data_2CT3
# 
_entry.id   2CT3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CT3         
RCSB  RCSB024592   
WWPDB D_1000024592 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsi002012305.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CT3 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-23 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Miyamoto, K.'                                           1 
'Tomizawa, T.'                                           2 
'Koshiba, S.'                                            3 
'Inoue, M.'                                              4 
'Kigawa, T.'                                             5 
'Yokoyama, S.'                                           6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     'Solution Structure of the SH3 domain of the Vinexin protein' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Miyamoto, K.' 1 
primary 'Tomizawa, T.' 2 
primary 'Koshiba, S.'  3 
primary 'Inoue, M.'    4 
primary 'Kigawa, T.'   5 
primary 'Yokoyama, S.' 6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           Vinexin 
_entity.formula_weight             7716.344 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'SH3 domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SH3-containing adapter molecule-1, SCAM-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsi002012305.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  THR n 
1 9  PRO n 
1 10 TYR n 
1 11 ARG n 
1 12 ALA n 
1 13 MET n 
1 14 TYR n 
1 15 GLN n 
1 16 TYR n 
1 17 ARG n 
1 18 PRO n 
1 19 GLN n 
1 20 ASN n 
1 21 GLU n 
1 22 ASP n 
1 23 GLU n 
1 24 LEU n 
1 25 GLU n 
1 26 LEU n 
1 27 ARG n 
1 28 GLU n 
1 29 GLY n 
1 30 ASP n 
1 31 ARG n 
1 32 VAL n 
1 33 ASP n 
1 34 VAL n 
1 35 MET n 
1 36 GLN n 
1 37 GLN n 
1 38 CYS n 
1 39 ASP n 
1 40 ASP n 
1 41 GLY n 
1 42 TRP n 
1 43 PHE n 
1 44 VAL n 
1 45 GLY n 
1 46 VAL n 
1 47 SER n 
1 48 ARG n 
1 49 ARG n 
1 50 THR n 
1 51 GLN n 
1 52 LYS n 
1 53 PHE n 
1 54 GLY n 
1 55 THR n 
1 56 PHE n 
1 57 PRO n 
1 58 GLY n 
1 59 ASN n 
1 60 TYR n 
1 61 VAL n 
1 62 ALA n 
1 63 PRO n 
1 64 VAL n 
1 65 SER n 
1 66 GLY n 
1 67 PRO n 
1 68 SER n 
1 69 SER n 
1 70 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 SCAM1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P041101-09 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protei synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VINEX_HUMAN 
_struct_ref.pdbx_db_accession          O60504 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   TPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPV 
_struct_ref.pdbx_align_begin           615 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2CT3 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 64 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O60504 
_struct_ref_seq.db_align_beg                  615 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  671 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       64 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2CT3 GLY A 1  ? UNP O60504 ? ? 'CLONING ARTIFACT' 1  1  
1 2CT3 SER A 2  ? UNP O60504 ? ? 'CLONING ARTIFACT' 2  2  
1 2CT3 SER A 3  ? UNP O60504 ? ? 'CLONING ARTIFACT' 3  3  
1 2CT3 GLY A 4  ? UNP O60504 ? ? 'CLONING ARTIFACT' 4  4  
1 2CT3 SER A 5  ? UNP O60504 ? ? 'CLONING ARTIFACT' 5  5  
1 2CT3 SER A 6  ? UNP O60504 ? ? 'CLONING ARTIFACT' 6  6  
1 2CT3 GLY A 7  ? UNP O60504 ? ? 'CLONING ARTIFACT' 7  7  
1 2CT3 SER A 65 ? UNP O60504 ? ? 'CLONING ARTIFACT' 65 8  
1 2CT3 GLY A 66 ? UNP O60504 ? ? 'CLONING ARTIFACT' 66 9  
1 2CT3 PRO A 67 ? UNP O60504 ? ? 'CLONING ARTIFACT' 67 10 
1 2CT3 SER A 68 ? UNP O60504 ? ? 'CLONING ARTIFACT' 68 11 
1 2CT3 SER A 69 ? UNP O60504 ? ? 'CLONING ARTIFACT' 69 12 
1 2CT3 GLY A 70 ? UNP O60504 ? ? 'CLONING ARTIFACT' 70 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         296 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.42mM SH3 domain U-13C, 15N; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2CT3 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2CT3 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2CT3 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker           1 
processing           NMRPipe 20031121 'Delaglio, F.'   2 
'data analysis'      NMRView 5.0.4    'Johnson, B. A.' 3 
'data analysis'      Kujira  0.925    'Kobayashi, N.'  4 
'structure solution' CYANA   2.0.17   'Guntert, P.'    5 
refinement           CYANA   2.0.17   'Guntert, P.'    6 
# 
_exptl.entry_id          2CT3 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2CT3 
_struct.title                     'Solution Structure of the SH3 domain of the Vinexin protein' 
_struct.pdbx_descriptor           Vinexin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CT3 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;Vinexin, SCAM-1, SH3 domian, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       GLY 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        58 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       TYR 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        60 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLY 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         58 
_struct_conf.end_auth_comp_id        TYR 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         60 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 53 ? PRO A 57 ? PHE A 53 PRO A 57 
A 2 TRP A 42 ? SER A 47 ? TRP A 42 SER A 47 
A 3 ASP A 30 ? GLN A 37 ? ASP A 30 GLN A 37 
A 4 THR A 8  ? ALA A 12 ? THR A 8  ALA A 12 
A 5 VAL A 61 ? PRO A 63 ? VAL A 61 PRO A 63 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 56 ? O PHE A 56 N PHE A 43 ? N PHE A 43 
A 2 3 O VAL A 46 ? O VAL A 46 N ASP A 33 ? N ASP A 33 
A 3 4 O ASP A 30 ? O ASP A 30 N ALA A 12 ? N ALA A 12 
A 4 5 N ARG A 11 ? N ARG A 11 O ALA A 62 ? O ALA A 62 
# 
_database_PDB_matrix.entry_id          2CT3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CT3 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? -19.358 3.523   18.936  1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? -20.526 2.893   18.348  1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? -20.612 3.113   16.851  1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? -21.471 3.854   16.374  1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? -18.536 3.614   18.410  1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1  ? -20.486 1.832   18.544  1.00 0.00 ? 1  GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1  ? -21.412 3.301   18.811  1.00 0.00 ? 1  GLY A HA3  1  
ATOM 8     N N    . SER A 1 2  ? -19.718 2.468   16.107  1.00 0.00 ? 2  SER A N    1  
ATOM 9     C CA   . SER A 1 2  ? -19.692 2.602   14.656  1.00 0.00 ? 2  SER A CA   1  
ATOM 10    C C    . SER A 1 2  ? -18.971 1.420   14.014  1.00 0.00 ? 2  SER A C    1  
ATOM 11    O O    . SER A 1 2  ? -18.107 0.797   14.631  1.00 0.00 ? 2  SER A O    1  
ATOM 12    C CB   . SER A 1 2  ? -19.009 3.910   14.254  1.00 0.00 ? 2  SER A CB   1  
ATOM 13    O OG   . SER A 1 2  ? -17.619 3.863   14.524  1.00 0.00 ? 2  SER A OG   1  
ATOM 14    H H    . SER A 1 2  ? -19.058 1.892   16.547  1.00 0.00 ? 2  SER A H    1  
ATOM 15    H HA   . SER A 1 2  ? -20.714 2.617   14.306  1.00 0.00 ? 2  SER A HA   1  
ATOM 16    H HB2  . SER A 1 2  ? -19.153 4.080   13.198  1.00 0.00 ? 2  SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2  ? -19.444 4.727   14.812  1.00 0.00 ? 2  SER A HB3  1  
ATOM 18    H HG   . SER A 1 2  ? -17.156 4.457   13.928  1.00 0.00 ? 2  SER A HG   1  
ATOM 19    N N    . SER A 1 3  ? -19.333 1.118   12.771  1.00 0.00 ? 3  SER A N    1  
ATOM 20    C CA   . SER A 1 3  ? -18.724 0.009   12.046  1.00 0.00 ? 3  SER A CA   1  
ATOM 21    C C    . SER A 1 3  ? -17.209 0.178   11.967  1.00 0.00 ? 3  SER A C    1  
ATOM 22    O O    . SER A 1 3  ? -16.689 1.284   12.110  1.00 0.00 ? 3  SER A O    1  
ATOM 23    C CB   . SER A 1 3  ? -19.311 -0.090  10.637  1.00 0.00 ? 3  SER A CB   1  
ATOM 24    O OG   . SER A 1 3  ? -20.481 -0.889  10.628  1.00 0.00 ? 3  SER A OG   1  
ATOM 25    H H    . SER A 1 3  ? -20.028 1.652   12.333  1.00 0.00 ? 3  SER A H    1  
ATOM 26    H HA   . SER A 1 3  ? -18.945 -0.900  12.584  1.00 0.00 ? 3  SER A HA   1  
ATOM 27    H HB2  . SER A 1 3  ? -19.562 0.898   10.284  1.00 0.00 ? 3  SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3  ? -18.581 -0.534  9.976   1.00 0.00 ? 3  SER A HB3  1  
ATOM 29    H HG   . SER A 1 3  ? -20.376 -1.605  9.996   1.00 0.00 ? 3  SER A HG   1  
ATOM 30    N N    . GLY A 1 4  ? -16.508 -0.928  11.739  1.00 0.00 ? 4  GLY A N    1  
ATOM 31    C CA   . GLY A 1 4  ? -15.060 -0.882  11.645  1.00 0.00 ? 4  GLY A CA   1  
ATOM 32    C C    . GLY A 1 4  ? -14.567 -1.022  10.219  1.00 0.00 ? 4  GLY A C    1  
ATOM 33    O O    . GLY A 1 4  ? -15.328 -1.394  9.325   1.00 0.00 ? 4  GLY A O    1  
ATOM 34    H H    . GLY A 1 4  ? -16.977 -1.782  11.634  1.00 0.00 ? 4  GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4  ? -14.714 0.060   12.044  1.00 0.00 ? 4  GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4  ? -14.647 -1.685  12.237  1.00 0.00 ? 4  GLY A HA3  1  
ATOM 37    N N    . SER A 1 5  ? -13.290 -0.722  10.003  1.00 0.00 ? 5  SER A N    1  
ATOM 38    C CA   . SER A 1 5  ? -12.698 -0.812  8.674   1.00 0.00 ? 5  SER A CA   1  
ATOM 39    C C    . SER A 1 5  ? -12.034 -2.170  8.465   1.00 0.00 ? 5  SER A C    1  
ATOM 40    O O    . SER A 1 5  ? -11.177 -2.581  9.247   1.00 0.00 ? 5  SER A O    1  
ATOM 41    C CB   . SER A 1 5  ? -11.672 0.306   8.473   1.00 0.00 ? 5  SER A CB   1  
ATOM 42    O OG   . SER A 1 5  ? -12.244 1.576   8.737   1.00 0.00 ? 5  SER A OG   1  
ATOM 43    H H    . SER A 1 5  ? -12.734 -0.431  10.756  1.00 0.00 ? 5  SER A H    1  
ATOM 44    H HA   . SER A 1 5  ? -13.490 -0.696  7.949   1.00 0.00 ? 5  SER A HA   1  
ATOM 45    H HB2  . SER A 1 5  ? -10.841 0.153   9.144   1.00 0.00 ? 5  SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5  ? -11.319 0.288   7.452   1.00 0.00 ? 5  SER A HB3  1  
ATOM 47    H HG   . SER A 1 5  ? -12.527 1.977   7.912   1.00 0.00 ? 5  SER A HG   1  
ATOM 48    N N    . SER A 1 6  ? -12.437 -2.861  7.404   1.00 0.00 ? 6  SER A N    1  
ATOM 49    C CA   . SER A 1 6  ? -11.885 -4.175  7.093   1.00 0.00 ? 6  SER A CA   1  
ATOM 50    C C    . SER A 1 6  ? -10.985 -4.109  5.863   1.00 0.00 ? 6  SER A C    1  
ATOM 51    O O    . SER A 1 6  ? -11.436 -3.777  4.767   1.00 0.00 ? 6  SER A O    1  
ATOM 52    C CB   . SER A 1 6  ? -13.012 -5.183  6.861   1.00 0.00 ? 6  SER A CB   1  
ATOM 53    O OG   . SER A 1 6  ? -13.875 -4.753  5.823   1.00 0.00 ? 6  SER A OG   1  
ATOM 54    H H    . SER A 1 6  ? -13.124 -2.480  6.818   1.00 0.00 ? 6  SER A H    1  
ATOM 55    H HA   . SER A 1 6  ? -11.295 -4.495  7.939   1.00 0.00 ? 6  SER A HA   1  
ATOM 56    H HB2  . SER A 1 6  ? -12.588 -6.137  6.587   1.00 0.00 ? 6  SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6  ? -13.587 -5.292  7.770   1.00 0.00 ? 6  SER A HB3  1  
ATOM 58    H HG   . SER A 1 6  ? -14.625 -5.350  5.761   1.00 0.00 ? 6  SER A HG   1  
ATOM 59    N N    . GLY A 1 7  ? -9.708  -4.427  6.053   1.00 0.00 ? 7  GLY A N    1  
ATOM 60    C CA   . GLY A 1 7  ? -8.764  -4.397  4.952   1.00 0.00 ? 7  GLY A CA   1  
ATOM 61    C C    . GLY A 1 7  ? -7.916  -5.652  4.881   1.00 0.00 ? 7  GLY A C    1  
ATOM 62    O O    . GLY A 1 7  ? -7.947  -6.484  5.789   1.00 0.00 ? 7  GLY A O    1  
ATOM 63    H H    . GLY A 1 7  ? -9.405  -4.683  6.950   1.00 0.00 ? 7  GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7  ? -9.310  -4.292  4.027   1.00 0.00 ? 7  GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7  ? -8.113  -3.544  5.073   1.00 0.00 ? 7  GLY A HA3  1  
ATOM 66    N N    . THR A 1 8  ? -7.157  -5.791  3.798   1.00 0.00 ? 8  THR A N    1  
ATOM 67    C CA   . THR A 1 8  ? -6.300  -6.955  3.611   1.00 0.00 ? 8  THR A CA   1  
ATOM 68    C C    . THR A 1 8  ? -4.854  -6.636  3.972   1.00 0.00 ? 8  THR A C    1  
ATOM 69    O O    . THR A 1 8  ? -4.332  -5.566  3.660   1.00 0.00 ? 8  THR A O    1  
ATOM 70    C CB   . THR A 1 8  ? -6.354  -7.464  2.158   1.00 0.00 ? 8  THR A CB   1  
ATOM 71    O OG1  . THR A 1 8  ? -7.683  -7.890  1.837   1.00 0.00 ? 8  THR A OG1  1  
ATOM 72    C CG2  . THR A 1 8  ? -5.383  -8.617  1.952   1.00 0.00 ? 8  THR A CG2  1  
ATOM 73    H H    . THR A 1 8  ? -7.176  -5.094  3.110   1.00 0.00 ? 8  THR A H    1  
ATOM 74    H HA   . THR A 1 8  ? -6.658  -7.741  4.259   1.00 0.00 ? 8  THR A HA   1  
ATOM 75    H HB   . THR A 1 8  ? -6.074  -6.655  1.499   1.00 0.00 ? 8  THR A HB   1  
ATOM 76    H HG1  . THR A 1 8  ? -8.313  -7.404  2.375   1.00 0.00 ? 8  THR A HG1  1  
ATOM 77    H HG21 . THR A 1 8  ? -4.469  -8.419  2.493   1.00 0.00 ? 8  THR A HG21 1  
ATOM 78    H HG22 . THR A 1 8  ? -5.164  -8.719  0.900   1.00 0.00 ? 8  THR A HG22 1  
ATOM 79    H HG23 . THR A 1 8  ? -5.826  -9.530  2.318   1.00 0.00 ? 8  THR A HG23 1  
ATOM 80    N N    . PRO A 1 9  ? -4.188  -7.586  4.646   1.00 0.00 ? 9  PRO A N    1  
ATOM 81    C CA   . PRO A 1 9  ? -2.792  -7.429  5.064   1.00 0.00 ? 9  PRO A CA   1  
ATOM 82    C C    . PRO A 1 9  ? -1.828  -7.454  3.883   1.00 0.00 ? 9  PRO A C    1  
ATOM 83    O O    . PRO A 1 9  ? -1.964  -8.274  2.975   1.00 0.00 ? 9  PRO A O    1  
ATOM 84    C CB   . PRO A 1 9  ? -2.556  -8.638  5.973   1.00 0.00 ? 9  PRO A CB   1  
ATOM 85    C CG   . PRO A 1 9  ? -3.541  -9.656  5.513   1.00 0.00 ? 9  PRO A CG   1  
ATOM 86    C CD   . PRO A 1 9  ? -4.748  -8.886  5.052   1.00 0.00 ? 9  PRO A CD   1  
ATOM 87    H HA   . PRO A 1 9  ? -2.646  -6.519  5.628   1.00 0.00 ? 9  PRO A HA   1  
ATOM 88    H HB2  . PRO A 1 9  ? -1.540  -8.988  5.854   1.00 0.00 ? 9  PRO A HB2  1  
ATOM 89    H HB3  . PRO A 1 9  ? -2.728  -8.359  7.001   1.00 0.00 ? 9  PRO A HB3  1  
ATOM 90    H HG2  . PRO A 1 9  ? -3.126  -10.226 4.695   1.00 0.00 ? 9  PRO A HG2  1  
ATOM 91    H HG3  . PRO A 1 9  ? -3.804  -10.309 6.332   1.00 0.00 ? 9  PRO A HG3  1  
ATOM 92    H HD2  . PRO A 1 9  ? -5.216  -9.383  4.215   1.00 0.00 ? 9  PRO A HD2  1  
ATOM 93    H HD3  . PRO A 1 9  ? -5.451  -8.766  5.864   1.00 0.00 ? 9  PRO A HD3  1  
ATOM 94    N N    . TYR A 1 10 ? -0.853  -6.551  3.903   1.00 0.00 ? 10 TYR A N    1  
ATOM 95    C CA   . TYR A 1 10 ? 0.133   -6.469  2.832   1.00 0.00 ? 10 TYR A CA   1  
ATOM 96    C C    . TYR A 1 10 ? 1.519   -6.163  3.391   1.00 0.00 ? 10 TYR A C    1  
ATOM 97    O O    . TYR A 1 10 ? 1.685   -5.959  4.594   1.00 0.00 ? 10 TYR A O    1  
ATOM 98    C CB   . TYR A 1 10 ? -0.270  -5.394  1.821   1.00 0.00 ? 10 TYR A CB   1  
ATOM 99    C CG   . TYR A 1 10 ? -1.161  -5.908  0.713   1.00 0.00 ? 10 TYR A CG   1  
ATOM 100   C CD1  . TYR A 1 10 ? -2.485  -6.248  0.962   1.00 0.00 ? 10 TYR A CD1  1  
ATOM 101   C CD2  . TYR A 1 10 ? -0.679  -6.055  -0.582  1.00 0.00 ? 10 TYR A CD2  1  
ATOM 102   C CE1  . TYR A 1 10 ? -3.303  -6.720  -0.047  1.00 0.00 ? 10 TYR A CE1  1  
ATOM 103   C CE2  . TYR A 1 10 ? -1.490  -6.524  -1.597  1.00 0.00 ? 10 TYR A CE2  1  
ATOM 104   C CZ   . TYR A 1 10 ? -2.801  -6.855  -1.325  1.00 0.00 ? 10 TYR A CZ   1  
ATOM 105   O OH   . TYR A 1 10 ? -3.612  -7.324  -2.333  1.00 0.00 ? 10 TYR A OH   1  
ATOM 106   H H    . TYR A 1 10 ? -0.796  -5.925  4.654   1.00 0.00 ? 10 TYR A H    1  
ATOM 107   H HA   . TYR A 1 10 ? 0.162   -7.426  2.333   1.00 0.00 ? 10 TYR A HA   1  
ATOM 108   H HB2  . TYR A 1 10 ? -0.800  -4.607  2.334   1.00 0.00 ? 10 TYR A HB2  1  
ATOM 109   H HB3  . TYR A 1 10 ? 0.621   -4.984  1.367   1.00 0.00 ? 10 TYR A HB3  1  
ATOM 110   H HD1  . TYR A 1 10 ? -2.875  -6.141  1.964   1.00 0.00 ? 10 TYR A HD1  1  
ATOM 111   H HD2  . TYR A 1 10 ? 0.349   -5.795  -0.791  1.00 0.00 ? 10 TYR A HD2  1  
ATOM 112   H HE1  . TYR A 1 10 ? -4.330  -6.979  0.166   1.00 0.00 ? 10 TYR A HE1  1  
ATOM 113   H HE2  . TYR A 1 10 ? -1.097  -6.630  -2.597  1.00 0.00 ? 10 TYR A HE2  1  
ATOM 114   H HH   . TYR A 1 10 ? -4.377  -6.750  -2.421  1.00 0.00 ? 10 TYR A HH   1  
ATOM 115   N N    . ARG A 1 11 ? 2.513   -6.132  2.508   1.00 0.00 ? 11 ARG A N    1  
ATOM 116   C CA   . ARG A 1 11 ? 3.885   -5.852  2.912   1.00 0.00 ? 11 ARG A CA   1  
ATOM 117   C C    . ARG A 1 11 ? 4.600   -5.009  1.860   1.00 0.00 ? 11 ARG A C    1  
ATOM 118   O O    . ARG A 1 11 ? 4.536   -5.302  0.667   1.00 0.00 ? 11 ARG A O    1  
ATOM 119   C CB   . ARG A 1 11 ? 4.649   -7.158  3.139   1.00 0.00 ? 11 ARG A CB   1  
ATOM 120   C CG   . ARG A 1 11 ? 6.157   -6.978  3.210   1.00 0.00 ? 11 ARG A CG   1  
ATOM 121   C CD   . ARG A 1 11 ? 6.844   -8.231  3.728   1.00 0.00 ? 11 ARG A CD   1  
ATOM 122   N NE   . ARG A 1 11 ? 8.289   -8.189  3.519   1.00 0.00 ? 11 ARG A NE   1  
ATOM 123   C CZ   . ARG A 1 11 ? 9.088   -9.235  3.699   1.00 0.00 ? 11 ARG A CZ   1  
ATOM 124   N NH1  . ARG A 1 11 ? 8.586   -10.398 4.090   1.00 0.00 ? 11 ARG A NH1  1  
ATOM 125   N NH2  . ARG A 1 11 ? 10.393  -9.118  3.488   1.00 0.00 ? 11 ARG A NH2  1  
ATOM 126   H H    . ARG A 1 11 ? 2.318   -6.303  1.563   1.00 0.00 ? 11 ARG A H    1  
ATOM 127   H HA   . ARG A 1 11 ? 3.852   -5.299  3.838   1.00 0.00 ? 11 ARG A HA   1  
ATOM 128   H HB2  . ARG A 1 11 ? 4.317   -7.599  4.068   1.00 0.00 ? 11 ARG A HB2  1  
ATOM 129   H HB3  . ARG A 1 11 ? 4.427   -7.836  2.329   1.00 0.00 ? 11 ARG A HB3  1  
ATOM 130   H HG2  . ARG A 1 11 ? 6.531   -6.758  2.221   1.00 0.00 ? 11 ARG A HG2  1  
