514  O OE1  . GLN A 1 23  ? -11.622 1.992   -3.828  1.00 0.00 ? 23  GLN A OE1  5  
ATOM 7515  N NE2  . GLN A 1 23  ? -10.382 0.572   -2.609  1.00 0.00 ? 23  GLN A NE2  5  
ATOM 7516  H H    . GLN A 1 23  ? -7.120  1.341   -7.002  1.00 0.00 ? 23  GLN A H    5  
ATOM 7517  H HA   . GLN A 1 23  ? -7.191  0.996   -4.078  1.00 0.00 ? 23  GLN A HA   5  
ATOM 7518  H HB2  . GLN A 1 23  ? -8.120  3.138   -5.236  1.00 0.00 ? 23  GLN A HB2  5  
ATOM 7519  H HB3  . GLN A 1 23  ? -9.479  2.110   -5.666  1.00 0.00 ? 23  GLN A HB3  5  
ATOM 7520  H HG2  . GLN A 1 23  ? -8.566  2.257   -2.830  1.00 0.00 ? 23  GLN A HG2  5  
ATOM 7521  H HG3  . GLN A 1 23  ? -9.562  3.544   -3.507  1.00 0.00 ? 23  GLN A HG3  5  
ATOM 7522  H HE21 . GLN A 1 23  ? -9.487  0.373   -2.260  1.00 0.00 ? 23  GLN A HE21 5  
ATOM 7523  H HE22 . GLN A 1 23  ? -11.167 0.013   -2.439  1.00 0.00 ? 23  GLN A HE22 5  
ATOM 7524  N N    . HIS A 1 24  ? -8.791  -0.640  -6.398  1.00 0.00 ? 24  HIS A N    5  
ATOM 7525  C CA   . HIS A 1 24  ? -9.558  -1.848  -6.679  1.00 0.00 ? 24  HIS A CA   5  
ATOM 7526  C C    . HIS A 1 24  ? -8.697  -2.886  -7.394  1.00 0.00 ? 24  HIS A C    5  
ATOM 7527  O O    . HIS A 1 24  ? -8.172  -2.631  -8.477  1.00 0.00 ? 24  HIS A O    5  
ATOM 7528  C CB   . HIS A 1 24  ? -10.784 -1.513  -7.530  1.00 0.00 ? 24  HIS A CB   5  
ATOM 7529  C CG   . HIS A 1 24  ? -11.876 -0.832  -6.765  1.00 0.00 ? 24  HIS A CG   5  
ATOM 7530  N ND1  . HIS A 1 24  ? -12.334 0.433   -7.071  1.00 0.00 ? 24  HIS A ND1  5  
ATOM 7531  C CD2  . HIS A 1 24  ? -12.604 -1.247  -5.702  1.00 0.00 ? 24  HIS A CD2  5  
ATOM 7532  C CE1  . HIS A 1 24  ? -13.295 0.766   -6.228  1.00 0.00 ? 24  HIS A CE1  5  
ATOM 7533  N NE2  . HIS A 1 24  ? -13.478 -0.236  -5.387  1.00 0.00 ? 24  HIS A NE2  5  
ATOM 7534  H H    . HIS A 1 24  ? -8.433  -0.117  -7.145  1.00 0.00 ? 24  HIS A H    5  
ATOM 7535  H HA   . HIS A 1 24  ? -9.887  -2.259  -5.737  1.00 0.00 ? 24  HIS A HA   5  
ATOM 7536  H HB2  . HIS A 1 24  ? -10.486 -0.858  -8.336  1.00 0.00 ? 24  HIS A HB2  5  
ATOM 7537  H HB3  . HIS A 1 24  ? -11.187 -2.426  -7.945  1.00 0.00 ? 24  HIS A HB3  5  
ATOM 7538  H HD1  . HIS A 1 24  ? -12.003 1.001   -7.796  1.00 0.00 ? 24  HIS A HD1  5  
ATOM 7539  H HD2  . HIS A 1 24  ? -12.514 -2.197  -5.194  1.00 0.00 ? 24  HIS A HD2  5  
ATOM 7540  H HE1  . HIS A 1 24  ? -13.838 1.699   -6.226  1.00 0.00 ? 24  HIS A HE1  5  
ATOM 7541  H HE2  . HIS A 1 24  ? -14.071 -0.217  -4.608  1.00 0.00 ? 24  HIS A HE2  5  
ATOM 7542  N N    . ALA A 1 25  ? -8.555  -4.055  -6.778  1.00 0.00 ? 25  ALA A N    5  
ATOM 7543  C CA   . ALA A 1 25  ? -7.759  -5.130  -7.356  1.00 0.00 ? 25  ALA A CA   5  
ATOM 7544  C C    . ALA A 1 25  ? -8.635  -6.318  -7.739  1.00 0.00 ? 25  ALA A C    5  
ATOM 7545  O O    . ALA A 1 25  ? -9.444  -6.790  -6.938  1.00 0.00 ? 25  ALA A O    5  
ATOM 7546  C CB   . ALA A 1 25  ? -6.674  -5.565  -6.381  1.00 0.00 ? 25  ALA A CB   5  
ATOM 7547  H H    . ALA A 1 25  ? -8.998  -4.198  -5.916  1.00 0.00 ? 25  ALA A H    5  
ATOM 7548  H HA   . ALA A 1 25  ? -7.278  -4.749  -8.245  1.00 0.00 ? 25  ALA A HA   5  
ATOM 7549  H HB1  . ALA A 1 25  ? -6.223  -4.692  -5.933  1.00 0.00 ? 25  ALA A HB1  5  
ATOM 7550  H HB2  . ALA A 1 25  ? -7.110  -6.182  -5.610  1.00 0.00 ? 25  ALA A HB2  5  
ATOM 7551  H HB3  . ALA A 1 25  ? -5.920  -6.129  -6.911  1.00 0.00 ? 25  ALA A HB3  5  
ATOM 7552  N N    . LEU A 1 26  ? -8.471  -6.796  -8.967  1.00 0.00 ? 26  LEU A N    5  
ATOM 7553  C CA   . LEU A 1 26  ? -9.249  -7.930  -9.457  1.00 0.00 ? 26  LEU A CA   5  
ATOM 7554  C C    . LEU A 1 26  ? -8.658  -9.248  -8.968  1.00 0.00 ? 26  LEU A C    5  
ATOM 7555  O O    . LEU A 1 26  ? -7.472  -9.519  -9.162  1.00 0.00 ? 26  LEU A O    5  
ATOM 7556  C CB   . LEU A 1 26  ? -9.299  -7.916  -10.986 1.00 0.00 ? 26  LEU A CB   5  
ATOM 7557  C CG   . LEU A 1 26  ? -10.112 -9.034  -11.640 1.00 0.00 ? 26  LEU A CG   5  
ATOM 7558  C CD1  . LEU A 1 26  ? -11.566 -8.617  -11.794 1.00 0.00 ? 26  LEU A CD1  5  
ATOM 7559  C CD2  . LEU A 1 26  ? -9.516  -9.405  -12.991 1.00 0.00 ? 26  LEU A CD2  5  
ATOM 7560  H H    . LEU A 1 26  ? -7.812  -6.379  -9.559  1.00 0.00 ? 26  LEU A H    5  
ATOM 7561  H HA   . LEU A 1 26  ? -10.253 -7.834  -9.071  1.00 0.00 ? 26  LEU A HA   5  
ATOM 7562  H HB2  . LEU A 1 26  ? -9.725  -6.974  -11.294 1.00 0.00 ? 26  LEU A HB2  5  
ATOM 7563  H HB3  . LEU A 1 26  ? -8.284  -7.987  -11.350 1.00 0.00 ? 26  LEU A HB3  5  
ATOM 7564  H HG   . LEU A 1 26  ? -10.081 -9.910  -11.008 1.00 0.00 ? 26  LEU A HG   5  
ATOM 7565  H HD11 . LEU A 1 26  ? -11.662 -7.562  -11.586 1.00 0.00 ? 26  LEU A HD11 5  
ATOM 7566  H HD12 . LEU A 1 26  ? -12.176 -9.177  -11.101 1.00 0.00 ? 26  LEU A HD12 5  
ATOM 7567  H HD13 . LEU A 1 26  ? -11.893 -8.817  -12.804 1.00 0.00 ? 26  LEU A HD13 5  
ATOM 7568  H HD21 . LEU A 1 26  ? -8.801  -10.204 -12.860 1.00 0.00 ? 26  LEU A HD21 5  
ATOM 7569  H HD22 . LEU A 1 26  ? -9.020  -8.544  -13.415 1.00 0.00 ? 26  LEU A HD22 5  
ATOM 7570  H HD23 . LEU A 1 26  ? -10.303 -9.731  -13.654 1.00 0.00 ? 26  LEU A HD23 5  
ATOM 7571  N N    . HIS A 1 27  ? -9.492  -10.066 -8.334  1.00 0.00 ? 27  HIS A N    5  
ATOM 7572  C CA   . HIS A 1 27  ? -9.053  -11.358 -7.819  1.00 0.00 ? 27  HIS A CA   5  
ATOM 7573  C C    . HIS A 1 27  ? -8.327  -12.155 -8.899  1.00 0.00 ? 27  HIS A C    5  
ATOM 7574  O O    . HIS A 1 27  ? -8.957  -12.794 -9.741  1.00 0.00 ? 27  HIS A O    5  
ATOM 7575  C CB   . HIS A 1 27  ? -10.248 -12.155 -7.296  1.00 0.00 ? 27  HIS A CB   5  
ATOM 7576  C CG   . HIS A 1 27  ? -9.888  -13.528 -6.817  1.00 0.00 ? 27  HIS A CG   5  
ATOM 7577  N ND1  . HIS A 1 27  ? -10.447 -14.677 -7.337  1.00 0.00 ? 27  HIS A ND1  5  
ATOM 7578  C CD2  . HIS A 1 27  ? -9.019  -13.933 -5.862  1.00 0.00 ? 27  HIS A CD2  5  
ATOM 7579  C CE1  . HIS A 1 27  ? -9.939  -15.729 -6.720  1.00 0.00 ? 27  HIS A CE1  5  
ATOM 7580  N NE2  . HIS A 1 27  ? -9.069  -15.305 -5.821  1.00 0.00 ? 27  HIS A NE2  5  
ATOM 7581  H H    . HIS A 1 27  ? -10.425 -9.794  -8.209  1.00 0.00 ? 27  HIS A H    5  
ATOM 7582  H HA   . HIS A 1 27  ? -8.369  -11.175 -7.004  1.00 0.00 ? 27  HIS A HA   5  
ATOM 7583  H HB2  . HIS A 1 27  ? -10.694 -11.622 -6.469  1.00 0.00 ? 27  HIS A HB2  5  
ATOM 7584  H HB3  . HIS A 1 27  ? -10.977 -12.259 -8.087  1.00 0.00 ? 27  HIS A HB3  5  
ATOM 7585  H HD1  . HIS A 1 27  ? -11.118 -14.715 -8.049  1.00 0.00 ? 27  HIS A HD1  5  
ATOM 7586  H HD2  . HIS A 1 27  ? -8.400  -13.296 -5.246  1.00 0.00 ? 27  HIS A HD2  5  
ATOM 7587  H HE1  . HIS A 1 27  ? -10.190 -16.760 -6.918  1.00 0.00 ? 27  HIS A HE1  5  
ATOM 7588  H HE2  . HIS A 1 27  ? -8.611  -15.873 -5.167  1.00 0.00 ? 27  HIS A HE2  5  
ATOM 7589  N N    . GLY A 1 28  ? -6.999  -12.110 -8.869  1.00 0.00 ? 28  GLY A N    5  
ATOM 7590  C CA   . GLY A 1 28  ? -6.210  -12.831 -9.851  1.00 0.00 ? 28  GLY A CA   5  
ATOM 7591  C C    . GLY A 1 28  ? -4.929  -12.106 -10.212 1.00 0.00 ? 28  GLY A C    5  
ATOM 7592  O O    . GLY A 1 28  ? -3.848  -12.694 -10.189 1.00 0.00 ? 28  GLY A O    5  
ATOM 7593  H H    . GLY A 1 28  ? -6.550  -11.584 -8.174  1.00 0.00 ? 28  GLY A H    5  
ATOM 7594  H HA2  . GLY A 1 28  ? -5.961  -13.804 -9.453  1.00 0.00 ? 28  GLY A HA2  5  
ATOM 7595  H HA3  . GLY A 1 28  ? -6.801  -12.960 -10.746 1.00 0.00 ? 28  GLY A HA3  5  
ATOM 7596  N N    . GLU A 1 29  ? -5.050  -10.825 -10.547 1.00 0.00 ? 29  GLU A N    5  
ATOM 7597  C CA   . GLU A 1 29  ? -3.892  -10.020 -10.917 1.00 0.00 ? 29  GLU A CA   5  
ATOM 7598  C C    . GLU A 1 29  ? -3.043  -9.694  -9.691  1.00 0.00 ? 29  GLU A C    5  
ATOM 7599  O O    . GLU A 1 29  ? -3.442  -9.957  -8.557  1.00 0.00 ? 29  GLU A O    5  
ATOM 7600  C CB   . GLU A 1 29  ? -4.339  -8.726  -11.600 1.00 0.00 ? 29  GLU A CB   5  
ATOM 7601  C CG   . GLU A 1 29  ? -5.405  -7.967  -10.828 1.00 0.00 ? 29  GLU A CG   5  
ATOM 7602  C CD   . GLU A 1 29  ? -5.575  -6.542  -11.316 1.00 0.00 ? 29  GLU A CD   5  
ATOM 7603  O OE1  . GLU A 1 29  ? -6.106  -6.357  -12.432 1.00 0.00 ? 29  GLU A OE1  5  
ATOM 7604  O OE2  . GLU A 1 29  ? -5.177  -5.611  -10.585 1.00 0.00 ? 29  GLU A OE2  5  
ATOM 7605  H H    . GLU A 1 29  ? -5.939  -10.412 -10.546 1.00 0.00 ? 29  GLU A H    5  
ATOM 7606  H HA   . GLU A 1 29  ? -3.296  -10.595 -11.609 1.00 0.00 ? 29  GLU A HA   5  
ATOM 7607  H HB2  . GLU A 1 29  ? -3.481  -8.081  -11.720 1.00 0.00 ? 29  GLU A HB2  5  
ATOM 7608  H HB3  . GLU A 1 29  ? -4.735  -8.968  -12.576 1.00 0.00 ? 29  GLU A HB3  5  
ATOM 7609  H HG2  . GLU A 1 29  ? -6.347  -8.483  -10.936 1.00 0.00 ? 29  GLU A HG2  5  
ATOM 7610  H HG3  . GLU A 1 29  ? -5.127  -7.943  -9.784  1.00 0.00 ? 29  GLU A HG3  5  
ATOM 7611  N N    . LYS A 1 30  ? -1.869  -9.119  -9.929  1.00 0.00 ? 30  LYS A N    5  
ATOM 7612  C CA   . LYS A 1 30  ? -0.962  -8.755  -8.847  1.00 0.00 ? 30  LYS A CA   5  
ATOM 7613  C C    . LYS A 1 30  ? -1.447  -7.499  -8.129  1.00 0.00 ? 30  LYS A C    5  
ATOM 7614  O O    . LYS A 1 30  ? -1.301  -6.388  -8.635  1.00 0.00 ? 30  LYS A O    5  
ATOM 7615  C CB   . LYS A 1 30  ? 0.451   -8.530  -9.391  1.00 0.00 ? 30  LYS A CB   5  
ATOM 7616  C CG   . LYS A 1 30  ? 1.150   -9.810  -9.814  1.00 0.00 ? 30  LYS A CG   5  
ATOM 7617  C CD   . LYS A 1 30  ? 2.659   -9.696  -9.668  1.00 0.00 ? 30  LYS A CD   5  
ATOM 7618  C CE   . LYS A 1 30  ? 3.350   -11.015 -9.977  1.00 0.00 ? 30  LYS A CE   5  
ATOM 7619  N NZ   . LYS A 1 30  ? 3.299   -11.952 -8.821  1.00 0.00 ? 30  LYS A NZ   5  
ATOM 7620  H H    . LYS A 1 30  ? -1.606  -8.934  -10.855 1.00 0.00 ? 30  LYS A H    5  
ATOM 7621  H HA   . LYS A 1 30  ? -0.941  -9.572  -8.142  1.00 0.00 ? 30  LYS A HA   5  
ATOM 7622  H HB2  . LYS A 1 30  ? 0.393   -7.876  -10.249 1.00 0.00 ? 30  LYS A HB2  5  
ATOM 7623  H HB3  . LYS A 1 30  ? 1.047   -8.055  -8.626  1.00 0.00 ? 30  LYS A HB3  5  
ATOM 7624  H HG2  . LYS A 1 30  ? 0.800   -10.623 -9.195  1.00 0.00 ? 30  LYS A HG2  5  
ATOM 7625  H HG3  . LYS A 1 30  ? 0.913   -10.015 -10.848 1.00 0.00 ? 30  LYS A HG3  5  
ATOM 7626  H HD2  . LYS A 1 30  ? 3.022   -8.943  -10.351 1.00 0.00 ? 30  LYS A HD2  5  
ATOM 7627  H HD3  . LYS A 1 30  ? 2.892   -9.406  -8.653  1.00 0.00 ? 30  LYS A HD3  5  
ATOM 7628  H HE2  . LYS A 1 30  ? 2.861   -11.473 -10.823 1.00 0.00 ? 30  LYS A HE2  5  
ATOM 7629  H HE3  . LYS A 1 30  ? 4.383   -10.815 -10.223 1.00 0.00 ? 30  LYS A HE3  5  
ATOM 7630  H HZ1  . LYS A 1 30  ? 3.651   -11.481 -7.964  1.00 0.00 ? 30  LYS A HZ1  5  
ATOM 7631  H HZ2  . LYS A 1 30  ? 3.889   -12.787 -9.012  1.00 0.00 ? 30  LYS A HZ2  5  
ATOM 7632  H HZ3  . LYS A 1 30  ? 2.320   -12.263 -8.656  1.00 0.00 ? 30  LYS A HZ3  5  
ATOM 7633  N N    . GLY A 1 31  ? -2.024  -7.685  -6.946  1.00 0.00 ? 31  GLY A N    5  
ATOM 7634  C CA   . GLY A 1 31  ? -2.521  -6.558  -6.178  1.00 0.00 ? 31  GLY A CA   5  
ATOM 7635  C C    . GLY A 1 31  ? -1.440  -5.538  -5.880  1.00 0.00 ? 31  GLY A C    5  
ATOM 7636  O O    . GLY A 1 31  ? -0.734  -5.647  -4.879  1.00 0.00 ? 31  GLY A O    5  
ATOM 7637  H H    . GLY A 1 31  ? -2.114  -8.595  -6.592  1.00 0.00 ? 31  GLY A H    5  
ATOM 7638  H HA2  . GLY A 1 31  ? -3.312  -6.078  -6.734  1.00 0.00 ? 31  GLY A HA2  5  
ATOM 7639  H HA3  . GLY A 1 31  ? -2.922  -6.923  -5.243  1.00 0.00 ? 31  GLY A HA3  5  
ATOM 7640  N N    . GLN A 1 32  ? -1.310  -4.545  -6.754  1.00 0.00 ? 32  GLN A N    5  
ATOM 7641  C CA   . GLN A 1 32  ? -0.305  -3.502  -6.580  1.00 0.00 ? 32  GLN A CA   5  
ATOM 7642  C C    . GLN A 1 32  ? -0.916  -2.259  -5.941  1.00 0.00 ? 32  GLN A C    5  
ATOM 7643  O O    . GLN A 1 32  ? -2.064  -1.908  -6.215  1.00 0.00 ? 32  GLN A O    5  
ATOM 7644  C CB   . GLN A 1 32  ? 0.323   -3.141  -7.927  1.00 0.00 ? 32  GLN A CB   5  
ATOM 7645  C CG   . GLN A 1 32  ? 1.702   -2.512  -7.806  1.00 0.00 ? 32  GLN A CG   5  
ATOM 7646  C CD   . GLN A 1 32  ? 2.448   -2.484  -9.126  1.00 0.00 ? 32  GLN A CD   5  
ATOM 7647  O OE1  . GLN A 1 32  ? 1.999   -1.869  -10.093 1.00 0.00 ? 32  GLN A OE1  5  
ATOM 7648  N NE2  . GLN A 1 32  ? 3.595   -3.151  -9.172  1.00 0.00 ? 32  GLN A NE2  5  
ATOM 7649  H H    . GLN A 1 32  ? -1.903  -4.512  -7.533  1.00 0.00 ? 32  GLN A H    5  
ATOM 7650  H HA   . GLN A 1 32  ? 0.463   -3.888  -5.927  1.00 0.00 ? 32  GLN A HA   5  
ATOM 7651  H HB2  . GLN A 1 32  ? 0.410   -4.038  -8.522  1.00 0.00 ? 32  GLN A HB2  5  
ATOM 7652  H HB3  . GLN A 1 32  ? -0.324  -2.442  -8.437  1.00 0.00 ? 32  GLN A HB3  5  
ATOM 7653  H HG2  . GLN A 1 32  ? 1.591   -1.498  -7.452  1.00 0.00 ? 32  GLN A HG2  5  
ATOM 7654  H HG3  . GLN A 1 32  ? 2.281   -3.081  -7.094  1.00 0.00 ? 32  GLN A HG3  5  
ATOM 7655  H HE21 . GLN A 1 32  ? 3.890   -3.619  -8.362  1.00 0.00 ? 32  GLN A HE21 5  
ATOM 7656  H HE22 . GLN A 1 32  ? 4.098   -3.151  -10.012 1.00 0.00 ? 32  GLN A HE22 5  
ATOM 7657  N N    . ILE A 1 33  ? -0.141  -1.598  -5.088  1.00 0.00 ? 33  ILE A N    5  
ATOM 7658  C CA   . ILE A 1 33  ? -0.605  -0.394  -4.410  1.00 0.00 ? 33  ILE A CA   5  
ATOM 7659  C C    . ILE A 1 33  ? 0.452   0.704   -4.455  1.00 0.00 ? 33  ILE A C    5  
ATOM 7660  O O    . ILE A 1 33  ? 1.321   0.781   -3.586  1.00 0.00 ? 33  ILE A O    5  
ATOM 7661  C CB   . ILE A 1 33  ? -0.970  -0.680  -2.942  1.00 0.00 ? 33  ILE A CB   5  
ATOM 7662  C CG1  . ILE A 1 33  ? -2.026  -1.784  -2.862  1.00 0.00 ? 33  ILE A CG1  5  
ATOM 7663  C CG2  . ILE A 1 33  ? -1.470  0.587   -2.264  1.00 0.00 ? 33  ILE A CG2  5  
ATOM 7664  C CD1  . ILE A 1 33  ? -2.181  -2.372  -1.477  1.00 0.00 ? 33  ILE A CD1  5  
ATOM 7665  H H    . ILE A 1 33  ? 0.765   -1.927  -4.910  1.00 0.00 ? 33  ILE A H    5  
ATOM 7666  H HA   . ILE A 1 33  ? -1.492  -0.046  -4.920  1.00 0.00 ? 33  ILE A HA   5  
ATOM 7667  H HB   . ILE A 1 33  ? -0.078  -1.006  -2.429  1.00 0.00 ? 33  ILE A HB   5  
ATOM 7668  H HG12 . ILE A 1 33  ? -2.982  -1.383  -3.160  1.00 0.00 ? 33  ILE A HG12 5  
ATOM 7669  H HG13 . ILE A 1 33  ? -1.750  -2.584  -3.534  1.00 0.00 ? 33  ILE A HG13 5  
ATOM 7670  H HG21 . ILE A 1 33  ? -0.626  1.177   -1.937  1.00 0.00 ? 33  ILE A HG21 5  
ATOM 7671  H HG22 . ILE A 1 33  ? -2.059  1.161   -2.963  1.00 0.00 ? 33  ILE A HG22 5  
ATOM 7672  H HG23 . ILE A 1 33  ? -2.077  0.325   -1.411  1.00 0.00 ? 33  ILE A HG23 5  
ATOM 7673  H HD11 . ILE A 1 33  ? -2.170  -1.578  -0.745  1.00 0.00 ? 33  ILE A HD11 5  
ATOM 7674  H HD12 . ILE A 1 33  ? -3.117  -2.908  -1.415  1.00 0.00 ? 33  ILE A HD12 5  
ATOM 7675  H HD13 . ILE A 1 33  ? -1.365  -3.052  -1.281  1.00 0.00 ? 33  ILE A HD13 5  
ATOM 7676  N N    . LYS A 1 34  ? 0.371   1.555   -5.472  1.00 0.00 ? 34  LYS A N    5  
ATOM 7677  C CA   . LYS A 1 34  ? 1.317   2.653   -5.630  1.00 0.00 ? 34  LYS A CA   5  
ATOM 7678  C C    . LYS A 1 34  ? 0.906   3.852   -4.783  1.00 0.00 ? 34  LYS A C    5  
ATOM 7679  O O    . LYS A 1 34  ? -0.099  4.507   -5.064  1.00 0.00 ? 34  LYS A O    5  
ATOM 7680  C CB   . LYS A 1 34  ? 1.414   3.063   -7.102  1.00 0.00 ? 34  LYS A CB   5  
ATOM 7681  C CG   . LYS A 1 34  ? 2.413   4.177   -7.358  1.00 0.00 ? 34  LYS A CG   5  
ATOM 7682  C CD   . LYS A 1 34  ? 2.430   4.585   -8.822  1.00 0.00 ? 34  LYS A CD   5  
ATOM 7683  C CE   . LYS A 1 34  ? 3.231   3.604   -9.664  1.00 0.00 ? 34  LYS A CE   5  
ATOM 7684  N NZ   . LYS A 1 34  ? 3.082   3.873   -11.121 1.00 0.00 ? 34  LYS A NZ   5  
ATOM 7685  H H    . LYS A 1 34  ? -0.345  1.442   -6.133  1.00 0.00 ? 34  LYS A H    5  
ATOM 7686  H HA   . LYS A 1 34  ? 2.284   2.307   -5.298  1.00 0.00 ? 34  LYS A HA   5  
ATOM 7687  H HB2  . LYS A 1 34  ? 1.708   2.202   -7.684  1.00 0.00 ? 34  LYS A HB2  5  
ATOM 7688  H HB3  . LYS A 1 34  ? 0.441   3.396   -7.434  1.00 0.00 ? 34  LYS A HB3  5  
ATOM 7689  H HG2  . LYS A 1 34  ? 2.143   5.035   -6.760  1.00 0.00 ? 34  LYS A HG2  5  
ATOM 7690  H HG3  . LYS A 1 34  ? 3.399   3.836   -7.077  1.00 0.00 ? 34  LYS A HG3  5  
ATOM 7691  H HD2  . LYS A 1 34  ? 1.415   4.614   -9.191  1.00 0.00 ? 34  LYS A HD2  5  
ATOM 7692  H HD3  . LYS A 1 34  ? 2.874   5.567   -8.908  1.00 0.00 ? 34  LYS A HD3  5  
ATOM 7693  H HE2  . LYS A 1 34  ? 4.273   3.687   -9.396  1.00 0.00 ? 34  LYS A HE2  5  
ATOM 7694  H HE3  . LYS A 1 34  ? 2.884   2.603   -9.455  1.00 0.00 ? 34  LYS A HE3  5  
ATOM 7695  H HZ1  . LYS A 1 34  ? 4.010   3.825   -11.590 1.00 0.00 ? 34  LYS A HZ1  5  
ATOM 7696  H HZ2  . LYS A 1 34  ? 2.680   4.821   -11.270 1.00 0.00 ? 34  LYS A HZ2  5  
ATOM 7697  H HZ3  . LYS A 1 34  ? 2.451   3.169   -11.553 1.00 0.00 ? 34  LYS A HZ3  5  
ATOM 7698  N N    . CYS A 1 35  ? 1.688   4.136   -3.748  1.00 0.00 ? 35  CYS A N    5  
ATOM 7699  C CA   . CYS A 1 35  ? 1.405   5.258   -2.860  1.00 0.00 ? 35  CYS A CA   5  
ATOM 7700  C C    . CYS A 1 35  ? 2.091   6.528   -3.353  1.00 0.00 ? 35  CYS A C    5  
ATOM 7701  O O    . CYS A 1 35  ? 3.095   6.468   -4.063  1.00 0.00 ? 35  CYS A O    5  
ATOM 7702  C CB   . CYS A 1 35  ? 1.862   4.937   -1.436  1.00 0.00 ? 35  CYS A CB   5  
ATOM 7703  S SG   . CYS A 1 35  ? 0.986   5.861   -0.153  1.00 0.00 ? 35  CYS A SG   5  
ATOM 7704  H H    . CYS A 1 35  ? 2.475   3.577   -3.575  1.00 0.00 ? 35  CYS A H    5  
ATOM 7705  H HA   . CYS A 1 35  ? 0.338   5.417   -2.859  1.00 0.00 ? 35  CYS A HA   5  
ATOM 7706  H HB2  . CYS A 1 35  ? 1.708   3.885   -1.245  1.00 0.00 ? 35  CYS A HB2  5  
ATOM 7707  H HB3  . CYS A 1 35  ? 2.914   5.162   -1.345  1.00 0.00 ? 35  CYS A HB3  5  
ATOM 7708  H HG   . CYS A 1 35  ? 0.214   5.011   0.508   1.00 0.00 ? 35  CYS A HG   5  
ATOM 7709  N N    . PHE A 1 36  ? 1.541   7.676   -2.973  1.00 0.00 ? 36  PHE A N    5  
ATOM 7710  C CA   . PHE A 1 36  ? 2.098   8.961   -3.379  1.00 0.00 ? 36  PHE A CA   5  
ATOM 7711  C C    . PHE A 1 36  ? 2.751   9.669   -2.195  1.00 0.00 ? 36  PHE A C    5  
ATOM 7712  O O    . PHE A 1 36  ? 2.112   10.462  -1.503  1.00 0.00 ? 36  PHE A O    5  
ATOM 7713  C CB   . PHE A 1 36  ? 1.005   9.849   -3.979  1.00 0.00 ? 36  PHE A CB   5  
ATOM 7714  C CG   . PHE A 1 36  ? 0.806   9.641   -5.453  1.00 0.00 ? 36  PHE A CG   5  
ATOM 7715  C CD1  . PHE A 1 36  ? 1.228   8.471   -6.064  1.00 0.00 ? 36  PHE A CD1  5  
ATOM 7716  C CD2  . PHE A 1 36  ? 0.196   10.615  -6.227  1.00 0.00 ? 36  PHE A CD2  5  
ATOM 7717  C CE1  . PHE A 1 36  ? 1.045   8.277   -7.420  1.00 0.00 ? 36  PHE A CE1  5  
ATOM 7718  C CE2  . PHE A 1 36  ? 0.011   10.426  -7.583  1.00 0.00 ? 36  PHE A CE2  5  
ATOM 7719  C CZ   . PHE A 1 36  ? 0.437   9.256   -8.181  1.00 0.00 ? 36  PHE A CZ   5  
ATOM 7720  H H    . PHE A 1 36  ? 0.741   7.659   -2.407  1.00 0.00 ? 36  PHE A H    5  
ATOM 7721  H HA   . PHE A 1 36  ? 2.850   8.774   -4.130  1.00 0.00 ? 36  PHE A HA   5  
ATOM 7722  H HB2  . PHE A 1 36  ? 0.069   9.637   -3.484  1.00 0.00 ? 36  PHE A HB2  5  
ATOM 7723  H HB3  . PHE A 1 36  ? 1.266   10.884  -3.820  1.00 0.00 ? 36  PHE A HB3  5  
ATOM 7724  H HD1  . PHE A 1 36  ? 1.704   7.705   -5.470  1.00 0.00 ? 36  PHE A HD1  5  
ATOM 7725  H HD2  . PHE A 1 36  ? -0.136  11.531  -5.761  1.00 0.00 ? 36  PHE A HD2  5  
ATOM 7726  H HE1  . PHE A 1 36  ? 1.380   7.361   -7.884  1.00 0.00 ? 36  PHE A HE1  5  
ATOM 7727  H HE2  . PHE A 1 36  ? -0.465  11.193  -8.176  1.00 0.00 ? 36  PHE A HE2  5  
ATOM 7728  H HZ   . PHE A 1 36  ? 0.293   9.106   -9.240  1.00 0.00 ? 36  PHE A HZ   5  
ATOM 7729  N N    . ILE A 1 37  ? 4.028   9.376   -1.970  1.00 0.00 ? 37  ILE A N    5  
ATOM 7730  C CA   . ILE A 1 37  ? 4.767   9.984   -0.871  1.00 0.00 ? 37  ILE A CA   5  
ATOM 7731  C C    . ILE A 1 37  ? 5.554   11.202  -1.345  1.00 0.00 ? 37  ILE A C    5  
ATOM 7732  O O    . ILE A 1 37  ? 6.519   11.075  -2.099  1.00 0.00 ? 37  ILE A O    5  
ATOM 7733  C CB   . ILE A 1 37  ? 5.739   8.980   -0.222  1.00 0.00 ? 37  ILE A CB   5  
ATOM 7734  C CG1  . ILE A 1 37  ? 5.072   7.611   -0.081  1.00 0.00 ? 37  ILE A CG1  5  
ATOM 7735  C CG2  . ILE A 1 37  ? 6.203   9.492   1.133   1.00 0.00 ? 37  ILE A CG2  5  
ATOM 7736  C CD1  . ILE A 1 37  ? 5.894   6.617   0.710   1.00 0.00 ? 37  ILE A CD1  5  
ATOM 7737  H H    . ILE A 1 37  ? 4.482   8.737   -2.556  1.00 0.00 ? 37  ILE A H    5  
ATOM 7738  H HA   . ILE A 1 37  ? 4.054   10.299  -0.123  1.00 0.00 ? 37  ILE A HA   5  
ATOM 7739  H HB   . ILE A 1 37  ? 6.604   8.887   -0.861  1.00 0.00 ? 37  ILE A HB   5  
ATOM 7740  H HG12 . ILE A 1 37  ? 4.124   7.729   0.420   1.00 0.00 ? 37  ILE A HG12 5  
ATOM 7741  H HG13 . ILE A 1 37  ? 4.905   7.196   -1.064  1.00 0.00 ? 37  ILE A HG13 5  
ATOM 7742  H HG21 . ILE A 1 37  ? 6.386   10.555  1.073   1.00 0.00 ? 37  ILE A HG21 5  
ATOM 7743  H HG22 . ILE A 1 37  ? 5.439   9.301   1.871   1.00 0.00 ? 37  ILE A HG22 5  
ATOM 7744  H HG23 . ILE A 1 37  ? 7.113   8.986   1.417   1.00 0.00 ? 37  ILE A HG23 5  
ATOM 7745  H HD11 . ILE A 1 37  ? 5.533   5.617   0.518   1.00 0.00 ? 37  ILE A HD11 5  
ATOM 7746  H HD12 . ILE A 1 37  ? 6.929   6.690   0.415   1.00 0.00 ? 37  ILE A HD12 5  
ATOM 7747  H HD13 . ILE A 1 37  ? 5.804   6.835   1.765   1.00 0.00 ? 37  ILE A HD13 5  
ATOM 7748  N N    . ARG A 1 38  ? 5.136   12.381  -0.896  1.00 0.00 ? 38  ARG A N    5  
ATOM 7749  C CA   . ARG A 1 38  ? 5.802   13.622  -1.274  1.00 0.00 ? 38  ARG A CA   5  
ATOM 7750  C C    . ARG A 1 38  ? 6.857   14.008  -0.241  1.00 0.00 ? 38  ARG A C    5  
ATOM 7751  O O    . ARG A 1 38  ? 7.107   15.191  -0.007  1.00 0.00 ? 38  ARG A O    5  
ATOM 7752  C CB   . ARG A 1 38  ? 4.779   14.750  -1.420  1.00 0.00 ? 38  ARG A CB   5  
ATOM 7753  C CG   . ARG A 1 38  ? 4.135   14.812  -2.795  1.00 0.00 ? 38  ARG A CG   5  
ATOM 7754  C CD   . ARG A 1 38  ? 2.793   15.527  -2.750  1.00 0.00 ? 38  ARG A CD   5  
ATOM 7755  N NE   . ARG A 1 38  ? 2.493   16.207  -4.007  1.00 0.00 ? 38  ARG A NE   5  
ATOM 7756  C CZ   . ARG A 1 38  ? 3.193   17.235  -4.473  1.00 0.00 ? 38  ARG A CZ   5  
ATOM 7757  N NH1  . ARG A 1 38  ? 4.229   17.700  -3.788  1.00 0.00 ? 38  ARG A NH1  5  
ATOM 7758  N NH2  . ARG A 1 38  ? 2.858   17.801  -5.625  1.00 0.00 ? 38  ARG A NH2  5  
ATOM 7759  H H    . ARG A 1 38  ? 4.361   12.417  -0.297  1.00 0.00 ? 38  ARG A H    5  
ATOM 7760  H HA   . ARG A 1 38  ? 6.287   13.462  -2.225  1.00 0.00 ? 38  ARG A HA   5  
ATOM 7761  H HB2  . ARG A 1 38  ? 3.998   14.610  -0.687  1.00 0.00 ? 38  ARG A HB2  5  
ATOM 7762  H HB3  . ARG A 1 38  ? 5.272   15.692  -1.235  1.00 0.00 ? 38  ARG A HB3  5  
ATOM 7763  H HG2  . ARG A 1 38  ? 4.791   15.345  -3.467  1.00 0.00 ? 38  ARG A HG2  5  
ATOM 7764  H HG3  . ARG A 1 38  ? 3.985   13.806  -3.158  1.00 0.00 ? 38  ARG A HG3  5  
ATOM 7765  H HD2  . ARG A 1 38  ? 2.020   14.801  -2.551  1.00 0.00 ? 38  ARG A HD2  5  
ATOM 7766  H HD3  . ARG A 1 38  ? 2.816   16.256  -1.954  1.00 0.00 ? 38  ARG A HD3  5  
ATOM 7767  H HE   . ARG A 1 38  ? 1.731   15.880  -4.529  1.00 0.00 ? 38  ARG A HE   5  
ATOM 7768  H HH11 . ARG A 1 38  ? 4.485   17.275  -2.920  1.00 0.00 ? 38  ARG A HH11 5  
ATOM 7769  H HH12 . ARG A 1 38  ? 4.756   18.473  -4.142  1.00 0.00 ? 38  ARG A HH12 5  
ATOM 7770  H HH21 . ARG A 1 38  ? 2.077   17.454  -6.144  1.00 0.00 ? 38  ARG A HH21 5  
ATOM 7771  H HH22 . ARG A 1 38  ? 3.385   18.575  -5.974  1.00 0.00 ? 38  ARG A HH22 5  
ATOM 7772  N N    . SER A 1 39  ? 7.473   13.003  0.373   1.00 0.00 ? 39  SER A N    5  
ATOM 7773  C CA   . SER A 1 39  ? 8.498   13.238  1.383   1.00 0.00 ? 39  SER A CA   5  
ATOM 7774  C C    . SER A 1 39  ? 9.699   13.959  0.781   1.00 0.00 ? 39  SER A C    5  
ATOM 7775  O O    . SER A 1 39  ? 10.327  13.469  -0.159  1.00 0.00 ? 39  SER A O    5  
ATOM 7776  C CB   . SER A 1 39  ? 8.943   11.914  2.006   1.00 0.00 ? 39  SER A CB   5  
ATOM 7777  O OG   . SER A 1 39  ? 10.023  12.109  2.903   1.00 0.00 ? 39  SER A OG   5  
ATOM 7778  H H    . SER A 1 39  ? 7.230   12.082  0.143   1.00 0.00 ? 39  SER A H    5  
ATOM 7779  H HA   . SER A 1 39  ? 8.068   13.861  2.153   1.00 0.00 ? 39  SER A HA   5  
ATOM 7780  H HB2  . SER A 1 39  ? 8.117   11.477  2.546   1.00 0.00 ? 39  SER A HB2  5  
ATOM 7781  H HB3  . SER A 1 39  ? 9.258   11.239  1.223   1.00 0.00 ? 39  SER A HB3  5  
ATOM 7782  H HG   . SER A 1 39  ? 9.859   11.621  3.713   1.00 0.00 ? 39  SER A HG   5  
ATOM 7783  N N    . THR A 1 40  ? 10.016  15.129  1.328   1.00 0.00 ? 40  THR A N    5  
ATOM 7784  C CA   . THR A 1 40  ? 11.141  15.920  0.845   1.00 0.00 ? 40  THR A CA   5  
ATOM 7785  C C    . THR A 1 40  ? 11.875  16.593  1.999   1.00 0.00 ? 40  THR A C    5  
ATOM 7786  O O    . THR A 1 40  ? 11.405  17.574  2.577   1.00 0.00 ? 40  THR A O    5  
ATOM 7787  C CB   . THR A 1 40  ? 10.682  16.997  -0.155  1.00 0.00 ? 40  THR A CB   5  
ATOM 7788  O OG1  . THR A 1 40  ? 10.020  16.383  -1.267  1.00 0.00 ? 40  THR A OG1  5  
ATOM 7789  C CG2  . THR A 1 40  ? 11.865  17.814  -0.652  1.00 0.00 ? 40  THR A CG2  5  
ATOM 7790  H H    . THR A 1 40  ? 9.478   15.467  2.074   1.00 0.00 ? 40  THR A H    5  
ATOM 7791  H HA   . THR A 1 40  ? 11.823  15.253  0.337   1.00 0.00 ? 40  THR A HA   5  
ATOM 7792  H HB   . THR A 1 40  ? 9.990   17.660  0.345   1.00 0.00 ? 40  THR A HB   5  
ATOM 7793  H HG1  . THR A 1 40  ? 9.175   16.027  -0.980  1.00 0.00 ? 40  THR A HG1  5  
ATOM 7794  H HG21 . THR A 1 40  ? 12.012  18.665  -0.004  1.00 0.00 ? 40  THR A HG21 5  
ATOM 7795  H HG22 . THR A 1 40  ? 11.670  18.156  -1.657  1.00 0.00 ? 40  THR A HG22 5  
ATOM 7796  H HG23 . THR A 1 40  ? 12.753  17.200  -0.646  1.00 0.00 ? 40  THR A HG23 5  
ATOM 7797  N N    . PRO A 1 41  ? 13.055  16.057  2.344   1.00 0.00 ? 41  PRO A N    5  
ATOM 7798  C CA   . PRO A 1 41  ? 13.623  14.890  1.664   1.00 0.00 ? 41  PRO A CA   5  
ATOM 7799  C C    . PRO A 1 41  ? 12.845  13.612  1.960   1.00 0.00 ? 41  PRO A C    5  
ATOM 7800  O O    . PRO A 1 41  ? 11.984  13.570  2.838   1.00 0.00 ? 41  PRO A O    5  
ATOM 7801  C CB   . PRO A 1 41  ? 15.039  14.799  2.239   1.00 0.00 ? 41  PRO A CB   5  
ATOM 7802  C CG   . PRO A 1 41  ? 14.950  15.460  3.571   1.00 0.00 ? 41  PRO A CG   5  
ATOM 7803  C CD   . PRO A 1 41  ? 13.925  16.550  3.425   1.00 0.00 ? 41  PRO A CD   5  
ATOM 7804  H HA   . PRO A 1 41  ? 13.675  15.039  0.596   1.00 0.00 ? 41  PRO A HA   5  
ATOM 7805  H HB2  . PRO A 1 41  ? 15.327  13.761  2.330   1.00 0.00 ? 41  PRO A HB2  5  
ATOM 7806  H HB3  . PRO A 1 41  ? 15.729  15.314  1.588   1.00 0.00 ? 41  PRO A HB3  5  
ATOM 7807  H HG2  . PRO A 1 41  ? 14.634  14.745  4.316   1.00 0.00 ? 41  PRO A HG2  5  
ATOM 7808  H HG3  . PRO A 1 41  ? 15.909  15.880  3.837   1.00 0.00 ? 41  PRO A HG3  5  
ATOM 7809  H HD2  . PRO A 1 41  ? 13.369  16.671  4.343   1.00 0.00 ? 41  PRO A HD2  5  
ATOM 7810  H HD3  . PRO A 1 41  ? 14.399  17.479  3.145   1.00 0.00 ? 41  PRO A HD3  5  
ATOM 7811  N N    . PRO A 1 42  ? 13.154  12.543  1.210   1.00 0.00 ? 42  PRO A N    5  
ATOM 7812  C CA   . PRO A 1 42  ? 12.496  11.244  1.374   1.00 0.00 ? 42  PRO A CA   5  
ATOM 7813  C C    . PRO A 1 42  ? 12.881  10.560  2.681   1.00 0.00 ? 42  PRO A C    5  
ATOM 7814  O O    . PRO A 1 42  ? 13.881  10.897  3.315   1.00 0.00 ? 42  PRO A O    5  
ATOM 7815  C CB   . PRO A 1 42  ? 13.004  10.435  0.178   1.00 0.00 ? 42  PRO A CB   5  
ATOM 7816  C CG   . PRO A 1 42  ? 14.311  11.059  -0.173  1.00 0.00 ? 42  PRO A CG   5  
ATOM 7817  C CD   . PRO A 1 42  ? 14.171  12.522  0.144   1.00 0.00 ? 42  PRO A CD   5  
ATOM 7818  H HA   . PRO A 1 42  ? 11.421  11.334  1.319   1.00 0.00 ? 42  PRO A HA   5  
ATOM 7819  H HB2  . PRO A 1 42  ? 13.124  9.400   0.464   1.00 0.00 ? 42  PRO A HB2  5  
ATOM 7820  H HB3  . PRO A 1 42  ? 12.300  10.510  -0.637  1.00 0.00 ? 42  PRO A HB3  5  
ATOM 7821  H HG2  . PRO A 1 42  ? 15.098  10.620  0.420   1.00 0.00 ? 42  PRO A HG2  5  
ATOM 7822  H HG3  . PRO A 1 42  ? 14.512  10.922  -1.226  1.00 0.00 ? 42  PRO A HG3  5  
ATOM 7823  H HD2  . PRO A 1 42  ? 15.109  12.923  0.498   1.00 0.00 ? 42  PRO A HD2  5  
ATOM 7824  H HD3  . PRO A 1 42  ? 13.829  13.065  -0.724  1.00 0.00 ? 42  PRO A HD3  5  
ATOM 7825  N N    . PRO A 1 43  ? 12.070  9.575   3.096   1.00 0.00 ? 43  PRO A N    5  
ATOM 7826  C CA   . PRO A 1 43  ? 12.307  8.823   4.332   1.00 0.00 ? 43  PRO A CA   5  
ATOM 7827  C C    . PRO A 1 43  ? 13.524  7.911   4.231   1.00 0.00 ? 43  PRO A C    5  
ATOM 7828  O O    . PRO A 1 43  ? 13.970  7.574   3.134   1.00 0.00 ? 43  PRO A O    5  
ATOM 7829  C CB   . PRO A 1 43  ? 11.030  7.994   4.492   1.00 0.00 ? 43  PRO A CB   5  
ATOM 7830  C CG   . PRO A 1 43  ? 10.494  7.852   3.109   1.00 0.00 ? 43  PRO A CG   5  
ATOM 7831  C CD   . PRO A 1 43  ? 10.860  9.121   2.391   1.00 0.00 ? 43  PRO A CD   5  
ATOM 7832  H HA   . PRO A 1 43  ? 12.420  9.480   5.181   1.00 0.00 ? 43  PRO A HA   5  
ATOM 7833  H HB2  . PRO A 1 43  ? 11.273  7.034   4.924   1.00 0.00 ? 43  PRO A HB2  5  
ATOM 7834  H HB3  . PRO A 1 43  ? 10.335  8.517   5.132   1.00 0.00 ? 43  PRO A HB3  5  
ATOM 7835  H HG2  . PRO A 1 43  ? 10.950  7.001   2.625   1.00 0.00 ? 43  PRO A HG2  5  
ATOM 7836  H HG3  . PRO A 1 43  ? 9.421   7.736   3.142   1.00 0.00 ? 43  PRO A HG3  5  
ATOM 7837  H HD2  . PRO A 1 43  ? 11.073  8.918   1.351   1.00 0.00 ? 43  PRO A HD2  5  
ATOM 7838  H HD3  . PRO A 1 43  ? 10.066  9.848   2.480   1.00 0.00 ? 43  PRO A HD3  5  
ATOM 7839  N N    . ASP A 1 44  ? 14.057  7.513   5.381   1.00 0.00 ? 44  ASP A N    5  
ATOM 7840  C CA   . ASP A 1 44  ? 15.223  6.638   5.422   1.00 0.00 ? 44  ASP A CA   5  
ATOM 7841  C C    . ASP A 1 44  ? 14.801  5.174   5.501   1.00 0.00 ? 44  ASP A C    5  
ATOM 7842  O O    . ASP A 1 44  ? 15.502  4.288   5.013   1.00 0.00 ? 44  ASP A O    5  
ATOM 7843  C CB   . ASP A 1 44  ? 16.111  6.991   6.616   1.00 0.00 ? 44  ASP A CB   5  
ATOM 7844  C CG   . ASP A 1 44  ? 16.935  8.241   6.375   1.00 0.00 ? 44  ASP A CG   5  
ATOM 7845  O OD1  . ASP A 1 44  ? 17.709  8.261   5.396   1.00 0.00 ? 44  ASP A OD1  5  
ATOM 7846  O OD2  . ASP A 1 44  ? 16.806  9.199   7.166   1.00 0.00 ? 44  ASP A OD2  5  
ATOM 7847  H H    . ASP A 1 44  ? 13.656  7.816   6.223   1.00 0.00 ? 44  ASP A H    5  
ATOM 7848  H HA   . ASP A 1 44  ? 15.783  6.789   4.511   1.00 0.00 ? 44  ASP A HA   5  
ATOM 7849  H HB2  . ASP A 1 44  ? 15.488  7.155   7.483   1.00 0.00 ? 44  ASP A HB2  5  
ATOM 7850  H HB3  . ASP A 1 44  ? 16.784  6.170   6.811   1.00 0.00 ? 44  ASP A HB3  5  
ATOM 7851  N N    . ARG A 1 45  ? 13.651  4.928   6.121   1.00 0.00 ? 45  ARG A N    5  
ATOM 7852  C CA   . ARG A 1 45  ? 13.137  3.572   6.266   1.00 0.00 ? 45  ARG A CA   5  
ATOM 7853  C C    . ARG A 1 45  ? 11.623  3.541   6.079   1.00 0.00 ? 45  ARG A C    5  
ATOM 7854  O O    . ARG A 1 45  ? 10.931  4.517   6.373   1.00 0.00 ? 45  ARG A O    5  
ATOM 7855  C CB   . ARG A 1 45  ? 13.503  3.010   7.641   1.00 0.00 ? 45  ARG A CB   5  
ATOM 7856  C CG   . ARG A 1 45  ? 12.652  1.822   8.060   1.00 0.00 ? 45  ARG A CG   5  
ATOM 7857  C CD   . ARG A 1 45  ? 12.868  1.470   9.523   1.00 0.00 ? 45  ARG A CD   5  
ATOM 7858  N NE   . ARG A 1 45  ? 12.419  2.535   10.415  1.00 0.00 ? 45  ARG A NE   5  
ATOM 7859  C CZ   . ARG A 1 45  ? 12.834  2.667   11.670  1.00 0.00 ? 45  ARG A CZ   5  
ATOM 7860  N NH1  . ARG A 1 45  ? 13.704  1.806   12.178  1.00 0.00 ? 45  ARG A NH1  5  
ATOM 7861  N NH2  . ARG A 1 45  ? 12.379  3.664   12.419  1.00 0.00 ? 45  ARG A NH2  5  
ATOM 7862  H H    . ARG A 1 45  ? 13.136  5.676   6.489   1.00 0.00 ? 45  ARG A H    5  
ATOM 7863  H HA   . ARG A 1 45  ? 13.594  2.960   5.504   1.00 0.00 ? 45  ARG A HA   5  
ATOM 7864  H HB2  . ARG A 1 45  ? 14.536  2.696   7.626   1.00 0.00 ? 45  ARG A HB2  5  
ATOM 7865  H HB3  . ARG A 1 45  ? 13.383  3.789   8.379   1.00 0.00 ? 45  ARG A HB3  5  
ATOM 7866  H HG2  . ARG A 1 45  ? 11.610  2.066   7.910   1.00 0.00 ? 45  ARG A HG2  5  
ATOM 7867  H HG3  . ARG A 1 45  ? 12.915  0.970   7.451   1.00 0.00 ? 45  ARG A HG3  5  
ATOM 7868  H HD2  . ARG A 1 45  ? 12.317  0.569   9.748   1.00 0.00 ? 45  ARG A HD2  5  
ATOM 7869  H HD3  . ARG A 1 45  ? 13.922  1.297   9.686   1.00 0.00 ? 45  ARG A HD3  5  
ATOM 7870  H HE   . ARG A 1 45  ? 11.776  3.183   10.060  1.00 0.00 ? 45  ARG A HE   5  
ATOM 7871  H HH11 . ARG A 1 45  ? 14.049  1.055   11.616  1.00 0.00 ? 45  ARG A HH11 5  
ATOM 7872  H HH12 . ARG A 1 45  ? 14.015  1.908   13.123  1.00 0.00 ? 45  ARG A HH12 5  
ATOM 7873  H HH21 . ARG A 1 45  ? 11.723  4.315   12.039  1.00 0.00 ? 45  ARG A HH21 5  
ATOM 7874  H HH22 . ARG A 1 45  ? 12.691  3.762   13.363  1.00 0.00 ? 45  ARG A HH22 5  
ATOM 7875  N N    . ILE A 1 46  ? 11.115  2.416   5.589   1.00 0.00 ? 46  ILE A N    5  
ATOM 7876  C CA   . ILE A 1 46  ? 9.684   2.258   5.363   1.00 0.00 ? 46  ILE A CA   5  
ATOM 7877  C C    . ILE A 1 46  ? 9.246   0.816   5.595   1.00 0.00 ? 46  ILE A C    5  
ATOM 7878  O O    . ILE A 1 46  ? 9.959   -0.124  5.246   1.00 0.00 ? 46  ILE A O    5  
ATOM 7879  C CB   . ILE A 1 46  ? 9.289   2.680   3.935   1.00 0.00 ? 46  ILE A CB   5  
ATOM 7880  C CG1  . ILE A 1 46  ? 9.684   4.136   3.682   1.00 0.00 ? 46  ILE A CG1  5  
ATOM 7881  C CG2  . ILE A 1 46  ? 7.796   2.484   3.719   1.00 0.00 ? 46  ILE A CG2  5  
ATOM 7882  C CD1  . ILE A 1 46  ? 9.415   4.598   2.267   1.00 0.00 ? 46  ILE A CD1  5  
ATOM 7883  H H    . ILE A 1 46  ? 11.717  1.673   5.374   1.00 0.00 ? 46  ILE A H    5  
ATOM 7884  H HA   . ILE A 1 46  ? 9.164   2.898   6.062   1.00 0.00 ? 46  ILE A HA   5  
ATOM 7885  H HB   . ILE A 1 46  ? 9.815   2.045   3.238   1.00 0.00 ? 46  ILE A HB   5  
ATOM 7886  H HG12 . ILE A 1 46  ? 9.127   4.774   4.350   1.00 0.00 ? 46  ILE A HG12 5  
ATOM 7887  H HG13 . ILE A 1 46  ? 10.740  4.253   3.875   1.00 0.00 ? 46  ILE A HG13 5  
ATOM 7888  H HG21 . ILE A 1 46  ? 7.344   3.429   3.455   1.00 0.00 ? 46  ILE A HG21 5  
ATOM 7889  H HG22 . ILE A 1 46  ? 7.638   1.776   2.920   1.00 0.00 ? 46  ILE A HG22 5  
ATOM 7890  H HG23 . ILE A 1 46  ? 7.346   2.111   4.626   1.00 0.00 ? 46  ILE A HG23 5  
ATOM 7891  H HD11 . ILE A 1 46  ? 8.849   5.518   2.289   1.00 0.00 ? 46  ILE A HD11 5  
ATOM 7892  H HD12 . ILE A 1 46  ? 10.352  4.763   1.757   1.00 0.00 ? 46  ILE A HD12 5  
ATOM 7893  H HD13 . ILE A 1 46  ? 8.849   3.841   1.743   1.00 0.00 ? 46  ILE A HD13 5  
ATOM 7894  N N    . ALA A 1 47  ? 8.066   0.649   6.185   1.00 0.00 ? 47  ALA A N    5  
ATOM 7895  C CA   . ALA A 1 47  ? 7.531   -0.678  6.460   1.00 0.00 ? 47  ALA A CA   5  
ATOM 7896  C C    . ALA A 1 47  ? 6.062   -0.771  6.059   1.00 0.00 ? 47  ALA A C    5  
ATOM 7897  O O    . ALA A 1 47  ? 5.273   0.129   6.345   1.00 0.00 ? 47  ALA A O    5  
ATOM 7898  C CB   . ALA A 1 47  ? 7.701   -1.021  7.932   1.00 0.00 ? 47  ALA A CB   5  
ATOM 7899  H H    . ALA A 1 47  ? 7.543   1.438   6.439   1.00 0.00 ? 47  ALA A H    5  
ATOM 7900  H HA   . ALA A 1 47  ? 8.098   -1.393  5.881   1.00 0.00 ? 47  ALA A HA   5  
ATOM 7901  H HB1  . ALA A 1 47  ? 6.939   -0.517  8.509   1.00 0.00 ? 47  ALA A HB1  5  
ATOM 7902  H HB2  . ALA A 1 47  ? 7.608   -2.089  8.066   1.00 0.00 ? 47  ALA A HB2  5  
ATOM 7903  H HB3  . ALA A 1 47  ? 8.677   -0.700  8.266   1.00 0.00 ? 47  ALA A HB3  5  
ATOM 7904  N N    . TRP A 1 48  ? 5.704   -1.865  5.396   1.00 0.00 ? 48  TRP A N    5  
ATOM 7905  C CA   . TRP A 1 48  ? 4.329   -2.074  4.956   1.00 0.00 ? 48  TRP A CA   5  
ATOM 7906  C C    . TRP A 1 48  ? 3.623   -3.094  5.842   1.00 0.00 ? 48  TRP A C    5  
ATOM 7907  O O    . TRP A 1 48  ? 3.814   -4.301  5.690   1.00 0.00 ? 48  TRP A O    5  
ATOM 7908  C CB   . TRP A 1 48  ? 4.304   -2.542  3.500   1.00 0.00 ? 48  TRP A CB   5  
ATOM 7909  C CG   . TRP A 1 48  ? 4.214   -1.416  2.515   1.00 0.00 ? 48  TRP A CG   5  
ATOM 7910  C CD1  . TRP A 1 48  ? 5.254   -0.712  1.978   1.00 0.00 ? 48  TRP A CD1  5  
ATOM 7911  C CD2  . TRP A 1 48  ? 3.020   -0.863  1.952   1.00 0.00 ? 48  TRP A CD2  5  
ATOM 7912  N NE1  . TRP A 1 48  ? 4.778   0.246   1.115   1.00 0.00 ? 48  TRP A NE1  5  
ATOM 7913  C CE2  . TRP A 1 48  ? 3.410   0.173   1.081   1.00 0.00 ? 48  TRP A CE2  5  
ATOM 7914  C CE3  . TRP A 1 48  ? 1.658   -1.143  2.097   1.00 0.00 ? 48  TRP A CE3  5  
ATOM 7915  C CZ2  . TRP A 1 48  ? 2.488   0.928   0.361   1.00 0.00 ? 48  TRP A CZ2  5  
ATOM 7916  C CZ3  . TRP A 1 48  ? 0.744   -0.393  1.382   1.00 0.00 ? 48  TRP A CZ3  5  
ATOM 7917  C CH2  . TRP A 1 48  ? 1.162   0.631   0.522   1.00 0.00 ? 48  TRP A CH2  5  
ATOM 7918  H H    . TRP A 1 48  ? 6.379   -2.547  5.197   1.00 0.00 ? 48  TRP A H    5  
ATOM 7919  H HA   . TRP A 1 48  ? 3.810   -1.130  5.030   1.00 0.00 ? 48  TRP A HA   5  
ATOM 7920  H HB2  . TRP A 1 48  ? 5.207   -3.097  3.290   1.00 0.00 ? 48  TRP A HB2  5  
ATOM 7921  H HB3  . TRP A 1 48  ? 3.448   -3.185  3.351   1.00 0.00 ? 48  TRP A HB3  5  
ATOM 7922  H HD1  . TRP A 1 48  ? 6.293   -0.891  2.209   1.00 0.00 ? 48  TRP A HD1  5  
ATOM 7923  H HE1  . TRP A 1 48  ? 5.329   0.877   0.606   1.00 0.00 ? 48  TRP A HE1  5  
ATOM 7924  H HE3  . TRP A 1 48  ? 1.317   -1.929  2.755   1.00 0.00 ? 48  TRP A HE3  5  
ATOM 7925  H HZ2  . TRP A 1 48  ? 2.794   1.720   -0.306  1.00 0.00 ? 48  TRP A HZ2  5  
ATOM 7926  H HZ3  . TRP A 1 48  ? -0.312  -0.595  1.482   1.00 0.00 ? 48  TRP A HZ3  5  
ATOM 7927  H HH2  . TRP A 1 48  ? 0.413   1.192   -0.016  1.00 0.00 ? 48  TRP A HH2  5  
ATOM 7928  N N    . SER A 1 49  ? 2.806   -2.602  6.768   1.00 0.00 ? 49  SER A N    5  
ATOM 7929  C CA   . SER A 1 49  ? 2.074   -3.471  7.682   1.00 0.00 ? 49  SER A CA   5  
ATOM 7930  C C    . SER A 1 49  ? 0.574   -3.202  7.604   1.00 0.00 ? 49  SER A C    5  
ATOM 7931  O O    . SER A 1 49  ? 0.143   -2.052  7.515   1.00 0.00 ? 49  SER A O    5  
ATOM 7932  C CB   . SER A 1 49  ? 2.566   -3.269  9.116   1.00 0.00 ? 49  SER A CB   5  
ATOM 7933  O OG   . SER A 1 49  ? 2.295   -1.953  9.567   1.00 0.00 ? 49  SER A OG   5  
ATOM 7934  H H    . SER A 1 49  ? 2.695   -1.631  6.840   1.00 0.00 ? 49  SER A H    5  
ATOM 7935  H HA   . SER A 1 49  ? 2.260   -4.493  7.388   1.00 0.00 ? 49  SER A HA   5  
ATOM 7936  H HB2  . SER A 1 49  ? 2.067   -3.970  9.768   1.00 0.00 ? 49  SER A HB2  5  
ATOM 7937  H HB3  . SER A 1 49  ? 3.633   -3.438  9.155   1.00 0.00 ? 49  SER A HB3  5  
ATOM 7938  H HG   . SER A 1 49  ? 2.271   -1.942  10.527  1.00 0.00 ? 49  SER A HG   5  
ATOM 7939  N N    . TRP A 1 50  ? -0.214  -4.270  7.638   1.00 0.00 ? 50  TRP A N    5  
ATOM 7940  C CA   . TRP A 1 50  ? -1.666  -4.149  7.571   1.00 0.00 ? 50  TRP A CA   5  
ATOM 7941  C C    . TRP A 1 50  ? -2.292  -4.330  8.950   1.00 0.00 ? 50  TRP A C    5  
ATOM 7942  O O    . TRP A 1 50  ? -2.791  -3.375  9.546   1.00 0.00 ? 50  TRP A O    5  
ATOM 7943  C CB   . TRP A 1 50  ? -2.240  -5.181  6.598   1.00 0.00 ? 50  TRP A CB   5  
ATOM 7944  C CG   . TRP A 1 50  ? -1.414  -6.428  6.500   1.00 0.00 ? 50  TRP A CG   5  
ATOM 7945  C CD1  . TRP A 1 50  ? -1.728  -7.660  6.999   1.00 0.00 ? 50  TRP A CD1  5  
ATOM 7946  C CD2  . TRP A 1 50  ? -0.137  -6.563  5.867   1.00 0.00 ? 50  TRP A CD2  5  
ATOM 7947  N NE1  . TRP A 1 50  ? -0.723  -8.553  6.713   1.00 0.00 ? 50  TRP A NE1  5  
ATOM 7948  C CE2  . TRP A 1 50  ? 0.264   -7.905  6.018   1.00 0.00 ? 50  TRP A CE2  5  
ATOM 7949  C CE3  . TRP A 1 50  ? 0.705   -5.682  5.184   1.00 0.00 ? 50  TRP A CE3  5  
ATOM 7950  C CZ2  . TRP A 1 50  ? 1.470   -8.383  5.513   1.00 0.00 ? 50  TRP A CZ2  5  
ATOM 7951  C CZ3  . TRP A 1 50  ? 1.902   -6.157  4.684   1.00 0.00 ? 50  TRP A CZ3  5  
ATOM 7952  C CH2  . TRP A 1 50  ? 2.275   -7.498  4.849   1.00 0.00 ? 50  TRP A CH2  5  
ATOM 7953  H H    . TRP A 1 50  ? 0.189   -5.160  7.710   1.00 0.00 ? 50  TRP A H    5  
ATOM 7954  H HA   . TRP A 1 50  ? -1.900  -3.159  7.209   1.00 0.00 ? 50  TRP A HA   5  
ATOM 7955  H HB2  . TRP A 1 50  ? -3.230  -5.462  6.924   1.00 0.00 ? 50  TRP A HB2  5  
ATOM 7956  H HB3  . TRP A 1 50  ? -2.300  -4.742  5.613   1.00 0.00 ? 50  TRP A HB3  5  
ATOM 7957  H HD1  . TRP A 1 50  ? -2.635  -7.885  7.538   1.00 0.00 ? 50  TRP A HD1  5  
ATOM 7958  H HE1  . TRP A 1 50  ? -0.716  -9.501  6.964   1.00 0.00 ? 50  TRP A HE1  5  
ATOM 7959  H HE3  . TRP A 1 50  ? 0.435   -4.645  5.046   1.00 0.00 ? 50  TRP A HE3  5  
ATOM 7960  H HZ2  . TRP A 1 50  ? 1.771   -9.413  5.632   1.00 0.00 ? 50  TRP A HZ2  5  
ATOM 7961  H HZ3  . TRP A 1 50  ? 2.567   -5.490  4.154   1.00 0.00 ? 50  TRP A HZ3  5  
ATOM 7962  H HH2  . TRP A 1 50  ? 3.219   -7.825  4.442   1.00 0.00 ? 50  TRP A HH2  5  
ATOM 7963  N N    . LYS A 1 51  ? -2.262  -5.559  9.452   1.00 0.00 ? 51  LYS A N    5  
ATOM 7964  C CA   . LYS A 1 51  ? -2.824  -5.865  10.762  1.00 0.00 ? 51  LYS A CA   5  
ATOM 7965  C C    . LYS A 1 51  ? -1.719  -6.102  11.787  1.00 0.00 ? 51  LYS A C    5  
ATOM 7966  O O    . LYS A 1 51  ? -1.462  -5.255  12.641  1.00 0.00 ? 51  LYS A O    5  
ATOM 7967  C CB   . LYS A 1 51  ? -3.728  -7.097  10.677  1.00 0.00 ? 51  LYS A CB   5  
ATOM 7968  C CG   . LYS A 1 51  ? -4.929  -6.909  9.767   1.00 0.00 ? 51  LYS A CG   5  
ATOM 7969  C CD   . LYS A 1 51  ? -6.094  -7.787  10.193  1.00 0.00 ? 51  LYS A CD   5  
ATOM 7970  C CE   . LYS A 1 51  ? -5.634  -9.196  10.535  1.00 0.00 ? 51  LYS A CE   5  
ATOM 7971  N NZ   . LYS A 1 51  ? -6.747  -10.028 11.069  1.00 0.00 ? 51  LYS A NZ   5  
ATOM 7972  H H    . LYS A 1 51  ? -1.850  -6.279  8.929   1.00 0.00 ? 51  LYS A H    5  
ATOM 7973  H HA   . LYS A 1 51  ? -3.414  -5.018  11.076  1.00 0.00 ? 51  LYS A HA   5  
ATOM 7974  H HB2  . LYS A 1 51  ? -3.148  -7.929  10.305  1.00 0.00 ? 51  LYS A HB2  5  
ATOM 7975  H HB3  . LYS A 1 51  ? -4.087  -7.335  11.668  1.00 0.00 ? 51  LYS A HB3  5  
ATOM 7976  H HG2  . LYS A 1 51  ? -5.240  -5.875  9.805   1.00 0.00 ? 51  LYS A HG2  5  
ATOM 7977  H HG3  . LYS A 1 51  ? -4.647  -7.165  8.756   1.00 0.00 ? 51  LYS A HG3  5  
ATOM 7978  H HD2  . LYS A 1 51  ? -6.563  -7.352  11.063  1.00 0.00 ? 51  LYS A HD2  5  
ATOM 7979  H HD3  . LYS A 1 51  ? -6.810  -7.838  9.384   1.00 0.00 ? 51  LYS A HD3  5  
ATOM 7980  H HE2  . LYS A 1 51  ? -5.245  -9.660  9.642   1.00 0.00 ? 51  LYS A HE2  5  
ATOM 7981  H HE3  . LYS A 1 51  ? -4.853  -9.134  11.278  1.00 0.00 ? 51  LYS A HE3  5  
ATOM 7982  H HZ1  . LYS A 1 51  ? -7.354  -10.356 10.291  1.00 0.00 ? 51  LYS A HZ1  5  
ATOM 7983  H HZ2  . LYS A 1 51  ? -7.324  -9.471  11.732  1.00 0.00 ? 51  LYS A HZ2  5  
ATOM 7984  H HZ3  . LYS A 1 51  ? -6.366  -10.856 11.570  1.00 0.00 ? 51  LYS A HZ3  5  
ATOM 7985  N N    . GLU A 1 52  ? -1.070  -7.258  11.694  1.00 0.00 ? 52  GLU A N    5  
ATOM 7986  C CA   . GLU A 1 52  ? 0.008   -7.604  12.613  1.00 0.00 ? 52  GLU A CA   5  
ATOM 7987  C C    . GLU A 1 52  ? 1.299   -7.896  11.854  1.00 0.00 ? 52  GLU A C    5  
ATOM 7988  O O    . GLU A 1 52  ? 2.388   -7.865  12.425  1.00 0.00 ? 52  GLU A O    5  
ATOM 7989  C CB   . GLU A 1 52  ? -0.384  -8.817  13.460  1.00 0.00 ? 52  GLU A CB   5  
ATOM 7990  C CG   . GLU A 1 52  ? -1.513  -8.538  14.438  1.00 0.00 ? 52  GLU A CG   5  
ATOM 7991  C CD   . GLU A 1 52  ? -2.321  -9.778  14.765  1.00 0.00 ? 52  GLU A CD   5  
ATOM 7992  O OE1  . GLU A 1 52  ? -3.228  -10.121 13.978  1.00 0.00 ? 52  GLU A OE1  5  
ATOM 7993  O OE2  . GLU A 1 52  ? -2.047  -10.406 15.809  1.00 0.00 ? 52  GLU A OE2  5  
ATOM 7994  H H    . GLU A 1 52  ? -1.321  -7.893  10.991  1.00 0.00 ? 52  GLU A H    5  
ATOM 7995  H HA   . GLU A 1 52  ? 0.171   -6.760  13.266  1.00 0.00 ? 52  GLU A HA   5  
ATOM 7996  H HB2  . GLU A 1 52  ? -0.694  -9.615  12.802  1.00 0.00 ? 52  GLU A HB2  5  
ATOM 7997  H HB3  . GLU A 1 52  ? 0.479   -9.142  14.022  1.00 0.00 ? 52  GLU A HB3  5  
ATOM 7998  H HG2  . GLU A 1 52  ? -1.092  -8.150  15.353  1.00 0.00 ? 52  GLU A HG2  5  
ATOM 7999  H HG3  . GLU A 1 52  ? -2.172  -7.800  14.005  1.00 0.00 ? 52  GLU A HG3  5  
ATOM 8000  N N    . ASN A 1 53  ? 1.167   -8.180  10.562  1.00 0.00 ? 53  ASN A N    5  
ATOM 8001  C CA   . ASN A 1 53  ? 2.322   -8.478  9.723   1.00 0.00 ? 53  ASN A CA   5  
ATOM 8002  C C    . ASN A 1 53  ? 2.964   -7.195  9.205   1.00 0.00 ? 53  ASN A C    5  
ATOM 8003  O O    . ASN A 1 53  ? 2.272   -6.240  8.852   1.00 0.00 ? 53  ASN A O    5  
ATOM 8004  C CB   . ASN A 1 53  ? 1.909   -9.366  8.548   1.00 0.00 ? 53  ASN A CB   5  
ATOM 8005  C CG   . ASN A 1 53  ? 1.509   -10.761 8.989   1.00 0.00 ? 53  ASN A CG   5  
ATOM 8006  O OD1  . ASN A 1 53  ? 2.281   -11.711 8.856   1.00 0.00 ? 53  ASN A OD1  5  
ATOM 8007  N ND2  . ASN A 1 53  ? 0.298   -10.890 9.517   1.00 0.00 ? 53  ASN A ND2  5  
ATOM 8008  H H    . ASN A 1 53  ? 0.272   -8.189  10.163  1.00 0.00 ? 53  ASN A H    5  
ATOM 8009  H HA   . ASN A 1 53  ? 3.042   -9.009  10.328  1.00 0.00 ? 53  ASN A HA   5  
ATOM 8010  H HB2  . ASN A 1 53  ? 1.068   -8.915  8.042   1.00 0.00 ? 53  ASN A HB2  5  
ATOM 8011  H HB3  . ASN A 1 53  ? 2.736   -9.449  7.858   1.00 0.00 ? 53  ASN A HB3  5  
ATOM 8012  H HD21 . ASN A 1 53  ? -0.263  -10.089 9.591   1.00 0.00 ? 53  ASN A HD21 5  
ATOM 8013  H HD22 . ASN A 1 53  ? 0.014   -11.780 9.811   1.00 0.00 ? 53  ASN A HD22 5  
ATOM 8014  N N    . VAL A 1 54  ? 4.293   -7.181  9.161   1.00 0.00 ? 54  VAL A N    5  
ATOM 8015  C CA   . VAL A 1 54  ? 5.029   -6.016  8.685   1.00 0.00 ? 54  VAL A CA   5  
ATOM 8016  C C    . VAL A 1 54  ? 6.081   -6.415  7.655   1.00 0.00 ? 54  VAL A C    5  
ATOM 8017  O O    . VAL A 1 54  ? 6.874   -7.328  7.883   1.00 0.00 ? 54  VAL A O    5  
ATOM 8018  C CB   . VAL A 1 54  ? 5.719   -5.275  9.845   1.00 0.00 ? 54  VAL A CB   5  
ATOM 8019  C CG1  . VAL A 1 54  ? 6.487   -4.068  9.327   1.00 0.00 ? 54  VAL A CG1  5  
ATOM 8020  C CG2  . VAL A 1 54  ? 4.697   -4.857  10.892  1.00 0.00 ? 54  VAL A CG2  5  
ATOM 8021  H H    . VAL A 1 54  ? 4.789   -7.973  9.456   1.00 0.00 ? 54  VAL A H    5  
ATOM 8022  H HA   . VAL A 1 54  ? 4.324   -5.341  8.222   1.00 0.00 ? 54  VAL A HA   5  
ATOM 8023  H HB   . VAL A 1 54  ? 6.423   -5.949  10.309  1.00 0.00 ? 54  VAL A HB   5  
ATOM 8024  H HG11 . VAL A 1 54  ? 5.790   -3.300  9.027   1.00 0.00 ? 54  VAL A HG11 5  
ATOM 8025  H HG12 . VAL A 1 54  ? 7.130   -3.688  10.107  1.00 0.00 ? 54  VAL A HG12 5  
ATOM 8026  H HG13 . VAL A 1 54  ? 7.086   -4.361  8.477   1.00 0.00 ? 54  VAL A HG13 5  
ATOM 8027  H HG21 . VAL A 1 54  ? 4.714   -3.783  11.001  1.00 0.00 ? 54  VAL A HG21 5  
ATOM 8028  H HG22 . VAL A 1 54  ? 3.711   -5.171  10.579  1.00 0.00 ? 54  VAL A HG22 5  
ATOM 8029  H HG23 . VAL A 1 54  ? 4.939   -5.320  11.837  1.00 0.00 ? 54  VAL A HG23 5  
ATOM 8030  N N    . LEU A 1 55  ? 6.081   -5.723  6.521   1.00 0.00 ? 55  LEU A N    5  
ATOM 8031  C CA   . LEU A 1 55  ? 7.036   -6.004  5.454   1.00 0.00 ? 55  LEU A CA   5  
ATOM 8032  C C    . LEU A 1 55  ? 7.893   -4.778  5.154   1.00 0.00 ? 55  LEU A C    5  
ATOM 8033  O O    . LEU A 1 55  ? 7.439   -3.836  4.506   1.00 0.00 ? 55  LEU A O    5  
ATOM 8034  C CB   . LEU A 1 55  ? 6.301   -6.448  4.188   1.00 0.00 ? 55  LEU A CB   5  
ATOM 8035  C CG   . LEU A 1 55  ? 7.117   -7.272  3.192   1.00 0.00 ? 55  LEU A CG   5  
ATOM 8036  C CD1  . LEU A 1 55  ? 7.803   -8.433  3.895   1.00 0.00 ? 55  LEU A CD1  5  
ATOM 8037  C CD2  . LEU A 1 55  ? 6.230   -7.778  2.064   1.00 0.00 ? 55  LEU A CD2  5  
ATOM 8038  H H    . LEU A 1 55  ? 5.425   -5.007  6.396   1.00 0.00 ? 55  LEU A H    5  
ATOM 8039  H HA   . LEU A 1 55  ? 7.679   -6.805  5.787   1.00 0.00 ? 55  LEU A HA   5  
ATOM 8040  H HB2  . LEU A 1 55  ? 5.452   -7.042  4.491   1.00 0.00 ? 55  LEU A HB2  5  
ATOM 8041  H HB3  . LEU A 1 55  ? 5.954   -5.560  3.679   1.00 0.00 ? 55  LEU A HB3  5  
ATOM 8042  H HG   . LEU A 1 55  ? 7.885   -6.645  2.759   1.00 0.00 ? 55  LEU A HG   5  
ATOM 8043  H HD11 . LEU A 1 55  ? 7.146   -8.835  4.651   1.00 0.00 ? 55  LEU A HD11 5  
ATOM 8044  H HD12 . LEU A 1 55  ? 8.715   -8.086  4.358   1.00 0.00 ? 55  LEU A HD12 5  
ATOM 8045  H HD13 . LEU A 1 55  ? 8.037   -9.203  3.174   1.00 0.00 ? 55  LEU A HD13 5  
ATOM 8046  H HD21 . LEU A 1 55  ? 5.227   -7.399  2.198   1.00 0.00 ? 55  LEU A HD21 5  
ATOM 8047  H HD22 . LEU A 1 55  ? 6.211   -8.858  2.078   1.00 0.00 ? 55  LEU A HD22 5  
ATOM 8048  H HD23 . LEU A 1 55  ? 6.621   -7.437  1.118   1.00 0.00 ? 55  LEU A HD23 5  
ATOM 8049  N N    . GLU A 1 56  ? 9.135   -4.800  5.628   1.00 0.00 ? 56  GLU A N    5  
ATOM 8050  C CA   . GLU A 1 56  ? 10.055  -3.691  5.408   1.00 0.00 ? 56  GLU A CA   5  
ATOM 8051  C C    . GLU A 1 56  ? 10.589  -3.701  3.979   1.00 0.00 ? 56  GLU A C    5  
ATOM 8052  O O    . GLU A 1 56  ? 10.671  -2.659  3.328   1.00 0.00 ? 56  GLU A O    5  
ATOM 8053  C CB   . GLU A 1 56  ? 11.219  -3.761  6.399   1.00 0.00 ? 56  GLU A CB   5  
ATOM 8054  C CG   . GLU A 1 56  ? 10.849  -3.321  7.805   1.00 0.00 ? 56  GLU A CG   5  
ATOM 8055  C CD   . GLU A 1 56  ? 11.926  -3.648  8.822   1.00 0.00 ? 56  GLU A CD   5  
ATOM 8056  O OE1  . GLU A 1 56  ? 12.562  -4.714  8.691   1.00 0.00 ? 56  GLU A OE1  5  
ATOM 8057  O OE2  . GLU A 1 56  ? 12.133  -2.836  9.748   1.00 0.00 ? 56  GLU A OE2  5  
ATOM 8058  H H    . GLU A 1 56  ? 9.439   -5.580  6.137   1.00 0.00 ? 56  GLU A H    5  
ATOM 8059  H HA   . GLU A 1 56  ? 9.512   -2.772  5.570   1.00 0.00 ? 56  GLU A HA   5  
ATOM 8060  H HB2  . GLU A 1 56  ? 11.577  -4.779  6.444   1.00 0.00 ? 56  GLU A HB2  5  
ATOM 8061  H HB3  . GLU A 1 56  ? 12.017  -3.125  6.044   1.00 0.00 ? 56  GLU A HB3  5  
ATOM 8062  H HG2  . GLU A 1 56  ? 10.689  -2.253  7.804   1.00 0.00 ? 56  GLU A HG2  5  
ATOM 8063  H HG3  . GLU A 1 56  ? 9.937   -3.821  8.097   1.00 0.00 ? 56  GLU A HG3  5  
ATOM 8064  N N    . SER A 1 57  ? 10.951  -4.886  3.497   1.00 0.00 ? 57  SER A N    5  
ATOM 8065  C CA   . SER A 1 57  ? 11.481  -5.032  2.146   1.00 0.00 ? 57  SER A CA   5  
ATOM 8066  C C    . SER A 1 57  ? 11.672  -6.504  1.794   1.00 0.00 ? 57  SER A C    5  
ATOM 8067  O O    . SER A 1 57  ? 12.104  -7.302  2.625   1.00 0.00 ? 57  SER A O    5  
ATOM 8068  C CB   . SER A 1 57  ? 12.810  -4.287  2.014   1.00 0.00 ? 57  SER A CB   5  
ATOM 8069  O OG   . SER A 1 57  ? 13.852  -4.981  2.679   1.00 0.00 ? 57  SER A OG   5  
ATOM 8070  H H    . SER A 1 57  ? 10.861  -5.680  4.064   1.00 0.00 ? 57  SER A H    5  
ATOM 8071  H HA   . SER A 1 57  ? 10.766  -4.600  1.461   1.00 0.00 ? 57  SER A HA   5  
ATOM 8072  H HB2  . SER A 1 57  ? 13.066  -4.195  0.969   1.00 0.00 ? 57  SER A HB2  5  
ATOM 8073  H HB3  . SER A 1 57  ? 12.713  -3.303  2.449   1.00 0.00 ? 57  SER A HB3  5  
ATOM 8074  H HG   . SER A 1 57  ? 14.244  -5.620  2.080   1.00 0.00 ? 57  SER A HG   5  
ATOM 8075  N N    . GLY A 1 58  ? 11.346  -6.857  0.554   1.00 0.00 ? 58  GLY A N    5  
ATOM 8076  C CA   . GLY A 1 58  ? 11.488  -8.233  0.113   1.00 0.00 ? 58  GLY A CA   5  
ATOM 8077  C C    . GLY A 1 58  ? 10.156  -8.877  -0.216  1.00 0.00 ? 58  GLY A C    5  
ATOM 8078  O O    . GLY A 1 58  ? 9.120   -8.210  -0.225  1.00 0.00 ? 58  GLY A O    5  
ATOM 8079  H H    . GLY A 1 58  ? 11.006  -6.179  -0.065  1.00 0.00 ? 58  GLY A H    5  
ATOM 8080  H HA2  . GLY A 1 58  ? 12.114  -8.254  -0.767  1.00 0.00 ? 58  GLY A HA2  5  
ATOM 8081  H HA3  . GLY A 1 58  ? 11.966  -8.802  0.896   1.00 0.00 ? 58  GLY A HA3  5  
ATOM 8082  N N    . THR A 1 59  ? 10.181  -10.178 -0.489  1.00 0.00 ? 59  THR A N    5  
ATOM 8083  C CA   . THR A 1 59  ? 8.967   -10.912 -0.823  1.00 0.00 ? 59  THR A CA   5  
ATOM 8084  C C    . THR A 1 59  ? 8.583   -11.877 0.293   1.00 0.00 ? 59  THR A C    5  
ATOM 8085  O O    . THR A 1 59  ? 9.327   -12.806 0.606   1.00 0.00 ? 59  THR A O    5  
ATOM 8086  C CB   . THR A 1 59  ? 9.131   -11.701 -2.135  1.00 0.00 ? 59  THR A CB   5  
ATOM 8087  O OG1  . THR A 1 59  ? 9.388   -10.802 -3.219  1.00 0.00 ? 59  THR A OG1  5  
ATOM 8088  C CG2  . THR A 1 59  ? 7.884   -12.520 -2.434  1.00 0.00 ? 59  THR A CG2  5  
ATOM 8089  H H    . THR A 1 59  ? 11.037  -10.653 -0.466  1.00 0.00 ? 59  THR A H    5  
ATOM 8090  H HA   . THR A 1 59  ? 8.169   -10.195 -0.956  1.00 0.00 ? 59  THR A HA   5  
ATOM 8091  H HB   . THR A 1 59  ? 9.969   -12.375 -2.030  1.00 0.00 ? 59  THR A HB   5  
ATOM 8092  H HG1  . THR A 1 59  ? 9.097   -11.201 -4.043  1.00 0.00 ? 59  THR A HG1  5  
ATOM 8093  H HG21 . THR A 1 59  ? 7.019   -12.024 -2.018  1.00 0.00 ? 59  THR A HG21 5  
ATOM 8094  H HG22 . THR A 1 59  ? 7.983   -13.501 -1.994  1.00 0.00 ? 59  THR A HG22 5  
ATOM 8095  H HG23 . THR A 1 59  ? 7.764   -12.615 -3.503  1.00 0.00 ? 59  THR A HG23 5  
ATOM 8096  N N    . SER A 1 60  ? 7.417   -11.651 0.890   1.00 0.00 ? 60  SER A N    5  
ATOM 8097  C CA   . SER A 1 60  ? 6.936   -12.499 1.974   1.00 0.00 ? 60  SER A CA   5  
ATOM 8098  C C    . SER A 1 60  ? 5.411   -12.515 2.015   1.00 0.00 ? 60  SER A C    5  
ATOM 8099  O O    . SER A 1 60  ? 4.760   -11.519 1.704   1.00 0.00 ? 60  SER A O    5  
ATOM 8100  C CB   . SER A 1 60  ? 7.489   -12.012 3.315   1.00 0.00 ? 60  SER A CB   5  
ATOM 8101  O OG   . SER A 1 60  ? 7.526   -13.064 4.263   1.00 0.00 ? 60  SER A OG   5  
ATOM 8102  H H    . SER A 1 60  ? 6.869   -10.893 0.595   1.00 0.00 ? 60  SER A H    5  
ATOM 8103  H HA   . SER A 1 60  ? 7.290   -13.503 1.791   1.00 0.00 ? 60  SER A HA   5  
ATOM 8104  H HB2  . SER A 1 60  ? 8.491   -11.636 3.173   1.00 0.00 ? 60  SER A HB2  5  
ATOM 8105  H HB3  . SER A 1 60  ? 6.858   -11.222 3.695   1.00 0.00 ? 60  SER A HB3  5  
ATOM 8106  H HG   . SER A 1 60  ? 7.510   -12.697 5.150   1.00 0.00 ? 60  SER A HG   5  
ATOM 8107  N N    . GLY A 1 61  ? 4.848   -13.656 2.402   1.00 0.00 ? 61  GLY A N    5  
ATOM 8108  C CA   . GLY A 1 61  ? 3.404   -13.782 2.477   1.00 0.00 ? 61  GLY A CA   5  
ATOM 8109  C C    . GLY A 1 61  ? 2.710   -13.241 1.244   1.00 0.00 ? 61  GLY A C    5  
ATOM 8110  O O    . GLY A 1 61  ? 1.704   -12.538 1.347   1.00 0.00 ? 61  GLY A O    5  
ATOM 8111  H H    . GLY A 1 61  ? 5.417   -14.418 2.638   1.00 0.00 ? 61  GLY A H    5  
ATOM 8112  H HA2  . GLY A 1 61  ? 3.150   -14.825 2.592   1.00 0.00 ? 61  GLY A HA2  5  
ATOM 8113  H HA3  . GLY A 1 61  ? 3.051   -13.239 3.342   1.00 0.00 ? 61  GLY A HA3  5  
ATOM 8114  N N    . ARG A 1 62  ? 3.248   -13.566 0.073   1.00 0.00 ? 62  ARG A N    5  
ATOM 8115  C CA   . ARG A 1 62  ? 2.675   -13.105 -1.186  1.00 0.00 ? 62  ARG A CA   5  
ATOM 8116  C C    . ARG A 1 62  ? 2.660   -11.581 -1.251  1.00 0.00 ? 62  ARG A C    5  
ATOM 8117  O O    . ARG A 1 62  ? 1.787   -10.984 -1.881  1.00 0.00 ? 62  ARG A O    5  
ATOM 8118  C CB   . ARG A 1 62  ? 1.254   -13.647 -1.353  1.00 0.00 ? 62  ARG A CB   5  
ATOM 8119  C CG   . ARG A 1 62  ? 1.204   -15.111 -1.760  1.00 0.00 ? 62  ARG A CG   5  
ATOM 8120  C CD   . ARG A 1 62  ? -0.194  -15.521 -2.194  1.00 0.00 ? 62  ARG A CD   5  
ATOM 8121  N NE   . ARG A 1 62  ? -0.299  -16.962 -2.411  1.00 0.00 ? 62  ARG A NE   5  
ATOM 8122  C CZ   . ARG A 1 62  ? -1.409  -17.564 -2.821  1.00 0.00 ? 62  ARG A CZ   5  
ATOM 8123  N NH1  . ARG A 1 62  ? -2.504  -16.854 -3.057  1.00 0.00 ? 62  ARG A NH1  5  
ATOM 8124  N NH2  . ARG A 1 62  ? -1.426  -18.879 -2.997  1.00 0.00 ? 62  ARG A NH2  5  
ATOM 8125  H H    . ARG A 1 62  ? 4.050   -14.129 0.055   1.00 0.00 ? 62  ARG A H    5  
ATOM 8126  H HA   . ARG A 1 62  ? 3.291   -13.482 -1.989  1.00 0.00 ? 62  ARG A HA   5  
ATOM 8127  H HB2  . ARG A 1 62  ? 0.727   -13.539 -0.416  1.00 0.00 ? 62  ARG A HB2  5  
ATOM 8128  H HB3  . ARG A 1 62  ? 0.748   -13.068 -2.111  1.00 0.00 ? 62  ARG A HB3  5  
ATOM 8129  H HG2  . ARG A 1 62  ? 1.886   -15.270 -2.582  1.00 0.00 ? 62  ARG A HG2  5  
ATOM 8130  H HG3  . ARG A 1 62  ? 1.504   -15.718 -0.919  1.00 0.00 ? 62  ARG A HG3  5  
ATOM 8131  H HD2  . ARG A 1 62  ? -0.895  -15.231 -1.425  1.00 0.00 ? 62  ARG A HD2  5  
ATOM 8132  H HD3  . ARG A 1 62  ? -0.435  -15.009 -3.113  1.00 0.00 ? 62  ARG A HD3  5  
ATOM 8133  H HE   . ARG A 1 62  ? 0.499   -17.505 -2.243  1.00 0.00 ? 62  ARG A HE   5  
ATOM 8134  H HH11 . ARG A 1 62  ? -2.494  -15.863 -2.927  1.00 0.00 ? 62  ARG A HH11 5  
ATOM 8135  H HH12 . ARG A 1 62  ? -3.339  -17.310 -3.367  1.00 0.00 ? 62  ARG A HH12 5  
ATOM 8136  H HH21 . ARG A 1 62  ? -0.603  -19.418 -2.820  1.00 0.00 ? 62  ARG A HH21 5  
ATOM 8137  H HH22 . ARG A 1 62  ? -2.262  -19.332 -3.305  1.00 0.00 ? 62  ARG A HH22 5  
ATOM 8138  N N    . TYR A 1 63  ? 3.631   -10.957 -0.594  1.00 0.00 ? 63  TYR A N    5  
ATOM 8139  C CA   . TYR A 1 63  ? 3.728   -9.502  -0.574  1.00 0.00 ? 63  TYR A CA   5  
ATOM 8140  C C    . TYR A 1 63  ? 5.133   -9.044  -0.956  1.00 0.00 ? 63  TYR A C    5  
ATOM 8141  O O    . TYR A 1 63  ? 6.121   -9.459  -0.349  1.00 0.00 ? 63  TYR A O    5  
ATOM 8142  C CB   . TYR A 1 63  ? 3.364   -8.964  0.811   1.00 0.00 ? 63  TYR A CB   5  
ATOM 8143  C CG   . TYR A 1 63  ? 1.904   -9.140  1.164   1.00 0.00 ? 63  TYR A CG   5  
ATOM 8144  C CD1  . TYR A 1 63  ? 0.925   -8.356  0.567   1.00 0.00 ? 63  TYR A CD1  5  
ATOM 8145  C CD2  . TYR A 1 63  ? 1.504   -10.092 2.094   1.00 0.00 ? 63  TYR A CD2  5  
ATOM 8146  C CE1  . TYR A 1 63  ? -0.409  -8.512  0.887   1.00 0.00 ? 63  TYR A CE1  5  
ATOM 8147  C CE2  . TYR A 1 63  ? 0.171   -10.256 2.419   1.00 0.00 ? 63  TYR A CE2  5  
ATOM 8148  C CZ   . TYR A 1 63  ? -0.781  -9.464  1.813   1.00 0.00 ? 63  TYR A CZ   5  
ATOM 8149  O OH   . TYR A 1 63  ? -2.110  -9.624  2.134   1.00 0.00 ? 63  TYR A OH   5  
ATOM 8150  H H    . TYR A 1 63  ? 4.298   -11.486 -0.109  1.00 0.00 ? 63  TYR A H    5  
ATOM 8151  H HA   . TYR A 1 63  ? 3.026   -9.113  -1.297  1.00 0.00 ? 63  TYR A HA   5  
ATOM 8152  H HB2  . TYR A 1 63  ? 3.949   -9.481  1.556   1.00 0.00 ? 63  TYR A HB2  5  
ATOM 8153  H HB3  . TYR A 1 63  ? 3.591   -7.909  0.851   1.00 0.00 ? 63  TYR A HB3  5  
ATOM 8154  H HD1  . TYR A 1 63  ? 1.220   -7.611  -0.159  1.00 0.00 ? 63  TYR A HD1  5  
ATOM 8155  H HD2  . TYR A 1 63  ? 2.253   -10.711 2.567   1.00 0.00 ? 63  TYR A HD2  5  
ATOM 8156  H HE1  . TYR A 1 63  ? -1.156  -7.892  0.412   1.00 0.00 ? 63  TYR A HE1  5  
ATOM 8157  H HE2  . TYR A 1 63  ? -0.120  -11.001 3.145   1.00 0.00 ? 63  TYR A HE2  5  
ATOM 8158  H HH   . TYR A 1 63  ? -2.578  -8.800  1.979   1.00 0.00 ? 63  TYR A HH   5  
ATOM 8159  N N    . THR A 1 64  ? 5.213   -8.185  -1.967  1.00 0.00 ? 64  THR A N    5  
ATOM 8160  C CA   . THR A 1 64  ? 6.495   -7.670  -2.432  1.00 0.00 ? 64  THR A CA   5  
ATOM 8161  C C    . THR A 1 64  ? 6.547   -6.150  -2.329  1.00 0.00 ? 64  THR A C    5  
ATOM 8162  O O    . THR A 1 64  ? 5.847   -5.444  -3.056  1.00 0.00 ? 64  THR A O    5  
ATOM 8163  C CB   . THR A 1 64  ? 6.772   -8.084  -3.890  1.00 0.00 ? 64  THR A CB   5  
ATOM 8164  O OG1  . THR A 1 64  ? 6.529   -9.486  -4.055  1.00 0.00 ? 64  THR A OG1  5  
ATOM 8165  C CG2  . THR A 1 64  ? 8.206   -7.764  -4.281  1.00 0.00 ? 64  THR A CG2  5  
ATOM 8166  H H    . THR A 1 64  ? 4.390   -7.892  -2.411  1.00 0.00 ? 64  THR A H    5  
ATOM 8167  H HA   . THR A 1 64  ? 7.270   -8.090  -1.807  1.00 0.00 ? 64  THR A HA   5  
ATOM 8168  H HB   . THR A 1 64  ? 6.106   -7.532  -4.538  1.00 0.00 ? 64  THR A HB   5  
ATOM 8169  H HG1  . THR A 1 64  ? 7.338   -9.974  -3.883  1.00 0.00 ? 64  THR A HG1  5  
ATOM 8170  H HG21 . THR A 1 64  ? 8.864   -8.530  -3.898  1.00 0.00 ? 64  THR A HG21 5  
ATOM 8171  H HG22 . THR A 1 64  ? 8.487   -6.807  -3.865  1.00 0.00 ? 64  THR A HG22 5  
ATOM 8172  H HG23 . THR A 1 64  ? 8.286   -7.726  -5.357  1.00 0.00 ? 64  THR A HG23 5  
ATOM 8173  N N    . VAL A 1 65  ? 7.381   -5.651  -1.423  1.00 0.00 ? 65  VAL A N    5  
ATOM 8174  C CA   . VAL A 1 65  ? 7.526   -4.213  -1.227  1.00 0.00 ? 65  VAL A CA   5  
ATOM 8175  C C    . VAL A 1 65  ? 8.593   -3.637  -2.151  1.00 0.00 ? 65  VAL A C    5  
ATOM 8176  O O    . VAL A 1 65  ? 9.684   -4.192  -2.276  1.00 0.00 ? 65  VAL A O    5  
ATOM 8177  C CB   . VAL A 1 65  ? 7.892   -3.880  0.232   1.00 0.00 ? 65  VAL A CB   5  
ATOM 8178  C CG1  . VAL A 1 65  ? 8.233   -2.405  0.373   1.00 0.00 ? 65  VAL A CG1  5  
ATOM 8179  C CG2  . VAL A 1 65  ? 6.755   -4.265  1.167   1.00 0.00 ? 65  VAL A CG2  5  
ATOM 8180  H H    . VAL A 1 65  ? 7.913   -6.264  -0.874  1.00 0.00 ? 65  VAL A H    5  
ATOM 8181  H HA   . VAL A 1 65  ? 6.578   -3.748  -1.453  1.00 0.00 ? 65  VAL A HA   5  
ATOM 8182  H HB   . VAL A 1 65  ? 8.764   -4.456  0.504   1.00 0.00 ? 65  VAL A HB   5  
ATOM 8183  H HG11 . VAL A 1 65  ? 8.610   -2.217  1.368   1.00 0.00 ? 65  VAL A HG11 5  
ATOM 8184  H HG12 . VAL A 1 65  ? 8.985   -2.138  -0.354  1.00 0.00 ? 65  VAL A HG12 5  
ATOM 8185  H HG13 . VAL A 1 65  ? 7.345   -1.812  0.208   1.00 0.00 ? 65  VAL A HG13 5  
ATOM 8186  H HG21 . VAL A 1 65  ? 5.893   -4.553  0.584   1.00 0.00 ? 65  VAL A HG21 5  
ATOM 8187  H HG22 . VAL A 1 65  ? 7.063   -5.093  1.788   1.00 0.00 ? 65  VAL A HG22 5  
ATOM 8188  H HG23 . VAL A 1 65  ? 6.501   -3.421  1.792   1.00 0.00 ? 65  VAL A HG23 5  
ATOM 8189  N N    . GLU A 1 66  ? 8.269   -2.520  -2.795  1.00 0.00 ? 66  GLU A N    5  
ATOM 8190  C CA   . GLU A 1 66  ? 9.201   -1.869  -3.709  1.00 0.00 ? 66  GLU A CA   5  
ATOM 8191  C C    . GLU A 1 66  ? 9.011   -0.355  -3.692  1.00 0.00 ? 66  GLU A C    5  
ATOM 8192  O O    . GLU A 1 66  ? 7.944   0.153   -4.040  1.00 0.00 ? 66  GLU A O    5  
ATOM 8193  C CB   . GLU A 1 66  ? 9.012   -2.402  -5.131  1.00 0.00 ? 66  GLU A CB   5  
ATOM 8194  C CG   . GLU A 1 66  ? 9.286   -3.890  -5.264  1.00 0.00 ? 66  GLU A CG   5  
ATOM 8195  C CD   . GLU A 1 66  ? 9.244   -4.364  -6.704  1.00 0.00 ? 66  GLU A CD   5  
ATOM 8196  O OE1  . GLU A 1 66  ? 9.702   -3.613  -7.590  1.00 0.00 ? 66  GLU A OE1  5  
ATOM 8197  O OE2  . GLU A 1 66  ? 8.754   -5.488  -6.944  1.00 0.00 ? 66  GLU A OE2  5  
ATOM 8198  H H    . GLU A 1 66  ? 7.383   -2.126  -2.654  1.00 0.00 ? 66  GLU A H    5  
ATOM 8199  H HA   . GLU A 1 66  ? 10.203  -2.098  -3.379  1.00 0.00 ? 66  GLU A HA   5  
ATOM 8200  H HB2  . GLU A 1 66  ? 7.995   -2.214  -5.440  1.00 0.00 ? 66  GLU A HB2  5  
ATOM 8201  H HB3  . GLU A 1 66  ? 9.683   -1.873  -5.792  1.00 0.00 ? 66  GLU A HB3  5  
ATOM 8202  H HG2  . GLU A 1 66  ? 10.265  -4.101  -4.860  1.00 0.00 ? 66  GLU A HG2  5  
ATOM 8203  H HG3  . GLU A 1 66  ? 8.541   -4.433  -4.701  1.00 0.00 ? 66  GLU A HG3  5  
ATOM 8204  N N    . THR A 1 67  ? 10.053  0.362   -3.283  1.00 0.00 ? 67  THR A N    5  
ATOM 8205  C CA   . THR A 1 67  ? 10.002  1.817   -3.218  1.00 0.00 ? 67  THR A CA   5  
ATOM 8206  C C    . THR A 1 67  ? 10.751  2.446   -4.387  1.00 0.00 ? 67  THR A C    5  
ATOM 8207  O O    . THR A 1 67  ? 11.752  1.905   -4.858  1.00 0.00 ? 67  THR A O    5  
ATOM 8208  C CB   . THR A 1 67  ? 10.598  2.342   -1.898  1.00 0.00 ? 67  THR A CB   5  
ATOM 8209  O OG1  . THR A 1 67  ? 10.386  1.388   -0.852  1.00 0.00 ? 67  THR A OG1  5  
ATOM 8210  C CG2  . THR A 1 67  ? 9.970   3.673   -1.513  1.00 0.00 ? 67  THR A CG2  5  
ATOM 8211  H H    . THR A 1 67  ? 10.875  -0.101  -3.018  1.00 0.00 ? 67  THR A H    5  
ATOM 8212  H HA   . THR A 1 67  ? 8.965   2.116   -3.265  1.00 0.00 ? 67  THR A HA   5  
ATOM 8213  H HB   . THR A 1 67  ? 11.660  2.487   -2.033  1.00 0.00 ? 67  THR A HB   5  
ATOM 8214  H HG1  . THR A 1 67  ? 10.328  0.507   -1.229  1.00 0.00 ? 67  THR A HG1  5  
ATOM 8215  H HG21 . THR A 1 67  ? 9.412   3.556   -0.596  1.00 0.00 ? 67  THR A HG21 5  
ATOM 8216  H HG22 . THR A 1 67  ? 9.307   3.999   -2.300  1.00 0.00 ? 67  THR A HG22 5  
ATOM 8217  H HG23 . THR A 1 67  ? 10.747  4.408   -1.369  1.00 0.00 ? 67  THR A HG23 5  
ATOM 8218  N N    . ILE A 1 68  ? 10.262  3.592   -4.849  1.00 0.00 ? 68  ILE A N    5  
ATOM 8219  C CA   . ILE A 1 68  ? 10.888  4.295   -5.962  1.00 0.00 ? 68  ILE A CA   5  
ATOM 8220  C C    . ILE A 1 68  ? 11.082  5.773   -5.639  1.00 0.00 ? 68  ILE A C    5  
ATOM 8221  O O    . ILE A 1 68  ? 10.477  6.299   -4.706  1.00 0.00 ? 68  ILE A O    5  
ATOM 8222  C CB   . ILE A 1 68  ? 10.052  4.168   -7.250  1.00 0.00 ? 68  ILE A CB   5  
ATOM 8223  C CG1  . ILE A 1 68  ? 9.307   2.831   -7.271  1.00 0.00 ? 68  ILE A CG1  5  
ATOM 8224  C CG2  . ILE A 1 68  ? 10.944  4.302   -8.475  1.00 0.00 ? 68  ILE A CG2  5  
ATOM 8225  C CD1  . ILE A 1 68  ? 10.219  1.634   -7.427  1.00 0.00 ? 68  ILE A CD1  5  
ATOM 8226  H H    . ILE A 1 68  ? 9.462   3.973   -4.432  1.00 0.00 ? 68  ILE A H    5  
ATOM 8227  H HA   . ILE A 1 68  ? 11.855  3.846   -6.139  1.00 0.00 ? 68  ILE A HA   5  
ATOM 8228  H HB   . ILE A 1 68  ? 9.333   4.973   -7.267  1.00 0.00 ? 68  ILE A HB   5  
ATOM 8229  H HG12 . ILE A 1 68  ? 8.764   2.715   -6.346  1.00 0.00 ? 68  ILE A HG12 5  
ATOM 8230  H HG13 . ILE A 1 68  ? 8.611   2.829   -8.096  1.00 0.00 ? 68  ILE A HG13 5  
ATOM 8231  H HG21 . ILE A 1 68  ? 10.392  4.007   -9.356  1.00 0.00 ? 68  ILE A HG21 5  
ATOM 8232  H HG22 . ILE A 1 68  ? 11.260  5.329   -8.578  1.00 0.00 ? 68  ILE A HG22 5  
ATOM 8233  H HG23 . ILE A 1 68  ? 11.810  3.668   -8.362  1.00 0.00 ? 68  ILE A HG23 5  
ATOM 8234  H HD11 . ILE A 1 68  ? 9.831   0.808   -6.849  1.00 0.00 ? 68  ILE A HD11 5  
ATOM 8235  H HD12 . ILE A 1 68  ? 10.270  1.354   -8.468  1.00 0.00 ? 68  ILE A HD12 5  
ATOM 8236  H HD13 . ILE A 1 68  ? 11.208  1.886   -7.073  1.00 0.00 ? 68  ILE A HD13 5  
ATOM 8237  N N    . SER A 1 69  ? 11.928  6.437   -6.420  1.00 0.00 ? 69  SER A N    5  
ATOM 8238  C CA   . SER A 1 69  ? 12.204  7.854   -6.216  1.00 0.00 ? 69  SER A CA   5  
ATOM 8239  C C    . SER A 1 69  ? 11.686  8.682   -7.389  1.00 0.00 ? 69  SER A C    5  
ATOM 8240  O O    . SER A 1 69  ? 12.100  8.488   -8.532  1.00 0.00 ? 69  SER A O    5  
ATOM 8241  C CB   . SER A 1 69  ? 13.706  8.083   -6.039  1.00 0.00 ? 69  SER A CB   5  
ATOM 8242  O OG   . SER A 1 69  ? 14.413  7.772   -7.227  1.00 0.00 ? 69  SER A OG   5  
ATOM 8243  H H    . SER A 1 69  ? 12.380  5.962   -7.148  1.00 0.00 ? 69  SER A H    5  
ATOM 8244  H HA   . SER A 1 69  ? 11.692  8.166   -5.317  1.00 0.00 ? 69  SER A HA   5  
ATOM 8245  H HB2  . SER A 1 69  ? 13.883  9.118   -5.789  1.00 0.00 ? 69  SER A HB2  5  
ATOM 8246  H HB3  . SER A 1 69  ? 14.071  7.453   -5.241  1.00 0.00 ? 69  SER A HB3  5  
ATOM 8247  H HG   . SER A 1 69  ? 14.809  6.902   -7.145  1.00 0.00 ? 69  SER A HG   5  
ATOM 8248  N N    . THR A 1 70  ? 10.777  9.607   -7.096  1.00 0.00 ? 70  THR A N    5  
ATOM 8249  C CA   . THR A 1 70  ? 10.202  10.465  -8.125  1.00 0.00 ? 70  THR A CA   5  
ATOM 8250  C C    . THR A 1 70  ? 10.648  11.912  -7.947  1.00 0.00 ? 70  THR A C    5  
ATOM 8251  O O    . THR A 1 70  ? 11.238  12.268  -6.928  1.00 0.00 ? 70  THR A O    5  
ATOM 8252  C CB   . THR A 1 70  ? 8.663   10.408  -8.106  1.00 0.00 ? 70  THR A CB   5  
ATOM 8253  O OG1  . THR A 1 70  ? 8.172   10.818  -6.825  1.00 0.00 ? 70  THR A OG1  5  
ATOM 8254  C CG2  . THR A 1 70  ? 8.169   9.003   -8.418  1.00 0.00 ? 70  THR A CG2  5  
ATOM 8255  H H    . THR A 1 70  ? 10.488  9.714   -6.166  1.00 0.00 ? 70  THR A H    5  
ATOM 8256  H HA   . THR A 1 70  ? 10.543  10.108  -9.086  1.00 0.00 ? 70  THR A HA   5  
ATOM 8257  H HB   . THR A 1 70  ? 8.284   11.083  -8.861  1.00 0.00 ? 70  THR A HB   5  
ATOM 8258  H HG1  . THR A 1 70  ? 7.238   11.029  -6.892  1.00 0.00 ? 70  THR A HG1  5  
ATOM 8259  H HG21 . THR A 1 70  ? 7.154   9.051   -8.783  1.00 0.00 ? 70  THR A HG21 5  
ATOM 8260  H HG22 . THR A 1 70  ? 8.201   8.403   -7.521  1.00 0.00 ? 70  THR A HG22 5  
ATOM 8261  H HG23 . THR A 1 70  ? 8.802   8.559   -9.171  1.00 0.00 ? 70  THR A HG23 5  
ATOM 8262  N N    . GLU A 1 71  ? 10.361  12.741  -8.945  1.00 0.00 ? 71  GLU A N    5  
ATOM 8263  C CA   . GLU A 1 71  ? 10.733  14.150  -8.898  1.00 0.00 ? 71  GLU A CA   5  
ATOM 8264  C C    . GLU A 1 71  ? 10.028  14.861  -7.746  1.00 0.00 ? 71  GLU A C    5  
ATOM 8265  O O    . GLU A 1 71  ? 10.580  15.777  -7.138  1.00 0.00 ? 71  GLU A O    5  
ATOM 8266  C CB   . GLU A 1 71  ? 10.391  14.836  -10.222 1.00 0.00 ? 71  GLU A CB   5  
ATOM 8267  C CG   . GLU A 1 71  ? 9.094   14.346  -10.844 1.00 0.00 ? 71  GLU A CG   5  
ATOM 8268  C CD   . GLU A 1 71  ? 9.302   13.167  -11.774 1.00 0.00 ? 71  GLU A CD   5  
ATOM 8269  O OE1  . GLU A 1 71  ? 10.046  13.318  -12.766 1.00 0.00 ? 71  GLU A OE1  5  
ATOM 8270  O OE2  . GLU A 1 71  ? 8.721   12.094  -11.510 1.00 0.00 ? 71  GLU A OE2  5  
ATOM 8271  H H    . GLU A 1 71  ? 9.888   12.398  -9.732  1.00 0.00 ? 71  GLU A H    5  
ATOM 8272  H HA   . GLU A 1 71  ? 11.800  14.206  -8.740  1.00 0.00 ? 71  GLU A HA   5  
ATOM 8273  H HB2  . GLU A 1 71  ? 10.305  15.900  -10.051 1.00 0.00 ? 71  GLU A HB2  5  
ATOM 8274  H HB3  . GLU A 1 71  ? 11.192  14.657  -10.924 1.00 0.00 ? 71  GLU A HB3  5  
ATOM 8275  H HG2  . GLU A 1 71  ? 8.421   14.047  -10.054 1.00 0.00 ? 71  GLU A HG2  5  
ATOM 8276  H HG3  . GLU A 1 71  ? 8.650   15.155  -11.405 1.00 0.00 ? 71  GLU A HG3  5  
ATOM 8277  N N    . GLU A 1 72  ? 8.804   14.432  -7.455  1.00 0.00 ? 72  GLU A N    5  
ATOM 8278  C CA   . GLU A 1 72  ? 8.022   15.028  -6.378  1.00 0.00 ? 72  GLU A CA   5  
ATOM 8279  C C    . GLU A 1 72  ? 8.466   14.490  -5.021  1.00 0.00 ? 72  GLU A C    5  
ATOM 8280  O O    . GLU A 1 72  ? 8.378   15.182  -4.008  1.00 0.00 ? 72  GLU A O    5  
ATOM 8281  C CB   . GLU A 1 72  ? 6.532   14.752  -6.586  1.00 0.00 ? 72  GLU A CB   5  
ATOM 8282  C CG   . GLU A 1 72  ? 6.079   14.907  -8.028  1.00 0.00 ? 72  GLU A CG   5  
ATOM 8283  C CD   . GLU A 1 72  ? 5.913   16.358  -8.435  1.00 0.00 ? 72  GLU A CD   5  
ATOM 8284  O OE1  . GLU A 1 72  ? 6.939   17.056  -8.573  1.00 0.00 ? 72  GLU A OE1  5  
ATOM 8285  O OE2  . GLU A 1 72  ? 4.757   16.795  -8.614  1.00 0.00 ? 72  GLU A OE2  5  
ATOM 8286  H H    . GLU A 1 72  ? 8.417   13.698  -7.977  1.00 0.00 ? 72  GLU A H    5  
ATOM 8287  H HA   . GLU A 1 72  ? 8.187   16.095  -6.400  1.00 0.00 ? 72  GLU A HA   5  
ATOM 8288  H HB2  . GLU A 1 72  ? 6.318   13.742  -6.269  1.00 0.00 ? 72  GLU A HB2  5  
ATOM 8289  H HB3  . GLU A 1 72  ? 5.962   15.438  -5.977  1.00 0.00 ? 72  GLU A HB3  5  
ATOM 8290  H HG2  . GLU A 1 72  ? 6.815   14.451  -8.674  1.00 0.00 ? 72  GLU A HG2  5  
ATOM 8291  H HG3  . GLU A 1 72  ? 5.132   14.402  -8.151  1.00 0.00 ? 72  GLU A HG3  5  
ATOM 8292  N N    . GLY A 1 73  ? 8.943   13.249  -5.011  1.00 0.00 ? 73  GLY A N    5  
ATOM 8293  C CA   . GLY A 1 73  ? 9.393   12.638  -3.774  1.00 0.00 ? 73  GLY A CA   5  
ATOM 8294  C C    . GLY A 1 73  ? 9.707   11.163  -3.936  1.00 0.00 ? 73  GLY A C    5  
ATOM 8295  O O    . GLY A 1 73  ? 10.695  10.798  -4.573  1.00 0.00 ? 73  GLY A O    5  
ATOM 8296  H H    . GLY A 1 73  ? 8.990   12.744  -5.850  1.00 0.00 ? 73  GLY A H    5  
ATOM 8297  H HA2  . GLY A 1 73  ? 10.282  13.149  -3.435  1.00 0.00 ? 73  GLY A HA2  5  
ATOM 8298  H HA3  . GLY A 1 73  ? 8.619   12.749  -3.028  1.00 0.00 ? 73  GLY A HA3  5  
ATOM 8299  N N    . VAL A 1 74  ? 8.865   10.313  -3.357  1.00 0.00 ? 74  VAL A N    5  
ATOM 8300  C CA   . VAL A 1 74  ? 9.057   8.871   -3.440  1.00 0.00 ? 74  VAL A CA   5  
ATOM 8301  C C    . VAL A 1 74  ? 7.730   8.150   -3.652  1.00 0.00 ? 74  VAL A C    5  
ATOM 8302  O O    . VAL A 1 74  ? 6.666   8.769   -3.626  1.00 0.00 ? 74  VAL A O    5  
ATOM 8303  C CB   . VAL A 1 74  ? 9.730   8.320   -2.169  1.00 0.00 ? 74  VAL A CB   5  
ATOM 8304  C CG1  . VAL A 1 74  ? 11.244  8.342   -2.314  1.00 0.00 ? 74  VAL A CG1  5  
ATOM 8305  C CG2  . VAL A 1 74  ? 9.291   9.114   -0.948  1.00 0.00 ? 74  VAL A CG2  5  
ATOM 8306  H H    . VAL A 1 74  ? 8.095   10.665  -2.863  1.00 0.00 ? 74  VAL A H    5  
ATOM 8307  H HA   . VAL A 1 74  ? 9.704   8.668   -4.281  1.00 0.00 ? 74  VAL A HA   5  
ATOM 8308  H HB   . VAL A 1 74  ? 9.418   7.295   -2.036  1.00 0.00 ? 74  VAL A HB   5  
ATOM 8309  H HG11 . VAL A 1 74  ? 11.684  7.672   -1.590  1.00 0.00 ? 74  VAL A HG11 5  
ATOM 8310  H HG12 . VAL A 1 74  ? 11.516  8.027   -3.311  1.00 0.00 ? 74  VAL A HG12 5  
ATOM 8311  H HG13 . VAL A 1 74  ? 11.607  9.345   -2.141  1.00 0.00 ? 74  VAL A HG13 5  
ATOM 8312  H HG21 . VAL A 1 74  ? 9.062   8.435   -0.141  1.00 0.00 ? 74  VAL A HG21 5  
ATOM 8313  H HG22 . VAL A 1 74  ? 10.088  9.778   -0.644  1.00 0.00 ? 74  VAL A HG22 5  
ATOM 8314  H HG23 . VAL A 1 74  ? 8.414   9.694   -1.191  1.00 0.00 ? 74  VAL A HG23 5  
ATOM 8315  N N    . ILE A 1 75  ? 7.802   6.840   -3.861  1.00 0.00 ? 75  ILE A N    5  
ATOM 8316  C CA   . ILE A 1 75  ? 6.605   6.035   -4.076  1.00 0.00 ? 75  ILE A CA   5  
ATOM 8317  C C    . ILE A 1 75  ? 6.812   4.604   -3.592  1.00 0.00 ? 75  ILE A C    5  
ATOM 8318  O O    . ILE A 1 75  ? 7.666   3.881   -4.106  1.00 0.00 ? 75  ILE A O    5  
ATOM 8319  C CB   . ILE A 1 75  ? 6.203   6.010   -5.562  1.00 0.00 ? 75  ILE A CB   5  
ATOM 8320  C CG1  . ILE A 1 75  ? 5.854   7.420   -6.043  1.00 0.00 ? 75  ILE A CG1  5  
ATOM 8321  C CG2  . ILE A 1 75  ? 5.030   5.066   -5.777  1.00 0.00 ? 75  ILE A CG2  5  
ATOM 8322  C CD1  . ILE A 1 75  ? 5.422   7.476   -7.491  1.00 0.00 ? 75  ILE A CD1  5  
ATOM 8323  H H    . ILE A 1 75  ? 8.679   6.404   -3.870  1.00 0.00 ? 75  ILE A H    5  
ATOM 8324  H HA   . ILE A 1 75  ? 5.798   6.481   -3.512  1.00 0.00 ? 75  ILE A HA   5  
ATOM 8325  H HB   . ILE A 1 75  ? 7.041   5.640   -6.133  1.00 0.00 ? 75  ILE A HB   5  
ATOM 8326  H HG12 . ILE A 1 75  ? 5.048   7.810   -5.441  1.00 0.00 ? 75  ILE A HG12 5  
ATOM 8327  H HG13 . ILE A 1 75  ? 6.721   8.055   -5.930  1.00 0.00 ? 75  ILE A HG13 5  
ATOM 8328  H HG21 . ILE A 1 75  ? 5.287   4.338   -6.533  1.00 0.00 ? 75  ILE A HG21 5  
ATOM 8329  H HG22 . ILE A 1 75  ? 4.803   4.558   -4.852  1.00 0.00 ? 75  ILE A HG22 5  
ATOM 8330  H HG23 . ILE A 1 75  ? 4.168   5.630   -6.100  1.00 0.00 ? 75  ILE A HG23 5  
ATOM 8331  H HD11 . ILE A 1 75  ? 6.189   7.038   -8.113  1.00 0.00 ? 75  ILE A HD11 5  
ATOM 8332  H HD12 . ILE A 1 75  ? 4.501   6.926   -7.614  1.00 0.00 ? 75  ILE A HD12 5  
ATOM 8333  H HD13 . ILE A 1 75  ? 5.268   8.505   -7.781  1.00 0.00 ? 75  ILE A HD13 5  
ATOM 8334  N N    . SER A 1 76  ? 6.023   4.200   -2.602  1.00 0.00 ? 76  SER A N    5  
ATOM 8335  C CA   . SER A 1 76  ? 6.121   2.855   -2.047  1.00 0.00 ? 76  SER A CA   5  
ATOM 8336  C C    . SER A 1 76  ? 5.036   1.950   -2.623  1.00 0.00 ? 76  SER A C    5  
ATOM 8337  O O    . SER A 1 76  ? 3.867   2.045   -2.248  1.00 0.00 ? 76  SER A O    5  
ATOM 8338  C CB   . SER A 1 76  ? 6.006   2.900   -0.522  1.00 0.00 ? 76  SER A CB   5  
ATOM 8339  O OG   . SER A 1 76  ? 6.747   1.851   0.076   1.00 0.00 ? 76  SER A OG   5  
ATOM 8340  H H    . SER A 1 76  ? 5.362   4.823   -2.234  1.00 0.00 ? 76  SER A H    5  
ATOM 8341  H HA   . SER A 1 76  ? 7.087   2.455   -2.315  1.00 0.00 ? 76  SER A HA   5  
ATOM 8342  H HB2  . SER A 1 76  ? 6.387   3.844   -0.163  1.00 0.00 ? 76  SER A HB2  5  
ATOM 8343  H HB3  . SER A 1 76  ? 4.968   2.799   -0.239  1.00 0.00 ? 76  SER A HB3  5  
ATOM 8344  H HG   . SER A 1 76  ? 6.852   1.133   -0.553  1.00 0.00 ? 76  SER A HG   5  
ATOM 8345  N N    . THR A 1 77  ? 5.432   1.071   -3.538  1.00 0.00 ? 77  THR A N    5  
ATOM 8346  C CA   . THR A 1 77  ? 4.495   0.149   -4.168  1.00 0.00 ? 77  THR A CA   5  
ATOM 8347  C C    . THR A 1 77  ? 4.591   -1.241  -3.549  1.00 0.00 ? 77  THR A C    5  
ATOM 8348  O O    . THR A 1 77  ? 5.679   -1.705  -3.205  1.00 0.00 ? 77  THR A O    5  
ATOM 8349  C CB   . THR A 1 77  ? 4.747   0.041   -5.684  1.00 0.00 ? 77  THR A CB   5  
ATOM 8350  O OG1  . THR A 1 77  ? 5.097   1.324   -6.216  1.00 0.00 ? 77  THR A OG1  5  
ATOM 8351  C CG2  . THR A 1 77  ? 3.516   -0.492  -6.401  1.00 0.00 ? 77  THR A CG2  5  
ATOM 8352  H H    . THR A 1 77  ? 6.377   1.043   -3.796  1.00 0.00 ? 77  THR A H    5  
ATOM 8353  H HA   . THR A 1 77  ? 3.497   0.532   -4.017  1.00 0.00 ? 77  THR A HA   5  
ATOM 8354  H HB   . THR A 1 77  ? 5.566   -0.645  -5.850  1.00 0.00 ? 77  THR A HB   5  
ATOM 8355  H HG1  . THR A 1 77  ? 4.907   1.343   -7.157  1.00 0.00 ? 77  THR A HG1  5  
ATOM 8356  H HG21 . THR A 1 77  ? 2.862   0.330   -6.652  1.00 0.00 ? 77  THR A HG21 5  
ATOM 8357  H HG22 . THR A 1 77  ? 2.994   -1.183  -5.755  1.00 0.00 ? 77  THR A HG22 5  
ATOM 8358  H HG23 . THR A 1 77  ? 3.817   -1.001  -7.304  1.00 0.00 ? 77  THR A HG23 5  
ATOM 8359  N N    . LEU A 1 78  ? 3.446   -1.901  -3.409  1.00 0.00 ? 78  LEU A N    5  
ATOM 8360  C CA   . LEU A 1 78  ? 3.401   -3.239  -2.831  1.00 0.00 ? 78  LEU A CA   5  
ATOM 8361  C C    . LEU A 1 78  ? 2.632   -4.197  -3.735  1.00 0.00 ? 78  LEU A C    5  
ATOM 8362  O O    . LEU A 1 78  ? 1.424   -4.054  -3.925  1.00 0.00 ? 78  LEU A O    5  
ATOM 8363  C CB   . LEU A 1 78  ? 2.753   -3.196  -1.446  1.00 0.00 ? 78  LEU A CB   5  
ATOM 8364  C CG   . LEU A 1 78  ? 2.201   -4.522  -0.921  1.00 0.00 ? 78  LEU A CG   5  
ATOM 8365  C CD1  . LEU A 1 78  ? 3.336   -5.460  -0.542  1.00 0.00 ? 78  LEU A CD1  5  
ATOM 8366  C CD2  . LEU A 1 78  ? 1.283   -4.285  0.269   1.00 0.00 ? 78  LEU A CD2  5  
ATOM 8367  H H    . LEU A 1 78  ? 2.612   -1.479  -3.701  1.00 0.00 ? 78  LEU A H    5  
ATOM 8368  H HA   . LEU A 1 78  ? 4.417   -3.592  -2.733  1.00 0.00 ? 78  LEU A HA   5  
ATOM 8369  H HB2  . LEU A 1 78  ? 3.494   -2.846  -0.744  1.00 0.00 ? 78  LEU A HB2  5  
ATOM 8370  H HB3  . LEU A 1 78  ? 1.936   -2.489  -1.486  1.00 0.00 ? 78  LEU A HB3  5  
ATOM 8371  H HG   . LEU A 1 78  ? 1.622   -4.998  -1.702  1.00 0.00 ? 78  LEU A HG   5  
ATOM 8372  H HD11 . LEU A 1 78  ? 4.266   -4.913  -0.531  1.00 0.00 ? 78  LEU A HD11 5  
ATOM 8373  H HD12 . LEU A 1 78  ? 3.398   -6.261  -1.265  1.00 0.00 ? 78  LEU A HD12 5  
ATOM 8374  H HD13 . LEU A 1 78  ? 3.149   -5.874  0.438   1.00 0.00 ? 78  LEU A HD13 5  
ATOM 8375  H HD21 . LEU A 1 78  ? 1.771   -4.620  1.172   1.00 0.00 ? 78  LEU A HD21 5  
ATOM 8376  H HD22 . LEU A 1 78  ? 0.364   -4.836  0.130   1.00 0.00 ? 78  LEU A HD22 5  
ATOM 8377  H HD23 . LEU A 1 78  ? 1.062   -3.231  0.349   1.00 0.00 ? 78  LEU A HD23 5  
ATOM 8378  N N    . THR A 1 79  ? 3.340   -5.176  -4.289  1.00 0.00 ? 79  THR A N    5  
ATOM 8379  C CA   . THR A 1 79  ? 2.725   -6.159  -5.173  1.00 0.00 ? 79  THR A CA   5  
ATOM 8380  C C    . THR A 1 79  ? 2.228   -7.368  -4.388  1.00 0.00 ? 79  THR A C    5  
ATOM 8381  O O    . THR A 1 79  ? 2.893   -7.836  -3.464  1.00 0.00 ? 79  THR A O    5  
ATOM 8382  C CB   . THR A 1 79  ? 3.711   -6.634  -6.257  1.00 0.00 ? 79  THR A CB   5  
ATOM 8383  O OG1  . THR A 1 79  ? 4.448   -5.520  -6.771  1.00 0.00 ? 79  THR A OG1  5  
ATOM 8384  C CG2  . THR A 1 79  ? 2.973   -7.328  -7.392  1.00 0.00 ? 79  THR A CG2  5  
ATOM 8385  H H    . THR A 1 79  ? 4.300   -5.238  -4.099  1.00 0.00 ? 79  THR A H    5  
ATOM 8386  H HA   . THR A 1 79  ? 1.885   -5.688  -5.661  1.00 0.00 ? 79  THR A HA   5  
ATOM 8387  H HB   . THR A 1 79  ? 4.400   -7.338  -5.812  1.00 0.00 ? 79  THR A HB   5  
ATOM 8388  H HG1  . THR A 1 79  ? 5.259   -5.413  -6.268  1.00 0.00 ? 79  THR A HG1  5  
ATOM 8389  H HG21 . THR A 1 79  ? 3.673   -7.585  -8.173  1.00 0.00 ? 79  THR A HG21 5  
ATOM 8390  H HG22 . THR A 1 79  ? 2.218   -6.666  -7.788  1.00 0.00 ? 79  THR A HG22 5  
ATOM 8391  H HG23 . THR A 1 79  ? 2.504   -8.227  -7.020  1.00 0.00 ? 79  THR A HG23 5  
ATOM 8392  N N    . ILE A 1 80  ? 1.056   -7.870  -4.764  1.00 0.00 ? 80  ILE A N    5  
ATOM 8393  C CA   . ILE A 1 80  ? 0.471   -9.026  -4.096  1.00 0.00 ? 80  ILE A CA   5  
ATOM 8394  C C    . ILE A 1 80  ? 0.169   -10.141 -5.092  1.00 0.00 ? 80  ILE A C    5  
ATOM 8395  O O    . ILE A 1 80  ? -0.796  -10.063 -5.852  1.00 0.00 ? 80  ILE A O    5  
ATOM 8396  C CB   . ILE A 1 80  ? -0.824  -8.651  -3.353  1.00 0.00 ? 80  ILE A CB   5  
ATOM 8397  C CG1  . ILE A 1 80  ? -0.617  -7.376  -2.533  1.00 0.00 ? 80  ILE A CG1  5  
ATOM 8398  C CG2  . ILE A 1 80  ? -1.271  -9.797  -2.457  1.00 0.00 ? 80  ILE A CG2  5  
ATOM 8399  C CD1  . ILE A 1 80  ? -1.895  -6.609  -2.276  1.00 0.00 ? 80  ILE A CD1  5  
ATOM 8400  H H    . ILE A 1 80  ? 0.574   -7.453  -5.508  1.00 0.00 ? 80  ILE A H    5  
ATOM 8401  H HA   . ILE A 1 80  ? 1.186   -9.389  -3.372  1.00 0.00 ? 80  ILE A HA   5  
ATOM 8402  H HB   . ILE A 1 80  ? -1.596  -8.477  -4.087  1.00 0.00 ? 80  ILE A HB   5  
ATOM 8403  H HG12 . ILE A 1 80  ? -0.189  -7.635  -1.578  1.00 0.00 ? 80  ILE A HG12 5  
ATOM 8404  H HG13 . ILE A 1 80  ? 0.062   -6.723  -3.063  1.00 0.00 ? 80  ILE A HG13 5  
ATOM 8405  H HG21 . ILE A 1 80  ? -0.426  -10.432 -2.236  1.00 0.00 ? 80  ILE A HG21 5  
ATOM 8406  H HG22 . ILE A 1 80  ? -1.671  -9.398  -1.537  1.00 0.00 ? 80  ILE A HG22 5  
ATOM 8407  H HG23 . ILE A 1 80  ? -2.032  -10.373 -2.961  1.00 0.00 ? 80  ILE A HG23 5  
ATOM 8408  H HD11 . ILE A 1 80  ? -2.740  -7.276  -2.365  1.00 0.00 ? 80  ILE A HD11 5  
ATOM 8409  H HD12 . ILE A 1 80  ? -1.870  -6.189  -1.282  1.00 0.00 ? 80  ILE A HD12 5  
ATOM 8410  H HD13 . ILE A 1 80  ? -1.989  -5.812  -3.000  1.00 0.00 ? 80  ILE A HD13 5  
ATOM 8411  N N    . SER A 1 81  ? 1.000   -11.178 -5.080  1.00 0.00 ? 81  SER A N    5  
ATOM 8412  C CA   . SER A 1 81  ? 0.823   -12.309 -5.983  1.00 0.00 ? 81  SER A CA   5  
ATOM 8413  C C    . SER A 1 81  ? -0.425  -13.107 -5.617  1.00 0.00 ? 81  SER A C    5  
ATOM 8414  O O    . SER A 1 81  ? -0.741  -13.281 -4.441  1.00 0.00 ? 81  SER A O    5  
ATOM 8415  C CB   . SER A 1 81  ? 2.053   -13.218 -5.943  1.00 0.00 ? 81  SER A CB   5  
ATOM 8416  O OG   . SER A 1 81  ? 1.950   -14.258 -6.901  1.00 0.00 ? 81  SER A OG   5  
ATOM 8417  H H    . SER A 1 81  ? 1.751   -11.182 -4.450  1.00 0.00 ? 81  SER A H    5  
ATOM 8418  H HA   . SER A 1 81  ? 0.706   -11.920 -6.984  1.00 0.00 ? 81  SER A HA   5  
ATOM 8419  H HB2  . SER A 1 81  ? 2.935   -12.635 -6.156  1.00 0.00 ? 81  SER A HB2  5  
ATOM 8420  H HB3  . SER A 1 81  ? 2.140   -13.658 -4.960  1.00 0.00 ? 81  SER A HB3  5  
ATOM 8421  H HG   . SER A 1 81  ? 2.316   -15.067 -6.536  1.00 0.00 ? 81  SER A HG   5  
ATOM 8422  N N    . ASN A 1 82  ? -1.131  -13.589 -6.635  1.00 0.00 ? 82  ASN A N    5  
ATOM 8423  C CA   . ASN A 1 82  ? -2.346  -14.368 -6.421  1.00 0.00 ? 82  ASN A CA   5  
ATOM 8424  C C    . ASN A 1 82  ? -3.149  -13.812 -5.250  1.00 0.00 ? 82  ASN A C    5  
ATOM 8425  O O    . ASN A 1 82  ? -3.561  -14.556 -4.358  1.00 0.00 ? 82  ASN A O    5  
ATOM 8426  C CB   . ASN A 1 82  ? -1.997  -15.836 -6.165  1.00 0.00 ? 82  ASN A CB   5  
ATOM 8427  C CG   . ASN A 1 82  ? -1.930  -16.647 -7.444  1.00 0.00 ? 82  ASN A CG   5  
ATOM 8428  O OD1  . ASN A 1 82  ? -2.931  -16.805 -8.144  1.00 0.00 ? 82  ASN A OD1  5  
ATOM 8429  N ND2  . ASN A 1 82  ? -0.748  -17.165 -7.755  1.00 0.00 ? 82  ASN A ND2  5  
ATOM 8430  H H    . ASN A 1 82  ? -0.829  -13.417 -7.551  1.00 0.00 ? 82  ASN A H    5  
ATOM 8431  H HA   . ASN A 1 82  ? -2.944  -14.301 -7.317  1.00 0.00 ? 82  ASN A HA   5  
ATOM 8432  H HB2  . ASN A 1 82  ? -1.034  -15.890 -5.677  1.00 0.00 ? 82  ASN A HB2  5  
ATOM 8433  H HB3  . ASN A 1 82  ? -2.747  -16.271 -5.522  1.00 0.00 ? 82  ASN A HB3  5  
ATOM 8434  H HD21 . ASN A 1 82  ? 0.005   -16.998 -7.150  1.00 0.00 ? 82  ASN A HD21 5  
ATOM 8435  H HD22 . ASN A 1 82  ? -0.677  -17.693 -8.578  1.00 0.00 ? 82  ASN A HD22 5  
ATOM 8436  N N    . ILE A 1 83  ? -3.369  -12.502 -5.259  1.00 0.00 ? 83  ILE A N    5  
ATOM 8437  C CA   . ILE A 1 83  ? -4.125  -11.847 -4.198  1.00 0.00 ? 83  ILE A CA   5  
ATOM 8438  C C    . ILE A 1 83  ? -5.353  -12.665 -3.813  1.00 0.00 ? 83  ILE A C    5  
ATOM 8439  O O    . ILE A 1 83  ? -5.973  -13.310 -4.659  1.00 0.00 ? 83  ILE A O    5  
ATOM 8440  C CB   . ILE A 1 83  ? -4.572  -10.434 -4.616  1.00 0.00 ? 83  ILE A CB   5  
ATOM 8441  C CG1  . ILE A 1 83  ? -4.845  -9.575  -3.379  1.00 0.00 ? 83  ILE A CG1  5  
ATOM 8442  C CG2  . ILE A 1 83  ? -5.810  -10.510 -5.498  1.00 0.00 ? 83  ILE A CG2  5  
ATOM 8443  C CD1  . ILE A 1 83  ? -5.194  -8.140  -3.705  1.00 0.00 ? 83  ILE A CD1  5  
ATOM 8444  H H    . ILE A 1 83  ? -3.015  -11.963 -5.996  1.00 0.00 ? 83  ILE A H    5  
ATOM 8445  H HA   . ILE A 1 83  ? -3.480  -11.759 -3.336  1.00 0.00 ? 83  ILE A HA   5  
ATOM 8446  H HB   . ILE A 1 83  ? -3.777  -9.984  -5.190  1.00 0.00 ? 83  ILE A HB   5  
ATOM 8447  H HG12 . ILE A 1 83  ? -5.669  -10.000 -2.828  1.00 0.00 ? 83  ILE A HG12 5  
ATOM 8448  H HG13 . ILE A 1 83  ? -3.964  -9.570  -2.753  1.00 0.00 ? 83  ILE A HG13 5  
ATOM 8449  H HG21 . ILE A 1 83  ? -5.741  -9.767  -6.279  1.00 0.00 ? 83  ILE A HG21 5  
ATOM 8450  H HG22 . ILE A 1 83  ? -5.875  -11.492 -5.942  1.00 0.00 ? 83  ILE A HG22 5  
ATOM 8451  H HG23 . ILE A 1 83  ? -6.690  -10.324 -4.901  1.00 0.00 ? 83  ILE A HG23 5  
ATOM 8452  H HD11 . ILE A 1 83  ? -5.918  -7.774  -2.992  1.00 0.00 ? 83  ILE A HD11 5  
ATOM 8453  H HD12 . ILE A 1 83  ? -4.303  -7.533  -3.659  1.00 0.00 ? 83  ILE A HD12 5  
ATOM 8454  H HD13 . ILE A 1 83  ? -5.613  -8.089  -4.700  1.00 0.00 ? 83  ILE A HD13 5  
ATOM 8455  N N    . VAL A 1 84  ? -5.702  -12.631 -2.531  1.00 0.00 ? 84  VAL A N    5  
ATOM 8456  C CA   . VAL A 1 84  ? -6.858  -13.367 -2.034  1.00 0.00 ? 84  VAL A CA   5  
ATOM 8457  C C    . VAL A 1 84  ? -7.931  -12.417 -1.513  1.00 0.00 ? 84  VAL A C    5  
ATOM 8458  O O    . VAL A 1 84  ? -7.628  -11.325 -1.032  1.00 0.00 ? 84  VAL A O    5  
ATOM 8459  C CB   . VAL A 1 84  ? -6.462  -14.342 -0.909  1.00 0.00 ? 84  VAL A CB   5  
ATOM 8460  C CG1  . VAL A 1 84  ? -5.472  -15.376 -1.422  1.00 0.00 ? 84  VAL A CG1  5  
ATOM 8461  C CG2  . VAL A 1 84  ? -5.886  -13.582 0.276   1.00 0.00 ? 84  VAL A CG2  5  
ATOM 8462  H H    . VAL A 1 84  ? -5.168  -12.099 -1.905  1.00 0.00 ? 84  VAL A H    5  
ATOM 8463  H HA   . VAL A 1 84  ? -7.266  -13.941 -2.853  1.00 0.00 ? 84  VAL A HA   5  
ATOM 8464  H HB   . VAL A 1 84  ? -7.351  -14.860 -0.580  1.00 0.00 ? 84  VAL A HB   5  
ATOM 8465  H HG11 . VAL A 1 84  ? -5.159  -15.109 -2.421  1.00 0.00 ? 84  VAL A HG11 5  
ATOM 8466  H HG12 . VAL A 1 84  ? -4.612  -15.405 -0.770  1.00 0.00 ? 84  VAL A HG12 5  
ATOM 8467  H HG13 . VAL A 1 84  ? -5.944  -16.347 -1.441  1.00 0.00 ? 84  VAL A HG13 5  
ATOM 8468  H HG21 . VAL A 1 84  ? -6.186  -14.066 1.193   1.00 0.00 ? 84  VAL A HG21 5  
ATOM 8469  H HG22 . VAL A 1 84  ? -4.808  -13.574 0.209   1.00 0.00 ? 84  VAL A HG22 5  
ATOM 8470  H HG23 . VAL A 1 84  ? -6.254  -12.567 0.267   1.00 0.00 ? 84  VAL A HG23 5  
ATOM 8471  N N    . ARG A 1 85  ? -9.187  -12.839 -1.614  1.00 0.00 ? 85  ARG A N    5  
ATOM 8472  C CA   . ARG A 1 85  ? -10.306 -12.026 -1.154  1.00 0.00 ? 85  ARG A CA   5  
ATOM 8473  C C    . ARG A 1 85  ? -9.982  -11.361 0.181   1.00 0.00 ? 85  ARG A C    5  
ATOM 8474  O O    . ARG A 1 85  ? -10.361 -10.215 0.422   1.00 0.00 ? 85  ARG A O    5  
ATOM 8475  C CB   . ARG A 1 85  ? -11.565 -12.884 -1.016  1.00 0.00 ? 85  ARG A CB   5  
ATOM 8476  C CG   . ARG A 1 85  ? -12.403 -12.944 -2.283  1.00 0.00 ? 85  ARG A CG   5  
ATOM 8477  C CD   . ARG A 1 85  ? -13.456 -14.039 -2.203  1.00 0.00 ? 85  ARG A CD   5  
ATOM 8478  N NE   . ARG A 1 85  ? -14.144 -14.230 -3.477  1.00 0.00 ? 85  ARG A NE   5  
ATOM 8479  C CZ   . ARG A 1 85  ? -14.813 -15.333 -3.792  1.00 0.00 ? 85  ARG A CZ   5  
ATOM 8480  N NH1  . ARG A 1 85  ? -14.884 -16.338 -2.930  1.00 0.00 ? 85  ARG A NH1  5  
ATOM 8481  N NH2  . ARG A 1 85  ? -15.414 -15.432 -4.971  1.00 0.00 ? 85  ARG A NH2  5  
ATOM 8482  H H    . ARG A 1 85  ? -9.366  -13.719 -2.007  1.00 0.00 ? 85  ARG A H    5  
ATOM 8483  H HA   . ARG A 1 85  ? -10.484 -11.258 -1.892  1.00 0.00 ? 85  ARG A HA   5  
ATOM 8484  H HB2  . ARG A 1 85  ? -11.274 -13.891 -0.755  1.00 0.00 ? 85  ARG A HB2  5  
ATOM 8485  H HB3  . ARG A 1 85  ? -12.177 -12.478 -0.225  1.00 0.00 ? 85  ARG A HB3  5  
ATOM 8486  H HG2  . ARG A 1 85  ? -12.897 -11.994 -2.422  1.00 0.00 ? 85  ARG A HG2  5  
ATOM 8487  H HG3  . ARG A 1 85  ? -11.754 -13.141 -3.123  1.00 0.00 ? 85  ARG A HG3  5  
ATOM 8488  H HD2  . ARG A 1 85  ? -12.974 -14.964 -1.923  1.00 0.00 ? 85  ARG A HD2  5  
ATOM 8489  H HD3  . ARG A 1 85  ? -14.180 -13.768 -1.450  1.00 0.00 ? 85  ARG A HD3  5  
ATOM 8490  H HE   . ARG A 1 85  ? -14.104 -13.500 -4.128  1.00 0.00 ? 85  ARG A HE   5  
ATOM 8491  H HH11 . ARG A 1 85  ? -14.434 -16.266 -2.041  1.00 0.00 ? 85  ARG A HH11 5  
ATOM 8492  H HH12 . ARG A 1 85  ? -15.390 -17.168 -3.170  1.00 0.00 ? 85  ARG A HH12 5  
ATOM 8493  H HH21 . ARG A 1 85  ? -15.362 -14.677 -5.623  1.00 0.00 ? 85  ARG A HH21 5  
ATOM 8494  H HH22 . ARG A 1 85  ? -15.917 -16.263 -5.207  1.00 0.00 ? 85  ARG A HH22 5  
ATOM 8495  N N    . ALA A 1 86  ? -9.280  -12.088 1.043   1.00 0.00 ? 86  ALA A N    5  
ATOM 8496  C CA   . ALA A 1 86  ? -8.904  -11.568 2.352   1.00 0.00 ? 86  ALA A CA   5  
ATOM 8497  C C    . ALA A 1 86  ? -8.192  -10.225 2.226   1.00 0.00 ? 86  ALA A C    5  
ATOM 8498  O O    . ALA A 1 86  ? -8.448  -9.301  2.997   1.00 0.00 ? 86  ALA A O    5  
ATOM 8499  C CB   . ALA A 1 86  ? -8.022  -12.568 3.084   1.00 0.00 ? 86  ALA A CB   5  
ATOM 8500  H H    . ALA A 1 86  ? -9.007  -12.994 0.793   1.00 0.00 ? 86  ALA A H    5  
ATOM 8501  H HA   . ALA A 1 86  ? -9.808  -11.431 2.929   1.00 0.00 ? 86  ALA A HA   5  
ATOM 8502  H HB1  . ALA A 1 86  ? -8.572  -13.485 3.239   1.00 0.00 ? 86  ALA A HB1  5  
ATOM 8503  H HB2  . ALA A 1 86  ? -7.142  -12.772 2.494   1.00 0.00 ? 86  ALA A HB2  5  
ATOM 8504  H HB3  . ALA A 1 86  ? -7.729  -12.158 4.039   1.00 0.00 ? 86  ALA A HB3  5  
ATOM 8505  N N    . ASP A 1 87  ? -7.297  -10.126 1.249   1.00 0.00 ? 87  ASP A N    5  
ATOM 8506  C CA   . ASP A 1 87  ? -6.547  -8.896  1.021   1.00 0.00 ? 87  ASP A CA   5  
ATOM 8507  C C    . ASP A 1 87  ? -7.472  -7.682  1.051   1.00 0.00 ? 87  ASP A C    5  
ATOM 8508  O O    . ASP A 1 87  ? -7.047  -6.573  1.373   1.00 0.00 ? 87  ASP A O    5  
ATOM 8509  C CB   . ASP A 1 87  ? -5.814  -8.961  -0.319  1.00 0.00 ? 87  ASP A CB   5  
ATOM 8510  C CG   . ASP A 1 87  ? -4.488  -9.690  -0.219  1.00 0.00 ? 87  ASP A CG   5  
ATOM 8511  O OD1  . ASP A 1 87  ? -4.502  -10.933 -0.112  1.00 0.00 ? 87  ASP A OD1  5  
ATOM 8512  O OD2  . ASP A 1 87  ? -3.437  -9.016  -0.246  1.00 0.00 ? 87  ASP A OD2  5  
ATOM 8513  H H    . ASP A 1 87  ? -7.137  -10.898 0.666   1.00 0.00 ? 87  ASP A H    5  
ATOM 8514  H HA   . ASP A 1 87  ? -5.821  -8.798  1.814   1.00 0.00 ? 87  ASP A HA   5  