ATOM 131   H HG3  . ARG A 1 11 ? 6.380   -6.155  3.873   1.00 0.00 ? 11 ARG A HG3  1  
ATOM 132   H HD2  . ARG A 1 11 ? 6.646   -8.323  4.786   1.00 0.00 ? 11 ARG A HD2  1  
ATOM 133   H HD3  . ARG A 1 11 ? 6.439   -9.087  3.210   1.00 0.00 ? 11 ARG A HD3  1  
ATOM 134   H HE   . ARG A 1 11 ? 8.681   -7.339  3.230   1.00 0.00 ? 11 ARG A HE   1  
ATOM 135   H HH11 . ARG A 1 11 ? 7.603   -10.489 4.248   1.00 0.00 ? 11 ARG A HH11 1  
ATOM 136   H HH12 . ARG A 1 11 ? 9.189   -11.184 4.224   1.00 0.00 ? 11 ARG A HH12 1  
ATOM 137   H HH21 . ARG A 1 11 ? 10.775  -8.243  3.194   1.00 0.00 ? 11 ARG A HH21 1  
ATOM 138   H HH22 . ARG A 1 11 ? 10.993  -9.905  3.624   1.00 0.00 ? 11 ARG A HH22 1  
ATOM 139   N N    . ALA A 1 12 ? 5.279   -3.960  2.312   1.00 0.00 ? 12 ALA A N    1  
ATOM 140   C CA   . ALA A 1 12 ? 6.007   -3.075  1.411   1.00 0.00 ? 12 ALA A CA   1  
ATOM 141   C C    . ALA A 1 12 ? 7.339   -3.690  0.995   1.00 0.00 ? 12 ALA A C    1  
ATOM 142   O O    . ALA A 1 12 ? 8.329   -3.597  1.720   1.00 0.00 ? 12 ALA A O    1  
ATOM 143   C CB   . ALA A 1 12 ? 6.230   -1.721  2.067   1.00 0.00 ? 12 ALA A CB   1  
ATOM 144   H H    . ALA A 1 12 ? 5.292   -3.778  3.274   1.00 0.00 ? 12 ALA A H    1  
ATOM 145   H HA   . ALA A 1 12 ? 5.400   -2.925  0.529   1.00 0.00 ? 12 ALA A HA   1  
ATOM 146   H HB1  . ALA A 1 12 ? 6.836   -1.847  2.953   1.00 0.00 ? 12 ALA A HB1  1  
ATOM 147   H HB2  . ALA A 1 12 ? 6.736   -1.065  1.375   1.00 0.00 ? 12 ALA A HB2  1  
ATOM 148   H HB3  . ALA A 1 12 ? 5.278   -1.292  2.340   1.00 0.00 ? 12 ALA A HB3  1  
ATOM 149   N N    . MET A 1 13 ? 7.356   -4.318  -0.176  1.00 0.00 ? 13 MET A N    1  
ATOM 150   C CA   . MET A 1 13 ? 8.568   -4.947  -0.688  1.00 0.00 ? 13 MET A CA   1  
ATOM 151   C C    . MET A 1 13 ? 9.731   -3.961  -0.696  1.00 0.00 ? 13 MET A C    1  
ATOM 152   O O    . MET A 1 13 ? 10.883  -4.343  -0.491  1.00 0.00 ? 13 MET A O    1  
ATOM 153   C CB   . MET A 1 13 ? 8.331   -5.486  -2.100  1.00 0.00 ? 13 MET A CB   1  
ATOM 154   C CG   . MET A 1 13 ? 7.116   -6.393  -2.209  1.00 0.00 ? 13 MET A CG   1  
ATOM 155   S SD   . MET A 1 13 ? 7.232   -7.547  -3.589  1.00 0.00 ? 13 MET A SD   1  
ATOM 156   C CE   . MET A 1 13 ? 6.492   -6.579  -4.902  1.00 0.00 ? 13 MET A CE   1  
ATOM 157   H H    . MET A 1 13 ? 6.535   -4.358  -0.710  1.00 0.00 ? 13 MET A H    1  
ATOM 158   H HA   . MET A 1 13 ? 8.814   -5.771  -0.035  1.00 0.00 ? 13 MET A HA   1  
ATOM 159   H HB2  . MET A 1 13 ? 8.192   -4.652  -2.772  1.00 0.00 ? 13 MET A HB2  1  
ATOM 160   H HB3  . MET A 1 13 ? 9.200   -6.047  -2.410  1.00 0.00 ? 13 MET A HB3  1  
ATOM 161   H HG2  . MET A 1 13 ? 7.022   -6.959  -1.293  1.00 0.00 ? 13 MET A HG2  1  
ATOM 162   H HG3  . MET A 1 13 ? 6.237   -5.780  -2.342  1.00 0.00 ? 13 MET A HG3  1  
ATOM 163   H HE1  . MET A 1 13 ? 5.417   -6.677  -4.860  1.00 0.00 ? 13 MET A HE1  1  
ATOM 164   H HE2  . MET A 1 13 ? 6.764   -5.541  -4.781  1.00 0.00 ? 13 MET A HE2  1  
ATOM 165   H HE3  . MET A 1 13 ? 6.848   -6.937  -5.857  1.00 0.00 ? 13 MET A HE3  1  
ATOM 166   N N    . TYR A 1 14 ? 9.422   -2.691  -0.936  1.00 0.00 ? 14 TYR A N    1  
ATOM 167   C CA   . TYR A 1 14 ? 10.443  -1.650  -0.973  1.00 0.00 ? 14 TYR A CA   1  
ATOM 168   C C    . TYR A 1 14 ? 9.916   -0.349  -0.377  1.00 0.00 ? 14 TYR A C    1  
ATOM 169   O O    . TYR A 1 14 ? 8.706   -0.137  -0.295  1.00 0.00 ? 14 TYR A O    1  
ATOM 170   C CB   . TYR A 1 14 ? 10.907  -1.414  -2.411  1.00 0.00 ? 14 TYR A CB   1  
ATOM 171   C CG   . TYR A 1 14 ? 10.829  -2.647  -3.283  1.00 0.00 ? 14 TYR A CG   1  
ATOM 172   C CD1  . TYR A 1 14 ? 11.844  -3.595  -3.273  1.00 0.00 ? 14 TYR A CD1  1  
ATOM 173   C CD2  . TYR A 1 14 ? 9.739   -2.863  -4.118  1.00 0.00 ? 14 TYR A CD2  1  
ATOM 174   C CE1  . TYR A 1 14 ? 11.777  -4.723  -4.068  1.00 0.00 ? 14 TYR A CE1  1  
ATOM 175   C CE2  . TYR A 1 14 ? 9.663   -3.988  -4.916  1.00 0.00 ? 14 TYR A CE2  1  
ATOM 176   C CZ   . TYR A 1 14 ? 10.684  -4.915  -4.887  1.00 0.00 ? 14 TYR A CZ   1  
ATOM 177   O OH   . TYR A 1 14 ? 10.613  -6.037  -5.681  1.00 0.00 ? 14 TYR A OH   1  
ATOM 178   H H    . TYR A 1 14 ? 8.486   -2.448  -1.092  1.00 0.00 ? 14 TYR A H    1  
ATOM 179   H HA   . TYR A 1 14 ? 11.283  -1.988  -0.385  1.00 0.00 ? 14 TYR A HA   1  
ATOM 180   H HB2  . TYR A 1 14 ? 10.291  -0.651  -2.861  1.00 0.00 ? 14 TYR A HB2  1  
ATOM 181   H HB3  . TYR A 1 14 ? 11.935  -1.080  -2.400  1.00 0.00 ? 14 TYR A HB3  1  
ATOM 182   H HD1  . TYR A 1 14 ? 12.699  -3.442  -2.630  1.00 0.00 ? 14 TYR A HD1  1  
ATOM 183   H HD2  . TYR A 1 14 ? 8.941   -2.135  -4.138  1.00 0.00 ? 14 TYR A HD2  1  
ATOM 184   H HE1  . TYR A 1 14 ? 12.577  -5.449  -4.046  1.00 0.00 ? 14 TYR A HE1  1  
ATOM 185   H HE2  . TYR A 1 14 ? 8.808   -4.139  -5.558  1.00 0.00 ? 14 TYR A HE2  1  
ATOM 186   H HH   . TYR A 1 14 ? 11.491  -6.409  -5.788  1.00 0.00 ? 14 TYR A HH   1  
ATOM 187   N N    . GLN A 1 15 ? 10.833  0.519   0.037   1.00 0.00 ? 15 GLN A N    1  
ATOM 188   C CA   . GLN A 1 15 ? 10.462  1.801   0.625   1.00 0.00 ? 15 GLN A CA   1  
ATOM 189   C C    . GLN A 1 15 ? 9.963   2.767   -0.444  1.00 0.00 ? 15 GLN A C    1  
ATOM 190   O O    . GLN A 1 15 ? 10.481  2.795   -1.560  1.00 0.00 ? 15 GLN A O    1  
ATOM 191   C CB   . GLN A 1 15 ? 11.654  2.411   1.365   1.00 0.00 ? 15 GLN A CB   1  
ATOM 192   C CG   . GLN A 1 15 ? 11.354  3.762   1.992   1.00 0.00 ? 15 GLN A CG   1  
ATOM 193   C CD   . GLN A 1 15 ? 12.607  4.569   2.268   1.00 0.00 ? 15 GLN A CD   1  
ATOM 194   O OE1  . GLN A 1 15 ? 13.379  4.869   1.356   1.00 0.00 ? 15 GLN A OE1  1  
ATOM 195   N NE2  . GLN A 1 15 ? 12.816  4.926   3.529   1.00 0.00 ? 15 GLN A NE2  1  
ATOM 196   H H    . GLN A 1 15 ? 11.782  0.293   -0.056  1.00 0.00 ? 15 GLN A H    1  
ATOM 197   H HA   . GLN A 1 15 ? 9.665   1.622   1.331   1.00 0.00 ? 15 GLN A HA   1  
ATOM 198   H HB2  . GLN A 1 15 ? 11.961  1.734   2.148   1.00 0.00 ? 15 GLN A HB2  1  
ATOM 199   H HB3  . GLN A 1 15 ? 12.469  2.536   0.667   1.00 0.00 ? 15 GLN A HB3  1  
ATOM 200   H HG2  . GLN A 1 15 ? 10.723  4.325   1.320   1.00 0.00 ? 15 GLN A HG2  1  
ATOM 201   H HG3  . GLN A 1 15 ? 10.833  3.603   2.925   1.00 0.00 ? 15 GLN A HG3  1  
ATOM 202   H HE21 . GLN A 1 15 ? 12.159  4.650   4.203   1.00 0.00 ? 15 GLN A HE21 1  
ATOM 203   H HE22 . GLN A 1 15 ? 13.619  5.447   3.736   1.00 0.00 ? 15 GLN A HE22 1  
ATOM 204   N N    . TYR A 1 16 ? 8.954   3.557   -0.095  1.00 0.00 ? 16 TYR A N    1  
ATOM 205   C CA   . TYR A 1 16 ? 8.383   4.523   -1.026  1.00 0.00 ? 16 TYR A CA   1  
ATOM 206   C C    . TYR A 1 16 ? 8.573   5.949   -0.517  1.00 0.00 ? 16 TYR A C    1  
ATOM 207   O O    . TYR A 1 16 ? 8.648   6.184   0.689   1.00 0.00 ? 16 TYR A O    1  
ATOM 208   C CB   . TYR A 1 16 ? 6.895   4.240   -1.239  1.00 0.00 ? 16 TYR A CB   1  
ATOM 209   C CG   . TYR A 1 16 ? 6.247   5.143   -2.264  1.00 0.00 ? 16 TYR A CG   1  
ATOM 210   C CD1  . TYR A 1 16 ? 6.581   5.052   -3.609  1.00 0.00 ? 16 TYR A CD1  1  
ATOM 211   C CD2  . TYR A 1 16 ? 5.300   6.088   -1.887  1.00 0.00 ? 16 TYR A CD2  1  
ATOM 212   C CE1  . TYR A 1 16 ? 5.992   5.876   -4.549  1.00 0.00 ? 16 TYR A CE1  1  
ATOM 213   C CE2  . TYR A 1 16 ? 4.705   6.914   -2.820  1.00 0.00 ? 16 TYR A CE2  1  
ATOM 214   C CZ   . TYR A 1 16 ? 5.055   6.805   -4.149  1.00 0.00 ? 16 TYR A CZ   1  
ATOM 215   O OH   . TYR A 1 16 ? 4.464   7.626   -5.082  1.00 0.00 ? 16 TYR A OH   1  
ATOM 216   H H    . TYR A 1 16 ? 8.583   3.489   0.809   1.00 0.00 ? 16 TYR A H    1  
ATOM 217   H HA   . TYR A 1 16 ? 8.898   4.419   -1.970  1.00 0.00 ? 16 TYR A HA   1  
ATOM 218   H HB2  . TYR A 1 16 ? 6.773   3.221   -1.572  1.00 0.00 ? 16 TYR A HB2  1  
ATOM 219   H HB3  . TYR A 1 16 ? 6.373   4.373   -0.302  1.00 0.00 ? 16 TYR A HB3  1  
ATOM 220   H HD1  . TYR A 1 16 ? 7.316   4.323   -3.919  1.00 0.00 ? 16 TYR A HD1  1  
ATOM 221   H HD2  . TYR A 1 16 ? 5.028   6.171   -0.844  1.00 0.00 ? 16 TYR A HD2  1  
ATOM 222   H HE1  . TYR A 1 16 ? 6.265   5.790   -5.590  1.00 0.00 ? 16 TYR A HE1  1  
ATOM 223   H HE2  . TYR A 1 16 ? 3.971   7.643   -2.507  1.00 0.00 ? 16 TYR A HE2  1  
ATOM 224   H HH   . TYR A 1 16 ? 3.510   7.529   -5.036  1.00 0.00 ? 16 TYR A HH   1  
ATOM 225   N N    . ARG A 1 17 ? 8.650   6.897   -1.445  1.00 0.00 ? 17 ARG A N    1  
ATOM 226   C CA   . ARG A 1 17 ? 8.832   8.299   -1.092  1.00 0.00 ? 17 ARG A CA   1  
ATOM 227   C C    . ARG A 1 17 ? 7.691   9.151   -1.642  1.00 0.00 ? 17 ARG A C    1  
ATOM 228   O O    . ARG A 1 17 ? 7.771   9.705   -2.738  1.00 0.00 ? 17 ARG A O    1  
ATOM 229   C CB   . ARG A 1 17 ? 10.170  8.813   -1.628  1.00 0.00 ? 17 ARG A CB   1  
ATOM 230   C CG   . ARG A 1 17 ? 11.377  8.233   -0.909  1.00 0.00 ? 17 ARG A CG   1  
ATOM 231   C CD   . ARG A 1 17 ? 12.603  9.116   -1.077  1.00 0.00 ? 17 ARG A CD   1  
ATOM 232   N NE   . ARG A 1 17 ? 13.072  9.144   -2.459  1.00 0.00 ? 17 ARG A NE   1  
ATOM 233   C CZ   . ARG A 1 17 ? 13.863  8.217   -2.986  1.00 0.00 ? 17 ARG A CZ   1  
ATOM 234   N NH1  . ARG A 1 17 ? 14.271  7.193   -2.249  1.00 0.00 ? 17 ARG A NH1  1  
ATOM 235   N NH2  . ARG A 1 17 ? 14.248  8.311   -4.252  1.00 0.00 ? 17 ARG A NH2  1  
ATOM 236   H H    . ARG A 1 17 ? 8.584   6.647   -2.391  1.00 0.00 ? 17 ARG A H    1  
ATOM 237   H HA   . ARG A 1 17 ? 8.834   8.373   -0.015  1.00 0.00 ? 17 ARG A HA   1  
ATOM 238   H HB2  . ARG A 1 17 ? 10.247  8.559   -2.675  1.00 0.00 ? 17 ARG A HB2  1  
ATOM 239   H HB3  . ARG A 1 17 ? 10.197  9.887   -1.523  1.00 0.00 ? 17 ARG A HB3  1  
ATOM 240   H HG2  . ARG A 1 17 ? 11.150  8.147   0.144   1.00 0.00 ? 17 ARG A HG2  1  
ATOM 241   H HG3  . ARG A 1 17 ? 11.590  7.255   -1.314  1.00 0.00 ? 17 ARG A HG3  1  
ATOM 242   H HD2  . ARG A 1 17 ? 12.351  10.121  -0.772  1.00 0.00 ? 17 ARG A HD2  1  
ATOM 243   H HD3  . ARG A 1 17 ? 13.393  8.737   -0.446  1.00 0.00 ? 17 ARG A HD3  1  
ATOM 244   H HE   . ARG A 1 17 ? 12.783  9.892   -3.022  1.00 0.00 ? 17 ARG A HE   1  
ATOM 245   H HH11 . ARG A 1 17 ? 13.982  7.118   -1.295  1.00 0.00 ? 17 ARG A HH11 1  
ATOM 246   H HH12 . ARG A 1 17 ? 14.866  6.494   -2.648  1.00 0.00 ? 17 ARG A HH12 1  
ATOM 247   H HH21 . ARG A 1 17 ? 13.942  9.082   -4.811  1.00 0.00 ? 17 ARG A HH21 1  
ATOM 248   H HH22 . ARG A 1 17 ? 14.843  7.613   -4.647  1.00 0.00 ? 17 ARG A HH22 1  
ATOM 249   N N    . PRO A 1 18 ? 6.604   9.258   -0.864  1.00 0.00 ? 18 PRO A N    1  
ATOM 250   C CA   . PRO A 1 18 ? 5.427   10.040  -1.252  1.00 0.00 ? 18 PRO A CA   1  
ATOM 251   C C    . PRO A 1 18 ? 5.699   11.540  -1.245  1.00 0.00 ? 18 PRO A C    1  
ATOM 252   O O    . PRO A 1 18 ? 6.105   12.101  -0.228  1.00 0.00 ? 18 PRO A O    1  
ATOM 253   C CB   . PRO A 1 18 ? 4.393   9.679   -0.182  1.00 0.00 ? 18 PRO A CB   1  
ATOM 254   C CG   . PRO A 1 18 ? 5.200   9.273   1.003   1.00 0.00 ? 18 PRO A CG   1  
ATOM 255   C CD   . PRO A 1 18 ? 6.441   8.624   0.455   1.00 0.00 ? 18 PRO A CD   1  
ATOM 256   H HA   . PRO A 1 18 ? 5.058   9.746   -2.224  1.00 0.00 ? 18 PRO A HA   1  
ATOM 257   H HB2  . PRO A 1 18 ? 3.779   10.542  0.034   1.00 0.00 ? 18 PRO A HB2  1  
ATOM 258   H HB3  . PRO A 1 18 ? 3.773   8.869   -0.534  1.00 0.00 ? 18 PRO A HB3  1  
ATOM 259   H HG2  . PRO A 1 18 ? 5.458   10.143  1.587   1.00 0.00 ? 18 PRO A HG2  1  
ATOM 260   H HG3  . PRO A 1 18 ? 4.642   8.569   1.602   1.00 0.00 ? 18 PRO A HG3  1  
ATOM 261   H HD2  . PRO A 1 18 ? 7.288   8.833   1.091   1.00 0.00 ? 18 PRO A HD2  1  
ATOM 262   H HD3  . PRO A 1 18 ? 6.296   7.558   0.355   1.00 0.00 ? 18 PRO A HD3  1  
ATOM 263   N N    . GLN A 1 19 ? 5.472   12.183  -2.386  1.00 0.00 ? 19 GLN A N    1  
ATOM 264   C CA   . GLN A 1 19 ? 5.694   13.619  -2.511  1.00 0.00 ? 19 GLN A CA   1  
ATOM 265   C C    . GLN A 1 19 ? 4.400   14.391  -2.280  1.00 0.00 ? 19 GLN A C    1  
ATOM 266   O O    . GLN A 1 19 ? 4.254   15.526  -2.733  1.00 0.00 ? 19 GLN A O    1  
ATOM 267   C CB   . GLN A 1 19 ? 6.261   13.951  -3.892  1.00 0.00 ? 19 GLN A CB   1  
ATOM 268   C CG   . GLN A 1 19 ? 7.728   13.585  -4.052  1.00 0.00 ? 19 GLN A CG   1  
ATOM 269   C CD   . GLN A 1 19 ? 8.335   14.150  -5.321  1.00 0.00 ? 19 GLN A CD   1  
ATOM 270   O OE1  . GLN A 1 19 ? 8.337   13.498  -6.366  1.00 0.00 ? 19 GLN A OE1  1  
ATOM 271   N NE2  . GLN A 1 19 ? 8.854   15.369  -5.238  1.00 0.00 ? 19 GLN A NE2  1  
ATOM 272   H H    . GLN A 1 19 ? 5.149   11.680  -3.162  1.00 0.00 ? 19 GLN A H    1  
ATOM 273   H HA   . GLN A 1 19 ? 6.412   13.909  -1.758  1.00 0.00 ? 19 GLN A HA   1  
ATOM 274   H HB2  . GLN A 1 19 ? 5.695   13.415  -4.639  1.00 0.00 ? 19 GLN A HB2  1  
ATOM 275   H HB3  . GLN A 1 19 ? 6.156   15.012  -4.066  1.00 0.00 ? 19 GLN A HB3  1  
ATOM 276   H HG2  . GLN A 1 19 ? 8.277   13.971  -3.206  1.00 0.00 ? 19 GLN A HG2  1  
ATOM 277   H HG3  . GLN A 1 19 ? 7.816   12.509  -4.076  1.00 0.00 ? 19 GLN A HG3  1  
ATOM 278   H HE21 . GLN A 1 19 ? 8.818   15.829  -4.372  1.00 0.00 ? 19 GLN A HE21 1  
ATOM 279   H HE22 . GLN A 1 19 ? 9.254   15.758  -6.042  1.00 0.00 ? 19 GLN A HE22 1  
ATOM 280   N N    . ASN A 1 20 ? 3.463   13.769  -1.572  1.00 0.00 ? 20 ASN A N    1  
ATOM 281   C CA   . ASN A 1 20 ? 2.180   14.398  -1.282  1.00 0.00 ? 20 ASN A CA   1  
ATOM 282   C C    . ASN A 1 20 ? 1.460   13.670  -0.151  1.00 0.00 ? 20 ASN A C    1  
ATOM 283   O O    . ASN A 1 20 ? 1.366   12.443  -0.150  1.00 0.00 ? 20 ASN A O    1  
ATOM 284   C CB   . ASN A 1 20 ? 1.300   14.413  -2.534  1.00 0.00 ? 20 ASN A CB   1  
ATOM 285   C CG   . ASN A 1 20 ? -0.078  14.986  -2.266  1.00 0.00 ? 20 ASN A CG   1  
ATOM 286   O OD1  . ASN A 1 20 ? -0.250  15.832  -1.389  1.00 0.00 ? 20 ASN A OD1  1  
ATOM 287   N ND2  . ASN A 1 20 ? -1.067  14.526  -3.023  1.00 0.00 ? 20 ASN A ND2  1  
ATOM 288   H H    . ASN A 1 20 ? 3.638   12.864  -1.238  1.00 0.00 ? 20 ASN A H    1  
ATOM 289   H HA   . ASN A 1 20 ? 2.371   15.415  -0.976  1.00 0.00 ? 20 ASN A HA   1  
ATOM 290   H HB2  . ASN A 1 20 ? 1.777   15.014  -3.295  1.00 0.00 ? 20 ASN A HB2  1  
ATOM 291   H HB3  . ASN A 1 20 ? 1.186   13.403  -2.899  1.00 0.00 ? 20 ASN A HB3  1  
ATOM 292   H HD21 . ASN A 1 20 ? -0.856  13.852  -3.703  1.00 0.00 ? 20 ASN A HD21 1  
ATOM 293   H HD22 . ASN A 1 20 ? -1.968  14.880  -2.872  1.00 0.00 ? 20 ASN A HD22 1  
ATOM 294   N N    . GLU A 1 21 ? 0.954   14.436  0.811   1.00 0.00 ? 21 GLU A N    1  
ATOM 295   C CA   . GLU A 1 21 ? 0.244   13.863  1.948   1.00 0.00 ? 21 GLU A CA   1  
ATOM 296   C C    . GLU A 1 21 ? -0.718  12.770  1.494   1.00 0.00 ? 21 GLU A C    1  
ATOM 297   O O    . GLU A 1 21 ? -0.914  11.772  2.189   1.00 0.00 ? 21 GLU A O    1  
ATOM 298   C CB   . GLU A 1 21 ? -0.524  14.953  2.700   1.00 0.00 ? 21 GLU A CB   1  
ATOM 299   C CG   . GLU A 1 21 ? -1.547  15.679  1.842   1.00 0.00 ? 21 GLU A CG   1  
ATOM 300   C CD   . GLU A 1 21 ? -1.978  17.003  2.442   1.00 0.00 ? 21 GLU A CD   1  
ATOM 301   O OE1  . GLU A 1 21 ? -2.838  16.991  3.347   1.00 0.00 ? 21 GLU A OE1  1  
ATOM 302   O OE2  . GLU A 1 21 ? -1.455  18.050  2.007   1.00 0.00 ? 21 GLU A OE2  1  
ATOM 303   H H    . GLU A 1 21 ? 1.062   15.409  0.754   1.00 0.00 ? 21 GLU A H    1  
ATOM 304   H HA   . GLU A 1 21 ? 0.976   13.429  2.612   1.00 0.00 ? 21 GLU A HA   1  
ATOM 305   H HB2  . GLU A 1 21 ? -1.039  14.503  3.535   1.00 0.00 ? 21 GLU A HB2  1  
ATOM 306   H HB3  . GLU A 1 21 ? 0.182   15.681  3.073   1.00 0.00 ? 21 GLU A HB3  1  
ATOM 307   H HG2  . GLU A 1 21 ? -1.116  15.865  0.870   1.00 0.00 ? 21 GLU A HG2  1  
ATOM 308   H HG3  . GLU A 1 21 ? -2.418  15.049  1.733   1.00 0.00 ? 21 GLU A HG3  1  
ATOM 309   N N    . ASP A 1 22 ? -1.316  12.964  0.324   1.00 0.00 ? 22 ASP A N    1  
ATOM 310   C CA   . ASP A 1 22 ? -2.258  11.995  -0.224  1.00 0.00 ? 22 ASP A CA   1  
ATOM 311   C C    . ASP A 1 22 ? -1.622  10.611  -0.315  1.00 0.00 ? 22 ASP A C    1  
ATOM 312   O O    . ASP A 1 22 ? -2.250  9.607   0.019   1.00 0.00 ? 22 ASP A O    1  
ATOM 313   C CB   . ASP A 1 22 ? -2.735  12.442  -1.607  1.00 0.00 ? 22 ASP A CB   1  
ATOM 314   C CG   . ASP A 1 22 ? -4.132  11.945  -1.926  1.00 0.00 ? 22 ASP A CG   1  
ATOM 315   O OD1  . ASP A 1 22 ? -4.468  10.816  -1.512  1.00 0.00 ? 22 ASP A OD1  1  
ATOM 316   O OD2  . ASP A 1 22 ? -4.888  12.685  -2.590  1.00 0.00 ? 22 ASP A OD2  1  
ATOM 317   H H    . ASP A 1 22 ? -1.119  13.780  -0.184  1.00 0.00 ? 22 ASP A H    1  
ATOM 318   H HA   . ASP A 1 22 ? -3.107  11.944  0.441   1.00 0.00 ? 22 ASP A HA   1  
ATOM 319   H HB2  . ASP A 1 22 ? -2.740  13.521  -1.648  1.00 0.00 ? 22 ASP A HB2  1  
ATOM 320   H HB3  . ASP A 1 22 ? -2.057  12.060  -2.355  1.00 0.00 ? 22 ASP A HB3  1  
ATOM 321   N N    . GLU A 1 23 ? -0.374  10.568  -0.769  1.00 0.00 ? 23 GLU A N    1  
ATOM 322   C CA   . GLU A 1 23 ? 0.346   9.306   -0.905  1.00 0.00 ? 23 GLU A CA   1  
ATOM 323   C C    . GLU A 1 23 ? 0.819   8.801   0.455   1.00 0.00 ? 23 GLU A C    1  
ATOM 324   O O    . GLU A 1 23 ? 1.227   9.584   1.313   1.00 0.00 ? 23 GLU A O    1  
ATOM 325   C CB   . GLU A 1 23 ? 1.542   9.474   -1.844  1.00 0.00 ? 23 GLU A CB   1  
ATOM 326   C CG   . GLU A 1 23 ? 1.183   10.102  -3.181  1.00 0.00 ? 23 GLU A CG   1  
ATOM 327   C CD   . GLU A 1 23 ? 2.298   9.980   -4.201  1.00 0.00 ? 23 GLU A CD   1  
ATOM 328   O OE1  . GLU A 1 23 ? 3.479   10.032  -3.798  1.00 0.00 ? 23 GLU A OE1  1  
ATOM 329   O OE2  . GLU A 1 23 ? 1.990   9.831   -5.402  1.00 0.00 ? 23 GLU A OE2  1  