ATOM 8515  H HB2  . ASP A 1 87  ? -6.434  -9.478  -1.037  1.00 0.00 ? 87  ASP A HB2  5  
ATOM 8516  H HB3  . ASP A 1 87  ? -5.626  -7.956  -0.669  1.00 0.00 ? 87  ASP A HB3  5  
ATOM 8517  N N    . PHE A 1 88  ? -8.738  -7.901  0.711   1.00 0.00 ? 88  PHE A N    5  
ATOM 8518  C CA   . PHE A 1 88  ? -9.723  -6.826  0.697   1.00 0.00 ? 88  PHE A CA   5  
ATOM 8519  C C    . PHE A 1 88  ? -10.251 -6.553  2.102   1.00 0.00 ? 88  PHE A C    5  
ATOM 8520  O O    . PHE A 1 88  ? -10.481 -5.403  2.477   1.00 0.00 ? 88  PHE A O    5  
ATOM 8521  C CB   . PHE A 1 88  ? -10.882 -7.180  -0.236  1.00 0.00 ? 88  PHE A CB   5  
ATOM 8522  C CG   . PHE A 1 88  ? -10.439 -7.639  -1.596  1.00 0.00 ? 88  PHE A CG   5  
ATOM 8523  C CD1  . PHE A 1 88  ? -9.596  -6.854  -2.365  1.00 0.00 ? 88  PHE A CD1  5  
ATOM 8524  C CD2  . PHE A 1 88  ? -10.867 -8.855  -2.105  1.00 0.00 ? 88  PHE A CD2  5  
ATOM 8525  C CE1  . PHE A 1 88  ? -9.186  -7.274  -3.617  1.00 0.00 ? 88  PHE A CE1  5  
ATOM 8526  C CE2  . PHE A 1 88  ? -10.460 -9.279  -3.355  1.00 0.00 ? 88  PHE A CE2  5  
ATOM 8527  C CZ   . PHE A 1 88  ? -9.619  -8.487  -4.113  1.00 0.00 ? 88  PHE A CZ   5  
ATOM 8528  H H    . PHE A 1 88  ? -9.017  -8.808  0.464   1.00 0.00 ? 88  PHE A H    5  
ATOM 8529  H HA   . PHE A 1 88  ? -9.235  -5.936  0.329   1.00 0.00 ? 88  PHE A HA   5  
ATOM 8530  H HB2  . PHE A 1 88  ? -11.463 -7.974  0.209   1.00 0.00 ? 88  PHE A HB2  5  
ATOM 8531  H HB3  . PHE A 1 88  ? -11.509 -6.311  -0.365  1.00 0.00 ? 88  PHE A HB3  5  
ATOM 8532  H HD1  . PHE A 1 88  ? -9.256  -5.904  -1.978  1.00 0.00 ? 88  PHE A HD1  5  
ATOM 8533  H HD2  . PHE A 1 88  ? -11.525 -9.475  -1.514  1.00 0.00 ? 88  PHE A HD2  5  
ATOM 8534  H HE1  . PHE A 1 88  ? -8.529  -6.652  -4.207  1.00 0.00 ? 88  PHE A HE1  5  
ATOM 8535  H HE2  . PHE A 1 88  ? -10.801 -10.229 -3.741  1.00 0.00 ? 88  PHE A HE2  5  
ATOM 8536  H HZ   . PHE A 1 88  ? -9.300  -8.817  -5.090  1.00 0.00 ? 88  PHE A HZ   5  
ATOM 8537  N N    . GLN A 1 89  ? -10.440 -7.618  2.874   1.00 0.00 ? 89  GLN A N    5  
ATOM 8538  C CA   . GLN A 1 89  ? -10.942 -7.494  4.237   1.00 0.00 ? 89  GLN A CA   5  
ATOM 8539  C C    . GLN A 1 89  ? -9.850  -6.991  5.176   1.00 0.00 ? 89  GLN A C    5  
ATOM 8540  O O    . GLN A 1 89  ? -10.135 -6.385  6.210   1.00 0.00 ? 89  GLN A O    5  
ATOM 8541  C CB   . GLN A 1 89  ? -11.477 -8.839  4.731   1.00 0.00 ? 89  GLN A CB   5  
ATOM 8542  C CG   . GLN A 1 89  ? -12.483 -9.478  3.788   1.00 0.00 ? 89  GLN A CG   5  
ATOM 8543  C CD   . GLN A 1 89  ? -13.906 -9.038  4.067   1.00 0.00 ? 89  GLN A CD   5  
ATOM 8544  O OE1  . GLN A 1 89  ? -14.544 -9.520  5.003   1.00 0.00 ? 89  GLN A OE1  5  
ATOM 8545  N NE2  . GLN A 1 89  ? -14.412 -8.118  3.255   1.00 0.00 ? 89  GLN A NE2  5  
ATOM 8546  H H    . GLN A 1 89  ? -10.239 -8.508  2.518   1.00 0.00 ? 89  GLN A H    5  
ATOM 8547  H HA   . GLN A 1 89  ? -11.750 -6.777  4.229   1.00 0.00 ? 89  GLN A HA   5  
ATOM 8548  H HB2  . GLN A 1 89  ? -10.647 -9.519  4.854   1.00 0.00 ? 89  GLN A HB2  5  
ATOM 8549  H HB3  . GLN A 1 89  ? -11.956 -8.693  5.688   1.00 0.00 ? 89  GLN A HB3  5  
ATOM 8550  H HG2  . GLN A 1 89  ? -12.231 -9.204  2.774   1.00 0.00 ? 89  GLN A HG2  5  
ATOM 8551  H HG3  . GLN A 1 89  ? -12.425 -10.551 3.894   1.00 0.00 ? 89  GLN A HG3  5  
ATOM 8552  H HE21 . GLN A 1 89  ? -13.846 -7.780  2.529   1.00 0.00 ? 89  GLN A HE21 5  
ATOM 8553  H HE22 . GLN A 1 89  ? -15.330 -7.816  3.412   1.00 0.00 ? 89  GLN A HE22 5  
ATOM 8554  N N    . THR A 1 90  ? -8.598  -7.247  4.810   1.00 0.00 ? 90  THR A N    5  
ATOM 8555  C CA   . THR A 1 90  ? -7.463  -6.822  5.619   1.00 0.00 ? 90  THR A CA   5  
ATOM 8556  C C    . THR A 1 90  ? -7.188  -5.333  5.442   1.00 0.00 ? 90  THR A C    5  
ATOM 8557  O O    . THR A 1 90  ? -7.348  -4.789  4.349   1.00 0.00 ? 90  THR A O    5  
ATOM 8558  C CB   . THR A 1 90  ? -6.191  -7.614  5.262   1.00 0.00 ? 90  THR A CB   5  
ATOM 8559  O OG1  . THR A 1 90  ? -6.383  -9.004  5.548   1.00 0.00 ? 90  THR A OG1  5  
ATOM 8560  C CG2  . THR A 1 90  ? -4.992  -7.092  6.040   1.00 0.00 ? 90  THR A CG2  5  
ATOM 8561  H H    . THR A 1 90  ? -8.435  -7.734  3.975   1.00 0.00 ? 90  THR A H    5  
ATOM 8562  H HA   . THR A 1 90  ? -7.702  -7.013  6.655   1.00 0.00 ? 90  THR A HA   5  
ATOM 8563  H HB   . THR A 1 90  ? -5.995  -7.495  4.206   1.00 0.00 ? 90  THR A HB   5  
ATOM 8564  H HG1  . THR A 1 90  ? -6.419  -9.498  4.725   1.00 0.00 ? 90  THR A HG1  5  
ATOM 8565  H HG21 . THR A 1 90  ? -5.330  -6.407  6.804   1.00 0.00 ? 90  THR A HG21 5  
ATOM 8566  H HG22 . THR A 1 90  ? -4.322  -6.579  5.367   1.00 0.00 ? 90  THR A HG22 5  
ATOM 8567  H HG23 . THR A 1 90  ? -4.476  -7.919  6.502   1.00 0.00 ? 90  THR A HG23 5  
ATOM 8568  N N    . ILE A 1 91  ? -6.772  -4.681  6.522   1.00 0.00 ? 91  ILE A N    5  
ATOM 8569  C CA   . ILE A 1 91  ? -6.473  -3.255  6.484   1.00 0.00 ? 91  ILE A CA   5  
ATOM 8570  C C    . ILE A 1 91  ? -4.981  -3.011  6.281   1.00 0.00 ? 91  ILE A C    5  
ATOM 8571  O O    . ILE A 1 91  ? -4.154  -3.466  7.071   1.00 0.00 ? 91  ILE A O    5  
ATOM 8572  C CB   . ILE A 1 91  ? -6.925  -2.550  7.777   1.00 0.00 ? 91  ILE A CB   5  
ATOM 8573  C CG1  . ILE A 1 91  ? -8.431  -2.728  7.981   1.00 0.00 ? 91  ILE A CG1  5  
ATOM 8574  C CG2  . ILE A 1 91  ? -6.562  -1.073  7.730   1.00 0.00 ? 91  ILE A CG2  5  
ATOM 8575  C CD1  . ILE A 1 91  ? -8.791  -3.960  8.781   1.00 0.00 ? 91  ILE A CD1  5  
ATOM 8576  H H    . ILE A 1 91  ? -6.664  -5.170  7.364   1.00 0.00 ? 91  ILE A H    5  
ATOM 8577  H HA   . ILE A 1 91  ? -7.014  -2.823  5.654   1.00 0.00 ? 91  ILE A HA   5  
ATOM 8578  H HB   . ILE A 1 91  ? -6.401  -2.998  8.607   1.00 0.00 ? 91  ILE A HB   5  
ATOM 8579  H HG12 . ILE A 1 91  ? -8.821  -1.869  8.503   1.00 0.00 ? 91  ILE A HG12 5  
ATOM 8580  H HG13 . ILE A 1 91  ? -8.910  -2.806  7.016   1.00 0.00 ? 91  ILE A HG13 5  
ATOM 8581  H HG21 . ILE A 1 91  ? -7.343  -0.527  7.221   1.00 0.00 ? 91  ILE A HG21 5  
ATOM 8582  H HG22 . ILE A 1 91  ? -6.458  -0.696  8.736   1.00 0.00 ? 91  ILE A HG22 5  
ATOM 8583  H HG23 . ILE A 1 91  ? -5.630  -0.948  7.199   1.00 0.00 ? 91  ILE A HG23 5  
ATOM 8584  H HD11 . ILE A 1 91  ? -8.922  -4.798  8.112   1.00 0.00 ? 91  ILE A HD11 5  
ATOM 8585  H HD12 . ILE A 1 91  ? -8.000  -4.179  9.482   1.00 0.00 ? 91  ILE A HD12 5  
ATOM 8586  H HD13 . ILE A 1 91  ? -9.710  -3.783  9.320   1.00 0.00 ? 91  ILE A HD13 5  
ATOM 8587  N N    . TYR A 1 92  ? -4.645  -2.290  5.217   1.00 0.00 ? 92  TYR A N    5  
ATOM 8588  C CA   . TYR A 1 92  ? -3.253  -1.985  4.909   1.00 0.00 ? 92  TYR A CA   5  
ATOM 8589  C C    . TYR A 1 92  ? -2.826  -0.671  5.556   1.00 0.00 ? 92  TYR A C    5  
ATOM 8590  O O    . TYR A 1 92  ? -3.659  0.179   5.868   1.00 0.00 ? 92  TYR A O    5  
ATOM 8591  C CB   . TYR A 1 92  ? -3.048  -1.912  3.395   1.00 0.00 ? 92  TYR A CB   5  
ATOM 8592  C CG   . TYR A 1 92  ? -3.310  -3.220  2.684   1.00 0.00 ? 92  TYR A CG   5  
ATOM 8593  C CD1  . TYR A 1 92  ? -2.491  -4.323  2.894   1.00 0.00 ? 92  TYR A CD1  5  
ATOM 8594  C CD2  . TYR A 1 92  ? -4.376  -3.354  1.803   1.00 0.00 ? 92  TYR A CD2  5  
ATOM 8595  C CE1  . TYR A 1 92  ? -2.726  -5.521  2.246   1.00 0.00 ? 92  TYR A CE1  5  
ATOM 8596  C CE2  . TYR A 1 92  ? -4.619  -4.548  1.152   1.00 0.00 ? 92  TYR A CE2  5  
ATOM 8597  C CZ   . TYR A 1 92  ? -3.791  -5.628  1.376   1.00 0.00 ? 92  TYR A CZ   5  
ATOM 8598  O OH   . TYR A 1 92  ? -4.030  -6.819  0.729   1.00 0.00 ? 92  TYR A OH   5  
ATOM 8599  H H    . TYR A 1 92  ? -5.349  -1.955  4.624   1.00 0.00 ? 92  TYR A H    5  
ATOM 8600  H HA   . TYR A 1 92  ? -2.643  -2.784  5.306   1.00 0.00 ? 92  TYR A HA   5  
ATOM 8601  H HB2  . TYR A 1 92  ? -3.717  -1.172  2.984   1.00 0.00 ? 92  TYR A HB2  5  
ATOM 8602  H HB3  . TYR A 1 92  ? -2.028  -1.621  3.190   1.00 0.00 ? 92  TYR A HB3  5  
ATOM 8603  H HD1  . TYR A 1 92  ? -1.657  -4.236  3.575   1.00 0.00 ? 92  TYR A HD1  5  
ATOM 8604  H HD2  . TYR A 1 92  ? -5.022  -2.505  1.629   1.00 0.00 ? 92  TYR A HD2  5  
ATOM 8605  H HE1  . TYR A 1 92  ? -2.078  -6.367  2.422   1.00 0.00 ? 92  TYR A HE1  5  
ATOM 8606  H HE2  . TYR A 1 92  ? -5.453  -4.632  0.471   1.00 0.00 ? 92  TYR A HE2  5  
ATOM 8607  H HH   . TYR A 1 92  ? -4.828  -7.220  1.081   1.00 0.00 ? 92  TYR A HH   5  
ATOM 8608  N N    . ASN A 1 93  ? -1.521  -0.513  5.753   1.00 0.00 ? 93  ASN A N    5  
ATOM 8609  C CA   . ASN A 1 93  ? -0.982  0.698   6.363   1.00 0.00 ? 93  ASN A CA   5  
ATOM 8610  C C    . ASN A 1 93  ? 0.489   0.879   6.001   1.00 0.00 ? 93  ASN A C    5  
ATOM 8611  O O    . ASN A 1 93  ? 1.305   -0.020  6.206   1.00 0.00 ? 93  ASN A O    5  
ATOM 8612  C CB   . ASN A 1 93  ? -1.142  0.643   7.883   1.00 0.00 ? 93  ASN A CB   5  
ATOM 8613  C CG   . ASN A 1 93  ? -2.443  1.266   8.350   1.00 0.00 ? 93  ASN A CG   5  
ATOM 8614  O OD1  . ASN A 1 93  ? -2.611  2.485   8.307   1.00 0.00 ? 93  ASN A OD1  5  
ATOM 8615  N ND2  . ASN A 1 93  ? -3.372  0.430   8.800   1.00 0.00 ? 93  ASN A ND2  5  
ATOM 8616  H H    . ASN A 1 93  ? -0.906  -1.226  5.483   1.00 0.00 ? 93  ASN A H    5  
ATOM 8617  H HA   . ASN A 1 93  ? -1.541  1.538   5.981   1.00 0.00 ? 93  ASN A HA   5  
ATOM 8618  H HB2  . ASN A 1 93  ? -1.124  -0.389  8.204   1.00 0.00 ? 93  ASN A HB2  5  
ATOM 8619  H HB3  . ASN A 1 93  ? -0.323  1.174   8.345   1.00 0.00 ? 93  ASN A HB3  5  
ATOM 8620  H HD21 . ASN A 1 93  ? -3.168  -0.529  8.806   1.00 0.00 ? 93  ASN A HD21 5  
ATOM 8621  H HD22 . ASN A 1 93  ? -4.222  0.806   9.108   1.00 0.00 ? 93  ASN A HD22 5  
ATOM 8622  N N    . CYS A 1 94  ? 0.820   2.048   5.464   1.00 0.00 ? 94  CYS A N    5  
ATOM 8623  C CA   . CYS A 1 94  ? 2.193   2.349   5.073   1.00 0.00 ? 94  CYS A CA   5  
ATOM 8624  C C    . CYS A 1 94  ? 2.827   3.346   6.038   1.00 0.00 ? 94  CYS A C    5  
ATOM 8625  O O    . CYS A 1 94  ? 2.447   4.517   6.077   1.00 0.00 ? 94  CYS A O    5  
ATOM 8626  C CB   . CYS A 1 94  ? 2.230   2.905   3.649   1.00 0.00 ? 94  CYS A CB   5  
ATOM 8627  S SG   . CYS A 1 94  ? 3.896   3.088   2.971   1.00 0.00 ? 94  CYS A SG   5  
ATOM 8628  H H    . CYS A 1 94  ? 0.125   2.726   5.325   1.00 0.00 ? 94  CYS A H    5  
ATOM 8629  H HA   . CYS A 1 94  ? 2.755   1.428   5.106   1.00 0.00 ? 94  CYS A HA   5  
ATOM 8630  H HB2  . CYS A 1 94  ? 1.682   2.240   2.997   1.00 0.00 ? 94  CYS A HB2  5  
ATOM 8631  H HB3  . CYS A 1 94  ? 1.760   3.877   3.638   1.00 0.00 ? 94  CYS A HB3  5  
ATOM 8632  H HG   . CYS A 1 94  ? 4.745   2.521   3.815   1.00 0.00 ? 94  CYS A HG   5  
ATOM 8633  N N    . THR A 1 95  ? 3.795   2.874   6.818   1.00 0.00 ? 95  THR A N    5  
ATOM 8634  C CA   . THR A 1 95  ? 4.479   3.723   7.785   1.00 0.00 ? 95  THR A CA   5  
ATOM 8635  C C    . THR A 1 95  ? 5.904   4.028   7.337   1.00 0.00 ? 95  THR A C    5  
ATOM 8636  O O    . THR A 1 95  ? 6.640   3.133   6.922   1.00 0.00 ? 95  THR A O    5  
ATOM 8637  C CB   . THR A 1 95  ? 4.521   3.067   9.178   1.00 0.00 ? 95  THR A CB   5  
ATOM 8638  O OG1  . THR A 1 95  ? 3.219   2.589   9.534   1.00 0.00 ? 95  THR A OG1  5  
ATOM 8639  C CG2  . THR A 1 95  ? 5.009   4.054   10.227  1.00 0.00 ? 95  THR A CG2  5  
ATOM 8640  H H    . THR A 1 95  ? 4.053   1.932   6.740   1.00 0.00 ? 95  THR A H    5  
ATOM 8641  H HA   . THR A 1 95  ? 3.930   4.650   7.863   1.00 0.00 ? 95  THR A HA   5  
ATOM 8642  H HB   . THR A 1 95  ? 5.206   2.231   9.145   1.00 0.00 ? 95  THR A HB   5  
ATOM 8643  H HG1  . THR A 1 95  ? 3.279   2.061   10.334  1.00 0.00 ? 95  THR A HG1  5  
ATOM 8644  H HG21 . THR A 1 95  ? 6.009   3.788   10.535  1.00 0.00 ? 95  THR A HG21 5  
ATOM 8645  H HG22 . THR A 1 95  ? 4.349   4.027   11.081  1.00 0.00 ? 95  THR A HG22 5  
ATOM 8646  H HG23 . THR A 1 95  ? 5.014   5.049   9.808   1.00 0.00 ? 95  THR A HG23 5  
ATOM 8647  N N    . ALA A 1 96  ? 6.287   5.298   7.423   1.00 0.00 ? 96  ALA A N    5  
ATOM 8648  C CA   . ALA A 1 96  ? 7.625   5.721   7.029   1.00 0.00 ? 96  ALA A CA   5  
ATOM 8649  C C    . ALA A 1 96  ? 8.384   6.314   8.211   1.00 0.00 ? 96  ALA A C    5  
ATOM 8650  O O    . ALA A 1 96  ? 7.824   6.495   9.292   1.00 0.00 ? 96  ALA A O    5  
ATOM 8651  C CB   . ALA A 1 96  ? 7.546   6.727   5.890   1.00 0.00 ? 96  ALA A CB   5  
ATOM 8652  H H    . ALA A 1 96  ? 5.655   5.966   7.761   1.00 0.00 ? 96  ALA A H    5  
ATOM 8653  H HA   . ALA A 1 96  ? 8.158   4.851   6.671   1.00 0.00 ? 96  ALA A HA   5  
ATOM 8654  H HB1  . ALA A 1 96  ? 8.545   6.986   5.571   1.00 0.00 ? 96  ALA A HB1  5  
ATOM 8655  H HB2  . ALA A 1 96  ? 7.004   6.294   5.063   1.00 0.00 ? 96  ALA A HB2  5  
ATOM 8656  H HB3  . ALA A 1 96  ? 7.035   7.615   6.230   1.00 0.00 ? 96  ALA A HB3  5  
ATOM 8657  N N    . TRP A 1 97  ? 9.660   6.614   7.998   1.00 0.00 ? 97  TRP A N    5  
ATOM 8658  C CA   . TRP A 1 97  ? 10.495  7.187   9.047   1.00 0.00 ? 97  TRP A CA   5  
ATOM 8659  C C    . TRP A 1 97  ? 11.604  8.048   8.451   1.00 0.00 ? 97  TRP A C    5  
ATOM 8660  O O    . TRP A 1 97  ? 12.364  7.593   7.598   1.00 0.00 ? 97  TRP A O    5  
ATOM 8661  C CB   . TRP A 1 97  ? 11.101  6.077   9.908   1.00 0.00 ? 97  TRP A CB   5  
ATOM 8662  C CG   . TRP A 1 97  ? 10.104  5.412   10.808  1.00 0.00 ? 97  TRP A CG   5  
ATOM 8663  C CD1  . TRP A 1 97  ? 9.643   5.878   12.006  1.00 0.00 ? 97  TRP A CD1  5  
ATOM 8664  C CD2  . TRP A 1 97  ? 9.447   4.161   10.582  1.00 0.00 ? 97  TRP A CD2  5  
ATOM 8665  N NE1  . TRP A 1 97  ? 8.739   4.991   12.539  1.00 0.00 ? 97  TRP A NE1  5  
ATOM 8666  C CE2  . TRP A 1 97  ? 8.600   3.930   11.684  1.00 0.00 ? 97  TRP A CE2  5  
ATOM 8667  C CE3  . TRP A 1 97  ? 9.489   3.213   9.555   1.00 0.00 ? 97  TRP A CE3  5  
ATOM 8668  C CZ2  . TRP A 1 97  ? 7.806   2.791   11.786  1.00 0.00 ? 97  TRP A CZ2  5  
ATOM 8669  C CZ3  . TRP A 1 97  ? 8.700   2.084   9.658   1.00 0.00 ? 97  TRP A CZ3  5  
ATOM 8670  C CH2  . TRP A 1 97  ? 7.867   1.880   10.767  1.00 0.00 ? 97  TRP A CH2  5  
ATOM 8671  H H    . TRP A 1 97  ? 10.050  6.447   7.114   1.00 0.00 ? 97  TRP A H    5  
ATOM 8672  H HA   . TRP A 1 97  ? 9.867   7.809   9.668   1.00 0.00 ? 97  TRP A HA   5  
ATOM 8673  H HB2  . TRP A 1 97  ? 11.525  5.321   9.264   1.00 0.00 ? 97  TRP A HB2  5  
ATOM 8674  H HB3  . TRP A 1 97  ? 11.882  6.497   10.526  1.00 0.00 ? 97  TRP A HB3  5  
ATOM 8675  H HD1  . TRP A 1 97  ? 9.955   6.807   12.457  1.00 0.00 ? 97  TRP A HD1  5  
ATOM 8676  H HE1  . TRP A 1 97  ? 8.269   5.102   13.392  1.00 0.00 ? 97  TRP A HE1  5  
ATOM 8677  H HE3  . TRP A 1 97  ? 10.124  3.353   8.693   1.00 0.00 ? 97  TRP A HE3  5  
ATOM 8678  H HZ2  . TRP A 1 97  ? 7.158   2.620   12.634  1.00 0.00 ? 97  TRP A HZ2  5  
ATOM 8679  H HZ3  . TRP A 1 97  ? 8.720   1.340   8.875   1.00 0.00 ? 97  TRP A HZ3  5  
ATOM 8680  H HH2  . TRP A 1 97  ? 7.269   0.983   10.805  1.00 0.00 ? 97  TRP A HH2  5  
ATOM 8681  N N    . ASN A 1 98  ? 11.690  9.293   8.907   1.00 0.00 ? 98  ASN A N    5  
ATOM 8682  C CA   . ASN A 1 98  ? 12.706  10.217  8.417   1.00 0.00 ? 98  ASN A CA   5  
ATOM 8683  C C    . ASN A 1 98  ? 13.333  10.997  9.570   1.00 0.00 ? 98  ASN A C    5  
ATOM 8684  O O    . ASN A 1 98  ? 12.805  11.012  10.682  1.00 0.00 ? 98  ASN A O    5  
ATOM 8685  C CB   . ASN A 1 98  ? 12.098  11.187  7.403   1.00 0.00 ? 98  ASN A CB   5  
ATOM 8686  C CG   . ASN A 1 98  ? 13.107  11.656  6.373   1.00 0.00 ? 98  ASN A CG   5  
ATOM 8687  O OD1  . ASN A 1 98  ? 14.127  11.005  6.146   1.00 0.00 ? 98  ASN A OD1  5  
ATOM 8688  N ND2  . ASN A 1 98  ? 12.827  12.792  5.744   1.00 0.00 ? 98  ASN A ND2  5  
ATOM 8689  H H    . ASN A 1 98  ? 11.055  9.598   9.588   1.00 0.00 ? 98  ASN A H    5  
ATOM 8690  H HA   . ASN A 1 98  ? 13.475  9.637   7.931   1.00 0.00 ? 98  ASN A HA   5  
ATOM 8691  H HB2  . ASN A 1 98  ? 11.287  10.695  6.885   1.00 0.00 ? 98  ASN A HB2  5  
ATOM 8692  H HB3  . ASN A 1 98  ? 11.714  12.052  7.924   1.00 0.00 ? 98  ASN A HB3  5  
ATOM 8693  H HD21 . ASN A 1 98  ? 11.996  13.257  5.976   1.00 0.00 ? 98  ASN A HD21 5  
ATOM 8694  H HD22 . ASN A 1 98  ? 13.463  13.118  5.073   1.00 0.00 ? 98  ASN A HD22 5  
ATOM 8695  N N    . SER A 1 99  ? 14.462  11.643  9.295   1.00 0.00 ? 99  SER A N    5  
ATOM 8696  C CA   . SER A 1 99  ? 15.163  12.422  10.310  1.00 0.00 ? 99  SER A CA   5  
ATOM 8697  C C    . SER A 1 99  ? 14.282  13.553  10.831  1.00 0.00 ? 99  SER A C    5  
ATOM 8698  O O    . SER A 1 99  ? 14.576  14.161  11.860  1.00 0.00 ? 99  SER A O    5  
ATOM 8699  C CB   . SER A 1 99  ? 16.461  12.994  9.737   1.00 0.00 ? 99  SER A CB   5  
ATOM 8700  O OG   . SER A 1 99  ? 17.270  13.547  10.760  1.00 0.00 ? 99  SER A OG   5  
ATOM 8701  H H    . SER A 1 99  ? 14.833  11.592  8.390   1.00 0.00 ? 99  SER A H    5  
ATOM 8702  H HA   . SER A 1 99  ? 15.401  11.760  11.129  1.00 0.00 ? 99  SER A HA   5  
ATOM 8703  H HB2  . SER A 1 99  ? 17.012  12.207  9.245   1.00 0.00 ? 99  SER A HB2  5  
ATOM 8704  H HB3  . SER A 1 99  ? 16.225  13.769  9.022   1.00 0.00 ? 99  SER A HB3  5  
ATOM 8705  H HG   . SER A 1 99  ? 16.848  14.334  11.112  1.00 0.00 ? 99  SER A HG   5  
ATOM 8706  N N    . PHE A 1 100 ? 13.199  13.830  10.112  1.00 0.00 ? 100 PHE A N    5  
ATOM 8707  C CA   . PHE A 1 100 ? 12.274  14.889  10.500  1.00 0.00 ? 100 PHE A CA   5  
ATOM 8708  C C    . PHE A 1 100 ? 11.159  14.340  11.386  1.00 0.00 ? 100 PHE A C    5  
ATOM 8709  O O    . PHE A 1 100 ? 10.810  14.936  12.404  1.00 0.00 ? 100 PHE A O    5  
ATOM 8710  C CB   . PHE A 1 100 ? 11.674  15.552  9.258   1.00 0.00 ? 100 PHE A CB   5  
ATOM 8711  C CG   . PHE A 1 100 ? 12.588  16.555  8.614   1.00 0.00 ? 100 PHE A CG   5  
ATOM 8712  C CD1  . PHE A 1 100 ? 12.772  17.807  9.180   1.00 0.00 ? 100 PHE A CD1  5  
ATOM 8713  C CD2  . PHE A 1 100 ? 13.261  16.248  7.443   1.00 0.00 ? 100 PHE A CD2  5  
ATOM 8714  C CE1  . PHE A 1 100 ? 13.612  18.733  8.590   1.00 0.00 ? 100 PHE A CE1  5  
ATOM 8715  C CE2  . PHE A 1 100 ? 14.102  17.170  6.849   1.00 0.00 ? 100 PHE A CE2  5  
ATOM 8716  C CZ   . PHE A 1 100 ? 14.277  18.414  7.423   1.00 0.00 ? 100 PHE A CZ   5  
ATOM 8717  H H    . PHE A 1 100 ? 13.018  13.311  9.301   1.00 0.00 ? 100 PHE A H    5  
ATOM 8718  H HA   . PHE A 1 100 ? 12.831  15.626  11.058  1.00 0.00 ? 100 PHE A HA   5  
ATOM 8719  H HB2  . PHE A 1 100 ? 11.450  14.791  8.526   1.00 0.00 ? 100 PHE A HB2  5  
ATOM 8720  H HB3  . PHE A 1 100 ? 10.763  16.060  9.535   1.00 0.00 ? 100 PHE A HB3  5  
ATOM 8721  H HD1  . PHE A 1 100 ? 12.252  18.057  10.094  1.00 0.00 ? 100 PHE A HD1  5  
ATOM 8722  H HD2  . PHE A 1 100 ? 13.124  15.276  6.992   1.00 0.00 ? 100 PHE A HD2  5  
ATOM 8723  H HE1  . PHE A 1 100 ? 13.747  19.704  9.042   1.00 0.00 ? 100 PHE A HE1  5  
ATOM 8724  H HE2  . PHE A 1 100 ? 14.621  16.918  5.936   1.00 0.00 ? 100 PHE A HE2  5  
ATOM 8725  H HZ   . PHE A 1 100 ? 14.934  19.135  6.961   1.00 0.00 ? 100 PHE A HZ   5  
ATOM 8726  N N    . GLY A 1 101 ? 10.604  13.199  10.989  1.00 0.00 ? 101 GLY A N    5  
ATOM 8727  C CA   . GLY A 1 101 ? 9.535   12.588  11.756  1.00 0.00 ? 101 GLY A CA   5  
ATOM 8728  C C    . GLY A 1 101 ? 9.072   11.273  11.162  1.00 0.00 ? 101 GLY A C    5  
ATOM 8729  O O    . GLY A 1 101 ? 9.889   10.424  10.805  1.00 0.00 ? 101 GLY A O    5  
ATOM 8730  H H    . GLY A 1 101 ? 10.924  12.768  10.168  1.00 0.00 ? 101 GLY A H    5  
ATOM 8731  H HA2  . GLY A 1 101 ? 9.883   12.413  12.763  1.00 0.00 ? 101 GLY A HA2  5  
ATOM 8732  H HA3  . GLY A 1 101 ? 8.697   13.269  11.790  1.00 0.00 ? 101 GLY A HA3  5  
ATOM 8733  N N    . SER A 1 102 ? 7.758   11.102  11.056  1.00 0.00 ? 102 SER A N    5  
ATOM 8734  C CA   . SER A 1 102 ? 7.188   9.878   10.506  1.00 0.00 ? 102 SER A CA   5  
ATOM 8735  C C    . SER A 1 102 ? 5.694   10.045  10.243  1.00 0.00 ? 102 SER A C    5  
ATOM 8736  O O    . SER A 1 102 ? 5.056   10.952  10.777  1.00 0.00 ? 102 SER A O    5  
ATOM 8737  C CB   . SER A 1 102 ? 7.422   8.707   11.461  1.00 0.00 ? 102 SER A CB   5  
ATOM 8738  O OG   . SER A 1 102 ? 6.830   8.954   12.725  1.00 0.00 ? 102 SER A OG   5  
ATOM 8739  H H    . SER A 1 102 ? 7.158   11.816  11.358  1.00 0.00 ? 102 SER A H    5  
ATOM 8740  H HA   . SER A 1 102 ? 7.685   9.673   9.569   1.00 0.00 ? 102 SER A HA   5  
ATOM 8741  H HB2  . SER A 1 102 ? 6.987   7.812   11.043  1.00 0.00 ? 102 SER A HB2  5  
ATOM 8742  H HB3  . SER A 1 102 ? 8.484   8.562   11.596  1.00 0.00 ? 102 SER A HB3  5  
ATOM 8743  H HG   . SER A 1 102 ? 7.268   8.421   13.393  1.00 0.00 ? 102 SER A HG   5  
ATOM 8744  N N    . ASP A 1 103 ? 5.143   9.163   9.417   1.00 0.00 ? 103 ASP A N    5  
ATOM 8745  C CA   . ASP A 1 103 ? 3.724   9.210   9.083   1.00 0.00 ? 103 ASP A CA   5  
ATOM 8746  C C    . ASP A 1 103 ? 3.190   7.813   8.781   1.00 0.00 ? 103 ASP A C    5  
ATOM 8747  O O    . ASP A 1 103 ? 3.959   6.879   8.551   1.00 0.00 ? 103 ASP A O    5  
ATOM 8748  C CB   . ASP A 1 103 ? 3.491   10.130  7.883   1.00 0.00 ? 103 ASP A CB   5  
ATOM 8749  C CG   . ASP A 1 103 ? 3.516   11.597  8.265   1.00 0.00 ? 103 ASP A CG   5  
ATOM 8750  O OD1  . ASP A 1 103 ? 4.623   12.167  8.356   1.00 0.00 ? 103 ASP A OD1  5  
ATOM 8751  O OD2  . ASP A 1 103 ? 2.429   12.175  8.473   1.00 0.00 ? 103 ASP A OD2  5  
ATOM 8752  H H    . ASP A 1 103 ? 5.704   8.462   9.022   1.00 0.00 ? 103 ASP A H    5  
ATOM 8753  H HA   . ASP A 1 103 ? 3.196   9.607   9.937   1.00 0.00 ? 103 ASP A HA   5  
ATOM 8754  H HB2  . ASP A 1 103 ? 4.264   9.955   7.149   1.00 0.00 ? 103 ASP A HB2  5  
ATOM 8755  H HB3  . ASP A 1 103 ? 2.529   9.905   7.448   1.00 0.00 ? 103 ASP A HB3  5  
ATOM 8756  N N    . THR A 1 104 ? 1.868   7.677   8.783   1.00 0.00 ? 104 THR A N    5  
ATOM 8757  C CA   . THR A 1 104 ? 1.231   6.395   8.512   1.00 0.00 ? 104 THR A CA   5  
ATOM 8758  C C    . THR A 1 104 ? -0.139  6.587   7.870   1.00 0.00 ? 104 THR A C    5  
ATOM 8759  O O    . THR A 1 104 ? -1.058  7.113   8.495   1.00 0.00 ? 104 THR A O    5  
ATOM 8760  C CB   . THR A 1 104 ? 1.070   5.564   9.799   1.00 0.00 ? 104 THR A CB   5  
ATOM 8761  O OG1  . THR A 1 104 ? 2.335   5.431   10.457  1.00 0.00 ? 104 THR A OG1  5  
ATOM 8762  C CG2  . THR A 1 104 ? 0.509   4.185   9.486   1.00 0.00 ? 104 THR A CG2  5  
ATOM 8763  H H    . THR A 1 104 ? 1.309   8.459   8.974   1.00 0.00 ? 104 THR A H    5  
ATOM 8764  H HA   . THR A 1 104 ? 1.864   5.846   7.830   1.00 0.00 ? 104 THR A HA   5  
ATOM 8765  H HB   . THR A 1 104 ? 0.382   6.076   10.456  1.00 0.00 ? 104 THR A HB   5  
ATOM 8766  H HG1  . THR A 1 104 ? 2.687   6.303   10.652  1.00 0.00 ? 104 THR A HG1  5  
ATOM 8767  H HG21 . THR A 1 104 ? -0.560  4.254   9.347   1.00 0.00 ? 104 THR A HG21 5  
ATOM 8768  H HG22 . THR A 1 104 ? 0.724   3.515   10.304  1.00 0.00 ? 104 THR A HG22 5  
ATOM 8769  H HG23 . THR A 1 104 ? 0.964   3.808   8.582   1.00 0.00 ? 104 THR A HG23 5  
ATOM 8770  N N    . GLU A 1 105 ? -0.266  6.155   6.619   1.00 0.00 ? 105 GLU A N    5  
ATOM 8771  C CA   . GLU A 1 105 ? -1.525  6.280   5.893   1.00 0.00 ? 105 GLU A CA   5  
ATOM 8772  C C    . GLU A 1 105 ? -2.271  4.949   5.865   1.00 0.00 ? 105 GLU A C    5  
ATOM 8773  O O    . GLU A 1 105 ? -1.664  3.888   5.714   1.00 0.00 ? 105 GLU A O    5  
ATOM 8774  C CB   . GLU A 1 105 ? -1.270  6.764   4.465   1.00 0.00 ? 105 GLU A CB   5  
ATOM 8775  C CG   . GLU A 1 105 ? -2.464  6.593   3.541   1.00 0.00 ? 105 GLU A CG   5  
ATOM 8776  C CD   . GLU A 1 105 ? -2.127  6.885   2.092   1.00 0.00 ? 105 GLU A CD   5  
ATOM 8777  O OE1  . GLU A 1 105 ? -1.567  7.966   1.818   1.00 0.00 ? 105 GLU A OE1  5  
ATOM 8778  O OE2  . GLU A 1 105 ? -2.425  6.030   1.231   1.00 0.00 ? 105 GLU A OE2  5  
ATOM 8779  H H    . GLU A 1 105 ? 0.504   5.744   6.174   1.00 0.00 ? 105 GLU A H    5  
ATOM 8780  H HA   . GLU A 1 105 ? -2.133  7.009   6.407   1.00 0.00 ? 105 GLU A HA   5  
ATOM 8781  H HB2  . GLU A 1 105 ? -1.010  7.812   4.494   1.00 0.00 ? 105 GLU A HB2  5  
ATOM 8782  H HB3  . GLU A 1 105 ? -0.440  6.209   4.052   1.00 0.00 ? 105 GLU A HB3  5  
ATOM 8783  H HG2  . GLU A 1 105 ? -2.817  5.575   3.615   1.00 0.00 ? 105 GLU A HG2  5  
ATOM 8784  H HG3  . GLU A 1 105 ? -3.247  7.267   3.857   1.00 0.00 ? 105 GLU A HG3  5  
ATOM 8785  N N    . ILE A 1 106 ? -3.590  5.013   6.012   1.00 0.00 ? 106 ILE A N    5  
ATOM 8786  C CA   . ILE A 1 106 ? -4.419  3.814   6.002   1.00 0.00 ? 106 ILE A CA   5  
ATOM 8787  C C    . ILE A 1 106 ? -4.984  3.548   4.612   1.00 0.00 ? 106 ILE A C    5  
ATOM 8788  O O    . ILE A 1 106 ? -5.392  4.473   3.908   1.00 0.00 ? 106 ILE A O    5  
ATOM 8789  C CB   . ILE A 1 106 ? -5.582  3.927   7.005   1.00 0.00 ? 106 ILE A CB   5  
ATOM 8790  C CG1  . ILE A 1 106 ? -5.046  4.155   8.419   1.00 0.00 ? 106 ILE A CG1  5  
ATOM 8791  C CG2  . ILE A 1 106 ? -6.447  2.676   6.956   1.00 0.00 ? 106 ILE A CG2  5  
ATOM 8792  C CD1  . ILE A 1 106 ? -5.989  4.938   9.305   1.00 0.00 ? 106 ILE A CD1  5  
ATOM 8793  H H    . ILE A 1 106 ? -4.016  5.888   6.128   1.00 0.00 ? 106 ILE A H    5  
ATOM 8794  H HA   . ILE A 1 106 ? -3.799  2.979   6.293   1.00 0.00 ? 106 ILE A HA   5  
ATOM 8795  H HB   . ILE A 1 106 ? -6.194  4.769   6.719   1.00 0.00 ? 106 ILE A HB   5  
ATOM 8796  H HG12 . ILE A 1 106 ? -4.868  3.200   8.888   1.00 0.00 ? 106 ILE A HG12 5  
ATOM 8797  H HG13 . ILE A 1 106 ? -4.115  4.701   8.359   1.00 0.00 ? 106 ILE A HG13 5  
ATOM 8798  H HG21 . ILE A 1 106 ? -5.899  1.843   7.372   1.00 0.00 ? 106 ILE A HG21 5  
ATOM 8799  H HG22 . ILE A 1 106 ? -7.346  2.837   7.531   1.00 0.00 ? 106 ILE A HG22 5  
ATOM 8800  H HG23 . ILE A 1 106 ? -6.708  2.458   5.931   1.00 0.00 ? 106 ILE A HG23 5  
ATOM 8801  H HD11 . ILE A 1 106 ? -5.523  5.111   10.264  1.00 0.00 ? 106 ILE A HD11 5  
ATOM 8802  H HD12 . ILE A 1 106 ? -6.218  5.885   8.839   1.00 0.00 ? 106 ILE A HD12 5  
ATOM 8803  H HD13 . ILE A 1 106 ? -6.901  4.376   9.445   1.00 0.00 ? 106 ILE A HD13 5  
ATOM 8804  N N    . ILE A 1 107 ? -5.008  2.278   4.222   1.00 0.00 ? 107 ILE A N    5  
ATOM 8805  C CA   . ILE A 1 107 ? -5.527  1.890   2.916   1.00 0.00 ? 107 ILE A CA   5  
ATOM 8806  C C    . ILE A 1 107 ? -6.315  0.587   3.003   1.00 0.00 ? 107 ILE A C    5  
ATOM 8807  O O    . ILE A 1 107 ? -5.824  -0.413  3.529   1.00 0.00 ? 107 ILE A O    5  
ATOM 8808  C CB   . ILE A 1 107 ? -4.394  1.724   1.887   1.00 0.00 ? 107 ILE A CB   5  
ATOM 8809  C CG1  . ILE A 1 107 ? -3.677  3.057   1.666   1.00 0.00 ? 107 ILE A CG1  5  
ATOM 8810  C CG2  . ILE A 1 107 ? -4.945  1.188   0.574   1.00 0.00 ? 107 ILE A CG2  5  
ATOM 8811  C CD1  . ILE A 1 107 ? -2.505  3.275   2.597   1.00 0.00 ? 107 ILE A CD1  5  
ATOM 8812  H H    . ILE A 1 107 ? -4.670  1.586   4.827   1.00 0.00 ? 107 ILE A H    5  
ATOM 8813  H HA   . ILE A 1 107 ? -6.186  2.674   2.573   1.00 0.00 ? 107 ILE A HA   5  
ATOM 8814  H HB   . ILE A 1 107 ? -3.689  1.004   2.273   1.00 0.00 ? 107 ILE A HB   5  
ATOM 8815  H HG12 . ILE A 1 107 ? -3.307  3.096   0.653   1.00 0.00 ? 107 ILE A HG12 5  
ATOM 8816  H HG13 . ILE A 1 107 ? -4.379  3.864   1.819   1.00 0.00 ? 107 ILE A HG13 5  
ATOM 8817  H HG21 . ILE A 1 107 ? -5.255  0.162   0.705   1.00 0.00 ? 107 ILE A HG21 5  
ATOM 8818  H HG22 . ILE A 1 107 ? -5.794  1.783   0.271   1.00 0.00 ? 107 ILE A HG22 5  
ATOM 8819  H HG23 . ILE A 1 107 ? -4.180  1.239   -0.186  1.00 0.00 ? 107 ILE A HG23 5  
ATOM 8820  H HD11 . ILE A 1 107 ? -1.971  4.166   2.302   1.00 0.00 ? 107 ILE A HD11 5  
ATOM 8821  H HD12 . ILE A 1 107 ? -2.865  3.388   3.609   1.00 0.00 ? 107 ILE A HD12 5  
ATOM 8822  H HD13 . ILE A 1 107 ? -1.841  2.425   2.544   1.00 0.00 ? 107 ILE A HD13 5  
ATOM 8823  N N    . ARG A 1 108 ? -7.537  0.605   2.482   1.00 0.00 ? 108 ARG A N    5  
ATOM 8824  C CA   . ARG A 1 108 ? -8.393  -0.576  2.500   1.00 0.00 ? 108 ARG A CA   5  
ATOM 8825  C C    . ARG A 1 108 ? -8.748  -1.011  1.081   1.00 0.00 ? 108 ARG A C    5  
ATOM 8826  O O    . ARG A 1 108 ? -9.739  -0.553  0.510   1.00 0.00 ? 108 ARG A O    5  
ATOM 8827  C CB   . ARG A 1 108 ? -9.670  -0.294  3.294   1.00 0.00 ? 108 ARG A CB   5  
ATOM 8828  C CG   . ARG A 1 108 ? -9.522  -0.531  4.788   1.00 0.00 ? 108 ARG A CG   5  
ATOM 8829  C CD   . ARG A 1 108 ? -10.814 -1.051  5.399   1.00 0.00 ? 108 ARG A CD   5  
ATOM 8830  N NE   . ARG A 1 108 ? -10.866 -2.510  5.411   1.00 0.00 ? 108 ARG A NE   5  
ATOM 8831  C CZ   . ARG A 1 108 ? -11.948 -3.205  5.743   1.00 0.00 ? 108 ARG A CZ   5  
ATOM 8832  N NH1  . ARG A 1 108 ? -13.063 -2.576  6.089   1.00 0.00 ? 108 ARG A NH1  5  
ATOM 8833  N NH2  . ARG A 1 108 ? -11.917 -4.531  5.730   1.00 0.00 ? 108 ARG A NH2  5  
ATOM 8834  H H    . ARG A 1 108 ? -7.872  1.432   2.076   1.00 0.00 ? 108 ARG A H    5  
ATOM 8835  H HA   . ARG A 1 108 ? -7.848  -1.373  2.983   1.00 0.00 ? 108 ARG A HA   5  
ATOM 8836  H HB2  . ARG A 1 108 ? -9.955  0.737   3.142   1.00 0.00 ? 108 ARG A HB2  5  
ATOM 8837  H HB3  . ARG A 1 108 ? -10.456 -0.935  2.926   1.00 0.00 ? 108 ARG A HB3  5  
ATOM 8838  H HG2  . ARG A 1 108 ? -8.741  -1.258  4.953   1.00 0.00 ? 108 ARG A HG2  5  
ATOM 8839  H HG3  . ARG A 1 108 ? -9.257  0.400   5.266   1.00 0.00 ? 108 ARG A HG3  5  
ATOM 8840  H HD2  . ARG A 1 108 ? -10.887 -0.690  6.414   1.00 0.00 ? 108 ARG A HD2  5  
ATOM 8841  H HD3  . ARG A 1 108 ? -11.646 -0.675  4.823   1.00 0.00 ? 108 ARG A HD3  5  
ATOM 8842  H HE   . ARG A 1 108 ? -10.053 -2.995  5.159   1.00 0.00 ? 108 ARG A HE   5  
ATOM 8843  H HH11 . ARG A 1 108 ? -13.090 -1.577  6.099   1.00 0.00 ? 108 ARG A HH11 5  
ATOM 8844  H HH12 . ARG A 1 108 ? -13.877 -3.101  6.338   1.00 0.00 ? 108 ARG A HH12 5  
ATOM 8845  H HH21 . ARG A 1 108 ? -11.078 -5.009  5.469   1.00 0.00 ? 108 ARG A HH21 5  
ATOM 8846  H HH22 . ARG A 1 108 ? -12.732 -5.053  5.980   1.00 0.00 ? 108 ARG A HH22 5  
ATOM 8847  N N    . LEU A 1 109 ? -7.934  -1.896  0.518   1.00 0.00 ? 109 LEU A N    5  
ATOM 8848  C CA   . LEU A 1 109 ? -8.162  -2.393  -0.834  1.00 0.00 ? 109 LEU A CA   5  
ATOM 8849  C C    . LEU A 1 109 ? -9.538  -3.040  -0.952  1.00 0.00 ? 109 LEU A C    5  
ATOM 8850  O O    . LEU A 1 109 ? -10.132 -3.449  0.047   1.00 0.00 ? 109 LEU A O    5  
ATOM 8851  C CB   . LEU A 1 109 ? -7.077  -3.402  -1.218  1.00 0.00 ? 109 LEU A CB   5  
ATOM 8852  C CG   . LEU A 1 109 ? -6.905  -3.665  -2.714  1.00 0.00 ? 109 LEU A CG   5  
ATOM 8853  C CD1  . LEU A 1 109 ? -6.337  -2.438  -3.410  1.00 0.00 ? 109 LEU A CD1  5  
ATOM 8854  C CD2  . LEU A 1 109 ? -6.008  -4.873  -2.943  1.00 0.00 ? 109 LEU A CD2  5  
ATOM 8855  H H    . LEU A 1 109 ? -7.161  -2.224  1.023   1.00 0.00 ? 109 LEU A H    5  
ATOM 8856  H HA   . LEU A 1 109 ? -8.115  -1.552  -1.509  1.00 0.00 ? 109 LEU A HA   5  
ATOM 8857  H HB2  . LEU A 1 109 ? -6.137  -3.036  -0.836  1.00 0.00 ? 109 LEU A HB2  5  
ATOM 8858  H HB3  . LEU A 1 109 ? -7.317  -4.341  -0.741  1.00 0.00 ? 109 LEU A HB3  5  
ATOM 8859  H HG   . LEU A 1 109 ? -7.871  -3.877  -3.150  1.00 0.00 ? 109 LEU A HG   5  
ATOM 8860  H HD11 . LEU A 1 109 ? -6.899  -1.565  -3.116  1.00 0.00 ? 109 LEU A HD11 5  
ATOM 8861  H HD12 . LEU A 1 109 ? -6.406  -2.567  -4.480  1.00 0.00 ? 109 LEU A HD12 5  
ATOM 8862  H HD13 . LEU A 1 109 ? -5.301  -2.312  -3.129  1.00 0.00 ? 109 LEU A HD13 5  
ATOM 8863  H HD21 . LEU A 1 109 ? -4.983  -4.547  -3.039  1.00 0.00 ? 109 LEU A HD21 5  
ATOM 8864  H HD22 . LEU A 1 109 ? -6.311  -5.380  -3.848  1.00 0.00 ? 109 LEU A HD22 5  
ATOM 8865  H HD23 . LEU A 1 109 ? -6.094  -5.549  -2.105  1.00 0.00 ? 109 LEU A HD23 5  
ATOM 8866  N N    . LYS A 1 110 ? -10.040 -3.132  -2.179  1.00 0.00 ? 110 LYS A N    5  
ATOM 8867  C CA   . LYS A 1 110 ? -11.345 -3.733  -2.429  1.00 0.00 ? 110 LYS A CA   5  
ATOM 8868  C C    . LYS A 1 110 ? -11.379 -4.411  -3.795  1.00 0.00 ? 110 LYS A C    5  
ATOM 8869  O O    . LYS A 1 110 ? -10.544 -4.134  -4.655  1.00 0.00 ? 110 LYS A O    5  
ATOM 8870  C CB   . LYS A 1 110 ? -12.443 -2.670  -2.347  1.00 0.00 ? 110 LYS A CB   5  
ATOM 8871  C CG   . LYS A 1 110 ? -12.761 -2.231  -0.929  1.00 0.00 ? 110 LYS A CG   5  
ATOM 8872  C CD   . LYS A 1 110 ? -14.180 -1.700  -0.814  1.00 0.00 ? 110 LYS A CD   5  
ATOM 8873  C CE   . LYS A 1 110 ? -14.529 -1.349  0.624   1.00 0.00 ? 110 LYS A CE   5  
ATOM 8874  N NZ   . LYS A 1 110 ? -15.993 -1.142  0.805   1.00 0.00 ? 110 LYS A NZ   5  
ATOM 8875  H H    . LYS A 1 110 ? -9.519  -2.788  -2.935  1.00 0.00 ? 110 LYS A H    5  
ATOM 8876  H HA   . LYS A 1 110 ? -11.519 -4.477  -1.667  1.00 0.00 ? 110 LYS A HA   5  
ATOM 8877  H HB2  . LYS A 1 110 ? -12.129 -1.802  -2.909  1.00 0.00 ? 110 LYS A HB2  5  
ATOM 8878  H HB3  . LYS A 1 110 ? -13.345 -3.067  -2.790  1.00 0.00 ? 110 LYS A HB3  5  
ATOM 8879  H HG2  . LYS A 1 110 ? -12.650 -3.077  -0.266  1.00 0.00 ? 110 LYS A HG2  5  
ATOM 8880  H HG3  . LYS A 1 110 ? -12.070 -1.453  -0.639  1.00 0.00 ? 110 LYS A HG3  5  
ATOM 8881  H HD2  . LYS A 1 110 ? -14.273 -0.812  -1.422  1.00 0.00 ? 110 LYS A HD2  5  
ATOM 8882  H HD3  . LYS A 1 110 ? -14.867 -2.455  -1.168  1.00 0.00 ? 110 LYS A HD3  5  
ATOM 8883  H HE2  . LYS A 1 110 ? -14.206 -2.153  1.266   1.00 0.00 ? 110 LYS A HE2  5  
ATOM 8884  H HE3  . LYS A 1 110 ? -14.010 -0.441  0.895   1.00 0.00 ? 110 LYS A HE3  5  
ATOM 8885  H HZ1  . LYS A 1 110 ? -16.465 -1.108  -0.121  1.00 0.00 ? 110 LYS A HZ1  5  
ATOM 8886  H HZ2  . LYS A 1 110 ? -16.168 -0.247  1.305   1.00 0.00 ? 110 LYS A HZ2  5  
ATOM 8887  H HZ3  . LYS A 1 110 ? -16.398 -1.922  1.361   1.00 0.00 ? 110 LYS A HZ3  5  
ATOM 8888  N N    . GLU A 1 111 ? -12.350 -5.298  -3.987  1.00 0.00 ? 111 GLU A N    5  
ATOM 8889  C CA   . GLU A 1 111 ? -12.492 -6.014  -5.249  1.00 0.00 ? 111 GLU A CA   5  
ATOM 8890  C C    . GLU A 1 111 ? -12.961 -5.075  -6.357  1.00 0.00 ? 111 GLU A C    5  
ATOM 8891  O O    . GLU A 1 111 ? -13.623 -4.071  -6.095  1.00 0.00 ? 111 GLU A O    5  
ATOM 8892  C CB   . GLU A 1 111 ? -13.480 -7.172  -5.096  1.00 0.00 ? 111 GLU A CB   5  
ATOM 8893  C CG   . GLU A 1 111 ? -13.624 -8.019  -6.349  1.00 0.00 ? 111 GLU A CG   5  
ATOM 8894  C CD   . GLU A 1 111 ? -14.634 -9.138  -6.184  1.00 0.00 ? 111 GLU A CD   5  
ATOM 8895  O OE1  . GLU A 1 111 ? -15.572 -8.978  -5.376  1.00 0.00 ? 111 GLU A OE1  5  
ATOM 8896  O OE2  . GLU A 1 111 ? -14.485 -10.175 -6.864  1.00 0.00 ? 111 GLU A OE2  5  
ATOM 8897  H H    . GLU A 1 111 ? -12.986 -5.476  -3.262  1.00 0.00 ? 111 GLU A H    5  
ATOM 8898  H HA   . GLU A 1 111 ? -11.525 -6.411  -5.516  1.00 0.00 ? 111 GLU A HA   5  
ATOM 8899  H HB2  . GLU A 1 111 ? -13.146 -7.810  -4.291  1.00 0.00 ? 111 GLU A HB2  5  
ATOM 8900  H HB3  . GLU A 1 111 ? -14.451 -6.770  -4.845  1.00 0.00 ? 111 GLU A HB3  5  
ATOM 8901  H HG2  . GLU A 1 111 ? -13.944 -7.384  -7.162  1.00 0.00 ? 111 GLU A HG2  5  
ATOM 8902  H HG3  . GLU A 1 111 ? -12.664 -8.452  -6.588  1.00 0.00 ? 111 GLU A HG3  5  
ATOM 8903  N N    . GLN A 1 112 ? -12.611 -5.409  -7.595  1.00 0.00 ? 112 GLN A N    5  
ATOM 8904  C CA   . GLN A 1 112 ? -12.995 -4.595  -8.743  1.00 0.00 ? 112 GLN A CA   5  
ATOM 8905  C C    . GLN A 1 112 ? -14.446 -4.854  -9.133  1.00 0.00 ? 112 GLN A C    5  
ATOM 8906  O O    . GLN A 1 112 ? -14.996 -5.917  -8.848  1.00 0.00 ? 112 GLN A O    5  
ATOM 8907  C CB   . GLN A 1 112 ? -12.075 -4.885  -9.930  1.00 0.00 ? 112 GLN A CB   5  
ATOM 8908  C CG   . GLN A 1 112 ? -12.363 -4.023  -11.148 1.00 0.00 ? 112 GLN A CG   5  
ATOM 8909  C CD   . GLN A 1 112 ? -11.224 -4.024  -12.147 1.00 0.00 ? 112 GLN A CD   5  
ATOM 8910  O OE1  . GLN A 1 112 ? -10.192 -3.388  -11.930 1.00 0.00 ? 112 GLN A OE1  5  
ATOM 8911  N NE2  . GLN A 1 112 ? -11.404 -4.740  -13.251 1.00 0.00 ? 112 GLN A NE2  5  
ATOM 8912  H H    . GLN A 1 112 ? -12.083 -6.221  -7.740  1.00 0.00 ? 112 GLN A H    5  
ATOM 8913  H HA   . GLN A 1 112 ? -12.890 -3.558  -8.463  1.00 0.00 ? 112 GLN A HA   5  
ATOM 8914  H HB2  . GLN A 1 112 ? -11.052 -4.715  -9.629  1.00 0.00 ? 112 GLN A HB2  5  
ATOM 8915  H HB3  . GLN A 1 112 ? -12.190 -5.921  -10.215 1.00 0.00 ? 112 GLN A HB3  5  
ATOM 8916  H HG2  . GLN A 1 112 ? -13.250 -4.397  -11.637 1.00 0.00 ? 112 GLN A HG2  5  
ATOM 8917  H HG3  . GLN A 1 112 ? -12.535 -3.008  -10.821 1.00 0.00 ? 112 GLN A HG3  5  
ATOM 8918  H HE21 . GLN A 1 112 ? -12.253 -5.220  -13.357 1.00 0.00 ? 112 GLN A HE21 5  
ATOM 8919  H HE22 . GLN A 1 112 ? -10.684 -4.758  -13.914 1.00 0.00 ? 112 GLN A HE22 5  
ATOM 8920  N N    . GLY A 1 113 ? -15.061 -3.874  -9.788  1.00 0.00 ? 113 GLY A N    5  
ATOM 8921  C CA   . GLY A 1 113 ? -16.444 -4.015  -10.206 1.00 0.00 ? 113 GLY A CA   5  
ATOM 8922  C C    . GLY A 1 113 ? -17.381 -3.116  -9.425  1.00 0.00 ? 113 GLY A C    5  
ATOM 8923  O O    . GLY A 1 113 ? -17.047 -2.662  -8.330  1.00 0.00 ? 113 GLY A O    5  
ATOM 8924  H H    . GLY A 1 113 ? -14.573 -3.048  -9.988  1.00 0.00 ? 113 GLY A H    5  
ATOM 8925  H HA2  . GLY A 1 113 ? -16.518 -3.770  -11.255 1.00 0.00 ? 113 GLY A HA2  5  
ATOM 8926  H HA3  . GLY A 1 113 ? -16.748 -5.042  -10.064 1.00 0.00 ? 113 GLY A HA3  5  
ATOM 8927  N N    . SER A 1 114 ? -18.556 -2.856  -9.988  1.00 0.00 ? 114 SER A N    5  
ATOM 8928  C CA   . SER A 1 114 ? -19.543 -2.000  -9.339  1.00 0.00 ? 114 SER A CA   5  
ATOM 8929  C C    . SER A 1 114 ? -20.337 -2.780  -8.297  1.00 0.00 ? 114 SER A C    5  
ATOM 8930  O O    . SER A 1 114 ? -20.641 -3.958  -8.487  1.00 0.00 ? 114 SER A O    5  
ATOM 8931  C CB   . SER A 1 114 ? -20.492 -1.402  -10.379 1.00 0.00 ? 114 SER A CB   5  
ATOM 8932  O OG   . SER A 1 114 ? -19.939 -0.236  -10.965 1.00 0.00 ? 114 SER A OG   5  
ATOM 8933  H H    . SER A 1 114 ? -18.764 -3.248  -10.863 1.00 0.00 ? 114 SER A H    5  
ATOM 8934  H HA   . SER A 1 114 ? -19.013 -1.199  -8.846  1.00 0.00 ? 114 SER A HA   5  
ATOM 8935  H HB2  . SER A 1 114 ? -20.675 -2.128  -11.156 1.00 0.00 ? 114 SER A HB2  5  
ATOM 8936  H HB3  . SER A 1 114 ? -21.427 -1.142  -9.902  1.00 0.00 ? 114 SER A HB3  5  
ATOM 8937  H HG   . SER A 1 114 ? -19.503 -0.467  -11.788 1.00 0.00 ? 114 SER A HG   5  
ATOM 8938  N N    . GLU A 1 115 ? -20.670 -2.115  -7.195  1.00 0.00 ? 115 GLU A N    5  
ATOM 8939  C CA   . GLU A 1 115 ? -21.429 -2.746  -6.122  1.00 0.00 ? 115 GLU A CA   5  
ATOM 8940  C C    . GLU A 1 115 ? -22.647 -1.906  -5.749  1.00 0.00 ? 115 GLU A C    5  
ATOM 8941  O O    . GLU A 1 115 ? -22.624 -0.680  -5.856  1.00 0.00 ? 115 GLU A O    5  
ATOM 8942  C CB   . GLU A 1 115 ? -20.542 -2.951  -4.893  1.00 0.00 ? 115 GLU A CB   5  
ATOM 8943  C CG   . GLU A 1 115 ? -21.098 -3.960  -3.902  1.00 0.00 ? 115 GLU A CG   5  
ATOM 8944  C CD   . GLU A 1 115 ? -20.641 -3.695  -2.480  1.00 0.00 ? 115 GLU A CD   5  
ATOM 8945  O OE1  . GLU A 1 115 ? -20.837 -2.560  -1.997  1.00 0.00 ? 115 GLU A OE1  5  
ATOM 8946  O OE2  . GLU A 1 115 ? -20.088 -4.621  -1.852  1.00 0.00 ? 115 GLU A OE2  5  
ATOM 8947  H H    . GLU A 1 115 ? -20.399 -1.178  -7.102  1.00 0.00 ? 115 GLU A H    5  
ATOM 8948  H HA   . GLU A 1 115 ? -21.766 -3.709  -6.476  1.00 0.00 ? 115 GLU A HA   5  
ATOM 8949  H HB2  . GLU A 1 115 ? -19.570 -3.295  -5.218  1.00 0.00 ? 115 GLU A HB2  5  
ATOM 8950  H HB3  . GLU A 1 115 ? -20.427 -2.005  -4.385  1.00 0.00 ? 115 GLU A HB3  5  
ATOM 8951  H HG2  . GLU A 1 115 ? -22.177 -3.916  -3.931  1.00 0.00 ? 115 GLU A HG2  5  
ATOM 8952  H HG3  . GLU A 1 115 ? -20.771 -4.948  -4.191  1.00 0.00 ? 115 GLU A HG3  5  
ATOM 8953  N N    . MET A 1 116 ? -23.709 -2.575  -5.313  1.00 0.00 ? 116 MET A N    5  
ATOM 8954  C CA   . MET A 1 116 ? -24.936 -1.890  -4.924  1.00 0.00 ? 116 MET A CA   5  
ATOM 8955  C C    . MET A 1 116 ? -24.748 -1.143  -3.607  1.00 0.00 ? 116 MET A C    5  
ATOM 8956  O O    . MET A 1 116 ? -25.114 -1.641  -2.542  1.00 0.00 ? 116 MET A O    5  
ATOM 8957  C CB   . MET A 1 116 ? -26.086 -2.891  -4.796  1.00 0.00 ? 116 MET A CB   5  
ATOM 8958  C CG   . MET A 1 116 ? -27.395 -2.259  -4.351  1.00 0.00 ? 116 MET A CG   5  
ATOM 8959  S SD   . MET A 1 116 ? -28.327 -1.552  -5.723  1.00 0.00 ? 116 MET A SD   5  
ATOM 8960  C CE   . MET A 1 116 ? -30.008 -1.849  -5.179  1.00 0.00 ? 116 MET A CE   5  
ATOM 8961  H H    . MET A 1 116 ? -23.667 -3.552  -5.250  1.00 0.00 ? 116 MET A H    5  
ATOM 8962  H HA   . MET A 1 116 ? -25.177 -1.176  -5.698  1.00 0.00 ? 116 MET A HA   5  
ATOM 8963  H HB2  . MET A 1 116 ? -26.246 -3.361  -5.755  1.00 0.00 ? 116 MET A HB2  5  
ATOM 8964  H HB3  . MET A 1 116 ? -25.812 -3.646  -4.074  1.00 0.00 ? 116 MET A HB3  5  
ATOM 8965  H HG2  . MET A 1 116 ? -28.001 -3.016  -3.875  1.00 0.00 ? 116 MET A HG2  5  
ATOM 8966  H HG3  . MET A 1 116 ? -27.177 -1.476  -3.640  1.00 0.00 ? 116 MET A HG3  5  
ATOM 8967  H HE1  . MET A 1 116 ? -30.614 -2.139  -6.024  1.00 0.00 ? 116 MET A HE1  5  
ATOM 8968  H HE2  . MET A 1 116 ? -30.013 -2.639  -4.443  1.00 0.00 ? 116 MET A HE2  5  
ATOM 8969  H HE3  . MET A 1 116 ? -30.409 -0.945  -4.742  1.00 0.00 ? 116 MET A HE3  5  
ATOM 8970  N N    . SER A 1 117 ? -24.175 0.054   -3.687  1.00 0.00 ? 117 SER A N    5  
ATOM 8971  C CA   . SER A 1 117 ? -23.935 0.867   -2.501  1.00 0.00 ? 117 SER A CA   5  
ATOM 8972  C C    . SER A 1 117 ? -25.112 1.800   -2.234  1.00 0.00 ? 117 SER A C    5  
ATOM 8973  O O    . SER A 1 117 ? -25.540 2.545   -3.114  1.00 0.00 ? 117 SER A O    5  
ATOM 8974  C CB   . SER A 1 117 ? -22.651 1.682   -2.667  1.00 0.00 ? 117 SER A CB   5  
ATOM 8975  O OG   . SER A 1 117 ? -22.776 2.621   -3.721  1.00 0.00 ? 117 SER A OG   5  
ATOM 8976  H H    . SER A 1 117 ? -23.906 0.397   -4.565  1.00 0.00 ? 117 SER A H    5  
ATOM 8977  H HA   . SER A 1 117 ? -23.821 0.200   -1.659  1.00 0.00 ? 117 SER A HA   5  
ATOM 8978  H HB2  . SER A 1 117 ? -22.444 2.213   -1.750  1.00 0.00 ? 117 SER A HB2  5  
ATOM 8979  H HB3  . SER A 1 117 ? -21.831 1.015   -2.890  1.00 0.00 ? 117 SER A HB3  5  
ATOM 8980  H HG   . SER A 1 117 ? -21.903 2.895   -4.011  1.00 0.00 ? 117 SER A HG   5  
ATOM 8981  N N    . GLY A 1 118 ? -25.631 1.752   -1.010  1.00 0.00 ? 118 GLY A N    5  
ATOM 8982  C CA   . GLY A 1 118 ? -26.754 2.597   -0.648  1.00 0.00 ? 118 GLY A CA   5  
ATOM 8983  C C    . GLY A 1 118 ? -27.068 2.540   0.834   1.00 0.00 ? 118 GLY A C    5  
ATOM 8984  O O    . GLY A 1 118 ? -26.422 1.824   1.600   1.00 0.00 ? 118 GLY A O    5  
ATOM 8985  H H    . GLY A 1 118 ? -25.249 1.139   -0.349  1.00 0.00 ? 118 GLY A H    5  
ATOM 8986  H HA2  . GLY A 1 118 ? -26.525 3.617   -0.918  1.00 0.00 ? 118 GLY A HA2  5  
ATOM 8987  H HA3  . GLY A 1 118 ? -27.625 2.276   -1.201  1.00 0.00 ? 118 GLY A HA3  5  
ATOM 8988  N N    . PRO A 1 119 ? -28.081 3.311   1.258   1.00 0.00 ? 119 PRO A N    5  
ATOM 8989  C CA   . PRO A 1 119 ? -28.501 3.363   2.662   1.00 0.00 ? 119 PRO A CA   5  
ATOM 8990  C C    . PRO A 1 119 ? -29.166 2.069   3.117   1.00 0.00 ? 119 PRO A C    5  
ATOM 8991  O O    . PRO A 1 119 ? -30.256 1.726   2.660   1.00 0.00 ? 119 PRO A O    5  
ATOM 8992  C CB   . PRO A 1 119 ? -29.505 4.518   2.688   1.00 0.00 ? 119 PRO A CB   5  
ATOM 8993  C CG   . PRO A 1 119 ? -30.031 4.595   1.297   1.00 0.00 ? 119 PRO A CG   5  
ATOM 8994  C CD   . PRO A 1 119 ? -28.894 4.189   0.401   1.00 0.00 ? 119 PRO A CD   5  
ATOM 8995  H HA   . PRO A 1 119 ? -27.672 3.590   3.316   1.00 0.00 ? 119 PRO A HA   5  
ATOM 8996  H HB2  . PRO A 1 119 ? -30.291 4.299   3.397   1.00 0.00 ? 119 PRO A HB2  5  
ATOM 8997  H HB3  . PRO A 1 119 ? -29.002 5.431   2.970   1.00 0.00 ? 119 PRO A HB3  5  
ATOM 8998  H HG2  . PRO A 1 119 ? -30.861 3.914   1.180   1.00 0.00 ? 119 PRO A HG2  5  
ATOM 8999  H HG3  . PRO A 1 119 ? -30.340 5.606   1.076   1.00 0.00 ? 119 PRO A HG3  5  
ATOM 9000  H HD2  . PRO A 1 119 ? -29.264 3.653   -0.460  1.00 0.00 ? 119 PRO A HD2  5  
ATOM 9001  H HD3  . PRO A 1 119 ? -28.329 5.057   0.093   1.00 0.00 ? 119 PRO A HD3  5  
ATOM 9002  N N    . SER A 1 120 ? -28.502 1.354   4.020   1.00 0.00 ? 120 SER A N    5  
ATOM 9003  C CA   . SER A 1 120 ? -29.028 0.095   4.534   1.00 0.00 ? 120 SER A CA   5  
ATOM 9004  C C    . SER A 1 120 ? -29.561 0.268   5.953   1.00 0.00 ? 120 SER A C    5  
ATOM 9005  O O    . SER A 1 120 ? -29.214 1.224   6.646   1.00 0.00 ? 120 SER A O    5  
ATOM 9006  C CB   . SER A 1 120 ? -27.942 -0.982  4.514   1.00 0.00 ? 120 SER A CB   5  
ATOM 9007  O OG   . SER A 1 120 ? -26.859 -0.631  5.358   1.00 0.00 ? 120 SER A OG   5  
ATOM 9008  H H    . SER A 1 120 ? -27.637 1.680   4.346   1.00 0.00 ? 120 SER A H    5  
ATOM 9009  H HA   . SER A 1 120 ? -29.840 -0.213  3.892   1.00 0.00 ? 120 SER A HA   5  
ATOM 9010  H HB2  . SER A 1 120 ? -28.359 -1.918  4.854   1.00 0.00 ? 120 SER A HB2  5  
ATOM 9011  H HB3  . SER A 1 120 ? -27.573 -1.099  3.505   1.00 0.00 ? 120 SER A HB3  5  
ATOM 9012  H HG   . SER A 1 120 ? -26.837 0.322   5.470   1.00 0.00 ? 120 SER A HG   5  
ATOM 9013  N N    . SER A 1 121 ? -30.408 -0.664  6.378   1.00 0.00 ? 121 SER A N    5  
ATOM 9014  C CA   . SER A 1 121 ? -30.993 -0.614  7.713   1.00 0.00 ? 121 SER A CA   5  
ATOM 9015  C C    . SER A 1 121 ? -30.633 -1.863  8.512   1.00 0.00 ? 121 SER A C    5  
ATOM 9016  O O    . SER A 1 121 ? -30.544 -1.825  9.738   1.00 0.00 ? 121 SER A O    5  
ATOM 9017  C CB   . SER A 1 121 ? -32.514 -0.474  7.621   1.00 0.00 ? 121 SER A CB   5  
ATOM 9018  O OG   . SER A 1 121 ? -33.015 -1.107  6.456   1.00 0.00 ? 121 SER A OG   5  
ATOM 9019  H H    . SER A 1 121 ? -30.647 -1.402  5.779   1.00 0.00 ? 121 SER A H    5  
ATOM 9020  H HA   . SER A 1 121 ? -30.591 0.251   8.219   1.00 0.00 ? 121 SER A HA   5  
ATOM 9021  H HB2  . SER A 1 121 ? -32.968 -0.932  8.487   1.00 0.00 ? 121 SER A HB2  5  
ATOM 9022  H HB3  . SER A 1 121 ? -32.776 0.573   7.588   1.00 0.00 ? 121 SER A HB3  5  
ATOM 9023  H HG   . SER A 1 121 ? -33.637 -1.793  6.706   1.00 0.00 ? 121 SER A HG   5  
ATOM 9024  N N    . GLY A 1 122 ? -30.427 -2.970  7.805   1.00 0.00 ? 122 GLY A N    5  
ATOM 9025  C CA   . GLY A 1 122 ? -30.079 -4.216  8.464   1.00 0.00 ? 122 GLY A CA   5  
ATOM 9026  C C    . GLY A 1 122 ? -28.602 -4.538  8.352   1.00 0.00 ? 122 GLY A C    5  
ATOM 9027  O O    . GLY A 1 122 ? -28.149 -5.053  7.330   1.00 0.00 ? 122 GLY A O    5  
ATOM 9028  H H    . GLY A 1 122 ? -30.512 -2.941  6.829   1.00 0.00 ? 122 GLY A H    5  
ATOM 9029  H HA2  . GLY A 1 122 ? -30.343 -4.144  9.508   1.00 0.00 ? 122 GLY A HA2  5  
ATOM 9030  H HA3  . GLY A 1 122 ? -30.646 -5.018  8.014   1.00 0.00 ? 122 GLY A HA3  5  
ATOM 9031  N N    . GLY A 1 1   ? 10.347  47.893  -11.559 1.00 0.00 ? 1   GLY A N    6  
ATOM 9032  C CA   . GLY A 1 1   ? 11.377  47.003  -12.062 1.00 0.00 ? 1   GLY A CA   6  
ATOM 9033  C C    . GLY A 1 1   ? 11.290  45.616  -11.456 1.00 0.00 ? 1   GLY A C    6  
ATOM 9034  O O    . GLY A 1 1   ? 11.984  45.310  -10.486 1.00 0.00 ? 1   GLY A O    6  
ATOM 9035  H H1   . GLY A 1 1   ? 9.673   48.256  -12.172 1.00 0.00 ? 1   GLY A H1   6  
ATOM 9036  H HA2  . GLY A 1 1   ? 11.276  46.923  -13.134 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 9037  H HA3  . GLY A 1 1   ? 12.344  47.424  -11.831 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 9038  N N    . SER A 1 2   ? 10.434  44.775  -12.028 1.00 0.00 ? 2   SER A N    6  
ATOM 9039  C CA   . SER A 1 2   ? 10.255  43.414  -11.534 1.00 0.00 ? 2   SER A CA   6  
ATOM 9040  C C    . SER A 1 2   ? 11.570  42.641  -11.582 1.00 0.00 ? 2   SER A C    6  
ATOM 9041  O O    . SER A 1 2   ? 12.191  42.516  -12.637 1.00 0.00 ? 2   SER A O    6  
ATOM 9042  C CB   . SER A 1 2   ? 9.193   42.686  -12.359 1.00 0.00 ? 2   SER A CB   6  
ATOM 9043  O OG   . SER A 1 2   ? 9.587   42.576  -13.716 1.00 0.00 ? 2   SER A OG   6  
ATOM 9044  H H    . SER A 1 2   ? 9.910   45.077  -12.798 1.00 0.00 ? 2   SER A H    6  
ATOM 9045  H HA   . SER A 1 2   ? 9.924   43.474  -10.509 1.00 0.00 ? 2   SER A HA   6  
ATOM 9046  H HB2  . SER A 1 2   ? 9.046   41.694  -11.958 1.00 0.00 ? 2   SER A HB2  6  
ATOM 9047  H HB3  . SER A 1 2   ? 8.264   43.235  -12.310 1.00 0.00 ? 2   SER A HB3  6  
ATOM 9048  H HG   . SER A 1 2   ? 9.335   43.373  -14.188 1.00 0.00 ? 2   SER A HG   6  
ATOM 9049  N N    . SER A 1 3   ? 11.988  42.126  -10.430 1.00 0.00 ? 3   SER A N    6  
ATOM 9050  C CA   . SER A 1 3   ? 13.231  41.369  -10.338 1.00 0.00 ? 3   SER A CA   6  
ATOM 9051  C C    . SER A 1 3   ? 13.149  40.088  -11.163 1.00 0.00 ? 3   SER A C    6  
ATOM 9052  O O    . SER A 1 3   ? 13.984  39.842  -12.033 1.00 0.00 ? 3   SER A O    6  
ATOM 9053  C CB   . SER A 1 3   ? 13.539  41.029  -8.878  1.00 0.00 ? 3   SER A CB   6  
ATOM 9054  O OG   . SER A 1 3   ? 12.446  40.366  -8.267  1.00 0.00 ? 3   SER A OG   6  
ATOM 9055  H H    . SER A 1 3   ? 11.449  42.260  -9.623  1.00 0.00 ? 3   SER A H    6  
ATOM 9056  H HA   . SER A 1 3   ? 14.025  41.986  -10.731 1.00 0.00 ? 3   SER A HA   6  
ATOM 9057  H HB2  . SER A 1 3   ? 14.404  40.386  -8.836  1.00 0.00 ? 3   SER A HB2  6  
ATOM 9058  H HB3  . SER A 1 3   ? 13.742  41.941  -8.335  1.00 0.00 ? 3   SER A HB3  6  
ATOM 9059  H HG   . SER A 1 3   ? 11.875  41.012  -7.846  1.00 0.00 ? 3   SER A HG   6  
ATOM 9060  N N    . GLY A 1 4   ? 12.136  39.274  -10.883 1.00 0.00 ? 4   GLY A N    6  
ATOM 9061  C CA   . GLY A 1 4   ? 11.962  38.029  -11.607 1.00 0.00 ? 4   GLY A CA   6  
ATOM 9062  C C    . GLY A 1 4   ? 12.278  36.815  -10.756 1.00 0.00 ? 4   GLY A C    6  
ATOM 9063  O O    . GLY A 1 4   ? 12.600  36.943  -9.575  1.00 0.00 ? 4   GLY A O    6  
ATOM 9064  H H    . GLY A 1 4   ? 11.500  39.522  -10.179 1.00 0.00 ? 4   GLY A H    6  
ATOM 9065  H HA2  . GLY A 1 4   ? 10.940  37.962  -11.947 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 9066  H HA3  . GLY A 1 4   ? 12.617  38.031  -12.466 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 9067  N N    . SER A 1 5   ? 12.183  35.632  -11.356 1.00 0.00 ? 5   SER A N    6  
ATOM 9068  C CA   . SER A 1 5   ? 12.456  34.390  -10.644 1.00 0.00 ? 5   SER A CA   6  
ATOM 9069  C C    . SER A 1 5   ? 13.720  33.724  -11.177 1.00 0.00 ? 5   SER A C    6  
ATOM 9070  O O    . SER A 1 5   ? 14.182  34.032  -12.276 1.00 0.00 ? 5   SER A O    6  
ATOM 9071  C CB   . SER A 1 5   ? 11.269  33.433  -10.772 1.00 0.00 ? 5   SER A CB   6  
ATOM 9072  O OG   . SER A 1 5   ? 10.222  33.798  -9.890  1.00 0.00 ? 5   SER A OG   6  
ATOM 9073  H H    . SER A 1 5   ? 11.921  35.595  -12.300 1.00 0.00 ? 5   SER A H    6  
ATOM 9074  H HA   . SER A 1 5   ? 12.602  34.630  -9.601  1.00 0.00 ? 5   SER A HA   6  
ATOM 9075  H HB2  . SER A 1 5   ? 10.896  33.460  -11.785 1.00 0.00 ? 5   SER A HB2  6  
ATOM 9076  H HB3  . SER A 1 5   ? 11.592  32.429  -10.534 1.00 0.00 ? 5   SER A HB3  6  
ATOM 9077  H HG   . SER A 1 5   ? 9.865   34.650  -10.151 1.00 0.00 ? 5   SER A HG   6  
ATOM 9078  N N    . SER A 1 6   ? 14.277  32.808  -10.390 1.00 0.00 ? 6   SER A N    6  
ATOM 9079  C CA   . SER A 1 6   ? 15.490  32.100  -10.780 1.00 0.00 ? 6   SER A CA   6  
ATOM 9080  C C    . SER A 1 6   ? 15.275  30.591  -10.740 1.00 0.00 ? 6   SER A C    6  
ATOM 9081  O O    . SER A 1 6   ? 15.510  29.893  -11.725 1.00 0.00 ? 6   SER A O    6  
ATOM 9082  C CB   . SER A 1 6   ? 16.649  32.487  -9.859  1.00 0.00 ? 6   SER A CB   6  
ATOM 9083  O OG   . SER A 1 6   ? 16.879  33.885  -9.887  1.00 0.00 ? 6   SER A OG   6  
ATOM 9084  H H    . SER A 1 6   ? 13.862  32.606  -9.525  1.00 0.00 ? 6   SER A H    6  
ATOM 9085  H HA   . SER A 1 6   ? 15.733  32.391  -11.791 1.00 0.00 ? 6   SER A HA   6  
ATOM 9086  H HB2  . SER A 1 6   ? 16.415  32.193  -8.847  1.00 0.00 ? 6   SER A HB2  6  
ATOM 9087  H HB3  . SER A 1 6   ? 17.547  31.980  -10.183 1.00 0.00 ? 6   SER A HB3  6  
ATOM 9088  H HG   . SER A 1 6   ? 16.460  34.263  -10.663 1.00 0.00 ? 6   SER A HG   6  
ATOM 9089  N N    . GLY A 1 7   ? 14.827  30.093  -9.591  1.00 0.00 ? 7   GLY A N    6  
ATOM 9090  C CA   . GLY A 1 7   ? 14.587  28.670  -9.443  1.00 0.00 ? 7   GLY A CA   6  
ATOM 9091  C C    . GLY A 1 7   ? 13.367  28.372  -8.595  1.00 0.00 ? 7   GLY A C    6  
ATOM 9092  O O    . GLY A 1 7   ? 12.808  29.268  -7.961  1.00 0.00 ? 7   GLY A O    6  
ATOM 9093  H H    . GLY A 1 7   ? 14.657  30.698  -8.839  1.00 0.00 ? 7   GLY A H    6  
ATOM 9094  H HA2  . GLY A 1 7   ? 14.447  28.235  -10.421 1.00 0.00 ? 7   GLY A HA2  6  
ATOM 9095  H HA3  . GLY A 1 7   ? 15.452  28.217  -8.980  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 9096  N N    . THR A 1 8   ? 12.949  27.110  -8.582  1.00 0.00 ? 8   THR A N    6  
ATOM 9097  C CA   . THR A 1 8   ? 11.786  26.697  -7.808  1.00 0.00 ? 8   THR A CA   6  
ATOM 9098  C C    . THR A 1 8   ? 12.053  26.809  -6.311  1.00 0.00 ? 8   THR A C    6  
ATOM 9099  O O    . THR A 1 8   ? 13.202  26.922  -5.882  1.00 0.00 ? 8   THR A O    6  
ATOM 9100  C CB   . THR A 1 8   ? 11.376  25.249  -8.138  1.00 0.00 ? 8   THR A CB   6  
ATOM 9101  O OG1  . THR A 1 8   ? 12.472  24.361  -7.887  1.00 0.00 ? 8   THR A OG1  6  
ATOM 9102  C CG2  . THR A 1 8   ? 10.940  25.128  -9.590  1.00 0.00 ? 8   THR A CG2  6  
ATOM 9103  H H    . THR A 1 8   ? 13.437  26.441  -9.107  1.00 0.00 ? 8   THR A H    6  
ATOM 9104  H HA   . THR A 1 8   ? 10.964  27.349  -8.067  1.00 0.00 ? 8   THR A HA   6  
ATOM 9105  H HB   . THR A 1 8   ? 10.546  24.973  -7.503  1.00 0.00 ? 8   THR A HB   6  
ATOM 9106  H HG1  . THR A 1 8   ? 13.296  24.853  -7.920  1.00 0.00 ? 8   THR A HG1  6  
ATOM 9107  H HG21 . THR A 1 8   ? 10.914  26.108  -10.041 1.00 0.00 ? 8   THR A HG21 6  
ATOM 9108  H HG22 . THR A 1 8   ? 9.957   24.684  -9.634  1.00 0.00 ? 8   THR A HG22 6  
ATOM 9109  H HG23 . THR A 1 8   ? 11.641  24.505  -10.125 1.00 0.00 ? 8   THR A HG23 6  
ATOM 9110  N N    . LEU A 1 9   ? 10.986  26.778  -5.521  1.00 0.00 ? 9   LEU A N    6  
ATOM 9111  C CA   . LEU A 1 9   ? 11.106  26.875  -4.070  1.00 0.00 ? 9   LEU A CA   6  
ATOM 9112  C C    . LEU A 1 9   ? 11.261  25.494  -3.442  1.00 0.00 ? 9   LEU A C    6  
ATOM 9113  O O    . LEU A 1 9   ? 10.467  24.589  -3.701  1.00 0.00 ? 9   LEU A O    6  
ATOM 9114  C CB   . LEU A 1 9   ? 9.881   27.580  -3.484  1.00 0.00 ? 9   LEU A CB   6  
ATOM 9115  C CG   . LEU A 1 9   ? 9.503   28.915  -4.126  1.00 0.00 ? 9   LEU A CG   6  
ATOM 9116  C CD1  . LEU A 1 9   ? 8.192   29.430  -3.554  1.00 0.00 ? 9   LEU A CD1  6  
ATOM 9117  C CD2  . LEU A 1 9   ? 10.613  29.936  -3.925  1.00 0.00 ? 9   LEU A CD2  6  
ATOM 9118  H H    . LEU A 1 9   ? 10.097  26.687  -5.920  1.00 0.00 ? 9   LEU A H    6  
ATOM 9119  H HA   . LEU A 1 9   ? 11.987  27.459  -3.849  1.00 0.00 ? 9   LEU A HA   6  
ATOM 9120  H HB2  . LEU A 1 9   ? 9.037   26.914  -3.584  1.00 0.00 ? 9   LEU A HB2  6  
ATOM 9121  H HB3  . LEU A 1 9   ? 10.074  27.758  -2.435  1.00 0.00 ? 9   LEU A HB3  6  
ATOM 9122  H HG   . LEU A 1 9   ? 9.369   28.770  -5.189  1.00 0.00 ? 9   LEU A HG   6  
ATOM 9123  H HD11 . LEU A 1 9   ? 7.529   28.599  -3.368  1.00 0.00 ? 9   LEU A HD11 6  
ATOM 9124  H HD12 . LEU A 1 9   ? 7.732   30.106  -4.260  1.00 0.00 ? 9   LEU A HD12 6  
ATOM 9125  H HD13 . LEU A 1 9   ? 8.383   29.952  -2.628  1.00 0.00 ? 9   LEU A HD13 6  
ATOM 9126  H HD21 . LEU A 1 9   ? 11.358  29.815  -4.697  1.00 0.00 ? 9   LEU A HD21 6  
ATOM 9127  H HD22 . LEU A 1 9   ? 11.070  29.786  -2.957  1.00 0.00 ? 9   LEU A HD22 6  
ATOM 9128  H HD23 . LEU A 1 9   ? 10.199  30.932  -3.977  1.00 0.00 ? 9   LEU A HD23 6  
ATOM 9129  N N    . THR A 1 10  ? 12.289  25.338  -2.613  1.00 0.00 ? 10  THR A N    6  
ATOM 9130  C CA   . THR A 1 10  ? 12.548  24.067  -1.948  1.00 0.00 ? 10  THR A CA   6  
ATOM 9131  C C    . THR A 1 10  ? 11.789  23.973  -0.629  1.00 0.00 ? 10  THR A C    6  
ATOM 9132  O O    . THR A 1 10  ? 11.443  24.989  -0.026  1.00 0.00 ? 10  THR A O    6  
ATOM 9133  C CB   . THR A 1 10  ? 14.051  23.871  -1.677  1.00 0.00 ? 10  THR A CB   6  
ATOM 9134  O OG1  . THR A 1 10  ? 14.276  22.599  -1.059  1.00 0.00 ? 10  THR A OG1  6  
ATOM 9135  C CG2  . THR A 1 10  ? 14.589  24.977  -0.783  1.00 0.00 ? 10  THR A CG2  6  
ATOM 9136  H H    . THR A 1 10  ? 12.886  26.096  -2.447  1.00 0.00 ? 10  THR A H    6  
ATOM 9137  H HA   . THR A 1 10  ? 12.214  23.274  -2.601  1.00 0.00 ? 10  THR A HA   6  
ATOM 9138  H HB   . THR A 1 10  ? 14.578  23.903  -2.620  1.00 0.00 ? 10  THR A HB   6  
ATOM 9139  H HG1  . THR A 1 10  ? 13.713  21.939  -1.471  1.00 0.00 ? 10  THR A HG1  6  
ATOM 9140  H HG21 . THR A 1 10  ? 14.676  24.611  0.230   1.00 0.00 ? 10  THR A HG21 6  
ATOM 9141  H HG22 . THR A 1 10  ? 13.913  25.819  -0.805  1.00 0.00 ? 10  THR A HG22 6  
ATOM 9142  H HG23 . THR A 1 10  ? 15.561  25.286  -1.137  1.00 0.00 ? 10  THR A HG23 6  
ATOM 9143  N N    . VAL A 1 11  ? 11.535  22.747  -0.184  1.00 0.00 ? 11  VAL A N    6  
ATOM 9144  C CA   . VAL A 1 11  ? 10.818  22.520  1.066   1.00 0.00 ? 11  VAL A CA   6  
ATOM 9145  C C    . VAL A 1 11  ? 11.465  21.400  1.874   1.00 0.00 ? 11  VAL A C    6  
ATOM 9146  O O    . VAL A 1 11  ? 12.160  20.547  1.325   1.00 0.00 ? 11  VAL A O    6  
ATOM 9147  C CB   . VAL A 1 11  ? 9.341   22.167  0.810   1.00 0.00 ? 11  VAL A CB   6  
ATOM 9148  C CG1  . VAL A 1 11  ? 8.641   23.300  0.075   1.00 0.00 ? 11  VAL A CG1  6  
ATOM 9149  C CG2  . VAL A 1 11  ? 9.232   20.866  0.029   1.00 0.00 ? 11  VAL A CG2  6  
ATOM 9150  H H    . VAL A 1 11  ? 11.836  21.976  -0.708  1.00 0.00 ? 11  VAL A H    6  
ATOM 9151  H HA   . VAL A 1 11  ? 10.854  23.433  1.642   1.00 0.00 ? 11  VAL A HA   6  
ATOM 9152  H HB   . VAL A 1 11  ? 8.854   22.031  1.764   1.00 0.00 ? 11  VAL A HB   6  
ATOM 9153  H HG11 . VAL A 1 11  ? 9.098   23.437  -0.894  1.00 0.00 ? 11  VAL A HG11 6  
ATOM 9154  H HG12 . VAL A 1 11  ? 7.596   23.057  -0.050  1.00 0.00 ? 11  VAL A HG12 6  
ATOM 9155  H HG13 . VAL A 1 11  ? 8.733   24.211  0.648   1.00 0.00 ? 11  VAL A HG13 6  
ATOM 9156  H HG21 . VAL A 1 11  ? 10.136  20.713  -0.541  1.00 0.00 ? 11  VAL A HG21 6  
ATOM 9157  H HG22 . VAL A 1 11  ? 9.097   20.043  0.716   1.00 0.00 ? 11  VAL A HG22 6  
ATOM 9158  H HG23 . VAL A 1 11  ? 8.387   20.917  -0.641  1.00 0.00 ? 11  VAL A HG23 6  
ATOM 9159  N N    . ASN A 1 12  ? 11.229  21.410  3.182   1.00 0.00 ? 12  ASN A N    6  
ATOM 9160  C CA   . ASN A 1 12  ? 11.788  20.395  4.067   1.00 0.00 ? 12  ASN A CA   6  
ATOM 9161  C C    . ASN A 1 12  ? 10.783  19.998  5.144   1.00 0.00 ? 12  ASN A C    6  
ATOM 9162  O O    . ASN A 1 12  ? 9.949   20.803  5.557   1.00 0.00 ? 12  ASN A O    6  
ATOM 9163  C CB   . ASN A 1 12  ? 13.074  20.909  4.719   1.00 0.00 ? 12  ASN A CB   6  
ATOM 9164  C CG   . ASN A 1 12  ? 12.987  22.376  5.092   1.00 0.00 ? 12  ASN A CG   6  
ATOM 9165  O OD1  . ASN A 1 12  ? 11.896  22.922  5.258   1.00 0.00 ? 12  ASN A OD1  6  
ATOM 9166  N ND2  . ASN A 1 12  ? 14.139  23.022  5.225   1.00 0.00 ? 12  ASN A ND2  6  
ATOM 9167  H H    . ASN A 1 12  ? 10.666  22.117  3.561   1.00 0.00 ? 12  ASN A H    6  
ATOM 9168  H HA   . ASN A 1 12  ? 12.020  19.526  3.470   1.00 0.00 ? 12  ASN A HA   6  
ATOM 9169  H HB2  . ASN A 1 12  ? 13.267  20.340  5.617   1.00 0.00 ? 12  ASN A HB2  6  
ATOM 9170  H HB3  . ASN A 1 12  ? 13.896  20.779  4.031   1.00 0.00 ? 12  ASN A HB3  6  
ATOM 9171  H HD21 . ASN A 1 12  ? 14.970  22.523  5.078   1.00 0.00 ? 12  ASN A HD21 6  
ATOM 9172  H HD22 . ASN A 1 12  ? 14.112  23.971  5.467   1.00 0.00 ? 12  ASN A HD22 6  
ATOM 9173  N N    . GLY A 1 13  ? 10.868  18.750  5.595   1.00 0.00 ? 13  GLY A N    6  
ATOM 9174  C CA   . GLY A 1 13  ? 9.961   18.268  6.620   1.00 0.00 ? 13  GLY A CA   6  
ATOM 9175  C C    . GLY A 1 13  ? 9.789   16.763  6.580   1.00 0.00 ? 13  GLY A C    6  
ATOM 9176  O O    . GLY A 1 13  ? 10.448  16.061  5.813   1.00 0.00 ? 13  GLY A O    6  
ATOM 9177  H H    . GLY A 1 13  ? 11.553  18.152  5.229   1.00 0.00 ? 13  GLY A H    6  
ATOM 9178  H HA2  . GLY A 1 13  ? 10.346  18.551  7.588   1.00 0.00 ? 13  GLY A HA2  6  
ATOM 9179  H HA3  . GLY A 1 13  ? 8.996   18.733  6.478   1.00 0.00 ? 13  GLY A HA3  6  
ATOM 9180  N N    . PRO A 1 14  ? 8.884   16.244  7.424   1.00 0.00 ? 14  PRO A N    6  
ATOM 9181  C CA   . PRO A 1 14  ? 8.607   14.807  7.502   1.00 0.00 ? 14  PRO A CA   6  
ATOM 9182  C C    . PRO A 1 14  ? 7.892   14.286  6.260   1.00 0.00 ? 14  PRO A C    6  
ATOM 9183  O O    . PRO A 1 14  ? 7.385   15.051  5.440   1.00 0.00 ? 14  PRO A O    6  
ATOM 9184  C CB   . PRO A 1 14  ? 7.702   14.687  8.730   1.00 0.00 ? 14  PRO A CB   6  
ATOM 9185  C CG   . PRO A 1 14  ? 7.050   16.021  8.853   1.00 0.00 ? 14  PRO A CG   6  
ATOM 9186  C CD   . PRO A 1 14  ? 8.061   17.022  8.366   1.00 0.00 ? 14  PRO A CD   6  
ATOM 9187  H HA   . PRO A 1 14  ? 9.510   14.237  7.662   1.00 0.00 ? 14  PRO A HA   6  
ATOM 9188  H HB2  . PRO A 1 14  ? 6.973   13.904  8.569   1.00 0.00 ? 14  PRO A HB2  6  
ATOM 9189  H HB3  . PRO A 1 14  ? 8.298   14.457  9.601   1.00 0.00 ? 14  PRO A HB3  6  
ATOM 9190  H HG2  . PRO A 1 14  ? 6.163   16.055  8.239   1.00 0.00 ? 14  PRO A HG2  6  
ATOM 9191  H HG3  . PRO A 1 14  ? 6.801   16.213  9.886   1.00 0.00 ? 14  PRO A HG3  6  
ATOM 9192  H HD2  . PRO A 1 14  ? 7.569   17.841  7.864   1.00 0.00 ? 14  PRO A HD2  6  
ATOM 9193  H HD3  . PRO A 1 14  ? 8.659   17.385  9.189   1.00 0.00 ? 14  PRO A HD3  6  
ATOM 9194  N N    . PRO A 1 15  ? 7.849   12.953  6.117   1.00 0.00 ? 15  PRO A N    6  
ATOM 9195  C CA   . PRO A 1 15  ? 7.197   12.301  4.977   1.00 0.00 ? 15  PRO A CA   6  
ATOM 9196  C C    . PRO A 1 15  ? 5.679   12.444  5.018   1.00 0.00 ? 15  PRO A C    6  
ATOM 9197  O O    . PRO A 1 15  ? 5.077   12.469  6.092   1.00 0.00 ? 15  PRO A O    6  
ATOM 9198  C CB   . PRO A 1 15  ? 7.600   10.832  5.132   1.00 0.00 ? 15  PRO A CB   6  
ATOM 9199  C CG   . PRO A 1 15  ? 7.874   10.665  6.586   1.00 0.00 ? 15  PRO A CG   6  
ATOM 9200  C CD   . PRO A 1 15  ? 8.432   11.981  7.056   1.00 0.00 ? 15  PRO A CD   6  
ATOM 9201  H HA   . PRO A 1 15  ? 7.568   12.680  4.037   1.00 0.00 ? 15  PRO A HA   6  
ATOM 9202  H HB2  . PRO A 1 15  ? 6.787   10.197  4.807   1.00 0.00 ? 15  PRO A HB2  6  
ATOM 9203  H HB3  . PRO A 1 15  ? 8.479   10.632  4.539   1.00 0.00 ? 15  PRO A HB3  6  
ATOM 9204  H HG2  . PRO A 1 15  ? 6.958   10.439  7.110   1.00 0.00 ? 15  PRO A HG2  6  
ATOM 9205  H HG3  . PRO A 1 15  ? 8.598   9.878   6.735   1.00 0.00 ? 15  PRO A HG3  6  
ATOM 9206  H HD2  . PRO A 1 15  ? 8.116   12.185  8.068   1.00 0.00 ? 15  PRO A HD2  6  
ATOM 9207  H HD3  . PRO A 1 15  ? 9.510   11.979  6.988   1.00 0.00 ? 15  PRO A HD3  6  
ATOM 9208  N N    . ILE A 1 16  ? 5.067   12.536  3.842   1.00 0.00 ? 16  ILE A N    6  
ATOM 9209  C CA   . ILE A 1 16  ? 3.619   12.675  3.744   1.00 0.00 ? 16  ILE A CA   6  
ATOM 9210  C C    . ILE A 1 16  ? 3.049   11.747  2.677   1.00 0.00 ? 16  ILE A C    6  
ATOM 9211  O O    . ILE A 1 16  ? 3.328   11.906  1.488   1.00 0.00 ? 16  ILE A O    6  
ATOM 9212  C CB   . ILE A 1 16  ? 3.213   14.124  3.418   1.00 0.00 ? 16  ILE A CB   6  
ATOM 9213  C CG1  . ILE A 1 16  ? 3.800   15.086  4.454   1.00 0.00 ? 16  ILE A CG1  6  
ATOM 9214  C CG2  . ILE A 1 16  ? 1.698   14.251  3.368   1.00 0.00 ? 16  ILE A CG2  6  
ATOM 9215  C CD1  . ILE A 1 16  ? 4.091   16.464  3.902   1.00 0.00 ? 16  ILE A CD1  6  
ATOM 9216  H H    . ILE A 1 16  ? 5.601   12.509  3.021   1.00 0.00 ? 16  ILE A H    6  
ATOM 9217  H HA   . ILE A 1 16  ? 3.194   12.409  4.701   1.00 0.00 ? 16  ILE A HA   6  
ATOM 9218  H HB   . ILE A 1 16  ? 3.604   14.373  2.444   1.00 0.00 ? 16  ILE A HB   6  
ATOM 9219  H HG12 . ILE A 1 16  ? 3.102   15.196  5.269   1.00 0.00 ? 16  ILE A HG12 6  
ATOM 9220  H HG13 . ILE A 1 16  ? 4.726   14.676  4.831   1.00 0.00 ? 16  ILE A HG13 6  
ATOM 9221  H HG21 . ILE A 1 16  ? 1.431   15.209  2.945   1.00 0.00 ? 16  ILE A HG21 6  
ATOM 9222  H HG22 . ILE A 1 16  ? 1.291   13.462  2.753   1.00 0.00 ? 16  ILE A HG22 6  
ATOM 9223  H HG23 . ILE A 1 16  ? 1.296   14.174  4.367   1.00 0.00 ? 16  ILE A HG23 6  
ATOM 9224  H HD11 . ILE A 1 16  ? 5.160   16.611  3.845   1.00 0.00 ? 16  ILE A HD11 6  
ATOM 9225  H HD12 . ILE A 1 16  ? 3.661   16.555  2.916   1.00 0.00 ? 16  ILE A HD12 6  
ATOM 9226  H HD13 . ILE A 1 16  ? 3.660   17.211  4.553   1.00 0.00 ? 16  ILE A HD13 6  
ATOM 9227  N N    . ILE A 1 17  ? 2.248   10.779  3.109   1.00 0.00 ? 17  ILE A N    6  
ATOM 9228  C CA   . ILE A 1 17  ? 1.635   9.827   2.190   1.00 0.00 ? 17  ILE A CA   6  
ATOM 9229  C C    . ILE A 1 17  ? 0.360   10.397  1.578   1.00 0.00 ? 17  ILE A C    6  
ATOM 9230  O O    . ILE A 1 17  ? -0.735  10.203  2.107   1.00 0.00 ? 17  ILE A O    6  
ATOM 9231  C CB   . ILE A 1 17  ? 1.305   8.498   2.893   1.00 0.00 ? 17  ILE A CB   6  
ATOM 9232  C CG1  . ILE A 1 17  ? 2.592   7.787   3.319   1.00 0.00 ? 17  ILE A CG1  6  
ATOM 9233  C CG2  . ILE A 1 17  ? 0.478   7.606   1.979   1.00 0.00 ? 17  ILE A CG2  6  
ATOM 9234  C CD1  . ILE A 1 17  ? 2.430   6.936   4.559   1.00 0.00 ? 17  ILE A CD1  6  
ATOM 9235  H H    . ILE A 1 17  ? 2.063   10.703  4.068   1.00 0.00 ? 17  ILE A H    6  
ATOM 9236  H HA   . ILE A 1 17  ? 2.343   9.627   1.398   1.00 0.00 ? 17  ILE A HA   6  
ATOM 9237  H HB   . ILE A 1 17  ? 0.716   8.717   3.771   1.00 0.00 ? 17  ILE A HB   6  
ATOM 9238  H HG12 . ILE A 1 17  ? 2.923   7.146   2.518   1.00 0.00 ? 17  ILE A HG12 6  
ATOM 9239  H HG13 . ILE A 1 17  ? 3.353   8.527   3.520   1.00 0.00 ? 17  ILE A HG13 6  
ATOM 9240  H HG21 . ILE A 1 17  ? 0.776   6.577   2.115   1.00 0.00 ? 17  ILE A HG21 6  
ATOM 9241  H HG22 . ILE A 1 17  ? -0.568  7.713   2.224   1.00 0.00 ? 17  ILE A HG22 6  
ATOM 9242  H HG23 . ILE A 1 17  ? 0.640   7.895   0.952   1.00 0.00 ? 17  ILE A HG23 6  
ATOM 9243  H HD11 . ILE A 1 17  ? 3.384   6.508   4.829   1.00 0.00 ? 17  ILE A HD11 6  
ATOM 9244  H HD12 . ILE A 1 17  ? 2.066   7.547   5.371   1.00 0.00 ? 17  ILE A HD12 6  
ATOM 9245  H HD13 . ILE A 1 17  ? 1.724   6.142   4.361   1.00 0.00 ? 17  ILE A HD13 6  
ATOM 9246  N N    . SER A 1 18  ? 0.509   11.099  0.460   1.00 0.00 ? 18  SER A N    6  
ATOM 9247  C CA   . SER A 1 18  ? -0.631  11.699  -0.224  1.00 0.00 ? 18  SER A CA   6  
ATOM 9248  C C    . SER A 1 18  ? -1.786  10.707  -0.326  1.00 0.00 ? 18  SER A C    6  
ATOM 9249  O O    . SER A 1 18  ? -2.823  10.877  0.315   1.00 0.00 ? 18  SER A O    6  
ATOM 9250  C CB   . SER A 1 18  ? -0.225  12.171  -1.621  1.00 0.00 ? 18  SER A CB   6  
ATOM 9251  O OG   . SER A 1 18  ? -1.299  12.827  -2.271  1.00 0.00 ? 18  SER A OG   6  
ATOM 9252  H H    . SER A 1 18  ? 1.407   11.219  0.087   1.00 0.00 ? 18  SER A H    6  
ATOM 9253  H HA   . SER A 1 18  ? -0.954  12.551  0.355   1.00 0.00 ? 18  SER A HA   6  
ATOM 9254  H HB2  . SER A 1 18  ? 0.604   12.858  -1.539  1.00 0.00 ? 18  SER A HB2  6  
ATOM 9255  H HB3  . SER A 1 18  ? 0.072   11.318  -2.214  1.00 0.00 ? 18  SER A HB3  6  
ATOM 9256  H HG   . SER A 1 18  ? -2.129  12.552  -1.875  1.00 0.00 ? 18  SER A HG   6  
ATOM 9257  N N    . SER A 1 19  ? -1.599  9.671   -1.137  1.00 0.00 ? 19  SER A N    6  
ATOM 9258  C CA   . SER A 1 19  ? -2.626  8.653   -1.327  1.00 0.00 ? 19  SER A CA   6  
ATOM 9259  C C    . SER A 1 19  ? -2.104  7.510   -2.192  1.00 0.00 ? 19  SER A C    6  
ATOM 9260  O O    . SER A 1 19  ? -1.029  7.604   -2.785  1.00 0.00 ? 19  SER A O    6  
ATOM 9261  C CB   . SER A 1 19  ? -3.870  9.268   -1.971  1.00 0.00 ? 19  SER A CB   6  
ATOM 9262  O OG   . SER A 1 19  ? -3.518  10.289  -2.889  1.00 0.00 ? 19  SER A OG   6  
ATOM 9263  H H    . SER A 1 19  ? -0.750  9.591   -1.621  1.00 0.00 ? 19  SER A H    6  
ATOM 9264  H HA   . SER A 1 19  ? -2.889  8.263   -0.356  1.00 0.00 ? 19  SER A HA   6  
ATOM 9265  H HB2  . SER A 1 19  ? -4.416  8.501   -2.497  1.00 0.00 ? 19  SER A HB2  6  
ATOM 9266  H HB3  . SER A 1 19  ? -4.497  9.694   -1.201  1.00 0.00 ? 19  SER A HB3  6  
ATOM 9267  H HG   . SER A 1 19  ? -4.086  11.051  -2.754  1.00 0.00 ? 19  SER A HG   6  
ATOM 9268  N N    . THR A 1 20  ? -2.873  6.428   -2.259  1.00 0.00 ? 20  THR A N    6  
ATOM 9269  C CA   . THR A 1 20  ? -2.490  5.265   -3.050  1.00 0.00 ? 20  THR A CA   6  
ATOM 9270  C C    . THR A 1 20  ? -3.415  5.086   -4.248  1.00 0.00 ? 20  THR A C    6  
ATOM 9271  O O    . THR A 1 20  ? -4.549  5.564   -4.245  1.00 0.00 ? 20  THR A O    6  
ATOM 9272  C CB   . THR A 1 20  ? -2.510  3.979   -2.203  1.00 0.00 ? 20  THR A CB   6  
ATOM 9273  O OG1  . THR A 1 20  ? -3.859  3.635   -1.866  1.00 0.00 ? 20  THR A OG1  6  
ATOM 9274  C CG2  . THR A 1 20  ? -1.694  4.155   -0.932  1.00 0.00 ? 20  THR A CG2  6  
ATOM 9275  H H    . THR A 1 20  ? -3.719  6.413   -1.764  1.00 0.00 ? 20  THR A H    6  
ATOM 9276  H HA   . THR A 1 20  ? -1.482  5.421   -3.406  1.00 0.00 ? 20  THR A HA   6  
ATOM 9277  H HB   . THR A 1 20  ? -2.077  3.177   -2.783  1.00 0.00 ? 20  THR A HB   6  
ATOM 9278  H HG1  . THR A 1 20  ? -4.362  3.488   -2.670  1.00 0.00 ? 20  THR A HG1  6  
ATOM 9279  H HG21 . THR A 1 20  ? -0.772  4.667   -1.164  1.00 0.00 ? 20  THR A HG21 6  
ATOM 9280  H HG22 . THR A 1 20  ? -1.471  3.186   -0.510  1.00 0.00 ? 20  THR A HG22 6  
ATOM 9281  H HG23 . THR A 1 20  ? -2.258  4.737   -0.219  1.00 0.00 ? 20  THR A HG23 6  
ATOM 9282  N N    . GLN A 1 21  ? -2.924  4.393   -5.271  1.00 0.00 ? 21  GLN A N    6  
ATOM 9283  C CA   . GLN A 1 21  ? -3.708  4.151   -6.476  1.00 0.00 ? 21  GLN A CA   6  
ATOM 9284  C C    . GLN A 1 21  ? -4.038  2.669   -6.622  1.00 0.00 ? 21  GLN A C    6  
ATOM 9285  O O    . GLN A 1 21  ? -3.865  2.086   -7.693  1.00 0.00 ? 21  GLN A O    6  
ATOM 9286  C CB   . GLN A 1 21  ? -2.950  4.642   -7.710  1.00 0.00 ? 21  GLN A CB   6  
ATOM 9287  C CG   . GLN A 1 21  ? -3.809  4.718   -8.962  1.00 0.00 ? 21  GLN A CG   6  
ATOM 9288  C CD   . GLN A 1 21  ? -4.807  5.859   -8.916  1.00 0.00 ? 21  GLN A CD   6  
ATOM 9289  O OE1  . GLN A 1 21  ? -4.493  6.988   -9.293  1.00 0.00 ? 21  GLN A OE1  6  
ATOM 9290  N NE2  . GLN A 1 21  ? -6.017  5.569   -8.453  1.00 0.00 ? 21  GLN A NE2  6  
ATOM 9291  H H    . GLN A 1 21  ? -2.013  4.037   -5.213  1.00 0.00 ? 21  GLN A H    6  
ATOM 9292  H HA   . GLN A 1 21  ? -4.630  4.705   -6.388  1.00 0.00 ? 21  GLN A HA   6  
ATOM 9293  H HB2  . GLN A 1 21  ? -2.556  5.627   -7.509  1.00 0.00 ? 21  GLN A HB2  6  
ATOM 9294  H HB3  . GLN A 1 21  ? -2.128  3.968   -7.905  1.00 0.00 ? 21  GLN A HB3  6  
ATOM 9295  H HG2  . GLN A 1 21  ? -3.165  4.858   -9.817  1.00 0.00 ? 21  GLN A HG2  6  
ATOM 9296  H HG3  . GLN A 1 21  ? -4.350  3.790   -9.068  1.00 0.00 ? 21  GLN A HG3  6  
ATOM 9297  H HE21 . GLN A 1 21  ? -6.195  4.647   -8.169  1.00 0.00 ? 21  GLN A HE21 6  
ATOM 9298  H HE22 . GLN A 1 21  ? -6.681  6.287   -8.411  1.00 0.00 ? 21  GLN A HE22 6  
ATOM 9299  N N    . THR A 1 22  ? -4.513  2.064   -5.539  1.00 0.00 ? 22  THR A N    6  
ATOM 9300  C CA   . THR A 1 22  ? -4.865  0.649   -5.546  1.00 0.00 ? 22  THR A CA   6  
ATOM 9301  C C    . THR A 1 22  ? -5.552  0.261   -6.850  1.00 0.00 ? 22  THR A C    6  
ATOM 9302  O O    . THR A 1 22  ? -6.454  0.956   -7.318  1.00 0.00 ? 22  THR A O    6  
ATOM 9303  C CB   . THR A 1 22  ? -5.790  0.295   -4.366  1.00 0.00 ? 22  THR A CB   6  
ATOM 9304  O OG1  . THR A 1 22  ? -6.991  1.071   -4.435  1.00 0.00 ? 22  THR A OG1  6  
ATOM 9305  C CG2  . THR A 1 22  ? -5.093  0.546   -3.037  1.00 0.00 ? 22  THR A CG2  6  
ATOM 9306  H H    . THR A 1 22  ? -4.628  2.582   -4.715  1.00 0.00 ? 22  THR A H    6  
ATOM 9307  H HA   . THR A 1 22  ? -3.954  0.078   -5.446  1.00 0.00 ? 22  THR A HA   6  
ATOM 9308  H HB   . THR A 1 22  ? -6.044  -0.754  -4.430  1.00 0.00 ? 22  THR A HB   6  
ATOM 9309  H HG1  . THR A 1 22  ? -6.884  1.873   -3.918  1.00 0.00 ? 22  THR A HG1  6  
ATOM 9310  H HG21 . THR A 1 22  ? -5.434  -0.175  -2.310  1.00 0.00 ? 22  THR A HG21 6  
ATOM 9311  H HG22 . THR A 1 22  ? -5.324  1.543   -2.693  1.00 0.00 ? 22  THR A HG22 6  
ATOM 9312  H HG23 . THR A 1 22  ? -4.026  0.449   -3.167  1.00 0.00 ? 22  THR A HG23 6  
ATOM 9313  N N    . GLN A 1 23  ? -5.120  -0.854  -7.431  1.00 0.00 ? 23  GLN A N    6  
ATOM 9314  C CA   . GLN A 1 23  ? -5.695  -1.334  -8.682  1.00 0.00 ? 23  GLN A CA   6  
ATOM 9315  C C    . GLN A 1 23  ? -6.897  -2.235  -8.418  1.00 0.00 ? 23  GLN A C    6  
ATOM 9316  O O    . GLN A 1 23  ? -7.321  -2.404  -7.275  1.00 0.00 ? 23  GLN A O    6  
ATOM 9317  C CB   . GLN A 1 23  ? -4.643  -2.092  -9.493  1.00 0.00 ? 23  GLN A CB   6  
ATOM 9318  C CG   . GLN A 1 23  ? -3.879  -3.128  -8.683  1.00 0.00 ? 23  GLN A CG   6  
ATOM 9319  C CD   . GLN A 1 23  ? -4.796  -4.104  -7.973  1.00 0.00 ? 23  GLN A CD   6  
ATOM 9320  O OE1  . GLN A 1 23  ? -5.475  -4.911  -8.608  1.00 0.00 ? 23  GLN A OE1  6  
ATOM 9321  N NE2  . GLN A 1 23  ? -4.819  -4.036  -6.647  1.00 0.00 ? 23  GLN A NE2  6  
ATOM 9322  H H    . GLN A 1 23  ? -4.399  -1.364  -7.010  1.00 0.00 ? 23  GLN A H    6  
ATOM 9323  H HA   . GLN A 1 23  ? -6.022  -0.475  -9.248  1.00 0.00 ? 23  GLN A HA   6  
ATOM 9324  H HB2  . GLN A 1 23  ? -5.132  -2.597  -10.313 1.00 0.00 ? 23  GLN A HB2  6  
ATOM 9325  H HB3  . GLN A 1 23  ? -3.932  -1.383  -9.891  1.00 0.00 ? 23  GLN A HB3  6  
ATOM 9326  H HG2  . GLN A 1 23  ? -3.235  -3.683  -9.348  1.00 0.00 ? 23  GLN A HG2  6  
ATOM 9327  H HG3  . GLN A 1 23  ? -3.279  -2.617  -7.945  1.00 0.00 ? 23  GLN A HG3  6  
ATOM 9328  H HE21 . GLN A 1 23  ? -4.252  -3.368  -6.208  1.00 0.00 ? 23  GLN A HE21 6  
ATOM 9329  H HE22 . GLN A 1 23  ? -5.403  -4.655  -6.162  1.00 0.00 ? 23  GLN A HE22 6  
ATOM 9330  N N    . HIS A 1 24  ? -7.443  -2.813  -9.484  1.00 0.00 ? 24  HIS A N    6  
ATOM 9331  C CA   . HIS A 1 24  ? -8.597  -3.697  -9.368  1.00 0.00 ? 24  HIS A CA   6  
ATOM 9332  C C    . HIS A 1 24  ? -8.158  -5.157  -9.301  1.00 0.00 ? 24  HIS A C    6  
ATOM 9333  O O    . HIS A 1 24  ? -7.974  -5.807  -10.329 1.00 0.00 ? 24  HIS A O    6  
ATOM 9334  C CB   . HIS A 1 24  ? -9.545  -3.491  -10.549 1.00 0.00 ? 24  HIS A CB   6  
ATOM 9335  C CG   . HIS A 1 24  ? -8.840  -3.279  -11.853 1.00 0.00 ? 24  HIS A CG   6  
ATOM 9336  N ND1  . HIS A 1 24  ? -7.746  -4.021  -12.247 1.00 0.00 ? 24  HIS A ND1  6  
ATOM 9337  C CD2  . HIS A 1 24  ? -9.079  -2.403  -12.857 1.00 0.00 ? 24  HIS A CD2  6  
ATOM 9338  C CE1  . HIS A 1 24  ? -7.342  -3.609  -13.436 1.00 0.00 ? 24  HIS A CE1  6  
ATOM 9339  N NE2  . HIS A 1 24  ? -8.135  -2.628  -13.828 1.00 0.00 ? 24  HIS A NE2  6  
ATOM 9340  H H    . HIS A 1 24  ? -7.060  -2.640  -10.370 1.00 0.00 ? 24  HIS A H    6  
ATOM 9341  H HA   . HIS A 1 24  ? -9.115  -3.448  -8.454  1.00 0.00 ? 24  HIS A HA   6  
ATOM 9342  H HB2  . HIS A 1 24  ? -10.176 -4.362  -10.652 1.00 0.00 ? 24  HIS A HB2  6  
ATOM 9343  H HB3  . HIS A 1 24  ? -10.163 -2.625  -10.360 1.00 0.00 ? 24  HIS A HB3  6  
ATOM 9344  H HD1  . HIS A 1 24  ? -7.327  -4.741  -11.731 1.00 0.00 ? 24  HIS A HD1  6  
ATOM 9345  H HD2  . HIS A 1 24  ? -9.867  -1.663  -12.889 1.00 0.00 ? 24  HIS A HD2  6  
ATOM 9346  H HE1  . HIS A 1 24  ? -6.507  -4.006  -13.992 1.00 0.00 ? 24  HIS A HE1  6  
ATOM 9347  H HE2  . HIS A 1 24  ? -8.006  -2.087  -14.634 1.00 0.00 ? 24  HIS A HE2  6  
ATOM 9348  N N    . ALA A 1 25  ? -7.990  -5.664  -8.084  1.00 0.00 ? 25  ALA A N    6  
ATOM 9349  C CA   . ALA A 1 25  ? -7.574  -7.047  -7.883  1.00 0.00 ? 25  ALA A CA   6  
ATOM 9350  C C    . ALA A 1 25  ? -8.744  -8.006  -8.075  1.00 0.00 ? 25  ALA A C    6  
ATOM 9351  O O    . ALA A 1 25  ? -9.321  -8.499  -7.105  1.00 0.00 ? 25  ALA A O    6  
ATOM 9352  C CB   . ALA A 1 25  ? -6.969  -7.220  -6.498  1.00 0.00 ? 25  ALA A CB   6  
ATOM 9353  H H    . ALA A 1 25  ? -8.152  -5.096  -7.303  1.00 0.00 ? 25  ALA A H    6  
ATOM 9354  H HA   . ALA A 1 25  ? -6.811  -7.275  -8.614  1.00 0.00 ? 25  ALA A HA   6  
ATOM 9355  H HB1  . ALA A 1 25  ? -5.892  -7.161  -6.567  1.00 0.00 ? 25  ALA A HB1  6  
ATOM 9356  H HB2  . ALA A 1 25  ? -7.332  -6.439  -5.847  1.00 0.00 ? 25  ALA A HB2  6  
ATOM 9357  H HB3  . ALA A 1 25  ? -7.252  -8.183  -6.100  1.00 0.00 ? 25  ALA A HB3  6  
ATOM 9358  N N    . LEU A 1 26  ? -9.091  -8.265  -9.331  1.00 0.00 ? 26  LEU A N    6  
ATOM 9359  C CA   . LEU A 1 26  ? -10.194 -9.165  -9.650  1.00 0.00 ? 26  LEU A CA   6  
ATOM 9360  C C    . LEU A 1 26  ? -9.955  -10.550 -9.057  1.00 0.00 ? 26  LEU A C    6  
ATOM 9361  O O    . LEU A 1 26  ? -10.570 -10.923 -8.057  1.00 0.00 ? 26  LEU A O    6  
ATOM 9362  C CB   . LEU A 1 26  ? -10.370 -9.270  -11.166 1.00 0.00 ? 26  LEU A CB   6  
ATOM 9363  C CG   . LEU A 1 26  ? -11.281 -8.224  -11.810 1.00 0.00 ? 26  LEU A CG   6  
ATOM 9364  C CD1  . LEU A 1 26  ? -10.727 -6.825  -11.588 1.00 0.00 ? 26  LEU A CD1  6  
ATOM 9365  C CD2  . LEU A 1 26  ? -11.447 -8.505  -13.296 1.00 0.00 ? 26  LEU A CD2  6  
ATOM 9366  H H    . LEU A 1 26  ? -8.594  -7.842  -10.061 1.00 0.00 ? 26  LEU A H    6  
ATOM 9367  H HA   . LEU A 1 26  ? -11.094 -8.752  -9.219  1.00 0.00 ? 26  LEU A HA   6  
ATOM 9368  H HB2  . LEU A 1 26  ? -9.395  -9.183  -11.619 1.00 0.00 ? 26  LEU A HB2  6  
ATOM 9369  H HB3  . LEU A 1 26  ? -10.780 -10.246 -11.383 1.00 0.00 ? 26  LEU A HB3  6  
ATOM 9370  H HG   . LEU A 1 26  ? -12.257 -8.273  -11.348 1.00 0.00 ? 26  LEU A HG   6  
ATOM 9371  H HD11 . LEU A 1 26  ? -10.732 -6.599  -10.533 1.00 0.00 ? 26  LEU A HD11 6  
ATOM 9372  H HD12 . LEU A 1 26  ? -11.340 -6.108  -12.114 1.00 0.00 ? 26  LEU A HD12 6  
ATOM 9373  H HD13 . LEU A 1 26  ? -9.715  -6.776  -11.963 1.00 0.00 ? 26  LEU A HD13 6  
ATOM 9374  H HD21 . LEU A 1 26  ? -11.975 -9.438  -13.429 1.00 0.00 ? 26  LEU A HD21 6  
ATOM 9375  H HD22 . LEU A 1 26  ? -10.474 -8.573  -13.761 1.00 0.00 ? 26  LEU A HD22 6  
ATOM 9376  H HD23 . LEU A 1 26  ? -12.010 -7.704  -13.752 1.00 0.00 ? 26  LEU A HD23 6  
ATOM 9377  N N    . HIS A 1 27  ? -9.057  -11.308 -9.678  1.00 0.00 ? 27  HIS A N    6  
ATOM 9378  C CA   . HIS A 1 27  ? -8.735  -12.651 -9.211  1.00 0.00 ? 27  HIS A CA   6  
ATOM 9379  C C    . HIS A 1 27  ? -7.527  -13.211 -9.956  1.00 0.00 ? 27  HIS A C    6  
ATOM 9380  O O    . HIS A 1 27  ? -7.577  -13.426 -11.166 1.00 0.00 ? 27  HIS A O    6  
ATOM 9381  C CB   . HIS A 1 27  ? -9.936  -13.579 -9.392  1.00 0.00 ? 27  HIS A CB   6  
ATOM 9382  C CG   . HIS A 1 27  ? -9.560  -15.019 -9.565  1.00 0.00 ? 27  HIS A CG   6  
ATOM 9383  N ND1  . HIS A 1 27  ? -9.616  -15.939 -8.540  1.00 0.00 ? 27  HIS A ND1  6  
ATOM 9384  C CD2  . HIS A 1 27  ? -9.122  -15.695 -10.652 1.00 0.00 ? 27  HIS A CD2  6  
ATOM 9385  C CE1  . HIS A 1 27  ? -9.228  -17.119 -8.989  1.00 0.00 ? 27  HIS A CE1  6  
ATOM 9386  N NE2  . HIS A 1 27  ? -8.922  -16.998 -10.268 1.00 0.00 ? 27  HIS A NE2  6  
ATOM 9387  H H    . HIS A 1 27  ? -8.600  -10.955 -10.470 1.00 0.00 ? 27  HIS A H    6  
ATOM 9388  H HA   . HIS A 1 27  ? -8.496  -12.588 -8.160  1.00 0.00 ? 27  HIS A HA   6  
ATOM 9389  H HB2  . HIS A 1 27  ? -10.574 -13.505 -8.524  1.00 0.00 ? 27  HIS A HB2  6  
ATOM 9390  H HB3  . HIS A 1 27  ? -10.490 -13.273 -10.268 1.00 0.00 ? 27  HIS A HB3  6  
ATOM 9391  H HD1  . HIS A 1 27  ? -9.898  -15.755 -7.620  1.00 0.00 ? 27  HIS A HD1  6  
ATOM 9392  H HD2  . HIS A 1 27  ? -8.959  -15.286 -11.640 1.00 0.00 ? 27  HIS A HD2  6  
ATOM 9393  H HE1  . HIS A 1 27  ? -9.169  -18.028 -8.410  1.00 0.00 ? 27  HIS A HE1  6  
ATOM 9394  H HE2  . HIS A 1 27  ? -8.525  -17.702 -10.822 1.00 0.00 ? 27  HIS A HE2  6  
ATOM 9395  N N    . GLY A 1 28  ? -6.441  -13.444 -9.224  1.00 0.00 ? 28  GLY A N    6  
ATOM 9396  C CA   . GLY A 1 28  ? -5.236  -13.975 -9.833  1.00 0.00 ? 28  GLY A CA   6  
ATOM 9397  C C    . GLY A 1 28  ? -4.123  -12.950 -9.906  1.00 0.00 ? 28  GLY A C    6  
ATOM 9398  O O    . GLY A 1 28  ? -3.222  -12.942 -9.068  1.00 0.00 ? 28  GLY A O    6  
ATOM 9399  H H    . GLY A 1 28  ? -6.459  -13.253 -8.263  1.00 0.00 ? 28  GLY A H    6  
ATOM 9400  H HA2  . GLY A 1 28  ? -4.896  -14.820 -9.253  1.00 0.00 ? 28  GLY A HA2  6  
ATOM 9401  H HA3  . GLY A 1 28  ? -5.469  -14.308 -10.834 1.00 0.00 ? 28  GLY A HA3  6  
ATOM 9402  N N    . GLU A 1 29  ? -4.184  -12.083 -10.912 1.00 0.00 ? 29  GLU A N    6  
ATOM 9403  C CA   . GLU A 1 29  ? -3.170  -11.050 -11.092 1.00 0.00 ? 29  GLU A CA   6  
ATOM 9404  C C    . GLU A 1 29  ? -2.657  -10.550 -9.745  1.00 0.00 ? 29  GLU A C    6  
ATOM 9405  O O    . GLU A 1 29  ? -3.390  -10.534 -8.755  1.00 0.00 ? 29  GLU A O    6  
ATOM 9406  C CB   . GLU A 1 29  ? -3.740  -9.881  -11.899 1.00 0.00 ? 29  GLU A CB   6  
ATOM 9407  C CG   . GLU A 1 29  ? -5.110  -9.426  -11.426 1.00 0.00 ? 29  GLU A CG   6  
ATOM 9408  C CD   . GLU A 1 29  ? -6.228  -10.313 -11.938 1.00 0.00 ? 29  GLU A CD   6  
ATOM 9409  O OE1  . GLU A 1 29  ? -5.942  -11.224 -12.742 1.00 0.00 ? 29  GLU A OE1  6  
ATOM 9410  O OE2  . GLU A 1 29  ? -7.389  -10.096 -11.533 1.00 0.00 ? 29  GLU A OE2  6  
ATOM 9411  H H    . GLU A 1 29  ? -4.927  -12.140 -11.548 1.00 0.00 ? 29  GLU A H    6  
ATOM 9412  H HA   . GLU A 1 29  ? -2.347  -11.485 -11.639 1.00 0.00 ? 29  GLU A HA   6  
ATOM 9413  H HB2  . GLU A 1 29  ? -3.060  -9.044  -11.826 1.00 0.00 ? 29  GLU A HB2  6  
ATOM 9414  H HB3  . GLU A 1 29  ? -3.820  -10.179 -12.933 1.00 0.00 ? 29  GLU A HB3  6  
ATOM 9415  H HG2  . GLU A 1 29  ? -5.127  -9.438  -10.347 1.00 0.00 ? 29  GLU A HG2  6  
ATOM 9416  H HG3  . GLU A 1 29  ? -5.281  -8.418  -11.776 1.00 0.00 ? 29  GLU A HG3  6  
ATOM 9417  N N    . LYS A 1 30  ? -1.392  -10.145 -9.714  1.00 0.00 ? 30  LYS A N    6  
ATOM 9418  C CA   . LYS A 1 30  ? -0.779  -9.644  -8.489  1.00 0.00 ? 30  LYS A CA   6  
ATOM 9419  C C    . LYS A 1 30  ? -1.293  -8.248  -8.155  1.00 0.00 ? 30  LYS A C    6  
ATOM 9420  O O    . LYS A 1 30  ? -1.117  -7.308  -8.929  1.00 0.00 ? 30  LYS A O    6  
ATOM 9421  C CB   . LYS A 1 30  ? 0.745   -9.617  -8.632  1.00 0.00 ? 30  LYS A CB   6  
ATOM 9422  C CG   . LYS A 1 30  ? 1.341   -10.954 -9.037  1.00 0.00 ? 30  LYS A CG   6  
ATOM 9423  C CD   . LYS A 1 30  ? 2.758   -11.114 -8.511  1.00 0.00 ? 30  LYS A CD   6  
ATOM 9424  C CE   . LYS A 1 30  ? 3.787   -10.672 -9.541  1.00 0.00 ? 30  LYS A CE   6  
ATOM 9425  N NZ   . LYS A 1 30  ? 5.023   -10.144 -8.898  1.00 0.00 ? 30  LYS A NZ   6  
ATOM 9426  H H    . LYS A 1 30  ? -0.858  -10.182 -10.535 1.00 0.00 ? 30  LYS A H    6  
ATOM 9427  H HA   . LYS A 1 30  ? -1.045  -10.315 -7.687  1.00 0.00 ? 30  LYS A HA   6  
ATOM 9428  H HB2  . LYS A 1 30  ? 1.011   -8.886  -9.381  1.00 0.00 ? 30  LYS A HB2  6  
ATOM 9429  H HB3  . LYS A 1 30  ? 1.178   -9.325  -7.686  1.00 0.00 ? 30  LYS A HB3  6  
ATOM 9430  H HG2  . LYS A 1 30  ? 0.729   -11.748 -8.636  1.00 0.00 ? 30  LYS A HG2  6  
ATOM 9431  H HG3  . LYS A 1 30  ? 1.357   -11.019 -10.115 1.00 0.00 ? 30  LYS A HG3  6  
ATOM 9432  H HD2  . LYS A 1 30  ? 2.874   -10.512 -7.622  1.00 0.00 ? 30  LYS A HD2  6  
ATOM 9433  H HD3  . LYS A 1 30  ? 2.928   -12.154 -8.269  1.00 0.00 ? 30  LYS A HD3  6  
ATOM 9434  H HE2  . LYS A 1 30  ? 4.047   -11.519 -10.158 1.00 0.00 ? 30  LYS A HE2  6  
ATOM 9435  H HE3  . LYS A 1 30  ? 3.352   -9.898  -10.156 1.00 0.00 ? 30  LYS A HE3  6  
ATOM 9436  H HZ1  . LYS A 1 30  ? 5.788   -10.846 -8.965  1.00 0.00 ? 30  LYS A HZ1  6  
ATOM 9437  H HZ2  . LYS A 1 30  ? 4.843   -9.938  -7.895  1.00 0.00 ? 30  LYS A HZ2  6  
ATOM 9438  H HZ3  . LYS A 1 30  ? 5.326   -9.270  -9.372  1.00 0.00 ? 30  LYS A HZ3  6  
ATOM 9439  N N    . GLY A 1 31  ? -1.929  -8.118  -6.994  1.00 0.00 ? 31  GLY A N    6  
ATOM 9440  C CA   . GLY A 1 31  ? -2.458  -6.833  -6.577  1.00 0.00 ? 31  GLY A CA   6  
ATOM 9441  C C    . GLY A 1 31  ? -1.366  -5.852  -6.198  1.00 0.00 ? 31  GLY A C    6  
ATOM 9442  O O    . GLY A 1 31  ? -0.614  -6.087  -5.252  1.00 0.00 ? 31  GLY A O    6  
ATOM 9443  H H    . GLY A 1 31  ? -2.040  -8.902  -6.416  1.00 0.00 ? 31  GLY A H    6  
ATOM 9444  H HA2  . GLY A 1 31  ? -3.038  -6.414  -7.386  1.00 0.00 ? 31  GLY A HA2  6  
ATOM 9445  H HA3  . GLY A 1 31  ? -3.104  -6.982  -5.724  1.00 0.00 ? 31  GLY A HA3  6  
ATOM 9446  N N    . GLN A 1 32  ? -1.278  -4.751  -6.937  1.00 0.00 ? 32  GLN A N    6  
ATOM 9447  C CA   . GLN A 1 32  ? -0.268  -3.733  -6.674  1.00 0.00 ? 32  GLN A CA   6  
ATOM 9448  C C    . GLN A 1 32  ? -0.875  -2.540  -5.944  1.00 0.00 ? 32  GLN A C    6  
ATOM 9449  O O    . GLN A 1 32  ? -2.015  -2.155  -6.205  1.00 0.00 ? 32  GLN A O    6  
ATOM 9450  C CB   . GLN A 1 32  ? 0.375   -3.272  -7.983  1.00 0.00 ? 32  GLN A CB   6  
ATOM 9451  C CG   . GLN A 1 32  ? 1.790   -2.742  -7.812  1.00 0.00 ? 32  GLN A CG   6  
ATOM 9452  C CD   . GLN A 1 32  ? 2.410   -2.301  -9.123  1.00 0.00 ? 32  GLN A CD   6  
ATOM 9453  O OE1  . GLN A 1 32  ? 2.093   -1.231  -9.644  1.00 0.00 ? 32  GLN A OE1  6  
ATOM 9454  N NE2  . GLN A 1 32  ? 3.299   -3.125  -9.664  1.00 0.00 ? 32  GLN A NE2  6  
ATOM 9455  H H    . GLN A 1 32  ? -1.906  -4.621  -7.677  1.00 0.00 ? 32  GLN A H    6  
ATOM 9456  H HA   . GLN A 1 32  ? 0.492   -4.175  -6.046  1.00 0.00 ? 32  GLN A HA   6  
ATOM 9457  H HB2  . GLN A 1 32  ? 0.406   -4.106  -8.668  1.00 0.00 ? 32  GLN A HB2  6  
ATOM 9458  H HB3  . GLN A 1 32  ? -0.231  -2.487  -8.411  1.00 0.00 ? 32  GLN A HB3  6  
ATOM 9459  H HG2  . GLN A 1 32  ? 1.765   -1.896  -7.141  1.00 0.00 ? 32  GLN A HG2  6  
ATOM 9460  H HG3  . GLN A 1 32  ? 2.403   -3.521  -7.385  1.00 0.00 ? 32  GLN A HG3  6  
ATOM 9461  H HE21 . GLN A 1 32  ? 3.502   -3.961  -9.194  1.00 0.00 ? 32  GLN A HE21 6  
ATOM 9462  H HE22 . GLN A 1 32  ? 3.715   -2.865  -10.512 1.00 0.00 ? 32  GLN A HE22 6  
ATOM 9463  N N    . ILE A 1 33  ? -0.107  -1.960  -5.028  1.00 0.00 ? 33  ILE A N    6  
ATOM 9464  C CA   . ILE A 1 33  ? -0.570  -0.810  -4.261  1.00 0.00 ? 33  ILE A CA   6  
ATOM 9465  C C    . ILE A 1 33  ? 0.471   0.304   -4.259  1.00 0.00 ? 33  ILE A C    6  
ATOM 9466  O O    . ILE A 1 33  ? 1.349   0.348   -3.397  1.00 0.00 ? 33  ILE A O    6  
ATOM 9467  C CB   . ILE A 1 33  ? -0.894  -1.197  -2.806  1.00 0.00 ? 33  ILE A CB   6  
ATOM 9468  C CG1  . ILE A 1 33  ? -2.036  -2.215  -2.768  1.00 0.00 ? 33  ILE A CG1  6  
ATOM 9469  C CG2  . ILE A 1 33  ? -1.252  0.040   -1.995  1.00 0.00 ? 33  ILE A CG2  6  
ATOM 9470  C CD1  . ILE A 1 33  ? -2.292  -2.785  -1.390  1.00 0.00 ? 33  ILE A CD1  6  
ATOM 9471  H H    . ILE A 1 33  ? 0.792   -2.313  -4.865  1.00 0.00 ? 33  ILE A H    6  
ATOM 9472  H HA   . ILE A 1 33  ? -1.474  -0.443  -4.724  1.00 0.00 ? 33  ILE A HA   6  
ATOM 9473  H HB   . ILE A 1 33  ? -0.011  -1.641  -2.370  1.00 0.00 ? 33  ILE A HB   6  
ATOM 9474  H HG12 . ILE A 1 33  ? -2.944  -1.740  -3.104  1.00 0.00 ? 33  ILE A HG12 6  
ATOM 9475  H HG13 . ILE A 1 33  ? -1.798  -3.036  -3.428  1.00 0.00 ? 33  ILE A HG13 6  
ATOM 9476  H HG21 . ILE A 1 33  ? -1.443  -0.244  -0.971  1.00 0.00 ? 33  ILE A HG21 6  
ATOM 9477  H HG22 . ILE A 1 33  ? -0.431  0.740   -2.026  1.00 0.00 ? 33  ILE A HG22 6  
ATOM 9478  H HG23 . ILE A 1 33  ? -2.135  0.500   -2.412  1.00 0.00 ? 33  ILE A HG23 6  
ATOM 9479  H HD11 . ILE A 1 33  ? -2.892  -3.679  -1.476  1.00 0.00 ? 33  ILE A HD11 6  
ATOM 9480  H HD12 . ILE A 1 33  ? -1.351  -3.025  -0.919  1.00 0.00 ? 33  ILE A HD12 6  
ATOM 9481  H HD13 . ILE A 1 33  ? -2.818  -2.055  -0.791  1.00 0.00 ? 33  ILE A HD13 6  
ATOM 9482  N N    . LYS A 1 34  ? 0.366   1.206   -5.229  1.00 0.00 ? 34  LYS A N    6  
ATOM 9483  C CA   . LYS A 1 34  ? 1.296   2.324   -5.339  1.00 0.00 ? 34  LYS A CA   6  
ATOM 9484  C C    . LYS A 1 34  ? 0.854   3.488   -4.457  1.00 0.00 ? 34  LYS A C    6  
ATOM 9485  O O    . LYS A 1 34  ? -0.284  3.951   -4.549  1.00 0.00 ? 34  LYS A O    6  
ATOM 9486  C CB   . LYS A 1 34  ? 1.402   2.785   -6.794  1.00 0.00 ? 34  LYS A CB   6  
ATOM 9487  C CG   . LYS A 1 34  ? 2.450   3.861   -7.017  1.00 0.00 ? 34  LYS A CG   6  
ATOM 9488  C CD   . LYS A 1 34  ? 2.658   4.139   -8.496  1.00 0.00 ? 34  LYS A CD   6  
ATOM 9489  C CE   . LYS A 1 34  ? 3.682   3.193   -9.103  1.00 0.00 ? 34  LYS A CE   6  
ATOM 9490  N NZ   . LYS A 1 34  ? 3.047   1.954   -9.632  1.00 0.00 ? 34  LYS A NZ   6  
ATOM 9491  H H    . LYS A 1 34  ? -0.356  1.118   -5.887  1.00 0.00 ? 34  LYS A H    6  
ATOM 9492  H HA   . LYS A 1 34  ? 2.264   1.984   -5.006  1.00 0.00 ? 34  LYS A HA   6  
ATOM 9493  H HB2  . LYS A 1 34  ? 1.652   1.934   -7.411  1.00 0.00 ? 34  LYS A HB2  6  
ATOM 9494  H HB3  . LYS A 1 34  ? 0.444   3.175   -7.106  1.00 0.00 ? 34  LYS A HB3  6  
ATOM 9495  H HG2  . LYS A 1 34  ? 2.128   4.770   -6.532  1.00 0.00 ? 34  LYS A HG2  6  
ATOM 9496  H HG3  . LYS A 1 34  ? 3.386   3.533   -6.587  1.00 0.00 ? 34  LYS A HG3  6  
ATOM 9497  H HD2  . LYS A 1 34  ? 1.718   4.014   -9.013  1.00 0.00 ? 34  LYS A HD2  6  
ATOM 9498  H HD3  . LYS A 1 34  ? 3.004   5.156   -8.617  1.00 0.00 ? 34  LYS A HD3  6  
ATOM 9499  H HE2  . LYS A 1 34  ? 4.188   3.701   -9.910  1.00 0.00 ? 34  LYS A HE2  6  
ATOM 9500  H HE3  . LYS A 1 34  ? 4.399   2.923   -8.342  1.00 0.00 ? 34  LYS A HE3  6  
ATOM 9501  H HZ1  . LYS A 1 34  ? 2.015   2.075   -9.682  1.00 0.00 ? 34  LYS A HZ1  6  
ATOM 9502  H HZ2  . LYS A 1 34  ? 3.261   1.149   -9.009  1.00 0.00 ? 34  LYS A HZ2  6  
ATOM 9503  H HZ3  . LYS A 1 34  ? 3.408   1.746   -10.585 1.00 0.00 ? 34  LYS A HZ3  6  
ATOM 9504  N N    . CYS A 1 35  ? 1.759   3.956   -3.606  1.00 0.00 ? 35  CYS A N    6  
ATOM 9505  C CA   . CYS A 1 35  ? 1.463   5.067   -2.708  1.00 0.00 ? 35  CYS A CA   6  
ATOM 9506  C C    . CYS A 1 35  ? 2.146   6.346   -3.181  1.00 0.00 ? 35  CYS A C    6  
ATOM 9507  O O    . CYS A 1 35  ? 3.200   6.301   -3.817  1.00 0.00 ? 35  CYS A O    6  
ATOM 9508  C CB   . CYS A 1 35  ? 1.910   4.733   -1.284  1.00 0.00 ? 35  CYS A CB   6  
ATOM 9509  S SG   . CYS A 1 35  ? 1.280   3.155   -0.664  1.00 0.00 ? 35  CYS A SG   6  
ATOM 9510  H H    . CYS A 1 35  ? 2.649   3.545   -3.579  1.00 0.00 ? 35  CYS A H    6  
ATOM 9511  H HA   . CYS A 1 35  ? 0.394   5.221   -2.714  1.00 0.00 ? 35  CYS A HA   6  
ATOM 9512  H HB2  . CYS A 1 35  ? 2.988   4.689   -1.254  1.00 0.00 ? 35  CYS A HB2  6  
ATOM 9513  H HB3  . CYS A 1 35  ? 1.569   5.510   -0.616  1.00 0.00 ? 35  CYS A HB3  6  
ATOM 9514  H HG   . CYS A 1 35  ? 0.480   3.409   0.360   1.00 0.00 ? 35  CYS A HG   6  