ATOM 330   H H    . GLU A 1 23 ? 0.074   11.403  -1.020  1.00 0.00 ? 23 GLU A H    1  
ATOM 331   H HA   . GLU A 1 23 ? -0.333  8.581   -1.328  1.00 0.00 ? 23 GLU A HA   1  
ATOM 332   H HB2  . GLU A 1 23 ? 2.278   10.100  -1.362  1.00 0.00 ? 23 GLU A HB2  1  
ATOM 333   H HB3  . GLU A 1 23 ? 1.975   8.503   -2.032  1.00 0.00 ? 23 GLU A HB3  1  
ATOM 334   H HG2  . GLU A 1 23 ? 0.304   9.612   -3.570  1.00 0.00 ? 23 GLU A HG2  1  
ATOM 335   H HG3  . GLU A 1 23 ? 0.970   11.150  -3.026  1.00 0.00 ? 23 GLU A HG3  1  
ATOM 336   N N    . LEU A 1 24 ? 0.762   7.487   0.643   1.00 0.00 ? 24 LEU A N    1  
ATOM 337   C CA   . LEU A 1 24 ? 1.185   6.876   1.899   1.00 0.00 ? 24 LEU A CA   1  
ATOM 338   C C    . LEU A 1 24 ? 2.618   6.363   1.799   1.00 0.00 ? 24 LEU A C    1  
ATOM 339   O O    . LEU A 1 24 ? 2.968   5.652   0.858   1.00 0.00 ? 24 LEU A O    1  
ATOM 340   C CB   . LEU A 1 24 ? 0.245   5.728   2.271   1.00 0.00 ? 24 LEU A CB   1  
ATOM 341   C CG   . LEU A 1 24 ? 0.313   5.249   3.722   1.00 0.00 ? 24 LEU A CG   1  
ATOM 342   C CD1  . LEU A 1 24 ? -0.159  6.342   4.668   1.00 0.00 ? 24 LEU A CD1  1  
ATOM 343   C CD2  . LEU A 1 24 ? -0.516  3.986   3.906   1.00 0.00 ? 24 LEU A CD2  1  
ATOM 344   H H    . LEU A 1 24 ? 0.429   6.914   -0.077  1.00 0.00 ? 24 LEU A H    1  
ATOM 345   H HA   . LEU A 1 24 ? 1.139   7.632   2.668   1.00 0.00 ? 24 LEU A HA   1  
ATOM 346   H HB2  . LEU A 1 24 ? -0.766  6.052   2.078   1.00 0.00 ? 24 LEU A HB2  1  
ATOM 347   H HB3  . LEU A 1 24 ? 0.481   4.888   1.633   1.00 0.00 ? 24 LEU A HB3  1  
ATOM 348   H HG   . LEU A 1 24 ? 1.340   5.014   3.969   1.00 0.00 ? 24 LEU A HG   1  
ATOM 349   H HD11 . LEU A 1 24 ? -0.211  7.280   4.137   1.00 0.00 ? 24 LEU A HD11 1  
ATOM 350   H HD12 . LEU A 1 24 ? 0.535   6.431   5.490   1.00 0.00 ? 24 LEU A HD12 1  
ATOM 351   H HD13 . LEU A 1 24 ? -1.138  6.089   5.049   1.00 0.00 ? 24 LEU A HD13 1  
ATOM 352   H HD21 . LEU A 1 24 ? -1.170  4.106   4.757   1.00 0.00 ? 24 LEU A HD21 1  
ATOM 353   H HD22 . LEU A 1 24 ? 0.141   3.145   4.072   1.00 0.00 ? 24 LEU A HD22 1  
ATOM 354   H HD23 . LEU A 1 24 ? -1.108  3.812   3.019   1.00 0.00 ? 24 LEU A HD23 1  
ATOM 355   N N    . GLU A 1 25 ? 3.441   6.728   2.777   1.00 0.00 ? 25 GLU A N    1  
ATOM 356   C CA   . GLU A 1 25 ? 4.836   6.303   2.800   1.00 0.00 ? 25 GLU A CA   1  
ATOM 357   C C    . GLU A 1 25 ? 4.947   4.817   3.129   1.00 0.00 ? 25 GLU A C    1  
ATOM 358   O O    . GLU A 1 25 ? 4.120   4.267   3.857   1.00 0.00 ? 25 GLU A O    1  
ATOM 359   C CB   . GLU A 1 25 ? 5.626   7.123   3.822   1.00 0.00 ? 25 GLU A CB   1  
ATOM 360   C CG   . GLU A 1 25 ? 7.129   7.084   3.603   1.00 0.00 ? 25 GLU A CG   1  
ATOM 361   C CD   . GLU A 1 25 ? 7.903   7.672   4.766   1.00 0.00 ? 25 GLU A CD   1  
ATOM 362   O OE1  . GLU A 1 25 ? 7.951   7.027   5.834   1.00 0.00 ? 25 GLU A OE1  1  
ATOM 363   O OE2  . GLU A 1 25 ? 8.463   8.777   4.608   1.00 0.00 ? 25 GLU A OE2  1  
ATOM 364   H H    . GLU A 1 25 ? 3.103   7.296   3.500   1.00 0.00 ? 25 GLU A H    1  
ATOM 365   H HA   . GLU A 1 25 ? 5.250   6.474   1.818   1.00 0.00 ? 25 GLU A HA   1  
ATOM 366   H HB2  . GLU A 1 25 ? 5.301   8.152   3.768   1.00 0.00 ? 25 GLU A HB2  1  
ATOM 367   H HB3  . GLU A 1 25 ? 5.417   6.740   4.810   1.00 0.00 ? 25 GLU A HB3  1  
ATOM 368   H HG2  . GLU A 1 25 ? 7.434   6.057   3.469   1.00 0.00 ? 25 GLU A HG2  1  
ATOM 369   H HG3  . GLU A 1 25 ? 7.365   7.647   2.711   1.00 0.00 ? 25 GLU A HG3  1  
ATOM 370   N N    . LEU A 1 26 ? 5.973   4.172   2.586   1.00 0.00 ? 26 LEU A N    1  
ATOM 371   C CA   . LEU A 1 26 ? 6.194   2.749   2.820   1.00 0.00 ? 26 LEU A CA   1  
ATOM 372   C C    . LEU A 1 26 ? 7.665   2.465   3.104   1.00 0.00 ? 26 LEU A C    1  
ATOM 373   O O    . LEU A 1 26 ? 8.546   3.210   2.673   1.00 0.00 ? 26 LEU A O    1  
ATOM 374   C CB   . LEU A 1 26 ? 5.729   1.935   1.611   1.00 0.00 ? 26 LEU A CB   1  
ATOM 375   C CG   . LEU A 1 26 ? 4.232   1.984   1.304   1.00 0.00 ? 26 LEU A CG   1  
ATOM 376   C CD1  . LEU A 1 26 ? 3.959   1.476   -0.103  1.00 0.00 ? 26 LEU A CD1  1  
ATOM 377   C CD2  . LEU A 1 26 ? 3.451   1.172   2.328   1.00 0.00 ? 26 LEU A CD2  1  
ATOM 378   H H    . LEU A 1 26 ? 6.599   4.663   2.014   1.00 0.00 ? 26 LEU A H    1  
ATOM 379   H HA   . LEU A 1 26 ? 5.611   2.462   3.683   1.00 0.00 ? 26 LEU A HA   1  
ATOM 380   H HB2  . LEU A 1 26 ? 6.256   2.301   0.744   1.00 0.00 ? 26 LEU A HB2  1  
ATOM 381   H HB3  . LEU A 1 26 ? 5.999   0.903   1.785   1.00 0.00 ? 26 LEU A HB3  1  
ATOM 382   H HG   . LEU A 1 26 ? 3.893   3.009   1.360   1.00 0.00 ? 26 LEU A HG   1  
ATOM 383   H HD11 . LEU A 1 26 ? 2.919   1.633   -0.347  1.00 0.00 ? 26 LEU A HD11 1  
ATOM 384   H HD12 . LEU A 1 26 ? 4.185   0.421   -0.155  1.00 0.00 ? 26 LEU A HD12 1  
ATOM 385   H HD13 . LEU A 1 26 ? 4.580   2.012   -0.806  1.00 0.00 ? 26 LEU A HD13 1  
ATOM 386   H HD21 . LEU A 1 26 ? 2.628   1.763   2.703   1.00 0.00 ? 26 LEU A HD21 1  
ATOM 387   H HD22 . LEU A 1 26 ? 4.103   0.902   3.146   1.00 0.00 ? 26 LEU A HD22 1  
ATOM 388   H HD23 . LEU A 1 26 ? 3.069   0.277   1.861   1.00 0.00 ? 26 LEU A HD23 1  
ATOM 389   N N    . ARG A 1 27 ? 7.924   1.382   3.830   1.00 0.00 ? 27 ARG A N    1  
ATOM 390   C CA   . ARG A 1 27 ? 9.289   1.000   4.170   1.00 0.00 ? 27 ARG A CA   1  
ATOM 391   C C    . ARG A 1 27 ? 9.530   -0.478  3.873   1.00 0.00 ? 27 ARG A C    1  
ATOM 392   O O    . ARG A 1 27 ? 8.670   -1.320  4.129   1.00 0.00 ? 27 ARG A O    1  
ATOM 393   C CB   . ARG A 1 27 ? 9.569   1.286   5.646   1.00 0.00 ? 27 ARG A CB   1  
ATOM 394   C CG   . ARG A 1 27 ? 10.958  0.862   6.096   1.00 0.00 ? 27 ARG A CG   1  
ATOM 395   C CD   . ARG A 1 27 ? 11.425  1.671   7.296   1.00 0.00 ? 27 ARG A CD   1  
ATOM 396   N NE   . ARG A 1 27 ? 12.880  1.788   7.344   1.00 0.00 ? 27 ARG A NE   1  
ATOM 397   C CZ   . ARG A 1 27 ? 13.676  0.859   7.862   1.00 0.00 ? 27 ARG A CZ   1  
ATOM 398   N NH1  . ARG A 1 27 ? 13.160  -0.251  8.372   1.00 0.00 ? 27 ARG A NH1  1  
ATOM 399   N NH2  . ARG A 1 27 ? 14.990  1.038   7.869   1.00 0.00 ? 27 ARG A NH2  1  
ATOM 400   H H    . ARG A 1 27 ? 7.180   0.828   4.144   1.00 0.00 ? 27 ARG A H    1  
ATOM 401   H HA   . ARG A 1 27 ? 9.961   1.590   3.564   1.00 0.00 ? 27 ARG A HA   1  
ATOM 402   H HB2  . ARG A 1 27 ? 9.466   2.347   5.821   1.00 0.00 ? 27 ARG A HB2  1  
ATOM 403   H HB3  . ARG A 1 27 ? 8.844   0.758   6.246   1.00 0.00 ? 27 ARG A HB3  1  
ATOM 404   H HG2  . ARG A 1 27 ? 10.935  -0.183  6.367   1.00 0.00 ? 27 ARG A HG2  1  
ATOM 405   H HG3  . ARG A 1 27 ? 11.651  1.010   5.281   1.00 0.00 ? 27 ARG A HG3  1  
ATOM 406   H HD2  . ARG A 1 27 ? 10.996  2.660   7.237   1.00 0.00 ? 27 ARG A HD2  1  
ATOM 407   H HD3  . ARG A 1 27 ? 11.083  1.184   8.197   1.00 0.00 ? 27 ARG A HD3  1  
ATOM 408   H HE   . ARG A 1 27 ? 13.283  2.600   6.972   1.00 0.00 ? 27 ARG A HE   1  
ATOM 409   H HH11 . ARG A 1 27 ? 12.170  -0.389  8.368   1.00 0.00 ? 27 ARG A HH11 1  
ATOM 410   H HH12 . ARG A 1 27 ? 13.761  -0.949  8.761   1.00 0.00 ? 27 ARG A HH12 1  
ATOM 411   H HH21 . ARG A 1 27 ? 15.383  1.873   7.485   1.00 0.00 ? 27 ARG A HH21 1  
ATOM 412   H HH22 . ARG A 1 27 ? 15.588  0.339   8.259   1.00 0.00 ? 27 ARG A HH22 1  
ATOM 413   N N    . GLU A 1 28 ? 10.704  -0.784  3.330   1.00 0.00 ? 28 GLU A N    1  
ATOM 414   C CA   . GLU A 1 28 ? 11.056  -2.159  2.997   1.00 0.00 ? 28 GLU A CA   1  
ATOM 415   C C    . GLU A 1 28 ? 10.804  -3.087  4.182   1.00 0.00 ? 28 GLU A C    1  
ATOM 416   O O    . GLU A 1 28 ? 11.546  -3.075  5.163   1.00 0.00 ? 28 GLU A O    1  
ATOM 417   C CB   . GLU A 1 28 ? 12.523  -2.245  2.571   1.00 0.00 ? 28 GLU A CB   1  
ATOM 418   C CG   . GLU A 1 28 ? 12.926  -3.614  2.049   1.00 0.00 ? 28 GLU A CG   1  
ATOM 419   C CD   . GLU A 1 28 ? 14.411  -3.882  2.201   1.00 0.00 ? 28 GLU A CD   1  
ATOM 420   O OE1  . GLU A 1 28 ? 14.907  -3.842  3.347   1.00 0.00 ? 28 GLU A OE1  1  
ATOM 421   O OE2  . GLU A 1 28 ? 15.076  -4.133  1.175   1.00 0.00 ? 28 GLU A OE2  1  
ATOM 422   H H    . GLU A 1 28 ? 11.349  -0.068  3.149   1.00 0.00 ? 28 GLU A H    1  
ATOM 423   H HA   . GLU A 1 28 ? 10.433  -2.470  2.173   1.00 0.00 ? 28 GLU A HA   1  
ATOM 424   H HB2  . GLU A 1 28 ? 12.703  -1.518  1.793   1.00 0.00 ? 28 GLU A HB2  1  
ATOM 425   H HB3  . GLU A 1 28 ? 13.146  -2.009  3.421   1.00 0.00 ? 28 GLU A HB3  1  
ATOM 426   H HG2  . GLU A 1 28 ? 12.382  -4.368  2.596   1.00 0.00 ? 28 GLU A HG2  1  
ATOM 427   H HG3  . GLU A 1 28 ? 12.670  -3.675  1.002   1.00 0.00 ? 28 GLU A HG3  1  
ATOM 428   N N    . GLY A 1 29 ? 9.750   -3.891  4.083   1.00 0.00 ? 29 GLY A N    1  
ATOM 429   C CA   . GLY A 1 29 ? 9.417   -4.814  5.152   1.00 0.00 ? 29 GLY A CA   1  
ATOM 430   C C    . GLY A 1 29 ? 8.418   -4.231  6.131   1.00 0.00 ? 29 GLY A C    1  
ATOM 431   O O    . GLY A 1 29 ? 8.480   -4.505  7.330   1.00 0.00 ? 29 GLY A O    1  
ATOM 432   H H    . GLY A 1 29 ? 9.193   -3.858  3.277   1.00 0.00 ? 29 GLY A H    1  
ATOM 433   H HA2  . GLY A 1 29 ? 9.002   -5.713  4.722   1.00 0.00 ? 29 GLY A HA2  1  
ATOM 434   H HA3  . GLY A 1 29 ? 10.321  -5.068  5.687   1.00 0.00 ? 29 GLY A HA3  1  
ATOM 435   N N    . ASP A 1 30 ? 7.494   -3.424  5.621   1.00 0.00 ? 30 ASP A N    1  
ATOM 436   C CA   . ASP A 1 30 ? 6.477   -2.800  6.459   1.00 0.00 ? 30 ASP A CA   1  
ATOM 437   C C    . ASP A 1 30 ? 5.095   -3.368  6.149   1.00 0.00 ? 30 ASP A C    1  
ATOM 438   O O    . ASP A 1 30 ? 4.785   -3.680  4.999   1.00 0.00 ? 30 ASP A O    1  
ATOM 439   C CB   . ASP A 1 30 ? 6.477   -1.284  6.254   1.00 0.00 ? 30 ASP A CB   1  
ATOM 440   C CG   . ASP A 1 30 ? 6.042   -0.533  7.497   1.00 0.00 ? 30 ASP A CG   1  
ATOM 441   O OD1  . ASP A 1 30 ? 6.641   -0.762  8.569   1.00 0.00 ? 30 ASP A OD1  1  
ATOM 442   O OD2  . ASP A 1 30 ? 5.104   0.285   7.398   1.00 0.00 ? 30 ASP A OD2  1  
ATOM 443   H H    . ASP A 1 30 ? 7.496   -3.245  4.657   1.00 0.00 ? 30 ASP A H    1  
ATOM 444   H HA   . ASP A 1 30 ? 6.717   -3.015  7.488   1.00 0.00 ? 30 ASP A HA   1  
ATOM 445   H HB2  . ASP A 1 30 ? 7.474   -0.963  5.992   1.00 0.00 ? 30 ASP A HB2  1  
ATOM 446   H HB3  . ASP A 1 30 ? 5.800   -1.036  5.450   1.00 0.00 ? 30 ASP A HB3  1  
ATOM 447   N N    . ARG A 1 31 ? 4.269   -3.499  7.182   1.00 0.00 ? 31 ARG A N    1  
ATOM 448   C CA   . ARG A 1 31 ? 2.921   -4.031  7.020   1.00 0.00 ? 31 ARG A CA   1  
ATOM 449   C C    . ARG A 1 31 ? 1.974   -2.959  6.488   1.00 0.00 ? 31 ARG A C    1  
ATOM 450   O O    . ARG A 1 31 ? 1.971   -1.825  6.967   1.00 0.00 ? 31 ARG A O    1  
ATOM 451   C CB   . ARG A 1 31 ? 2.400   -4.571  8.353   1.00 0.00 ? 31 ARG A CB   1  
ATOM 452   C CG   . ARG A 1 31 ? 2.875   -5.980  8.667   1.00 0.00 ? 31 ARG A CG   1  
ATOM 453   C CD   . ARG A 1 31 ? 2.194   -7.008  7.777   1.00 0.00 ? 31 ARG A CD   1  
ATOM 454   N NE   . ARG A 1 31 ? 0.807   -7.241  8.172   1.00 0.00 ? 31 ARG A NE   1  
ATOM 455   C CZ   . ARG A 1 31 ? 0.456   -7.961  9.232   1.00 0.00 ? 31 ARG A CZ   1  
ATOM 456   N NH1  . ARG A 1 31 ? 1.385   -8.514  9.999   1.00 0.00 ? 31 ARG A NH1  1  
ATOM 457   N NH2  . ARG A 1 31 ? -0.827  -8.127  9.527   1.00 0.00 ? 31 ARG A NH2  1  
ATOM 458   H H    . ARG A 1 31 ? 4.574   -3.232  8.075   1.00 0.00 ? 31 ARG A H    1  
ATOM 459   H HA   . ARG A 1 31 ? 2.967   -4.840  6.307   1.00 0.00 ? 31 ARG A HA   1  
ATOM 460   H HB2  . ARG A 1 31 ? 2.732   -3.918  9.148   1.00 0.00 ? 31 ARG A HB2  1  
ATOM 461   H HB3  . ARG A 1 31 ? 1.321   -4.575  8.329   1.00 0.00 ? 31 ARG A HB3  1  
ATOM 462   H HG2  . ARG A 1 31 ? 3.942   -6.034  8.509   1.00 0.00 ? 31 ARG A HG2  1  
ATOM 463   H HG3  . ARG A 1 31 ? 2.650   -6.204  9.699   1.00 0.00 ? 31 ARG A HG3  1  
ATOM 464   H HD2  . ARG A 1 31 ? 2.212   -6.652  6.758   1.00 0.00 ? 31 ARG A HD2  1  
ATOM 465   H HD3  . ARG A 1 31 ? 2.738   -7.938  7.843   1.00 0.00 ? 31 ARG A HD3  1  
ATOM 466   H HE   . ARG A 1 31 ? 0.104   -6.841  7.620   1.00 0.00 ? 31 ARG A HE   1  
ATOM 467   H HH11 . ARG A 1 31 ? 2.352   -8.390  9.780   1.00 0.00 ? 31 ARG A HH11 1  
ATOM 468   H HH12 . ARG A 1 31 ? 1.118   -9.055  10.797  1.00 0.00 ? 31 ARG A HH12 1  
ATOM 469   H HH21 . ARG A 1 31 ? -1.530  -7.711  8.951   1.00 0.00 ? 31 ARG A HH21 1  
ATOM 470   H HH22 . ARG A 1 31 ? -1.091  -8.669  10.325  1.00 0.00 ? 31 ARG A HH22 1  
ATOM 471   N N    . VAL A 1 32 ? 1.172   -3.327  5.494   1.00 0.00 ? 32 VAL A N    1  
ATOM 472   C CA   . VAL A 1 32 ? 0.220   -2.398  4.896   1.00 0.00 ? 32 VAL A CA   1  
ATOM 473   C C    . VAL A 1 32 ? -1.196  -2.959  4.941   1.00 0.00 ? 32 VAL A C    1  
ATOM 474   O O    . VAL A 1 32 ? -1.406  -4.159  4.764   1.00 0.00 ? 32 VAL A O    1  
ATOM 475   C CB   . VAL A 1 32 ? 0.589   -2.079  3.435   1.00 0.00 ? 32 VAL A CB   1  
ATOM 476   C CG1  . VAL A 1 32 ? -0.231  -0.906  2.921   1.00 0.00 ? 32 VAL A CG1  1  
ATOM 477   C CG2  . VAL A 1 32 ? 2.078   -1.794  3.311   1.00 0.00 ? 32 VAL A CG2  1  
ATOM 478   H H    . VAL A 1 32 ? 1.222   -4.245  5.154   1.00 0.00 ? 32 VAL A H    1  
ATOM 479   H HA   . VAL A 1 32 ? 0.251   -1.478  5.462   1.00 0.00 ? 32 VAL A HA   1  
ATOM 480   H HB   . VAL A 1 32 ? 0.357   -2.943  2.830   1.00 0.00 ? 32 VAL A HB   1  
ATOM 481   H HG11 . VAL A 1 32 ? 0.389   -0.022  2.886   1.00 0.00 ? 32 VAL A HG11 1  
ATOM 482   H HG12 . VAL A 1 32 ? -0.599  -1.129  1.931   1.00 0.00 ? 32 VAL A HG12 1  
ATOM 483   H HG13 . VAL A 1 32 ? -1.066  -0.732  3.585   1.00 0.00 ? 32 VAL A HG13 1  
ATOM 484   H HG21 . VAL A 1 32 ? 2.252   -0.736  3.431   1.00 0.00 ? 32 VAL A HG21 1  
ATOM 485   H HG22 . VAL A 1 32 ? 2.613   -2.336  4.078   1.00 0.00 ? 32 VAL A HG22 1  
ATOM 486   H HG23 . VAL A 1 32 ? 2.426   -2.110  2.339   1.00 0.00 ? 32 VAL A HG23 1  
ATOM 487   N N    . ASP A 1 33 ? -2.166  -2.083  5.179   1.00 0.00 ? 33 ASP A N    1  
ATOM 488   C CA   . ASP A 1 33 ? -3.565  -2.490  5.245   1.00 0.00 ? 33 ASP A CA   1  
ATOM 489   C C    . ASP A 1 33 ? -4.341  -1.969  4.039   1.00 0.00 ? 33 ASP A C    1  
ATOM 490   O O    . ASP A 1 33 ? -4.954  -0.903  4.095   1.00 0.00 ? 33 ASP A O    1  
ATOM 491   C CB   . ASP A 1 33 ? -4.206  -1.980  6.538   1.00 0.00 ? 33 ASP A CB   1  
ATOM 492   C CG   . ASP A 1 33 ? -3.579  -2.593  7.775   1.00 0.00 ? 33 ASP A CG   1  
ATOM 493   O OD1  . ASP A 1 33 ? -3.663  -3.829  7.932   1.00 0.00 ? 33 ASP A OD1  1  
ATOM 494   O OD2  . ASP A 1 33 ? -3.005  -1.836  8.586   1.00 0.00 ? 33 ASP A OD2  1  
ATOM 495   H H    . ASP A 1 33 ? -1.936  -1.139  5.312   1.00 0.00 ? 33 ASP A H    1  
ATOM 496   H HA   . ASP A 1 33 ? -3.597  -3.569  5.240   1.00 0.00 ? 33 ASP A HA   1  
ATOM 497   H HB2  . ASP A 1 33 ? -4.089  -0.908  6.591   1.00 0.00 ? 33 ASP A HB2  1  
ATOM 498   H HB3  . ASP A 1 33 ? -5.258  -2.224  6.530   1.00 0.00 ? 33 ASP A HB3  1  
ATOM 499   N N    . VAL A 1 34 ? -4.307  -2.728  2.948   1.00 0.00 ? 34 VAL A N    1  
ATOM 500   C CA   . VAL A 1 34 ? -5.007  -2.343  1.728   1.00 0.00 ? 34 VAL A CA   1  
ATOM 501   C C    . VAL A 1 34 ? -6.518  -2.399  1.920   1.00 0.00 ? 34 VAL A C    1  
ATOM 502   O O    . VAL A 1 34 ? -7.044  -3.338  2.518   1.00 0.00 ? 34 VAL A O    1  
ATOM 503   C CB   . VAL A 1 34 ? -4.617  -3.252  0.548   1.00 0.00 ? 34 VAL A CB   1  
ATOM 504   C CG1  . VAL A 1 34 ? -5.633  -3.132  -0.578  1.00 0.00 ? 34 VAL A CG1  1  
ATOM 505   C CG2  . VAL A 1 34 ? -3.219  -2.913  0.053   1.00 0.00 ? 34 VAL A CG2  1  
ATOM 506   H H    . VAL A 1 34 ? -3.801  -3.567  2.965   1.00 0.00 ? 34 VAL A H    1  
ATOM 507   H HA   . VAL A 1 34 ? -4.722  -1.330  1.485   1.00 0.00 ? 34 VAL A HA   1  
ATOM 508   H HB   . VAL A 1 34 ? -4.615  -4.276  0.893   1.00 0.00 ? 34 VAL A HB   1  
ATOM 509   H HG11 . VAL A 1 34 ? -5.325  -3.750  -1.408  1.00 0.00 ? 34 VAL A HG11 1  
ATOM 510   H HG12 . VAL A 1 34 ? -6.601  -3.456  -0.225  1.00 0.00 ? 34 VAL A HG12 1  
ATOM 511   H HG13 . VAL A 1 34 ? -5.693  -2.103  -0.900  1.00 0.00 ? 34 VAL A HG13 1  
ATOM 512   H HG21 . VAL A 1 34 ? -3.243  -1.969  -0.470  1.00 0.00 ? 34 VAL A HG21 1  
ATOM 513   H HG22 . VAL A 1 34 ? -2.546  -2.840  0.896   1.00 0.00 ? 34 VAL A HG22 1  
ATOM 514   H HG23 . VAL A 1 34 ? -2.875  -3.687  -0.616  1.00 0.00 ? 34 VAL A HG23 1  
ATOM 515   N N    . MET A 1 35 ? -7.212  -1.387  1.409   1.00 0.00 ? 35 MET A N    1  
ATOM 516   C CA   . MET A 1 35 ? -8.664  -1.322  1.523   1.00 0.00 ? 35 MET A CA   1  
ATOM 517   C C    . MET A 1 35 ? -9.324  -1.466  0.156   1.00 0.00 ? 35 MET A C    1  
ATOM 518   O O    . MET A 1 35 ? -10.221 -2.289  -0.027  1.00 0.00 ? 35 MET A O    1  
ATOM 519   C CB   . MET A 1 35 ? -9.088  -0.002  2.170   1.00 0.00 ? 35 MET A CB   1  
ATOM 520   C CG   . MET A 1 35 ? -8.331  0.318   3.449   1.00 0.00 ? 35 MET A CG   1  
ATOM 521   S SD   . MET A 1 35 ? -9.141  -0.341  4.919   1.00 0.00 ? 35 MET A SD   1  
ATOM 522   C CE   . MET A 1 35 ? -8.181  0.440   6.214   1.00 0.00 ? 35 MET A CE   1  
ATOM 523   H H    . MET A 1 35 ? -6.737  -0.668  0.944   1.00 0.00 ? 35 MET A H    1  
ATOM 524   H HA   . MET A 1 35 ? -8.984  -2.140  2.152   1.00 0.00 ? 35 MET A HA   1  
ATOM 525   H HB2  . MET A 1 35 ? -8.919  0.800   1.467   1.00 0.00 ? 35 MET A HB2  1  
ATOM 526   H HB3  . MET A 1 35 ? -10.141 -0.050  2.404   1.00 0.00 ? 35 MET A HB3  1  
ATOM 527   H HG2  . MET A 1 35 ? -7.340  -0.106  3.381   1.00 0.00 ? 35 MET A HG2  1  
ATOM 528   H HG3  . MET A 1 35 ? -8.255  1.391   3.547   1.00 0.00 ? 35 MET A HG3  1  
ATOM 529   H HE1  . MET A 1 35 ? -8.847  0.856   6.955   1.00 0.00 ? 35 MET A HE1  1  