ATOM 9515  N N    . PHE A 1 36  ? 1.538   7.486   -2.869  1.00 0.00 ? 36  PHE A N    6  
ATOM 9516  C CA   . PHE A 1 36  ? 2.086   8.778   -3.265  1.00 0.00 ? 36  PHE A CA   6  
ATOM 9517  C C    . PHE A 1 36  ? 2.665   9.515   -2.061  1.00 0.00 ? 36  PHE A C    6  
ATOM 9518  O O    . PHE A 1 36  ? 1.952   10.232  -1.357  1.00 0.00 ? 36  PHE A O    6  
ATOM 9519  C CB   . PHE A 1 36  ? 1.004   9.633   -3.929  1.00 0.00 ? 36  PHE A CB   6  
ATOM 9520  C CG   . PHE A 1 36  ? 0.934   9.460   -5.419  1.00 0.00 ? 36  PHE A CG   6  
ATOM 9521  C CD1  . PHE A 1 36  ? 1.382   8.292   -6.016  1.00 0.00 ? 36  PHE A CD1  6  
ATOM 9522  C CD2  . PHE A 1 36  ? 0.420   10.464  -6.223  1.00 0.00 ? 36  PHE A CD2  6  
ATOM 9523  C CE1  . PHE A 1 36  ? 1.318   8.130   -7.387  1.00 0.00 ? 36  PHE A CE1  6  
ATOM 9524  C CE2  . PHE A 1 36  ? 0.353   10.307  -7.594  1.00 0.00 ? 36  PHE A CE2  6  
ATOM 9525  C CZ   . PHE A 1 36  ? 0.804   9.139   -8.177  1.00 0.00 ? 36  PHE A CZ   6  
ATOM 9526  H H    . PHE A 1 36  ? 0.700   7.457   -2.361  1.00 0.00 ? 36  PHE A H    6  
ATOM 9527  H HA   . PHE A 1 36  ? 2.877   8.598   -3.976  1.00 0.00 ? 36  PHE A HA   6  
ATOM 9528  H HB2  . PHE A 1 36  ? 0.042   9.365   -3.518  1.00 0.00 ? 36  PHE A HB2  6  
ATOM 9529  H HB3  . PHE A 1 36  ? 1.202   10.674  -3.723  1.00 0.00 ? 36  PHE A HB3  6  
ATOM 9530  H HD1  . PHE A 1 36  ? 1.785   7.502   -5.398  1.00 0.00 ? 36  PHE A HD1  6  
ATOM 9531  H HD2  . PHE A 1 36  ? 0.068   11.379  -5.769  1.00 0.00 ? 36  PHE A HD2  6  
ATOM 9532  H HE1  . PHE A 1 36  ? 1.672   7.215   -7.840  1.00 0.00 ? 36  PHE A HE1  6  
ATOM 9533  H HE2  . PHE A 1 36  ? -0.049  11.098  -8.210  1.00 0.00 ? 36  PHE A HE2  6  
ATOM 9534  H HZ   . PHE A 1 36  ? 0.753   9.014   -9.249  1.00 0.00 ? 36  PHE A HZ   6  
ATOM 9535  N N    . ILE A 1 37  ? 3.960   9.332   -1.830  1.00 0.00 ? 37  ILE A N    6  
ATOM 9536  C CA   . ILE A 1 37  ? 4.635   9.979   -0.712  1.00 0.00 ? 37  ILE A CA   6  
ATOM 9537  C C    . ILE A 1 37  ? 5.299   11.281  -1.149  1.00 0.00 ? 37  ILE A C    6  
ATOM 9538  O O    . ILE A 1 37  ? 6.300   11.269  -1.866  1.00 0.00 ? 37  ILE A O    6  
ATOM 9539  C CB   . ILE A 1 37  ? 5.700   9.058   -0.087  1.00 0.00 ? 37  ILE A CB   6  
ATOM 9540  C CG1  . ILE A 1 37  ? 5.062   7.747   0.376   1.00 0.00 ? 37  ILE A CG1  6  
ATOM 9541  C CG2  . ILE A 1 37  ? 6.390   9.758   1.075   1.00 0.00 ? 37  ILE A CG2  6  
ATOM 9542  C CD1  . ILE A 1 37  ? 6.069   6.655   0.667   1.00 0.00 ? 37  ILE A CD1  6  
ATOM 9543  H H    . ILE A 1 37  ? 4.475   8.749   -2.426  1.00 0.00 ? 37  ILE A H    6  
ATOM 9544  H HA   . ILE A 1 37  ? 3.893   10.201  0.042   1.00 0.00 ? 37  ILE A HA   6  
ATOM 9545  H HB   . ILE A 1 37  ? 6.443   8.843   -0.839  1.00 0.00 ? 37  ILE A HB   6  
ATOM 9546  H HG12 . ILE A 1 37  ? 4.499   7.927   1.278   1.00 0.00 ? 37  ILE A HG12 6  
ATOM 9547  H HG13 . ILE A 1 37  ? 4.395   7.388   -0.394  1.00 0.00 ? 37  ILE A HG13 6  
ATOM 9548  H HG21 . ILE A 1 37  ? 6.054   10.783  1.128   1.00 0.00 ? 37  ILE A HG21 6  
ATOM 9549  H HG22 . ILE A 1 37  ? 6.144   9.251   1.996   1.00 0.00 ? 37  ILE A HG22 6  
ATOM 9550  H HG23 . ILE A 1 37  ? 7.459   9.736   0.925   1.00 0.00 ? 37  ILE A HG23 6  
ATOM 9551  H HD11 . ILE A 1 37  ? 6.207   6.048   -0.215  1.00 0.00 ? 37  ILE A HD11 6  
ATOM 9552  H HD12 . ILE A 1 37  ? 7.011   7.100   0.951   1.00 0.00 ? 37  ILE A HD12 6  
ATOM 9553  H HD13 . ILE A 1 37  ? 5.705   6.037   1.475   1.00 0.00 ? 37  ILE A HD13 6  
ATOM 9554  N N    . ARG A 1 38  ? 4.735   12.402  -0.712  1.00 0.00 ? 38  ARG A N    6  
ATOM 9555  C CA   . ARG A 1 38  ? 5.272   13.713  -1.058  1.00 0.00 ? 38  ARG A CA   6  
ATOM 9556  C C    . ARG A 1 38  ? 6.313   14.160  -0.036  1.00 0.00 ? 38  ARG A C    6  
ATOM 9557  O O    . ARG A 1 38  ? 6.296   15.302  0.423   1.00 0.00 ? 38  ARG A O    6  
ATOM 9558  C CB   . ARG A 1 38  ? 4.145   14.744  -1.139  1.00 0.00 ? 38  ARG A CB   6  
ATOM 9559  C CG   . ARG A 1 38  ? 3.128   14.450  -2.229  1.00 0.00 ? 38  ARG A CG   6  
ATOM 9560  C CD   . ARG A 1 38  ? 1.867   15.281  -2.053  1.00 0.00 ? 38  ARG A CD   6  
ATOM 9561  N NE   . ARG A 1 38  ? 2.081   16.682  -2.406  1.00 0.00 ? 38  ARG A NE   6  
ATOM 9562  C CZ   . ARG A 1 38  ? 1.094   17.547  -2.610  1.00 0.00 ? 38  ARG A CZ   6  
ATOM 9563  N NH1  . ARG A 1 38  ? -0.168  17.158  -2.496  1.00 0.00 ? 38  ARG A NH1  6  
ATOM 9564  N NH2  . ARG A 1 38  ? 1.369   18.806  -2.927  1.00 0.00 ? 38  ARG A NH2  6  
ATOM 9565  H H    . ARG A 1 38  ? 3.938   12.347  -0.144  1.00 0.00 ? 38  ARG A H    6  
ATOM 9566  H HA   . ARG A 1 38  ? 5.746   13.633  -2.025  1.00 0.00 ? 38  ARG A HA   6  
ATOM 9567  H HB2  . ARG A 1 38  ? 3.627   14.770  -0.192  1.00 0.00 ? 38  ARG A HB2  6  
ATOM 9568  H HB3  . ARG A 1 38  ? 4.576   15.715  -1.331  1.00 0.00 ? 38  ARG A HB3  6  
ATOM 9569  H HG2  . ARG A 1 38  ? 3.566   14.680  -3.189  1.00 0.00 ? 38  ARG A HG2  6  
ATOM 9570  H HG3  . ARG A 1 38  ? 2.867   13.403  -2.192  1.00 0.00 ? 38  ARG A HG3  6  
ATOM 9571  H HD2  . ARG A 1 38  ? 1.093   14.875  -2.687  1.00 0.00 ? 38  ARG A HD2  6  
ATOM 9572  H HD3  . ARG A 1 38  ? 1.555   15.222  -1.021  1.00 0.00 ? 38  ARG A HD3  6  
ATOM 9573  H HE   . ARG A 1 38  ? 3.006   16.991  -2.495  1.00 0.00 ? 38  ARG A HE   6  
ATOM 9574  H HH11 . ARG A 1 38  ? -0.378  16.210  -2.256  1.00 0.00 ? 38  ARG A HH11 6  
ATOM 9575  H HH12 . ARG A 1 38  ? -0.909  17.812  -2.649  1.00 0.00 ? 38  ARG A HH12 6  
ATOM 9576  H HH21 . ARG A 1 38  ? 2.319   19.104  -3.013  1.00 0.00 ? 38  ARG A HH21 6  
ATOM 9577  H HH22 . ARG A 1 38  ? 0.626   19.457  -3.080  1.00 0.00 ? 38  ARG A HH22 6  
ATOM 9578  N N    . SER A 1 39  ? 7.218   13.252  0.316   1.00 0.00 ? 39  SER A N    6  
ATOM 9579  C CA   . SER A 1 39  ? 8.264   13.552  1.287   1.00 0.00 ? 39  SER A CA   6  
ATOM 9580  C C    . SER A 1 39  ? 9.437   14.263  0.619   1.00 0.00 ? 39  SER A C    6  
ATOM 9581  O O    . SER A 1 39  ? 9.777   13.982  -0.531  1.00 0.00 ? 39  SER A O    6  
ATOM 9582  C CB   . SER A 1 39  ? 8.748   12.266  1.960   1.00 0.00 ? 39  SER A CB   6  
ATOM 9583  O OG   . SER A 1 39  ? 9.601   12.554  3.055   1.00 0.00 ? 39  SER A OG   6  
ATOM 9584  H H    . SER A 1 39  ? 7.179   12.359  -0.085  1.00 0.00 ? 39  SER A H    6  
ATOM 9585  H HA   . SER A 1 39  ? 7.843   14.204  2.037   1.00 0.00 ? 39  SER A HA   6  
ATOM 9586  H HB2  . SER A 1 39  ? 7.897   11.708  2.319   1.00 0.00 ? 39  SER A HB2  6  
ATOM 9587  H HB3  . SER A 1 39  ? 9.293   11.671  1.242   1.00 0.00 ? 39  SER A HB3  6  
ATOM 9588  H HG   . SER A 1 39  ? 10.084  11.762  3.301   1.00 0.00 ? 39  SER A HG   6  
ATOM 9589  N N    . THR A 1 40  ? 10.054  15.187  1.350   1.00 0.00 ? 40  THR A N    6  
ATOM 9590  C CA   . THR A 1 40  ? 11.188  15.941  0.830   1.00 0.00 ? 40  THR A CA   6  
ATOM 9591  C C    . THR A 1 40  ? 11.998  16.566  1.960   1.00 0.00 ? 40  THR A C    6  
ATOM 9592  O O    . THR A 1 40  ? 11.594  17.556  2.570   1.00 0.00 ? 40  THR A O    6  
ATOM 9593  C CB   . THR A 1 40  ? 10.731  17.051  -0.134  1.00 0.00 ? 40  THR A CB   6  
ATOM 9594  O OG1  . THR A 1 40  ? 9.908   16.496  -1.166  1.00 0.00 ? 40  THR A OG1  6  
ATOM 9595  C CG2  . THR A 1 40  ? 11.927  17.755  -0.757  1.00 0.00 ? 40  THR A CG2  6  
ATOM 9596  H H    . THR A 1 40  ? 9.737   15.366  2.259   1.00 0.00 ? 40  THR A H    6  
ATOM 9597  H HA   . THR A 1 40  ? 11.821  15.256  0.283   1.00 0.00 ? 40  THR A HA   6  
ATOM 9598  H HB   . THR A 1 40  ? 10.155  17.777  0.423   1.00 0.00 ? 40  THR A HB   6  
ATOM 9599  H HG1  . THR A 1 40  ? 10.232  15.623  -1.399  1.00 0.00 ? 40  THR A HG1  6  
ATOM 9600  H HG21 . THR A 1 40  ? 11.615  18.704  -1.166  1.00 0.00 ? 40  THR A HG21 6  
ATOM 9601  H HG22 . THR A 1 40  ? 12.336  17.140  -1.545  1.00 0.00 ? 40  THR A HG22 6  
ATOM 9602  H HG23 . THR A 1 40  ? 12.681  17.919  -0.001  1.00 0.00 ? 40  THR A HG23 6  
ATOM 9603  N N    . PRO A 1 41  ? 13.168  15.977  2.247   1.00 0.00 ? 41  PRO A N    6  
ATOM 9604  C CA   . PRO A 1 41  ? 13.658  14.798  1.527   1.00 0.00 ? 41  PRO A CA   6  
ATOM 9605  C C    . PRO A 1 41  ? 12.842  13.548  1.838   1.00 0.00 ? 41  PRO A C    6  
ATOM 9606  O O    . PRO A 1 41  ? 12.008  13.532  2.744   1.00 0.00 ? 41  PRO A O    6  
ATOM 9607  C CB   . PRO A 1 41  ? 15.092  14.641  2.040   1.00 0.00 ? 41  PRO A CB   6  
ATOM 9608  C CG   . PRO A 1 41  ? 15.087  15.284  3.383   1.00 0.00 ? 41  PRO A CG   6  
ATOM 9609  C CD   . PRO A 1 41  ? 14.103  16.417  3.296   1.00 0.00 ? 41  PRO A CD   6  
ATOM 9610  H HA   . PRO A 1 41  ? 13.672  14.962  0.460   1.00 0.00 ? 41  PRO A HA   6  
ATOM 9611  H HB2  . PRO A 1 41  ? 15.341  13.591  2.104   1.00 0.00 ? 41  PRO A HB2  6  
ATOM 9612  H HB3  . PRO A 1 41  ? 15.775  15.138  1.367   1.00 0.00 ? 41  PRO A HB3  6  
ATOM 9613  H HG2  . PRO A 1 41  ? 14.773  14.571  4.130   1.00 0.00 ? 41  PRO A HG2  6  
ATOM 9614  H HG3  . PRO A 1 41  ? 16.073  15.661  3.613   1.00 0.00 ? 41  PRO A HG3  6  
ATOM 9615  H HD2  . PRO A 1 41  ? 13.592  16.546  4.239   1.00 0.00 ? 41  PRO A HD2  6  
ATOM 9616  H HD3  . PRO A 1 41  ? 14.603  17.330  3.008   1.00 0.00 ? 41  PRO A HD3  6  
ATOM 9617  N N    . PRO A 1 42  ? 13.085  12.475  1.071   1.00 0.00 ? 42  PRO A N    6  
ATOM 9618  C CA   . PRO A 1 42  ? 12.383  11.201  1.246   1.00 0.00 ? 42  PRO A CA   6  
ATOM 9619  C C    . PRO A 1 42  ? 12.783  10.491  2.535   1.00 0.00 ? 42  PRO A C    6  
ATOM 9620  O O    . PRO A 1 42  ? 13.785  10.822  3.169   1.00 0.00 ? 42  PRO A O    6  
ATOM 9621  C CB   . PRO A 1 42  ? 12.820  10.384  0.028   1.00 0.00 ? 42  PRO A CB   6  
ATOM 9622  C CG   . PRO A 1 42  ? 14.138  10.959  -0.360  1.00 0.00 ? 42  PRO A CG   6  
ATOM 9623  C CD   . PRO A 1 42  ? 14.065  12.424  -0.027  1.00 0.00 ? 42  PRO A CD   6  
ATOM 9624  H HA   . PRO A 1 42  ? 11.311  11.333  1.227   1.00 0.00 ? 42  PRO A HA   6  
ATOM 9625  H HB2  . PRO A 1 42  ? 12.909  9.342   0.303   1.00 0.00 ? 42  PRO A HB2  6  
ATOM 9626  H HB3  . PRO A 1 42  ? 12.094  10.493  -0.763  1.00 0.00 ? 42  PRO A HB3  6  
ATOM 9627  H HG2  . PRO A 1 42  ? 14.927  10.486  0.204   1.00 0.00 ? 42  PRO A HG2  6  
ATOM 9628  H HG3  . PRO A 1 42  ? 14.300  10.824  -1.419  1.00 0.00 ? 42  PRO A HG3  6  
ATOM 9629  H HD2  . PRO A 1 42  ? 15.029  12.786  0.299   1.00 0.00 ? 42  PRO A HD2  6  
ATOM 9630  H HD3  . PRO A 1 42  ? 13.717  12.988  -0.880  1.00 0.00 ? 42  PRO A HD3  6  
ATOM 9631  N N    . PRO A 1 43  ? 11.982  9.492   2.934   1.00 0.00 ? 43  PRO A N    6  
ATOM 9632  C CA   . PRO A 1 43  ? 12.234  8.714   4.151   1.00 0.00 ? 43  PRO A CA   6  
ATOM 9633  C C    . PRO A 1 43  ? 13.457  7.813   4.021   1.00 0.00 ? 43  PRO A C    6  
ATOM 9634  O O    . PRO A 1 43  ? 13.974  7.607   2.923   1.00 0.00 ? 43  PRO A O    6  
ATOM 9635  C CB   . PRO A 1 43  ? 10.964  7.872   4.303   1.00 0.00 ? 43  PRO A CB   6  
ATOM 9636  C CG   . PRO A 1 43  ? 10.420  7.756   2.921   1.00 0.00 ? 43  PRO A CG   6  
ATOM 9637  C CD   . PRO A 1 43  ? 10.771  9.043   2.228   1.00 0.00 ? 43  PRO A CD   6  
ATOM 9638  H HA   . PRO A 1 43  ? 12.349  9.353   5.014   1.00 0.00 ? 43  PRO A HA   6  
ATOM 9639  H HB2  . PRO A 1 43  ? 11.218  6.904   4.711   1.00 0.00 ? 43  PRO A HB2  6  
ATOM 9640  H HB3  . PRO A 1 43  ? 10.271  8.376   4.959   1.00 0.00 ? 43  PRO A HB3  6  
ATOM 9641  H HG2  . PRO A 1 43  ? 10.878  6.920   2.415   1.00 0.00 ? 43  PRO A HG2  6  
ATOM 9642  H HG3  . PRO A 1 43  ? 9.347   7.631   2.959   1.00 0.00 ? 43  PRO A HG3  6  
ATOM 9643  H HD2  . PRO A 1 43  ? 10.977  8.865   1.183   1.00 0.00 ? 43  PRO A HD2  6  
ATOM 9644  H HD3  . PRO A 1 43  ? 9.972   9.762   2.339   1.00 0.00 ? 43  PRO A HD3  6  
ATOM 9645  N N    . ASP A 1 44  ? 13.916  7.280   5.148   1.00 0.00 ? 44  ASP A N    6  
ATOM 9646  C CA   . ASP A 1 44  ? 15.079  6.400   5.159   1.00 0.00 ? 44  ASP A CA   6  
ATOM 9647  C C    . ASP A 1 44  ? 14.657  4.945   5.342   1.00 0.00 ? 44  ASP A C    6  
ATOM 9648  O O    . ASP A 1 44  ? 15.389  4.026   4.975   1.00 0.00 ? 44  ASP A O    6  
ATOM 9649  C CB   . ASP A 1 44  ? 16.043  6.808   6.274   1.00 0.00 ? 44  ASP A CB   6  
ATOM 9650  C CG   . ASP A 1 44  ? 16.863  8.030   5.911   1.00 0.00 ? 44  ASP A CG   6  
ATOM 9651  O OD1  . ASP A 1 44  ? 17.594  7.975   4.900   1.00 0.00 ? 44  ASP A OD1  6  
ATOM 9652  O OD2  . ASP A 1 44  ? 16.775  9.042   6.639   1.00 0.00 ? 44  ASP A OD2  6  
ATOM 9653  H H    . ASP A 1 44  ? 13.461  7.482   5.992   1.00 0.00 ? 44  ASP A H    6  
ATOM 9654  H HA   . ASP A 1 44  ? 15.580  6.499   4.208   1.00 0.00 ? 44  ASP A HA   6  
ATOM 9655  H HB2  . ASP A 1 44  ? 15.477  7.030   7.168   1.00 0.00 ? 44  ASP A HB2  6  
ATOM 9656  H HB3  . ASP A 1 44  ? 16.718  5.989   6.474   1.00 0.00 ? 44  ASP A HB3  6  
ATOM 9657  N N    . ARG A 1 45  ? 13.474  4.744   5.912   1.00 0.00 ? 45  ARG A N    6  
ATOM 9658  C CA   . ARG A 1 45  ? 12.956  3.401   6.145   1.00 0.00 ? 45  ARG A CA   6  
ATOM 9659  C C    . ARG A 1 45  ? 11.446  3.355   5.926   1.00 0.00 ? 45  ARG A C    6  
ATOM 9660  O O    . ARG A 1 45  ? 10.751  4.353   6.117   1.00 0.00 ? 45  ARG A O    6  
ATOM 9661  C CB   . ARG A 1 45  ? 13.290  2.943   7.566   1.00 0.00 ? 45  ARG A CB   6  
ATOM 9662  C CG   . ARG A 1 45  ? 12.467  1.752   8.031   1.00 0.00 ? 45  ARG A CG   6  
ATOM 9663  C CD   . ARG A 1 45  ? 12.793  1.377   9.468   1.00 0.00 ? 45  ARG A CD   6  
ATOM 9664  N NE   . ARG A 1 45  ? 12.118  2.246   10.427  1.00 0.00 ? 45  ARG A NE   6  
ATOM 9665  C CZ   . ARG A 1 45  ? 11.873  1.901   11.686  1.00 0.00 ? 45  ARG A CZ   6  
ATOM 9666  N NH1  . ARG A 1 45  ? 12.246  0.711   12.136  1.00 0.00 ? 45  ARG A NH1  6  
ATOM 9667  N NH2  . ARG A 1 45  ? 11.253  2.747   12.499  1.00 0.00 ? 45  ARG A NH2  6  
ATOM 9668  H H    . ARG A 1 45  ? 12.936  5.517   6.183   1.00 0.00 ? 45  ARG A H    6  
ATOM 9669  H HA   . ARG A 1 45  ? 13.431  2.735   5.440   1.00 0.00 ? 45  ARG A HA   6  
ATOM 9670  H HB2  . ARG A 1 45  ? 14.334  2.669   7.607   1.00 0.00 ? 45  ARG A HB2  6  
ATOM 9671  H HB3  . ARG A 1 45  ? 13.114  3.762   8.246   1.00 0.00 ? 45  ARG A HB3  6  
ATOM 9672  H HG2  . ARG A 1 45  ? 11.419  2.003   7.965   1.00 0.00 ? 45  ARG A HG2  6  
ATOM 9673  H HG3  . ARG A 1 45  ? 12.678  0.909   7.391   1.00 0.00 ? 45  ARG A HG3  6  
ATOM 9674  H HD2  . ARG A 1 45  ? 12.482  0.357   9.639   1.00 0.00 ? 45  ARG A HD2  6  
ATOM 9675  H HD3  . ARG A 1 45  ? 13.860  1.456   9.613   1.00 0.00 ? 45  ARG A HD3  6  
ATOM 9676  H HE   . ARG A 1 45  ? 11.833  3.131   10.117  1.00 0.00 ? 45  ARG A HE   6  
ATOM 9677  H HH11 . ARG A 1 45  ? 12.714  0.071   11.526  1.00 0.00 ? 45  ARG A HH11 6  
ATOM 9678  H HH12 . ARG A 1 45  ? 12.061  0.453   13.084  1.00 0.00 ? 45  ARG A HH12 6  
ATOM 9679  H HH21 . ARG A 1 45  ? 10.970  3.645   12.164  1.00 0.00 ? 45  ARG A HH21 6  
ATOM 9680  H HH22 . ARG A 1 45  ? 11.069  2.486   13.446  1.00 0.00 ? 45  ARG A HH22 6  
ATOM 9681  N N    . ILE A 1 46  ? 10.948  2.191   5.524   1.00 0.00 ? 46  ILE A N    6  
ATOM 9682  C CA   . ILE A 1 46  ? 9.522   2.015   5.280   1.00 0.00 ? 46  ILE A CA   6  
ATOM 9683  C C    . ILE A 1 46  ? 9.096   0.572   5.527   1.00 0.00 ? 46  ILE A C    6  
ATOM 9684  O O    . ILE A 1 46  ? 9.842   -0.364  5.241   1.00 0.00 ? 46  ILE A O    6  
ATOM 9685  C CB   . ILE A 1 46  ? 9.144   2.410   3.840   1.00 0.00 ? 46  ILE A CB   6  
ATOM 9686  C CG1  . ILE A 1 46  ? 9.510   3.872   3.577   1.00 0.00 ? 46  ILE A CG1  6  
ATOM 9687  C CG2  . ILE A 1 46  ? 7.660   2.178   3.599   1.00 0.00 ? 46  ILE A CG2  6  
ATOM 9688  C CD1  . ILE A 1 46  ? 9.326   4.291   2.135   1.00 0.00 ? 46  ILE A CD1  6  
ATOM 9689  H H    . ILE A 1 46  ? 11.553  1.432   5.389   1.00 0.00 ? 46  ILE A H    6  
ATOM 9690  H HA   . ILE A 1 46  ? 8.985   2.659   5.961   1.00 0.00 ? 46  ILE A HA   6  
ATOM 9691  H HB   . ILE A 1 46  ? 9.698   1.780   3.160   1.00 0.00 ? 46  ILE A HB   6  
ATOM 9692  H HG12 . ILE A 1 46  ? 8.889   4.508   4.188   1.00 0.00 ? 46  ILE A HG12 6  
ATOM 9693  H HG13 . ILE A 1 46  ? 10.546  4.029   3.839   1.00 0.00 ? 46  ILE A HG13 6  
ATOM 9694  H HG21 . ILE A 1 46  ? 7.086   2.866   4.202   1.00 0.00 ? 46  ILE A HG21 6  
ATOM 9695  H HG22 . ILE A 1 46  ? 7.435   2.342   2.555   1.00 0.00 ? 46  ILE A HG22 6  
ATOM 9696  H HG23 . ILE A 1 46  ? 7.406   1.164   3.867   1.00 0.00 ? 46  ILE A HG23 6  
ATOM 9697  H HD11 . ILE A 1 46  ? 10.293  4.416   1.670   1.00 0.00 ? 46  ILE A HD11 6  
ATOM 9698  H HD12 . ILE A 1 46  ? 8.767   3.533   1.608   1.00 0.00 ? 46  ILE A HD12 6  
ATOM 9699  H HD13 . ILE A 1 46  ? 8.787   5.227   2.098   1.00 0.00 ? 46  ILE A HD13 6  
ATOM 9700  N N    . ALA A 1 47  ? 7.890   0.399   6.058   1.00 0.00 ? 47  ALA A N    6  
ATOM 9701  C CA   . ALA A 1 47  ? 7.362   -0.930  6.340   1.00 0.00 ? 47  ALA A CA   6  
ATOM 9702  C C    . ALA A 1 47  ? 5.882   -1.020  5.985   1.00 0.00 ? 47  ALA A C    6  
ATOM 9703  O O    . ALA A 1 47  ? 5.132   -0.059  6.162   1.00 0.00 ? 47  ALA A O    6  
ATOM 9704  C CB   . ALA A 1 47  ? 7.578   -1.284  7.804   1.00 0.00 ? 47  ALA A CB   6  
ATOM 9705  H H    . ALA A 1 47  ? 7.341   1.185   6.264   1.00 0.00 ? 47  ALA A H    6  
ATOM 9706  H HA   . ALA A 1 47  ? 7.910   -1.641  5.739   1.00 0.00 ? 47  ALA A HA   6  
ATOM 9707  H HB1  . ALA A 1 47  ? 8.157   -0.506  8.280   1.00 0.00 ? 47  ALA A HB1  6  
ATOM 9708  H HB2  . ALA A 1 47  ? 6.622   -1.375  8.297   1.00 0.00 ? 47  ALA A HB2  6  
ATOM 9709  H HB3  . ALA A 1 47  ? 8.110   -2.221  7.873   1.00 0.00 ? 47  ALA A HB3  6  
ATOM 9710  N N    . TRP A 1 48  ? 5.468   -2.178  5.484   1.00 0.00 ? 48  TRP A N    6  
ATOM 9711  C CA   . TRP A 1 48  ? 4.076   -2.392  5.103   1.00 0.00 ? 48  TRP A CA   6  
ATOM 9712  C C    . TRP A 1 48  ? 3.378   -3.319  6.091   1.00 0.00 ? 48  TRP A C    6  
ATOM 9713  O O    . TRP A 1 48  ? 3.459   -4.542  5.973   1.00 0.00 ? 48  TRP A O    6  
ATOM 9714  C CB   . TRP A 1 48  ? 3.996   -2.976  3.692   1.00 0.00 ? 48  TRP A CB   6  
ATOM 9715  C CG   . TRP A 1 48  ? 3.989   -1.933  2.616   1.00 0.00 ? 48  TRP A CG   6  
ATOM 9716  C CD1  . TRP A 1 48  ? 5.078   -1.366  2.017   1.00 0.00 ? 48  TRP A CD1  6  
ATOM 9717  C CD2  . TRP A 1 48  ? 2.838   -1.331  2.014   1.00 0.00 ? 48  TRP A CD2  6  
ATOM 9718  N NE1  . TRP A 1 48  ? 4.673   -0.448  1.078   1.00 0.00 ? 48  TRP A NE1  6  
ATOM 9719  C CE2  . TRP A 1 48  ? 3.304   -0.408  1.057   1.00 0.00 ? 48  TRP A CE2  6  
ATOM 9720  C CE3  . TRP A 1 48  ? 1.460   -1.482  2.188   1.00 0.00 ? 48  TRP A CE3  6  
ATOM 9721  C CZ2  . TRP A 1 48  ? 2.439   0.358   0.280   1.00 0.00 ? 48  TRP A CZ2  6  
ATOM 9722  C CZ3  . TRP A 1 48  ? 0.603   -0.721  1.417   1.00 0.00 ? 48  TRP A CZ3  6  
ATOM 9723  C CH2  . TRP A 1 48  ? 1.095   0.189   0.472   1.00 0.00 ? 48  TRP A CH2  6  
ATOM 9724  H H    . TRP A 1 48  ? 6.113   -2.906  5.366   1.00 0.00 ? 48  TRP A H    6  
ATOM 9725  H HA   . TRP A 1 48  ? 3.579   -1.433  5.114   1.00 0.00 ? 48  TRP A HA   6  
ATOM 9726  H HB2  . TRP A 1 48  ? 4.847   -3.620  3.527   1.00 0.00 ? 48  TRP A HB2  6  
ATOM 9727  H HB3  . TRP A 1 48  ? 3.088   -3.556  3.601   1.00 0.00 ? 48  TRP A HB3  6  
ATOM 9728  H HD1  . TRP A 1 48  ? 6.101   -1.612  2.257   1.00 0.00 ? 48  TRP A HD1  6  
ATOM 9729  H HE1  . TRP A 1 48  ? 5.268   0.090   0.515   1.00 0.00 ? 48  TRP A HE1  6  
ATOM 9730  H HE3  . TRP A 1 48  ? 1.062   -2.179  2.912   1.00 0.00 ? 48  TRP A HE3  6  
ATOM 9731  H HZ2  . TRP A 1 48  ? 2.802   1.064   -0.453  1.00 0.00 ? 48  TRP A HZ2  6  
ATOM 9732  H HZ3  . TRP A 1 48  ? -0.465  -0.824  1.538   1.00 0.00 ? 48  TRP A HZ3  6  
ATOM 9733  H HH2  . TRP A 1 48  ? 0.389   0.764   -0.108  1.00 0.00 ? 48  TRP A HH2  6  
ATOM 9734  N N    . SER A 1 49  ? 2.693   -2.731  7.066   1.00 0.00 ? 49  SER A N    6  
ATOM 9735  C CA   . SER A 1 49  ? 1.983   -3.505  8.077   1.00 0.00 ? 49  SER A CA   6  
ATOM 9736  C C    . SER A 1 49  ? 0.482   -3.238  8.013   1.00 0.00 ? 49  SER A C    6  
ATOM 9737  O O    . SER A 1 49  ? 0.047   -2.088  7.973   1.00 0.00 ? 49  SER A O    6  
ATOM 9738  C CB   . SER A 1 49  ? 2.513   -3.169  9.473   1.00 0.00 ? 49  SER A CB   6  
ATOM 9739  O OG   . SER A 1 49  ? 2.251   -1.816  9.805   1.00 0.00 ? 49  SER A OG   6  
ATOM 9740  H H    . SER A 1 49  ? 2.666   -1.752  7.107   1.00 0.00 ? 49  SER A H    6  
ATOM 9741  H HA   . SER A 1 49  ? 2.159   -4.552  7.877   1.00 0.00 ? 49  SER A HA   6  
ATOM 9742  H HB2  . SER A 1 49  ? 2.032   -3.805  10.200  1.00 0.00 ? 49  SER A HB2  6  
ATOM 9743  H HB3  . SER A 1 49  ? 3.580   -3.334  9.499   1.00 0.00 ? 49  SER A HB3  6  
ATOM 9744  H HG   . SER A 1 49  ? 1.667   -1.781  10.566  1.00 0.00 ? 49  SER A HG   6  
ATOM 9745  N N    . TRP A 1 50  ? -0.303  -4.309  8.002   1.00 0.00 ? 50  TRP A N    6  
ATOM 9746  C CA   . TRP A 1 50  ? -1.755  -4.192  7.942   1.00 0.00 ? 50  TRP A CA   6  
ATOM 9747  C C    . TRP A 1 50  ? -2.383  -4.508  9.295   1.00 0.00 ? 50  TRP A C    6  
ATOM 9748  O O    . TRP A 1 50  ? -2.852  -3.612  9.998   1.00 0.00 ? 50  TRP A O    6  
ATOM 9749  C CB   . TRP A 1 50  ? -2.319  -5.128  6.872   1.00 0.00 ? 50  TRP A CB   6  
ATOM 9750  C CG   . TRP A 1 50  ? -1.501  -6.368  6.677   1.00 0.00 ? 50  TRP A CG   6  
ATOM 9751  C CD1  . TRP A 1 50  ? -1.787  -7.620  7.141   1.00 0.00 ? 50  TRP A CD1  6  
ATOM 9752  C CD2  . TRP A 1 50  ? -0.262  -6.474  5.967   1.00 0.00 ? 50  TRP A CD2  6  
ATOM 9753  N NE1  . TRP A 1 50  ? -0.800  -8.499  6.763   1.00 0.00 ? 50  TRP A NE1  6  
ATOM 9754  C CE2  . TRP A 1 50  ? 0.146   -7.821  6.041   1.00 0.00 ? 50  TRP A CE2  6  
ATOM 9755  C CE3  . TRP A 1 50  ? 0.541   -5.564  5.275   1.00 0.00 ? 50  TRP A CE3  6  
ATOM 9756  C CZ2  . TRP A 1 50  ? 1.322   -8.275  5.450   1.00 0.00 ? 50  TRP A CZ2  6  
ATOM 9757  C CZ3  . TRP A 1 50  ? 1.708   -6.017  4.689   1.00 0.00 ? 50  TRP A CZ3  6  
ATOM 9758  C CH2  . TRP A 1 50  ? 2.089   -7.362  4.778   1.00 0.00 ? 50  TRP A CH2  6  
ATOM 9759  H H    . TRP A 1 50  ? 0.104   -5.201  8.035   1.00 0.00 ? 50  TRP A H    6  
ATOM 9760  H HA   . TRP A 1 50  ? -1.993  -3.172  7.677   1.00 0.00 ? 50  TRP A HA   6  
ATOM 9761  H HB2  . TRP A 1 50  ? -3.317  -5.428  7.155   1.00 0.00 ? 50  TRP A HB2  6  
ATOM 9762  H HB3  . TRP A 1 50  ? -2.360  -4.602  5.929   1.00 0.00 ? 50  TRP A HB3  6  
ATOM 9763  H HD1  . TRP A 1 50  ? -2.662  -7.869  7.721   1.00 0.00 ? 50  TRP A HD1  6  
ATOM 9764  H HE1  . TRP A 1 50  ? -0.779  -9.456  6.974   1.00 0.00 ? 50  TRP A HE1  6  
ATOM 9765  H HE3  . TRP A 1 50  ? 0.264   -4.523  5.195   1.00 0.00 ? 50  TRP A HE3  6  
ATOM 9766  H HZ2  . TRP A 1 50  ? 1.630   -9.309  5.509   1.00 0.00 ? 50  TRP A HZ2  6  
ATOM 9767  H HZ3  . TRP A 1 50  ? 2.342   -5.327  4.150   1.00 0.00 ? 50  TRP A HZ3  6  
ATOM 9768  H HH2  . TRP A 1 50  ? 3.009   -7.671  4.306   1.00 0.00 ? 50  TRP A HH2  6  
ATOM 9769  N N    . LYS A 1 51  ? -2.391  -5.787  9.654   1.00 0.00 ? 51  LYS A N    6  
ATOM 9770  C CA   . LYS A 1 51  ? -2.960  -6.222  10.924  1.00 0.00 ? 51  LYS A CA   6  
ATOM 9771  C C    . LYS A 1 51  ? -1.862  -6.497  11.947  1.00 0.00 ? 51  LYS A C    6  
ATOM 9772  O O    . LYS A 1 51  ? -1.676  -5.731  12.891  1.00 0.00 ? 51  LYS A O    6  
ATOM 9773  C CB   . LYS A 1 51  ? -3.810  -7.479  10.722  1.00 0.00 ? 51  LYS A CB   6  
ATOM 9774  C CG   . LYS A 1 51  ? -4.994  -7.269  9.793   1.00 0.00 ? 51  LYS A CG   6  
ATOM 9775  C CD   . LYS A 1 51  ? -6.204  -6.739  10.544  1.00 0.00 ? 51  LYS A CD   6  
ATOM 9776  C CE   . LYS A 1 51  ? -6.782  -7.788  11.481  1.00 0.00 ? 51  LYS A CE   6  
ATOM 9777  N NZ   . LYS A 1 51  ? -6.171  -7.718  12.837  1.00 0.00 ? 51  LYS A NZ   6  
ATOM 9778  H H    . LYS A 1 51  ? -2.002  -6.455  9.051   1.00 0.00 ? 51  LYS A H    6  
ATOM 9779  H HA   . LYS A 1 51  ? -3.590  -5.428  11.295  1.00 0.00 ? 51  LYS A HA   6  
ATOM 9780  H HB2  . LYS A 1 51  ? -3.187  -8.257  10.307  1.00 0.00 ? 51  LYS A HB2  6  
ATOM 9781  H HB3  . LYS A 1 51  ? -4.185  -7.803  11.681  1.00 0.00 ? 51  LYS A HB3  6  
ATOM 9782  H HG2  . LYS A 1 51  ? -4.718  -6.559  9.028   1.00 0.00 ? 51  LYS A HG2  6  
ATOM 9783  H HG3  . LYS A 1 51  ? -5.251  -8.213  9.334   1.00 0.00 ? 51  LYS A HG3  6  
ATOM 9784  H HD2  . LYS A 1 51  ? -5.908  -5.878  11.125  1.00 0.00 ? 51  LYS A HD2  6  
ATOM 9785  H HD3  . LYS A 1 51  ? -6.962  -6.450  9.829   1.00 0.00 ? 51  LYS A HD3  6  
ATOM 9786  H HE2  . LYS A 1 51  ? -7.846  -7.629  11.566  1.00 0.00 ? 51  LYS A HE2  6  
ATOM 9787  H HE3  . LYS A 1 51  ? -6.598  -8.767  11.062  1.00 0.00 ? 51  LYS A HE3  6  
ATOM 9788  H HZ1  . LYS A 1 51  ? -6.901  -7.855  13.565  1.00 0.00 ? 51  LYS A HZ1  6  
ATOM 9789  H HZ2  . LYS A 1 51  ? -5.725  -6.790  12.980  1.00 0.00 ? 51  LYS A HZ2  6  
ATOM 9790  H HZ3  . LYS A 1 51  ? -5.448  -8.459  12.942  1.00 0.00 ? 51  LYS A HZ3  6  
ATOM 9791  N N    . GLU A 1 52  ? -1.139  -7.595  11.751  1.00 0.00 ? 52  GLU A N    6  
ATOM 9792  C CA   . GLU A 1 52  ? -0.059  -7.970  12.657  1.00 0.00 ? 52  GLU A CA   6  
ATOM 9793  C C    . GLU A 1 52  ? 1.247   -8.167  11.894  1.00 0.00 ? 52  GLU A C    6  
ATOM 9794  O O    . GLU A 1 52  ? 2.333   -8.057  12.463  1.00 0.00 ? 52  GLU A O    6  
ATOM 9795  C CB   . GLU A 1 52  ? -0.419  -9.251  13.413  1.00 0.00 ? 52  GLU A CB   6  
ATOM 9796  C CG   . GLU A 1 52  ? -1.537  -9.066  14.425  1.00 0.00 ? 52  GLU A CG   6  
ATOM 9797  C CD   . GLU A 1 52  ? -1.492  -10.095 15.538  1.00 0.00 ? 52  GLU A CD   6  
ATOM 9798  O OE1  . GLU A 1 52  ? -0.513  -10.085 16.315  1.00 0.00 ? 52  GLU A OE1  6  
ATOM 9799  O OE2  . GLU A 1 52  ? -2.433  -10.909 15.633  1.00 0.00 ? 52  GLU A OE2  6  
ATOM 9800  H H    . GLU A 1 52  ? -1.336  -8.167  10.980  1.00 0.00 ? 52  GLU A H    6  
ATOM 9801  H HA   . GLU A 1 52  ? 0.070   -7.168  13.368  1.00 0.00 ? 52  GLU A HA   6  
ATOM 9802  H HB2  . GLU A 1 52  ? -0.727  -10.001 12.699  1.00 0.00 ? 52  GLU A HB2  6  
ATOM 9803  H HB3  . GLU A 1 52  ? 0.457   -9.603  13.936  1.00 0.00 ? 52  GLU A HB3  6  
ATOM 9804  H HG2  . GLU A 1 52  ? -1.452  -8.082  14.862  1.00 0.00 ? 52  GLU A HG2  6  
ATOM 9805  H HG3  . GLU A 1 52  ? -2.485  -9.151  13.915  1.00 0.00 ? 52  GLU A HG3  6  
ATOM 9806  N N    . ASN A 1 53  ? 1.134   -8.458  10.602  1.00 0.00 ? 53  ASN A N    6  
ATOM 9807  C CA   . ASN A 1 53  ? 2.306   -8.672  9.761   1.00 0.00 ? 53  ASN A CA   6  
ATOM 9808  C C    . ASN A 1 53  ? 2.996   -7.349  9.443   1.00 0.00 ? 53  ASN A C    6  
ATOM 9809  O O    . ASN A 1 53  ? 2.392   -6.281  9.546   1.00 0.00 ? 53  ASN A O    6  
ATOM 9810  C CB   . ASN A 1 53  ? 1.906   -9.376  8.463   1.00 0.00 ? 53  ASN A CB   6  
ATOM 9811  C CG   . ASN A 1 53  ? 1.440   -10.800 8.697   1.00 0.00 ? 53  ASN A CG   6  
ATOM 9812  O OD1  . ASN A 1 53  ? 2.192   -11.753 8.494   1.00 0.00 ? 53  ASN A OD1  6  
ATOM 9813  N ND2  . ASN A 1 53  ? 0.192   -10.951 9.127   1.00 0.00 ? 53  ASN A ND2  6  
ATOM 9814  H H    . ASN A 1 53  ? 0.241   -8.533  10.206  1.00 0.00 ? 53  ASN A H    6  
ATOM 9815  H HA   . ASN A 1 53  ? 2.993   -9.302  10.305  1.00 0.00 ? 53  ASN A HA   6  
ATOM 9816  H HB2  . ASN A 1 53  ? 1.101   -8.827  7.996   1.00 0.00 ? 53  ASN A HB2  6  
ATOM 9817  H HB3  . ASN A 1 53  ? 2.755   -9.399  7.796   1.00 0.00 ? 53  ASN A HB3  6  
ATOM 9818  H HD21 . ASN A 1 53  ? -0.350  -10.146 9.267   1.00 0.00 ? 53  ASN A HD21 6  
ATOM 9819  H HD22 . ASN A 1 53  ? -0.135  -11.861 9.287   1.00 0.00 ? 53  ASN A HD22 6  
ATOM 9820  N N    . VAL A 1 54  ? 4.265   -7.428  9.056   1.00 0.00 ? 54  VAL A N    6  
ATOM 9821  C CA   . VAL A 1 54  ? 5.037   -6.237  8.722   1.00 0.00 ? 54  VAL A CA   6  
ATOM 9822  C C    . VAL A 1 54  ? 6.129   -6.558  7.707   1.00 0.00 ? 54  VAL A C    6  
ATOM 9823  O O    . VAL A 1 54  ? 7.034   -7.348  7.981   1.00 0.00 ? 54  VAL A O    6  
ATOM 9824  C CB   . VAL A 1 54  ? 5.683   -5.616  9.975   1.00 0.00 ? 54  VAL A CB   6  
ATOM 9825  C CG1  . VAL A 1 54  ? 6.357   -4.297  9.631   1.00 0.00 ? 54  VAL A CG1  6  
ATOM 9826  C CG2  . VAL A 1 54  ? 4.644   -5.424  11.069  1.00 0.00 ? 54  VAL A CG2  6  
ATOM 9827  H H    . VAL A 1 54  ? 4.692   -8.307  8.994   1.00 0.00 ? 54  VAL A H    6  
ATOM 9828  H HA   . VAL A 1 54  ? 4.362   -5.511  8.293   1.00 0.00 ? 54  VAL A HA   6  
ATOM 9829  H HB   . VAL A 1 54  ? 6.438   -6.296  10.341  1.00 0.00 ? 54  VAL A HB   6  
ATOM 9830  H HG11 . VAL A 1 54  ? 7.429   -4.412  9.700   1.00 0.00 ? 54  VAL A HG11 6  
ATOM 9831  H HG12 . VAL A 1 54  ? 6.088   -4.006  8.626   1.00 0.00 ? 54  VAL A HG12 6  
ATOM 9832  H HG13 . VAL A 1 54  ? 6.033   -3.535  10.325  1.00 0.00 ? 54  VAL A HG13 6  
ATOM 9833  H HG21 . VAL A 1 54  ? 4.376   -6.384  11.484  1.00 0.00 ? 54  VAL A HG21 6  
ATOM 9834  H HG22 . VAL A 1 54  ? 5.052   -4.797  11.849  1.00 0.00 ? 54  VAL A HG22 6  
ATOM 9835  H HG23 . VAL A 1 54  ? 3.765   -4.953  10.653  1.00 0.00 ? 54  VAL A HG23 6  
ATOM 9836  N N    . LEU A 1 55  ? 6.039   -5.939  6.535   1.00 0.00 ? 55  LEU A N    6  
ATOM 9837  C CA   . LEU A 1 55  ? 7.020   -6.158  5.478   1.00 0.00 ? 55  LEU A CA   6  
ATOM 9838  C C    . LEU A 1 55  ? 7.853   -4.902  5.239   1.00 0.00 ? 55  LEU A C    6  
ATOM 9839  O O    . LEU A 1 55  ? 7.383   -3.942  4.630   1.00 0.00 ? 55  LEU A O    6  
ATOM 9840  C CB   . LEU A 1 55  ? 6.320   -6.573  4.183   1.00 0.00 ? 55  LEU A CB   6  
ATOM 9841  C CG   . LEU A 1 55  ? 7.207   -7.215  3.115   1.00 0.00 ? 55  LEU A CG   6  
ATOM 9842  C CD1  . LEU A 1 55  ? 7.901   -8.449  3.670   1.00 0.00 ? 55  LEU A CD1  6  
ATOM 9843  C CD2  . LEU A 1 55  ? 6.387   -7.570  1.883   1.00 0.00 ? 55  LEU A CD2  6  
ATOM 9844  H H    . LEU A 1 55  ? 5.296   -5.321  6.376   1.00 0.00 ? 55  LEU A H    6  
ATOM 9845  H HA   . LEU A 1 55  ? 7.676   -6.955  5.794   1.00 0.00 ? 55  LEU A HA   6  
ATOM 9846  H HB2  . LEU A 1 55  ? 5.545   -7.279  4.437   1.00 0.00 ? 55  LEU A HB2  6  
ATOM 9847  H HB3  . LEU A 1 55  ? 5.870   -5.688  3.753   1.00 0.00 ? 55  LEU A HB3  6  
ATOM 9848  H HG   . LEU A 1 55  ? 7.970   -6.508  2.818   1.00 0.00 ? 55  LEU A HG   6  
ATOM 9849  H HD11 . LEU A 1 55  ? 8.382   -8.983  2.865   1.00 0.00 ? 55  LEU A HD11 6  
ATOM 9850  H HD12 . LEU A 1 55  ? 7.171   -9.090  4.142   1.00 0.00 ? 55  LEU A HD12 6  
ATOM 9851  H HD13 . LEU A 1 55  ? 8.641   -8.149  4.398   1.00 0.00 ? 55  LEU A HD13 6  
ATOM 9852  H HD21 . LEU A 1 55  ? 5.370   -7.232  2.019   1.00 0.00 ? 55  LEU A HD21 6  
ATOM 9853  H HD22 . LEU A 1 55  ? 6.395   -8.641  1.743   1.00 0.00 ? 55  LEU A HD22 6  
ATOM 9854  H HD23 . LEU A 1 55  ? 6.814   -7.089  1.016   1.00 0.00 ? 55  LEU A HD23 6  
ATOM 9855  N N    . GLU A 1 56  ? 9.091   -4.919  5.722   1.00 0.00 ? 56  GLU A N    6  
ATOM 9856  C CA   . GLU A 1 56  ? 9.989   -3.781  5.560   1.00 0.00 ? 56  GLU A CA   6  
ATOM 9857  C C    . GLU A 1 56  ? 10.400  -3.616  4.099   1.00 0.00 ? 56  GLU A C    6  
ATOM 9858  O O    . GLU A 1 56  ? 10.262  -2.538  3.523   1.00 0.00 ? 56  GLU A O    6  
ATOM 9859  C CB   . GLU A 1 56  ? 11.232  -3.956  6.434   1.00 0.00 ? 56  GLU A CB   6  
ATOM 9860  C CG   . GLU A 1 56  ? 10.995  -3.635  7.900   1.00 0.00 ? 56  GLU A CG   6  
ATOM 9861  C CD   . GLU A 1 56  ? 12.268  -3.689  8.723   1.00 0.00 ? 56  GLU A CD   6  
ATOM 9862  O OE1  . GLU A 1 56  ? 13.346  -3.389  8.167   1.00 0.00 ? 56  GLU A OE1  6  
ATOM 9863  O OE2  . GLU A 1 56  ? 12.188  -4.033  9.920   1.00 0.00 ? 56  GLU A OE2  6  
ATOM 9864  H H    . GLU A 1 56  ? 9.408   -5.714  6.199   1.00 0.00 ? 56  GLU A H    6  
ATOM 9865  H HA   . GLU A 1 56  ? 9.461   -2.894  5.875   1.00 0.00 ? 56  GLU A HA   6  
ATOM 9866  H HB2  . GLU A 1 56  ? 11.569  -4.979  6.360   1.00 0.00 ? 56  GLU A HB2  6  
ATOM 9867  H HB3  . GLU A 1 56  ? 12.010  -3.303  6.066   1.00 0.00 ? 56  GLU A HB3  6  
ATOM 9868  H HG2  . GLU A 1 56  ? 10.579  -2.642  7.976   1.00 0.00 ? 56  GLU A HG2  6  
ATOM 9869  H HG3  . GLU A 1 56  ? 10.293  -4.350  8.303   1.00 0.00 ? 56  GLU A HG3  6  
ATOM 9870  N N    . SER A 1 57  ? 10.905  -4.694  3.508   1.00 0.00 ? 57  SER A N    6  
ATOM 9871  C CA   . SER A 1 57  ? 11.340  -4.669  2.116   1.00 0.00 ? 57  SER A CA   6  
ATOM 9872  C C    . SER A 1 57  ? 11.623  -6.080  1.610   1.00 0.00 ? 57  SER A C    6  
ATOM 9873  O O    . SER A 1 57  ? 11.822  -7.005  2.395   1.00 0.00 ? 57  SER A O    6  
ATOM 9874  C CB   . SER A 1 57  ? 12.591  -3.801  1.967   1.00 0.00 ? 57  SER A CB   6  
ATOM 9875  O OG   . SER A 1 57  ? 12.645  -3.199  0.685   1.00 0.00 ? 57  SER A OG   6  
ATOM 9876  H H    . SER A 1 57  ? 10.989  -5.525  4.021   1.00 0.00 ? 57  SER A H    6  
ATOM 9877  H HA   . SER A 1 57  ? 10.543  -4.240  1.527   1.00 0.00 ? 57  SER A HA   6  
ATOM 9878  H HB2  . SER A 1 57  ? 12.579  -3.024  2.716   1.00 0.00 ? 57  SER A HB2  6  
ATOM 9879  H HB3  . SER A 1 57  ? 13.470  -4.415  2.100   1.00 0.00 ? 57  SER A HB3  6  
ATOM 9880  H HG   . SER A 1 57  ? 13.285  -3.663  0.140   1.00 0.00 ? 57  SER A HG   6  
ATOM 9881  N N    . GLY A 1 58  ? 11.638  -6.236  0.289   1.00 0.00 ? 58  GLY A N    6  
ATOM 9882  C CA   . GLY A 1 58  ? 11.896  -7.536  -0.301  1.00 0.00 ? 58  GLY A CA   6  
ATOM 9883  C C    . GLY A 1 58  ? 10.641  -8.378  -0.422  1.00 0.00 ? 58  GLY A C    6  
ATOM 9884  O O    . GLY A 1 58  ? 9.530   -7.882  -0.230  1.00 0.00 ? 58  GLY A O    6  
ATOM 9885  H H    . GLY A 1 58  ? 11.472  -5.462  -0.289  1.00 0.00 ? 58  GLY A H    6  
ATOM 9886  H HA2  . GLY A 1 58  ? 12.319  -7.395  -1.285  1.00 0.00 ? 58  GLY A HA2  6  
ATOM 9887  H HA3  . GLY A 1 58  ? 12.611  -8.063  0.315   1.00 0.00 ? 58  GLY A HA3  6  
ATOM 9888  N N    . THR A 1 59  ? 10.817  -9.656  -0.742  1.00 0.00 ? 59  THR A N    6  
ATOM 9889  C CA   . THR A 1 59  ? 9.689   -10.568 -0.891  1.00 0.00 ? 59  THR A CA   6  
ATOM 9890  C C    . THR A 1 59  ? 9.671   -11.607 0.225   1.00 0.00 ? 59  THR A C    6  
ATOM 9891  O O    . THR A 1 59  ? 10.570  -12.443 0.323   1.00 0.00 ? 59  THR A O    6  
ATOM 9892  C CB   . THR A 1 59  ? 9.728   -11.292 -2.250  1.00 0.00 ? 59  THR A CB   6  
ATOM 9893  O OG1  . THR A 1 59  ? 9.897   -10.341 -3.307  1.00 0.00 ? 59  THR A OG1  6  
ATOM 9894  C CG2  . THR A 1 59  ? 8.452   -12.088 -2.476  1.00 0.00 ? 59  THR A CG2  6  
ATOM 9895  H H    . THR A 1 59  ? 11.726  -9.993  -0.882  1.00 0.00 ? 59  THR A H    6  
ATOM 9896  H HA   . THR A 1 59  ? 8.781   -9.986  -0.843  1.00 0.00 ? 59  THR A HA   6  
ATOM 9897  H HB   . THR A 1 59  ? 10.566  -11.975 -2.253  1.00 0.00 ? 59  THR A HB   6  
ATOM 9898  H HG1  . THR A 1 59  ? 9.395   -10.624 -4.075  1.00 0.00 ? 59  THR A HG1  6  
ATOM 9899  H HG21 . THR A 1 59  ? 8.692   -13.025 -2.957  1.00 0.00 ? 59  THR A HG21 6  
ATOM 9900  H HG22 . THR A 1 59  ? 7.781   -11.522 -3.105  1.00 0.00 ? 59  THR A HG22 6  
ATOM 9901  H HG23 . THR A 1 59  ? 7.977   -12.283 -1.526  1.00 0.00 ? 59  THR A HG23 6  
ATOM 9902  N N    . SER A 1 60  ? 8.642   -11.549 1.064   1.00 0.00 ? 60  SER A N    6  
ATOM 9903  C CA   . SER A 1 60  ? 8.509   -12.483 2.176   1.00 0.00 ? 60  SER A CA   6  
ATOM 9904  C C    . SER A 1 60  ? 7.776   -13.748 1.738   1.00 0.00 ? 60  SER A C    6  
ATOM 9905  O O    . SER A 1 60  ? 8.353   -14.834 1.708   1.00 0.00 ? 60  SER A O    6  
ATOM 9906  C CB   . SER A 1 60  ? 7.763   -11.824 3.337   1.00 0.00 ? 60  SER A CB   6  
ATOM 9907  O OG   . SER A 1 60  ? 7.613   -12.723 4.423   1.00 0.00 ? 60  SER A OG   6  
ATOM 9908  H H    . SER A 1 60  ? 7.958   -10.860 0.934   1.00 0.00 ? 60  SER A H    6  
ATOM 9909  H HA   . SER A 1 60  ? 9.502   -12.752 2.504   1.00 0.00 ? 60  SER A HA   6  
ATOM 9910  H HB2  . SER A 1 60  ? 8.316   -10.961 3.674   1.00 0.00 ? 60  SER A HB2  6  
ATOM 9911  H HB3  . SER A 1 60  ? 6.783   -11.516 3.002   1.00 0.00 ? 60  SER A HB3  6  
ATOM 9912  H HG   . SER A 1 60  ? 8.202   -13.471 4.303   1.00 0.00 ? 60  SER A HG   6  
ATOM 9913  N N    . GLY A 1 61  ? 6.500   -13.597 1.398   1.00 0.00 ? 61  GLY A N    6  
ATOM 9914  C CA   . GLY A 1 61  ? 5.708   -14.734 0.966   1.00 0.00 ? 61  GLY A CA   6  
ATOM 9915  C C    . GLY A 1 61  ? 4.818   -14.405 -0.217  1.00 0.00 ? 61  GLY A C    6  
ATOM 9916  O O    . GLY A 1 61  ? 5.141   -14.740 -1.357  1.00 0.00 ? 61  GLY A O    6  
ATOM 9917  H H    . GLY A 1 61  ? 6.092   -12.707 1.441   1.00 0.00 ? 61  GLY A H    6  
ATOM 9918  H HA2  . GLY A 1 61  ? 6.373   -15.538 0.690   1.00 0.00 ? 61  GLY A HA2  6  
ATOM 9919  H HA3  . GLY A 1 61  ? 5.088   -15.059 1.788   1.00 0.00 ? 61  GLY A HA3  6  
ATOM 9920  N N    . ARG A 1 62  ? 3.695   -13.748 0.054   1.00 0.00 ? 62  ARG A N    6  
ATOM 9921  C CA   . ARG A 1 62  ? 2.755   -13.377 -0.996  1.00 0.00 ? 62  ARG A CA   6  
ATOM 9922  C C    . ARG A 1 62  ? 2.724   -11.863 -1.188  1.00 0.00 ? 62  ARG A C    6  
ATOM 9923  O O    . ARG A 1 62  ? 1.833   -11.329 -1.849  1.00 0.00 ? 62  ARG A O    6  
ATOM 9924  C CB   . ARG A 1 62  ? 1.353   -13.888 -0.660  1.00 0.00 ? 62  ARG A CB   6  
ATOM 9925  C CG   . ARG A 1 62  ? 1.259   -15.403 -0.588  1.00 0.00 ? 62  ARG A CG   6  
ATOM 9926  C CD   . ARG A 1 62  ? -0.169  -15.883 -0.801  1.00 0.00 ? 62  ARG A CD   6  
ATOM 9927  N NE   . ARG A 1 62  ? -0.903  -15.993 0.456   1.00 0.00 ? 62  ARG A NE   6  
ATOM 9928  C CZ   . ARG A 1 62  ? -1.528  -14.973 1.034   1.00 0.00 ? 62  ARG A CZ   6  
ATOM 9929  N NH1  . ARG A 1 62  ? -1.507  -13.773 0.469   1.00 0.00 ? 62  ARG A NH1  6  
ATOM 9930  N NH2  . ARG A 1 62  ? -2.175  -15.151 2.178   1.00 0.00 ? 62  ARG A NH2  6  
ATOM 9931  H H    . ARG A 1 62  ? 3.493   -13.508 0.983   1.00 0.00 ? 62  ARG A H    6  
ATOM 9932  H HA   . ARG A 1 62  ? 3.085   -13.837 -1.916  1.00 0.00 ? 62  ARG A HA   6  
ATOM 9933  H HB2  . ARG A 1 62  ? 1.055   -13.485 0.297   1.00 0.00 ? 62  ARG A HB2  6  
ATOM 9934  H HB3  . ARG A 1 62  ? 0.666   -13.542 -1.417  1.00 0.00 ? 62  ARG A HB3  6  
ATOM 9935  H HG2  . ARG A 1 62  ? 1.889   -15.831 -1.353  1.00 0.00 ? 62  ARG A HG2  6  
ATOM 9936  H HG3  . ARG A 1 62  ? 1.597   -15.730 0.384   1.00 0.00 ? 62  ARG A HG3  6  
ATOM 9937  H HD2  . ARG A 1 62  ? -0.678  -15.181 -1.444  1.00 0.00 ? 62  ARG A HD2  6  
ATOM 9938  H HD3  . ARG A 1 62  ? -0.141  -16.852 -1.277  1.00 0.00 ? 62  ARG A HD3  6  
ATOM 9939  H HE   . ARG A 1 62  ? -0.931  -16.871 0.890   1.00 0.00 ? 62  ARG A HE   6  
ATOM 9940  H HH11 . ARG A 1 62  ? -1.021  -13.636 -0.393  1.00 0.00 ? 62  ARG A HH11 6  
ATOM 9941  H HH12 . ARG A 1 62  ? -1.979  -13.007 0.906   1.00 0.00 ? 62  ARG A HH12 6  
ATOM 9942  H HH21 . ARG A 1 62  ? -2.193  -16.054 2.606   1.00 0.00 ? 62  ARG A HH21 6  
ATOM 9943  H HH22 . ARG A 1 62  ? -2.645  -14.383 2.612   1.00 0.00 ? 62  ARG A HH22 6  
ATOM 9944  N N    . TYR A 1 63  ? 3.701   -11.178 -0.605  1.00 0.00 ? 63  TYR A N    6  
ATOM 9945  C CA   . TYR A 1 63  ? 3.784   -9.726  -0.708  1.00 0.00 ? 63  TYR A CA   6  
ATOM 9946  C C    . TYR A 1 63  ? 5.136   -9.296  -1.270  1.00 0.00 ? 63  TYR A C    6  
ATOM 9947  O O    . TYR A 1 63  ? 6.093   -10.071 -1.280  1.00 0.00 ? 63  TYR A O    6  
ATOM 9948  C CB   . TYR A 1 63  ? 3.560   -9.083  0.661   1.00 0.00 ? 63  TYR A CB   6  
ATOM 9949  C CG   . TYR A 1 63  ? 2.162   -9.279  1.201   1.00 0.00 ? 63  TYR A CG   6  
ATOM 9950  C CD1  . TYR A 1 63  ? 1.107   -8.493  0.754   1.00 0.00 ? 63  TYR A CD1  6  
ATOM 9951  C CD2  . TYR A 1 63  ? 1.895   -10.251 2.158   1.00 0.00 ? 63  TYR A CD2  6  
ATOM 9952  C CE1  . TYR A 1 63  ? -0.172  -8.668  1.246   1.00 0.00 ? 63  TYR A CE1  6  
ATOM 9953  C CE2  . TYR A 1 63  ? 0.619   -10.434 2.653   1.00 0.00 ? 63  TYR A CE2  6  
ATOM 9954  C CZ   . TYR A 1 63  ? -0.412  -9.640  2.195   1.00 0.00 ? 63  TYR A CZ   6  
ATOM 9955  O OH   . TYR A 1 63  ? -1.685  -9.818  2.685   1.00 0.00 ? 63  TYR A OH   6  
ATOM 9956  H H    . TYR A 1 63  ? 4.382   -11.660 -0.091  1.00 0.00 ? 63  TYR A H    6  
ATOM 9957  H HA   . TYR A 1 63  ? 3.006   -9.397  -1.381  1.00 0.00 ? 63  TYR A HA   6  
ATOM 9958  H HB2  . TYR A 1 63  ? 4.252   -9.511  1.370   1.00 0.00 ? 63  TYR A HB2  6  
ATOM 9959  H HB3  . TYR A 1 63  ? 3.742   -8.021  0.586   1.00 0.00 ? 63  TYR A HB3  6  
ATOM 9960  H HD1  . TYR A 1 63  ? 1.297   -7.732  0.011   1.00 0.00 ? 63  TYR A HD1  6  
ATOM 9961  H HD2  . TYR A 1 63  ? 2.704   -10.871 2.515   1.00 0.00 ? 63  TYR A HD2  6  
ATOM 9962  H HE1  . TYR A 1 63  ? -0.979  -8.046  0.886   1.00 0.00 ? 63  TYR A HE1  6  
ATOM 9963  H HE2  . TYR A 1 63  ? 0.431   -11.195 3.397   1.00 0.00 ? 63  TYR A HE2  6  
ATOM 9964  H HH   . TYR A 1 63  ? -1.644  -9.967  3.633   1.00 0.00 ? 63  TYR A HH   6  
ATOM 9965  N N    . THR A 1 64  ? 5.207   -8.054  -1.737  1.00 0.00 ? 64  THR A N    6  
ATOM 9966  C CA   . THR A 1 64  ? 6.440   -7.519  -2.301  1.00 0.00 ? 64  THR A CA   6  
ATOM 9967  C C    . THR A 1 64  ? 6.491   -6.001  -2.170  1.00 0.00 ? 64  THR A C    6  
ATOM 9968  O O    . THR A 1 64  ? 5.748   -5.284  -2.840  1.00 0.00 ? 64  THR A O    6  
ATOM 9969  C CB   . THR A 1 64  ? 6.590   -7.900  -3.786  1.00 0.00 ? 64  THR A CB   6  
ATOM 9970  O OG1  . THR A 1 64  ? 6.203   -9.264  -3.983  1.00 0.00 ? 64  THR A OG1  6  
ATOM 9971  C CG2  . THR A 1 64  ? 8.024   -7.701  -4.253  1.00 0.00 ? 64  THR A CG2  6  
ATOM 9972  H H    . THR A 1 64  ? 4.410   -7.484  -1.701  1.00 0.00 ? 64  THR A H    6  
ATOM 9973  H HA   . THR A 1 64  ? 7.269   -7.946  -1.756  1.00 0.00 ? 64  THR A HA   6  
ATOM 9974  H HB   . THR A 1 64  ? 5.944   -7.262  -4.372  1.00 0.00 ? 64  THR A HB   6  
ATOM 9975  H HG1  . THR A 1 64  ? 6.749   -9.834  -3.437  1.00 0.00 ? 64  THR A HG1  6  
ATOM 9976  H HG21 . THR A 1 64  ? 8.131   -8.083  -5.258  1.00 0.00 ? 64  THR A HG21 6  
ATOM 9977  H HG22 . THR A 1 64  ? 8.694   -8.231  -3.593  1.00 0.00 ? 64  THR A HG22 6  
ATOM 9978  H HG23 . THR A 1 64  ? 8.264   -6.649  -4.241  1.00 0.00 ? 64  THR A HG23 6  
ATOM 9979  N N    . VAL A 1 65  ? 7.375   -5.516  -1.303  1.00 0.00 ? 65  VAL A N    6  
ATOM 9980  C CA   . VAL A 1 65  ? 7.525   -4.082  -1.085  1.00 0.00 ? 65  VAL A CA   6  
ATOM 9981  C C    . VAL A 1 65  ? 8.604   -3.499  -1.989  1.00 0.00 ? 65  VAL A C    6  
ATOM 9982  O O    . VAL A 1 65  ? 9.685   -4.069  -2.129  1.00 0.00 ? 65  VAL A O    6  
ATOM 9983  C CB   . VAL A 1 65  ? 7.876   -3.771  0.382   1.00 0.00 ? 65  VAL A CB   6  
ATOM 9984  C CG1  . VAL A 1 65  ? 8.191   -2.293  0.554   1.00 0.00 ? 65  VAL A CG1  6  
ATOM 9985  C CG2  . VAL A 1 65  ? 6.741   -4.194  1.303   1.00 0.00 ? 65  VAL A CG2  6  
ATOM 9986  H H    . VAL A 1 65  ? 7.940   -6.138  -0.798  1.00 0.00 ? 65  VAL A H    6  
ATOM 9987  H HA   . VAL A 1 65  ? 6.581   -3.609  -1.315  1.00 0.00 ? 65  VAL A HA   6  
ATOM 9988  H HB   . VAL A 1 65  ? 8.757   -4.337  0.648   1.00 0.00 ? 65  VAL A HB   6  
ATOM 9989  H HG11 . VAL A 1 65  ? 7.279   -1.719  0.472   1.00 0.00 ? 65  VAL A HG11 6  
ATOM 9990  H HG12 . VAL A 1 65  ? 8.635   -2.130  1.525   1.00 0.00 ? 65  VAL A HG12 6  
ATOM 9991  H HG13 . VAL A 1 65  ? 8.882   -1.981  -0.215  1.00 0.00 ? 65  VAL A HG13 6  
ATOM 9992  H HG21 . VAL A 1 65  ? 5.809   -4.166  0.759   1.00 0.00 ? 65  VAL A HG21 6  
ATOM 9993  H HG22 . VAL A 1 65  ? 6.921   -5.198  1.659   1.00 0.00 ? 65  VAL A HG22 6  
ATOM 9994  H HG23 . VAL A 1 65  ? 6.689   -3.518  2.144   1.00 0.00 ? 65  VAL A HG23 6  
ATOM 9995  N N    . GLU A 1 66  ? 8.303   -2.358  -2.602  1.00 0.00 ? 66  GLU A N    6  
ATOM 9996  C CA   . GLU A 1 66  ? 9.248   -1.698  -3.494  1.00 0.00 ? 66  GLU A CA   6  
ATOM 9997  C C    . GLU A 1 66  ? 9.031   -0.187  -3.495  1.00 0.00 ? 66  GLU A C    6  
ATOM 9998  O O    . GLU A 1 66  ? 7.940   0.295   -3.802  1.00 0.00 ? 66  GLU A O    6  
ATOM 9999  C CB   . GLU A 1 66  ? 9.109   -2.245  -4.916  1.00 0.00 ? 66  GLU A CB   6  
ATOM 10000 C CG   . GLU A 1 66  ? 9.563   -3.688  -5.060  1.00 0.00 ? 66  GLU A CG   6  
ATOM 10001 C CD   . GLU A 1 66  ? 9.635   -4.135  -6.507  1.00 0.00 ? 66  GLU A CD   6  
ATOM 10002 O OE1  . GLU A 1 66  ? 10.012  -3.311  -7.366  1.00 0.00 ? 66  GLU A OE1  6  
ATOM 10003 O OE2  . GLU A 1 66  ? 9.313   -5.311  -6.781  1.00 0.00 ? 66  GLU A OE2  6  
ATOM 10004 H H    . GLU A 1 66  ? 7.424   -1.952  -2.451  1.00 0.00 ? 66  GLU A H    6  
ATOM 10005 H HA   . GLU A 1 66  ? 10.244  -1.906  -3.134  1.00 0.00 ? 66  GLU A HA   6  
ATOM 10006 H HB2  . GLU A 1 66  ? 8.073   -2.184  -5.213  1.00 0.00 ? 66  GLU A HB2  6  
ATOM 10007 H HB3  . GLU A 1 66  ? 9.702   -1.635  -5.582  1.00 0.00 ? 66  GLU A HB3  6  
ATOM 10008 H HG2  . GLU A 1 66  ? 10.543  -3.789  -4.619  1.00 0.00 ? 66  GLU A HG2  6  
ATOM 10009 H HG3  . GLU A 1 66  ? 8.866   -4.325  -4.536  1.00 0.00 ? 66  GLU A HG3  6  
ATOM 10010 N N    . THR A 1 67  ? 10.078  0.555   -3.149  1.00 0.00 ? 67  THR A N    6  
ATOM 10011 C CA   . THR A 1 67  ? 10.003  2.010   -3.108  1.00 0.00 ? 67  THR A CA   6  
ATOM 10012 C C    . THR A 1 67  ? 10.820  2.635   -4.233  1.00 0.00 ? 67  THR A C    6  
ATOM 10013 O O    . THR A 1 67  ? 11.885  2.132   -4.592  1.00 0.00 ? 67  THR A O    6  
ATOM 10014 C CB   . THR A 1 67  ? 10.503  2.561   -1.759  1.00 0.00 ? 67  THR A CB   6  
ATOM 10015 O OG1  . THR A 1 67  ? 9.875   1.859   -0.680  1.00 0.00 ? 67  THR A OG1  6  
ATOM 10016 C CG2  . THR A 1 67  ? 10.212  4.049   -1.640  1.00 0.00 ? 67  THR A CG2  6  
ATOM 10017 H H    . THR A 1 67  ? 10.920  0.113   -2.915  1.00 0.00 ? 67  THR A H    6  
ATOM 10018 H HA   . THR A 1 67  ? 8.967   2.294   -3.227  1.00 0.00 ? 67  THR A HA   6  
ATOM 10019 H HB   . THR A 1 67  ? 11.572  2.412   -1.701  1.00 0.00 ? 67  THR A HB   6  
ATOM 10020 H HG1  . THR A 1 67  ? 9.824   2.433   0.088   1.00 0.00 ? 67  THR A HG1  6  
ATOM 10021 H HG21 . THR A 1 67  ? 9.300   4.281   -2.171  1.00 0.00 ? 67  THR A HG21 6  
ATOM 10022 H HG22 . THR A 1 67  ? 11.030  4.611   -2.066  1.00 0.00 ? 67  THR A HG22 6  
ATOM 10023 H HG23 . THR A 1 67  ? 10.098  4.311   -0.599  1.00 0.00 ? 67  THR A HG23 6  
ATOM 10024 N N    . ILE A 1 68  ? 10.315  3.733   -4.785  1.00 0.00 ? 68  ILE A N    6  
ATOM 10025 C CA   . ILE A 1 68  ? 11.000  4.427   -5.868  1.00 0.00 ? 68  ILE A CA   6  
ATOM 10026 C C    . ILE A 1 68  ? 11.147  5.914   -5.562  1.00 0.00 ? 68  ILE A C    6  
ATOM 10027 O O    . ILE A 1 68  ? 10.479  6.445   -4.675  1.00 0.00 ? 68  ILE A O    6  
ATOM 10028 C CB   . ILE A 1 68  ? 10.253  4.261   -7.204  1.00 0.00 ? 68  ILE A CB   6  
ATOM 10029 C CG1  . ILE A 1 68  ? 9.801   2.810   -7.384  1.00 0.00 ? 68  ILE A CG1  6  
ATOM 10030 C CG2  . ILE A 1 68  ? 11.138  4.693   -8.364  1.00 0.00 ? 68  ILE A CG2  6  
ATOM 10031 C CD1  . ILE A 1 68  ? 8.769   2.629   -8.475  1.00 0.00 ? 68  ILE A CD1  6  
ATOM 10032 H H    . ILE A 1 68  ? 9.462   4.086   -4.455  1.00 0.00 ? 68  ILE A H    6  
ATOM 10033 H HA   . ILE A 1 68  ? 11.984  3.993   -5.972  1.00 0.00 ? 68  ILE A HA   6  
ATOM 10034 H HB   . ILE A 1 68  ? 9.384   4.901   -7.188  1.00 0.00 ? 68  ILE A HB   6  
ATOM 10035 H HG12 . ILE A 1 68  ? 10.656  2.202   -7.633  1.00 0.00 ? 68  ILE A HG12 6  
ATOM 10036 H HG13 . ILE A 1 68  ? 9.371   2.457   -6.458  1.00 0.00 ? 68  ILE A HG13 6  
ATOM 10037 H HG21 . ILE A 1 68  ? 12.143  4.334   -8.202  1.00 0.00 ? 68  ILE A HG21 6  
ATOM 10038 H HG22 . ILE A 1 68  ? 10.752  4.281   -9.284  1.00 0.00 ? 68  ILE A HG22 6  
ATOM 10039 H HG23 . ILE A 1 68  ? 11.147  5.771   -8.428  1.00 0.00 ? 68  ILE A HG23 6  
ATOM 10040 H HD11 . ILE A 1 68  ? 8.591   3.575   -8.964  1.00 0.00 ? 68  ILE A HD11 6  
ATOM 10041 H HD12 . ILE A 1 68  ? 9.130   1.912   -9.197  1.00 0.00 ? 68  ILE A HD12 6  
ATOM 10042 H HD13 . ILE A 1 68  ? 7.847   2.270   -8.042  1.00 0.00 ? 68  ILE A HD13 6  
ATOM 10043 N N    . SER A 1 69  ? 12.025  6.581   -6.305  1.00 0.00 ? 69  SER A N    6  
ATOM 10044 C CA   . SER A 1 69  ? 12.261  8.007   -6.112  1.00 0.00 ? 69  SER A CA   6  
ATOM 10045 C C    . SER A 1 69  ? 11.745  8.809   -7.303  1.00 0.00 ? 69  SER A C    6  
ATOM 10046 O O    . SER A 1 69  ? 12.231  8.660   -8.425  1.00 0.00 ? 69  SER A O    6  
ATOM 10047 C CB   . SER A 1 69  ? 13.754  8.275   -5.910  1.00 0.00 ? 69  SER A CB   6  
ATOM 10048 O OG   . SER A 1 69  ? 14.323  7.339   -5.012  1.00 0.00 ? 69  SER A OG   6  
ATOM 10049 H H    . SER A 1 69  ? 12.527  6.102   -6.997  1.00 0.00 ? 69  SER A H    6  
ATOM 10050 H HA   . SER A 1 69  ? 11.726  8.315   -5.227  1.00 0.00 ? 69  SER A HA   6  
ATOM 10051 H HB2  . SER A 1 69  ? 14.262  8.201   -6.860  1.00 0.00 ? 69  SER A HB2  6  
ATOM 10052 H HB3  . SER A 1 69  ? 13.887  9.269   -5.508  1.00 0.00 ? 69  SER A HB3  6  
ATOM 10053 H HG   . SER A 1 69  ? 13.770  7.267   -4.231  1.00 0.00 ? 69  SER A HG   6  
ATOM 10054 N N    . THR A 1 70  ? 10.757  9.662   -7.051  1.00 0.00 ? 70  THR A N    6  
ATOM 10055 C CA   . THR A 1 70  ? 10.173  10.487  -8.101  1.00 0.00 ? 70  THR A CA   6  
ATOM 10056 C C    . THR A 1 70  ? 10.449  11.966  -7.855  1.00 0.00 ? 70  THR A C    6  
ATOM 10057 O O    . THR A 1 70  ? 10.867  12.355  -6.765  1.00 0.00 ? 70  THR A O    6  
ATOM 10058 C CB   . THR A 1 70  ? 8.651   10.271  -8.204  1.00 0.00 ? 70  THR A CB   6  
ATOM 10059 O OG1  . THR A 1 70  ? 8.014   10.683  -6.990  1.00 0.00 ? 70  THR A OG1  6  
ATOM 10060 C CG2  . THR A 1 70  ? 8.329   8.810   -8.481  1.00 0.00 ? 70  THR A CG2  6  
ATOM 10061 H H    . THR A 1 70  ? 10.412  9.735   -6.137  1.00 0.00 ? 70  THR A H    6  
ATOM 10062 H HA   . THR A 1 70  ? 10.621  10.198  -9.041  1.00 0.00 ? 70  THR A HA   6  
ATOM 10063 H HB   . THR A 1 70  ? 8.273   10.869  -9.021  1.00 0.00 ? 70  THR A HB   6  
ATOM 10064 H HG1  . THR A 1 70  ? 7.523   11.494  -7.145  1.00 0.00 ? 70  THR A HG1  6  
ATOM 10065 H HG21 . THR A 1 70  ? 9.190   8.329   -8.921  1.00 0.00 ? 70  THR A HG21 6  
ATOM 10066 H HG22 . THR A 1 70  ? 7.494   8.749   -9.163  1.00 0.00 ? 70  THR A HG22 6  
ATOM 10067 H HG23 . THR A 1 70  ? 8.076   8.317   -7.555  1.00 0.00 ? 70  THR A HG23 6  
ATOM 10068 N N    . GLU A 1 71  ? 10.213  12.785  -8.876  1.00 0.00 ? 71  GLU A N    6  
ATOM 10069 C CA   . GLU A 1 71  ? 10.437  14.222  -8.769  1.00 0.00 ? 71  GLU A CA   6  
ATOM 10070 C C    . GLU A 1 71  ? 9.781   14.783  -7.510  1.00 0.00 ? 71  GLU A C    6  
ATOM 10071 O O    . GLU A 1 71  ? 10.431  15.445  -6.702  1.00 0.00 ? 71  GLU A O    6  
ATOM 10072 C CB   . GLU A 1 71  ? 9.891   14.939  -10.005 1.00 0.00 ? 71  GLU A CB   6  
ATOM 10073 C CG   . GLU A 1 71  ? 8.425   14.650  -10.278 1.00 0.00 ? 71  GLU A CG   6  
ATOM 10074 C CD   . GLU A 1 71  ? 8.003   15.048  -11.679 1.00 0.00 ? 71  GLU A CD   6  
ATOM 10075 O OE1  . GLU A 1 71  ? 8.869   15.054  -12.579 1.00 0.00 ? 71  GLU A OE1  6  
ATOM 10076 O OE2  . GLU A 1 71  ? 6.808   15.353  -11.875 1.00 0.00 ? 71  GLU A OE2  6  
ATOM 10077 H H    . GLU A 1 71  ? 9.880   12.414  -9.719  1.00 0.00 ? 71  GLU A H    6  
ATOM 10078 H HA   . GLU A 1 71  ? 11.502  14.387  -8.709  1.00 0.00 ? 71  GLU A HA   6  
ATOM 10079 H HB2  . GLU A 1 71  ? 10.008  16.004  -9.869  1.00 0.00 ? 71  GLU A HB2  6  
ATOM 10080 H HB3  . GLU A 1 71  ? 10.464  14.630  -10.867 1.00 0.00 ? 71  GLU A HB3  6  
ATOM 10081 H HG2  . GLU A 1 71  ? 8.250   13.592  -10.154 1.00 0.00 ? 71  GLU A HG2  6  
ATOM 10082 H HG3  . GLU A 1 71  ? 7.824   15.198  -9.567  1.00 0.00 ? 71  GLU A HG3  6  
ATOM 10083 N N    . GLU A 1 72  ? 8.489   14.513  -7.353  1.00 0.00 ? 72  GLU A N    6  
ATOM 10084 C CA   . GLU A 1 72  ? 7.745   14.992  -6.194  1.00 0.00 ? 72  GLU A CA   6  
ATOM 10085 C C    . GLU A 1 72  ? 8.382   14.500  -4.897  1.00 0.00 ? 72  GLU A C    6  
ATOM 10086 O O    . GLU A 1 72  ? 8.470   15.239  -3.918  1.00 0.00 ? 72  GLU A O    6  
ATOM 10087 C CB   . GLU A 1 72  ? 6.289   14.528  -6.268  1.00 0.00 ? 72  GLU A CB   6  
ATOM 10088 C CG   . GLU A 1 72  ? 5.557   15.015  -7.508  1.00 0.00 ? 72  GLU A CG   6  
ATOM 10089 C CD   . GLU A 1 72  ? 4.070   15.195  -7.274  1.00 0.00 ? 72  GLU A CD   6  
ATOM 10090 O OE1  . GLU A 1 72  ? 3.701   16.042  -6.433  1.00 0.00 ? 72  GLU A OE1  6  
ATOM 10091 O OE2  . GLU A 1 72  ? 3.275   14.491  -7.930  1.00 0.00 ? 72  GLU A OE2  6  
ATOM 10092 H H    . GLU A 1 72  ? 8.026   13.979  -8.032  1.00 0.00 ? 72  GLU A H    6  
ATOM 10093 H HA   . GLU A 1 72  ? 7.770   16.071  -6.207  1.00 0.00 ? 72  GLU A HA   6  
ATOM 10094 H HB2  . GLU A 1 72  ? 6.267   13.448  -6.263  1.00 0.00 ? 72  GLU A HB2  6  
ATOM 10095 H HB3  . GLU A 1 72  ? 5.763   14.894  -5.399  1.00 0.00 ? 72  GLU A HB3  6  
ATOM 10096 H HG2  . GLU A 1 72  ? 5.976   15.963  -7.808  1.00 0.00 ? 72  GLU A HG2  6  
ATOM 10097 H HG3  . GLU A 1 72  ? 5.697   14.293  -8.299  1.00 0.00 ? 72  GLU A HG3  6  
ATOM 10098 N N    . GLY A 1 73  ? 8.824   13.246  -4.900  1.00 0.00 ? 73  GLY A N    6  
ATOM 10099 C CA   . GLY A 1 73  ? 9.446   12.676  -3.719  1.00 0.00 ? 73  GLY A CA   6  
ATOM 10100 C C    . GLY A 1 73  ? 9.740   11.198  -3.875  1.00 0.00 ? 73  GLY A C    6  
ATOM 10101 O O    . GLY A 1 73  ? 10.748  10.817  -4.472  1.00 0.00 ? 73  GLY A O    6  
ATOM 10102 H H    . GLY A 1 73  ? 8.726   12.703  -5.711  1.00 0.00 ? 73  GLY A H    6  
ATOM 10103 H HA2  . GLY A 1 73  ? 10.371  13.199  -3.525  1.00 0.00 ? 73  GLY A HA2  6  
ATOM 10104 H HA3  . GLY A 1 73  ? 8.784   12.812  -2.877  1.00 0.00 ? 73  GLY A HA3  6  
ATOM 10105 N N    . VAL A 1 74  ? 8.860   10.360  -3.337  1.00 0.00 ? 74  VAL A N    6  
ATOM 10106 C CA   . VAL A 1 74  ? 9.031   8.914   -3.418  1.00 0.00 ? 74  VAL A CA   6  
ATOM 10107 C C    . VAL A 1 74  ? 7.683   8.205   -3.498  1.00 0.00 ? 74  VAL A C    6  
ATOM 10108 O O    . VAL A 1 74  ? 6.633   8.825   -3.327  1.00 0.00 ? 74  VAL A O    6  
ATOM 10109 C CB   . VAL A 1 74  ? 9.813   8.372   -2.207  1.00 0.00 ? 74  VAL A CB   6  
ATOM 10110 C CG1  . VAL A 1 74  ? 11.311  8.504   -2.436  1.00 0.00 ? 74  VAL A CG1  6  
ATOM 10111 C CG2  . VAL A 1 74  ? 9.393   9.095   -0.936  1.00 0.00 ? 74  VAL A CG2  6  
ATOM 10112 H H    . VAL A 1 74  ? 8.076   10.723  -2.874  1.00 0.00 ? 74  VAL A H    6  
ATOM 10113 H HA   . VAL A 1 74  ? 9.596   8.695   -4.313  1.00 0.00 ? 74  VAL A HA   6  
ATOM 10114 H HB   . VAL A 1 74  ? 9.579   7.324   -2.094  1.00 0.00 ? 74  VAL A HB   6  
ATOM 10115 H HG11 . VAL A 1 74  ? 11.548  9.529   -2.681  1.00 0.00 ? 74  VAL A HG11 6  
ATOM 10116 H HG12 . VAL A 1 74  ? 11.839  8.216   -1.539  1.00 0.00 ? 74  VAL A HG12 6  
ATOM 10117 H HG13 . VAL A 1 74  ? 11.608  7.862   -3.252  1.00 0.00 ? 74  VAL A HG13 6  
ATOM 10118 H HG21 . VAL A 1 74  ? 8.361   9.402   -1.021  1.00 0.00 ? 74  VAL A HG21 6  
ATOM 10119 H HG22 . VAL A 1 74  ? 9.501   8.430   -0.091  1.00 0.00 ? 74  VAL A HG22 6  
ATOM 10120 H HG23 . VAL A 1 74  ? 10.018  9.963   -0.792  1.00 0.00 ? 74  VAL A HG23 6  
ATOM 10121 N N    . ILE A 1 75  ? 7.721   6.903   -3.759  1.00 0.00 ? 75  ILE A N    6  
ATOM 10122 C CA   . ILE A 1 75  ? 6.503   6.109   -3.860  1.00 0.00 ? 75  ILE A CA   6  
ATOM 10123 C C    . ILE A 1 75  ? 6.730   4.687   -3.359  1.00 0.00 ? 75  ILE A C    6  
ATOM 10124 O O    . ILE A 1 75  ? 7.692   4.027   -3.751  1.00 0.00 ? 75  ILE A O    6  
ATOM 10125 C CB   . ILE A 1 75  ? 5.985   6.055   -5.310  1.00 0.00 ? 75  ILE A CB   6  
ATOM 10126 C CG1  . ILE A 1 75  ? 5.494   7.435   -5.752  1.00 0.00 ? 75  ILE A CG1  6  
ATOM 10127 C CG2  . ILE A 1 75  ? 4.873   5.025   -5.436  1.00 0.00 ? 75  ILE A CG2  6  
ATOM 10128 C CD1  . ILE A 1 75  ? 4.945   7.458   -7.161  1.00 0.00 ? 75  ILE A CD1  6  
ATOM 10129 H H    . ILE A 1 75  ? 8.588   6.466   -3.886  1.00 0.00 ? 75  ILE A H    6  
ATOM 10130 H HA   . ILE A 1 75  ? 5.747   6.579   -3.247  1.00 0.00 ? 75  ILE A HA   6  
ATOM 10131 H HB   . ILE A 1 75  ? 6.800   5.749   -5.948  1.00 0.00 ? 75  ILE A HB   6  
ATOM 10132 H HG12 . ILE A 1 75  ? 4.710   7.761   -5.086  1.00 0.00 ? 75  ILE A HG12 6  
ATOM 10133 H HG13 . ILE A 1 75  ? 6.316   8.134   -5.703  1.00 0.00 ? 75  ILE A HG13 6  
ATOM 10134 H HG21 . ILE A 1 75  ? 3.999   5.489   -5.870  1.00 0.00 ? 75  ILE A HG21 6  
ATOM 10135 H HG22 . ILE A 1 75  ? 5.202   4.216   -6.072  1.00 0.00 ? 75  ILE A HG22 6  
ATOM 10136 H HG23 . ILE A 1 75  ? 4.627   4.638   -4.459  1.00 0.00 ? 75  ILE A HG23 6  
ATOM 10137 H HD11 . ILE A 1 75  ? 3.866   7.458   -7.128  1.00 0.00 ? 75  ILE A HD11 6  
ATOM 10138 H HD12 . ILE A 1 75  ? 5.290   8.346   -7.668  1.00 0.00 ? 75  ILE A HD12 6  
ATOM 10139 H HD13 . ILE A 1 75  ? 5.288   6.583   -7.695  1.00 0.00 ? 75  ILE A HD13 6  
ATOM 10140 N N    . SER A 1 76  ? 5.837   4.221   -2.493  1.00 0.00 ? 76  SER A N    6  
ATOM 10141 C CA   . SER A 1 76  ? 5.940   2.877   -1.936  1.00 0.00 ? 76  SER A CA   6  
ATOM 10142 C C    . SER A 1 76  ? 4.900   1.950   -2.558  1.00 0.00 ? 76  SER A C    6  
ATOM 10143 O O    . SER A 1 76  ? 3.717   2.009   -2.221  1.00 0.00 ? 76  SER A O    6  
ATOM 10144 C CB   . SER A 1 76  ? 5.763   2.916   -0.417  1.00 0.00 ? 76  SER A CB   6  
ATOM 10145 O OG   . SER A 1 76  ? 6.486   1.870   0.208   1.00 0.00 ? 76  SER A OG   6  
ATOM 10146 H H    . SER A 1 76  ? 5.091   4.796   -2.219  1.00 0.00 ? 76  SER A H    6  
ATOM 10147 H HA   . SER A 1 76  ? 6.926   2.499   -2.165  1.00 0.00 ? 76  SER A HA   6  
ATOM 10148 H HB2  . SER A 1 76  ? 6.122   3.861   -0.040  1.00 0.00 ? 76  SER A HB2  6  
ATOM 10149 H HB3  . SER A 1 76  ? 4.715   2.807   -0.177  1.00 0.00 ? 76  SER A HB3  6  
ATOM 10150 H HG   . SER A 1 76  ? 6.111   1.695   1.074   1.00 0.00 ? 76  SER A HG   6  
ATOM 10151 N N    . THR A 1 77  ? 5.350   1.092   -3.469  1.00 0.00 ? 77  THR A N    6  
ATOM 10152 C CA   . THR A 1 77  ? 4.460   0.153   -4.139  1.00 0.00 ? 77  THR A CA   6  
ATOM 10153 C C    . THR A 1 77  ? 4.560   -1.237  -3.520  1.00 0.00 ? 77  THR A C    6  
ATOM 10154 O O    . THR A 1 77  ? 5.655   -1.728  -3.245  1.00 0.00 ? 77  THR A O    6  
ATOM 10155 C CB   . THR A 1 77  ? 4.777   0.055   -5.644  1.00 0.00 ? 77  THR A CB   6  
ATOM 10156 O OG1  . THR A 1 77  ? 5.134   1.345   -6.153  1.00 0.00 ? 77  THR A OG1  6  
ATOM 10157 C CG2  . THR A 1 77  ? 3.582   -0.487  -6.414  1.00 0.00 ? 77  THR A CG2  6  
ATOM 10158 H H    . THR A 1 77  ? 6.304   1.093   -3.695  1.00 0.00 ? 77  THR A H    6  
ATOM 10159 H HA   . THR A 1 77  ? 3.448   0.514   -4.028  1.00 0.00 ? 77  THR A HA   6  
ATOM 10160 H HB   . THR A 1 77  ? 5.609   -0.620  -5.778  1.00 0.00 ? 77  THR A HB   6  
ATOM 10161 H HG1  . THR A 1 77  ? 5.150   1.316   -7.113  1.00 0.00 ? 77  THR A HG1  6  
ATOM 10162 H HG21 . THR A 1 77  ? 3.805   -1.480  -6.772  1.00 0.00 ? 77  THR A HG21 6  
ATOM 10163 H HG22 . THR A 1 77  ? 3.371   0.160   -7.252  1.00 0.00 ? 77  THR A HG22 6  
ATOM 10164 H HG23 . THR A 1 77  ? 2.722   -0.524  -5.763  1.00 0.00 ? 77  THR A HG23 6  
ATOM 10165 N N    . LEU A 1 78  ? 3.410   -1.866  -3.302  1.00 0.00 ? 78  LEU A N    6  
ATOM 10166 C CA   . LEU A 1 78  ? 3.368   -3.201  -2.715  1.00 0.00 ? 78  LEU A CA   6  
ATOM 10167 C C    . LEU A 1 78  ? 2.600   -4.166  -3.613  1.00 0.00 ? 78  LEU A C    6  
ATOM 10168 O O    . LEU A 1 78  ? 1.419   -3.964  -3.895  1.00 0.00 ? 78  LEU A O    6  
ATOM 10169 C CB   . LEU A 1 78  ? 2.720   -3.150  -1.330  1.00 0.00 ? 78  LEU A CB   6  
ATOM 10170 C CG   . LEU A 1 78  ? 2.362   -4.499  -0.707  1.00 0.00 ? 78  LEU A CG   6  
ATOM 10171 C CD1  . LEU A 1 78  ? 3.554   -5.072  0.045   1.00 0.00 ? 78  LEU A CD1  6  
ATOM 10172 C CD2  . LEU A 1 78  ? 1.163   -4.358  0.219   1.00 0.00 ? 78  LEU A CD2  6  
ATOM 10173 H H    . LEU A 1 78  ? 2.570   -1.423  -3.542  1.00 0.00 ? 78  LEU A H    6  
ATOM 10174 H HA   . LEU A 1 78  ? 4.384   -3.551  -2.616  1.00 0.00 ? 78  LEU A HA   6  
ATOM 10175 H HB2  . LEU A 1 78  ? 3.405   -2.649  -0.664  1.00 0.00 ? 78  LEU A HB2  6  
ATOM 10176 H HB3  . LEU A 1 78  ? 1.811   -2.571  -1.412  1.00 0.00 ? 78  LEU A HB3  6  
ATOM 10177 H HG   . LEU A 1 78  ? 2.099   -5.194  -1.493  1.00 0.00 ? 78  LEU A HG   6  
ATOM 10178 H HD11 . LEU A 1 78  ? 3.330   -6.081  0.358   1.00 0.00 ? 78  LEU A HD11 6  
ATOM 10179 H HD12 . LEU A 1 78  ? 3.758   -4.463  0.913   1.00 0.00 ? 78  LEU A HD12 6  
ATOM 10180 H HD13 . LEU A 1 78  ? 4.419   -5.079  -0.602  1.00 0.00 ? 78  LEU A HD13 6  
ATOM 10181 H HD21 . LEU A 1 78  ? 0.279   -4.155  -0.367  1.00 0.00 ? 78  LEU A HD21 6  
ATOM 10182 H HD22 . LEU A 1 78  ? 1.333   -3.542  0.907   1.00 0.00 ? 78  LEU A HD22 6  
ATOM 10183 H HD23 . LEU A 1 78  ? 1.026   -5.275  0.773   1.00 0.00 ? 78  LEU A HD23 6  
ATOM 10184 N N    . THR A 1 79  ? 3.279   -5.219  -4.058  1.00 0.00 ? 79  THR A N    6  
ATOM 10185 C CA   . THR A 1 79  ? 2.662   -6.216  -4.923  1.00 0.00 ? 79  THR A CA   6  
ATOM 10186 C C    . THR A 1 79  ? 2.258   -7.455  -4.132  1.00 0.00 ? 79  THR A C    6  
ATOM 10187 O O    . THR A 1 79  ? 2.957   -7.867  -3.205  1.00 0.00 ? 79  THR A O    6  
ATOM 10188 C CB   . THR A 1 79  ? 3.610   -6.636  -6.063  1.00 0.00 ? 79  THR A CB   6  
ATOM 10189 O OG1  . THR A 1 79  ? 4.176   -5.475  -6.681  1.00 0.00 ? 79  THR A OG1  6  
ATOM 10190 C CG2  . THR A 1 79  ? 2.871   -7.462  -7.105  1.00 0.00 ? 79  THR A CG2  6  
ATOM 10191 H H    . THR A 1 79  ? 4.218   -5.325  -3.799  1.00 0.00 ? 79  THR A H    6  
ATOM 10192 H HA   . THR A 1 79  ? 1.778   -5.777  -5.361  1.00 0.00 ? 79  THR A HA   6  
ATOM 10193 H HB   . THR A 1 79  ? 4.405   -7.237  -5.646  1.00 0.00 ? 79  THR A HB   6  
ATOM 10194 H HG1  . THR A 1 79  ? 4.710   -5.741  -7.433  1.00 0.00 ? 79  THR A HG1  6  
ATOM 10195 H HG21 . THR A 1 79  ? 2.676   -8.448  -6.710  1.00 0.00 ? 79  THR A HG21 6  
ATOM 10196 H HG22 . THR A 1 79  ? 3.476   -7.543  -7.995  1.00 0.00 ? 79  THR A HG22 6  
ATOM 10197 H HG23 . THR A 1 79  ? 1.935   -6.980  -7.347  1.00 0.00 ? 79  THR A HG23 6  
ATOM 10198 N N    . ILE A 1 80  ? 1.127   -8.046  -4.503  1.00 0.00 ? 80  ILE A N    6  
ATOM 10199 C CA   . ILE A 1 80  ? 0.632   -9.239  -3.828  1.00 0.00 ? 80  ILE A CA   6  
ATOM 10200 C C    . ILE A 1 80  ? 0.486   -10.402 -4.804  1.00 0.00 ? 80  ILE A C    6  
ATOM 10201 O O    . ILE A 1 80  ? -0.478  -10.469 -5.566  1.00 0.00 ? 80  ILE A O    6  
ATOM 10202 C CB   . ILE A 1 80  ? -0.726  -8.979  -3.150  1.00 0.00 ? 80  ILE A CB   6  
ATOM 10203 C CG1  . ILE A 1 80  ? -0.603  -7.846  -2.129  1.00 0.00 ? 80  ILE A CG1  6  
ATOM 10204 C CG2  . ILE A 1 80  ? -1.236  -10.248 -2.482  1.00 0.00 ? 80  ILE A CG2  6  
ATOM 10205 C CD1  . ILE A 1 80  ? -1.891  -7.082  -1.916  1.00 0.00 ? 80  ILE A CD1  6  
ATOM 10206 H H    . ILE A 1 80  ? 0.614   -7.670  -5.248  1.00 0.00 ? 80  ILE A H    6  
ATOM 10207 H HA   . ILE A 1 80  ? 1.347   -9.511  -3.065  1.00 0.00 ? 80  ILE A HA   6  
ATOM 10208 H HB   . ILE A 1 80  ? -1.435  -8.693  -3.912  1.00 0.00 ? 80  ILE A HB   6  
ATOM 10209 H HG12 . ILE A 1 80  ? -0.301  -8.258  -1.179  1.00 0.00 ? 80  ILE A HG12 6  
ATOM 10210 H HG13 . ILE A 1 80  ? 0.147   -7.147  -2.468  1.00 0.00 ? 80  ILE A HG13 6  
ATOM 10211 H HG21 . ILE A 1 80  ? -2.316  -10.243 -2.478  1.00 0.00 ? 80  ILE A HG21 6  
ATOM 10212 H HG22 . ILE A 1 80  ? -0.883  -11.109 -3.030  1.00 0.00 ? 80  ILE A HG22 6  
ATOM 10213 H HG23 . ILE A 1 80  ? -0.872  -10.292 -1.467  1.00 0.00 ? 80  ILE A HG23 6  
ATOM 10214 H HD11 . ILE A 1 80  ? -2.072  -6.969  -0.857  1.00 0.00 ? 80  ILE A HD11 6  
ATOM 10215 H HD12 . ILE A 1 80  ? -1.812  -6.108  -2.375  1.00 0.00 ? 80  ILE A HD12 6  
ATOM 10216 H HD13 . ILE A 1 80  ? -2.710  -7.626  -2.364  1.00 0.00 ? 80  ILE A HD13 6  
ATOM 10217 N N    . SER A 1 81  ? 1.450   -11.317 -4.774  1.00 0.00 ? 81  SER A N    6  
ATOM 10218 C CA   . SER A 1 81  ? 1.430   -12.477 -5.657  1.00 0.00 ? 81  SER A CA   6  
ATOM 10219 C C    . SER A 1 81  ? 0.024   -13.060 -5.757  1.00 0.00 ? 81  SER A C    6  
ATOM 10220 O O    . SER A 1 81  ? -0.663  -12.885 -6.762  1.00 0.00 ? 81  SER A O    6  
ATOM 10221 C CB   . SER A 1 81  ? 2.403   -13.545 -5.153  1.00 0.00 ? 81  SER A CB   6  
ATOM 10222 O OG   . SER A 1 81  ? 3.713   -13.020 -5.021  1.00 0.00 ? 81  SER A OG   6  
ATOM 10223 H H    . SER A 1 81  ? 2.193   -11.207 -4.144  1.00 0.00 ? 81  SER A H    6  
ATOM 10224 H HA   . SER A 1 81  ? 1.743   -12.152 -6.638  1.00 0.00 ? 81  SER A HA   6  
ATOM 10225 H HB2  . SER A 1 81  ? 2.073   -13.902 -4.190  1.00 0.00 ? 81  SER A HB2  6  
ATOM 10226 H HB3  . SER A 1 81  ? 2.426   -14.366 -5.854  1.00 0.00 ? 81  SER A HB3  6  
ATOM 10227 H HG   . SER A 1 81  ? 3.670   -12.063 -4.961  1.00 0.00 ? 81  SER A HG   6  
ATOM 10228 N N    . ASN A 1 82  ? -0.397  -13.755 -4.705  1.00 0.00 ? 82  ASN A N    6  
ATOM 10229 C CA   . ASN A 1 82  ? -1.721  -14.366 -4.673  1.00 0.00 ? 82  ASN A CA   6  
ATOM 10230 C C    . ASN A 1 82  ? -2.650  -13.601 -3.734  1.00 0.00 ? 82  ASN A C    6  
ATOM 10231 O O    . ASN A 1 82  ? -2.587  -13.762 -2.515  1.00 0.00 ? 82  ASN A O    6  
ATOM 10232 C CB   . ASN A 1 82  ? -1.622  -15.827 -4.231  1.00 0.00 ? 82  ASN A CB   6  
ATOM 10233 C CG   . ASN A 1 82  ? -0.782  -16.662 -5.179  1.00 0.00 ? 82  ASN A CG   6  
ATOM 10234 O OD1  . ASN A 1 82  ? 0.442   -16.536 -5.217  1.00 0.00 ? 82  ASN A OD1  6  
ATOM 10235 N ND2  . ASN A 1 82  ? -1.439  -17.520 -5.950  1.00 0.00 ? 82  ASN A ND2  6  
ATOM 10236 H H    . ASN A 1 82  ? 0.196   -13.860 -3.932  1.00 0.00 ? 82  ASN A H    6  
ATOM 10237 H HA   . ASN A 1 82  ? -2.128  -14.328 -5.672  1.00 0.00 ? 82  ASN A HA   6  
ATOM 10238 H HB2  . ASN A 1 82  ? -1.171  -15.870 -3.250  1.00 0.00 ? 82  ASN A HB2  6  
ATOM 10239 H HB3  . ASN A 1 82  ? -2.613  -16.252 -4.186  1.00 0.00 ? 82  ASN A HB3  6  
ATOM 10240 H HD21 . ASN A 1 82  ? -2.415  -17.566 -5.866  1.00 0.00 ? 82  ASN A HD21 6  
ATOM 10241 H HD22 . ASN A 1 82  ? -0.921  -18.073 -6.572  1.00 0.00 ? 82  ASN A HD22 6  
ATOM 10242 N N    . ILE A 1 83  ? -3.512  -12.770 -4.311  1.00 0.00 ? 83  ILE A N    6  
ATOM 10243 C CA   . ILE A 1 83  ? -4.455  -11.983 -3.527  1.00 0.00 ? 83  ILE A CA   6  
ATOM 10244 C C    . ILE A 1 83  ? -5.743  -12.759 -3.274  1.00 0.00 ? 83  ILE A C    6  
ATOM 10245 O O    . ILE A 1 83  ? -6.176  -13.552 -4.109  1.00 0.00 ? 83  ILE A O    6  
ATOM 10246 C CB   . ILE A 1 83  ? -4.798  -10.655 -4.227  1.00 0.00 ? 83  ILE A CB   6  
ATOM 10247 C CG1  . ILE A 1 83  ? -5.162  -9.587  -3.193  1.00 0.00 ? 83  ILE A CG1  6  
ATOM 10248 C CG2  . ILE A 1 83  ? -5.939  -10.856 -5.213  1.00 0.00 ? 83  ILE A CG2  6  
ATOM 10249 C CD1  . ILE A 1 83  ? -5.413  -8.223  -3.796  1.00 0.00 ? 83  ILE A CD1  6  
ATOM 10250 H H    . ILE A 1 83  ? -3.514  -12.686 -5.287  1.00 0.00 ? 83  ILE A H    6  
ATOM 10251 H HA   . ILE A 1 83  ? -3.991  -11.757 -2.578  1.00 0.00 ? 83  ILE A HA   6  
ATOM 10252 H HB   . ILE A 1 83  ? -3.930  -10.330 -4.780  1.00 0.00 ? 83  ILE A HB   6  
ATOM 10253 H HG12 . ILE A 1 83  ? -6.058  -9.889  -2.673  1.00 0.00 ? 83  ILE A HG12 6  
ATOM 10254 H HG13 . ILE A 1 83  ? -4.353  -9.493  -2.484  1.00 0.00 ? 83  ILE A HG13 6  
ATOM 10255 H HG21 . ILE A 1 83  ? -5.800  -10.204 -6.063  1.00 0.00 ? 83  ILE A HG21 6  
ATOM 10256 H HG22 . ILE A 1 83  ? -5.950  -11.882 -5.547  1.00 0.00 ? 83  ILE A HG22 6  
ATOM 10257 H HG23 . ILE A 1 83  ? -6.877  -10.623 -4.731  1.00 0.00 ? 83  ILE A HG23 6  
ATOM 10258 H HD11 . ILE A 1 83  ? -5.529  -8.317  -4.866  1.00 0.00 ? 83  ILE A HD11 6  
ATOM 10259 H HD12 . ILE A 1 83  ? -6.311  -7.800  -3.372  1.00 0.00 ? 83  ILE A HD12 6  
ATOM 10260 H HD13 . ILE A 1 83  ? -4.575  -7.575  -3.582  1.00 0.00 ? 83  ILE A HD13 6  
ATOM 10261 N N    . VAL A 1 84  ? -6.351  -12.524 -2.116  1.00 0.00 ? 84  VAL A N    6  
ATOM 10262 C CA   . VAL A 1 84  ? -7.592  -13.198 -1.753  1.00 0.00 ? 84  VAL A CA   6  
ATOM 10263 C C    . VAL A 1 84  ? -8.612  -12.211 -1.197  1.00 0.00 ? 84  VAL A C    6  
ATOM 10264 O O    . VAL A 1 84  ? -8.251  -11.149 -0.691  1.00 0.00 ? 84  VAL A O    6  
ATOM 10265 C CB   . VAL A 1 84  ? -7.345  -14.306 -0.712  1.00 0.00 ? 84  VAL A CB   6  
ATOM 10266 C CG1  . VAL A 1 84  ? -6.441  -15.386 -1.285  1.00 0.00 ? 84  VAL A CG1  6  
ATOM 10267 C CG2  . VAL A 1 84  ? -6.748  -13.719 0.558   1.00 0.00 ? 84  VAL A CG2  6  
ATOM 10268 H H    . VAL A 1 84  ? -5.957  -11.880 -1.491  1.00 0.00 ? 84  VAL A H    6  
ATOM 10269 H HA   . VAL A 1 84  ? -7.996  -13.655 -2.645  1.00 0.00 ? 84  VAL A HA   6  
ATOM 10270 H HB   . VAL A 1 84  ? -8.294  -14.757 -0.463  1.00 0.00 ? 84  VAL A HB   6  
ATOM 10271 H HG11 . VAL A 1 84  ? -6.987  -16.316 -1.348  1.00 0.00 ? 84  VAL A HG11 6  
ATOM 10272 H HG12 . VAL A 1 84  ? -6.110  -15.094 -2.271  1.00 0.00 ? 84  VAL A HG12 6  
ATOM 10273 H HG13 . VAL A 1 84  ? -5.583  -15.517 -0.642  1.00 0.00 ? 84  VAL A HG13 6  
ATOM 10274 H HG21 . VAL A 1 84  ? -7.536  -13.298 1.164   1.00 0.00 ? 84  VAL A HG21 6  
ATOM 10275 H HG22 . VAL A 1 84  ? -6.244  -14.497 1.114   1.00 0.00 ? 84  VAL A HG22 6  
ATOM 10276 H HG23 . VAL A 1 84  ? -6.040  -12.946 0.300   1.00 0.00 ? 84  VAL A HG23 6  
ATOM 10277 N N    . ARG A 1 85  ? -9.888  -12.570 -1.293  1.00 0.00 ? 85  ARG A N    6  
ATOM 10278 C CA   . ARG A 1 85  ? -10.961 -11.716 -0.800  1.00 0.00 ? 85  ARG A CA   6  
ATOM 10279 C C    . ARG A 1 85  ? -10.570 -11.059 0.520   1.00 0.00 ? 85  ARG A C    6  
ATOM 10280 O O    . ARG A 1 85  ? -10.943 -9.918  0.792   1.00 0.00 ? 85  ARG A O    6  
ATOM 10281 C CB   . ARG A 1 85  ? -12.245 -12.527 -0.618  1.00 0.00 ? 85  ARG A CB   6  
ATOM 10282 C CG   . ARG A 1 85  ? -13.115 -12.579 -1.864  1.00 0.00 ? 85  ARG A CG   6  
ATOM 10283 C CD   . ARG A 1 85  ? -14.278 -13.544 -1.692  1.00 0.00 ? 85  ARG A CD   6  
ATOM 10284 N NE   . ARG A 1 85  ? -15.240 -13.070 -0.700  1.00 0.00 ? 85  ARG A NE   6  
ATOM 10285 C CZ   . ARG A 1 85  ? -16.078 -13.869 -0.049  1.00 0.00 ? 85  ARG A CZ   6  
ATOM 10286 N NH1  . ARG A 1 85  ? -16.072 -15.174 -0.283  1.00 0.00 ? 85  ARG A NH1  6  
ATOM 10287 N NH2  . ARG A 1 85  ? -16.924 -13.362 0.838   1.00 0.00 ? 85  ARG A NH2  6  
ATOM 10288 H H    . ARG A 1 85  ? -10.113 -13.430 -1.707  1.00 0.00 ? 85  ARG A H    6  
ATOM 10289 H HA   . ARG A 1 85  ? -11.135 -10.944 -1.535  1.00 0.00 ? 85  ARG A HA   6  
ATOM 10290 H HB2  . ARG A 1 85  ? -11.983 -13.539 -0.347  1.00 0.00 ? 85  ARG A HB2  6  
ATOM 10291 H HB3  . ARG A 1 85  ? -12.824 -12.088 0.180   1.00 0.00 ? 85  ARG A HB3  6  
ATOM 10292 H HG2  . ARG A 1 85  ? -13.507 -11.592 -2.060  1.00 0.00 ? 85  ARG A HG2  6  
ATOM 10293 H HG3  . ARG A 1 85  ? -12.511 -12.901 -2.699  1.00 0.00 ? 85  ARG A HG3  6  
ATOM 10294 H HD2  . ARG A 1 85  ? -14.779 -13.655 -2.641  1.00 0.00 ? 85  ARG A HD2  6  
ATOM 10295 H HD3  . ARG A 1 85  ? -13.890 -14.500 -1.375  1.00 0.00 ? 85  ARG A HD3  6  
ATOM 10296 H HE   . ARG A 1 85  ? -15.261 -12.109 -0.512  1.00 0.00 ? 85  ARG A HE   6  
ATOM 10297 H HH11 . ARG A 1 85  ? -15.435 -15.558 -0.951  1.00 0.00 ? 85  ARG A HH11 6  
ATOM 10298 H HH12 . ARG A 1 85  ? -16.703 -15.773 0.209   1.00 0.00 ? 85  ARG A HH12 6  
ATOM 10299 H HH21 . ARG A 1 85  ? -16.932 -12.379 1.018   1.00 0.00 ? 85  ARG A HH21 6  
ATOM 10300 H HH22 . ARG A 1 85  ? -17.555 -13.964 1.328   1.00 0.00 ? 85  ARG A HH22 6  
ATOM 10301 N N    . ALA A 1 86  ? -9.818  -11.788 1.338   1.00 0.00 ? 86  ALA A N    6  
ATOM 10302 C CA   . ALA A 1 86  ? -9.375  -11.276 2.629   1.00 0.00 ? 86  ALA A CA   6  
ATOM 10303 C C    . ALA A 1 86  ? -8.553  -10.003 2.462   1.00 0.00 ? 86  ALA A C    6  
ATOM 10304 O O    . ALA A 1 86  ? -8.740  -9.031  3.194   1.00 0.00 ? 86  ALA A O    6  
ATOM 10305 C CB   . ALA A 1 86  ? -8.569  -12.335 3.368   1.00 0.00 ? 86  ALA A CB   6  
ATOM 10306 H H    . ALA A 1 86  ? -9.553  -12.691 1.065   1.00 0.00 ? 86  ALA A H    6  
ATOM 10307 H HA   . ALA A 1 86  ? -10.253 -11.051 3.217   1.00 0.00 ? 86  ALA A HA   6  
ATOM 10308 H HB1  . ALA A 1 86  ? -8.709  -12.214 4.432   1.00 0.00 ? 86  ALA A HB1  6  
ATOM 10309 H HB2  . ALA A 1 86  ? -8.905  -13.316 3.069   1.00 0.00 ? 86  ALA A HB2  6  
ATOM 10310 H HB3  . ALA A 1 86  ? -7.523  -12.223 3.127   1.00 0.00 ? 86  ALA A HB3  6  
ATOM 10311 N N    . ASP A 1 87  ? -7.641  -10.016 1.496   1.00 0.00 ? 87  ASP A N    6  
ATOM 10312 C CA   . ASP A 1 87  ? -6.789  -8.862  1.233   1.00 0.00 ? 87  ASP A CA   6  
ATOM 10313 C C    . ASP A 1 87  ? -7.610  -7.576  1.208   1.00 0.00 ? 87  ASP A C    6  
ATOM 10314 O O    . ASP A 1 87  ? -7.112  -6.503  1.551   1.00 0.00 ? 87  ASP A O    6  
ATOM 10315 C CB   . ASP A 1 87  ? -6.052  -9.037  -0.096  1.00 0.00 ? 87  ASP A CB   6  
ATOM 10316 C CG   . ASP A 1 87  ? -4.715  -9.732  0.072   1.00 0.00 ? 87  ASP A CG   6  
ATOM 10317 O OD1  . ASP A 1 87  ? -4.691  -10.844 0.638   1.00 0.00 ? 87  ASP A OD1  6  
ATOM 10318 O OD2  . ASP A 1 87  ? -3.692  -9.162  -0.363  1.00 0.00 ? 87  ASP A OD2  6  
ATOM 10319 H H    . ASP A 1 87  ? -7.538  -10.821 0.946   1.00 0.00 ? 87  ASP A H    6  
ATOM 10320 H HA   . ASP A 1 87  ? -6.065  -8.796  2.030   1.00 0.00 ? 87  ASP A HA   6  
ATOM 10321 H HB2  . ASP A 1 87  ? -6.662  -9.628  -0.763  1.00 0.00 ? 87  ASP A HB2  6  
ATOM 10322 H HB3  . ASP A 1 87  ? -5.881  -8.066  -0.536  1.00 0.00 ? 87  ASP A HB3  6  
ATOM 10323 N N    . PHE A 1 88  ? -8.869  -7.691  0.798   1.00 0.00 ? 88  PHE A N    6  
ATOM 10324 C CA   . PHE A 1 88  ? -9.758  -6.538  0.726   1.00 0.00 ? 88  PHE A CA   6  
ATOM 10325 C C    . PHE A 1 88  ? -10.240 -6.134  2.116   1.00 0.00 ? 88  PHE A C    6  
ATOM 10326 O O    . PHE A 1 88  ? -10.236 -4.955  2.467   1.00 0.00 ? 88  PHE A O    6  
ATOM 10327 C CB   . PHE A 1 88  ? -10.957 -6.847  -0.172  1.00 0.00 ? 88  PHE A CB   6  
ATOM 10328 C CG   . PHE A 1 88  ? -10.577 -7.455  -1.492  1.00 0.00 ? 88  PHE A CG   6  
ATOM 10329 C CD1  . PHE A 1 88  ? -9.574  -6.893  -2.266  1.00 0.00 ? 88  PHE A CD1  6  
ATOM 10330 C CD2  . PHE A 1 88  ? -11.223 -8.589  -1.959  1.00 0.00 ? 88  PHE A CD2  6  
ATOM 10331 C CE1  . PHE A 1 88  ? -9.222  -7.451  -3.481  1.00 0.00 ? 88  PHE A CE1  6  
ATOM 10332 C CE2  . PHE A 1 88  ? -10.874 -9.151  -3.173  1.00 0.00 ? 88  PHE A CE2  6  
ATOM 10333 C CZ   . PHE A 1 88  ? -9.874  -8.580  -3.935  1.00 0.00 ? 88  PHE A CZ   6  
ATOM 10334 H H    . PHE A 1 88  ? -9.207  -8.573  0.537   1.00 0.00 ? 88  PHE A H    6  
ATOM 10335 H HA   . PHE A 1 88  ? -9.201  -5.718  0.298   1.00 0.00 ? 88  PHE A HA   6  
ATOM 10336 H HB2  . PHE A 1 88  ? -11.609 -7.541  0.336   1.00 0.00 ? 88  PHE A HB2  6  
ATOM 10337 H HB3  . PHE A 1 88  ? -11.495 -5.932  -0.370  1.00 0.00 ? 88  PHE A HB3  6  
ATOM 10338 H HD1  . PHE A 1 88  ? -9.064  -6.009  -1.911  1.00 0.00 ? 88  PHE A HD1  6  
ATOM 10339 H HD2  . PHE A 1 88  ? -12.006 -9.035  -1.365  1.00 0.00 ? 88  PHE A HD2  6  
ATOM 10340 H HE1  . PHE A 1 88  ? -8.439  -7.002  -4.074  1.00 0.00 ? 88  PHE A HE1  6  
ATOM 10341 H HE2  . PHE A 1 88  ? -11.386 -10.034 -3.526  1.00 0.00 ? 88  PHE A HE2  6  
ATOM 10342 H HZ   . PHE A 1 88  ? -9.599  -9.018  -4.883  1.00 0.00 ? 88  PHE A HZ   6  
ATOM 10343 N N    . GLN A 1 89  ? -10.654 -7.123  2.902   1.00 0.00 ? 89  GLN A N    6  
ATOM 10344 C CA   . GLN A 1 89  ? -11.140 -6.871  4.253   1.00 0.00 ? 89  GLN A CA   6  
ATOM 10345 C C    . GLN A 1 89  ? -10.006 -6.410  5.163   1.00 0.00 ? 89  GLN A C    6  
ATOM 10346 O O    . GLN A 1 89  ? -10.221 -5.644  6.103   1.00 0.00 ? 89  GLN A O    6  
ATOM 10347 C CB   . GLN A 1 89  ? -11.790 -8.131  4.827   1.00 0.00 ? 89  GLN A CB   6  
ATOM 10348 C CG   . GLN A 1 89  ? -12.841 -8.743  3.915   1.00 0.00 ? 89  GLN A CG   6  
ATOM 10349 C CD   . GLN A 1 89  ? -14.181 -8.041  4.016   1.00 0.00 ? 89  GLN A CD   6  
ATOM 10350 O OE1  . GLN A 1 89  ? -14.750 -7.917  5.101   1.00 0.00 ? 89  GLN A OE1  6  
ATOM 10351 N NE2  . GLN A 1 89  ? -14.694 -7.578  2.882   1.00 0.00 ? 89  GLN A NE2  6  
ATOM 10352 H H    . GLN A 1 89  ? -10.633 -8.042  2.565   1.00 0.00 ? 89  GLN A H    6  
ATOM 10353 H HA   . GLN A 1 89  ? -11.881 -6.088  4.198   1.00 0.00 ? 89  GLN A HA   6  
ATOM 10354 H HB2  . GLN A 1 89  ? -11.023 -8.870  5.003   1.00 0.00 ? 89  GLN A HB2  6  
ATOM 10355 H HB3  . GLN A 1 89  ? -12.262 -7.883  5.767   1.00 0.00 ? 89  GLN A HB3  6  
ATOM 10356 H HG2  . GLN A 1 89  ? -12.495 -8.679  2.894   1.00 0.00 ? 89  GLN A HG2  6  
ATOM 10357 H HG3  . GLN A 1 89  ? -12.973 -9.780  4.184   1.00 0.00 ? 89  GLN A HG3  6  
ATOM 10358 H HE21 . GLN A 1 89  ? -14.185 -7.714  2.055   1.00 0.00 ? 89  GLN A HE21 6  
ATOM 10359 H HE22 . GLN A 1 89  ? -15.559 -7.121  2.918   1.00 0.00 ? 89  GLN A HE22 6  
ATOM 10360 N N    . THR A 1 90  ? -8.796  -6.883  4.878   1.00 0.00 ? 90  THR A N    6  
ATOM 10361 C CA   . THR A 1 90  ? -7.628  -6.521  5.671   1.00 0.00 ? 90  THR A CA   6  
ATOM 10362 C C    . THR A 1 90  ? -7.236  -5.067  5.439   1.00 0.00 ? 90  THR A C    6  
ATOM 10363 O O    . THR A 1 90  ? -7.219  -4.592  4.303   1.00 0.00 ? 90  THR A O    6  
ATOM 10364 C CB   . THR A 1 90  ? -6.425  -7.425  5.343   1.00 0.00 ? 90  THR A CB   6  
ATOM 10365 O OG1  . THR A 1 90  ? -6.795  -8.801  5.475   1.00 0.00 ? 90  THR A OG1  6  
ATOM 10366 C CG2  . THR A 1 90  ? -5.252  -7.119  6.262   1.00 0.00 ? 90  THR A CG2  6  
ATOM 10367 H H    . THR A 1 90  ? -8.689  -7.490  4.116   1.00 0.00 ? 90  THR A H    6  
ATOM 10368 H HA   . THR A 1 90  ? -7.878  -6.655  6.713   1.00 0.00 ? 90  THR A HA   6  
ATOM 10369 H HB   . THR A 1 90  ? -6.121  -7.237  4.322   1.00 0.00 ? 90  THR A HB   6  
ATOM 10370 H HG1  . THR A 1 90  ? -6.964  -9.172  4.605   1.00 0.00 ? 90  THR A HG1  6  
ATOM 10371 H HG21 . THR A 1 90  ? -4.688  -6.290  5.863   1.00 0.00 ? 90  THR A HG21 6  
ATOM 10372 H HG22 . THR A 1 90  ? -4.615  -7.988  6.333   1.00 0.00 ? 90  THR A HG22 6  
ATOM 10373 H HG23 . THR A 1 90  ? -5.622  -6.863  7.243   1.00 0.00 ? 90  THR A HG23 6  
ATOM 10374 N N    . ILE A 1 91  ? -6.920  -4.364  6.522   1.00 0.00 ? 91  ILE A N    6  
ATOM 10375 C CA   . ILE A 1 91  ? -6.525  -2.964  6.435   1.00 0.00 ? 91  ILE A CA   6  
ATOM 10376 C C    . ILE A 1 91  ? -5.020  -2.828  6.233   1.00 0.00 ? 91  ILE A C    6  
ATOM 10377 O O    . ILE A 1 91  ? -4.228  -3.339  7.025   1.00 0.00 ? 91  ILE A O    6  
ATOM 10378 C CB   . ILE A 1 91  ? -6.934  -2.184  7.699   1.00 0.00 ? 91  ILE A CB   6  
ATOM 10379 C CG1  . ILE A 1 91  ? -8.448  -1.963  7.720   1.00 0.00 ? 91  ILE A CG1  6  
ATOM 10380 C CG2  . ILE A 1 91  ? -6.198  -0.854  7.762   1.00 0.00 ? 91  ILE A CG2  6  
ATOM 10381 C CD1  . ILE A 1 91  ? -9.212  -3.078  8.401   1.00 0.00 ? 91  ILE A CD1  6  
ATOM 10382 H H    . ILE A 1 91  ? -6.952  -4.798  7.400   1.00 0.00 ? 91  ILE A H    6  
ATOM 10383 H HA   . ILE A 1 91  ? -7.032  -2.527  5.587   1.00 0.00 ? 91  ILE A HA   6  
ATOM 10384 H HB   . ILE A 1 91  ? -6.650  -2.767  8.562   1.00 0.00 ? 91  ILE A HB   6  
ATOM 10385 H HG12 . ILE A 1 91  ? -8.664  -1.046  8.244   1.00 0.00 ? 91  ILE A HG12 6  
ATOM 10386 H HG13 . ILE A 1 91  ? -8.807  -1.886  6.704   1.00 0.00 ? 91  ILE A HG13 6  
ATOM 10387 H HG21 . ILE A 1 91  ? -6.401  -0.288  6.865   1.00 0.00 ? 91  ILE A HG21 6  
ATOM 10388 H HG22 . ILE A 1 91  ? -6.537  -0.297  8.623   1.00 0.00 ? 91  ILE A HG22 6  
ATOM 10389 H HG23 . ILE A 1 91  ? -5.137  -1.033  7.843   1.00 0.00 ? 91  ILE A HG23 6  
ATOM 10390 H HD11 . ILE A 1 91  ? -9.964  -3.462  7.729   1.00 0.00 ? 91  ILE A HD11 6  
ATOM 10391 H HD12 . ILE A 1 91  ? -8.530  -3.870  8.671   1.00 0.00 ? 91  ILE A HD12 6  
ATOM 10392 H HD13 . ILE A 1 91  ? -9.688  -2.695  9.292   1.00 0.00 ? 91  ILE A HD13 6  
ATOM 10393 N N    . TYR A 1 92  ? -4.631  -2.135  5.169   1.00 0.00 ? 92  TYR A N    6  
ATOM 10394 C CA   . TYR A 1 92  ? -3.220  -1.932  4.862   1.00 0.00 ? 92  TYR A CA   6  
ATOM 10395 C C    . TYR A 1 92  ? -2.752  -0.559  5.333   1.00 0.00 ? 92  TYR A C    6  
ATOM 10396 O O    . TYR A 1 92  ? -3.521  0.401   5.344   1.00 0.00 ? 92  TYR A O    6  
ATOM 10397 C CB   . TYR A 1 92  ? -2.978  -2.077  3.358   1.00 0.00 ? 92  TYR A CB   6  
ATOM 10398 C CG   . TYR A 1 92  ? -3.224  -3.475  2.837   1.00 0.00 ? 92  TYR A CG   6  
ATOM 10399 C CD1  . TYR A 1 92  ? -2.354  -4.515  3.142   1.00 0.00 ? 92  TYR A CD1  6  
ATOM 10400 C CD2  . TYR A 1 92  ? -4.326  -3.757  2.040   1.00 0.00 ? 92  TYR A CD2  6  
ATOM 10401 C CE1  . TYR A 1 92  ? -2.574  -5.793  2.668   1.00 0.00 ? 92  TYR A CE1  6  
ATOM 10402 C CE2  . TYR A 1 92  ? -4.555  -5.033  1.562   1.00 0.00 ? 92  TYR A CE2  6  
ATOM 10403 C CZ   . TYR A 1 92  ? -3.676  -6.048  1.879   1.00 0.00 ? 92  TYR A CZ   6  
ATOM 10404 O OH   . TYR A 1 92  ? -3.900  -7.320  1.404   1.00 0.00 ? 92  TYR A OH   6  
ATOM 10405 H H    . TYR A 1 92  ? -5.309  -1.752  4.574   1.00 0.00 ? 92  TYR A H    6  
ATOM 10406 H HA   . TYR A 1 92  ? -2.655  -2.691  5.382   1.00 0.00 ? 92  TYR A HA   6  
ATOM 10407 H HB2  . TYR A 1 92  ? -3.636  -1.406  2.828   1.00 0.00 ? 92  TYR A HB2  6  
ATOM 10408 H HB3  . TYR A 1 92  ? -1.953  -1.817  3.139   1.00 0.00 ? 92  TYR A HB3  6  
ATOM 10409 H HD1  . TYR A 1 92  ? -1.491  -4.312  3.761   1.00 0.00 ? 92  TYR A HD1  6  
ATOM 10410 H HD2  . TYR A 1 92  ? -5.013  -2.960  1.793   1.00 0.00 ? 92  TYR A HD2  6  
ATOM 10411 H HE1  . TYR A 1 92  ? -1.886  -6.588  2.916   1.00 0.00 ? 92  TYR A HE1  6  
ATOM 10412 H HE2  . TYR A 1 92  ? -5.418  -5.232  0.944   1.00 0.00 ? 92  TYR A HE2  6  
ATOM 10413 H HH   . TYR A 1 92  ? -4.466  -7.277  0.630   1.00 0.00 ? 92  TYR A HH   6  
ATOM 10414 N N    . ASN A 1 93  ? -1.484  -0.475  5.722   1.00 0.00 ? 93  ASN A N    6  
ATOM 10415 C CA   . ASN A 1 93  ? -0.911  0.780   6.195   1.00 0.00 ? 93  ASN A CA   6  
ATOM 10416 C C    . ASN A 1 93  ? 0.579   0.851   5.878   1.00 0.00 ? 93  ASN A C    6  
ATOM 10417 O O    . ASN A 1 93  ? 1.336   -0.068  6.193   1.00 0.00 ? 93  ASN A O    6  
ATOM 10418 C CB   . ASN A 1 93  ? -1.131  0.929   7.702   1.00 0.00 ? 93  ASN A CB   6  
ATOM 10419 C CG   . ASN A 1 93  ? -2.454  1.594   8.030   1.00 0.00 ? 93  ASN A CG   6  
ATOM 10420 O OD1  . ASN A 1 93  ? -2.501  2.779   8.359   1.00 0.00 ? 93  ASN A OD1  6  
ATOM 10421 N ND2  . ASN A 1 93  ? -3.538  0.831   7.942   1.00 0.00 ? 93  ASN A ND2  6  
ATOM 10422 H H    . ASN A 1 93  ? -0.920  -1.276  5.691   1.00 0.00 ? 93  ASN A H    6  
ATOM 10423 H HA   . ASN A 1 93  ? -1.415  1.587   5.685   1.00 0.00 ? 93  ASN A HA   6  
ATOM 10424 H HB2  . ASN A 1 93  ? -1.119  -0.049  8.160   1.00 0.00 ? 93  ASN A HB2  6  
ATOM 10425 H HB3  . ASN A 1 93  ? -0.335  1.527   8.119   1.00 0.00 ? 93  ASN A HB3  6  
ATOM 10426 H HD21 . ASN A 1 93  ? -3.424  -0.105  7.674   1.00 0.00 ? 93  ASN A HD21 6  
ATOM 10427 H HD22 . ASN A 1 93  ? -4.406  1.236   8.148   1.00 0.00 ? 93  ASN A HD22 6  
ATOM 10428 N N    . CYS A 1 94  ? 0.994   1.948   5.254   1.00 0.00 ? 94  CYS A N    6  
ATOM 10429 C CA   . CYS A 1 94  ? 2.394   2.140   4.894   1.00 0.00 ? 94  CYS A CA   6  
ATOM 10430 C C    . CYS A 1 94  ? 3.067   3.133   5.836   1.00 0.00 ? 94  CYS A C    6  
ATOM 10431 O O    . CYS A 1 94  ? 2.906   4.346   5.695   1.00 0.00 ? 94  CYS A O    6  
ATOM 10432 C CB   . CYS A 1 94  ? 2.508   2.631   3.450   1.00 0.00 ? 94  CYS A CB   6  
ATOM 10433 S SG   . CYS A 1 94  ? 4.192   3.051   2.943   1.00 0.00 ? 94  CYS A SG   6  
ATOM 10434 H H    . CYS A 1 94  ? 0.343   2.646   5.029   1.00 0.00 ? 94  CYS A H    6  
ATOM 10435 H HA   . CYS A 1 94  ? 2.891   1.186   4.981   1.00 0.00 ? 94  CYS A HA   6  
ATOM 10436 H HB2  . CYS A 1 94  ? 2.149   1.859   2.785   1.00 0.00 ? 94  CYS A HB2  6  
ATOM 10437 H HB3  . CYS A 1 94  ? 1.897   3.513   3.328   1.00 0.00 ? 94  CYS A HB3  6  
ATOM 10438 H HG   . CYS A 1 94  ? 5.025   2.255   3.596   1.00 0.00 ? 94  CYS A HG   6  
ATOM 10439 N N    . THR A 1 95  ? 3.820   2.611   6.799   1.00 0.00 ? 95  THR A N    6  
ATOM 10440 C CA   . THR A 1 95  ? 4.515   3.450   7.766   1.00 0.00 ? 95  THR A CA   6  
ATOM 10441 C C    . THR A 1 95  ? 5.937   3.755   7.309   1.00 0.00 ? 95  THR A C    6  
ATOM 10442 O O    . THR A 1 95  ? 6.687   2.852   6.939   1.00 0.00 ? 95  THR A O    6  
ATOM 10443 C CB   . THR A 1 95  ? 4.566   2.784   9.154   1.00 0.00 ? 95  THR A CB   6  
ATOM 10444 O OG1  . THR A 1 95  ? 3.264   2.312   9.519   1.00 0.00 ? 95  THR A OG1  6  
ATOM 10445 C CG2  . THR A 1 95  ? 5.069   3.761   10.205  1.00 0.00 ? 95  THR A CG2  6  
ATOM 10446 H H    . THR A 1 95  ? 3.909   1.636   6.859   1.00 0.00 ? 95  THR A H    6  
ATOM 10447 H HA   . THR A 1 95  ? 3.969   4.378   7.855   1.00 0.00 ? 95  THR A HA   6  
ATOM 10448 H HB   . THR A 1 95  ? 5.245   1.945   9.109   1.00 0.00 ? 95  THR A HB   6  
ATOM 10449 H HG1  . THR A 1 95  ? 2.596   2.835   9.069   1.00 0.00 ? 95  THR A HG1  6  
ATOM 10450 H HG21 . THR A 1 95  ? 5.446   3.213   11.056  1.00 0.00 ? 95  THR A HG21 6  
ATOM 10451 H HG22 . THR A 1 95  ? 4.258   4.401   10.520  1.00 0.00 ? 95  THR A HG22 6  
ATOM 10452 H HG23 . THR A 1 95  ? 5.862   4.363   9.786   1.00 0.00 ? 95  THR A HG23 6  
ATOM 10453 N N    . ALA A 1 96  ? 6.301   5.033   7.336   1.00 0.00 ? 96  ALA A N    6  
ATOM 10454 C CA   . ALA A 1 96  ? 7.634   5.456   6.927   1.00 0.00 ? 96  ALA A CA   6  
ATOM 10455 C C    . ALA A 1 96  ? 8.395   6.078   8.093   1.00 0.00 ? 96  ALA A C    6  
ATOM 10456 O O    . ALA A 1 96  ? 7.851   6.240   9.186   1.00 0.00 ? 96  ALA A O    6  
ATOM 10457 C CB   . ALA A 1 96  ? 7.544   6.438   5.769   1.00 0.00 ? 96  ALA A CB   6  
ATOM 10458 H H    . ALA A 1 96  ? 5.658   5.707   7.641   1.00 0.00 ? 96  ALA A H    6  
ATOM 10459 H HA   . ALA A 1 96  ? 8.171   4.583   6.585   1.00 0.00 ? 96  ALA A HA   6  
ATOM 10460 H HB1  . ALA A 1 96  ? 8.401   6.312   5.123   1.00 0.00 ? 96  ALA A HB1  6  
ATOM 10461 H HB2  . ALA A 1 96  ? 6.640   6.252   5.209   1.00 0.00 ? 96  ALA A HB2  6  
ATOM 10462 H HB3  . ALA A 1 96  ? 7.529   7.447   6.153   1.00 0.00 ? 96  ALA A HB3  6  
ATOM 10463 N N    . TRP A 1 97  ? 9.654   6.425   7.854   1.00 0.00 ? 97  TRP A N    6  
ATOM 10464 C CA   . TRP A 1 97  ? 10.490  7.029   8.886   1.00 0.00 ? 97  TRP A CA   6  
ATOM 10465 C C    . TRP A 1 97  ? 11.587  7.886   8.264   1.00 0.00 ? 97  TRP A C    6  
ATOM 10466 O O    . TRP A 1 97  ? 12.305  7.440   7.371   1.00 0.00 ? 97  TRP A O    6  
ATOM 10467 C CB   . TRP A 1 97  ? 11.110  5.945   9.768   1.00 0.00 ? 97  TRP A CB   6  
ATOM 10468 C CG   . TRP A 1 97  ? 10.133  5.321   10.718  1.00 0.00 ? 97  TRP A CG   6  
ATOM 10469 C CD1  . TRP A 1 97  ? 9.791   5.778   11.959  1.00 0.00 ? 97  TRP A CD1  6  
ATOM 10470 C CD2  . TRP A 1 97  ? 9.374   4.126   10.505  1.00 0.00 ? 97  TRP A CD2  6  
ATOM 10471 N NE1  . TRP A 1 97  ? 8.865   4.938   12.530  1.00 0.00 ? 97  TRP A NE1  6  
ATOM 10472 C CE2  . TRP A 1 97  ? 8.592   3.918   11.657  1.00 0.00 ? 97  TRP A CE2  6  
ATOM 10473 C CE3  . TRP A 1 97  ? 9.277   3.213   9.451   1.00 0.00 ? 97  TRP A CE3  6  
ATOM 10474 C CZ2  . TRP A 1 97  ? 7.727   2.834   11.784  1.00 0.00 ? 97  TRP A CZ2  6  
ATOM 10475 C CZ3  . TRP A 1 97  ? 8.419   2.137   9.579   1.00 0.00 ? 97  TRP A CZ3  6  
ATOM 10476 C CH2  . TRP A 1 97  ? 7.653   1.955   10.738  1.00 0.00 ? 97  TRP A CH2  6  
ATOM 10477 H H    . TRP A 1 97  ? 10.032  6.271   6.962   1.00 0.00 ? 97  TRP A H    6  
ATOM 10478 H HA   . TRP A 1 97  ? 9.859   7.659   9.495   1.00 0.00 ? 97  TRP A HA   6  
ATOM 10479 H HB2  . TRP A 1 97  ? 11.510  5.163   9.140   1.00 0.00 ? 97  TRP A HB2  6  
ATOM 10480 H HB3  . TRP A 1 97  ? 11.911  6.379   10.350  1.00 0.00 ? 97  TRP A HB3  6  
ATOM 10481 H HD1  . TRP A 1 97  ? 10.198  6.668   12.413  1.00 0.00 ? 97  TRP A HD1  6  
ATOM 10482 H HE1  . TRP A 1 97  ? 8.464   5.053   13.417  1.00 0.00 ? 97  TRP A HE1  6  
ATOM 10483 H HE3  . TRP A 1 97  ? 9.860   3.336   8.550   1.00 0.00 ? 97  TRP A HE3  6  
ATOM 10484 H HZ2  . TRP A 1 97  ? 7.130   2.680   12.671  1.00 0.00 ? 97  TRP A HZ2  6  
ATOM 10485 H HZ3  . TRP A 1 97  ? 8.331   1.421   8.775   1.00 0.00 ? 97  TRP A HZ3  6  
ATOM 10486 H HH2  . TRP A 1 97  ? 6.996   1.101   10.794  1.00 0.00 ? 97  TRP A HH2  6  
ATOM 10487 N N    . ASN A 1 98  ? 11.712  9.119   8.744   1.00 0.00 ? 98  ASN A N    6  
ATOM 10488 C CA   . ASN A 1 98  ? 12.723  10.039  8.235   1.00 0.00 ? 98  ASN A CA   6  
ATOM 10489 C C    . ASN A 1 98  ? 13.359  10.833  9.372   1.00 0.00 ? 98  ASN A C    6  
ATOM 10490 O O    . ASN A 1 98  ? 12.765  10.992  10.439  1.00 0.00 ? 98  ASN A O    6  
ATOM 10491 C CB   . ASN A 1 98  ? 12.104  10.995  7.214   1.00 0.00 ? 98  ASN A CB   6  
ATOM 10492 C CG   . ASN A 1 98  ? 13.114  11.485  6.194   1.00 0.00 ? 98  ASN A CG   6  
ATOM 10493 O OD1  . ASN A 1 98  ? 14.056  10.774  5.846   1.00 0.00 ? 98  ASN A OD1  6  
ATOM 10494 N ND2  . ASN A 1 98  ? 12.922  12.707  5.711   1.00 0.00 ? 98  ASN A ND2  6  
ATOM 10495 H H    . ASN A 1 98  ? 11.110  9.418   9.457   1.00 0.00 ? 98  ASN A H    6  
ATOM 10496 H HA   . ASN A 1 98  ? 13.489  9.453   7.748   1.00 0.00 ? 98  ASN A HA   6  
ATOM 10497 H HB2  . ASN A 1 98  ? 11.309  10.486  6.688   1.00 0.00 ? 98  ASN A HB2  6  
ATOM 10498 H HB3  . ASN A 1 98  ? 11.697  11.851  7.731   1.00 0.00 ? 98  ASN A HB3  6  
ATOM 10499 H HD21 . ASN A 1 98  ? 12.149  13.217  6.034   1.00 0.00 ? 98  ASN A HD21 6  
ATOM 10500 H HD22 . ASN A 1 98  ? 13.559  13.049  5.050   1.00 0.00 ? 98  ASN A HD22 6  
ATOM 10501 N N    . SER A 1 99  ? 14.569  11.329  9.136   1.00 0.00 ? 99  SER A N    6  
ATOM 10502 C CA   . SER A 1 99  ? 15.287  12.104  10.141  1.00 0.00 ? 99  SER A CA   6  
ATOM 10503 C C    . SER A 1 99  ? 14.381  13.166  10.757  1.00 0.00 ? 99  SER A C    6  
ATOM 10504 O O    . SER A 1 99  ? 14.606  13.615  11.881  1.00 0.00 ? 99  SER A O    6  
ATOM 10505 C CB   . SER A 1 99  ? 16.519  12.766  9.521   1.00 0.00 ? 99  SER A CB   6  
ATOM 10506 O OG   . SER A 1 99  ? 17.153  13.632  10.447  1.00 0.00 ? 99  SER A OG   6  
ATOM 10507 H H    . SER A 1 99  ? 14.990  11.168  8.265   1.00 0.00 ? 99  SER A H    6  
ATOM 10508 H HA   . SER A 1 99  ? 15.605  11.425  10.918  1.00 0.00 ? 99  SER A HA   6  
ATOM 10509 H HB2  . SER A 1 99  ? 17.221  12.003  9.221   1.00 0.00 ? 99  SER A HB2  6  
ATOM 10510 H HB3  . SER A 1 99  ? 16.219  13.340  8.656   1.00 0.00 ? 99  SER A HB3  6  
ATOM 10511 H HG   . SER A 1 99  ? 17.732  13.121  11.018  1.00 0.00 ? 99  SER A HG   6  
ATOM 10512 N N    . PHE A 1 100 ? 13.355  13.565  10.012  1.00 0.00 ? 100 PHE A N    6  
ATOM 10513 C CA   . PHE A 1 100 ? 12.415  14.575  10.483  1.00 0.00 ? 100 PHE A CA   6  
ATOM 10514 C C    . PHE A 1 100 ? 11.369  13.956  11.407  1.00 0.00 ? 100 PHE A C    6  
ATOM 10515 O O    . PHE A 1 100 ? 11.233  14.353  12.563  1.00 0.00 ? 100 PHE A O    6  