ATOM 530   H HE2  . MET A 1 35 ? -7.538  -0.293  6.678   1.00 0.00 ? 35 MET A HE2  1  
ATOM 531   H HE3  . MET A 1 35 ? -7.578  1.230   5.788   1.00 0.00 ? 35 MET A HE3  1  
ATOM 532   N N    . GLN A 1 36 ? -8.874  -0.660  -0.801  1.00 0.00 ? 36 GLN A N    1  
ATOM 533   C CA   . GLN A 1 36 ? -9.423  -0.699  -2.152  1.00 0.00 ? 36 GLN A CA   1  
ATOM 534   C C    . GLN A 1 36 ? -8.316  -0.888  -3.184  1.00 0.00 ? 36 GLN A C    1  
ATOM 535   O O    . GLN A 1 36 ? -7.165  -0.520  -2.948  1.00 0.00 ? 36 GLN A O    1  
ATOM 536   C CB   . GLN A 1 36 ? -10.197 0.587   -2.447  1.00 0.00 ? 36 GLN A CB   1  
ATOM 537   C CG   . GLN A 1 36 ? -10.781 0.637   -3.850  1.00 0.00 ? 36 GLN A CG   1  
ATOM 538   C CD   . GLN A 1 36 ? -11.916 1.635   -3.974  1.00 0.00 ? 36 GLN A CD   1  
ATOM 539   O OE1  . GLN A 1 36 ? -11.714 2.842   -3.836  1.00 0.00 ? 36 GLN A OE1  1  
ATOM 540   N NE2  . GLN A 1 36 ? -13.118 1.135   -4.236  1.00 0.00 ? 36 GLN A NE2  1  
ATOM 541   H H    . GLN A 1 36 ? -8.158  -0.026  -0.594  1.00 0.00 ? 36 GLN A H    1  
ATOM 542   H HA   . GLN A 1 36 ? -10.100 -1.537  -2.211  1.00 0.00 ? 36 GLN A HA   1  
ATOM 543   H HB2  . GLN A 1 36 ? -11.007 0.676   -1.739  1.00 0.00 ? 36 GLN A HB2  1  
ATOM 544   H HB3  . GLN A 1 36 ? -9.531  1.429   -2.328  1.00 0.00 ? 36 GLN A HB3  1  
ATOM 545   H HG2  . GLN A 1 36 ? -10.000 0.916   -4.541  1.00 0.00 ? 36 GLN A HG2  1  
ATOM 546   H HG3  . GLN A 1 36 ? -11.153 -0.344  -4.105  1.00 0.00 ? 36 GLN A HG3  1  
ATOM 547   H HE21 . GLN A 1 36 ? -13.203 0.163   -4.332  1.00 0.00 ? 36 GLN A HE21 1  
ATOM 548   H HE22 . GLN A 1 36 ? -13.869 1.757   -4.321  1.00 0.00 ? 36 GLN A HE22 1  
ATOM 549   N N    . GLN A 1 37 ? -8.672  -1.465  -4.327  1.00 0.00 ? 37 GLN A N    1  
ATOM 550   C CA   . GLN A 1 37 ? -7.708  -1.704  -5.394  1.00 0.00 ? 37 GLN A CA   1  
ATOM 551   C C    . GLN A 1 37 ? -8.023  -0.847  -6.615  1.00 0.00 ? 37 GLN A C    1  
ATOM 552   O O    . GLN A 1 37 ? -9.132  -0.893  -7.149  1.00 0.00 ? 37 GLN A O    1  
ATOM 553   C CB   . GLN A 1 37 ? -7.702  -3.184  -5.783  1.00 0.00 ? 37 GLN A CB   1  
ATOM 554   C CG   . GLN A 1 37 ? -7.711  -4.126  -4.590  1.00 0.00 ? 37 GLN A CG   1  
ATOM 555   C CD   . GLN A 1 37 ? -7.481  -5.571  -4.986  1.00 0.00 ? 37 GLN A CD   1  
ATOM 556   O OE1  . GLN A 1 37 ? -7.207  -5.872  -6.149  1.00 0.00 ? 37 GLN A OE1  1  
ATOM 557   N NE2  . GLN A 1 37 ? -7.591  -6.475  -4.020  1.00 0.00 ? 37 GLN A NE2  1  
ATOM 558   H H    . GLN A 1 37 ? -9.604  -1.736  -4.455  1.00 0.00 ? 37 GLN A H    1  
ATOM 559   H HA   . GLN A 1 37 ? -6.730  -1.435  -5.024  1.00 0.00 ? 37 GLN A HA   1  
ATOM 560   H HB2  . GLN A 1 37 ? -8.575  -3.389  -6.384  1.00 0.00 ? 37 GLN A HB2  1  
ATOM 561   H HB3  . GLN A 1 37 ? -6.817  -3.387  -6.367  1.00 0.00 ? 37 GLN A HB3  1  
ATOM 562   H HG2  . GLN A 1 37 ? -6.930  -3.828  -3.906  1.00 0.00 ? 37 GLN A HG2  1  
ATOM 563   H HG3  . GLN A 1 37 ? -8.668  -4.051  -4.096  1.00 0.00 ? 37 GLN A HG3  1  
ATOM 564   H HE21 . GLN A 1 37 ? -7.812  -6.162  -3.117  1.00 0.00 ? 37 GLN A HE21 1  
ATOM 565   H HE22 . GLN A 1 37 ? -7.448  -7.416  -4.248  1.00 0.00 ? 37 GLN A HE22 1  
ATOM 566   N N    . CYS A 1 38 ? -7.042  -0.065  -7.052  1.00 0.00 ? 38 CYS A N    1  
ATOM 567   C CA   . CYS A 1 38 ? -7.216  0.804   -8.211  1.00 0.00 ? 38 CYS A CA   1  
ATOM 568   C C    . CYS A 1 38 ? -7.183  -0.002  -9.505  1.00 0.00 ? 38 CYS A C    1  
ATOM 569   O O    . CYS A 1 38 ? -6.488  -1.013  -9.601  1.00 0.00 ? 38 CYS A O    1  
ATOM 570   C CB   . CYS A 1 38 ? -6.126  1.878   -8.236  1.00 0.00 ? 38 CYS A CB   1  
ATOM 571   S SG   . CYS A 1 38 ? -6.558  3.389   -7.342  1.00 0.00 ? 38 CYS A SG   1  
ATOM 572   H H    . CYS A 1 38 ? -6.180  -0.072  -6.586  1.00 0.00 ? 38 CYS A H    1  
ATOM 573   H HA   . CYS A 1 38 ? -8.179  1.283   -8.123  1.00 0.00 ? 38 CYS A HA   1  
ATOM 574   H HB2  . CYS A 1 38 ? -5.227  1.478   -7.790  1.00 0.00 ? 38 CYS A HB2  1  
ATOM 575   H HB3  . CYS A 1 38 ? -5.922  2.148   -9.262  1.00 0.00 ? 38 CYS A HB3  1  
ATOM 576   H HG   . CYS A 1 38 ? -5.432  4.001   -7.007  1.00 0.00 ? 38 CYS A HG   1  
ATOM 577   N N    . ASP A 1 39 ? -7.940  0.453   -10.498 1.00 0.00 ? 39 ASP A N    1  
ATOM 578   C CA   . ASP A 1 39 ? -7.999  -0.226  -11.787 1.00 0.00 ? 39 ASP A CA   1  
ATOM 579   C C    . ASP A 1 39 ? -6.597  -0.480  -12.332 1.00 0.00 ? 39 ASP A C    1  
ATOM 580   O O    . ASP A 1 39 ? -6.198  -1.627  -12.536 1.00 0.00 ? 39 ASP A O    1  
ATOM 581   C CB   . ASP A 1 39 ? -8.806  0.603   -12.788 1.00 0.00 ? 39 ASP A CB   1  
ATOM 582   C CG   . ASP A 1 39 ? -8.397  2.062   -12.793 1.00 0.00 ? 39 ASP A CG   1  
ATOM 583   O OD1  . ASP A 1 39 ? -8.831  2.804   -11.887 1.00 0.00 ? 39 ASP A OD1  1  
ATOM 584   O OD2  . ASP A 1 39 ? -7.641  2.463   -13.704 1.00 0.00 ? 39 ASP A OD2  1  
ATOM 585   H H    . ASP A 1 39 ? -8.472  1.265   -10.360 1.00 0.00 ? 39 ASP A H    1  
ATOM 586   H HA   . ASP A 1 39 ? -8.491  -1.175  -11.640 1.00 0.00 ? 39 ASP A HA   1  
ATOM 587   H HB2  . ASP A 1 39 ? -8.657  0.202   -13.780 1.00 0.00 ? 39 ASP A HB2  1  
ATOM 588   H HB3  . ASP A 1 39 ? -9.854  0.542   -12.533 1.00 0.00 ? 39 ASP A HB3  1  
ATOM 589   N N    . ASP A 1 40 ? -5.855  0.597   -12.566 1.00 0.00 ? 40 ASP A N    1  
ATOM 590   C CA   . ASP A 1 40 ? -4.497  0.491   -13.087 1.00 0.00 ? 40 ASP A CA   1  
ATOM 591   C C    . ASP A 1 40 ? -3.710  -0.582  -12.341 1.00 0.00 ? 40 ASP A C    1  
ATOM 592   O O    . ASP A 1 40 ? -2.948  -1.338  -12.941 1.00 0.00 ? 40 ASP A O    1  
ATOM 593   C CB   . ASP A 1 40 ? -3.779  1.837   -12.977 1.00 0.00 ? 40 ASP A CB   1  
ATOM 594   C CG   . ASP A 1 40 ? -4.018  2.721   -14.185 1.00 0.00 ? 40 ASP A CG   1  
ATOM 595   O OD1  . ASP A 1 40 ? -5.192  3.052   -14.455 1.00 0.00 ? 40 ASP A OD1  1  
ATOM 596   O OD2  . ASP A 1 40 ? -3.032  3.082   -14.862 1.00 0.00 ? 40 ASP A OD2  1  
ATOM 597   H H    . ASP A 1 40 ? -6.229  1.484   -12.383 1.00 0.00 ? 40 ASP A H    1  
ATOM 598   H HA   . ASP A 1 40 ? -4.562  0.212   -14.128 1.00 0.00 ? 40 ASP A HA   1  
ATOM 599   H HB2  . ASP A 1 40 ? -4.134  2.356   -12.099 1.00 0.00 ? 40 ASP A HB2  1  
ATOM 600   H HB3  . ASP A 1 40 ? -2.717  1.665   -12.884 1.00 0.00 ? 40 ASP A HB3  1  
ATOM 601   N N    . GLY A 1 41 ? -3.900  -0.640  -11.026 1.00 0.00 ? 41 GLY A N    1  
ATOM 602   C CA   . GLY A 1 41 ? -3.200  -1.622  -10.218 1.00 0.00 ? 41 GLY A CA   1  
ATOM 603   C C    . GLY A 1 41 ? -2.844  -1.095  -8.843  1.00 0.00 ? 41 GLY A C    1  
ATOM 604   O O    . GLY A 1 41 ? -2.639  -1.869  -7.908  1.00 0.00 ? 41 GLY A O    1  
ATOM 605   H H    . GLY A 1 41 ? -4.520  -0.011  -10.601 1.00 0.00 ? 41 GLY A H    1  
ATOM 606   H HA2  . GLY A 1 41 ? -3.828  -2.494  -10.107 1.00 0.00 ? 41 GLY A HA2  1  
ATOM 607   H HA3  . GLY A 1 41 ? -2.291  -1.908  -10.727 1.00 0.00 ? 41 GLY A HA3  1  
ATOM 608   N N    . TRP A 1 42 ? -2.769  0.225   -8.719  1.00 0.00 ? 42 TRP A N    1  
ATOM 609   C CA   . TRP A 1 42 ? -2.434  0.856   -7.447  1.00 0.00 ? 42 TRP A CA   1  
ATOM 610   C C    . TRP A 1 42 ? -3.343  0.350   -6.332  1.00 0.00 ? 42 TRP A C    1  
ATOM 611   O O    . TRP A 1 42 ? -4.368  -0.281  -6.592  1.00 0.00 ? 42 TRP A O    1  
ATOM 612   C CB   . TRP A 1 42 ? -2.546  2.377   -7.562  1.00 0.00 ? 42 TRP A CB   1  
ATOM 613   C CG   . TRP A 1 42 ? -1.308  3.024   -8.106  1.00 0.00 ? 42 TRP A CG   1  
ATOM 614   C CD1  . TRP A 1 42 ? -0.751  2.823   -9.337  1.00 0.00 ? 42 TRP A CD1  1  
ATOM 615   C CD2  . TRP A 1 42 ? -0.474  3.975   -7.436  1.00 0.00 ? 42 TRP A CD2  1  
ATOM 616   N NE1  . TRP A 1 42 ? 0.380   3.592   -9.472  1.00 0.00 ? 42 TRP A NE1  1  
ATOM 617   C CE2  . TRP A 1 42 ? 0.571   4.308   -8.320  1.00 0.00 ? 42 TRP A CE2  1  
ATOM 618   C CE3  . TRP A 1 42 ? -0.508  4.579   -6.176  1.00 0.00 ? 42 TRP A CE3  1  
ATOM 619   C CZ2  . TRP A 1 42 ? 1.571   5.217   -7.982  1.00 0.00 ? 42 TRP A CZ2  1  
ATOM 620   C CZ3  . TRP A 1 42 ? 0.485   5.480   -5.842  1.00 0.00 ? 42 TRP A CZ3  1  
ATOM 621   C CH2  . TRP A 1 42 ? 1.512   5.793   -6.742  1.00 0.00 ? 42 TRP A CH2  1  
ATOM 622   H H    . TRP A 1 42 ? -2.944  0.790   -9.501  1.00 0.00 ? 42 TRP A H    1  
ATOM 623   H HA   . TRP A 1 42 ? -1.413  0.596   -7.208  1.00 0.00 ? 42 TRP A HA   1  
ATOM 624   H HB2  . TRP A 1 42 ? -3.366  2.622   -8.220  1.00 0.00 ? 42 TRP A HB2  1  
ATOM 625   H HB3  . TRP A 1 42 ? -2.737  2.792   -6.583  1.00 0.00 ? 42 TRP A HB3  1  
ATOM 626   H HD1  . TRP A 1 42 ? -1.151  2.154   -10.083 1.00 0.00 ? 42 TRP A HD1  1  
ATOM 627   H HE1  . TRP A 1 42 ? 0.954   3.623   -10.266 1.00 0.00 ? 42 TRP A HE1  1  
ATOM 628   H HE3  . TRP A 1 42 ? -1.291  4.350   -5.469  1.00 0.00 ? 42 TRP A HE3  1  
ATOM 629   H HZ2  . TRP A 1 42 ? 2.369   5.469   -8.665  1.00 0.00 ? 42 TRP A HZ2  1  
ATOM 630   H HZ3  . TRP A 1 42 ? 0.475   5.956   -4.873  1.00 0.00 ? 42 TRP A HZ3  1  
ATOM 631   H HH2  . TRP A 1 42 ? 2.267   6.502   -6.439  1.00 0.00 ? 42 TRP A HH2  1  
ATOM 632   N N    . PHE A 1 43 ? -2.962  0.630   -5.090  1.00 0.00 ? 43 PHE A N    1  
ATOM 633   C CA   . PHE A 1 43 ? -3.743  0.202   -3.936  1.00 0.00 ? 43 PHE A CA   1  
ATOM 634   C C    . PHE A 1 43 ? -3.992  1.370   -2.985  1.00 0.00 ? 43 PHE A C    1  
ATOM 635   O O    . PHE A 1 43 ? -3.181  2.290   -2.887  1.00 0.00 ? 43 PHE A O    1  
ATOM 636   C CB   . PHE A 1 43 ? -3.023  -0.927  -3.196  1.00 0.00 ? 43 PHE A CB   1  
ATOM 637   C CG   . PHE A 1 43 ? -2.871  -2.178  -4.015  1.00 0.00 ? 43 PHE A CG   1  
ATOM 638   C CD1  . PHE A 1 43 ? -3.951  -2.707  -4.702  1.00 0.00 ? 43 PHE A CD1  1  
ATOM 639   C CD2  . PHE A 1 43 ? -1.648  -2.824  -4.095  1.00 0.00 ? 43 PHE A CD2  1  
ATOM 640   C CE1  . PHE A 1 43 ? -3.815  -3.858  -5.456  1.00 0.00 ? 43 PHE A CE1  1  
ATOM 641   C CE2  . PHE A 1 43 ? -1.506  -3.974  -4.848  1.00 0.00 ? 43 PHE A CE2  1  
ATOM 642   C CZ   . PHE A 1 43 ? -2.590  -4.492  -5.529  1.00 0.00 ? 43 PHE A CZ   1  
ATOM 643   H H    . PHE A 1 43 ? -2.134  1.136   -4.947  1.00 0.00 ? 43 PHE A H    1  
ATOM 644   H HA   . PHE A 1 43 ? -4.693  -0.162  -4.296  1.00 0.00 ? 43 PHE A HA   1  
ATOM 645   H HB2  . PHE A 1 43 ? -2.036  -0.593  -2.916  1.00 0.00 ? 43 PHE A HB2  1  
ATOM 646   H HB3  . PHE A 1 43 ? -3.581  -1.177  -2.306  1.00 0.00 ? 43 PHE A HB3  1  
ATOM 647   H HD1  . PHE A 1 43 ? -4.910  -2.211  -4.646  1.00 0.00 ? 43 PHE A HD1  1  
ATOM 648   H HD2  . PHE A 1 43 ? -0.799  -2.421  -3.563  1.00 0.00 ? 43 PHE A HD2  1  
ATOM 649   H HE1  . PHE A 1 43 ? -4.665  -4.260  -5.987  1.00 0.00 ? 43 PHE A HE1  1  
ATOM 650   H HE2  . PHE A 1 43 ? -0.547  -4.469  -4.903  1.00 0.00 ? 43 PHE A HE2  1  
ATOM 651   H HZ   . PHE A 1 43 ? -2.481  -5.391  -6.118  1.00 0.00 ? 43 PHE A HZ   1  
ATOM 652   N N    . VAL A 1 44 ? -5.122  1.325   -2.286  1.00 0.00 ? 44 VAL A N    1  
ATOM 653   C CA   . VAL A 1 44 ? -5.480  2.377   -1.342  1.00 0.00 ? 44 VAL A CA   1  
ATOM 654   C C    . VAL A 1 44 ? -5.832  1.796   0.022   1.00 0.00 ? 44 VAL A C    1  
ATOM 655   O O    . VAL A 1 44 ? -6.859  1.139   0.182   1.00 0.00 ? 44 VAL A O    1  
ATOM 656   C CB   . VAL A 1 44 ? -6.669  3.211   -1.855  1.00 0.00 ? 44 VAL A CB   1  
ATOM 657   C CG1  . VAL A 1 44 ? -6.890  4.428   -0.970  1.00 0.00 ? 44 VAL A CG1  1  
ATOM 658   C CG2  . VAL A 1 44 ? -6.443  3.628   -3.301  1.00 0.00 ? 44 VAL A CG2  1  
ATOM 659   H H    . VAL A 1 44 ? -5.729  0.565   -2.407  1.00 0.00 ? 44 VAL A H    1  
ATOM 660   H HA   . VAL A 1 44 ? -4.627  3.033   -1.235  1.00 0.00 ? 44 VAL A HA   1  
ATOM 661   H HB   . VAL A 1 44 ? -7.557  2.597   -1.814  1.00 0.00 ? 44 VAL A HB   1  
ATOM 662   H HG11 . VAL A 1 44 ? -7.203  4.105   0.013   1.00 0.00 ? 44 VAL A HG11 1  
ATOM 663   H HG12 . VAL A 1 44 ? -5.970  4.987   -0.890  1.00 0.00 ? 44 VAL A HG12 1  
ATOM 664   H HG13 . VAL A 1 44 ? -7.656  5.054   -1.403  1.00 0.00 ? 44 VAL A HG13 1  
ATOM 665   H HG21 . VAL A 1 44 ? -6.478  4.704   -3.374  1.00 0.00 ? 44 VAL A HG21 1  
ATOM 666   H HG22 . VAL A 1 44 ? -5.475  3.276   -3.630  1.00 0.00 ? 44 VAL A HG22 1  
ATOM 667   H HG23 . VAL A 1 44 ? -7.212  3.198   -3.924  1.00 0.00 ? 44 VAL A HG23 1  
ATOM 668   N N    . GLY A 1 45 ? -4.971  2.043   1.005   1.00 0.00 ? 45 GLY A N    1  
ATOM 669   C CA   . GLY A 1 45 ? -5.209  1.537   2.344   1.00 0.00 ? 45 GLY A CA   1  
ATOM 670   C C    . GLY A 1 45 ? -4.558  2.394   3.412   1.00 0.00 ? 45 GLY A C    1  
ATOM 671   O O    . GLY A 1 45 ? -4.363  3.594   3.221   1.00 0.00 ? 45 GLY A O    1  
ATOM 672   H H    . GLY A 1 45 ? -4.168  2.573   0.819   1.00 0.00 ? 45 GLY A H    1  
ATOM 673   H HA2  . GLY A 1 45 ? -6.273  1.506   2.522   1.00 0.00 ? 45 GLY A HA2  1  
ATOM 674   H HA3  . GLY A 1 45 ? -4.813  0.534   2.413   1.00 0.00 ? 45 GLY A HA3  1  
ATOM 675   N N    . VAL A 1 46 ? -4.223  1.777   4.541   1.00 0.00 ? 46 VAL A N    1  
ATOM 676   C CA   . VAL A 1 46 ? -3.592  2.492   5.644   1.00 0.00 ? 46 VAL A CA   1  
ATOM 677   C C    . VAL A 1 46 ? -2.263  1.850   6.025   1.00 0.00 ? 46 VAL A C    1  
ATOM 678   O O    . VAL A 1 46 ? -2.088  0.638   5.898   1.00 0.00 ? 46 VAL A O    1  
ATOM 679   C CB   . VAL A 1 46 ? -4.505  2.531   6.884   1.00 0.00 ? 46 VAL A CB   1  
ATOM 680   C CG1  . VAL A 1 46 ? -3.703  2.885   8.127   1.00 0.00 ? 46 VAL A CG1  1  
ATOM 681   C CG2  . VAL A 1 46 ? -5.644  3.517   6.675   1.00 0.00 ? 46 VAL A CG2  1  
ATOM 682   H H    . VAL A 1 46 ? -4.405  0.819   4.634   1.00 0.00 ? 46 VAL A H    1  
ATOM 683   H HA   . VAL A 1 46 ? -3.411  3.508   5.324   1.00 0.00 ? 46 VAL A HA   1  
ATOM 684   H HB   . VAL A 1 46 ? -4.929  1.547   7.024   1.00 0.00 ? 46 VAL A HB   1  
ATOM 685   H HG11 . VAL A 1 46 ? -3.203  2.002   8.496   1.00 0.00 ? 46 VAL A HG11 1  
ATOM 686   H HG12 . VAL A 1 46 ? -2.970  3.639   7.879   1.00 0.00 ? 46 VAL A HG12 1  
ATOM 687   H HG13 . VAL A 1 46 ? -4.369  3.266   8.887   1.00 0.00 ? 46 VAL A HG13 1  
ATOM 688   H HG21 . VAL A 1 46 ? -6.562  2.974   6.501   1.00 0.00 ? 46 VAL A HG21 1  
ATOM 689   H HG22 . VAL A 1 46 ? -5.753  4.134   7.555   1.00 0.00 ? 46 VAL A HG22 1  
ATOM 690   H HG23 . VAL A 1 46 ? -5.428  4.142   5.821   1.00 0.00 ? 46 VAL A HG23 1  
ATOM 691   N N    . SER A 1 47 ? -1.328  2.670   6.494   1.00 0.00 ? 47 SER A N    1  
ATOM 692   C CA   . SER A 1 47 ? -0.012  2.183   6.891   1.00 0.00 ? 47 SER A CA   1  
ATOM 693   C C    . SER A 1 47 ? -0.048  1.615   8.307   1.00 0.00 ? 47 SER A C    1  
ATOM 694   O O    . SER A 1 47 ? -1.014  1.816   9.044   1.00 0.00 ? 47 SER A O    1  
ATOM 695   C CB   . SER A 1 47 ? 1.019   3.310   6.808   1.00 0.00 ? 47 SER A CB   1  
ATOM 696   O OG   . SER A 1 47 ? 2.311   2.846   7.156   1.00 0.00 ? 47 SER A OG   1  
ATOM 697   H H    . SER A 1 47 ? -1.528  3.627   6.572   1.00 0.00 ? 47 SER A H    1  
ATOM 698   H HA   . SER A 1 47 ? 0.270   1.397   6.207   1.00 0.00 ? 47 SER A HA   1  
ATOM 699   H HB2  . SER A 1 47 ? 1.048   3.694   5.799   1.00 0.00 ? 47 SER A HB2  1  
ATOM 700   H HB3  . SER A 1 47 ? 0.738   4.102   7.487   1.00 0.00 ? 47 SER A HB3  1  
ATOM 701   H HG   . SER A 1 47 ? 2.821   2.688   6.358   1.00 0.00 ? 47 SER A HG   1  
ATOM 702   N N    . ARG A 1 48 ? 1.012   0.905   8.679   1.00 0.00 ? 48 ARG A N    1  
ATOM 703   C CA   . ARG A 1 48 ? 1.102   0.306   10.005  1.00 0.00 ? 48 ARG A CA   1  
ATOM 704   C C    . ARG A 1 48 ? 2.192   0.981   10.833  1.00 0.00 ? 48 ARG A C    1  
ATOM 705   O O    . ARG A 1 48 ? 2.512   0.536   11.936  1.00 0.00 ? 48 ARG A O    1  
ATOM 706   C CB   . ARG A 1 48 ? 1.386   -1.193  9.893   1.00 0.00 ? 48 ARG A CB   1  
ATOM 707   C CG   . ARG A 1 48 ? 0.193   -2.006  9.419   1.00 0.00 ? 48 ARG A CG   1  
ATOM 708   C CD   . ARG A 1 48 ? -0.983  -1.878  10.375  1.00 0.00 ? 48 ARG A CD   1  
ATOM 709   N NE   . ARG A 1 48 ? -1.823  -3.073  10.371  1.00 0.00 ? 48 ARG A NE   1  
ATOM 710   C CZ   . ARG A 1 48 ? -1.437  -4.245  10.864  1.00 0.00 ? 48 ARG A CZ   1  
ATOM 711   N NH1  . ARG A 1 48 ? -0.230  -4.378  11.396  1.00 0.00 ? 48 ARG A NH1  1  
ATOM 712   N NH2  . ARG A 1 48 ? -2.258  -5.286  10.824  1.00 0.00 ? 48 ARG A NH2  1  
ATOM 713   H H    . ARG A 1 48 ? 1.750   0.780   8.047   1.00 0.00 ? 48 ARG A H    1  
ATOM 714   H HA   . ARG A 1 48 ? 0.152   0.447   10.499  1.00 0.00 ? 48 ARG A HA   1  
ATOM 715   H HB2  . ARG A 1 48 ? 2.196   -1.343  9.194   1.00 0.00 ? 48 ARG A HB2  1  
ATOM 716   H HB3  . ARG A 1 48 ? 1.685   -1.564  10.862  1.00 0.00 ? 48 ARG A HB3  1  
ATOM 717   H HG2  . ARG A 1 48 ? -0.110  -1.649  8.445   1.00 0.00 ? 48 ARG A HG2  1  
ATOM 718   H HG3  . ARG A 1 48 ? 0.480   -3.044  9.351   1.00 0.00 ? 48 ARG A HG3  1  
ATOM 719   H HD2  . ARG A 1 48 ? -0.603  -1.721  11.373  1.00 0.00 ? 48 ARG A HD2  1  
ATOM 720   H HD3  . ARG A 1 48 ? -1.580  -1.029  10.079  1.00 0.00 ? 48 ARG A HD3  1  
ATOM 721   H HE   . ARG A 1 48 ? -2.719  -2.997  9.983   1.00 0.00 ? 48 ARG A HE   1  
ATOM 722   H HH11 . ARG A 1 48 ? 0.391   -3.595  11.428  1.00 0.00 ? 48 ARG A HH11 1  
ATOM 723   H HH12 . ARG A 1 48 ? 0.058   -5.262  11.767  1.00 0.00 ? 48 ARG A HH12 1  
ATOM 724   H HH21 . ARG A 1 48 ? -3.169  -5.189  10.423  1.00 0.00 ? 48 ARG A HH21 1  
ATOM 725   H HH22 . ARG A 1 48 ? -1.967  -6.167  11.194  1.00 0.00 ? 48 ARG A HH22 1  
ATOM 726   N N    . ARG A 1 49 ? 2.758   2.055   10.294  1.00 0.00 ? 49 ARG A N    1  
ATOM 727   C CA   . ARG A 1 49 ? 3.813   2.790   10.982  1.00 0.00 ? 49 ARG A CA   1  
ATOM 728   C C    . ARG A 1 49 ? 3.324   4.171   11.407  1.00 0.00 ? 49 ARG A C    1  