ATOM 10516 C CB   . PHE A 1 100 ? 11.726  15.254  9.297   1.00 0.00 ? 100 PHE A CB   6  
ATOM 10517 C CG   . PHE A 1 100 ? 12.642  16.134  8.496   1.00 0.00 ? 100 PHE A CG   6  
ATOM 10518 C CD1  . PHE A 1 100 ? 13.655  15.585  7.727   1.00 0.00 ? 100 PHE A CD1  6  
ATOM 10519 C CD2  . PHE A 1 100 ? 12.490  17.511  8.513   1.00 0.00 ? 100 PHE A CD2  6  
ATOM 10520 C CE1  . PHE A 1 100 ? 14.500  16.393  6.989   1.00 0.00 ? 100 PHE A CE1  6  
ATOM 10521 C CE2  . PHE A 1 100 ? 13.332  18.325  7.777   1.00 0.00 ? 100 PHE A CE2  6  
ATOM 10522 C CZ   . PHE A 1 100 ? 14.337  17.764  7.014   1.00 0.00 ? 100 PHE A CZ   6  
ATOM 10523 H H    . PHE A 1 100 ? 13.228  13.170  9.124   1.00 0.00 ? 100 PHE A H    6  
ATOM 10524 H HA   . PHE A 1 100 ? 12.973  15.314  11.036  1.00 0.00 ? 100 PHE A HA   6  
ATOM 10525 H HB2  . PHE A 1 100 ? 11.334  14.496  8.636   1.00 0.00 ? 100 PHE A HB2  6  
ATOM 10526 H HB3  . PHE A 1 100 ? 10.914  15.863  9.663   1.00 0.00 ? 100 PHE A HB3  6  
ATOM 10527 H HD1  . PHE A 1 100 ? 13.783  14.512  7.706   1.00 0.00 ? 100 PHE A HD1  6  
ATOM 10528 H HD2  . PHE A 1 100 ? 11.704  17.951  9.110   1.00 0.00 ? 100 PHE A HD2  6  
ATOM 10529 H HE1  . PHE A 1 100 ? 15.285  15.952  6.393   1.00 0.00 ? 100 PHE A HE1  6  
ATOM 10530 H HE2  . PHE A 1 100 ? 13.202  19.396  7.798   1.00 0.00 ? 100 PHE A HE2  6  
ATOM 10531 H HZ   . PHE A 1 100 ? 14.996  18.398  6.439   1.00 0.00 ? 100 PHE A HZ   6  
ATOM 10532 N N    . GLY A 1 101 ? 10.632  12.980  10.886  1.00 0.00 ? 101 GLY A N    6  
ATOM 10533 C CA   . GLY A 1 101 ? 9.607   12.322  11.676  1.00 0.00 ? 101 GLY A CA   6  
ATOM 10534 C C    . GLY A 1 101 ? 9.167   11.004  11.071  1.00 0.00 ? 101 GLY A C    6  
ATOM 10535 O O    . GLY A 1 101 ? 9.994   10.142  10.774  1.00 0.00 ? 101 GLY A O    6  
ATOM 10536 H H    . GLY A 1 101 ? 10.784  12.704  9.958   1.00 0.00 ? 101 GLY A H    6  
ATOM 10537 H HA2  . GLY A 1 101 ? 9.994   12.140  12.667  1.00 0.00 ? 101 GLY A HA2  6  
ATOM 10538 H HA3  . GLY A 1 101 ? 8.750   12.975  11.748  1.00 0.00 ? 101 GLY A HA3  6  
ATOM 10539 N N    . SER A 1 102 ? 7.860   10.845  10.890  1.00 0.00 ? 102 SER A N    6  
ATOM 10540 C CA   . SER A 1 102 ? 7.310   9.620   10.322  1.00 0.00 ? 102 SER A CA   6  
ATOM 10541 C C    . SER A 1 102 ? 5.959   9.884   9.664   1.00 0.00 ? 102 SER A C    6  
ATOM 10542 O O    . SER A 1 102 ? 5.497   11.023  9.606   1.00 0.00 ? 102 SER A O    6  
ATOM 10543 C CB   . SER A 1 102 ? 7.161   8.551   11.407  1.00 0.00 ? 102 SER A CB   6  
ATOM 10544 O OG   . SER A 1 102 ? 6.429   9.048   12.514  1.00 0.00 ? 102 SER A OG   6  
ATOM 10545 H H    . SER A 1 102 ? 7.250   11.569  11.146  1.00 0.00 ? 102 SER A H    6  
ATOM 10546 H HA   . SER A 1 102 ? 7.999   9.264   9.571   1.00 0.00 ? 102 SER A HA   6  
ATOM 10547 H HB2  . SER A 1 102 ? 6.640   7.698   11.000  1.00 0.00 ? 102 SER A HB2  6  
ATOM 10548 H HB3  . SER A 1 102 ? 8.141   8.247   11.745  1.00 0.00 ? 102 SER A HB3  6  
ATOM 10549 H HG   . SER A 1 102 ? 5.489   8.951   12.346  1.00 0.00 ? 102 SER A HG   6  
ATOM 10550 N N    . ASP A 1 103 ? 5.331   8.823   9.170   1.00 0.00 ? 103 ASP A N    6  
ATOM 10551 C CA   . ASP A 1 103 ? 4.032   8.938   8.517   1.00 0.00 ? 103 ASP A CA   6  
ATOM 10552 C C    . ASP A 1 103 ? 3.297   7.601   8.530   1.00 0.00 ? 103 ASP A C    6  
ATOM 10553 O O    . ASP A 1 103 ? 3.895   6.553   8.774   1.00 0.00 ? 103 ASP A O    6  
ATOM 10554 C CB   . ASP A 1 103 ? 4.202   9.427   7.078   1.00 0.00 ? 103 ASP A CB   6  
ATOM 10555 C CG   . ASP A 1 103 ? 4.850   8.387   6.186   1.00 0.00 ? 103 ASP A CG   6  
ATOM 10556 O OD1  . ASP A 1 103 ? 5.210   7.306   6.699   1.00 0.00 ? 103 ASP A OD1  6  
ATOM 10557 O OD2  . ASP A 1 103 ? 4.996   8.652   4.975   1.00 0.00 ? 103 ASP A OD2  6  
ATOM 10558 H H    . ASP A 1 103 ? 5.751   7.940   9.248   1.00 0.00 ? 103 ASP A H    6  
ATOM 10559 H HA   . ASP A 1 103 ? 3.448   9.661   9.067   1.00 0.00 ? 103 ASP A HA   6  
ATOM 10560 H HB2  . ASP A 1 103 ? 3.232   9.670   6.670   1.00 0.00 ? 103 ASP A HB2  6  
ATOM 10561 H HB3  . ASP A 1 103 ? 4.821   10.312  7.077   1.00 0.00 ? 103 ASP A HB3  6  
ATOM 10562 N N    . THR A 1 104 ? 1.995   7.645   8.266   1.00 0.00 ? 104 THR A N    6  
ATOM 10563 C CA   . THR A 1 104 ? 1.177   6.439   8.248   1.00 0.00 ? 104 THR A CA   6  
ATOM 10564 C C    . THR A 1 104 ? -0.173  6.699   7.590   1.00 0.00 ? 104 THR A C    6  
ATOM 10565 O O    . THR A 1 104 ? -0.943  7.544   8.046   1.00 0.00 ? 104 THR A O    6  
ATOM 10566 C CB   . THR A 1 104 ? 0.946   5.897   9.672   1.00 0.00 ? 104 THR A CB   6  
ATOM 10567 O OG1  . THR A 1 104 ? 2.194   5.798   10.367  1.00 0.00 ? 104 THR A OG1  6  
ATOM 10568 C CG2  . THR A 1 104 ? 0.274   4.533   9.628   1.00 0.00 ? 104 THR A CG2  6  
ATOM 10569 H H    . THR A 1 104 ? 1.575   8.511   8.079   1.00 0.00 ? 104 THR A H    6  
ATOM 10570 H HA   . THR A 1 104 ? 1.705   5.686   7.680   1.00 0.00 ? 104 THR A HA   6  
ATOM 10571 H HB   . THR A 1 104 ? 0.300   6.583   10.201  1.00 0.00 ? 104 THR A HB   6  
ATOM 10572 H HG1  . THR A 1 104 ? 2.450   6.665   10.689  1.00 0.00 ? 104 THR A HG1  6  
ATOM 10573 H HG21 . THR A 1 104 ? 0.815   3.886   8.954   1.00 0.00 ? 104 THR A HG21 6  
ATOM 10574 H HG22 . THR A 1 104 ? -0.743  4.643   9.283   1.00 0.00 ? 104 THR A HG22 6  
ATOM 10575 H HG23 . THR A 1 104 ? 0.273   4.101   10.618  1.00 0.00 ? 104 THR A HG23 6  
ATOM 10576 N N    . GLU A 1 105 ? -0.454  5.967   6.517   1.00 0.00 ? 105 GLU A N    6  
ATOM 10577 C CA   . GLU A 1 105 ? -1.712  6.120   5.796   1.00 0.00 ? 105 GLU A CA   6  
ATOM 10578 C C    . GLU A 1 105 ? -2.485  4.804   5.765   1.00 0.00 ? 105 GLU A C    6  
ATOM 10579 O O    . GLU A 1 105 ? -1.897  3.726   5.854   1.00 0.00 ? 105 GLU A O    6  
ATOM 10580 C CB   . GLU A 1 105 ? -1.453  6.606   4.369   1.00 0.00 ? 105 GLU A CB   6  
ATOM 10581 C CG   . GLU A 1 105 ? -2.721  6.929   3.596   1.00 0.00 ? 105 GLU A CG   6  
ATOM 10582 C CD   . GLU A 1 105 ? -3.344  8.244   4.020   1.00 0.00 ? 105 GLU A CD   6  
ATOM 10583 O OE1  . GLU A 1 105 ? -3.393  8.512   5.239   1.00 0.00 ? 105 GLU A OE1  6  
ATOM 10584 O OE2  . GLU A 1 105 ? -3.782  9.006   3.133   1.00 0.00 ? 105 GLU A OE2  6  
ATOM 10585 H H    . GLU A 1 105 ? 0.201   5.309   6.202   1.00 0.00 ? 105 GLU A H    6  
ATOM 10586 H HA   . GLU A 1 105 ? -2.304  6.858   6.316   1.00 0.00 ? 105 GLU A HA   6  
ATOM 10587 H HB2  . GLU A 1 105 ? -0.844  7.497   4.410   1.00 0.00 ? 105 GLU A HB2  6  
ATOM 10588 H HB3  . GLU A 1 105 ? -0.915  5.838   3.833   1.00 0.00 ? 105 GLU A HB3  6  
ATOM 10589 H HG2  . GLU A 1 105 ? -2.482  6.984   2.545   1.00 0.00 ? 105 GLU A HG2  6  
ATOM 10590 H HG3  . GLU A 1 105 ? -3.438  6.138   3.760   1.00 0.00 ? 105 GLU A HG3  6  
ATOM 10591 N N    . ILE A 1 106 ? -3.804  4.902   5.638   1.00 0.00 ? 106 ILE A N    6  
ATOM 10592 C CA   . ILE A 1 106 ? -4.656  3.721   5.594   1.00 0.00 ? 106 ILE A CA   6  
ATOM 10593 C C    . ILE A 1 106 ? -5.191  3.481   4.186   1.00 0.00 ? 106 ILE A C    6  
ATOM 10594 O O    . ILE A 1 106 ? -5.539  4.423   3.475   1.00 0.00 ? 106 ILE A O    6  
ATOM 10595 C CB   . ILE A 1 106 ? -5.843  3.846   6.567   1.00 0.00 ? 106 ILE A CB   6  
ATOM 10596 C CG1  . ILE A 1 106 ? -5.343  4.179   7.975   1.00 0.00 ? 106 ILE A CG1  6  
ATOM 10597 C CG2  . ILE A 1 106 ? -6.657  2.561   6.578   1.00 0.00 ? 106 ILE A CG2  6  
ATOM 10598 C CD1  . ILE A 1 106 ? -6.401  4.800   8.860   1.00 0.00 ? 106 ILE A CD1  6  
ATOM 10599 H H    . ILE A 1 106 ? -4.213  5.790   5.571   1.00 0.00 ? 106 ILE A H    6  
ATOM 10600 H HA   . ILE A 1 106 ? -4.061  2.869   5.891   1.00 0.00 ? 106 ILE A HA   6  
ATOM 10601 H HB   . ILE A 1 106 ? -6.481  4.645   6.221   1.00 0.00 ? 106 ILE A HB   6  
ATOM 10602 H HG12 . ILE A 1 106 ? -5.001  3.274   8.452   1.00 0.00 ? 106 ILE A HG12 6  
ATOM 10603 H HG13 . ILE A 1 106 ? -4.521  4.876   7.901   1.00 0.00 ? 106 ILE A HG13 6  
ATOM 10604 H HG21 . ILE A 1 106 ? -7.197  2.469   5.648   1.00 0.00 ? 106 ILE A HG21 6  
ATOM 10605 H HG22 . ILE A 1 106 ? -5.994  1.717   6.694   1.00 0.00 ? 106 ILE A HG22 6  
ATOM 10606 H HG23 . ILE A 1 106 ? -7.357  2.585   7.400   1.00 0.00 ? 106 ILE A HG23 6  
ATOM 10607 H HD11 . ILE A 1 106 ? -7.313  4.929   8.296   1.00 0.00 ? 106 ILE A HD11 6  
ATOM 10608 H HD12 . ILE A 1 106 ? -6.588  4.154   9.705   1.00 0.00 ? 106 ILE A HD12 6  
ATOM 10609 H HD13 . ILE A 1 106 ? -6.057  5.762   9.212   1.00 0.00 ? 106 ILE A HD13 6  
ATOM 10610 N N    . ILE A 1 107 ? -5.255  2.213   3.792   1.00 0.00 ? 107 ILE A N    6  
ATOM 10611 C CA   . ILE A 1 107 ? -5.751  1.849   2.470   1.00 0.00 ? 107 ILE A CA   6  
ATOM 10612 C C    . ILE A 1 107 ? -6.491  0.517   2.508   1.00 0.00 ? 107 ILE A C    6  
ATOM 10613 O O    . ILE A 1 107 ? -5.889  -0.533  2.738   1.00 0.00 ? 107 ILE A O    6  
ATOM 10614 C CB   . ILE A 1 107 ? -4.605  1.759   1.445   1.00 0.00 ? 107 ILE A CB   6  
ATOM 10615 C CG1  . ILE A 1 107 ? -3.885  3.104   1.332   1.00 0.00 ? 107 ILE A CG1  6  
ATOM 10616 C CG2  . ILE A 1 107 ? -5.141  1.323   0.089   1.00 0.00 ? 107 ILE A CG2  6  
ATOM 10617 C CD1  . ILE A 1 107 ? -2.719  3.247   2.284   1.00 0.00 ? 107 ILE A CD1  6  
ATOM 10618 H H    . ILE A 1 107 ? -4.964  1.507   4.404   1.00 0.00 ? 107 ILE A H    6  
ATOM 10619 H HA   . ILE A 1 107 ? -6.436  2.620   2.148   1.00 0.00 ? 107 ILE A HA   6  
ATOM 10620 H HB   . ILE A 1 107 ? -3.906  1.011   1.785   1.00 0.00 ? 107 ILE A HB   6  
ATOM 10621 H HG12 . ILE A 1 107 ? -3.509  3.221   0.328   1.00 0.00 ? 107 ILE A HG12 6  
ATOM 10622 H HG13 . ILE A 1 107 ? -4.587  3.898   1.543   1.00 0.00 ? 107 ILE A HG13 6  
ATOM 10623 H HG21 . ILE A 1 107 ? -4.449  0.630   -0.366  1.00 0.00 ? 107 ILE A HG21 6  
ATOM 10624 H HG22 . ILE A 1 107 ? -6.099  0.841   0.219   1.00 0.00 ? 107 ILE A HG22 6  
ATOM 10625 H HG23 . ILE A 1 107 ? -5.256  2.187   -0.548  1.00 0.00 ? 107 ILE A HG23 6  
ATOM 10626 H HD11 . ILE A 1 107 ? -2.324  4.250   2.223   1.00 0.00 ? 107 ILE A HD11 6  
ATOM 10627 H HD12 . ILE A 1 107 ? -3.051  3.050   3.293   1.00 0.00 ? 107 ILE A HD12 6  
ATOM 10628 H HD13 . ILE A 1 107 ? -1.946  2.540   2.016   1.00 0.00 ? 107 ILE A HD13 6  
ATOM 10629 N N    . ARG A 1 108 ? -7.799  0.566   2.280   1.00 0.00 ? 108 ARG A N    6  
ATOM 10630 C CA   . ARG A 1 108 ? -8.622  -0.638  2.288   1.00 0.00 ? 108 ARG A CA   6  
ATOM 10631 C C    . ARG A 1 108 ? -8.934  -1.092  0.865   1.00 0.00 ? 108 ARG A C    6  
ATOM 10632 O O    . ARG A 1 108 ? -9.909  -0.646  0.260   1.00 0.00 ? 108 ARG A O    6  
ATOM 10633 C CB   . ARG A 1 108 ? -9.923  -0.388  3.052   1.00 0.00 ? 108 ARG A CB   6  
ATOM 10634 C CG   . ARG A 1 108 ? -9.759  -0.423  4.563   1.00 0.00 ? 108 ARG A CG   6  
ATOM 10635 C CD   . ARG A 1 108 ? -9.063  0.828   5.077   1.00 0.00 ? 108 ARG A CD   6  
ATOM 10636 N NE   . ARG A 1 108 ? -9.831  2.038   4.793   1.00 0.00 ? 108 ARG A NE   6  
ATOM 10637 C CZ   . ARG A 1 108 ? -10.917 2.394   5.470   1.00 0.00 ? 108 ARG A CZ   6  
ATOM 10638 N NH1  . ARG A 1 108 ? -11.360 1.638   6.465   1.00 0.00 ? 108 ARG A NH1  6  
ATOM 10639 N NH2  . ARG A 1 108 ? -11.561 3.510   5.152   1.00 0.00 ? 108 ARG A NH2  6  
ATOM 10640 H H    . ARG A 1 108 ? -8.222  1.432   2.104   1.00 0.00 ? 108 ARG A H    6  
ATOM 10641 H HA   . ARG A 1 108 ? -8.065  -1.417  2.788   1.00 0.00 ? 108 ARG A HA   6  
ATOM 10642 H HB2  . ARG A 1 108 ? -10.308 0.583   2.777   1.00 0.00 ? 108 ARG A HB2  6  
ATOM 10643 H HB3  . ARG A 1 108 ? -10.641 -1.143  2.772   1.00 0.00 ? 108 ARG A HB3  6  
ATOM 10644 H HG2  . ARG A 1 108 ? -10.735 -0.492  5.020   1.00 0.00 ? 108 ARG A HG2  6  
ATOM 10645 H HG3  . ARG A 1 108 ? -9.171  -1.287  4.832   1.00 0.00 ? 108 ARG A HG3  6  
ATOM 10646 H HD2  . ARG A 1 108 ? -8.933  0.739   6.145   1.00 0.00 ? 108 ARG A HD2  6  
ATOM 10647 H HD3  . ARG A 1 108 ? -8.096  0.907   4.602   1.00 0.00 ? 108 ARG A HD3  6  
ATOM 10648 H HE   . ARG A 1 108 ? -9.521  2.611   4.061   1.00 0.00 ? 108 ARG A HE   6  
ATOM 10649 H HH11 . ARG A 1 108 ? -10.875 0.798   6.707   1.00 0.00 ? 108 ARG A HH11 6  
ATOM 10650 H HH12 . ARG A 1 108 ? -12.177 1.910   6.974   1.00 0.00 ? 108 ARG A HH12 6  
ATOM 10651 H HH21 . ARG A 1 108 ? -11.230 4.082   4.402   1.00 0.00 ? 108 ARG A HH21 6  
ATOM 10652 H HH22 . ARG A 1 108 ? -12.378 3.777   5.662   1.00 0.00 ? 108 ARG A HH22 6  
ATOM 10653 N N    . LEU A 1 109 ? -8.100  -1.981  0.337   1.00 0.00 ? 109 LEU A N    6  
ATOM 10654 C CA   . LEU A 1 109 ? -8.287  -2.496  -1.015  1.00 0.00 ? 109 LEU A CA   6  
ATOM 10655 C C    . LEU A 1 109 ? -9.709  -3.012  -1.210  1.00 0.00 ? 109 LEU A C    6  
ATOM 10656 O O    . LEU A 1 109 ? -10.290 -3.618  -0.310  1.00 0.00 ? 109 LEU A O    6  
ATOM 10657 C CB   . LEU A 1 109 ? -7.283  -3.615  -1.299  1.00 0.00 ? 109 LEU A CB   6  
ATOM 10658 C CG   . LEU A 1 109 ? -7.193  -4.083  -2.752  1.00 0.00 ? 109 LEU A CG   6  
ATOM 10659 C CD1  . LEU A 1 109 ? -6.835  -2.922  -3.666  1.00 0.00 ? 109 LEU A CD1  6  
ATOM 10660 C CD2  . LEU A 1 109 ? -6.175  -5.206  -2.888  1.00 0.00 ? 109 LEU A CD2  6  
ATOM 10661 H H    . LEU A 1 109 ? -7.341  -2.300  0.868   1.00 0.00 ? 109 LEU A H    6  
ATOM 10662 H HA   . LEU A 1 109 ? -8.113  -1.684  -1.705  1.00 0.00 ? 109 LEU A HA   6  
ATOM 10663 H HB2  . LEU A 1 109 ? -6.306  -3.264  -1.004  1.00 0.00 ? 109 LEU A HB2  6  
ATOM 10664 H HB3  . LEU A 1 109 ? -7.557  -4.466  -0.692  1.00 0.00 ? 109 LEU A HB3  6  
ATOM 10665 H HG   . LEU A 1 109 ? -8.157  -4.466  -3.060  1.00 0.00 ? 109 LEU A HG   6  
ATOM 10666 H HD11 . LEU A 1 109 ? -5.976  -2.403  -3.270  1.00 0.00 ? 109 LEU A HD11 6  
ATOM 10667 H HD12 . LEU A 1 109 ? -7.671  -2.241  -3.727  1.00 0.00 ? 109 LEU A HD12 6  
ATOM 10668 H HD13 . LEU A 1 109 ? -6.606  -3.299  -4.653  1.00 0.00 ? 109 LEU A HD13 6  
ATOM 10669 H HD21 . LEU A 1 109 ? -6.295  -5.686  -3.849  1.00 0.00 ? 109 LEU A HD21 6  
ATOM 10670 H HD22 . LEU A 1 109 ? -6.330  -5.930  -2.102  1.00 0.00 ? 109 LEU A HD22 6  
ATOM 10671 H HD23 . LEU A 1 109 ? -5.178  -4.798  -2.812  1.00 0.00 ? 109 LEU A HD23 6  
ATOM 10672 N N    . LYS A 1 110 ? -10.264 -2.769  -2.393  1.00 0.00 ? 110 LYS A N    6  
ATOM 10673 C CA   . LYS A 1 110 ? -11.617 -3.212  -2.709  1.00 0.00 ? 110 LYS A CA   6  
ATOM 10674 C C    . LYS A 1 110 ? -11.694 -3.750  -4.134  1.00 0.00 ? 110 LYS A C    6  
ATOM 10675 O O    . LYS A 1 110 ? -10.894 -3.376  -4.992  1.00 0.00 ? 110 LYS A O    6  
ATOM 10676 C CB   . LYS A 1 110 ? -12.607 -2.058  -2.534  1.00 0.00 ? 110 LYS A CB   6  
ATOM 10677 C CG   . LYS A 1 110 ? -12.884 -1.710  -1.082  1.00 0.00 ? 110 LYS A CG   6  
ATOM 10678 C CD   . LYS A 1 110 ? -14.075 -2.483  -0.541  1.00 0.00 ? 110 LYS A CD   6  
ATOM 10679 C CE   . LYS A 1 110 ? -13.688 -3.900  -0.149  1.00 0.00 ? 110 LYS A CE   6  
ATOM 10680 N NZ   . LYS A 1 110 ? -13.873 -4.857  -1.275  1.00 0.00 ? 110 LYS A NZ   6  
ATOM 10681 H H    . LYS A 1 110 ? -9.750  -2.281  -3.070  1.00 0.00 ? 110 LYS A H    6  
ATOM 10682 H HA   . LYS A 1 110 ? -11.875 -4.004  -2.023  1.00 0.00 ? 110 LYS A HA   6  
ATOM 10683 H HB2  . LYS A 1 110 ? -12.209 -1.181  -3.023  1.00 0.00 ? 110 LYS A HB2  6  
ATOM 10684 H HB3  . LYS A 1 110 ? -13.542 -2.328  -3.003  1.00 0.00 ? 110 LYS A HB3  6  
ATOM 10685 H HG2  . LYS A 1 110 ? -12.014 -1.951  -0.490  1.00 0.00 ? 110 LYS A HG2  6  
ATOM 10686 H HG3  . LYS A 1 110 ? -13.090 -0.651  -1.008  1.00 0.00 ? 110 LYS A HG3  6  
ATOM 10687 H HD2  . LYS A 1 110 ? -14.459 -1.973  0.330   1.00 0.00 ? 110 LYS A HD2  6  
ATOM 10688 H HD3  . LYS A 1 110 ? -14.841 -2.525  -1.302  1.00 0.00 ? 110 LYS A HD3  6  
ATOM 10689 H HE2  . LYS A 1 110 ? -12.652 -3.907  0.151   1.00 0.00 ? 110 LYS A HE2  6  
ATOM 10690 H HE3  . LYS A 1 110 ? -14.305 -4.211  0.682   1.00 0.00 ? 110 LYS A HE3  6  
ATOM 10691 H HZ1  . LYS A 1 110 ? -14.100 -4.341  -2.149  1.00 0.00 ? 110 LYS A HZ1  6  
ATOM 10692 H HZ2  . LYS A 1 110 ? -14.651 -5.514  -1.062  1.00 0.00 ? 110 LYS A HZ2  6  
ATOM 10693 H HZ3  . LYS A 1 110 ? -13.002 -5.406  -1.425  1.00 0.00 ? 110 LYS A HZ3  6  
ATOM 10694 N N    . GLU A 1 111 ? -12.662 -4.627  -4.379  1.00 0.00 ? 111 GLU A N    6  
ATOM 10695 C CA   . GLU A 1 111 ? -12.842 -5.215  -5.701  1.00 0.00 ? 111 GLU A CA   6  
ATOM 10696 C C    . GLU A 1 111 ? -13.122 -4.136  -6.743  1.00 0.00 ? 111 GLU A C    6  
ATOM 10697 O O    . GLU A 1 111 ? -13.593 -3.048  -6.413  1.00 0.00 ? 111 GLU A O    6  
ATOM 10698 C CB   . GLU A 1 111 ? -13.988 -6.229  -5.681  1.00 0.00 ? 111 GLU A CB   6  
ATOM 10699 C CG   . GLU A 1 111 ? -13.825 -7.353  -6.690  1.00 0.00 ? 111 GLU A CG   6  
ATOM 10700 C CD   . GLU A 1 111 ? -14.929 -8.388  -6.594  1.00 0.00 ? 111 GLU A CD   6  
ATOM 10701 O OE1  . GLU A 1 111 ? -16.041 -8.031  -6.155  1.00 0.00 ? 111 GLU A OE1  6  
ATOM 10702 O OE2  . GLU A 1 111 ? -14.679 -9.556  -6.960  1.00 0.00 ? 111 GLU A OE2  6  
ATOM 10703 H H    . GLU A 1 111 ? -13.268 -4.886  -3.654  1.00 0.00 ? 111 GLU A H    6  
ATOM 10704 H HA   . GLU A 1 111 ? -11.928 -5.725  -5.965  1.00 0.00 ? 111 GLU A HA   6  
ATOM 10705 H HB2  . GLU A 1 111 ? -14.050 -6.664  -4.694  1.00 0.00 ? 111 GLU A HB2  6  
ATOM 10706 H HB3  . GLU A 1 111 ? -14.913 -5.713  -5.895  1.00 0.00 ? 111 GLU A HB3  6  
ATOM 10707 H HG2  . GLU A 1 111 ? -13.833 -6.932  -7.684  1.00 0.00 ? 111 GLU A HG2  6  
ATOM 10708 H HG3  . GLU A 1 111 ? -12.877 -7.842  -6.515  1.00 0.00 ? 111 GLU A HG3  6  
ATOM 10709 N N    . GLN A 1 112 ? -12.828 -4.446  -8.002  1.00 0.00 ? 112 GLN A N    6  
ATOM 10710 C CA   . GLN A 1 112 ? -13.047 -3.503  -9.091  1.00 0.00 ? 112 GLN A CA   6  
ATOM 10711 C C    . GLN A 1 112 ? -14.384 -2.787  -8.932  1.00 0.00 ? 112 GLN A C    6  
ATOM 10712 O O    . GLN A 1 112 ? -15.420 -3.422  -8.738  1.00 0.00 ? 112 GLN A O    6  
ATOM 10713 C CB   . GLN A 1 112 ? -13.000 -4.227  -10.438 1.00 0.00 ? 112 GLN A CB   6  
ATOM 10714 C CG   . GLN A 1 112 ? -12.885 -3.289  -11.629 1.00 0.00 ? 112 GLN A CG   6  
ATOM 10715 C CD   . GLN A 1 112 ? -13.416 -3.904  -12.909 1.00 0.00 ? 112 GLN A CD   6  
ATOM 10716 O OE1  . GLN A 1 112 ? -14.612 -3.831  -13.197 1.00 0.00 ? 112 GLN A OE1  6  
ATOM 10717 N NE2  . GLN A 1 112 ? -12.529 -4.514  -13.686 1.00 0.00 ? 112 GLN A NE2  6  
ATOM 10718 H H    . GLN A 1 112 ? -12.455 -5.329  -8.201  1.00 0.00 ? 112 GLN A H    6  
ATOM 10719 H HA   . GLN A 1 112 ? -12.255 -2.770  -9.059  1.00 0.00 ? 112 GLN A HA   6  
ATOM 10720 H HB2  . GLN A 1 112 ? -12.149 -4.891  -10.447 1.00 0.00 ? 112 GLN A HB2  6  
ATOM 10721 H HB3  . GLN A 1 112 ? -13.902 -4.809  -10.552 1.00 0.00 ? 112 GLN A HB3  6  
ATOM 10722 H HG2  . GLN A 1 112 ? -13.447 -2.391  -11.420 1.00 0.00 ? 112 GLN A HG2  6  
ATOM 10723 H HG3  . GLN A 1 112 ? -11.845 -3.036  -11.773 1.00 0.00 ? 112 GLN A HG3  6  
ATOM 10724 H HE21 . GLN A 1 112 ? -11.594 -4.534  -13.392 1.00 0.00 ? 112 GLN A HE21 6  
ATOM 10725 H HE22 . GLN A 1 112 ? -12.845 -4.921  -14.518 1.00 0.00 ? 112 GLN A HE22 6  
ATOM 10726 N N    . GLY A 1 113 ? -14.354 -1.460  -9.015  1.00 0.00 ? 113 GLY A N    6  
ATOM 10727 C CA   . GLY A 1 113 ? -15.570 -0.680  -8.877  1.00 0.00 ? 113 GLY A CA   6  
ATOM 10728 C C    . GLY A 1 113 ? -15.813 -0.233  -7.449  1.00 0.00 ? 113 GLY A C    6  
ATOM 10729 O O    . GLY A 1 113 ? -15.070 -0.604  -6.541  1.00 0.00 ? 113 GLY A O    6  
ATOM 10730 H H    . GLY A 1 113 ? -13.499 -1.008  -9.171  1.00 0.00 ? 113 GLY A H    6  
ATOM 10731 H HA2  . GLY A 1 113 ? -15.499 0.192   -9.510  1.00 0.00 ? 113 GLY A HA2  6  
ATOM 10732 H HA3  . GLY A 1 113 ? -16.407 -1.281  -9.201  1.00 0.00 ? 113 GLY A HA3  6  
ATOM 10733 N N    . SER A 1 114 ? -16.855 0.567   -7.251  1.00 0.00 ? 114 SER A N    6  
ATOM 10734 C CA   . SER A 1 114 ? -17.191 1.070   -5.924  1.00 0.00 ? 114 SER A CA   6  
ATOM 10735 C C    . SER A 1 114 ? -18.702 1.087   -5.716  1.00 0.00 ? 114 SER A C    6  
ATOM 10736 O O    . SER A 1 114 ? -19.419 1.856   -6.356  1.00 0.00 ? 114 SER A O    6  
ATOM 10737 C CB   . SER A 1 114 ? -16.623 2.478   -5.730  1.00 0.00 ? 114 SER A CB   6  
ATOM 10738 O OG   . SER A 1 114 ? -16.790 2.915   -4.393  1.00 0.00 ? 114 SER A OG   6  
ATOM 10739 H H    . SER A 1 114 ? -17.410 0.828   -8.016  1.00 0.00 ? 114 SER A H    6  
ATOM 10740 H HA   . SER A 1 114 ? -16.747 0.408   -5.196  1.00 0.00 ? 114 SER A HA   6  
ATOM 10741 H HB2  . SER A 1 114 ? -15.569 2.473   -5.966  1.00 0.00 ? 114 SER A HB2  6  
ATOM 10742 H HB3  . SER A 1 114 ? -17.136 3.164   -6.388  1.00 0.00 ? 114 SER A HB3  6  
ATOM 10743 H HG   . SER A 1 114 ? -15.964 3.283   -4.070  1.00 0.00 ? 114 SER A HG   6  
ATOM 10744 N N    . GLU A 1 115 ? -19.179 0.232   -4.816  1.00 0.00 ? 115 GLU A N    6  
ATOM 10745 C CA   . GLU A 1 115 ? -20.605 0.148   -4.524  1.00 0.00 ? 115 GLU A CA   6  
ATOM 10746 C C    . GLU A 1 115 ? -20.845 -0.004  -3.025  1.00 0.00 ? 115 GLU A C    6  
ATOM 10747 O O    . GLU A 1 115 ? -19.998 -0.524  -2.299  1.00 0.00 ? 115 GLU A O    6  
ATOM 10748 C CB   . GLU A 1 115 ? -21.233 -1.028  -5.274  1.00 0.00 ? 115 GLU A CB   6  
ATOM 10749 C CG   . GLU A 1 115 ? -22.700 -1.249  -4.942  1.00 0.00 ? 115 GLU A CG   6  
ATOM 10750 C CD   . GLU A 1 115 ? -23.241 -2.541  -5.521  1.00 0.00 ? 115 GLU A CD   6  
ATOM 10751 O OE1  . GLU A 1 115 ? -22.482 -3.532  -5.572  1.00 0.00 ? 115 GLU A OE1  6  
ATOM 10752 O OE2  . GLU A 1 115 ? -24.423 -2.562  -5.924  1.00 0.00 ? 115 GLU A OE2  6  
ATOM 10753 H H    . GLU A 1 115 ? -18.557 -0.355  -4.338  1.00 0.00 ? 115 GLU A H    6  
ATOM 10754 H HA   . GLU A 1 115 ? -21.067 1.064   -4.859  1.00 0.00 ? 115 GLU A HA   6  
ATOM 10755 H HB2  . GLU A 1 115 ? -21.148 -0.850  -6.336  1.00 0.00 ? 115 GLU A HB2  6  
ATOM 10756 H HB3  . GLU A 1 115 ? -20.691 -1.928  -5.025  1.00 0.00 ? 115 GLU A HB3  6  
ATOM 10757 H HG2  . GLU A 1 115 ? -22.812 -1.278  -3.869  1.00 0.00 ? 115 GLU A HG2  6  
ATOM 10758 H HG3  . GLU A 1 115 ? -23.273 -0.425  -5.340  1.00 0.00 ? 115 GLU A HG3  6  
ATOM 10759 N N    . MET A 1 116 ? -22.006 0.455   -2.568  1.00 0.00 ? 116 MET A N    6  
ATOM 10760 C CA   . MET A 1 116 ? -22.359 0.369   -1.155  1.00 0.00 ? 116 MET A CA   6  
ATOM 10761 C C    . MET A 1 116 ? -23.294 -0.808  -0.898  1.00 0.00 ? 116 MET A C    6  
ATOM 10762 O O    . MET A 1 116 ? -24.468 -0.772  -1.265  1.00 0.00 ? 116 MET A O    6  
ATOM 10763 C CB   . MET A 1 116 ? -23.018 1.670   -0.693  1.00 0.00 ? 116 MET A CB   6  
ATOM 10764 C CG   . MET A 1 116 ? -22.029 2.706   -0.185  1.00 0.00 ? 116 MET A CG   6  
ATOM 10765 S SD   . MET A 1 116 ? -22.837 4.098   0.628   1.00 0.00 ? 116 MET A SD   6  
ATOM 10766 C CE   . MET A 1 116 ? -23.074 5.209   -0.757  1.00 0.00 ? 116 MET A CE   6  
ATOM 10767 H H    . MET A 1 116 ? -22.642 0.859   -3.195  1.00 0.00 ? 116 MET A H    6  
ATOM 10768 H HA   . MET A 1 116 ? -21.448 0.220   -0.596  1.00 0.00 ? 116 MET A HA   6  
ATOM 10769 H HB2  . MET A 1 116 ? -23.562 2.098   -1.522  1.00 0.00 ? 116 MET A HB2  6  
ATOM 10770 H HB3  . MET A 1 116 ? -23.711 1.445   0.104   1.00 0.00 ? 116 MET A HB3  6  
ATOM 10771 H HG2  . MET A 1 116 ? -21.363 2.233   0.521   1.00 0.00 ? 116 MET A HG2  6  
ATOM 10772 H HG3  . MET A 1 116 ? -21.458 3.078   -1.023  1.00 0.00 ? 116 MET A HG3  6  
ATOM 10773 H HE1  . MET A 1 116 ? -22.270 5.929   -0.782  1.00 0.00 ? 116 MET A HE1  6  
ATOM 10774 H HE2  . MET A 1 116 ? -23.078 4.641   -1.676  1.00 0.00 ? 116 MET A HE2  6  
ATOM 10775 H HE3  . MET A 1 116 ? -24.017 5.724   -0.647  1.00 0.00 ? 116 MET A HE3  6  
ATOM 10776 N N    . SER A 1 117 ? -22.765 -1.851  -0.267  1.00 0.00 ? 117 SER A N    6  
ATOM 10777 C CA   . SER A 1 117 ? -23.551 -3.041  0.035   1.00 0.00 ? 117 SER A CA   6  
ATOM 10778 C C    . SER A 1 117 ? -23.432 -3.411  1.511   1.00 0.00 ? 117 SER A C    6  
ATOM 10779 O O    . SER A 1 117 ? -22.331 -3.502  2.053   1.00 0.00 ? 117 SER A O    6  
ATOM 10780 C CB   . SER A 1 117 ? -23.095 -4.214  -0.835  1.00 0.00 ? 117 SER A CB   6  
ATOM 10781 O OG   . SER A 1 117 ? -21.724 -4.503  -0.623  1.00 0.00 ? 117 SER A OG   6  
ATOM 10782 H H    . SER A 1 117 ? -21.822 -1.820  0.000   1.00 0.00 ? 117 SER A H    6  
ATOM 10783 H HA   . SER A 1 117 ? -24.585 -2.821  -0.186  1.00 0.00 ? 117 SER A HA   6  
ATOM 10784 H HB2  . SER A 1 117 ? -23.677 -5.089  -0.588  1.00 0.00 ? 117 SER A HB2  6  
ATOM 10785 H HB3  . SER A 1 117 ? -23.242 -3.965  -1.876  1.00 0.00 ? 117 SER A HB3  6  
ATOM 10786 H HG   . SER A 1 117 ? -21.201 -3.717  -0.796  1.00 0.00 ? 117 SER A HG   6  
ATOM 10787 N N    . GLY A 1 118 ? -24.575 -3.624  2.155   1.00 0.00 ? 118 GLY A N    6  
ATOM 10788 C CA   . GLY A 1 118 ? -24.579 -3.982  3.562   1.00 0.00 ? 118 GLY A CA   6  
ATOM 10789 C C    . GLY A 1 118 ? -25.502 -3.102  4.381   1.00 0.00 ? 118 GLY A C    6  
ATOM 10790 O O    . GLY A 1 118 ? -25.627 -1.901  4.139   1.00 0.00 ? 118 GLY A O    6  
ATOM 10791 H H    . GLY A 1 118 ? -25.424 -3.538  1.672   1.00 0.00 ? 118 GLY A H    6  
ATOM 10792 H HA2  . GLY A 1 118 ? -24.896 -5.009  3.660   1.00 0.00 ? 118 GLY A HA2  6  
ATOM 10793 H HA3  . GLY A 1 118 ? -23.574 -3.887  3.948   1.00 0.00 ? 118 GLY A HA3  6  
ATOM 10794 N N    . PRO A 1 119 ? -26.170 -3.704  5.376   1.00 0.00 ? 119 PRO A N    6  
ATOM 10795 C CA   . PRO A 1 119 ? -27.099 -2.986  6.254   1.00 0.00 ? 119 PRO A CA   6  
ATOM 10796 C C    . PRO A 1 119 ? -26.383 -2.018  7.189   1.00 0.00 ? 119 PRO A C    6  
ATOM 10797 O O    . PRO A 1 119 ? -25.464 -2.404  7.912   1.00 0.00 ? 119 PRO A O    6  
ATOM 10798 C CB   . PRO A 1 119 ? -27.769 -4.106  7.054   1.00 0.00 ? 119 PRO A CB   6  
ATOM 10799 C CG   . PRO A 1 119 ? -26.781 -5.221  7.044   1.00 0.00 ? 119 PRO A CG   6  
ATOM 10800 C CD   . PRO A 1 119 ? -26.070 -5.132  5.722   1.00 0.00 ? 119 PRO A CD   6  
ATOM 10801 H HA   . PRO A 1 119 ? -27.846 -2.450  5.687   1.00 0.00 ? 119 PRO A HA   6  
ATOM 10802 H HB2  . PRO A 1 119 ? -27.968 -3.763  8.060   1.00 0.00 ? 119 PRO A HB2  6  
ATOM 10803 H HB3  . PRO A 1 119 ? -28.693 -4.393  6.575   1.00 0.00 ? 119 PRO A HB3  6  
ATOM 10804 H HG2  . PRO A 1 119 ? -26.081 -5.100  7.856   1.00 0.00 ? 119 PRO A HG2  6  
ATOM 10805 H HG3  . PRO A 1 119 ? -27.296 -6.167  7.128   1.00 0.00 ? 119 PRO A HG3  6  
ATOM 10806 H HD2  . PRO A 1 119 ? -25.037 -5.431  5.828   1.00 0.00 ? 119 PRO A HD2  6  
ATOM 10807 H HD3  . PRO A 1 119 ? -26.567 -5.742  4.983   1.00 0.00 ? 119 PRO A HD3  6  
ATOM 10808 N N    . SER A 1 120 ? -26.809 -0.759  7.170   1.00 0.00 ? 120 SER A N    6  
ATOM 10809 C CA   . SER A 1 120 ? -26.205 0.265   8.015   1.00 0.00 ? 120 SER A CA   6  
ATOM 10810 C C    . SER A 1 120 ? -26.717 0.159   9.448   1.00 0.00 ? 120 SER A C    6  
ATOM 10811 O O    . SER A 1 120 ? -27.921 0.225   9.695   1.00 0.00 ? 120 SER A O    6  
ATOM 10812 C CB   . SER A 1 120 ? -26.504 1.658   7.456   1.00 0.00 ? 120 SER A CB   6  
ATOM 10813 O OG   . SER A 1 120 ? -25.687 2.639   8.070   1.00 0.00 ? 120 SER A OG   6  
ATOM 10814 H H    . SER A 1 120 ? -27.545 -0.513  6.572   1.00 0.00 ? 120 SER A H    6  
ATOM 10815 H HA   . SER A 1 120 ? -25.137 0.108   8.014   1.00 0.00 ? 120 SER A HA   6  
ATOM 10816 H HB2  . SER A 1 120 ? -26.316 1.664   6.393   1.00 0.00 ? 120 SER A HB2  6  
ATOM 10817 H HB3  . SER A 1 120 ? -27.540 1.902   7.641   1.00 0.00 ? 120 SER A HB3  6  
ATOM 10818 H HG   . SER A 1 120 ? -25.266 3.175   7.394   1.00 0.00 ? 120 SER A HG   6  
ATOM 10819 N N    . SER A 1 121 ? -25.793 -0.007  10.389  1.00 0.00 ? 121 SER A N    6  
ATOM 10820 C CA   . SER A 1 121 ? -26.150 -0.127  11.798  1.00 0.00 ? 121 SER A CA   6  
ATOM 10821 C C    . SER A 1 121 ? -26.592 1.220   12.363  1.00 0.00 ? 121 SER A C    6  
ATOM 10822 O O    . SER A 1 121 ? -26.377 2.264   11.748  1.00 0.00 ? 121 SER A O    6  
ATOM 10823 C CB   . SER A 1 121 ? -24.965 -0.666  12.602  1.00 0.00 ? 121 SER A CB   6  
ATOM 10824 O OG   . SER A 1 121 ? -23.898 0.266   12.625  1.00 0.00 ? 121 SER A OG   6  
ATOM 10825 H H    . SER A 1 121 ? -24.849 -0.053  10.129  1.00 0.00 ? 121 SER A H    6  
ATOM 10826 H HA   . SER A 1 121 ? -26.972 -0.823  11.874  1.00 0.00 ? 121 SER A HA   6  
ATOM 10827 H HB2  . SER A 1 121 ? -25.280 -0.859  13.616  1.00 0.00 ? 121 SER A HB2  6  
ATOM 10828 H HB3  . SER A 1 121 ? -24.616 -1.584  12.151  1.00 0.00 ? 121 SER A HB3  6  
ATOM 10829 H HG   . SER A 1 121 ? -24.062 0.957   11.978  1.00 0.00 ? 121 SER A HG   6  
ATOM 10830 N N    . GLY A 1 122 ? -27.210 1.187   13.539  1.00 0.00 ? 122 GLY A N    6  
ATOM 10831 C CA   . GLY A 1 122 ? -27.673 2.411   14.168  1.00 0.00 ? 122 GLY A CA   6  
ATOM 10832 C C    . GLY A 1 122 ? -28.754 2.158   15.201  1.00 0.00 ? 122 GLY A C    6  
ATOM 10833 O O    . GLY A 1 122 ? -28.505 2.246   16.403  1.00 0.00 ? 122 GLY A O    6  
ATOM 10834 H H    . GLY A 1 122 ? -27.354 0.326   13.983  1.00 0.00 ? 122 GLY A H    6  
ATOM 10835 H HA2  . GLY A 1 122 ? -26.836 2.894   14.649  1.00 0.00 ? 122 GLY A HA2  6  
ATOM 10836 H HA3  . GLY A 1 122 ? -28.066 3.067   13.406  1.00 0.00 ? 122 GLY A HA3  6  
ATOM 10837 N N    . GLY A 1 1   ? 4.038   43.036  -3.431  1.00 0.00 ? 1   GLY A N    7  
ATOM 10838 C CA   . GLY A 1 1   ? 5.212   43.858  -3.657  1.00 0.00 ? 1   GLY A CA   7  
ATOM 10839 C C    . GLY A 1 1   ? 6.354   43.080  -4.279  1.00 0.00 ? 1   GLY A C    7  
ATOM 10840 O O    . GLY A 1 1   ? 6.164   41.964  -4.761  1.00 0.00 ? 1   GLY A O    7  
ATOM 10841 H H1   . GLY A 1 1   ? 4.129   42.062  -3.368  1.00 0.00 ? 1   GLY A H1   7  
ATOM 10842 H HA2  . GLY A 1 1   ? 4.946   44.674  -4.313  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10843 H HA3  . GLY A 1 1   ? 5.541   44.263  -2.711  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10844 N N    . SER A 1 2   ? 7.545   43.670  -4.269  1.00 0.00 ? 2   SER A N    7  
ATOM 10845 C CA   . SER A 1 2   ? 8.722   43.027  -4.842  1.00 0.00 ? 2   SER A CA   7  
ATOM 10846 C C    . SER A 1 2   ? 9.557   42.355  -3.756  1.00 0.00 ? 2   SER A C    7  
ATOM 10847 O O    . SER A 1 2   ? 10.325  43.012  -3.053  1.00 0.00 ? 2   SER A O    7  
ATOM 10848 C CB   . SER A 1 2   ? 9.573   44.051  -5.595  1.00 0.00 ? 2   SER A CB   7  
ATOM 10849 O OG   . SER A 1 2   ? 10.492  43.410  -6.464  1.00 0.00 ? 2   SER A OG   7  
ATOM 10850 H H    . SER A 1 2   ? 7.634   44.561  -3.870  1.00 0.00 ? 2   SER A H    7  
ATOM 10851 H HA   . SER A 1 2   ? 8.383   42.273  -5.536  1.00 0.00 ? 2   SER A HA   7  
ATOM 10852 H HB2  . SER A 1 2   ? 8.929   44.690  -6.180  1.00 0.00 ? 2   SER A HB2  7  
ATOM 10853 H HB3  . SER A 1 2   ? 10.125  44.649  -4.885  1.00 0.00 ? 2   SER A HB3  7  
ATOM 10854 H HG   . SER A 1 2   ? 11.386  43.554  -6.147  1.00 0.00 ? 2   SER A HG   7  
ATOM 10855 N N    . SER A 1 3   ? 9.400   41.042  -3.625  1.00 0.00 ? 3   SER A N    7  
ATOM 10856 C CA   . SER A 1 3   ? 10.135  40.281  -2.622  1.00 0.00 ? 3   SER A CA   7  
ATOM 10857 C C    . SER A 1 3   ? 11.637  40.511  -2.759  1.00 0.00 ? 3   SER A C    7  
ATOM 10858 O O    . SER A 1 3   ? 12.326  40.789  -1.778  1.00 0.00 ? 3   SER A O    7  
ATOM 10859 C CB   . SER A 1 3   ? 9.823   38.789  -2.753  1.00 0.00 ? 3   SER A CB   7  
ATOM 10860 O OG   . SER A 1 3   ? 9.925   38.134  -1.501  1.00 0.00 ? 3   SER A OG   7  
ATOM 10861 H H    . SER A 1 3   ? 8.772   40.575  -4.215  1.00 0.00 ? 3   SER A H    7  
ATOM 10862 H HA   . SER A 1 3   ? 9.818   40.622  -1.648  1.00 0.00 ? 3   SER A HA   7  
ATOM 10863 H HB2  . SER A 1 3   ? 8.819   38.666  -3.130  1.00 0.00 ? 3   SER A HB2  7  
ATOM 10864 H HB3  . SER A 1 3   ? 10.523  38.336  -3.441  1.00 0.00 ? 3   SER A HB3  7  
ATOM 10865 H HG   . SER A 1 3   ? 9.064   38.120  -1.076  1.00 0.00 ? 3   SER A HG   7  
ATOM 10866 N N    . GLY A 1 4   ? 12.139  40.393  -3.984  1.00 0.00 ? 4   GLY A N    7  
ATOM 10867 C CA   . GLY A 1 4   ? 13.556  40.591  -4.229  1.00 0.00 ? 4   GLY A CA   7  
ATOM 10868 C C    . GLY A 1 4   ? 14.153  39.500  -5.095  1.00 0.00 ? 4   GLY A C    7  
ATOM 10869 O O    . GLY A 1 4   ? 13.567  39.109  -6.104  1.00 0.00 ? 4   GLY A O    7  
ATOM 10870 H H    . GLY A 1 4   ? 11.542  40.170  -4.729  1.00 0.00 ? 4   GLY A H    7  
ATOM 10871 H HA2  . GLY A 1 4   ? 13.696  41.543  -4.719  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10872 H HA3  . GLY A 1 4   ? 14.074  40.607  -3.281  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10873 N N    . SER A 1 5   ? 15.323  39.008  -4.701  1.00 0.00 ? 5   SER A N    7  
ATOM 10874 C CA   . SER A 1 5   ? 16.003  37.959  -5.451  1.00 0.00 ? 5   SER A CA   7  
ATOM 10875 C C    . SER A 1 5   ? 15.426  36.588  -5.113  1.00 0.00 ? 5   SER A C    7  
ATOM 10876 O O    . SER A 1 5   ? 15.959  35.870  -4.267  1.00 0.00 ? 5   SER A O    7  
ATOM 10877 C CB   . SER A 1 5   ? 17.504  37.981  -5.155  1.00 0.00 ? 5   SER A CB   7  
ATOM 10878 O OG   . SER A 1 5   ? 18.094  39.190  -5.601  1.00 0.00 ? 5   SER A OG   7  
ATOM 10879 H H    . SER A 1 5   ? 15.740  39.361  -3.887  1.00 0.00 ? 5   SER A H    7  
ATOM 10880 H HA   . SER A 1 5   ? 15.850  38.152  -6.503  1.00 0.00 ? 5   SER A HA   7  
ATOM 10881 H HB2  . SER A 1 5   ? 17.659  37.890  -4.091  1.00 0.00 ? 5   SER A HB2  7  
ATOM 10882 H HB3  . SER A 1 5   ? 17.980  37.154  -5.660  1.00 0.00 ? 5   SER A HB3  7  
ATOM 10883 H HG   . SER A 1 5   ? 17.570  39.557  -6.316  1.00 0.00 ? 5   SER A HG   7  
ATOM 10884 N N    . SER A 1 6   ? 14.334  36.231  -5.780  1.00 0.00 ? 6   SER A N    7  
ATOM 10885 C CA   . SER A 1 6   ? 13.681  34.948  -5.549  1.00 0.00 ? 6   SER A CA   7  
ATOM 10886 C C    . SER A 1 6   ? 14.445  33.819  -6.233  1.00 0.00 ? 6   SER A C    7  
ATOM 10887 O O    . SER A 1 6   ? 14.082  33.381  -7.324  1.00 0.00 ? 6   SER A O    7  
ATOM 10888 C CB   . SER A 1 6   ? 12.239  34.986  -6.058  1.00 0.00 ? 6   SER A CB   7  
ATOM 10889 O OG   . SER A 1 6   ? 11.353  35.440  -5.050  1.00 0.00 ? 6   SER A OG   7  
ATOM 10890 H H    . SER A 1 6   ? 13.956  36.847  -6.443  1.00 0.00 ? 6   SER A H    7  
ATOM 10891 H HA   . SER A 1 6   ? 13.673  34.768  -4.484  1.00 0.00 ? 6   SER A HA   7  
ATOM 10892 H HB2  . SER A 1 6   ? 12.176  35.654  -6.904  1.00 0.00 ? 6   SER A HB2  7  
ATOM 10893 H HB3  . SER A 1 6   ? 11.941  33.993  -6.362  1.00 0.00 ? 6   SER A HB3  7  
ATOM 10894 H HG   . SER A 1 6   ? 11.652  36.291  -4.721  1.00 0.00 ? 6   SER A HG   7  
ATOM 10895 N N    . GLY A 1 7   ? 15.506  33.351  -5.583  1.00 0.00 ? 7   GLY A N    7  
ATOM 10896 C CA   . GLY A 1 7   ? 16.306  32.277  -6.143  1.00 0.00 ? 7   GLY A CA   7  
ATOM 10897 C C    . GLY A 1 7   ? 15.469  31.076  -6.536  1.00 0.00 ? 7   GLY A C    7  
ATOM 10898 O O    . GLY A 1 7   ? 15.371  30.737  -7.716  1.00 0.00 ? 7   GLY A O    7  
ATOM 10899 H H    . GLY A 1 7   ? 15.749  33.739  -4.716  1.00 0.00 ? 7   GLY A H    7  
ATOM 10900 H HA2  . GLY A 1 7   ? 16.822  32.645  -7.017  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10901 H HA3  . GLY A 1 7   ? 17.036  31.968  -5.409  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10902 N N    . THR A 1 8   ? 14.864  30.428  -5.545  1.00 0.00 ? 8   THR A N    7  
ATOM 10903 C CA   . THR A 1 8   ? 14.034  29.256  -5.793  1.00 0.00 ? 8   THR A CA   7  
ATOM 10904 C C    . THR A 1 8   ? 13.142  28.950  -4.595  1.00 0.00 ? 8   THR A C    7  
ATOM 10905 O O    . THR A 1 8   ? 13.263  29.578  -3.542  1.00 0.00 ? 8   THR A O    7  
ATOM 10906 C CB   . THR A 1 8   ? 14.892  28.017  -6.110  1.00 0.00 ? 8   THR A CB   7  
ATOM 10907 O OG1  . THR A 1 8   ? 14.082  27.002  -6.714  1.00 0.00 ? 8   THR A OG1  7  
ATOM 10908 C CG2  . THR A 1 8   ? 15.540  27.471  -4.847  1.00 0.00 ? 8   THR A CG2  7  
ATOM 10909 H H    . THR A 1 8   ? 14.980  30.747  -4.626  1.00 0.00 ? 8   THR A H    7  
ATOM 10910 H HA   . THR A 1 8   ? 13.410  29.465  -6.650  1.00 0.00 ? 8   THR A HA   7  
ATOM 10911 H HB   . THR A 1 8   ? 15.671  28.304  -6.801  1.00 0.00 ? 8   THR A HB   7  
ATOM 10912 H HG1  . THR A 1 8   ? 13.467  27.407  -7.330  1.00 0.00 ? 8   THR A HG1  7  
ATOM 10913 H HG21 . THR A 1 8   ? 16.615  27.511  -4.947  1.00 0.00 ? 8   THR A HG21 7  
ATOM 10914 H HG22 . THR A 1 8   ? 15.230  26.447  -4.697  1.00 0.00 ? 8   THR A HG22 7  
ATOM 10915 H HG23 . THR A 1 8   ? 15.236  28.067  -4.000  1.00 0.00 ? 8   THR A HG23 7  
ATOM 10916 N N    . LEU A 1 9   ? 12.247  27.983  -4.761  1.00 0.00 ? 9   LEU A N    7  
ATOM 10917 C CA   . LEU A 1 9   ? 11.335  27.593  -3.692  1.00 0.00 ? 9   LEU A CA   7  
ATOM 10918 C C    . LEU A 1 9   ? 11.534  26.129  -3.313  1.00 0.00 ? 9   LEU A C    7  
ATOM 10919 O O    . LEU A 1 9   ? 11.487  25.243  -4.166  1.00 0.00 ? 9   LEU A O    7  
ATOM 10920 C CB   . LEU A 1 9   ? 9.885   27.828  -4.121  1.00 0.00 ? 9   LEU A CB   7  
ATOM 10921 C CG   . LEU A 1 9   ? 9.404   29.279  -4.093  1.00 0.00 ? 9   LEU A CG   7  
ATOM 10922 C CD1  . LEU A 1 9   ? 9.476   29.838  -2.680  1.00 0.00 ? 9   LEU A CD1  7  
ATOM 10923 C CD2  . LEU A 1 9   ? 10.225  30.132  -5.048  1.00 0.00 ? 9   LEU A CD2  7  
ATOM 10924 H H    . LEU A 1 9   ? 12.198  27.519  -5.623  1.00 0.00 ? 9   LEU A H    7  
ATOM 10925 H HA   . LEU A 1 9   ? 11.551  28.208  -2.831  1.00 0.00 ? 9   LEU A HA   7  
ATOM 10926 H HB2  . LEU A 1 9   ? 9.776   27.463  -5.130  1.00 0.00 ? 9   LEU A HB2  7  
ATOM 10927 H HB3  . LEU A 1 9   ? 9.249   27.254  -3.461  1.00 0.00 ? 9   LEU A HB3  7  
ATOM 10928 H HG   . LEU A 1 9   ? 8.372   29.315  -4.413  1.00 0.00 ? 9   LEU A HG   7  
ATOM 10929 H HD11 . LEU A 1 9   ? 9.854   29.080  -2.012  1.00 0.00 ? 9   LEU A HD11 7  
ATOM 10930 H HD12 . LEU A 1 9   ? 8.489   30.139  -2.361  1.00 0.00 ? 9   LEU A HD12 7  
ATOM 10931 H HD13 . LEU A 1 9   ? 10.135  30.694  -2.665  1.00 0.00 ? 9   LEU A HD13 7  
ATOM 10932 H HD21 . LEU A 1 9   ? 10.713  29.494  -5.771  1.00 0.00 ? 9   LEU A HD21 7  
ATOM 10933 H HD22 . LEU A 1 9   ? 10.971  30.680  -4.491  1.00 0.00 ? 9   LEU A HD22 7  
ATOM 10934 H HD23 . LEU A 1 9   ? 9.575   30.826  -5.560  1.00 0.00 ? 9   LEU A HD23 7  
ATOM 10935 N N    . THR A 1 10  ? 11.756  25.881  -2.025  1.00 0.00 ? 10  THR A N    7  
ATOM 10936 C CA   . THR A 1 10  ? 11.961  24.525  -1.532  1.00 0.00 ? 10  THR A CA   7  
ATOM 10937 C C    . THR A 1 10  ? 11.658  24.430  -0.041  1.00 0.00 ? 10  THR A C    7  
ATOM 10938 O O    . THR A 1 10  ? 11.739  25.422  0.683   1.00 0.00 ? 10  THR A O    7  
ATOM 10939 C CB   . THR A 1 10  ? 13.404  24.049  -1.783  1.00 0.00 ? 10  THR A CB   7  
ATOM 10940 O OG1  . THR A 1 10  ? 13.562  22.701  -1.327  1.00 0.00 ? 10  THR A OG1  7  
ATOM 10941 C CG2  . THR A 1 10  ? 14.403  24.950  -1.071  1.00 0.00 ? 10  THR A CG2  7  
ATOM 10942 H H    . THR A 1 10  ? 11.782  26.630  -1.393  1.00 0.00 ? 10  THR A H    7  
ATOM 10943 H HA   . THR A 1 10  ? 11.290  23.870  -2.069  1.00 0.00 ? 10  THR A HA   7  
ATOM 10944 H HB   . THR A 1 10  ? 13.601  24.087  -2.845  1.00 0.00 ? 10  THR A HB   7  
ATOM 10945 H HG1  . THR A 1 10  ? 12.757  22.207  -1.504  1.00 0.00 ? 10  THR A HG1  7  
ATOM 10946 H HG21 . THR A 1 10  ? 14.267  25.969  -1.402  1.00 0.00 ? 10  THR A HG21 7  
ATOM 10947 H HG22 . THR A 1 10  ? 15.407  24.627  -1.302  1.00 0.00 ? 10  THR A HG22 7  
ATOM 10948 H HG23 . THR A 1 10  ? 14.242  24.893  -0.005  1.00 0.00 ? 10  THR A HG23 7  
ATOM 10949 N N    . VAL A 1 11  ? 11.310  23.230  0.412   1.00 0.00 ? 11  VAL A N    7  
ATOM 10950 C CA   . VAL A 1 11  ? 10.997  23.005  1.818   1.00 0.00 ? 11  VAL A CA   7  
ATOM 10951 C C    . VAL A 1 11  ? 11.352  21.584  2.240   1.00 0.00 ? 11  VAL A C    7  
ATOM 10952 O O    . VAL A 1 11  ? 11.166  20.635  1.479   1.00 0.00 ? 11  VAL A O    7  
ATOM 10953 C CB   . VAL A 1 11  ? 9.505   23.258  2.108   1.00 0.00 ? 11  VAL A CB   7  
ATOM 10954 C CG1  . VAL A 1 11  ? 9.137   24.700  1.796   1.00 0.00 ? 11  VAL A CG1  7  
ATOM 10955 C CG2  . VAL A 1 11  ? 8.638   22.294  1.313   1.00 0.00 ? 11  VAL A CG2  7  
ATOM 10956 H H    . VAL A 1 11  ? 11.263  22.478  -0.214  1.00 0.00 ? 11  VAL A H    7  
ATOM 10957 H HA   . VAL A 1 11  ? 11.578  23.701  2.405   1.00 0.00 ? 11  VAL A HA   7  
ATOM 10958 H HB   . VAL A 1 11  ? 9.329   23.084  3.159   1.00 0.00 ? 11  VAL A HB   7  
ATOM 10959 H HG11 . VAL A 1 11  ? 9.665   25.360  2.469   1.00 0.00 ? 11  VAL A HG11 7  
ATOM 10960 H HG12 . VAL A 1 11  ? 9.410   24.930  0.776   1.00 0.00 ? 11  VAL A HG12 7  
ATOM 10961 H HG13 . VAL A 1 11  ? 8.073   24.835  1.923   1.00 0.00 ? 11  VAL A HG13 7  
ATOM 10962 H HG21 . VAL A 1 11  ? 8.756   21.295  1.707   1.00 0.00 ? 11  VAL A HG21 7  
ATOM 10963 H HG22 . VAL A 1 11  ? 7.602   22.591  1.392   1.00 0.00 ? 11  VAL A HG22 7  
ATOM 10964 H HG23 . VAL A 1 11  ? 8.938   22.309  0.276   1.00 0.00 ? 11  VAL A HG23 7  
ATOM 10965 N N    . ASN A 1 12  ? 11.864  21.445  3.458   1.00 0.00 ? 12  ASN A N    7  
ATOM 10966 C CA   . ASN A 1 12  ? 12.246  20.138  3.982   1.00 0.00 ? 12  ASN A CA   7  
ATOM 10967 C C    . ASN A 1 12  ? 11.453  19.805  5.242   1.00 0.00 ? 12  ASN A C    7  
ATOM 10968 O O    . ASN A 1 12  ? 10.806  20.671  5.829   1.00 0.00 ? 12  ASN A O    7  
ATOM 10969 C CB   . ASN A 1 12  ? 13.745  20.106  4.286   1.00 0.00 ? 12  ASN A CB   7  
ATOM 10970 C CG   . ASN A 1 12  ? 14.553  20.921  3.295   1.00 0.00 ? 12  ASN A CG   7  
ATOM 10971 O OD1  . ASN A 1 12  ? 14.889  22.077  3.552   1.00 0.00 ? 12  ASN A OD1  7  
ATOM 10972 N ND2  . ASN A 1 12  ? 14.871  20.319  2.154   1.00 0.00 ? 12  ASN A ND2  7  
ATOM 10973 H H    . ASN A 1 12  ? 11.989  22.239  4.018   1.00 0.00 ? 12  ASN A H    7  
ATOM 10974 H HA   . ASN A 1 12  ? 12.025  19.401  3.226   1.00 0.00 ? 12  ASN A HA   7  
ATOM 10975 H HB2  . ASN A 1 12  ? 13.915  20.507  5.275   1.00 0.00 ? 12  ASN A HB2  7  
ATOM 10976 H HB3  . ASN A 1 12  ? 14.091  19.084  4.252   1.00 0.00 ? 12  ASN A HB3  7  
ATOM 10977 H HD21 . ASN A 1 12  ? 14.569  19.396  2.017   1.00 0.00 ? 12  ASN A HD21 7  
ATOM 10978 H HD22 . ASN A 1 12  ? 15.393  20.823  1.496   1.00 0.00 ? 12  ASN A HD22 7  
ATOM 10979 N N    . GLY A 1 13  ? 11.509  18.541  5.653   1.00 0.00 ? 13  GLY A N    7  
ATOM 10980 C CA   . GLY A 1 13  ? 10.792  18.115  6.841   1.00 0.00 ? 13  GLY A CA   7  
ATOM 10981 C C    . GLY A 1 13  ? 10.481  16.632  6.829   1.00 0.00 ? 13  GLY A C    7  
ATOM 10982 O O    . GLY A 1 13  ? 11.128  15.845  6.138   1.00 0.00 ? 13  GLY A O    7  
ATOM 10983 H H    . GLY A 1 13  ? 12.041  17.894  5.145   1.00 0.00 ? 13  GLY A H    7  
ATOM 10984 H HA2  . GLY A 1 13  ? 11.393  18.340  7.710   1.00 0.00 ? 13  GLY A HA2  7  
ATOM 10985 H HA3  . GLY A 1 13  ? 9.865   18.665  6.905   1.00 0.00 ? 13  GLY A HA3  7  
ATOM 10986 N N    . PRO A 1 14  ? 9.468   16.230  7.611   1.00 0.00 ? 14  PRO A N    7  
ATOM 10987 C CA   . PRO A 1 14  ? 9.050   14.828  7.707   1.00 0.00 ? 14  PRO A CA   7  
ATOM 10988 C C    . PRO A 1 14  ? 8.387   14.332  6.426   1.00 0.00 ? 14  PRO A C    7  
ATOM 10989 O O    . PRO A 1 14  ? 7.949   15.115  5.582   1.00 0.00 ? 14  PRO A O    7  
ATOM 10990 C CB   . PRO A 1 14  ? 8.045   14.835  8.861   1.00 0.00 ? 14  PRO A CB   7  
ATOM 10991 C CG   . PRO A 1 14  ? 7.516   16.228  8.894   1.00 0.00 ? 14  PRO A CG   7  
ATOM 10992 C CD   . PRO A 1 14  ? 8.653   17.113  8.463   1.00 0.00 ? 14  PRO A CD   7  
ATOM 10993 H HA   . PRO A 1 14  ? 9.880   14.182  7.954   1.00 0.00 ? 14  PRO A HA   7  
ATOM 10994 H HB2  . PRO A 1 14  ? 7.260   14.119  8.663   1.00 0.00 ? 14  PRO A HB2  7  
ATOM 10995 H HB3  . PRO A 1 14  ? 8.547   14.582  9.782   1.00 0.00 ? 14  PRO A HB3  7  
ATOM 10996 H HG2  . PRO A 1 14  ? 6.687   16.322  8.210   1.00 0.00 ? 14  PRO A HG2  7  
ATOM 10997 H HG3  . PRO A 1 14  ? 7.207   16.479  9.898   1.00 0.00 ? 14  PRO A HG3  7  
ATOM 10998 H HD2  . PRO A 1 14  ? 8.282   17.956  7.899   1.00 0.00 ? 14  PRO A HD2  7  
ATOM 10999 H HD3  . PRO A 1 14  ? 9.217   17.448  9.321   1.00 0.00 ? 14  PRO A HD3  7  
ATOM 11000 N N    . PRO A 1 15  ? 8.310   13.002  6.275   1.00 0.00 ? 15  PRO A N    7  
ATOM 11001 C CA   . PRO A 1 15  ? 7.700   12.373  5.100   1.00 0.00 ? 15  PRO A CA   7  
ATOM 11002 C C    . PRO A 1 15  ? 6.188   12.564  5.059   1.00 0.00 ? 15  PRO A C    7  
ATOM 11003 O O    . PRO A 1 15  ? 5.478   12.169  5.985   1.00 0.00 ? 15  PRO A O    7  
ATOM 11004 C CB   . PRO A 1 15  ? 8.048   10.892  5.271   1.00 0.00 ? 15  PRO A CB   7  
ATOM 11005 C CG   . PRO A 1 15  ? 8.238   10.714  6.738   1.00 0.00 ? 15  PRO A CG   7  
ATOM 11006 C CD   . PRO A 1 15  ? 8.811   12.010  7.241   1.00 0.00 ? 15  PRO A CD   7  
ATOM 11007 H HA   . PRO A 1 15  ? 8.134   12.742  4.182   1.00 0.00 ? 15  PRO A HA   7  
ATOM 11008 H HB2  . PRO A 1 15  ? 7.234   10.283  4.900   1.00 0.00 ? 15  PRO A HB2  7  
ATOM 11009 H HB3  . PRO A 1 15  ? 8.951   10.665  4.725   1.00 0.00 ? 15  PRO A HB3  7  
ATOM 11010 H HG2  . PRO A 1 15  ? 7.288   10.515  7.210   1.00 0.00 ? 15  PRO A HG2  7  
ATOM 11011 H HG3  . PRO A 1 15  ? 8.927   9.903   6.922   1.00 0.00 ? 15  PRO A HG3  7  
ATOM 11012 H HD2  . PRO A 1 15  ? 8.447   12.222  8.236   1.00 0.00 ? 15  PRO A HD2  7  
ATOM 11013 H HD3  . PRO A 1 15  ? 9.890   11.974  7.231   1.00 0.00 ? 15  PRO A HD3  7  
ATOM 11014 N N    . ILE A 1 16  ? 5.702   13.170  3.981   1.00 0.00 ? 16  ILE A N    7  
ATOM 11015 C CA   . ILE A 1 16  ? 4.273   13.411  3.820   1.00 0.00 ? 16  ILE A CA   7  