ATOM 729   O O    . ARG A 1 49 ? 3.557   4.604   12.536  1.00 0.00 ? 49 ARG A O    1  
ATOM 730   C CB   . ARG A 1 49 ? 5.040   2.927   10.079  1.00 0.00 ? 49 ARG A CB   1  
ATOM 731   C CG   . ARG A 1 49 ? 6.183   3.699   10.718  1.00 0.00 ? 49 ARG A CG   1  
ATOM 732   C CD   . ARG A 1 49 ? 7.525   3.299   10.126  1.00 0.00 ? 49 ARG A CD   1  
ATOM 733   N NE   . ARG A 1 49 ? 8.043   2.071   10.725  1.00 0.00 ? 49 ARG A NE   1  
ATOM 734   C CZ   . ARG A 1 49 ? 8.402   1.970   12.000  1.00 0.00 ? 49 ARG A CZ   1  
ATOM 735   N NH1  . ARG A 1 49 ? 8.300   3.018   12.806  1.00 0.00 ? 49 ARG A NH1  1  
ATOM 736   N NH2  . ARG A 1 49 ? 8.864   0.819   12.471  1.00 0.00 ? 49 ARG A NH2  1  
ATOM 737   H H    . ARG A 1 49 ? 2.460   2.361   9.412   1.00 0.00 ? 49 ARG A H    1  
ATOM 738   H HA   . ARG A 1 49 ? 4.086   2.230   11.864  1.00 0.00 ? 49 ARG A HA   1  
ATOM 739   H HB2  . ARG A 1 49 ? 5.399   1.940   9.827   1.00 0.00 ? 49 ARG A HB2  1  
ATOM 740   H HB3  . ARG A 1 49 ? 4.751   3.438   9.173   1.00 0.00 ? 49 ARG A HB3  1  
ATOM 741   H HG2  . ARG A 1 49 ? 6.029   4.755   10.551  1.00 0.00 ? 49 ARG A HG2  1  
ATOM 742   H HG3  . ARG A 1 49 ? 6.192   3.498   11.779  1.00 0.00 ? 49 ARG A HG3  1  
ATOM 743   H HD2  . ARG A 1 49 ? 7.405   3.147   9.064   1.00 0.00 ? 49 ARG A HD2  1  
ATOM 744   H HD3  . ARG A 1 49 ? 8.231   4.098   10.298  1.00 0.00 ? 49 ARG A HD3  1  
ATOM 745   H HE   . ARG A 1 49 ? 8.126   1.285   10.147  1.00 0.00 ? 49 ARG A HE   1  
ATOM 746   H HH11 . ARG A 1 49 ? 7.952   3.886   12.454  1.00 0.00 ? 49 ARG A HH11 1  
ATOM 747   H HH12 . ARG A 1 49 ? 8.570   2.939   13.766  1.00 0.00 ? 49 ARG A HH12 1  
ATOM 748   H HH21 . ARG A 1 49 ? 8.942   0.027   11.866  1.00 0.00 ? 49 ARG A HH21 1  
ATOM 749   H HH22 . ARG A 1 49 ? 9.135   0.744   13.430  1.00 0.00 ? 49 ARG A HH22 1  
ATOM 750   N N    . THR A 1 50 ? 2.646   4.860   10.495  1.00 0.00 ? 50 THR A N    1  
ATOM 751   C CA   . THR A 1 50 ? 2.126   6.193   10.774  1.00 0.00 ? 50 THR A CA   1  
ATOM 752   C C    . THR A 1 50 ? 0.608   6.173   10.916  1.00 0.00 ? 50 THR A C    1  
ATOM 753   O O    . THR A 1 50 ? -0.009  7.194   11.216  1.00 0.00 ? 50 THR A O    1  
ATOM 754   C CB   . THR A 1 50 ? 2.514   7.191   9.667   1.00 0.00 ? 50 THR A CB   1  
ATOM 755   O OG1  . THR A 1 50 ? 2.005   6.744   8.405   1.00 0.00 ? 50 THR A OG1  1  
ATOM 756   C CG2  . THR A 1 50 ? 4.024   7.347   9.583   1.00 0.00 ? 50 THR A CG2  1  
ATOM 757   H H    . THR A 1 50 ? 2.492   4.462   9.613   1.00 0.00 ? 50 THR A H    1  
ATOM 758   H HA   . THR A 1 50 ? 2.560   6.532   11.704  1.00 0.00 ? 50 THR A HA   1  
ATOM 759   H HB   . THR A 1 50 ? 2.080   8.152   9.901   1.00 0.00 ? 50 THR A HB   1  
ATOM 760   H HG1  . THR A 1 50 ? 1.046   6.803   8.407   1.00 0.00 ? 50 THR A HG1  1  
ATOM 761   H HG21 . THR A 1 50 ? 4.369   7.956   10.406  1.00 0.00 ? 50 THR A HG21 1  
ATOM 762   H HG22 . THR A 1 50 ? 4.286   7.820   8.649   1.00 0.00 ? 50 THR A HG22 1  
ATOM 763   H HG23 . THR A 1 50 ? 4.490   6.374   9.637   1.00 0.00 ? 50 THR A HG23 1  
ATOM 764   N N    . GLN A 1 51 ? 0.014   5.004   10.698  1.00 0.00 ? 51 GLN A N    1  
ATOM 765   C CA   . GLN A 1 51 ? -1.433  4.852   10.802  1.00 0.00 ? 51 GLN A CA   1  
ATOM 766   C C    . GLN A 1 51 ? -2.152  5.888   9.944   1.00 0.00 ? 51 GLN A C    1  
ATOM 767   O O    . GLN A 1 51 ? -3.233  6.360   10.296  1.00 0.00 ? 51 GLN A O    1  
ATOM 768   C CB   . GLN A 1 51 ? -1.877  4.983   12.260  1.00 0.00 ? 51 GLN A CB   1  
ATOM 769   C CG   . GLN A 1 51 ? -1.154  4.035   13.203  1.00 0.00 ? 51 GLN A CG   1  
ATOM 770   C CD   . GLN A 1 51 ? -1.631  4.163   14.637  1.00 0.00 ? 51 GLN A CD   1  
ATOM 771   O OE1  . GLN A 1 51 ? -1.794  5.269   15.152  1.00 0.00 ? 51 GLN A OE1  1  
ATOM 772   N NE2  . GLN A 1 51 ? -1.856  3.029   15.290  1.00 0.00 ? 51 GLN A NE2  1  
ATOM 773   H H    . GLN A 1 51 ? 0.560   4.226   10.462  1.00 0.00 ? 51 GLN A H    1  
ATOM 774   H HA   . GLN A 1 51 ? -1.689  3.867   10.444  1.00 0.00 ? 51 GLN A HA   1  
ATOM 775   H HB2  . GLN A 1 51 ? -1.695  5.995   12.590  1.00 0.00 ? 51 GLN A HB2  1  
ATOM 776   H HB3  . GLN A 1 51 ? -2.936  4.778   12.321  1.00 0.00 ? 51 GLN A HB3  1  
ATOM 777   H HG2  . GLN A 1 51 ? -1.324  3.021   12.874  1.00 0.00 ? 51 GLN A HG2  1  
ATOM 778   H HG3  . GLN A 1 51 ? -0.097  4.252   13.170  1.00 0.00 ? 51 GLN A HG3  1  
ATOM 779   H HE21 . GLN A 1 51 ? -1.703  2.184   14.815  1.00 0.00 ? 51 GLN A HE21 1  
ATOM 780   H HE22 . GLN A 1 51 ? -2.164  3.082   16.218  1.00 0.00 ? 51 GLN A HE22 1  
ATOM 781   N N    . LYS A 1 52 ? -1.544  6.240   8.816   1.00 0.00 ? 52 LYS A N    1  
ATOM 782   C CA   . LYS A 1 52 ? -2.125  7.220   7.906   1.00 0.00 ? 52 LYS A CA   1  
ATOM 783   C C    . LYS A 1 52 ? -2.853  6.530   6.756   1.00 0.00 ? 52 LYS A C    1  
ATOM 784   O O    . LYS A 1 52 ? -2.641  5.345   6.496   1.00 0.00 ? 52 LYS A O    1  
ATOM 785   C CB   . LYS A 1 52 ? -1.037  8.143   7.354   1.00 0.00 ? 52 LYS A CB   1  
ATOM 786   C CG   . LYS A 1 52 ? -0.485  9.115   8.382   1.00 0.00 ? 52 LYS A CG   1  
ATOM 787   C CD   . LYS A 1 52 ? 0.129   10.338  7.720   1.00 0.00 ? 52 LYS A CD   1  
ATOM 788   C CE   . LYS A 1 52 ? 1.260   10.915  8.557   1.00 0.00 ? 52 LYS A CE   1  
ATOM 789   N NZ   . LYS A 1 52 ? 2.575   10.315  8.201   1.00 0.00 ? 52 LYS A NZ   1  
ATOM 790   H H    . LYS A 1 52 ? -0.683  5.829   8.589   1.00 0.00 ? 52 LYS A H    1  
ATOM 791   H HA   . LYS A 1 52 ? -2.837  7.809   8.464   1.00 0.00 ? 52 LYS A HA   1  
ATOM 792   H HB2  . LYS A 1 52 ? -0.221  7.538   6.987   1.00 0.00 ? 52 LYS A HB2  1  
ATOM 793   H HB3  . LYS A 1 52 ? -1.447  8.713   6.534   1.00 0.00 ? 52 LYS A HB3  1  
ATOM 794   H HG2  . LYS A 1 52 ? -1.288  9.435   9.029   1.00 0.00 ? 52 LYS A HG2  1  
ATOM 795   H HG3  . LYS A 1 52 ? 0.274   8.615   8.967   1.00 0.00 ? 52 LYS A HG3  1  
ATOM 796   H HD2  . LYS A 1 52 ? 0.519   10.055  6.754   1.00 0.00 ? 52 LYS A HD2  1  
ATOM 797   H HD3  . LYS A 1 52 ? -0.637  11.091  7.596   1.00 0.00 ? 52 LYS A HD3  1  
ATOM 798   H HE2  . LYS A 1 52 ? 1.304   11.981  8.392   1.00 0.00 ? 52 LYS A HE2  1  
ATOM 799   H HE3  . LYS A 1 52 ? 1.055   10.721  9.599   1.00 0.00 ? 52 LYS A HE3  1  
ATOM 800   H HZ1  . LYS A 1 52 ? 3.280   11.064  8.047   1.00 0.00 ? 52 LYS A HZ1  1  
ATOM 801   H HZ2  . LYS A 1 52 ? 2.488   9.752   7.331   1.00 0.00 ? 52 LYS A HZ2  1  
ATOM 802   H HZ3  . LYS A 1 52 ? 2.905   9.696   8.970   1.00 0.00 ? 52 LYS A HZ3  1  
ATOM 803   N N    . PHE A 1 53 ? -3.710  7.279   6.070   1.00 0.00 ? 53 PHE A N    1  
ATOM 804   C CA   . PHE A 1 53 ? -4.468  6.739   4.948   1.00 0.00 ? 53 PHE A CA   1  
ATOM 805   C C    . PHE A 1 53 ? -4.142  7.490   3.660   1.00 0.00 ? 53 PHE A C    1  
ATOM 806   O O    . PHE A 1 53 ? -4.078  8.719   3.645   1.00 0.00 ? 53 PHE A O    1  
ATOM 807   C CB   . PHE A 1 53 ? -5.969  6.820   5.233   1.00 0.00 ? 53 PHE A CB   1  
ATOM 808   C CG   . PHE A 1 53 ? -6.823  6.391   4.074   1.00 0.00 ? 53 PHE A CG   1  
ATOM 809   C CD1  . PHE A 1 53 ? -7.050  7.248   3.009   1.00 0.00 ? 53 PHE A CD1  1  
ATOM 810   C CD2  . PHE A 1 53 ? -7.399  5.131   4.050   1.00 0.00 ? 53 PHE A CD2  1  
ATOM 811   C CE1  . PHE A 1 53 ? -7.836  6.857   1.942   1.00 0.00 ? 53 PHE A CE1  1  
ATOM 812   C CE2  . PHE A 1 53 ? -8.186  4.734   2.985   1.00 0.00 ? 53 PHE A CE2  1  
ATOM 813   C CZ   . PHE A 1 53 ? -8.404  5.598   1.930   1.00 0.00 ? 53 PHE A CZ   1  
ATOM 814   H H    . PHE A 1 53 ? -3.836  8.217   6.326   1.00 0.00 ? 53 PHE A H    1  
ATOM 815   H HA   . PHE A 1 53 ? -4.188  5.704   4.827   1.00 0.00 ? 53 PHE A HA   1  
ATOM 816   H HB2  . PHE A 1 53 ? -6.204  6.182   6.071   1.00 0.00 ? 53 PHE A HB2  1  
ATOM 817   H HB3  . PHE A 1 53 ? -6.227  7.839   5.478   1.00 0.00 ? 53 PHE A HB3  1  
ATOM 818   H HD1  . PHE A 1 53 ? -6.606  8.233   3.017   1.00 0.00 ? 53 PHE A HD1  1  
ATOM 819   H HD2  . PHE A 1 53 ? -7.229  4.455   4.875   1.00 0.00 ? 53 PHE A HD2  1  
ATOM 820   H HE1  . PHE A 1 53 ? -8.005  7.534   1.118   1.00 0.00 ? 53 PHE A HE1  1  
ATOM 821   H HE2  . PHE A 1 53 ? -8.629  3.749   2.979   1.00 0.00 ? 53 PHE A HE2  1  
ATOM 822   H HZ   . PHE A 1 53 ? -9.019  5.290   1.097   1.00 0.00 ? 53 PHE A HZ   1  
ATOM 823   N N    . GLY A 1 54 ? -3.937  6.742   2.581   1.00 0.00 ? 54 GLY A N    1  
ATOM 824   C CA   . GLY A 1 54 ? -3.620  7.353   1.303   1.00 0.00 ? 54 GLY A CA   1  
ATOM 825   C C    . GLY A 1 54 ? -3.508  6.335   0.185   1.00 0.00 ? 54 GLY A C    1  
ATOM 826   O O    . GLY A 1 54 ? -4.034  5.226   0.290   1.00 0.00 ? 54 GLY A O    1  
ATOM 827   H H    . GLY A 1 54 ? -4.001  5.766   2.653   1.00 0.00 ? 54 GLY A H    1  
ATOM 828   H HA2  . GLY A 1 54 ? -4.394  8.063   1.054   1.00 0.00 ? 54 GLY A HA2  1  
ATOM 829   H HA3  . GLY A 1 54 ? -2.679  7.877   1.392   1.00 0.00 ? 54 GLY A HA3  1  
ATOM 830   N N    . THR A 1 55 ? -2.823  6.712   -0.890  1.00 0.00 ? 55 THR A N    1  
ATOM 831   C CA   . THR A 1 55 ? -2.647  5.826   -2.033  1.00 0.00 ? 55 THR A CA   1  
ATOM 832   C C    . THR A 1 55 ? -1.169  5.595   -2.328  1.00 0.00 ? 55 THR A C    1  
ATOM 833   O O    . THR A 1 55 ? -0.360  6.520   -2.253  1.00 0.00 ? 55 THR A O    1  
ATOM 834   C CB   . THR A 1 55 ? -3.328  6.392   -3.293  1.00 0.00 ? 55 THR A CB   1  
ATOM 835   O OG1  . THR A 1 55 ? -2.937  5.634   -4.444  1.00 0.00 ? 55 THR A OG1  1  
ATOM 836   C CG2  . THR A 1 55 ? -2.962  7.855   -3.495  1.00 0.00 ? 55 THR A CG2  1  
ATOM 837   H H    . THR A 1 55 ? -2.428  7.608   -0.914  1.00 0.00 ? 55 THR A H    1  
ATOM 838   H HA   . THR A 1 55 ? -3.109  4.878   -1.795  1.00 0.00 ? 55 THR A HA   1  
ATOM 839   H HB   . THR A 1 55 ? -4.399  6.318   -3.170  1.00 0.00 ? 55 THR A HB   1  
ATOM 840   H HG1  . THR A 1 55 ? -2.168  6.042   -4.850  1.00 0.00 ? 55 THR A HG1  1  
ATOM 841   H HG21 . THR A 1 55 ? -2.074  8.086   -2.925  1.00 0.00 ? 55 THR A HG21 1  
ATOM 842   H HG22 . THR A 1 55 ? -3.777  8.479   -3.161  1.00 0.00 ? 55 THR A HG22 1  
ATOM 843   H HG23 . THR A 1 55 ? -2.774  8.037   -4.542  1.00 0.00 ? 55 THR A HG23 1  
ATOM 844   N N    . PHE A 1 56 ? -0.824  4.357   -2.663  1.00 0.00 ? 56 PHE A N    1  
ATOM 845   C CA   . PHE A 1 56 ? 0.558   4.005   -2.969  1.00 0.00 ? 56 PHE A CA   1  
ATOM 846   C C    . PHE A 1 56 ? 0.622   2.993   -4.109  1.00 0.00 ? 56 PHE A C    1  
ATOM 847   O O    . PHE A 1 56 ? -0.335  2.270   -4.385  1.00 0.00 ? 56 PHE A O    1  
ATOM 848   C CB   . PHE A 1 56 ? 1.248   3.436   -1.728  1.00 0.00 ? 56 PHE A CB   1  
ATOM 849   C CG   . PHE A 1 56 ? 0.368   2.531   -0.914  1.00 0.00 ? 56 PHE A CG   1  
ATOM 850   C CD1  . PHE A 1 56 ? -0.530  3.056   0.002   1.00 0.00 ? 56 PHE A CD1  1  
ATOM 851   C CD2  . PHE A 1 56 ? 0.439   1.156   -1.064  1.00 0.00 ? 56 PHE A CD2  1  
ATOM 852   C CE1  . PHE A 1 56 ? -1.342  2.227   0.752   1.00 0.00 ? 56 PHE A CE1  1  
ATOM 853   C CE2  . PHE A 1 56 ? -0.371  0.321   -0.316  1.00 0.00 ? 56 PHE A CE2  1  
ATOM 854   C CZ   . PHE A 1 56 ? -1.261  0.857   0.593   1.00 0.00 ? 56 PHE A CZ   1  
ATOM 855   H H    . PHE A 1 56 ? -1.515  3.662   -2.705  1.00 0.00 ? 56 PHE A H    1  
ATOM 856   H HA   . PHE A 1 56 ? 1.069   4.905   -3.274  1.00 0.00 ? 56 PHE A HA   1  
ATOM 857   H HB2  . PHE A 1 56 ? 2.114   2.868   -2.034  1.00 0.00 ? 56 PHE A HB2  1  
ATOM 858   H HB3  . PHE A 1 56 ? 1.564   4.252   -1.095  1.00 0.00 ? 56 PHE A HB3  1  
ATOM 859   H HD1  . PHE A 1 56 ? -0.593  4.128   0.127   1.00 0.00 ? 56 PHE A HD1  1  
ATOM 860   H HD2  . PHE A 1 56 ? 1.135   0.735   -1.774  1.00 0.00 ? 56 PHE A HD2  1  
ATOM 861   H HE1  . PHE A 1 56 ? -2.036  2.649   1.462   1.00 0.00 ? 56 PHE A HE1  1  
ATOM 862   H HE2  . PHE A 1 56 ? -0.306  -0.749  -0.442  1.00 0.00 ? 56 PHE A HE2  1  
ATOM 863   H HZ   . PHE A 1 56 ? -1.895  0.207   1.178   1.00 0.00 ? 56 PHE A HZ   1  
ATOM 864   N N    . PRO A 1 57 ? 1.778   2.939   -4.788  1.00 0.00 ? 57 PRO A N    1  
ATOM 865   C CA   . PRO A 1 57 ? 1.995   2.020   -5.909  1.00 0.00 ? 57 PRO A CA   1  
ATOM 866   C C    . PRO A 1 57 ? 2.080   0.566   -5.459  1.00 0.00 ? 57 PRO A C    1  
ATOM 867   O O    . PRO A 1 57 ? 3.067   0.149   -4.855  1.00 0.00 ? 57 PRO A O    1  
ATOM 868   C CB   . PRO A 1 57 ? 3.336   2.479   -6.489  1.00 0.00 ? 57 PRO A CB   1  
ATOM 869   C CG   . PRO A 1 57 ? 4.036   3.135   -5.350  1.00 0.00 ? 57 PRO A CG   1  
ATOM 870   C CD   . PRO A 1 57 ? 2.961   3.772   -4.513  1.00 0.00 ? 57 PRO A CD   1  
ATOM 871   H HA   . PRO A 1 57 ? 1.224   2.119   -6.659  1.00 0.00 ? 57 PRO A HA   1  
ATOM 872   H HB2  . PRO A 1 57 ? 3.886   1.622   -6.852  1.00 0.00 ? 57 PRO A HB2  1  
ATOM 873   H HB3  . PRO A 1 57 ? 3.163   3.172   -7.298  1.00 0.00 ? 57 PRO A HB3  1  
ATOM 874   H HG2  . PRO A 1 57 ? 4.572   2.397   -4.773  1.00 0.00 ? 57 PRO A HG2  1  
ATOM 875   H HG3  . PRO A 1 57 ? 4.716   3.888   -5.722  1.00 0.00 ? 57 PRO A HG3  1  
ATOM 876   H HD2  . PRO A 1 57 ? 3.224   3.734   -3.467  1.00 0.00 ? 57 PRO A HD2  1  
ATOM 877   H HD3  . PRO A 1 57 ? 2.794   4.792   -4.826  1.00 0.00 ? 57 PRO A HD3  1  
ATOM 878   N N    . GLY A 1 58 ? 1.036   -0.203  -5.757  1.00 0.00 ? 58 GLY A N    1  
ATOM 879   C CA   . GLY A 1 58 ? 1.013   -1.603  -5.375  1.00 0.00 ? 58 GLY A CA   1  
ATOM 880   C C    . GLY A 1 58 ? 2.252   -2.349  -5.831  1.00 0.00 ? 58 GLY A C    1  
ATOM 881   O O    . GLY A 1 58 ? 2.559   -3.425  -5.320  1.00 0.00 ? 58 GLY A O    1  
ATOM 882   H H    . GLY A 1 58 ? 0.276   0.184   -6.240  1.00 0.00 ? 58 GLY A H    1  
ATOM 883   H HA2  . GLY A 1 58 ? 0.941   -1.670  -4.299  1.00 0.00 ? 58 GLY A HA2  1  
ATOM 884   H HA3  . GLY A 1 58 ? 0.144   -2.070  -5.814  1.00 0.00 ? 58 GLY A HA3  1  
ATOM 885   N N    . ASN A 1 59 ? 2.963   -1.776  -6.797  1.00 0.00 ? 59 ASN A N    1  
ATOM 886   C CA   . ASN A 1 59 ? 4.174   -2.396  -7.324  1.00 0.00 ? 59 ASN A CA   1  
ATOM 887   C C    . ASN A 1 59 ? 5.260   -2.462  -6.255  1.00 0.00 ? 59 ASN A C    1  
ATOM 888   O O    . ASN A 1 59 ? 6.264   -3.156  -6.417  1.00 0.00 ? 59 ASN A O    1  
ATOM 889   C CB   . ASN A 1 59 ? 4.683   -1.616  -8.538  1.00 0.00 ? 59 ASN A CB   1  
ATOM 890   C CG   . ASN A 1 59 ? 3.721   -1.676  -9.709  1.00 0.00 ? 59 ASN A CG   1  
ATOM 891   O OD1  . ASN A 1 59 ? 3.698   -2.653  -10.458 1.00 0.00 ? 59 ASN A OD1  1  
ATOM 892   N ND2  . ASN A 1 59 ? 2.922   -0.628  -9.871  1.00 0.00 ? 59 ASN A ND2  1  
ATOM 893   H H    . ASN A 1 59 ? 2.667   -0.918  -7.164  1.00 0.00 ? 59 ASN A H    1  
ATOM 894   H HA   . ASN A 1 59 ? 3.925   -3.400  -7.630  1.00 0.00 ? 59 ASN A HA   1  
ATOM 895   H HB2  . ASN A 1 59 ? 4.820   -0.581  -8.262  1.00 0.00 ? 59 ASN A HB2  1  
ATOM 896   H HB3  . ASN A 1 59 ? 5.630   -2.029  -8.852  1.00 0.00 ? 59 ASN A HB3  1  
ATOM 897   H HD21 . ASN A 1 59 ? 2.996   0.114   -9.236  1.00 0.00 ? 59 ASN A HD21 1  
ATOM 898   H HD22 . ASN A 1 59 ? 2.289   -0.641  -10.620 1.00 0.00 ? 59 ASN A HD22 1  
ATOM 899   N N    . TYR A 1 60 ? 5.053   -1.734  -5.163  1.00 0.00 ? 60 TYR A N    1  
ATOM 900   C CA   . TYR A 1 60 ? 6.015   -1.708  -4.068  1.00 0.00 ? 60 TYR A CA   1  
ATOM 901   C C    . TYR A 1 60 ? 5.588   -2.649  -2.945  1.00 0.00 ? 60 TYR A C    1  
ATOM 902   O O    . TYR A 1 60 ? 6.418   -3.137  -2.178  1.00 0.00 ? 60 TYR A O    1  
ATOM 903   C CB   . TYR A 1 60 ? 6.166   -0.286  -3.527  1.00 0.00 ? 60 TYR A CB   1  
ATOM 904   C CG   . TYR A 1 60 ? 6.951   0.629   -4.439  1.00 0.00 ? 60 TYR A CG   1  
ATOM 905   C CD1  . TYR A 1 60 ? 6.522   0.884   -5.736  1.00 0.00 ? 60 TYR A CD1  1  
ATOM 906   C CD2  . TYR A 1 60 ? 8.123   1.237   -4.006  1.00 0.00 ? 60 TYR A CD2  1  
ATOM 907   C CE1  . TYR A 1 60 ? 7.237   1.719   -6.574  1.00 0.00 ? 60 TYR A CE1  1  
ATOM 908   C CE2  . TYR A 1 60 ? 8.843   2.073   -4.836  1.00 0.00 ? 60 TYR A CE2  1  
ATOM 909   C CZ   . TYR A 1 60 ? 8.396   2.311   -6.119  1.00 0.00 ? 60 TYR A CZ   1  
ATOM 910   O OH   . TYR A 1 60 ? 9.112   3.143   -6.950  1.00 0.00 ? 60 TYR A OH   1  
ATOM 911   H H    . TYR A 1 60 ? 4.234   -1.201  -5.091  1.00 0.00 ? 60 TYR A H    1  
ATOM 912   H HA   . TYR A 1 60 ? 6.968   -2.038  -4.455  1.00 0.00 ? 60 TYR A HA   1  
ATOM 913   H HB2  . TYR A 1 60 ? 5.186   0.146   -3.389  1.00 0.00 ? 60 TYR A HB2  1  
ATOM 914   H HB3  . TYR A 1 60 ? 6.675   -0.322  -2.575  1.00 0.00 ? 60 TYR A HB3  1  
ATOM 915   H HD1  . TYR A 1 60 ? 5.613   0.419   -6.090  1.00 0.00 ? 60 TYR A HD1  1  
ATOM 916   H HD2  . TYR A 1 60 ? 8.470   1.048   -3.000  1.00 0.00 ? 60 TYR A HD2  1  
ATOM 917   H HE1  . TYR A 1 60 ? 6.887   1.905   -7.579  1.00 0.00 ? 60 TYR A HE1  1  
ATOM 918   H HE2  . TYR A 1 60 ? 9.751   2.537   -4.480  1.00 0.00 ? 60 TYR A HE2  1  
ATOM 919   H HH   . TYR A 1 60 ? 8.657   3.222   -7.792  1.00 0.00 ? 60 TYR A HH   1  
ATOM 920   N N    . VAL A 1 61 ? 4.285   -2.898  -2.854  1.00 0.00 ? 61 VAL A N    1  
ATOM 921   C CA   . VAL A 1 61 ? 3.746   -3.781  -1.827  1.00 0.00 ? 61 VAL A CA   1  
ATOM 922   C C    . VAL A 1 61 ? 3.312   -5.116  -2.422  1.00 0.00 ? 61 VAL A C    1  
ATOM 923   O O    . VAL A 1 61 ? 3.243   -5.271  -3.641  1.00 0.00 ? 61 VAL A O    1  
ATOM 924   C CB   . VAL A 1 61 ? 2.546   -3.137  -1.107  1.00 0.00 ? 61 VAL A CB   1  
ATOM 925   C CG1  . VAL A 1 61 ? 2.924   -1.772  -0.555  1.00 0.00 ? 61 VAL A CG1  1  
ATOM 926   C CG2  . VAL A 1 61 ? 1.356   -3.030  -2.049  1.00 0.00 ? 61 VAL A CG2  1  
ATOM 927   H H    . VAL A 1 61 ? 3.673   -2.479  -3.494  1.00 0.00 ? 61 VAL A H    1  
ATOM 928   H HA   . VAL A 1 61 ? 4.523   -3.959  -1.097  1.00 0.00 ? 61 VAL A HA   1  
ATOM 929   H HB   . VAL A 1 61 ? 2.266   -3.772  -0.279  1.00 0.00 ? 61 VAL A HB   1  
ATOM 930   H HG11 . VAL A 1 61 ? 3.599   -1.896  0.280   1.00 0.00 ? 61 VAL A HG11 1  
ATOM 931   H HG12 . VAL A 1 61 ? 3.407   -1.191  -1.327  1.00 0.00 ? 61 VAL A HG12 1  
ATOM 932   H HG13 . VAL A 1 61 ? 2.033   -1.259  -0.222  1.00 0.00 ? 61 VAL A HG13 1  
ATOM 933   H HG21 . VAL A 1 61 ? 0.505   -3.532  -1.613  1.00 0.00 ? 61 VAL A HG21 1  
ATOM 934   H HG22 . VAL A 1 61 ? 1.116   -1.988  -2.209  1.00 0.00 ? 61 VAL A HG22 1  
ATOM 935   H HG23 . VAL A 1 61 ? 1.601   -3.491  -2.994  1.00 0.00 ? 61 VAL A HG23 1  
ATOM 936   N N    . ALA A 1 62 ? 3.019   -6.078  -1.553  1.00 0.00 ? 62 ALA A N    1  
ATOM 937   C CA   . ALA A 1 62 ? 2.589   -7.399  -1.992  1.00 0.00 ? 62 ALA A CA   1  
ATOM 938   C C    . ALA A 1 62 ? 1.653   -8.039  -0.972  1.00 0.00 ? 62 ALA A C    1  
ATOM 939   O O    . ALA A 1 62 ? 1.768   -7.821  0.234   1.00 0.00 ? 62 ALA A O    1  
ATOM 940   C CB   . ALA A 1 62 ? 3.795   -8.293  -2.237  1.00 0.00 ? 62 ALA A CB   1  
ATOM 941   H H    . ALA A 1 62 ? 3.093   -5.893  -0.593  1.00 0.00 ? 62 ALA A H    1  
ATOM 942   H HA   . ALA A 1 62 ? 2.060   -7.284  -2.928  1.00 0.00 ? 62 ALA A HA   1  
ATOM 943   H HB1  . ALA A 1 62 ? 3.523   -9.085  -2.920  1.00 0.00 ? 62 ALA A HB1  1  
ATOM 944   H HB2  . ALA A 1 62 ? 4.595   -7.707  -2.666  1.00 0.00 ? 62 ALA A HB2  1  
ATOM 945   H HB3  . ALA A 1 62 ? 4.123   -8.720  -1.302  1.00 0.00 ? 62 ALA A HB3  1  
ATOM 946   N N    . PRO A 1 63 ? 0.703   -8.848  -1.465  1.00 0.00 ? 63 PRO A N    1  
ATOM 947   C CA   . PRO A 1 63 ? -0.271  -9.536  -0.612  1.00 0.00 ? 63 PRO A CA   1  
ATOM 948   C C    . PRO A 1 63 ? 0.369   -10.637 0.227   1.00 0.00 ? 63 PRO A C    1  
ATOM 949   O O    . PRO A 1 63 ? 0.649   -11.727 -0.270  1.00 0.00 ? 63 PRO A O    1  
ATOM 950   C CB   . PRO A 1 63 ? -1.259  -10.135 -1.616  1.00 0.00 ? 63 PRO A CB   1  
ATOM 951   C CG   . PRO A 1 63 ? -0.475  -10.292 -2.873  1.00 0.00 ? 63 PRO A CG   1  
ATOM 952   C CD   . PRO A 1 63 ? 0.508   -9.154  -2.892  1.00 0.00 ? 63 PRO A CD   1  
ATOM 953   H HA   . PRO A 1 63 ? -0.789  -8.845  0.036   1.00 0.00 ? 63 PRO A HA   1  
ATOM 954   H HB2  . PRO A 1 63 ? -1.615  -11.088 -1.250  1.00 0.00 ? 63 PRO A HB2  1  
ATOM 955   H HB3  . PRO A 1 63 ? -2.092  -9.462  -1.752  1.00 0.00 ? 63 PRO A HB3  1  
ATOM 956   H HG2  . PRO A 1 63 ? 0.046   -11.237 -2.866  1.00 0.00 ? 63 PRO A HG2  1  
ATOM 957   H HG3  . PRO A 1 63 ? -1.134  -10.231 -3.726  1.00 0.00 ? 63 PRO A HG3  1  
ATOM 958   H HD2  . PRO A 1 63 ? 1.435   -9.464  -3.350  1.00 0.00 ? 63 PRO A HD2  1  
ATOM 959   H HD3  . PRO A 1 63 ? 0.092   -8.305  -3.414  1.00 0.00 ? 63 PRO A HD3  1  
ATOM 960   N N    . VAL A 1 64 ? 0.597   -10.344 1.504   1.00 0.00 ? 64 VAL A N    1  
ATOM 961   C CA   . VAL A 1 64 ? 1.202   -11.310 2.413   1.00 0.00 ? 64 VAL A CA   1  
ATOM 962   C C    . VAL A 1 64 ? 0.193   -12.370 2.840   1.00 0.00 ? 64 VAL A C    1  
ATOM 963   O O    . VAL A 1 64 ? 0.565   -13.490 3.189   1.00 0.00 ? 64 VAL A O    1  
ATOM 964   C CB   . VAL A 1 64 ? 1.767   -10.620 3.669   1.00 0.00 ? 64 VAL A CB   1  
ATOM 965   C CG1  . VAL A 1 64 ? 0.795   -9.570  4.185   1.00 0.00 ? 64 VAL A CG1  1  
ATOM 966   C CG2  . VAL A 1 64 ? 2.077   -11.648 4.747   1.00 0.00 ? 64 VAL A CG2  1  
ATOM 967   H H    . VAL A 1 64 ? 0.352   -9.458  1.842   1.00 0.00 ? 64 VAL A H    1  
ATOM 968   H HA   . VAL A 1 64 ? 2.018   -11.791 1.894   1.00 0.00 ? 64 VAL A HA   1  
ATOM 969   H HB   . VAL A 1 64 ? 2.688   -10.124 3.399   1.00 0.00 ? 64 VAL A HB   1  
ATOM 970   H HG11 . VAL A 1 64 ? 0.994   -8.626  3.699   1.00 0.00 ? 64 VAL A HG11 1  
ATOM 971   H HG12 . VAL A 1 64 ? -0.217  -9.880  3.971   1.00 0.00 ? 64 VAL A HG12 1  
ATOM 972   H HG13 . VAL A 1 64 ? 0.920   -9.458  5.252   1.00 0.00 ? 64 VAL A HG13 1  
ATOM 973   H HG21 . VAL A 1 64 ? 2.505   -12.528 4.292   1.00 0.00 ? 64 VAL A HG21 1  
ATOM 974   H HG22 . VAL A 1 64 ? 2.780   -11.229 5.453   1.00 0.00 ? 64 VAL A HG22 1  
ATOM 975   H HG23 . VAL A 1 64 ? 1.166   -11.915 5.262   1.00 0.00 ? 64 VAL A HG23 1  
ATOM 976   N N    . SER A 1 65 ? -1.086  -12.009 2.808   1.00 0.00 ? 65 SER A N    1  
ATOM 977   C CA   . SER A 1 65 ? -2.149  -12.929 3.195   1.00 0.00 ? 65 SER A CA   1  
ATOM 978   C C    . SER A 1 65 ? -1.884  -14.327 2.647   1.00 0.00 ? 65 SER A C    1  
ATOM 979   O O    . SER A 1 65 ? -2.137  -15.327 3.317   1.00 0.00 ? 65 SER A O    1  
ATOM 980   C CB   . SER A 1 65 ? -3.501  -12.419 2.691   1.00 0.00 ? 65 SER A CB   1  
ATOM 981   O OG   . SER A 1 65 ? -4.568  -13.154 3.264   1.00 0.00 ? 65 SER A OG   1  
ATOM 982   H H    . SER A 1 65 ? -1.319  -11.101 2.521   1.00 0.00 ? 65 SER A H    1  
ATOM 983   H HA   . SER A 1 65 ? -2.171  -12.976 4.273   1.00 0.00 ? 65 SER A HA   1  
ATOM 984   H HB2  . SER A 1 65 ? -3.613  -11.379 2.958   1.00 0.00 ? 65 SER A HB2  1  
ATOM 985   H HB3  . SER A 1 65 ? -3.544  -12.522 1.617   1.00 0.00 ? 65 SER A HB3  1  
ATOM 986   H HG   . SER A 1 65 ? -4.270  -14.043 3.472   1.00 0.00 ? 65 SER A HG   1  
ATOM 987   N N    . GLY A 1 66 ? -1.372  -14.388 1.421   1.00 0.00 ? 66 GLY A N    1  
ATOM 988   C CA   . GLY A 1 66 ? -1.080  -15.668 0.802   1.00 0.00 ? 66 GLY A CA   1  
ATOM 989   C C    . GLY A 1 66 ? -2.178  -16.120 -0.141  1.00 0.00 ? 66 GLY A C    1  
ATOM 990   O O    . GLY A 1 66 ? -2.968  -15.317 -0.638  1.00 0.00 ? 66 GLY A O    1  
ATOM 991   H H    . GLY A 1 66 ? -1.190  -13.558 0.933   1.00 0.00 ? 66 GLY A H    1  
ATOM 992   H HA2  . GLY A 1 66 ? -0.156  -15.586 0.249   1.00 0.00 ? 66 GLY A HA2  1  
ATOM 993   H HA3  . GLY A 1 66 ? -0.960  -16.411 1.577   1.00 0.00 ? 66 GLY A HA3  1  
ATOM 994   N N    . PRO A 1 67 ? -2.236  -17.434 -0.402  1.00 0.00 ? 67 PRO A N    1  
ATOM 995   C CA   . PRO A 1 67 ? -3.241  -18.021 -1.294  1.00 0.00 ? 67 PRO A CA   1  
ATOM 996   C C    . PRO A 1 67 ? -4.643  -17.977 -0.696  1.00 0.00 ? 67 PRO A C    1  
ATOM 997   O O    . PRO A 1 67 ? -5.008  -18.827 0.115   1.00 0.00 ? 67 PRO A O    1  
ATOM 998   C CB   . PRO A 1 67 ? -2.772  -19.469 -1.453  1.00 0.00 ? 67 PRO A CB   1  
ATOM 999   C CG   . PRO A 1 67 ? -1.983  -19.749 -0.220  1.00 0.00 ? 67 PRO A CG   1  
ATOM 1000  C CD   . PRO A 1 67 ? -1.326  -18.449 0.155   1.00 0.00 ? 67 PRO A CD   1  
ATOM 1001  H HA   . PRO A 1 67 ? -3.246  -17.534 -2.259  1.00 0.00 ? 67 PRO A HA   1  
ATOM 1002  H HB2  . PRO A 1 67 ? -3.630  -20.121 -1.530  1.00 0.00 ? 67 PRO A HB2  1  
ATOM 1003  H HB3  . PRO A 1 67 ? -2.163  -19.559 -2.340  1.00 0.00 ? 67 PRO A HB3  1  
ATOM 1004  H HG2  . PRO A 1 67 ? -2.640  -20.079 0.569   1.00 0.00 ? 67 PRO A HG2  1  
ATOM 1005  H HG3  . PRO A 1 67 ? -1.235  -20.500 -0.427  1.00 0.00 ? 67 PRO A HG3  1  
ATOM 1006  H HD2  . PRO A 1 67 ? -1.258  -18.358 1.229   1.00 0.00 ? 67 PRO A HD2  1  
ATOM 1007  H HD3  . PRO A 1 67 ? -0.347  -18.377 -0.295  1.00 0.00 ? 67 PRO A HD3  1  
ATOM 1008  N N    . SER A 1 68 ? -5.424  -16.982 -1.104  1.00 0.00 ? 68 SER A N    1  
ATOM 1009  C CA   . SER A 1 68 ? -6.786  -16.826 -0.606  1.00 0.00 ? 68 SER A CA   1  
ATOM 1010  C C    . SER A 1 68 ? -7.803  -17.197 -1.681  1.00 0.00 ? 68 SER A C    1  
ATOM 1011  O O    . SER A 1 68 ? -7.488  -17.211 -2.870  1.00 0.00 ? 68 SER A O    1  
ATOM 1012  C CB   . SER A 1 68 ? -7.020  -15.388 -0.140  1.00 0.00 ? 68 SER A CB   1  
ATOM 1013  O OG   . SER A 1 68 ? -6.783  -14.467 -1.190  1.00 0.00 ? 68 SER A OG   1  
ATOM 1014  H H    . SER A 1 68 ? -5.075  -16.336 -1.753  1.00 0.00 ? 68 SER A H    1  
ATOM 1015  H HA   . SER A 1 68 ? -6.910  -17.492 0.235   1.00 0.00 ? 68 SER A HA   1  
ATOM 1016  H HB2  . SER A 1 68 ? -8.041  -15.281 0.192   1.00 0.00 ? 68 SER A HB2  1  
ATOM 1017  H HB3  . SER A 1 68 ? -6.350  -15.164 0.678   1.00 0.00 ? 68 SER A HB3  1  
ATOM 1018  H HG   . SER A 1 68 ? -7.151  -13.612 -0.956  1.00 0.00 ? 68 SER A HG   1  
ATOM 1019  N N    . SER A 1 69 ? -9.025  -17.496 -1.252  1.00 0.00 ? 69 SER A N    1  
ATOM 1020  C CA   . SER A 1 69 ? -10.089 -17.870 -2.176  1.00 0.00 ? 69 SER A CA   1  
ATOM 1021  C C    . SER A 1 69 ? -11.024 -16.693 -2.434  1.00 0.00 ? 69 SER A C    1  
ATOM 1022  O O    . SER A 1 69 ? -11.375 -15.952 -1.516  1.00 0.00 ? 69 SER A O    1  
ATOM 1023  C CB   . SER A 1 69 ? -10.883 -19.055 -1.621  1.00 0.00 ? 69 SER A CB   1  
ATOM 1024  O OG   . SER A 1 69 ? -11.931 -19.423 -2.500  1.00 0.00 ? 69 SER A OG   1  
ATOM 1025  H H    . SER A 1 69 ? -9.215  -17.467 -0.291  1.00 0.00 ? 69 SER A H    1  
ATOM 1026  H HA   . SER A 1 69 ? -9.630  -18.161 -3.109  1.00 0.00 ? 69 SER A HA   1  
ATOM 1027  H HB2  . SER A 1 69 ? -10.223 -19.899 -1.494  1.00 0.00 ? 69 SER A HB2  1  
ATOM 1028  H HB3  . SER A 1 69 ? -11.308 -18.783 -0.665  1.00 0.00 ? 69 SER A HB3  1  
ATOM 1029  H HG   . SER A 1 69 ? -11.868 -20.360 -2.700  1.00 0.00 ? 69 SER A HG   1  
ATOM 1030  N N    . GLY A 1 70 ? -11.425 -16.527 -3.691  1.00 0.00 ? 70 GLY A N    1  
ATOM 1031  C CA   . GLY A 1 70 ? -12.316 -15.439 -4.048  1.00 0.00 ? 70 GLY A CA   1  
ATOM 1032  C C    . GLY A 1 70 ? -13.248 -15.802 -5.187  1.00 0.00 ? 70 GLY A C    1  
ATOM 1033  O O    . GLY A 1 70 ? -13.306 -15.102 -6.197  1.00 0.00 ? 70 GLY A O    1  
ATOM 1034  H H    . GLY A 1 70 ? -11.114 -17.149 -4.381  1.00 0.00 ? 70 GLY A H    1  
ATOM 1035  H HA2  . GLY A 1 70 ? -12.907 -15.173 -3.184  1.00 0.00 ? 70 GLY A HA2  1  
ATOM 1036  H HA3  . GLY A 1 70 ? -11.723 -14.585 -4.342  1.00 0.00 ? 70 GLY A HA3  1  
ATOM 1037  N N    . GLY A 1 1  ? -18.862 -9.015  7.635   1.00 0.00 ? 1  GLY A N    2  
ATOM 1038  C CA   . GLY A 1 1  ? -17.469 -9.073  8.040   1.00 0.00 ? 1  GLY A CA   2  
ATOM 1039  C C    . GLY A 1 1  ? -17.269 -9.863  9.318   1.00 0.00 ? 1  GLY A C    2  
ATOM 1040  O O    . GLY A 1 1  ? -18.236 -10.225 9.989   1.00 0.00 ? 1  GLY A O    2  
ATOM 1041  H H1   . GLY A 1 1  ? -19.223 -8.191  7.247   1.00 0.00 ? 1  GLY A H1   2  
ATOM 1042  H HA2  . GLY A 1 1  ? -16.895 -9.535  7.250   1.00 0.00 ? 1  GLY A HA2  2  
ATOM 1043  H HA3  . GLY A 1 1  ? -17.108 -8.067  8.192   1.00 0.00 ? 1  GLY A HA3  2  
ATOM 1044  N N    . SER A 1 2  ? -16.012 -10.131 9.656   1.00 0.00 ? 2  SER A N    2  
ATOM 1045  C CA   . SER A 1 2  ? -15.689 -10.888 10.860  1.00 0.00 ? 2  SER A CA   2  
ATOM 1046  C C    . SER A 1 2  ? -15.563 -9.962  12.066  1.00 0.00 ? 2  SER A C    2  
ATOM 1047  O O    . SER A 1 2  ? -14.571 -10.003 12.793  1.00 0.00 ? 2  SER A O    2  
ATOM 1048  C CB   . SER A 1 2  ? -14.387 -11.668 10.663  1.00 0.00 ? 2  SER A CB   2  
ATOM 1049  O OG   . SER A 1 2  ? -13.261 -10.814 10.765  1.00 0.00 ? 2  SER A OG   2  
ATOM 1050  H H    . SER A 1 2  ? -15.285 -9.815  9.079   1.00 0.00 ? 2  SER A H    2  
ATOM 1051  H HA   . SER A 1 2  ? -16.493 -11.586 11.038  1.00 0.00 ? 2  SER A HA   2  
ATOM 1052  H HB2  . SER A 1 2  ? -14.312 -12.434 11.419  1.00 0.00 ? 2  SER A HB2  2  
ATOM 1053  H HB3  . SER A 1 2  ? -14.390 -12.126 9.685   1.00 0.00 ? 2  SER A HB3  2  
ATOM 1054  H HG   . SER A 1 2  ? -12.516 -11.306 11.118  1.00 0.00 ? 2  SER A HG   2  
ATOM 1055  N N    . SER A 1 3  ? -16.577 -9.128  12.271  1.00 0.00 ? 3  SER A N    2  
ATOM 1056  C CA   . SER A 1 3  ? -16.580 -8.188  13.386  1.00 0.00 ? 3  SER A CA   2  
ATOM 1057  C C    . SER A 1 3  ? -15.343 -7.296  13.348  1.00 0.00 ? 3  SER A C    2  
ATOM 1058  O O    . SER A 1 3  ? -14.717 -7.039  14.376  1.00 0.00 ? 3  SER A O    2  
ATOM 1059  C CB   . SER A 1 3  ? -16.638 -8.942  14.716  1.00 0.00 ? 3  SER A CB   2  
ATOM 1060  O OG   . SER A 1 3  ? -17.857 -9.652  14.847  1.00 0.00 ? 3  SER A OG   2  
ATOM 1061  H H    . SER A 1 3  ? -17.341 -9.143  11.656  1.00 0.00 ? 3  SER A H    2  
ATOM 1062  H HA   . SER A 1 3  ? -17.460 -7.568  13.296  1.00 0.00 ? 3  SER A HA   2  
ATOM 1063  H HB2  . SER A 1 3  ? -15.820 -9.645  14.765  1.00 0.00 ? 3  SER A HB2  2  
ATOM 1064  H HB3  . SER A 1 3  ? -16.556 -8.237  15.531  1.00 0.00 ? 3  SER A HB3  2  
ATOM 1065  H HG   . SER A 1 3  ? -18.053 -10.108 14.025  1.00 0.00 ? 3  SER A HG   2  
ATOM 1066  N N    . GLY A 1 4  ? -14.997 -6.826  12.154  1.00 0.00 ? 4  GLY A N    2  
ATOM 1067  C CA   . GLY A 1 4  ? -13.836 -5.968  12.002  1.00 0.00 ? 4  GLY A CA   2  
ATOM 1068  C C    . GLY A 1 4  ? -12.853 -6.498  10.977  1.00 0.00 ? 4  GLY A C    2  
ATOM 1069  O O    . GLY A 1 4  ? -13.239 -7.195  10.039  1.00 0.00 ? 4  GLY A O    2  
ATOM 1070  H H    . GLY A 1 4  ? -15.533 -7.064  11.369  1.00 0.00 ? 4  GLY A H    2  
ATOM 1071  H HA2  . GLY A 1 4  ? -14.165 -4.986  11.696  1.00 0.00 ? 4  GLY A HA2  2  
ATOM 1072  H HA3  . GLY A 1 4  ? -13.335 -5.888  12.956  1.00 0.00 ? 4  GLY A HA3  2  
ATOM 1073  N N    . SER A 1 5  ? -11.579 -6.165  11.154  1.00 0.00 ? 5  SER A N    2  
ATOM 1074  C CA   . SER A 1 5  ? -10.538 -6.607  10.234  1.00 0.00 ? 5  SER A CA   2  
ATOM 1075  C C    . SER A 1 5  ? -10.777 -6.049  8.834   1.00 0.00 ? 5  SER A C    2  
ATOM 1076  O O    . SER A 1 5  ? -10.583 -6.742  7.836   1.00 0.00 ? 5  SER A O    2  
ATOM 1077  C CB   . SER A 1 5  ? -10.488 -8.135  10.184  1.00 0.00 ? 5  SER A CB   2  
ATOM 1078  O OG   . SER A 1 5  ? -9.983  -8.669  11.396  1.00 0.00 ? 5  SER A OG   2  
ATOM 1079  H H    . SER A 1 5  ? -11.333 -5.606  11.921  1.00 0.00 ? 5  SER A H    2  
ATOM 1080  H HA   . SER A 1 5  ? -9.592  -6.236  10.600  1.00 0.00 ? 5  SER A HA   2  
ATOM 1081  H HB2  . SER A 1 5  ? -11.483 -8.520  10.022  1.00 0.00 ? 5  SER A HB2  2  
ATOM 1082  H HB3  . SER A 1 5  ? -9.845  -8.445  9.372   1.00 0.00 ? 5  SER A HB3  2  
ATOM 1083  H HG   . SER A 1 5  ? -9.550  -9.508  11.221  1.00 0.00 ? 5  SER A HG   2  
ATOM 1084  N N    . SER A 1 6  ? -11.200 -4.790  8.770   1.00 0.00 ? 6  SER A N    2  
ATOM 1085  C CA   . SER A 1 6  ? -11.470 -4.138  7.494   1.00 0.00 ? 6  SER A CA   2  
ATOM 1086  C C    . SER A 1 6  ? -10.170 -3.757  6.793   1.00 0.00 ? 6  SER A C    2  
ATOM 1087  O O    . SER A 1 6  ? -9.589  -2.707  7.066   1.00 0.00 ? 6  SER A O    2  
ATOM 1088  C CB   . SER A 1 6  ? -12.333 -2.893  7.706   1.00 0.00 ? 6  SER A CB   2  
ATOM 1089  O OG   . SER A 1 6  ? -13.671 -3.245  8.011   1.00 0.00 ? 6  SER A OG   2  
ATOM 1090  H H    . SER A 1 6  ? -11.336 -4.289  9.602   1.00 0.00 ? 6  SER A H    2  
ATOM 1091  H HA   . SER A 1 6  ? -12.009 -4.837  6.872   1.00 0.00 ? 6  SER A HA   2  
ATOM 1092  H HB2  . SER A 1 6  ? -11.931 -2.314  8.524   1.00 0.00 ? 6  SER A HB2  2  
ATOM 1093  H HB3  . SER A 1 6  ? -12.326 -2.296  6.805   1.00 0.00 ? 6  SER A HB3  2  
ATOM 1094  H HG   . SER A 1 6  ? -13.944 -2.802  8.817   1.00 0.00 ? 6  SER A HG   2  
ATOM 1095  N N    . GLY A 1 7  ? -9.718  -4.619  5.888   1.00 0.00 ? 7  GLY A N    2  
ATOM 1096  C CA   . GLY A 1 7  ? -8.489  -4.356  5.161   1.00 0.00 ? 7  GLY A CA   2  
ATOM 1097  C C    . GLY A 1 7  ? -7.568  -5.559  5.124   1.00 0.00 ? 7  GLY A C    2  
ATOM 1098  O O    . GLY A 1 7  ? -7.247  -6.137  6.163   1.00 0.00 ? 7  GLY A O    2  
ATOM 1099  H H    . GLY A 1 7  ? -10.222 -5.440  5.711   1.00 0.00 ? 7  GLY A H    2  
ATOM 1100  H HA2  . GLY A 1 7  ? -8.736  -4.073  4.149   1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1101  H HA3  . GLY A 1 7  ? -7.972  -3.535  5.637   1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1102  N N    . THR A 1 8  ? -7.142  -5.940  3.924   1.00 0.00 ? 8  THR A N    2  
ATOM 1103  C CA   . THR A 1 8  ? -6.255  -7.084  3.755   1.00 0.00 ? 8  THR A CA   2  
ATOM 1104  C C    . THR A 1 8  ? -4.814  -6.715  4.085   1.00 0.00 ? 8  THR A C    2  
ATOM 1105  O O    . THR A 1 8  ? -4.327  -5.640  3.736   1.00 0.00 ? 8  THR A O    2  
ATOM 1106  C CB   . THR A 1 8  ? -6.316  -7.634  2.317   1.00 0.00 ? 8  THR A CB   2  
ATOM 1107  O OG1  . THR A 1 8  ? -7.638  -8.102  2.027   1.00 0.00 ? 8  THR A OG1  2  
ATOM 1108  C CG2  . THR A 1 8  ? -5.319  -8.768  2.130   1.00 0.00 ? 8  THR A CG2  2  
ATOM 1109  H H    . THR A 1 8  ? -7.433  -5.439  3.133   1.00 0.00 ? 8  THR A H    2  
ATOM 1110  H HA   . THR A 1 8  ? -6.582  -7.862  4.430   1.00 0.00 ? 8  THR A HA   2  
ATOM 1111  H HB   . THR A 1 8  ? -6.066  -6.837  1.632   1.00 0.00 ? 8  THR A HB   2  
ATOM 1112  H HG1  . THR A 1 8  ? -7.998  -8.543  2.801   1.00 0.00 ? 8  THR A HG1  2  
ATOM 1113  H HG21 . THR A 1 8  ? -4.412  -8.543  2.671   1.00 0.00 ? 8  THR A HG21 2  
ATOM 1114  H HG22 . THR A 1 8  ? -5.093  -8.878  1.079   1.00 0.00 ? 8  THR A HG22 2  
ATOM 1115  H HG23 . THR A 1 8  ? -5.743  -9.686  2.506   1.00 0.00 ? 8  THR A HG23 2  
ATOM 1116  N N    . PRO A 1 9  ? -4.112  -7.627  4.775   1.00 0.00 ? 9  PRO A N    2  
ATOM 1117  C CA   . PRO A 1 9  ? -2.715  -7.420  5.167   1.00 0.00 ? 9  PRO A CA   2  
ATOM 1118  C C    . PRO A 1 9  ? -1.767  -7.451  3.973   1.00 0.00 ? 9  PRO A C    2  
ATOM 1119  O O    . PRO A 1 9  ? -1.894  -8.299  3.089   1.00 0.00 ? 9  PRO A O    2  
ATOM 1120  C CB   . PRO A 1 9  ? -2.432  -8.596  6.105   1.00 0.00 ? 9  PRO A CB   2  
ATOM 1121  C CG   . PRO A 1 9  ? -3.395  -9.654  5.688   1.00 0.00 ? 9  PRO A CG   2  
ATOM 1122  C CD   . PRO A 1 9  ? -4.629  -8.930  5.225   1.00 0.00 ? 9  PRO A CD   2  
ATOM 1123  H HA   . PRO A 1 9  ? -2.587  -6.491  5.703   1.00 0.00 ? 9  PRO A HA   2  
ATOM 1124  H HB2  . PRO A 1 9  ? -1.408  -8.921  5.980   1.00 0.00 ? 9  PRO A HB2  2  
ATOM 1125  H HB3  . PRO A 1 9  ? -2.597  -8.293  7.128   1.00 0.00 ? 9  PRO A HB3  2  
ATOM 1126  H HG2  . PRO A 1 9  ? -2.975  -10.234 4.881   1.00 0.00 ? 9  PRO A HG2  2  
ATOM 1127  H HG3  . PRO A 1 9  ? -3.627  -10.290 6.529   1.00 0.00 ? 9  PRO A HG3  2  