ATOM 11016 C C    . ILE A 1 16  ? 3.627   12.329  2.961   1.00 0.00 ? 16  ILE A C    7  
ATOM 11017 O O    . ILE A 1 16  ? 4.194   11.897  1.957   1.00 0.00 ? 16  ILE A O    7  
ATOM 11018 C CB   . ILE A 1 16  ? 4.003   14.786  3.182   1.00 0.00 ? 16  ILE A CB   7  
ATOM 11019 C CG1  . ILE A 1 16  ? 4.582   15.901  4.057   1.00 0.00 ? 16  ILE A CG1  7  
ATOM 11020 C CG2  . ILE A 1 16  ? 2.510   14.990  2.975   1.00 0.00 ? 16  ILE A CG2  7  
ATOM 11021 C CD1  . ILE A 1 16  ? 4.997   17.128  3.276   1.00 0.00 ? 16  ILE A CD1  7  
ATOM 11022 H H    . ILE A 1 16  ? 6.318   13.460  3.278   1.00 0.00 ? 16  ILE A H    7  
ATOM 11023 H HA   . ILE A 1 16  ? 3.820   13.396  4.801   1.00 0.00 ? 16  ILE A HA   7  
ATOM 11024 H HB   . ILE A 1 16  ? 4.483   14.811  2.216   1.00 0.00 ? 16  ILE A HB   7  
ATOM 11025 H HG12 . ILE A 1 16  ? 3.841   16.203  4.780   1.00 0.00 ? 16  ILE A HG12 7  
ATOM 11026 H HG13 . ILE A 1 16  ? 5.453   15.526  4.575   1.00 0.00 ? 16  ILE A HG13 7  
ATOM 11027 H HG21 . ILE A 1 16  ? 2.053   15.277  3.910   1.00 0.00 ? 16  ILE A HG21 7  
ATOM 11028 H HG22 . ILE A 1 16  ? 2.351   15.768  2.243   1.00 0.00 ? 16  ILE A HG22 7  
ATOM 11029 H HG23 . ILE A 1 16  ? 2.066   14.070  2.625   1.00 0.00 ? 16  ILE A HG23 7  
ATOM 11030 H HD11 . ILE A 1 16  ? 6.040   17.048  3.007   1.00 0.00 ? 16  ILE A HD11 7  
ATOM 11031 H HD12 . ILE A 1 16  ? 4.399   17.205  2.381   1.00 0.00 ? 16  ILE A HD12 7  
ATOM 11032 H HD13 . ILE A 1 16  ? 4.849   18.009  3.884   1.00 0.00 ? 16  ILE A HD13 7  
ATOM 11033 N N    . ILE A 1 17  ? 2.436   11.897  3.362   1.00 0.00 ? 17  ILE A N    7  
ATOM 11034 C CA   . ILE A 1 17  ? 1.711   10.868  2.627   1.00 0.00 ? 17  ILE A CA   7  
ATOM 11035 C C    . ILE A 1 17  ? 0.308   11.340  2.260   1.00 0.00 ? 17  ILE A C    7  
ATOM 11036 O O    . ILE A 1 17  ? -0.486  11.695  3.131   1.00 0.00 ? 17  ILE A O    7  
ATOM 11037 C CB   . ILE A 1 17  ? 1.605   9.564   3.441   1.00 0.00 ? 17  ILE A CB   7  
ATOM 11038 C CG1  . ILE A 1 17  ? 2.987   9.135   3.940   1.00 0.00 ? 17  ILE A CG1  7  
ATOM 11039 C CG2  . ILE A 1 17  ? 0.975   8.464   2.599   1.00 0.00 ? 17  ILE A CG2  7  
ATOM 11040 C CD1  . ILE A 1 17  ? 2.936   8.151   5.087   1.00 0.00 ? 17  ILE A CD1  7  
ATOM 11041 H H    . ILE A 1 17  ? 2.035   12.279  4.170   1.00 0.00 ? 17  ILE A H    7  
ATOM 11042 H HA   . ILE A 1 17  ? 2.258   10.659  1.719   1.00 0.00 ? 17  ILE A HA   7  
ATOM 11043 H HB   . ILE A 1 17  ? 0.964   9.746   4.290   1.00 0.00 ? 17  ILE A HB   7  
ATOM 11044 H HG12 . ILE A 1 17  ? 3.527   8.672   3.130   1.00 0.00 ? 17  ILE A HG12 7  
ATOM 11045 H HG13 . ILE A 1 17  ? 3.527   10.009  4.274   1.00 0.00 ? 17  ILE A HG13 7  
ATOM 11046 H HG21 . ILE A 1 17  ? 0.770   7.607   3.223   1.00 0.00 ? 17  ILE A HG21 7  
ATOM 11047 H HG22 . ILE A 1 17  ? 0.053   8.825   2.169   1.00 0.00 ? 17  ILE A HG22 7  
ATOM 11048 H HG23 . ILE A 1 17  ? 1.655   8.180   1.810   1.00 0.00 ? 17  ILE A HG23 7  
ATOM 11049 H HD11 . ILE A 1 17  ? 2.237   8.501   5.832   1.00 0.00 ? 17  ILE A HD11 7  
ATOM 11050 H HD12 . ILE A 1 17  ? 2.620   7.186   4.721   1.00 0.00 ? 17  ILE A HD12 7  
ATOM 11051 H HD13 . ILE A 1 17  ? 3.918   8.064   5.530   1.00 0.00 ? 17  ILE A HD13 7  
ATOM 11052 N N    . SER A 1 18  ? 0.009   11.339  0.965   1.00 0.00 ? 18  SER A N    7  
ATOM 11053 C CA   . SER A 1 18  ? -1.298  11.769  0.482   1.00 0.00 ? 18  SER A CA   7  
ATOM 11054 C C    . SER A 1 18  ? -2.259  10.588  0.392   1.00 0.00 ? 18  SER A C    7  
ATOM 11055 O O    . SER A 1 18  ? -3.153  10.437  1.225   1.00 0.00 ? 18  SER A O    7  
ATOM 11056 C CB   . SER A 1 18  ? -1.164  12.437  -0.888  1.00 0.00 ? 18  SER A CB   7  
ATOM 11057 O OG   . SER A 1 18  ? -2.434  12.641  -1.482  1.00 0.00 ? 18  SER A OG   7  
ATOM 11058 H H    . SER A 1 18  ? 0.685   11.045  0.319   1.00 0.00 ? 18  SER A H    7  
ATOM 11059 H HA   . SER A 1 18  ? -1.692  12.486  1.186   1.00 0.00 ? 18  SER A HA   7  
ATOM 11060 H HB2  . SER A 1 18  ? -0.677  13.393  -0.773  1.00 0.00 ? 18  SER A HB2  7  
ATOM 11061 H HB3  . SER A 1 18  ? -0.573  11.807  -1.536  1.00 0.00 ? 18  SER A HB3  7  
ATOM 11062 H HG   . SER A 1 18  ? -2.530  13.564  -1.725  1.00 0.00 ? 18  SER A HG   7  
ATOM 11063 N N    . SER A 1 19  ? -2.069  9.754   -0.625  1.00 0.00 ? 19  SER A N    7  
ATOM 11064 C CA   . SER A 1 19  ? -2.921  8.587   -0.827  1.00 0.00 ? 19  SER A CA   7  
ATOM 11065 C C    . SER A 1 19  ? -2.265  7.594   -1.781  1.00 0.00 ? 19  SER A C    7  
ATOM 11066 O O    . SER A 1 19  ? -1.158  7.823   -2.270  1.00 0.00 ? 19  SER A O    7  
ATOM 11067 C CB   . SER A 1 19  ? -4.284  9.014   -1.375  1.00 0.00 ? 19  SER A CB   7  
ATOM 11068 O OG   . SER A 1 19  ? -5.193  9.291   -0.324  1.00 0.00 ? 19  SER A OG   7  
ATOM 11069 H H    . SER A 1 19  ? -1.339  9.928   -1.255  1.00 0.00 ? 19  SER A H    7  
ATOM 11070 H HA   . SER A 1 19  ? -3.061  8.110   0.131   1.00 0.00 ? 19  SER A HA   7  
ATOM 11071 H HB2  . SER A 1 19  ? -4.165  9.903   -1.975  1.00 0.00 ? 19  SER A HB2  7  
ATOM 11072 H HB3  . SER A 1 19  ? -4.688  8.219   -1.985  1.00 0.00 ? 19  SER A HB3  7  
ATOM 11073 H HG   . SER A 1 19  ? -4.814  9.953   0.261   1.00 0.00 ? 19  SER A HG   7  
ATOM 11074 N N    . THR A 1 20  ? -2.955  6.488   -2.040  1.00 0.00 ? 20  THR A N    7  
ATOM 11075 C CA   . THR A 1 20  ? -2.441  5.458   -2.934  1.00 0.00 ? 20  THR A CA   7  
ATOM 11076 C C    . THR A 1 20  ? -3.318  5.317   -4.173  1.00 0.00 ? 20  THR A C    7  
ATOM 11077 O O    . THR A 1 20  ? -4.473  5.743   -4.178  1.00 0.00 ? 20  THR A O    7  
ATOM 11078 C CB   . THR A 1 20  ? -2.350  4.094   -2.225  1.00 0.00 ? 20  THR A CB   7  
ATOM 11079 O OG1  . THR A 1 20  ? -3.647  3.690   -1.771  1.00 0.00 ? 20  THR A OG1  7  
ATOM 11080 C CG2  . THR A 1 20  ? -1.392  4.159   -1.045  1.00 0.00 ? 20  THR A CG2  7  
ATOM 11081 H H    . THR A 1 20  ? -3.832  6.363   -1.620  1.00 0.00 ? 20  THR A H    7  
ATOM 11082 H HA   . THR A 1 20  ? -1.447  5.748   -3.240  1.00 0.00 ? 20  THR A HA   7  
ATOM 11083 H HB   . THR A 1 20  ? -1.980  3.363   -2.930  1.00 0.00 ? 20  THR A HB   7  
ATOM 11084 H HG1  . THR A 1 20  ? -4.193  4.467   -1.631  1.00 0.00 ? 20  THR A HG1  7  
ATOM 11085 H HG21 . THR A 1 20  ? -1.390  5.160   -0.639  1.00 0.00 ? 20  THR A HG21 7  
ATOM 11086 H HG22 . THR A 1 20  ? -0.397  3.902   -1.375  1.00 0.00 ? 20  THR A HG22 7  
ATOM 11087 H HG23 . THR A 1 20  ? -1.711  3.463   -0.284  1.00 0.00 ? 20  THR A HG23 7  
ATOM 11088 N N    . GLN A 1 21  ? -2.763  4.716   -5.220  1.00 0.00 ? 21  GLN A N    7  
ATOM 11089 C CA   . GLN A 1 21  ? -3.496  4.520   -6.465  1.00 0.00 ? 21  GLN A CA   7  
ATOM 11090 C C    . GLN A 1 21  ? -4.156  3.145   -6.497  1.00 0.00 ? 21  GLN A C    7  
ATOM 11091 O O    . GLN A 1 21  ? -3.983  2.383   -7.449  1.00 0.00 ? 21  GLN A O    7  
ATOM 11092 C CB   . GLN A 1 21  ? -2.559  4.677   -7.664  1.00 0.00 ? 21  GLN A CB   7  
ATOM 11093 C CG   . GLN A 1 21  ? -2.382  6.118   -8.113  1.00 0.00 ? 21  GLN A CG   7  
ATOM 11094 C CD   . GLN A 1 21  ? -3.685  6.757   -8.553  1.00 0.00 ? 21  GLN A CD   7  
ATOM 11095 O OE1  . GLN A 1 21  ? -4.521  6.114   -9.189  1.00 0.00 ? 21  GLN A OE1  7  
ATOM 11096 N NE2  . GLN A 1 21  ? -3.865  8.028   -8.215  1.00 0.00 ? 21  GLN A NE2  7  
ATOM 11097 H H    . GLN A 1 21  ? -1.839  4.399   -5.155  1.00 0.00 ? 21  GLN A H    7  
ATOM 11098 H HA   . GLN A 1 21  ? -4.265  5.275   -6.519  1.00 0.00 ? 21  GLN A HA   7  
ATOM 11099 H HB2  . GLN A 1 21  ? -1.589  4.282   -7.402  1.00 0.00 ? 21  GLN A HB2  7  
ATOM 11100 H HB3  . GLN A 1 21  ? -2.957  4.111   -8.493  1.00 0.00 ? 21  GLN A HB3  7  
ATOM 11101 H HG2  . GLN A 1 21  ? -1.978  6.691   -7.291  1.00 0.00 ? 21  GLN A HG2  7  
ATOM 11102 H HG3  . GLN A 1 21  ? -1.689  6.141   -8.941  1.00 0.00 ? 21  GLN A HG3  7  
ATOM 11103 H HE21 . GLN A 1 21  ? -3.156  8.477   -7.708  1.00 0.00 ? 21  GLN A HE21 7  
ATOM 11104 H HE22 . GLN A 1 21  ? -4.698  8.466   -8.487  1.00 0.00 ? 21  GLN A HE22 7  
ATOM 11105 N N    . THR A 1 22  ? -4.912  2.832   -5.449  1.00 0.00 ? 22  THR A N    7  
ATOM 11106 C CA   . THR A 1 22  ? -5.597  1.549   -5.356  1.00 0.00 ? 22  THR A CA   7  
ATOM 11107 C C    . THR A 1 22  ? -6.054  1.069   -6.729  1.00 0.00 ? 22  THR A C    7  
ATOM 11108 O O    . THR A 1 22  ? -6.920  1.681   -7.353  1.00 0.00 ? 22  THR A O    7  
ATOM 11109 C CB   . THR A 1 22  ? -6.817  1.630   -4.420  1.00 0.00 ? 22  THR A CB   7  
ATOM 11110 O OG1  . THR A 1 22  ? -7.837  2.441   -5.014  1.00 0.00 ? 22  THR A OG1  7  
ATOM 11111 C CG2  . THR A 1 22  ? -6.425  2.207   -3.069  1.00 0.00 ? 22  THR A CG2  7  
ATOM 11112 H H    . THR A 1 22  ? -5.011  3.481   -4.722  1.00 0.00 ? 22  THR A H    7  
ATOM 11113 H HA   . THR A 1 22  ? -4.902  0.829   -4.947  1.00 0.00 ? 22  THR A HA   7  
ATOM 11114 H HB   . THR A 1 22  ? -7.203  0.631   -4.271  1.00 0.00 ? 22  THR A HB   7  
ATOM 11115 H HG1  . THR A 1 22  ? -8.191  1.995   -5.787  1.00 0.00 ? 22  THR A HG1  7  
ATOM 11116 H HG21 . THR A 1 22  ? -6.603  3.272   -3.067  1.00 0.00 ? 22  THR A HG21 7  
ATOM 11117 H HG22 . THR A 1 22  ? -5.378  2.016   -2.886  1.00 0.00 ? 22  THR A HG22 7  
ATOM 11118 H HG23 . THR A 1 22  ? -7.017  1.743   -2.294  1.00 0.00 ? 22  THR A HG23 7  
ATOM 11119 N N    . GLN A 1 23  ? -5.467  -0.029  -7.193  1.00 0.00 ? 23  GLN A N    7  
ATOM 11120 C CA   . GLN A 1 23  ? -5.815  -0.591  -8.493  1.00 0.00 ? 23  GLN A CA   7  
ATOM 11121 C C    . GLN A 1 23  ? -7.039  -1.495  -8.385  1.00 0.00 ? 23  GLN A C    7  
ATOM 11122 O O    . GLN A 1 23  ? -7.640  -1.618  -7.317  1.00 0.00 ? 23  GLN A O    7  
ATOM 11123 C CB   . GLN A 1 23  ? -4.634  -1.377  -9.066  1.00 0.00 ? 23  GLN A CB   7  
ATOM 11124 C CG   . GLN A 1 23  ? -3.922  -2.241  -8.037  1.00 0.00 ? 23  GLN A CG   7  
ATOM 11125 C CD   . GLN A 1 23  ? -4.848  -2.719  -6.936  1.00 0.00 ? 23  GLN A CD   7  
ATOM 11126 O OE1  . GLN A 1 23  ? -4.941  -2.101  -5.875  1.00 0.00 ? 23  GLN A OE1  7  
ATOM 11127 N NE2  . GLN A 1 23  ? -5.539  -3.826  -7.182  1.00 0.00 ? 23  GLN A NE2  7  
ATOM 11128 H H    . GLN A 1 23  ? -4.783  -0.472  -6.649  1.00 0.00 ? 23  GLN A H    7  
ATOM 11129 H HA   . GLN A 1 23  ? -6.046  0.229   -9.156  1.00 0.00 ? 23  GLN A HA   7  
ATOM 11130 H HB2  . GLN A 1 23  ? -4.994  -2.018  -9.856  1.00 0.00 ? 23  GLN A HB2  7  
ATOM 11131 H HB3  . GLN A 1 23  ? -3.918  -0.680  -9.475  1.00 0.00 ? 23  GLN A HB3  7  
ATOM 11132 H HG2  . GLN A 1 23  ? -3.506  -3.103  -8.536  1.00 0.00 ? 23  GLN A HG2  7  
ATOM 11133 H HG3  . GLN A 1 23  ? -3.125  -1.664  -7.592  1.00 0.00 ? 23  GLN A HG3  7  
ATOM 11134 H HE21 . GLN A 1 23  ? -5.413  -4.266  -8.050  1.00 0.00 ? 23  GLN A HE21 7  
ATOM 11135 H HE22 . GLN A 1 23  ? -6.144  -4.158  -6.488  1.00 0.00 ? 23  GLN A HE22 7  
ATOM 11136 N N    . HIS A 1 24  ? -7.402  -2.125  -9.497  1.00 0.00 ? 24  HIS A N    7  
ATOM 11137 C CA   . HIS A 1 24  ? -8.555  -3.019  -9.527  1.00 0.00 ? 24  HIS A CA   7  
ATOM 11138 C C    . HIS A 1 24  ? -8.110  -4.479  -9.530  1.00 0.00 ? 24  HIS A C    7  
ATOM 11139 O O    . HIS A 1 24  ? -7.551  -4.965  -10.512 1.00 0.00 ? 24  HIS A O    7  
ATOM 11140 C CB   . HIS A 1 24  ? -9.416  -2.734  -10.758 1.00 0.00 ? 24  HIS A CB   7  
ATOM 11141 C CG   . HIS A 1 24  ? -8.680  -2.892  -12.054 1.00 0.00 ? 24  HIS A CG   7  
ATOM 11142 N ND1  . HIS A 1 24  ? -7.665  -2.048  -12.451 1.00 0.00 ? 24  HIS A ND1  7  
ATOM 11143 C CD2  . HIS A 1 24  ? -8.817  -3.806  -13.043 1.00 0.00 ? 24  HIS A CD2  7  
ATOM 11144 C CE1  . HIS A 1 24  ? -7.210  -2.435  -13.629 1.00 0.00 ? 24  HIS A CE1  7  
ATOM 11145 N NE2  . HIS A 1 24  ? -7.892  -3.500  -14.011 1.00 0.00 ? 24  HIS A NE2  7  
ATOM 11146 H H    . HIS A 1 24  ? -6.883  -1.987  -10.316 1.00 0.00 ? 24  HIS A H    7  
ATOM 11147 H HA   . HIS A 1 24  ? -9.140  -2.835  -8.639  1.00 0.00 ? 24  HIS A HA   7  
ATOM 11148 H HB2  . HIS A 1 24  ? -10.255 -3.414  -10.768 1.00 0.00 ? 24  HIS A HB2  7  
ATOM 11149 H HB3  . HIS A 1 24  ? -9.782  -1.718  -10.706 1.00 0.00 ? 24  HIS A HB3  7  
ATOM 11150 H HD1  . HIS A 1 24  ? -7.329  -1.279  -11.945 1.00 0.00 ? 24  HIS A HD1  7  
ATOM 11151 H HD2  . HIS A 1 24  ? -9.523  -4.625  -13.068 1.00 0.00 ? 24  HIS A HD2  7  
ATOM 11152 H HE1  . HIS A 1 24  ? -6.416  -1.961  -14.187 1.00 0.00 ? 24  HIS A HE1  7  
ATOM 11153 H HE2  . HIS A 1 24  ? -7.815  -3.936  -14.884 1.00 0.00 ? 24  HIS A HE2  7  
ATOM 11154 N N    . ALA A 1 25  ? -8.363  -5.171  -8.424  1.00 0.00 ? 25  ALA A N    7  
ATOM 11155 C CA   . ALA A 1 25  ? -7.990  -6.575  -8.300  1.00 0.00 ? 25  ALA A CA   7  
ATOM 11156 C C    . ALA A 1 25  ? -9.195  -7.484  -8.518  1.00 0.00 ? 25  ALA A C    7  
ATOM 11157 O O    . ALA A 1 25  ? -10.303 -7.182  -8.071  1.00 0.00 ? 25  ALA A O    7  
ATOM 11158 C CB   . ALA A 1 25  ? -7.369  -6.837  -6.936  1.00 0.00 ? 25  ALA A CB   7  
ATOM 11159 H H    . ALA A 1 25  ? -8.812  -4.727  -7.675  1.00 0.00 ? 25  ALA A H    7  
ATOM 11160 H HA   . ALA A 1 25  ? -7.247  -6.791  -9.054  1.00 0.00 ? 25  ALA A HA   7  
ATOM 11161 H HB1  . ALA A 1 25  ? -7.948  -7.586  -6.416  1.00 0.00 ? 25  ALA A HB1  7  
ATOM 11162 H HB2  . ALA A 1 25  ? -6.356  -7.188  -7.064  1.00 0.00 ? 25  ALA A HB2  7  
ATOM 11163 H HB3  . ALA A 1 25  ? -7.364  -5.923  -6.361  1.00 0.00 ? 25  ALA A HB3  7  
ATOM 11164 N N    . LEU A 1 26  ? -8.972  -8.597  -9.208  1.00 0.00 ? 26  LEU A N    7  
ATOM 11165 C CA   . LEU A 1 26  ? -10.041 -9.551  -9.486  1.00 0.00 ? 26  LEU A CA   7  
ATOM 11166 C C    . LEU A 1 26  ? -9.732  -10.910 -8.867  1.00 0.00 ? 26  LEU A C    7  
ATOM 11167 O O    . LEU A 1 26  ? -10.411 -11.350 -7.938  1.00 0.00 ? 26  LEU A O    7  
ATOM 11168 C CB   . LEU A 1 26  ? -10.239 -9.699  -10.996 1.00 0.00 ? 26  LEU A CB   7  
ATOM 11169 C CG   . LEU A 1 26  ? -10.393 -8.397  -11.783 1.00 0.00 ? 26  LEU A CG   7  
ATOM 11170 C CD1  . LEU A 1 26  ? -9.863  -8.564  -13.199 1.00 0.00 ? 26  LEU A CD1  7  
ATOM 11171 C CD2  . LEU A 1 26  ? -11.849 -7.956  -11.805 1.00 0.00 ? 26  LEU A CD2  7  
ATOM 11172 H H    . LEU A 1 26  ? -8.069  -8.783  -9.538  1.00 0.00 ? 26  LEU A H    7  
ATOM 11173 H HA   . LEU A 1 26  ? -10.950 -9.167  -9.048  1.00 0.00 ? 26  LEU A HA   7  
ATOM 11174 H HB2  . LEU A 1 26  ? -9.384  -10.225 -11.391 1.00 0.00 ? 26  LEU A HB2  7  
ATOM 11175 H HB3  . LEU A 1 26  ? -11.129 -10.290 -11.155 1.00 0.00 ? 26  LEU A HB3  7  
ATOM 11176 H HG   . LEU A 1 26  ? -9.814  -7.621  -11.300 1.00 0.00 ? 26  LEU A HG   7  
ATOM 11177 H HD11 . LEU A 1 26  ? -9.252  -9.452  -13.252 1.00 0.00 ? 26  LEU A HD11 7  
ATOM 11178 H HD12 . LEU A 1 26  ? -9.270  -7.701  -13.465 1.00 0.00 ? 26  LEU A HD12 7  
ATOM 11179 H HD13 . LEU A 1 26  ? -10.693 -8.655  -13.885 1.00 0.00 ? 26  LEU A HD13 7  
ATOM 11180 H HD21 . LEU A 1 26  ? -12.147 -7.651  -10.812 1.00 0.00 ? 26  LEU A HD21 7  
ATOM 11181 H HD22 . LEU A 1 26  ? -12.469 -8.778  -12.130 1.00 0.00 ? 26  LEU A HD22 7  
ATOM 11182 H HD23 . LEU A 1 26  ? -11.963 -7.126  -12.486 1.00 0.00 ? 26  LEU A HD23 7  
ATOM 11183 N N    . HIS A 1 27  ? -8.701  -11.571 -9.385  1.00 0.00 ? 27  HIS A N    7  
ATOM 11184 C CA   . HIS A 1 27  ? -8.300  -12.879 -8.881  1.00 0.00 ? 27  HIS A CA   7  
ATOM 11185 C C    . HIS A 1 27  ? -7.020  -13.355 -9.561  1.00 0.00 ? 27  HIS A C    7  
ATOM 11186 O O    . HIS A 1 27  ? -6.971  -13.503 -10.781 1.00 0.00 ? 27  HIS A O    7  
ATOM 11187 C CB   . HIS A 1 27  ? -9.418  -13.899 -9.103  1.00 0.00 ? 27  HIS A CB   7  
ATOM 11188 C CG   . HIS A 1 27  ? -9.045  -15.293 -8.702  1.00 0.00 ? 27  HIS A CG   7  
ATOM 11189 N ND1  . HIS A 1 27  ? -8.487  -16.204 -9.575  1.00 0.00 ? 27  HIS A ND1  7  
ATOM 11190 C CD2  . HIS A 1 27  ? -9.151  -15.931 -7.513  1.00 0.00 ? 27  HIS A CD2  7  
ATOM 11191 C CE1  . HIS A 1 27  ? -8.268  -17.341 -8.940  1.00 0.00 ? 27  HIS A CE1  7  
ATOM 11192 N NE2  . HIS A 1 27  ? -8.662  -17.202 -7.687  1.00 0.00 ? 27  HIS A NE2  7  
ATOM 11193 H H    . HIS A 1 27  ? -8.199  -11.168 -10.124 1.00 0.00 ? 27  HIS A H    7  
ATOM 11194 H HA   . HIS A 1 27  ? -8.117  -12.785 -7.822  1.00 0.00 ? 27  HIS A HA   7  
ATOM 11195 H HB2  . HIS A 1 27  ? -10.282 -13.608 -8.524  1.00 0.00 ? 27  HIS A HB2  7  
ATOM 11196 H HB3  . HIS A 1 27  ? -9.681  -13.913 -10.151 1.00 0.00 ? 27  HIS A HB3  7  
ATOM 11197 H HD1  . HIS A 1 27  ? -8.284  -16.041 -10.519 1.00 0.00 ? 27  HIS A HD1  7  
ATOM 11198 H HD2  . HIS A 1 27  ? -9.547  -15.517 -6.596  1.00 0.00 ? 27  HIS A HD2  7  
ATOM 11199 H HE1  . HIS A 1 27  ? -7.840  -18.234 -9.372  1.00 0.00 ? 27  HIS A HE1  7  
ATOM 11200 H HE2  . HIS A 1 27  ? -8.690  -17.920 -7.022  1.00 0.00 ? 27  HIS A HE2  7  
ATOM 11201 N N    . GLY A 1 28  ? -5.984  -13.591 -8.762  1.00 0.00 ? 28  GLY A N    7  
ATOM 11202 C CA   . GLY A 1 28  ? -4.717  -14.045 -9.305  1.00 0.00 ? 28  GLY A CA   7  
ATOM 11203 C C    . GLY A 1 28  ? -3.787  -12.898 -9.646  1.00 0.00 ? 28  GLY A C    7  
ATOM 11204 O O    . GLY A 1 28  ? -2.569  -13.018 -9.516  1.00 0.00 ? 28  GLY A O    7  
ATOM 11205 H H    . GLY A 1 28  ? -6.080  -13.455 -7.796  1.00 0.00 ? 28  GLY A H    7  
ATOM 11206 H HA2  . GLY A 1 28  ? -4.234  -14.683 -8.579  1.00 0.00 ? 28  GLY A HA2  7  
ATOM 11207 H HA3  . GLY A 1 28  ? -4.907  -14.618 -10.201 1.00 0.00 ? 28  GLY A HA3  7  
ATOM 11208 N N    . GLU A 1 29  ? -4.362  -11.783 -10.086 1.00 0.00 ? 29  GLU A N    7  
ATOM 11209 C CA   . GLU A 1 29  ? -3.575  -10.610 -10.449 1.00 0.00 ? 29  GLU A CA   7  
ATOM 11210 C C    . GLU A 1 29  ? -2.609  -10.235 -9.329  1.00 0.00 ? 29  GLU A C    7  
ATOM 11211 O O    . GLU A 1 29  ? -2.509  -10.933 -8.320  1.00 0.00 ? 29  GLU A O    7  
ATOM 11212 C CB   . GLU A 1 29  ? -4.495  -9.428  -10.762 1.00 0.00 ? 29  GLU A CB   7  
ATOM 11213 C CG   . GLU A 1 29  ? -5.369  -9.645  -11.986 1.00 0.00 ? 29  GLU A CG   7  
ATOM 11214 C CD   . GLU A 1 29  ? -4.573  -10.079 -13.202 1.00 0.00 ? 29  GLU A CD   7  
ATOM 11215 O OE1  . GLU A 1 29  ? -4.285  -11.288 -13.320 1.00 0.00 ? 29  GLU A OE1  7  
ATOM 11216 O OE2  . GLU A 1 29  ? -4.239  -9.210  -14.034 1.00 0.00 ? 29  GLU A OE2  7  
ATOM 11217 H H    . GLU A 1 29  ? -5.338  -11.748 -10.168 1.00 0.00 ? 29  GLU A H    7  
ATOM 11218 H HA   . GLU A 1 29  ? -3.005  -10.854 -11.333 1.00 0.00 ? 29  GLU A HA   7  
ATOM 11219 H HB2  . GLU A 1 29  ? -5.137  -9.253  -9.912  1.00 0.00 ? 29  GLU A HB2  7  
ATOM 11220 H HB3  . GLU A 1 29  ? -3.888  -8.551  -10.930 1.00 0.00 ? 29  GLU A HB3  7  
ATOM 11221 H HG2  . GLU A 1 29  ? -6.099  -10.408 -11.761 1.00 0.00 ? 29  GLU A HG2  7  
ATOM 11222 H HG3  . GLU A 1 29  ? -5.877  -8.720  -12.218 1.00 0.00 ? 29  GLU A HG3  7  
ATOM 11223 N N    . LYS A 1 30  ? -1.899  -9.127  -9.514  1.00 0.00 ? 30  LYS A N    7  
ATOM 11224 C CA   . LYS A 1 30  ? -0.942  -8.656  -8.521  1.00 0.00 ? 30  LYS A CA   7  
ATOM 11225 C C    . LYS A 1 30  ? -1.386  -7.324  -7.925  1.00 0.00 ? 30  LYS A C    7  
ATOM 11226 O O    . LYS A 1 30  ? -1.342  -6.290  -8.590  1.00 0.00 ? 30  LYS A O    7  
ATOM 11227 C CB   . LYS A 1 30  ? 0.446   -8.508  -9.150  1.00 0.00 ? 30  LYS A CB   7  
ATOM 11228 C CG   . LYS A 1 30  ? 1.138   -9.834  -9.415  1.00 0.00 ? 30  LYS A CG   7  
ATOM 11229 C CD   . LYS A 1 30  ? 2.649   -9.702  -9.328  1.00 0.00 ? 30  LYS A CD   7  
ATOM 11230 C CE   . LYS A 1 30  ? 3.347   -10.966 -9.804  1.00 0.00 ? 30  LYS A CE   7  
ATOM 11231 N NZ   . LYS A 1 30  ? 3.182   -11.173 -11.270 1.00 0.00 ? 30  LYS A NZ   7  
ATOM 11232 H H    . LYS A 1 30  ? -2.023  -8.613  -10.340 1.00 0.00 ? 30  LYS A H    7  
ATOM 11233 H HA   . LYS A 1 30  ? -0.893  -9.392  -7.732  1.00 0.00 ? 30  LYS A HA   7  
ATOM 11234 H HB2  . LYS A 1 30  ? 0.348   -7.983  -10.088 1.00 0.00 ? 30  LYS A HB2  7  
ATOM 11235 H HB3  . LYS A 1 30  ? 1.069   -7.928  -8.485  1.00 0.00 ? 30  LYS A HB3  7  
ATOM 11236 H HG2  . LYS A 1 30  ? 0.807   -10.556 -8.683  1.00 0.00 ? 30  LYS A HG2  7  
ATOM 11237 H HG3  . LYS A 1 30  ? 0.872   -10.177 -10.406 1.00 0.00 ? 30  LYS A HG3  7  
ATOM 11238 H HD2  . LYS A 1 30  ? 2.966   -8.875  -9.946  1.00 0.00 ? 30  LYS A HD2  7  
ATOM 11239 H HD3  . LYS A 1 30  ? 2.926   -9.513  -8.301  1.00 0.00 ? 30  LYS A HD3  7  
ATOM 11240 H HE2  . LYS A 1 30  ? 4.399   -10.888 -9.577  1.00 0.00 ? 30  LYS A HE2  7  
ATOM 11241 H HE3  . LYS A 1 30  ? 2.928   -11.813 -9.280  1.00 0.00 ? 30  LYS A HE3  7  
ATOM 11242 H HZ1  . LYS A 1 30  ? 2.367   -10.629 -11.617 1.00 0.00 ? 30  LYS A HZ1  7  
ATOM 11243 H HZ2  . LYS A 1 30  ? 3.024   -12.180 -11.473 1.00 0.00 ? 30  LYS A HZ2  7  
ATOM 11244 H HZ3  . LYS A 1 30  ? 4.036   -10.859 -11.773 1.00 0.00 ? 30  LYS A HZ3  7  
ATOM 11245 N N    . GLY A 1 31  ? -1.813  -7.357  -6.666  1.00 0.00 ? 31  GLY A N    7  
ATOM 11246 C CA   . GLY A 1 31  ? -2.257  -6.145  -6.002  1.00 0.00 ? 31  GLY A CA   7  
ATOM 11247 C C    . GLY A 1 31  ? -1.139  -5.138  -5.824  1.00 0.00 ? 31  GLY A C    7  
ATOM 11248 O O    . GLY A 1 31  ? -0.430  -5.160  -4.818  1.00 0.00 ? 31  GLY A O    7  
ATOM 11249 H H    . GLY A 1 31  ? -1.826  -8.210  -6.185  1.00 0.00 ? 31  GLY A H    7  
ATOM 11250 H HA2  . GLY A 1 31  ? -3.044  -5.695  -6.588  1.00 0.00 ? 31  GLY A HA2  7  
ATOM 11251 H HA3  . GLY A 1 31  ? -2.650  -6.405  -5.030  1.00 0.00 ? 31  GLY A HA3  7  
ATOM 11252 N N    . GLN A 1 32  ? -0.979  -4.254  -6.803  1.00 0.00 ? 32  GLN A N    7  
ATOM 11253 C CA   . GLN A 1 32  ? 0.063   -3.236  -6.750  1.00 0.00 ? 32  GLN A CA   7  
ATOM 11254 C C    . GLN A 1 32  ? -0.470  -1.942  -6.142  1.00 0.00 ? 32  GLN A C    7  
ATOM 11255 O O    . GLN A 1 32  ? -1.130  -1.153  -6.818  1.00 0.00 ? 32  GLN A O    7  
ATOM 11256 C CB   . GLN A 1 32  ? 0.613   -2.965  -8.152  1.00 0.00 ? 32  GLN A CB   7  
ATOM 11257 C CG   . GLN A 1 32  ? 2.025   -2.401  -8.153  1.00 0.00 ? 32  GLN A CG   7  
ATOM 11258 C CD   . GLN A 1 32  ? 2.730   -2.597  -9.481  1.00 0.00 ? 32  GLN A CD   7  
ATOM 11259 O OE1  . GLN A 1 32  ? 2.152   -2.366  -10.544 1.00 0.00 ? 32  GLN A OE1  7  
ATOM 11260 N NE2  . GLN A 1 32  ? 3.986   -3.024  -9.427  1.00 0.00 ? 32  GLN A NE2  7  
ATOM 11261 H H    . GLN A 1 32  ? -1.576  -4.287  -7.579  1.00 0.00 ? 32  GLN A H    7  
ATOM 11262 H HA   . GLN A 1 32  ? 0.861   -3.610  -6.127  1.00 0.00 ? 32  GLN A HA   7  
ATOM 11263 H HB2  . GLN A 1 32  ? 0.617   -3.890  -8.709  1.00 0.00 ? 32  GLN A HB2  7  
ATOM 11264 H HB3  . GLN A 1 32  ? -0.034  -2.257  -8.649  1.00 0.00 ? 32  GLN A HB3  7  
ATOM 11265 H HG2  . GLN A 1 32  ? 1.976   -1.343  -7.942  1.00 0.00 ? 32  GLN A HG2  7  
ATOM 11266 H HG3  . GLN A 1 32  ? 2.596   -2.896  -7.382  1.00 0.00 ? 32  GLN A HG3  7  
ATOM 11267 H HE21 . GLN A 1 32  ? 4.381   -3.188  -8.545  1.00 0.00 ? 32  GLN A HE21 7  
ATOM 11268 H HE22 . GLN A 1 32  ? 4.465   -3.159  -10.270 1.00 0.00 ? 32  GLN A HE22 7  
ATOM 11269 N N    . ILE A 1 33  ? -0.179  -1.733  -4.862  1.00 0.00 ? 33  ILE A N    7  
ATOM 11270 C CA   . ILE A 1 33  ? -0.628  -0.535  -4.164  1.00 0.00 ? 33  ILE A CA   7  
ATOM 11271 C C    . ILE A 1 33  ? 0.522   0.443   -3.954  1.00 0.00 ? 33  ILE A C    7  
ATOM 11272 O O    . ILE A 1 33  ? 1.395   0.223   -3.114  1.00 0.00 ? 33  ILE A O    7  
ATOM 11273 C CB   . ILE A 1 33  ? -1.249  -0.880  -2.797  1.00 0.00 ? 33  ILE A CB   7  
ATOM 11274 C CG1  . ILE A 1 33  ? -2.224  -2.051  -2.936  1.00 0.00 ? 33  ILE A CG1  7  
ATOM 11275 C CG2  . ILE A 1 33  ? -1.953  0.336   -2.213  1.00 0.00 ? 33  ILE A CG2  7  
ATOM 11276 C CD1  . ILE A 1 33  ? -2.651  -2.643  -1.611  1.00 0.00 ? 33  ILE A CD1  7  
ATOM 11277 H H    . ILE A 1 33  ? 0.351   -2.399  -4.377  1.00 0.00 ? 33  ILE A H    7  
ATOM 11278 H HA   . ILE A 1 33  ? -1.385  -0.060  -4.771  1.00 0.00 ? 33  ILE A HA   7  
ATOM 11279 H HB   . ILE A 1 33  ? -0.452  -1.162  -2.126  1.00 0.00 ? 33  ILE A HB   7  
ATOM 11280 H HG12 . ILE A 1 33  ? -3.111  -1.714  -3.449  1.00 0.00 ? 33  ILE A HG12 7  
ATOM 11281 H HG13 . ILE A 1 33  ? -1.754  -2.834  -3.514  1.00 0.00 ? 33  ILE A HG13 7  
ATOM 11282 H HG21 . ILE A 1 33  ? -1.803  0.359   -1.143  1.00 0.00 ? 33  ILE A HG21 7  
ATOM 11283 H HG22 . ILE A 1 33  ? -1.544  1.233   -2.652  1.00 0.00 ? 33  ILE A HG22 7  
ATOM 11284 H HG23 . ILE A 1 33  ? -3.009  0.278   -2.428  1.00 0.00 ? 33  ILE A HG23 7  
ATOM 11285 H HD11 . ILE A 1 33  ? -1.787  -2.755  -0.972  1.00 0.00 ? 33  ILE A HD11 7  
ATOM 11286 H HD12 . ILE A 1 33  ? -3.367  -1.989  -1.138  1.00 0.00 ? 33  ILE A HD12 7  
ATOM 11287 H HD13 . ILE A 1 33  ? -3.102  -3.610  -1.778  1.00 0.00 ? 33  ILE A HD13 7  
ATOM 11288 N N    . LYS A 1 34  ? 0.517   1.528   -4.723  1.00 0.00 ? 34  LYS A N    7  
ATOM 11289 C CA   . LYS A 1 34  ? 1.558   2.543   -4.620  1.00 0.00 ? 34  LYS A CA   7  
ATOM 11290 C C    . LYS A 1 34  ? 1.066   3.749   -3.825  1.00 0.00 ? 34  LYS A C    7  
ATOM 11291 O O    . LYS A 1 34  ? -0.031  4.256   -4.064  1.00 0.00 ? 34  LYS A O    7  
ATOM 11292 C CB   . LYS A 1 34  ? 2.005   2.987   -6.015  1.00 0.00 ? 34  LYS A CB   7  
ATOM 11293 C CG   . LYS A 1 34  ? 0.857   3.409   -6.916  1.00 0.00 ? 34  LYS A CG   7  
ATOM 11294 C CD   . LYS A 1 34  ? 1.302   4.437   -7.942  1.00 0.00 ? 34  LYS A CD   7  
ATOM 11295 C CE   . LYS A 1 34  ? 2.163   3.807   -9.026  1.00 0.00 ? 34  LYS A CE   7  
ATOM 11296 N NZ   . LYS A 1 34  ? 2.143   4.604   -10.284 1.00 0.00 ? 34  LYS A NZ   7  
ATOM 11297 H H    . LYS A 1 34  ? -0.206  1.648   -5.374  1.00 0.00 ? 34  LYS A H    7  
ATOM 11298 H HA   . LYS A 1 34  ? 2.399   2.106   -4.105  1.00 0.00 ? 34  LYS A HA   7  
ATOM 11299 H HB2  . LYS A 1 34  ? 2.682   3.823   -5.915  1.00 0.00 ? 34  LYS A HB2  7  
ATOM 11300 H HB3  . LYS A 1 34  ? 2.525   2.168   -6.491  1.00 0.00 ? 34  LYS A HB3  7  
ATOM 11301 H HG2  . LYS A 1 34  ? 0.479   2.540   -7.434  1.00 0.00 ? 34  LYS A HG2  7  
ATOM 11302 H HG3  . LYS A 1 34  ? 0.073   3.837   -6.308  1.00 0.00 ? 34  LYS A HG3  7  
ATOM 11303 H HD2  . LYS A 1 34  ? 0.429   4.876   -8.402  1.00 0.00 ? 34  LYS A HD2  7  
ATOM 11304 H HD3  . LYS A 1 34  ? 1.873   5.207   -7.443  1.00 0.00 ? 34  LYS A HD3  7  
ATOM 11305 H HE2  . LYS A 1 34  ? 3.179   3.741   -8.667  1.00 0.00 ? 34  LYS A HE2  7  
ATOM 11306 H HE3  . LYS A 1 34  ? 1.790   2.815   -9.232  1.00 0.00 ? 34  LYS A HE3  7  
ATOM 11307 H HZ1  . LYS A 1 34  ? 2.815   5.395   -10.216 1.00 0.00 ? 34  LYS A HZ1  7  
ATOM 11308 H HZ2  . LYS A 1 34  ? 1.191   4.986   -10.450 1.00 0.00 ? 34  LYS A HZ2  7  
ATOM 11309 H HZ3  . LYS A 1 34  ? 2.410   4.005   -11.091 1.00 0.00 ? 34  LYS A HZ3  7  
ATOM 11310 N N    . CYS A 1 35  ? 1.883   4.203   -2.882  1.00 0.00 ? 35  CYS A N    7  
ATOM 11311 C CA   . CYS A 1 35  ? 1.531   5.349   -2.052  1.00 0.00 ? 35  CYS A CA   7  
ATOM 11312 C C    . CYS A 1 35  ? 2.281   6.598   -2.504  1.00 0.00 ? 35  CYS A C    7  
ATOM 11313 O O    . CYS A 1 35  ? 3.510   6.608   -2.569  1.00 0.00 ? 35  CYS A O    7  
ATOM 11314 C CB   . CYS A 1 35  ? 1.841   5.057   -0.583  1.00 0.00 ? 35  CYS A CB   7  
ATOM 11315 S SG   . CYS A 1 35  ? 0.844   6.009   0.586   1.00 0.00 ? 35  CYS A SG   7  
ATOM 11316 H H    . CYS A 1 35  ? 2.744   3.756   -2.739  1.00 0.00 ? 35  CYS A H    7  
ATOM 11317 H HA   . CYS A 1 35  ? 0.471   5.522   -2.160  1.00 0.00 ? 35  CYS A HA   7  
ATOM 11318 H HB2  . CYS A 1 35  ? 1.665   4.009   -0.388  1.00 0.00 ? 35  CYS A HB2  7  
ATOM 11319 H HB3  . CYS A 1 35  ? 2.880   5.282   -0.391  1.00 0.00 ? 35  CYS A HB3  7  
ATOM 11320 H HG   . CYS A 1 35  ? 0.024   5.171   1.201   1.00 0.00 ? 35  CYS A HG   7  
ATOM 11321 N N    . PHE A 1 36  ? 1.532   7.650   -2.817  1.00 0.00 ? 36  PHE A N    7  
ATOM 11322 C CA   . PHE A 1 36  ? 2.126   8.905   -3.266  1.00 0.00 ? 36  PHE A CA   7  
ATOM 11323 C C    . PHE A 1 36  ? 2.794   9.636   -2.106  1.00 0.00 ? 36  PHE A C    7  
ATOM 11324 O O    . PHE A 1 36  ? 2.185   10.493  -1.465  1.00 0.00 ? 36  PHE A O    7  
ATOM 11325 C CB   . PHE A 1 36  ? 1.059   9.800   -3.901  1.00 0.00 ? 36  PHE A CB   7  
ATOM 11326 C CG   . PHE A 1 36  ? 0.914   9.600   -5.383  1.00 0.00 ? 36  PHE A CG   7  
ATOM 11327 C CD1  . PHE A 1 36  ? 1.254   8.391   -5.969  1.00 0.00 ? 36  PHE A CD1  7  
ATOM 11328 C CD2  . PHE A 1 36  ? 0.437   10.621  -6.189  1.00 0.00 ? 36  PHE A CD2  7  
ATOM 11329 C CE1  . PHE A 1 36  ? 1.120   8.204   -7.332  1.00 0.00 ? 36  PHE A CE1  7  
ATOM 11330 C CE2  . PHE A 1 36  ? 0.301   10.439  -7.552  1.00 0.00 ? 36  PHE A CE2  7  
ATOM 11331 C CZ   . PHE A 1 36  ? 0.644   9.229   -8.125  1.00 0.00 ? 36  PHE A CZ   7  
ATOM 11332 H H    . PHE A 1 36  ? 0.557   7.582   -2.746  1.00 0.00 ? 36  PHE A H    7  
ATOM 11333 H HA   . PHE A 1 36  ? 2.874   8.670   -4.007  1.00 0.00 ? 36  PHE A HA   7  
ATOM 11334 H HB2  . PHE A 1 36  ? 0.105   9.590   -3.443  1.00 0.00 ? 36  PHE A HB2  7  
ATOM 11335 H HB3  . PHE A 1 36  ? 1.318   10.833  -3.728  1.00 0.00 ? 36  PHE A HB3  7  
ATOM 11336 H HD1  . PHE A 1 36  ? 1.627   7.588   -5.349  1.00 0.00 ? 36  PHE A HD1  7  
ATOM 11337 H HD2  . PHE A 1 36  ? 0.169   11.567  -5.744  1.00 0.00 ? 36  PHE A HD2  7  
ATOM 11338 H HE1  . PHE A 1 36  ? 1.390   7.257   -7.775  1.00 0.00 ? 36  PHE A HE1  7  
ATOM 11339 H HE2  . PHE A 1 36  ? -0.071  11.242  -8.170  1.00 0.00 ? 36  PHE A HE2  7  
ATOM 11340 H HZ   . PHE A 1 36  ? 0.539   9.085   -9.189  1.00 0.00 ? 36  PHE A HZ   7  
ATOM 11341 N N    . ILE A 1 37  ? 4.050   9.290   -1.841  1.00 0.00 ? 37  ILE A N    7  
ATOM 11342 C CA   . ILE A 1 37  ? 4.802   9.913   -0.759  1.00 0.00 ? 37  ILE A CA   7  
ATOM 11343 C C    . ILE A 1 37  ? 5.588   11.120  -1.260  1.00 0.00 ? 37  ILE A C    7  
ATOM 11344 O O    . ILE A 1 37  ? 6.600   10.974  -1.946  1.00 0.00 ? 37  ILE A O    7  
ATOM 11345 C CB   . ILE A 1 37  ? 5.775   8.917   -0.103  1.00 0.00 ? 37  ILE A CB   7  
ATOM 11346 C CG1  . ILE A 1 37  ? 5.027   7.661   0.348   1.00 0.00 ? 37  ILE A CG1  7  
ATOM 11347 C CG2  . ILE A 1 37  ? 6.487   9.568   1.073   1.00 0.00 ? 37  ILE A CG2  7  
ATOM 11348 C CD1  . ILE A 1 37  ? 5.932   6.588   0.912   1.00 0.00 ? 37  ILE A CD1  7  
ATOM 11349 H H    . ILE A 1 37  ? 4.481   8.600   -2.387  1.00 0.00 ? 37  ILE A H    7  
ATOM 11350 H HA   . ILE A 1 37  ? 4.096   10.242  -0.010  1.00 0.00 ? 37  ILE A HA   7  
ATOM 11351 H HB   . ILE A 1 37  ? 6.519   8.640   -0.835  1.00 0.00 ? 37  ILE A HB   7  
ATOM 11352 H HG12 . ILE A 1 37  ? 4.315   7.929   1.113   1.00 0.00 ? 37  ILE A HG12 7  
ATOM 11353 H HG13 . ILE A 1 37  ? 4.500   7.242   -0.497  1.00 0.00 ? 37  ILE A HG13 7  
ATOM 11354 H HG21 . ILE A 1 37  ? 7.546   9.366   1.010   1.00 0.00 ? 37  ILE A HG21 7  
ATOM 11355 H HG22 . ILE A 1 37  ? 6.322   10.634  1.048   1.00 0.00 ? 37  ILE A HG22 7  
ATOM 11356 H HG23 . ILE A 1 37  ? 6.099   9.165   1.997   1.00 0.00 ? 37  ILE A HG23 7  
ATOM 11357 H HD11 . ILE A 1 37  ? 6.801   6.481   0.281   1.00 0.00 ? 37  ILE A HD11 7  
ATOM 11358 H HD12 . ILE A 1 37  ? 6.241   6.864   1.909   1.00 0.00 ? 37  ILE A HD12 7  
ATOM 11359 H HD13 . ILE A 1 37  ? 5.397   5.649   0.949   1.00 0.00 ? 37  ILE A HD13 7  
ATOM 11360 N N    . ARG A 1 38  ? 5.116   12.313  -0.911  1.00 0.00 ? 38  ARG A N    7  
ATOM 11361 C CA   . ARG A 1 38  ? 5.776   13.546  -1.324  1.00 0.00 ? 38  ARG A CA   7  
ATOM 11362 C C    . ARG A 1 38  ? 6.877   13.929  -0.341  1.00 0.00 ? 38  ARG A C    7  
ATOM 11363 O O    . ARG A 1 38  ? 7.162   15.110  -0.141  1.00 0.00 ? 38  ARG A O    7  
ATOM 11364 C CB   . ARG A 1 38  ? 4.757   14.682  -1.434  1.00 0.00 ? 38  ARG A CB   7  
ATOM 11365 C CG   . ARG A 1 38  ? 3.715   14.462  -2.519  1.00 0.00 ? 38  ARG A CG   7  
ATOM 11366 C CD   . ARG A 1 38  ? 2.394   15.126  -2.164  1.00 0.00 ? 38  ARG A CD   7  
ATOM 11367 N NE   . ARG A 1 38  ? 2.374   16.539  -2.536  1.00 0.00 ? 38  ARG A NE   7  
ATOM 11368 C CZ   . ARG A 1 38  ? 1.522   17.421  -2.025  1.00 0.00 ? 38  ARG A CZ   7  
ATOM 11369 N NH1  . ARG A 1 38  ? 0.626   17.038  -1.126  1.00 0.00 ? 38  ARG A NH1  7  
ATOM 11370 N NH2  . ARG A 1 38  ? 1.566   18.689  -2.413  1.00 0.00 ? 38  ARG A NH2  7  
ATOM 11371 H H    . ARG A 1 38  ? 4.306   12.365  -0.363  1.00 0.00 ? 38  ARG A H    7  
ATOM 11372 H HA   . ARG A 1 38  ? 6.219   13.376  -2.294  1.00 0.00 ? 38  ARG A HA   7  
ATOM 11373 H HB2  . ARG A 1 38  ? 4.244   14.783  -0.489  1.00 0.00 ? 38  ARG A HB2  7  
ATOM 11374 H HB3  . ARG A 1 38  ? 5.282   15.600  -1.650  1.00 0.00 ? 38  ARG A HB3  7  
ATOM 11375 H HG2  . ARG A 1 38  ? 4.079   14.883  -3.445  1.00 0.00 ? 38  ARG A HG2  7  
ATOM 11376 H HG3  . ARG A 1 38  ? 3.554   13.402  -2.641  1.00 0.00 ? 38  ARG A HG3  7  
ATOM 11377 H HD2  . ARG A 1 38  ? 1.598   14.616  -2.686  1.00 0.00 ? 38  ARG A HD2  7  
ATOM 11378 H HD3  . ARG A 1 38  ? 2.238   15.041  -1.099  1.00 0.00 ? 38  ARG A HD3  7  
ATOM 11379 H HE   . ARG A 1 38  ? 3.027   16.843  -3.199  1.00 0.00 ? 38  ARG A HE   7  
ATOM 11380 H HH11 . ARG A 1 38  ? 0.591   16.084  -0.831  1.00 0.00 ? 38  ARG A HH11 7  
ATOM 11381 H HH12 . ARG A 1 38  ? -0.014  17.705  -0.742  1.00 0.00 ? 38  ARG A HH12 7  
ATOM 11382 H HH21 . ARG A 1 38  ? 2.240   18.981  -3.091  1.00 0.00 ? 38  ARG A HH21 7  
ATOM 11383 H HH22 . ARG A 1 38  ? 0.924   19.352  -2.029  1.00 0.00 ? 38  ARG A HH22 7  
ATOM 11384 N N    . SER A 1 39  ? 7.494   12.923  0.272   1.00 0.00 ? 39  SER A N    7  
ATOM 11385 C CA   . SER A 1 39  ? 8.561   13.155  1.238   1.00 0.00 ? 39  SER A CA   7  
ATOM 11386 C C    . SER A 1 39  ? 9.738   13.875  0.585   1.00 0.00 ? 39  SER A C    7  
ATOM 11387 O O    . SER A 1 39  ? 10.195  13.492  -0.492  1.00 0.00 ? 39  SER A O    7  
ATOM 11388 C CB   . SER A 1 39  ? 9.029   11.829  1.840   1.00 0.00 ? 39  SER A CB   7  
ATOM 11389 O OG   . SER A 1 39  ? 7.980   11.191  2.547   1.00 0.00 ? 39  SER A OG   7  
ATOM 11390 H H    . SER A 1 39  ? 7.222   12.003  0.071   1.00 0.00 ? 39  SER A H    7  
ATOM 11391 H HA   . SER A 1 39  ? 8.165   13.779  2.026   1.00 0.00 ? 39  SER A HA   7  
ATOM 11392 H HB2  . SER A 1 39  ? 9.364   11.176  1.049   1.00 0.00 ? 39  SER A HB2  7  
ATOM 11393 H HB3  . SER A 1 39  ? 9.846   12.016  2.522   1.00 0.00 ? 39  SER A HB3  7  
ATOM 11394 H HG   . SER A 1 39  ? 8.246   10.297  2.777   1.00 0.00 ? 39  SER A HG   7  
ATOM 11395 N N    . THR A 1 40  ? 10.224  14.921  1.246   1.00 0.00 ? 40  THR A N    7  
ATOM 11396 C CA   . THR A 1 40  ? 11.346  15.695  0.732   1.00 0.00 ? 40  THR A CA   7  
ATOM 11397 C C    . THR A 1 40  ? 12.119  16.362  1.864   1.00 0.00 ? 40  THR A C    7  
ATOM 11398 O O    . THR A 1 40  ? 11.679  17.351  2.450   1.00 0.00 ? 40  THR A O    7  
ATOM 11399 C CB   . THR A 1 40  ? 10.875  16.777  -0.259  1.00 0.00 ? 40  THR A CB   7  
ATOM 11400 O OG1  . THR A 1 40  ? 10.178  16.169  -1.352  1.00 0.00 ? 40  THR A OG1  7  
ATOM 11401 C CG2  . THR A 1 40  ? 12.055  17.579  -0.786  1.00 0.00 ? 40  THR A CG2  7  
ATOM 11402 H H    . THR A 1 40  ? 9.817   15.177  2.100   1.00 0.00 ? 40  THR A H    7  
ATOM 11403 H HA   . THR A 1 40  ? 12.006  15.019  0.208   1.00 0.00 ? 40  THR A HA   7  
ATOM 11404 H HB   . THR A 1 40  ? 10.204  17.448  0.257   1.00 0.00 ? 40  THR A HB   7  
ATOM 11405 H HG1  . THR A 1 40  ? 10.741  16.170  -2.131  1.00 0.00 ? 40  THR A HG1  7  
ATOM 11406 H HG21 . THR A 1 40  ? 12.236  18.422  -0.136  1.00 0.00 ? 40  THR A HG21 7  
ATOM 11407 H HG22 . THR A 1 40  ? 11.834  17.933  -1.782  1.00 0.00 ? 40  THR A HG22 7  
ATOM 11408 H HG23 . THR A 1 40  ? 12.933  16.951  -0.814  1.00 0.00 ? 40  THR A HG23 7  
ATOM 11409 N N    . PRO A 1 41  ? 13.300  15.810  2.180   1.00 0.00 ? 41  PRO A N    7  
ATOM 11410 C CA   . PRO A 1 41  ? 13.834  14.632  1.490   1.00 0.00 ? 41  PRO A CA   7  
ATOM 11411 C C    . PRO A 1 41  ? 13.046  13.366  1.809   1.00 0.00 ? 41  PRO A C    7  
ATOM 11412 O O    . PRO A 1 41  ? 12.201  13.341  2.704   1.00 0.00 ? 41  PRO A O    7  
ATOM 11413 C CB   . PRO A 1 41  ? 15.263  14.523  2.028   1.00 0.00 ? 41  PRO A CB   7  
ATOM 11414 C CG   . PRO A 1 41  ? 15.218  15.188  3.360   1.00 0.00 ? 41  PRO A CG   7  
ATOM 11415 C CD   . PRO A 1 41  ? 14.205  16.293  3.237   1.00 0.00 ? 41  PRO A CD   7  
ATOM 11416 H HA   . PRO A 1 41  ? 13.861  14.778  0.420   1.00 0.00 ? 41  PRO A HA   7  
ATOM 11417 H HB2  . PRO A 1 41  ? 15.538  13.481  2.115   1.00 0.00 ? 41  PRO A HB2  7  
ATOM 11418 H HB3  . PRO A 1 41  ? 15.943  15.026  1.358   1.00 0.00 ? 41  PRO A HB3  7  
ATOM 11419 H HG2  . PRO A 1 41  ? 14.911  14.480  4.114   1.00 0.00 ? 41  PRO A HG2  7  
ATOM 11420 H HG3  . PRO A 1 41  ? 16.189  15.596  3.599   1.00 0.00 ? 41  PRO A HG3  7  
ATOM 11421 H HD2  . PRO A 1 41  ? 13.675  16.424  4.169   1.00 0.00 ? 41  PRO A HD2  7  
ATOM 11422 H HD3  . PRO A 1 41  ? 14.685  17.214  2.941   1.00 0.00 ? 41  PRO A HD3  7  
ATOM 11423 N N    . PRO A 1 42  ? 13.327  12.289  1.061   1.00 0.00 ? 42  PRO A N    7  
ATOM 11424 C CA   . PRO A 1 42  ? 12.656  10.999  1.247   1.00 0.00 ? 42  PRO A CA   7  
ATOM 11425 C C    . PRO A 1 42  ? 13.057  10.320  2.552   1.00 0.00 ? 42  PRO A C    7  
ATOM 11426 O O    . PRO A 1 42  ? 14.085  10.633  3.153   1.00 0.00 ? 42  PRO A O    7  
ATOM 11427 C CB   . PRO A 1 42  ? 13.131  10.175  0.048   1.00 0.00 ? 42  PRO A CB   7  
ATOM 11428 C CG   . PRO A 1 42  ? 14.439  10.779  -0.332  1.00 0.00 ? 42  PRO A CG   7  
ATOM 11429 C CD   . PRO A 1 42  ? 14.323  12.246  -0.023  1.00 0.00 ? 42  PRO A CD   7  
ATOM 11430 H HA   . PRO A 1 42  ? 11.581  11.102  1.212   1.00 0.00 ? 42  PRO A HA   7  
ATOM 11431 H HB2  . PRO A 1 42  ? 13.243  9.141   0.340   1.00 0.00 ? 42  PRO A HB2  7  
ATOM 11432 H HB3  . PRO A 1 42  ? 12.413  10.253  -0.754  1.00 0.00 ? 42  PRO A HB3  7  
ATOM 11433 H HG2  . PRO A 1 42  ? 15.232  10.335  0.250   1.00 0.00 ? 42  PRO A HG2  7  
ATOM 11434 H HG3  . PRO A 1 42  ? 14.618  10.632  -1.387  1.00 0.00 ? 42  PRO A HG3  7  
ATOM 11435 H HD2  . PRO A 1 42  ? 15.273  12.638  0.310   1.00 0.00 ? 42  PRO A HD2  7  
ATOM 11436 H HD3  . PRO A 1 42  ? 13.972  12.788  -0.889  1.00 0.00 ? 42  PRO A HD3  7  
ATOM 11437 N N    . PRO A 1 43  ? 12.228  9.367   3.003   1.00 0.00 ? 43  PRO A N    7  
ATOM 11438 C CA   . PRO A 1 43  ? 12.476  8.623   4.242   1.00 0.00 ? 43  PRO A CA   7  
ATOM 11439 C C    . PRO A 1 43  ? 13.661  7.671   4.118   1.00 0.00 ? 43  PRO A C    7  
ATOM 11440 O O    . PRO A 1 43  ? 14.062  7.303   3.014   1.00 0.00 ? 43  PRO A O    7  
ATOM 11441 C CB   . PRO A 1 43  ? 11.179  7.837   4.450   1.00 0.00 ? 43  PRO A CB   7  
ATOM 11442 C CG   . PRO A 1 43  ? 10.600  7.694   3.085   1.00 0.00 ? 43  PRO A CG   7  
ATOM 11443 C CD   . PRO A 1 43  ? 10.984  8.942   2.339   1.00 0.00 ? 43  PRO A CD   7  
ATOM 11444 H HA   . PRO A 1 43  ? 12.635  9.287   5.079   1.00 0.00 ? 43  PRO A HA   7  
ATOM 11445 H HB2  . PRO A 1 43  ? 11.404  6.875   4.887   1.00 0.00 ? 43  PRO A HB2  7  
ATOM 11446 H HB3  . PRO A 1 43  ? 10.520  8.390   5.102   1.00 0.00 ? 43  PRO A HB3  7  
ATOM 11447 H HG2  . PRO A 1 43  ? 11.014  6.824   2.599   1.00 0.00 ? 43  PRO A HG2  7  
ATOM 11448 H HG3  . PRO A 1 43  ? 9.525   7.613   3.150   1.00 0.00 ? 43  PRO A HG3  7  
ATOM 11449 H HD2  . PRO A 1 43  ? 11.161  8.719   1.297   1.00 0.00 ? 43  PRO A HD2  7  
ATOM 11450 H HD3  . PRO A 1 43  ? 10.217  9.694   2.441   1.00 0.00 ? 43  PRO A HD3  7  
ATOM 11451 N N    . ASP A 1 44  ? 14.217  7.275   5.258   1.00 0.00 ? 44  ASP A N    7  
ATOM 11452 C CA   . ASP A 1 44  ? 15.356  6.364   5.278   1.00 0.00 ? 44  ASP A CA   7  
ATOM 11453 C C    . ASP A 1 44  ? 14.892  4.917   5.412   1.00 0.00 ? 44  ASP A C    7  
ATOM 11454 O O    . ASP A 1 44  ? 15.617  3.987   5.058   1.00 0.00 ? 44  ASP A O    7  
ATOM 11455 C CB   . ASP A 1 44  ? 16.300  6.719   6.427   1.00 0.00 ? 44  ASP A CB   7  
ATOM 11456 C CG   . ASP A 1 44  ? 17.156  7.933   6.121   1.00 0.00 ? 44  ASP A CG   7  
ATOM 11457 O OD1  . ASP A 1 44  ? 17.844  7.925   5.079   1.00 0.00 ? 44  ASP A OD1  7  
ATOM 11458 O OD2  . ASP A 1 44  ? 17.137  8.890   6.923   1.00 0.00 ? 44  ASP A OD2  7  
ATOM 11459 H H    . ASP A 1 44  ? 13.853  7.603   6.107   1.00 0.00 ? 44  ASP A H    7  
ATOM 11460 H HA   . ASP A 1 44  ? 15.885  6.474   4.343   1.00 0.00 ? 44  ASP A HA   7  
ATOM 11461 H HB2  . ASP A 1 44  ? 15.717  6.927   7.312   1.00 0.00 ? 44  ASP A HB2  7  
ATOM 11462 H HB3  . ASP A 1 44  ? 16.953  5.880   6.620   1.00 0.00 ? 44  ASP A HB3  7  
ATOM 11463 N N    . ARG A 1 45  ? 13.680  4.735   5.926   1.00 0.00 ? 45  ARG A N    7  
ATOM 11464 C CA   . ARG A 1 45  ? 13.121  3.401   6.109   1.00 0.00 ? 45  ARG A CA   7  
ATOM 11465 C C    . ARG A 1 45  ? 11.618  3.401   5.847   1.00 0.00 ? 45  ARG A C    7  
ATOM 11466 O O    . ARG A 1 45  ? 10.947  4.419   6.021   1.00 0.00 ? 45  ARG A O    7  
ATOM 11467 C CB   . ARG A 1 45  ? 13.402  2.897   7.526   1.00 0.00 ? 45  ARG A CB   7  
ATOM 11468 C CG   . ARG A 1 45  ? 12.552  1.703   7.927   1.00 0.00 ? 45  ARG A CG   7  
ATOM 11469 C CD   . ARG A 1 45  ? 12.917  1.200   9.315   1.00 0.00 ? 45  ARG A CD   7  
ATOM 11470 N NE   . ARG A 1 45  ? 12.589  2.174   10.353  1.00 0.00 ? 45  ARG A NE   7  
ATOM 11471 C CZ   . ARG A 1 45  ? 12.508  1.872   11.644  1.00 0.00 ? 45  ARG A CZ   7  
ATOM 11472 N NH1  . ARG A 1 45  ? 12.730  0.630   12.054  1.00 0.00 ? 45  ARG A NH1  7  
ATOM 11473 N NH2  . ARG A 1 45  ? 12.204  2.813   12.529  1.00 0.00 ? 45  ARG A NH2  7  
ATOM 11474 H H    . ARG A 1 45  ? 13.150  5.516   6.189   1.00 0.00 ? 45  ARG A H    7  
ATOM 11475 H HA   . ARG A 1 45  ? 13.598  2.741   5.400   1.00 0.00 ? 45  ARG A HA   7  
ATOM 11476 H HB2  . ARG A 1 45  ? 14.441  2.610   7.594   1.00 0.00 ? 45  ARG A HB2  7  
ATOM 11477 H HB3  . ARG A 1 45  ? 13.211  3.698   8.224   1.00 0.00 ? 45  ARG A HB3  7  
ATOM 11478 H HG2  . ARG A 1 45  ? 11.512  1.995   7.924   1.00 0.00 ? 45  ARG A HG2  7  
ATOM 11479 H HG3  . ARG A 1 45  ? 12.706  0.907   7.213   1.00 0.00 ? 45  ARG A HG3  7  
ATOM 11480 H HD2  . ARG A 1 45  ? 12.375  0.287   9.507   1.00 0.00 ? 45  ARG A HD2  7  
ATOM 11481 H HD3  . ARG A 1 45  ? 13.978  1.001   9.343   1.00 0.00 ? 45  ARG A HD3  7  
ATOM 11482 H HE   . ARG A 1 45  ? 12.421  3.097   10.073  1.00 0.00 ? 45  ARG A HE   7  
ATOM 11483 H HH11 . ARG A 1 45  ? 12.960  -0.081  11.389  1.00 0.00 ? 45  ARG A HH11 7  
ATOM 11484 H HH12 . ARG A 1 45  ? 12.670  0.406   13.026  1.00 0.00 ? 45  ARG A HH12 7  
ATOM 11485 H HH21 . ARG A 1 45  ? 12.036  3.750   12.225  1.00 0.00 ? 45  ARG A HH21 7  
ATOM 11486 H HH22 . ARG A 1 45  ? 12.143  2.584   13.500  1.00 0.00 ? 45  ARG A HH22 7  
ATOM 11487 N N    . ILE A 1 46  ? 11.096  2.254   5.426   1.00 0.00 ? 46  ILE A N    7  
ATOM 11488 C CA   . ILE A 1 46  ? 9.672   2.122   5.140   1.00 0.00 ? 46  ILE A CA   7  
ATOM 11489 C C    . ILE A 1 46  ? 9.194   0.694   5.379   1.00 0.00 ? 46  ILE A C    7  
ATOM 11490 O O    . ILE A 1 46  ? 9.920   -0.265  5.122   1.00 0.00 ? 46  ILE A O    7  
ATOM 11491 C CB   . ILE A 1 46  ? 9.350   2.524   3.689   1.00 0.00 ? 46  ILE A CB   7  
ATOM 11492 C CG1  . ILE A 1 46  ? 9.816   3.956   3.417   1.00 0.00 ? 46  ILE A CG1  7  
ATOM 11493 C CG2  . ILE A 1 46  ? 7.859   2.387   3.420   1.00 0.00 ? 46  ILE A CG2  7  
ATOM 11494 C CD1  . ILE A 1 46  ? 9.692   4.367   1.967   1.00 0.00 ? 46  ILE A CD1  7  
ATOM 11495 H H    . ILE A 1 46  ? 11.681  1.478   5.305   1.00 0.00 ? 46  ILE A H    7  
ATOM 11496 H HA   . ILE A 1 46  ? 9.137   2.786   5.804   1.00 0.00 ? 46  ILE A HA   7  
ATOM 11497 H HB   . ILE A 1 46  ? 9.874   1.851   3.028   1.00 0.00 ? 46  ILE A HB   7  
ATOM 11498 H HG12 . ILE A 1 46  ? 9.224   4.639   4.006   1.00 0.00 ? 46  ILE A HG12 7  
ATOM 11499 H HG13 . ILE A 1 46  ? 10.854  4.049   3.702   1.00 0.00 ? 46  ILE A HG13 7  
ATOM 11500 H HG21 . ILE A 1 46  ? 7.675   1.475   2.872   1.00 0.00 ? 46  ILE A HG21 7  
ATOM 11501 H HG22 . ILE A 1 46  ? 7.326   2.356   4.358   1.00 0.00 ? 46  ILE A HG22 7  
ATOM 11502 H HG23 . ILE A 1 46  ? 7.518   3.231   2.839   1.00 0.00 ? 46  ILE A HG23 7  
ATOM 11503 H HD11 . ILE A 1 46  ? 9.401   5.406   1.910   1.00 0.00 ? 46  ILE A HD11 7  
ATOM 11504 H HD12 . ILE A 1 46  ? 10.641  4.230   1.471   1.00 0.00 ? 46  ILE A HD12 7  
ATOM 11505 H HD13 . ILE A 1 46  ? 8.942   3.758   1.483   1.00 0.00 ? 46  ILE A HD13 7  
ATOM 11506 N N    . ALA A 1 47  ? 7.966   0.562   5.870   1.00 0.00 ? 47  ALA A N    7  
ATOM 11507 C CA   . ALA A 1 47  ? 7.388   -0.749  6.140   1.00 0.00 ? 47  ALA A CA   7  
ATOM 11508 C C    . ALA A 1 47  ? 5.914   -0.789  5.752   1.00 0.00 ? 47  ALA A C    7  
ATOM 11509 O O    . ALA A 1 47  ? 5.224   0.229   5.791   1.00 0.00 ? 47  ALA A O    7  
ATOM 11510 C CB   . ALA A 1 47  ? 7.559   -1.109  7.608   1.00 0.00 ? 47  ALA A CB   7  
ATOM 11511 H H    . ALA A 1 47  ? 7.436   1.365   6.054   1.00 0.00 ? 47  ALA A H    7  
ATOM 11512 H HA   . ALA A 1 47  ? 7.926   -1.478  5.551   1.00 0.00 ? 47  ALA A HA   7  
ATOM 11513 H HB1  . ALA A 1 47  ? 8.451   -0.634  7.993   1.00 0.00 ? 47  ALA A HB1  7  
ATOM 11514 H HB2  . ALA A 1 47  ? 6.700   -0.767  8.165   1.00 0.00 ? 47  ALA A HB2  7  
ATOM 11515 H HB3  . ALA A 1 47  ? 7.650   -2.180  7.707   1.00 0.00 ? 47  ALA A HB3  7  
ATOM 11516 N N    . TR