ATOM 1128  H HD2  . PRO A 1 9  ? -5.095  -9.463  4.410   1.00 0.00 ? 9  PRO A HD2  2  
ATOM 1129  H HD3  . PRO A 1 9  ? -5.323  -8.807  6.043   1.00 0.00 ? 9  PRO A HD3  2  
ATOM 1130  N N    . TYR A 1 10 ? -0.818  -6.522  3.953   1.00 0.00 ? 10 TYR A N    2  
ATOM 1131  C CA   . TYR A 1 10 ? 0.150   -6.442  2.865   1.00 0.00 ? 10 TYR A CA   2  
ATOM 1132  C C    . TYR A 1 10 ? 1.544   -6.128  3.399   1.00 0.00 ? 10 TYR A C    2  
ATOM 1133  O O    . TYR A 1 10 ? 1.740   -5.979  4.605   1.00 0.00 ? 10 TYR A O    2  
ATOM 1134  C CB   . TYR A 1 10 ? -0.273  -5.375  1.855   1.00 0.00 ? 10 TYR A CB   2  
ATOM 1135  C CG   . TYR A 1 10 ? -1.169  -5.902  0.756   1.00 0.00 ? 10 TYR A CG   2  
ATOM 1136  C CD1  . TYR A 1 10 ? -2.484  -6.265  1.019   1.00 0.00 ? 10 TYR A CD1  2  
ATOM 1137  C CD2  . TYR A 1 10 ? -0.699  -6.038  -0.544  1.00 0.00 ? 10 TYR A CD2  2  
ATOM 1138  C CE1  . TYR A 1 10 ? -3.305  -6.747  0.019   1.00 0.00 ? 10 TYR A CE1  2  
ATOM 1139  C CE2  . TYR A 1 10 ? -1.514  -6.519  -1.551  1.00 0.00 ? 10 TYR A CE2  2  
ATOM 1140  C CZ   . TYR A 1 10 ? -2.816  -6.872  -1.264  1.00 0.00 ? 10 TYR A CZ   2  
ATOM 1141  O OH   . TYR A 1 10 ? -3.630  -7.353  -2.264  1.00 0.00 ? 10 TYR A OH   2  
ATOM 1142  H H    . TYR A 1 10 ? -0.768  -5.874  4.686   1.00 0.00 ? 10 TYR A H    2  
ATOM 1143  H HA   . TYR A 1 10 ? 0.174   -7.402  2.371   1.00 0.00 ? 10 TYR A HA   2  
ATOM 1144  H HB2  . TYR A 1 10 ? -0.808  -4.592  2.371   1.00 0.00 ? 10 TYR A HB2  2  
ATOM 1145  H HB3  . TYR A 1 10 ? 0.609   -4.956  1.393   1.00 0.00 ? 10 TYR A HB3  2  
ATOM 1146  H HD1  . TYR A 1 10 ? -2.864  -6.166  2.026   1.00 0.00 ? 10 TYR A HD1  2  
ATOM 1147  H HD2  . TYR A 1 10 ? 0.322   -5.761  -0.765  1.00 0.00 ? 10 TYR A HD2  2  
ATOM 1148  H HE1  . TYR A 1 10 ? -4.325  -7.024  0.243   1.00 0.00 ? 10 TYR A HE1  2  
ATOM 1149  H HE2  . TYR A 1 10 ? -1.131  -6.617  -2.556  1.00 0.00 ? 10 TYR A HE2  2  
ATOM 1150  H HH   . TYR A 1 10 ? -4.018  -8.186  -1.988  1.00 0.00 ? 10 TYR A HH   2  
ATOM 1151  N N    . ARG A 1 11 ? 2.510   -6.030  2.492   1.00 0.00 ? 11 ARG A N    2  
ATOM 1152  C CA   . ARG A 1 11 ? 3.887   -5.735  2.870   1.00 0.00 ? 11 ARG A CA   2  
ATOM 1153  C C    . ARG A 1 11 ? 4.575   -4.891  1.800   1.00 0.00 ? 11 ARG A C    2  
ATOM 1154  O O    . ARG A 1 11 ? 4.459   -5.169  0.607   1.00 0.00 ? 11 ARG A O    2  
ATOM 1155  C CB   . ARG A 1 11 ? 4.666   -7.032  3.092   1.00 0.00 ? 11 ARG A CB   2  
ATOM 1156  C CG   . ARG A 1 11 ? 6.162   -6.822  3.263   1.00 0.00 ? 11 ARG A CG   2  
ATOM 1157  C CD   . ARG A 1 11 ? 6.928   -8.128  3.119   1.00 0.00 ? 11 ARG A CD   2  
ATOM 1158  N NE   . ARG A 1 11 ? 7.269   -8.412  1.728   1.00 0.00 ? 11 ARG A NE   2  
ATOM 1159  C CZ   . ARG A 1 11 ? 8.307   -7.872  1.101   1.00 0.00 ? 11 ARG A CZ   2  
ATOM 1160  N NH1  . ARG A 1 11 ? 9.103   -7.024  1.737   1.00 0.00 ? 11 ARG A NH1  2  
ATOM 1161  N NH2  . ARG A 1 11 ? 8.552   -8.180  -0.167  1.00 0.00 ? 11 ARG A NH2  2  
ATOM 1162  H H    . ARG A 1 11 ? 2.292   -6.160  1.545   1.00 0.00 ? 11 ARG A H    2  
ATOM 1163  H HA   . ARG A 1 11 ? 3.865   -5.176  3.793   1.00 0.00 ? 11 ARG A HA   2  
ATOM 1164  H HB2  . ARG A 1 11 ? 4.290   -7.517  3.980   1.00 0.00 ? 11 ARG A HB2  2  
ATOM 1165  H HB3  . ARG A 1 11 ? 4.511   -7.681  2.243   1.00 0.00 ? 11 ARG A HB3  2  
ATOM 1166  H HG2  . ARG A 1 11 ? 6.508   -6.130  2.509   1.00 0.00 ? 11 ARG A HG2  2  
ATOM 1167  H HG3  . ARG A 1 11 ? 6.348   -6.411  4.244   1.00 0.00 ? 11 ARG A HG3  2  
ATOM 1168  H HD2  . ARG A 1 11 ? 7.839   -8.061  3.696   1.00 0.00 ? 11 ARG A HD2  2  
ATOM 1169  H HD3  . ARG A 1 11 ? 6.318   -8.931  3.503   1.00 0.00 ? 11 ARG A HD3  2  
ATOM 1170  H HE   . ARG A 1 11 ? 6.694   -9.036  1.239   1.00 0.00 ? 11 ARG A HE   2  
ATOM 1171  H HH11 . ARG A 1 11 ? 8.922   -6.791  2.692   1.00 0.00 ? 11 ARG A HH11 2  
ATOM 1172  H HH12 . ARG A 1 11 ? 9.886   -6.620  1.263   1.00 0.00 ? 11 ARG A HH12 2  
ATOM 1173  H HH21 . ARG A 1 11 ? 7.955   -8.819  -0.650  1.00 0.00 ? 11 ARG A HH21 2  
ATOM 1174  H HH22 . ARG A 1 11 ? 9.334   -7.773  -0.638  1.00 0.00 ? 11 ARG A HH22 2  
ATOM 1175  N N    . ALA A 1 12 ? 5.292   -3.861  2.237   1.00 0.00 ? 12 ALA A N    2  
ATOM 1176  C CA   . ALA A 1 12 ? 6.000   -2.978  1.318   1.00 0.00 ? 12 ALA A CA   2  
ATOM 1177  C C    . ALA A 1 12 ? 7.327   -3.590  0.883   1.00 0.00 ? 12 ALA A C    2  
ATOM 1178  O O    . ALA A 1 12 ? 8.310   -3.555  1.623   1.00 0.00 ? 12 ALA A O    2  
ATOM 1179  C CB   . ALA A 1 12 ? 6.229   -1.619  1.963   1.00 0.00 ? 12 ALA A CB   2  
ATOM 1180  H H    . ALA A 1 12 ? 5.346   -3.691  3.201   1.00 0.00 ? 12 ALA A H    2  
ATOM 1181  H HA   . ALA A 1 12 ? 5.377   -2.835  0.447   1.00 0.00 ? 12 ALA A HA   2  
ATOM 1182  H HB1  . ALA A 1 12 ? 6.706   -0.961  1.252   1.00 0.00 ? 12 ALA A HB1  2  
ATOM 1183  H HB2  . ALA A 1 12 ? 5.281   -1.200  2.264   1.00 0.00 ? 12 ALA A HB2  2  
ATOM 1184  H HB3  . ALA A 1 12 ? 6.864   -1.735  2.829   1.00 0.00 ? 12 ALA A HB3  2  
ATOM 1185  N N    . MET A 1 13 ? 7.348   -4.151  -0.322  1.00 0.00 ? 13 MET A N    2  
ATOM 1186  C CA   . MET A 1 13 ? 8.555   -4.770  -0.856  1.00 0.00 ? 13 MET A CA   2  
ATOM 1187  C C    . MET A 1 13 ? 9.705   -3.769  -0.901  1.00 0.00 ? 13 MET A C    2  
ATOM 1188  O O    . MET A 1 13 ? 10.867  -4.135  -0.725  1.00 0.00 ? 13 MET A O    2  
ATOM 1189  C CB   . MET A 1 13 ? 8.293   -5.327  -2.256  1.00 0.00 ? 13 MET A CB   2  
ATOM 1190  C CG   . MET A 1 13 ? 7.114   -6.285  -2.318  1.00 0.00 ? 13 MET A CG   2  
ATOM 1191  S SD   . MET A 1 13 ? 7.275   -7.498  -3.642  1.00 0.00 ? 13 MET A SD   2  
ATOM 1192  C CE   . MET A 1 13 ? 6.704   -6.545  -5.047  1.00 0.00 ? 13 MET A CE   2  
ATOM 1193  H H    . MET A 1 13 ? 6.532   -4.148  -0.866  1.00 0.00 ? 13 MET A H    2  
ATOM 1194  H HA   . MET A 1 13 ? 8.827   -5.584  -0.200  1.00 0.00 ? 13 MET A HA   2  
ATOM 1195  H HB2  . MET A 1 13 ? 8.095   -4.504  -2.927  1.00 0.00 ? 13 MET A HB2  2  
ATOM 1196  H HB3  . MET A 1 13 ? 9.174   -5.852  -2.594  1.00 0.00 ? 13 MET A HB3  2  
ATOM 1197  H HG2  . MET A 1 13 ? 7.043   -6.808  -1.377  1.00 0.00 ? 13 MET A HG2  2  
ATOM 1198  H HG3  . MET A 1 13 ? 6.212   -5.713  -2.479  1.00 0.00 ? 13 MET A HG3  2  
ATOM 1199  H HE1  . MET A 1 13 ? 7.427   -5.778  -5.280  1.00 0.00 ? 13 MET A HE1  2  
ATOM 1200  H HE2  . MET A 1 13 ? 6.583   -7.197  -5.899  1.00 0.00 ? 13 MET A HE2  2  
ATOM 1201  H HE3  . MET A 1 13 ? 5.756   -6.085  -4.808  1.00 0.00 ? 13 MET A HE3  2  
ATOM 1202  N N    . TYR A 1 14 ? 9.374   -2.505  -1.138  1.00 0.00 ? 14 TYR A N    2  
ATOM 1203  C CA   . TYR A 1 14 ? 10.380  -1.451  -1.210  1.00 0.00 ? 14 TYR A CA   2  
ATOM 1204  C C    . TYR A 1 14 ? 9.845   -0.147  -0.625  1.00 0.00 ? 14 TYR A C    2  
ATOM 1205  O O    . TYR A 1 14 ? 8.656   0.152   -0.733  1.00 0.00 ? 14 TYR A O    2  
ATOM 1206  C CB   . TYR A 1 14 ? 10.817  -1.232  -2.659  1.00 0.00 ? 14 TYR A CB   2  
ATOM 1207  C CG   . TYR A 1 14 ? 10.738  -2.479  -3.510  1.00 0.00 ? 14 TYR A CG   2  
ATOM 1208  C CD1  . TYR A 1 14 ? 11.780  -3.399  -3.527  1.00 0.00 ? 14 TYR A CD1  2  
ATOM 1209  C CD2  . TYR A 1 14 ? 9.624   -2.737  -4.299  1.00 0.00 ? 14 TYR A CD2  2  
ATOM 1210  C CE1  . TYR A 1 14 ? 11.713  -4.539  -4.304  1.00 0.00 ? 14 TYR A CE1  2  
ATOM 1211  C CE2  . TYR A 1 14 ? 9.548   -3.875  -5.078  1.00 0.00 ? 14 TYR A CE2  2  
ATOM 1212  C CZ   . TYR A 1 14 ? 10.595  -4.773  -5.077  1.00 0.00 ? 14 TYR A CZ   2  
ATOM 1213  O OH   . TYR A 1 14 ? 10.523  -5.908  -5.852  1.00 0.00 ? 14 TYR A OH   2  
ATOM 1214  H H    . TYR A 1 14 ? 8.431   -2.274  -1.271  1.00 0.00 ? 14 TYR A H    2  
ATOM 1215  H HA   . TYR A 1 14 ? 11.234  -1.769  -0.630  1.00 0.00 ? 14 TYR A HA   2  
ATOM 1216  H HB2  . TYR A 1 14 ? 10.184  -0.483  -3.109  1.00 0.00 ? 14 TYR A HB2  2  
ATOM 1217  H HB3  . TYR A 1 14 ? 11.840  -0.886  -2.670  1.00 0.00 ? 14 TYR A HB3  2  
ATOM 1218  H HD1  . TYR A 1 14 ? 12.654  -3.213  -2.920  1.00 0.00 ? 14 TYR A HD1  2  
ATOM 1219  H HD2  . TYR A 1 14 ? 8.806   -2.031  -4.297  1.00 0.00 ? 14 TYR A HD2  2  
ATOM 1220  H HE1  . TYR A 1 14 ? 12.532  -5.243  -4.304  1.00 0.00 ? 14 TYR A HE1  2  
ATOM 1221  H HE2  . TYR A 1 14 ? 8.673   -4.059  -5.683  1.00 0.00 ? 14 TYR A HE2  2  
ATOM 1222  H HH   . TYR A 1 14 ? 9.986   -6.567  -5.407  1.00 0.00 ? 14 TYR A HH   2  
ATOM 1223  N N    . GLN A 1 15 ? 10.733  0.624   -0.007  1.00 0.00 ? 15 GLN A N    2  
ATOM 1224  C CA   . GLN A 1 15 ? 10.352  1.896   0.595   1.00 0.00 ? 15 GLN A CA   2  
ATOM 1225  C C    . GLN A 1 15 ? 9.841   2.868   -0.463  1.00 0.00 ? 15 GLN A C    2  
ATOM 1226  O O    . GLN A 1 15 ? 10.356  2.911   -1.581  1.00 0.00 ? 15 GLN A O    2  
ATOM 1227  C CB   . GLN A 1 15 ? 11.540  2.510   1.337   1.00 0.00 ? 15 GLN A CB   2  
ATOM 1228  C CG   . GLN A 1 15 ? 11.211  3.820   2.034   1.00 0.00 ? 15 GLN A CG   2  
ATOM 1229  C CD   . GLN A 1 15 ? 12.437  4.495   2.618   1.00 0.00 ? 15 GLN A CD   2  
ATOM 1230  O OE1  . GLN A 1 15 ? 13.290  3.844   3.220   1.00 0.00 ? 15 GLN A OE1  2  
ATOM 1231  N NE2  . GLN A 1 15 ? 12.530  5.808   2.442   1.00 0.00 ? 15 GLN A NE2  2  
ATOM 1232  H H    . GLN A 1 15 ? 11.666  0.331   0.046   1.00 0.00 ? 15 GLN A H    2  
ATOM 1233  H HA   . GLN A 1 15 ? 9.559   1.703   1.302   1.00 0.00 ? 15 GLN A HA   2  
ATOM 1234  H HB2  . GLN A 1 15 ? 11.887  1.808   2.081   1.00 0.00 ? 15 GLN A HB2  2  
ATOM 1235  H HB3  . GLN A 1 15 ? 12.335  2.694   0.629   1.00 0.00 ? 15 GLN A HB3  2  
ATOM 1236  H HG2  . GLN A 1 15 ? 10.757  4.490   1.319   1.00 0.00 ? 15 GLN A HG2  2  
ATOM 1237  H HG3  . GLN A 1 15 ? 10.512  3.622   2.834   1.00 0.00 ? 15 GLN A HG3  2  
ATOM 1238  H HE21 . GLN A 1 15 ? 11.811  6.261   1.953   1.00 0.00 ? 15 GLN A HE21 2  
ATOM 1239  H HE22 . GLN A 1 15 ? 13.312  6.270   2.809   1.00 0.00 ? 15 GLN A HE22 2  
ATOM 1240  N N    . TYR A 1 16 ? 8.825   3.645   -0.105  1.00 0.00 ? 16 TYR A N    2  
ATOM 1241  C CA   . TYR A 1 16 ? 8.242   4.614   -1.025  1.00 0.00 ? 16 TYR A CA   2  
ATOM 1242  C C    . TYR A 1 16 ? 8.362   6.031   -0.472  1.00 0.00 ? 16 TYR A C    2  
ATOM 1243  O O    . TYR A 1 16 ? 8.050   6.283   0.692   1.00 0.00 ? 16 TYR A O    2  
ATOM 1244  C CB   . TYR A 1 16 ? 6.773   4.280   -1.288  1.00 0.00 ? 16 TYR A CB   2  
ATOM 1245  C CG   . TYR A 1 16 ? 6.112   5.199   -2.290  1.00 0.00 ? 16 TYR A CG   2  
ATOM 1246  C CD1  . TYR A 1 16 ? 6.279   5.005   -3.656  1.00 0.00 ? 16 TYR A CD1  2  
ATOM 1247  C CD2  . TYR A 1 16 ? 5.321   6.262   -1.871  1.00 0.00 ? 16 TYR A CD2  2  
ATOM 1248  C CE1  . TYR A 1 16 ? 5.678   5.843   -4.575  1.00 0.00 ? 16 TYR A CE1  2  
ATOM 1249  C CE2  . TYR A 1 16 ? 4.715   7.104   -2.784  1.00 0.00 ? 16 TYR A CE2  2  
ATOM 1250  C CZ   . TYR A 1 16 ? 4.897   6.891   -4.134  1.00 0.00 ? 16 TYR A CZ   2  
ATOM 1251  O OH   . TYR A 1 16 ? 4.296   7.727   -5.047  1.00 0.00 ? 16 TYR A OH   2  
ATOM 1252  H H    . TYR A 1 16 ? 8.456   3.564   0.800   1.00 0.00 ? 16 TYR A H    2  
ATOM 1253  H HA   . TYR A 1 16 ? 8.786   4.556   -1.956  1.00 0.00 ? 16 TYR A HA   2  
ATOM 1254  H HB2  . TYR A 1 16 ? 6.702   3.272   -1.666  1.00 0.00 ? 16 TYR A HB2  2  
ATOM 1255  H HB3  . TYR A 1 16 ? 6.223   4.350   -0.360  1.00 0.00 ? 16 TYR A HB3  2  
ATOM 1256  H HD1  . TYR A 1 16 ? 6.891   4.183   -3.998  1.00 0.00 ? 16 TYR A HD1  2  
ATOM 1257  H HD2  . TYR A 1 16 ? 5.180   6.426   -0.813  1.00 0.00 ? 16 TYR A HD2  2  
ATOM 1258  H HE1  . TYR A 1 16 ? 5.820   5.676   -5.633  1.00 0.00 ? 16 TYR A HE1  2  
ATOM 1259  H HE2  . TYR A 1 16 ? 4.103   7.925   -2.439  1.00 0.00 ? 16 TYR A HE2  2  
ATOM 1260  H HH   . TYR A 1 16 ? 3.344   7.709   -4.919  1.00 0.00 ? 16 TYR A HH   2  
ATOM 1261  N N    . ARG A 1 17 ? 8.815   6.952   -1.316  1.00 0.00 ? 17 ARG A N    2  
ATOM 1262  C CA   . ARG A 1 17 ? 8.977   8.344   -0.912  1.00 0.00 ? 17 ARG A CA   2  
ATOM 1263  C C    . ARG A 1 17 ? 7.888   9.218   -1.528  1.00 0.00 ? 17 ARG A C    2  
ATOM 1264  O O    . ARG A 1 17 ? 8.049   9.781   -2.611  1.00 0.00 ? 17 ARG A O    2  
ATOM 1265  C CB   . ARG A 1 17 ? 10.356  8.860   -1.327  1.00 0.00 ? 17 ARG A CB   2  
ATOM 1266  C CG   . ARG A 1 17 ? 11.475  8.421   -0.397  1.00 0.00 ? 17 ARG A CG   2  
ATOM 1267  C CD   . ARG A 1 17 ? 12.598  9.445   -0.355  1.00 0.00 ? 17 ARG A CD   2  
ATOM 1268  N NE   . ARG A 1 17 ? 13.537  9.274   -1.460  1.00 0.00 ? 17 ARG A NE   2  
ATOM 1269  C CZ   . ARG A 1 17 ? 14.517  10.129  -1.731  1.00 0.00 ? 17 ARG A CZ   2  
ATOM 1270  N NH1  . ARG A 1 17 ? 14.685  11.209  -0.980  1.00 0.00 ? 17 ARG A NH1  2  
ATOM 1271  N NH2  . ARG A 1 17 ? 15.331  9.905   -2.755  1.00 0.00 ? 17 ARG A NH2  2  
ATOM 1272  H H    . ARG A 1 17 ? 9.046   6.690   -2.231  1.00 0.00 ? 17 ARG A H    2  
ATOM 1273  H HA   . ARG A 1 17 ? 8.893   8.390   0.163   1.00 0.00 ? 17 ARG A HA   2  
ATOM 1274  H HB2  . ARG A 1 17 ? 10.580  8.498   -2.320  1.00 0.00 ? 17 ARG A HB2  2  
ATOM 1275  H HB3  . ARG A 1 17 ? 10.333  9.939   -1.343  1.00 0.00 ? 17 ARG A HB3  2  
ATOM 1276  H HG2  . ARG A 1 17 ? 11.076  8.299   0.599   1.00 0.00 ? 17 ARG A HG2  2  
ATOM 1277  H HG3  . ARG A 1 17 ? 11.872  7.479   -0.746  1.00 0.00 ? 17 ARG A HG3  2  
ATOM 1278  H HD2  . ARG A 1 17 ? 12.168  10.434  -0.411  1.00 0.00 ? 17 ARG A HD2  2  
ATOM 1279  H HD3  . ARG A 1 17 ? 13.131  9.337   0.578   1.00 0.00 ? 17 ARG A HD3  2  
ATOM 1280  H HE   . ARG A 1 17 ? 13.431  8.483   -2.028  1.00 0.00 ? 17 ARG A HE   2  
ATOM 1281  H HH11 . ARG A 1 17 ? 14.074  11.380  -0.208  1.00 0.00 ? 17 ARG A HH11 2  
ATOM 1282  H HH12 . ARG A 1 17 ? 15.425  11.851  -1.186  1.00 0.00 ? 17 ARG A HH12 2  
ATOM 1283  H HH21 . ARG A 1 17 ? 15.207  9.092   -3.323  1.00 0.00 ? 17 ARG A HH21 2  
ATOM 1284  H HH22 . ARG A 1 17 ? 16.068  10.549  -2.958  1.00 0.00 ? 17 ARG A HH22 2  
ATOM 1285  N N    . PRO A 1 18 ? 6.753   9.336   -0.822  1.00 0.00 ? 18 PRO A N    2  
ATOM 1286  C CA   . PRO A 1 18 ? 5.617   10.140  -1.280  1.00 0.00 ? 18 PRO A CA   2  
ATOM 1287  C C    . PRO A 1 18 ? 5.911   11.635  -1.240  1.00 0.00 ? 18 PRO A C    2  
ATOM 1288  O O    . PRO A 1 18 ? 6.095   12.212  -0.169  1.00 0.00 ? 18 PRO A O    2  
ATOM 1289  C CB   . PRO A 1 18 ? 4.509   9.786   -0.284  1.00 0.00 ? 18 PRO A CB   2  
ATOM 1290  C CG   . PRO A 1 18 ? 5.229   9.356   0.947   1.00 0.00 ? 18 PRO A CG   2  
ATOM 1291  C CD   . PRO A 1 18 ? 6.493   8.692   0.476   1.00 0.00 ? 18 PRO A CD   2  
ATOM 1292  H HA   . PRO A 1 18 ? 5.309   9.861   -2.277  1.00 0.00 ? 18 PRO A HA   2  
ATOM 1293  H HB2  . PRO A 1 18 ? 3.895   10.657  -0.101  1.00 0.00 ? 18 PRO A HB2  2  
ATOM 1294  H HB3  . PRO A 1 18 ? 3.901   8.989   -0.685  1.00 0.00 ? 18 PRO A HB3  2  
ATOM 1295  H HG2  . PRO A 1 18 ? 5.461   10.217  1.556   1.00 0.00 ? 18 PRO A HG2  2  
ATOM 1296  H HG3  . PRO A 1 18 ? 4.622   8.656   1.501   1.00 0.00 ? 18 PRO A HG3  2  
ATOM 1297  H HD2  . PRO A 1 18 ? 7.300   8.882   1.169   1.00 0.00 ? 18 PRO A HD2  2  
ATOM 1298  H HD3  . PRO A 1 18 ? 6.339   7.630   0.356   1.00 0.00 ? 18 PRO A HD3  2  
ATOM 1299  N N    . GLN A 1 19 ? 5.954   12.257  -2.414  1.00 0.00 ? 19 GLN A N    2  
ATOM 1300  C CA   . GLN A 1 19 ? 6.226   13.686  -2.512  1.00 0.00 ? 19 GLN A CA   2  
ATOM 1301  C C    . GLN A 1 19 ? 5.083   14.500  -1.916  1.00 0.00 ? 19 GLN A C    2  
ATOM 1302  O O    . GLN A 1 19 ? 5.268   15.650  -1.520  1.00 0.00 ? 19 GLN A O    2  
ATOM 1303  C CB   . GLN A 1 19 ? 6.446   14.086  -3.972  1.00 0.00 ? 19 GLN A CB   2  
ATOM 1304  C CG   . GLN A 1 19 ? 7.807   13.681  -4.516  1.00 0.00 ? 19 GLN A CG   2  
ATOM 1305  C CD   . GLN A 1 19 ? 8.255   14.552  -5.674  1.00 0.00 ? 19 GLN A CD   2  
ATOM 1306  O OE1  . GLN A 1 19 ? 7.500   15.394  -6.161  1.00 0.00 ? 19 GLN A OE1  2  
ATOM 1307  N NE2  . GLN A 1 19 ? 9.489   14.353  -6.121  1.00 0.00 ? 19 GLN A NE2  2  
ATOM 1308  H H    . GLN A 1 19 ? 5.799   11.742  -3.233  1.00 0.00 ? 19 GLN A H    2  
ATOM 1309  H HA   . GLN A 1 19 ? 7.127   13.890  -1.953  1.00 0.00 ? 19 GLN A HA   2  
ATOM 1310  H HB2  . GLN A 1 19 ? 5.686   13.617  -4.580  1.00 0.00 ? 19 GLN A HB2  2  
ATOM 1311  H HB3  . GLN A 1 19 ? 6.353   15.158  -4.057  1.00 0.00 ? 19 GLN A HB3  2  
ATOM 1312  H HG2  . GLN A 1 19 ? 8.535   13.761  -3.723  1.00 0.00 ? 19 GLN A HG2  2  
ATOM 1313  H HG3  . GLN A 1 19 ? 7.755   12.657  -4.854  1.00 0.00 ? 19 GLN A HG3  2  
ATOM 1314  H HE21 . GLN A 1 19 ? 10.034  13.663  -5.685  1.00 0.00 ? 19 GLN A HE21 2  
ATOM 1315  H HE22 . GLN A 1 19 ? 9.805   14.901  -6.868  1.00 0.00 ? 19 GLN A HE22 2  
ATOM 1316  N N    . ASN A 1 20 ? 3.901   13.896  -1.856  1.00 0.00 ? 20 ASN A N    2  
ATOM 1317  C CA   . ASN A 1 20 ? 2.727   14.565  -1.309  1.00 0.00 ? 20 ASN A CA   2  
ATOM 1318  C C    . ASN A 1 20 ? 2.143   13.774  -0.142  1.00 0.00 ? 20 ASN A C    2  
ATOM 1319  O O    . ASN A 1 20 ? 2.378   12.573  -0.016  1.00 0.00 ? 20 ASN A O    2  
ATOM 1320  C CB   . ASN A 1 20 ? 1.666   14.750  -2.396  1.00 0.00 ? 20 ASN A CB   2  
ATOM 1321  C CG   . ASN A 1 20 ? 0.368   15.312  -1.849  1.00 0.00 ? 20 ASN A CG   2  
ATOM 1322  O OD1  . ASN A 1 20 ? 0.374   16.217  -1.014  1.00 0.00 ? 20 ASN A OD1  2  
ATOM 1323  N ND2  . ASN A 1 20 ? -0.753  14.776  -2.317  1.00 0.00 ? 20 ASN A ND2  2  
ATOM 1324  H H    . ASN A 1 20 ? 3.816   12.977  -2.188  1.00 0.00 ? 20 ASN A H    2  
ATOM 1325  H HA   . ASN A 1 20 ? 3.035   15.536  -0.952  1.00 0.00 ? 20 ASN A HA   2  
ATOM 1326  H HB2  . ASN A 1 20 ? 2.042   15.430  -3.146  1.00 0.00 ? 20 ASN A HB2  2  
ATOM 1327  H HB3  . ASN A 1 20 ? 1.458   13.794  -2.854  1.00 0.00 ? 20 ASN A HB3  2  
ATOM 1328  H HD21 . ASN A 1 20 ? -0.681  14.058  -2.980  1.00 0.00 ? 20 ASN A HD21 2  
ATOM 1329  H HD22 . ASN A 1 20 ? -1.606  15.122  -1.981  1.00 0.00 ? 20 ASN A HD22 2  
ATOM 1330  N N    . GLU A 1 21 ? 1.382   14.457  0.707   1.00 0.00 ? 21 GLU A N    2  
ATOM 1331  C CA   . GLU A 1 21 ? 0.766   13.817  1.863   1.00 0.00 ? 21 GLU A CA   2  
ATOM 1332  C C    . GLU A 1 21 ? -0.219  12.736  1.426   1.00 0.00 ? 21 GLU A C    2  
ATOM 1333  O O    . GLU A 1 21 ? -0.206  11.622  1.950   1.00 0.00 ? 21 GLU A O    2  
ATOM 1334  C CB   . GLU A 1 21 ? 0.048   14.857  2.727   1.00 0.00 ? 21 GLU A CB   2  
ATOM 1335  C CG   . GLU A 1 21 ? -0.097  14.444  4.182   1.00 0.00 ? 21 GLU A CG   2  
ATOM 1336  C CD   . GLU A 1 21 ? -1.096  15.301  4.935   1.00 0.00 ? 21 GLU A CD   2  
ATOM 1337  O OE1  . GLU A 1 21 ? -2.079  15.753  4.311   1.00 0.00 ? 21 GLU A OE1  2  
ATOM 1338  O OE2  . GLU A 1 21 ? -0.895  15.519  6.148   1.00 0.00 ? 21 GLU A OE2  2  
ATOM 1339  H H    . GLU A 1 21 ? 1.232   15.413  0.553   1.00 0.00 ? 21 GLU A H    2  
ATOM 1340  H HA   . GLU A 1 21 ? 1.550   13.359  2.446   1.00 0.00 ? 21 GLU A HA   2  
ATOM 1341  H HB2  . GLU A 1 21 ? 0.603   15.783  2.690   1.00 0.00 ? 21 GLU A HB2  2  
ATOM 1342  H HB3  . GLU A 1 21 ? -0.939  15.024  2.322   1.00 0.00 ? 21 GLU A HB3  2  
ATOM 1343  H HG2  . GLU A 1 21 ? -0.427  13.417  4.220   1.00 0.00 ? 21 GLU A HG2  2  
ATOM 1344  H HG3  . GLU A 1 21 ? 0.865   14.530  4.665   1.00 0.00 ? 21 GLU A HG3  2  
ATOM 1345  N N    . ASP A 1 22 ? -1.071  13.074  0.465   1.00 0.00 ? 22 ASP A N    2  
ATOM 1346  C CA   . ASP A 1 22 ? -2.062  12.133  -0.044  1.00 0.00 ? 22 ASP A CA   2  
ATOM 1347  C C    . ASP A 1 22 ? -1.476  10.728  -0.144  1.00 0.00 ? 22 ASP A C    2  
ATOM 1348  O O    . ASP A 1 22 ? -2.072  9.762   0.330   1.00 0.00 ? 22 ASP A O    2  
ATOM 1349  C CB   . ASP A 1 22 ? -2.571  12.586  -1.413  1.00 0.00 ? 22 ASP A CB   2  
ATOM 1350  C CG   . ASP A 1 22 ? -3.391  13.859  -1.334  1.00 0.00 ? 22 ASP A CG   2  
ATOM 1351  O OD1  . ASP A 1 22 ? -3.105  14.695  -0.452  1.00 0.00 ? 22 ASP A OD1  2  
ATOM 1352  O OD2  . ASP A 1 22 ? -4.319  14.019  -2.154  1.00 0.00 ? 22 ASP A OD2  2  
ATOM 1353  H H    . ASP A 1 22 ? -1.031  13.978  0.087   1.00 0.00 ? 22 ASP A H    2  
ATOM 1354  H HA   . ASP A 1 22 ? -2.889  12.116  0.650   1.00 0.00 ? 22 ASP A HA   2  
ATOM 1355  H HB2  . ASP A 1 22 ? -1.727  12.764  -2.063  1.00 0.00 ? 22 ASP A HB2  2  
ATOM 1356  H HB3  . ASP A 1 22 ? -3.188  11.807  -1.836  1.00 0.00 ? 22 ASP A HB3  2  
ATOM 1357  N N    . GLU A 1 23 ? -0.306  10.623  -0.766  1.00 0.00 ? 23 GLU A N    2  
ATOM 1358  C CA   . GLU A 1 23 ? 0.359   9.336   -0.931  1.00 0.00 ? 23 GLU A CA   2  
ATOM 1359  C C    . GLU A 1 23 ? 0.850   8.802   0.412   1.00 0.00 ? 23 GLU A C    2  
ATOM 1360  O O    . GLU A 1 23 ? 1.293   9.565   1.272   1.00 0.00 ? 23 GLU A O    2  
ATOM 1361  C CB   . GLU A 1 23 ? 1.534   9.464   -1.902  1.00 0.00 ? 23 GLU A CB   2  
ATOM 1362  C CG   . GLU A 1 23 ? 1.179   10.176  -3.196  1.00 0.00 ? 23 GLU A CG   2  
ATOM 1363  C CD   . GLU A 1 23 ? 2.322   10.179  -4.193  1.00 0.00 ? 23 GLU A CD   2  
ATOM 1364  O OE1  . GLU A 1 23 ? 3.462   10.491  -3.786  1.00 0.00 ? 23 GLU A OE1  2  
ATOM 1365  O OE2  . GLU A 1 23 ? 2.078   9.871   -5.377  1.00 0.00 ? 23 GLU A OE2  2  
ATOM 1366  H H    . GLU A 1 23 ? 0.120   11.430  -1.124  1.00 0.00 ? 23 GLU A H    2  
ATOM 1367  H HA   . GLU A 1 23 ? -0.360  8.642   -1.339  1.00 0.00 ? 23 GLU A HA   2  
ATOM 1368  H HB2  . GLU A 1 23 ? 2.327   10.014  -1.418  1.00 0.00 ? 23 GLU A HB2  2  
ATOM 1369  H HB3  . GLU A 1 23 ? 1.892   8.474   -2.147  1.00 0.00 ? 23 GLU A HB3  2  
ATOM 1370  H HG2  . GLU A 1 23 ? 0.332   9.679   -3.645  1.00 0.00 ? 23 GLU A HG2  2  
ATOM 1371  H HG3  . GLU A 1 23 ? 0.916   11.199  -2.969  1.00 0.00 ? 23 GLU A HG3  2  
ATOM 1372  N N    . LEU A 1 24 ? 0.767   7.488   0.585   1.00 0.00 ? 24 LEU A N    2  
ATOM 1373  C CA   . LEU A 1 24 ? 1.202   6.850   1.823   1.00 0.00 ? 24 LEU A CA   2  
ATOM 1374  C C    . LEU A 1 24 ? 2.673   6.454   1.744   1.00 0.00 ? 24 LEU A C    2  
ATOM 1375  O O    . LEU A 1 24 ? 3.127   5.918   0.733   1.00 0.00 ? 24 LEU A O    2  
ATOM 1376  C CB   . LEU A 1 24 ? 0.345   5.617   2.114   1.00 0.00 ? 24 LEU A CB   2  
ATOM 1377  C CG   . LEU A 1 24 ? 0.267   5.183   3.578   1.00 0.00 ? 24 LEU A CG   2  
ATOM 1378  C CD1  . LEU A 1 24 ? -0.103  6.361   4.465   1.00 0.00 ? 24 LEU A CD1  2  
ATOM 1379  C CD2  . LEU A 1 24 ? -0.735  4.051   3.746   1.00 0.00 ? 24 LEU A CD2  2  
ATOM 1380  H H    . LEU A 1 24 ? 0.404   6.932   -0.136  1.00 0.00 ? 24 LEU A H    2  
ATOM 1381  H HA   . LEU A 1 24 ? 1.076   7.563   2.625   1.00 0.00 ? 24 LEU A HA   2  
ATOM 1382  H HB2  . LEU A 1 24 ? -0.659  5.826   1.777   1.00 0.00 ? 24 LEU A HB2  2  
ATOM 1383  H HB3  . LEU A 1 24 ? 0.749   4.792   1.544   1.00 0.00 ? 24 LEU A HB3  2  
ATOM 1384  H HG   . LEU A 1 24 ? 1.237   4.822   3.891   1.00 0.00 ? 24 LEU A HG   2  
ATOM 1385  H HD11 . LEU A 1 24 ? -0.842  6.969   3.966   1.00 0.00 ? 24 LEU A HD11 2  
ATOM 1386  H HD12 . LEU A 1 24 ? 0.778   6.954   4.662   1.00 0.00 ? 24 LEU A HD12 2  
ATOM 1387  H HD13 . LEU A 1 24 ? -0.506  5.996   5.398   1.00 0.00 ? 24 LEU A HD13 2  
ATOM 1388  H HD21 . LEU A 1 24 ? -1.497  4.347   4.452   1.00 0.00 ? 24 LEU A HD21 2  
ATOM 1389  H HD22 . LEU A 1 24 ? -0.227  3.171   4.114   1.00 0.00 ? 24 LEU A HD22 2  
ATOM 1390  H HD23 . LEU A 1 24 ? -1.193  3.830   2.793   1.00 0.00 ? 24 LEU A HD23 2  
ATOM 1391  N N    . GLU A 1 25 ? 3.411   6.718   2.817   1.00 0.00 ? 25 GLU A N    2  
ATOM 1392  C CA   . GLU A 1 25 ? 4.830   6.388   2.868   1.00 0.00 ? 25 GLU A CA   2  
ATOM 1393  C C    . GLU A 1 25 ? 5.035   4.932   3.279   1.00 0.00 ? 25 GLU A C    2  
ATOM 1394  O O    . GLU A 1 25 ? 4.561   4.500   4.331   1.00 0.00 ? 25 GLU A O    2  
ATOM 1395  C CB   . GLU A 1 25 ? 5.557   7.312   3.847   1.00 0.00 ? 25 GLU A CB   2  
ATOM 1396  C CG   . GLU A 1 25 ? 7.071   7.253   3.730   1.00 0.00 ? 25 GLU A CG   2  
ATOM 1397  C CD   . GLU A 1 25 ? 7.772   7.894   4.912   1.00 0.00 ? 25 GLU A CD   2  
ATOM 1398  O OE1  . GLU A 1 25 ? 7.799   9.140   4.980   1.00 0.00 ? 25 GLU A OE1  2  
ATOM 1399  O OE2  . GLU A 1 25 ? 8.295   7.149   5.767   1.00 0.00 ? 25 GLU A OE2  2  
ATOM 1400  H H    . GLU A 1 25 ? 2.991   7.146   3.592   1.00 0.00 ? 25 GLU A H    2  
ATOM 1401  H HA   . GLU A 1 25 ? 5.240   6.531   1.880   1.00 0.00 ? 25 GLU A HA   2  
ATOM 1402  H HB2  . GLU A 1 25 ? 5.242   8.329   3.664   1.00 0.00 ? 25 GLU A HB2  2  
ATOM 1403  H HB3  . GLU A 1 25 ? 5.284   7.036   4.854   1.00 0.00 ? 25 GLU A HB3  2  
ATOM 1404  H HG2  . GLU A 1 25 ? 7.374   6.218   3.669   1.00 0.00 ? 25 GLU A HG2  2  
ATOM 1405  H HG3  . GLU A 1 25 ? 7.370   7.768   2.829   1.00 0.00 ? 25 GLU A HG3  2  
ATOM 1406  N N    . LEU A 1 26 ? 5.743   4.182   2.442   1.00 0.00 ? 26 LEU A N    2  
ATOM 1407  C CA   . LEU A 1 26 ? 6.011   2.774   2.717   1.00 0.00 ? 26 LEU A CA   2  
ATOM 1408  C C    . LEU A 1 26 ? 7.483   2.556   3.052   1.00 0.00 ? 26 LEU A C    2  
ATOM 1409  O O    . LEU A 1 26 ? 8.353   3.286   2.577   1.00 0.00 ? 26 LEU A O    2  
ATOM 1410  C CB   . LEU A 1 26 ? 5.616   1.915   1.514   1.00 0.00 ? 26 LEU A CB   2  
ATOM 1411  C CG   . LEU A 1 26 ? 4.150   1.990   1.088   1.00 0.00 ? 26 LEU A CG   2  
ATOM 1412  C CD1  . LEU A 1 26 ? 3.951   1.318   -0.262  1.00 0.00 ? 26 LEU A CD1  2  
ATOM 1413  C CD2  . LEU A 1 26 ? 3.256   1.350   2.141   1.00 0.00 ? 26 LEU A CD2  2  
ATOM 1414  H H    . LEU A 1 26 ? 6.094   4.582   1.620   1.00 0.00 ? 26 LEU A H    2  
ATOM 1415  H HA   . LEU A 1 26 ? 5.413   2.483   3.568   1.00 0.00 ? 26 LEU A HA   2  
ATOM 1416  H HB2  . LEU A 1 26 ? 6.220   2.225   0.675   1.00 0.00 ? 26 LEU A HB2  2  
ATOM 1417  H HB3  . LEU A 1 26 ? 5.840   0.886   1.756   1.00 0.00 ? 26 LEU A HB3  2  
ATOM 1418  H HG   . LEU A 1 26 ? 3.862   3.028   0.990   1.00 0.00 ? 26 LEU A HG   2  
ATOM 1419  H HD11 . LEU A 1 26 ? 3.693   2.063   -0.999  1.00 0.00 ? 26 LEU A HD11 2  
ATOM 1420  H HD12 . LEU A 1 26 ? 3.155   0.592   -0.189  1.00 0.00 ? 26 LEU A HD12 2  
ATOM 1421  H HD13 . LEU A 1 26 ? 4.865   0.822   -0.555  1.00 0.00 ? 26 LEU A HD13 2  
ATOM 1422  H HD21 . LEU A 1 26 ? 3.821   0.615   2.694   1.00 0.00 ? 26 LEU A HD21 2  
ATOM 1423  H HD22 . LEU A 1 26 ? 2.418   0.869   1.657   1.00 0.00 ? 26 LEU A HD22 2  
ATOM 1424  H HD23 . LEU A 1 26 ? 2.894   2.111   2.817   1.00 0.00 ? 26 LEU A HD23 2  
ATOM 1425  N N    . ARG A 1 27 ? 7.754   1.544   3.870   1.00 0.00 ? 27 ARG A N    2  
ATOM 1426  C CA   . ARG A 1 27 ? 9.121   1.228   4.267   1.00 0.00 ? 27 ARG A CA   2  
ATOM 1427  C C    . ARG A 1 27 ? 9.423   -0.251  4.046   1.00 0.00 ? 27 ARG A C    2  
ATOM 1428  O O    . ARG A 1 27 ? 8.608   -1.115  4.368   1.00 0.00 ? 27 ARG A O    2  
ATOM 1429  C CB   . ARG A 1 27 ? 9.345   1.592   5.736   1.00 0.00 ? 27 ARG A CB   2  
ATOM 1430  C CG   . ARG A 1 27 ? 10.776  1.384   6.203   1.00 0.00 ? 27 ARG A CG   2  
ATOM 1431  C CD   . ARG A 1 27 ? 10.901  1.556   7.709   1.00 0.00 ? 27 ARG A CD   2  
ATOM 1432  N NE   . ARG A 1 27 ? 12.295  1.610   8.140   1.00 0.00 ? 27 ARG A NE   2  
ATOM 1433  C CZ   . ARG A 1 27 ? 12.669  1.651   9.414   1.00 0.00 ? 27 ARG A CZ   2  
ATOM 1434  N NH1  . ARG A 1 27 ? 11.757  1.643   10.377  1.00 0.00 ? 27 ARG A NH1  2  
ATOM 1435  N NH2  . ARG A 1 27 ? 13.958  1.699   9.727   1.00 0.00 ? 27 ARG A NH2  2  
ATOM 1436  H H    . ARG A 1 27 ? 7.018   0.997   4.215   1.00 0.00 ? 27 ARG A H    2  
ATOM 1437  H HA   . ARG A 1 27 ? 9.789   1.815   3.654   1.00 0.00 ? 27 ARG A HA   2  
ATOM 1438  H HB2  . ARG A 1 27 ? 9.090   2.632   5.880   1.00 0.00 ? 27 ARG A HB2  2  
ATOM 1439  H HB3  . ARG A 1 27 ? 8.697   0.983   6.348   1.00 0.00 ? 27 ARG A HB3  2  
ATOM 1440  H HG2  . ARG A 1 27 ? 11.090  0.385   5.940   1.00 0.00 ? 27 ARG A HG2  2  
ATOM 1441  H HG3  . ARG A 1 27 ? 11.413  2.105   5.713   1.00 0.00 ? 27 ARG A HG3  2  
ATOM 1442  H HD2  . ARG A 1 27 ? 10.410  2.475   7.995   1.00 0.00 ? 27 ARG A HD2  2  
ATOM 1443  H HD3  . ARG A 1 27 ? 10.415  0.723   8.195   1.00 0.00 ? 27 ARG A HD3  2  
ATOM 1444  H HE   . ARG A 1 27 ? 12.985  1.617   7.445   1.00 0.00 ? 27 ARG A HE   2  
ATOM 1445  H HH11 . ARG A 1 27 ? 10.786  1.606   10.144  1.00 0.00 ? 27 ARG A HH11 2  
ATOM 1446  H HH12 . ARG A 1 27 ? 12.042  1.673   11.336  1.00 0.00 ? 27 ARG A HH12 2  
ATOM 1447  H HH21 . ARG A 1 27 ? 14.648  1.704   9.004   1.00 0.00 ? 27 ARG A HH21 2  
ATOM 1448  H HH22 . ARG A 1 27 ? 14.238  1.729   10.686  1.00 0.00 ? 27 ARG A HH22 2  
ATOM 1449  N N    . GLU A 1 28 ? 10.600  -0.534  3.495   1.00 0.00 ? 28 GLU A N    2  
ATOM 1450  C CA   . GLU A 1 28 ? 11.008  -1.908  3.231   1.00 0.00 ? 28 GLU A CA   2  
ATOM 1451  C C    . GLU A 1 28 ? 10.849  -2.773  4.478   1.00 0.00 ? 28 GLU A C    2  
ATOM 1452  O O    . GLU A 1 28 ? 11.501  -2.541  5.495   1.00 0.00 ? 28 GLU A O    2  
ATOM 1453  C CB   . GLU A 1 28 ? 12.460  -1.949  2.751   1.00 0.00 ? 28 GLU A CB   2  
ATOM 1454  C CG   . GLU A 1 28 ? 12.850  -3.266  2.101   1.00 0.00 ? 28 GLU A CG   2  
ATOM 1455  C CD   . GLU A 1 28 ? 14.352  -3.468  2.047   1.00 0.00 ? 28 GLU A CD   2  
ATOM 1456  O OE1  . GLU A 1 28 ? 14.997  -2.879  1.154   1.00 0.00 ? 28 GLU A OE1  2  
ATOM 1457  O OE2  . GLU A 1 28 ? 14.882  -4.215  2.895   1.00 0.00 ? 28 GLU A OE2  2  
ATOM 1458  H H    . GLU A 1 28 ? 11.207  0.199   3.261   1.00 0.00 ? 28 GLU A H    2  
ATOM 1459  H HA   . GLU A 1 28 ? 10.371  -2.300  2.453   1.00 0.00 ? 28 GLU A HA   2  
ATOM 1460  H HB2  . GLU A 1 28 ? 12.612  -1.157  2.032   1.00 0.00 ? 28 GLU A HB2  2  
ATOM 1461  H HB3  . GLU A 1 28 ? 13.111  -1.784  3.597   1.00 0.00 ? 28 GLU A HB3  2  
ATOM 1462  H HG2  . GLU A 1 28 ? 12.414  -4.075  2.667   1.00 0.00 ? 28 GLU A HG2  2  
ATOM 1463  H HG3  . GLU A 1 28 ? 12.462  -3.284  1.093   1.00 0.00 ? 28 GLU A HG3  2  
ATOM 1464  N N    . GLY A 1 29 ? 9.975   -3.771  4.392   1.00 0.00 ? 29 GLY A N    2  
ATOM 1465  C CA   . GLY A 1 29 ? 9.744   -4.655  5.520   1.00 0.00 ? 29 GLY A CA   2  
ATOM 1466  C C    . GLY A 1 29 ? 8.704   -4.111  6.480   1.00 0.00 ? 29 GLY A C    2  
ATOM 1467  O O    . GLY A 1 29 ? 8.887   -4.161  7.696   1.00 0.00 ? 29 GLY A O    2  
ATOM 1468  H H    . GLY A 1 29 ? 9.482   -3.908  3.556   1.00 0.00 ? 29 GLY A H    2  
ATOM 1469  H HA2  . GLY A 1 29 ? 9.411   -5.613  5.150   1.00 0.00 ? 29 GLY A HA2  2  
ATOM 1470  H HA3  . GLY A 1 29 ? 10.674  -4.789  6.053   1.00 0.00 ? 29 GLY A HA3  2  
ATOM 1471  N N    . ASP A 1 30 ? 7.613   -3.588  5.933   1.00 0.00 ? 30 ASP A N    2  
ATOM 1472  C CA   . ASP A 1 30 ? 6.540   -3.031  6.749   1.00 0.00 ? 30 ASP A CA   2  
ATOM 1473  C C    . ASP A 1 30 ? 5.180   -3.535  6.277   1.00 0.00 ? 30 ASP A C    2  
ATOM 1474  O O    . ASP A 1 30 ? 4.949   -3.698  5.078   1.00 0.00 ? 30 ASP A O    2  
ATOM 1475  C CB   . ASP A 1 30 ? 6.575   -1.503  6.702   1.00 0.00 ? 30 ASP A CB   2  
ATOM 1476  C CG   . ASP A 1 30 ? 7.553   -0.915  7.701   1.00 0.00 ? 30 ASP A CG   2  
ATOM 1477  O OD1  . ASP A 1 30 ? 8.489   -1.635  8.109   1.00 0.00 ? 30 ASP A OD1  2  
ATOM 1478  O OD2  . ASP A 1 30 ? 7.383   0.264   8.074   1.00 0.00 ? 30 ASP A OD2  2  
ATOM 1479  H H    . ASP A 1 30 ? 7.526   -3.577  4.956   1.00 0.00 ? 30 ASP A H    2  
ATOM 1480  H HA   . ASP A 1 30 ? 6.696   -3.354  7.767   1.00 0.00 ? 30 ASP A HA   2  
ATOM 1481  H HB2  . ASP A 1 30 ? 6.868   -1.186  5.711   1.00 0.00 ? 30 ASP A HB2  2  
ATOM 1482  H HB3  . ASP A 1 30 ? 5.590   -1.119  6.921   1.00 0.00 ? 30 ASP A HB3  2  
ATOM 1483  N N    . ARG A 1 31 ? 4.284   -3.782  7.226   1.00 0.00 ? 31 ARG A N    2  
ATOM 1484  C CA   . ARG A 1 31 ? 2.947   -4.270  6.908   1.00 0.00 ? 31 ARG A CA   2  
ATOM 1485  C C    . ARG A 1 31 ? 2.047   -3.128  6.445   1.00 0.00 ? 31 ARG A C    2  
ATOM 1486  O O    . ARG A 1 31 ? 2.194   -1.989  6.888   1.00 0.00 ? 31 ARG A O    2  
ATOM 1487  C CB   . ARG A 1 31 ? 2.329   -4.960  8.125   1.00 0.00 ? 31 ARG A CB   2  
ATOM 1488  C CG   . ARG A 1 31 ? 2.887   -6.349  8.387   1.00 0.00 ? 31 ARG A CG   2  
ATOM 1489  C CD   . ARG A 1 31 ? 2.395   -7.351  7.354   1.00 0.00 ? 31 ARG A CD   2  
ATOM 1490  N NE   . ARG A 1 31 ? 2.660   -8.729  7.758   1.00 0.00 ? 31 ARG A NE   2  
ATOM 1491  C CZ   . ARG A 1 31 ? 3.848   -9.313  7.645   1.00 0.00 ? 31 ARG A CZ   2  
ATOM 1492  N NH1  . ARG A 1 31 ? 4.875   -8.642  7.144   1.00 0.00 ? 31 ARG A NH1  2  
ATOM 1493  N NH2  . ARG A 1 31 ? 4.009   -10.571 8.036   1.00 0.00 ? 31 ARG A NH2  2  
ATOM 1494  H H    . ARG A 1 31 ? 4.527   -3.633  8.164   1.00 0.00 ? 31 ARG A H    2  
ATOM 1495  H HA   . ARG A 1 31 ? 3.039   -4.988  6.106   1.00 0.00 ? 31 ARG A HA   2  
ATOM 1496  H HB2  . ARG A 1 31 ? 2.511   -4.352  9.000   1.00 0.00 ? 31 ARG A HB2  2  
ATOM 1497  H HB3  . ARG A 1 31 ? 1.264   -5.046  7.972   1.00 0.00 ? 31 ARG A HB3  2  
ATOM 1498  H HG2  . ARG A 1 31 ? 3.966   -6.307  8.347   1.00 0.00 ? 31 ARG A HG2  2  
ATOM 1499  H HG3  . ARG A 1 31 ? 2.574   -6.674  9.368   1.00 0.00 ? 31 ARG A HG3  2  
ATOM 1500  H HD2  . ARG A 1 31 ? 1.331   -7.221  7.224   1.00 0.00 ? 31 ARG A HD2  2  
ATOM 1501  H HD3  . ARG A 1 31 ? 2.898   -7.157  6.417   1.00 0.00 ? 31 ARG A HD3  2  
ATOM 1502  H HE   . ARG A 1 31 ? 1.914   -9.243  8.131   1.00 0.00 ? 31 ARG A HE   2  
ATOM 1503  H HH11 . ARG A 1 31 ? 4.756   -7.694  6.850   1.00 0.00 ? 31 ARG A HH11 2  
ATOM 1504  H HH12 . ARG A 1 31 ? 5.769   -9.084  7.061   1.00 0.00 ? 31 ARG A HH12 2  
ATOM 1505  H HH21 . ARG A 1 31 ? 3.237   -11.080 8.415   1.00 0.00 ? 31 ARG A HH21 2  
ATOM 1506  H HH22 . ARG A 1 31 ? 4.903   -11.009 7.950   1.00 0.00 ? 31 ARG A HH22 2  
ATOM 1507  N N    . VAL A 1 32 ? 1.116   -3.441  5.550   1.00 0.00 ? 32 VAL A N    2  
ATOM 1508  C CA   . VAL A 1 32 ? 0.191   -2.442  5.027   1.00 0.00 ? 32 VAL A CA   2  
ATOM 1509  C C    . VAL A 1 32 ? -1.231  -2.987  4.968   1.00 0.00 ? 32 VAL A C    2  
ATOM 1510  O O    . VAL A 1 32 ? -1.453  -4.131  4.570   1.00 0.00 ? 32 VAL A O    2  
ATOM 1511  C CB   . VAL A 1 32 ? 0.609   -1.973  3.620   1.00 0.00 ? 32 VAL A CB   2  
ATOM 1512  C CG1  . VAL A 1 32 ? -0.194  -0.749  3.206   1.00 0.00 ? 32 VAL A CG1  2  
ATOM 1513  C CG2  . VAL A 1 32 ? 2.101   -1.682  3.577   1.00 0.00 ? 32 VAL A CG2  2  
ATOM 1514  H H    . VAL A 1 32 ? 1.048   -4.366  5.234   1.00 0.00 ? 32 VAL A H    2  
ATOM 1515  H HA   . VAL A 1 32 ? 0.213   -1.589  5.689   1.00 0.00 ? 32 VAL A HA   2  
ATOM 1516  H HB   . VAL A 1 32 ? 0.398   -2.768  2.921   1.00 0.00 ? 32 VAL A HB   2  
ATOM 1517  H HG11 . VAL A 1 32 ? -1.242  -0.922  3.404   1.00 0.00 ? 32 VAL A HG11 2  
ATOM 1518  H HG12 . VAL A 1 32 ? 0.143   0.110   3.767   1.00 0.00 ? 32 VAL A HG12 2  
ATOM 1519  H HG13 . VAL A 1 32 ? -0.053  -0.568  2.150   1.00 0.00 ? 32 VAL A HG13 2  
ATOM 1520  H HG21 . VAL A 1 32 ? 2.271   -0.641  3.809   1.00 0.00 ? 32 VAL A HG21 2  
ATOM 1521  H HG22 . VAL A 1 32 ? 2.610   -2.299  4.303   1.00 0.00 ? 32 VAL A HG22 2  
ATOM 1522  H HG23 . VAL A 1 32 ? 2.482   -1.899  2.591   1.00 0.00 ? 32 VAL A HG23 2  
ATOM 1523  N N    . ASP A 1 33 ? -2.192  -2.161  5.366   1.00 0.00 ? 33 ASP A N    2  
ATOM 1524  C CA   . ASP A 1 33 ? -3.595  -2.559  5.357   1.00 0.00 ? 33 ASP A CA   2  
ATOM 1525  C C    . ASP A 1 33 ? -4.292  -2.065  4.093   1.00 0.00 ? 33 ASP A C    2  
ATOM 1526  O O    . ASP A 1 33 ? -4.666  -0.896  3.993   1.00 0.00 ? 33 ASP A O    2  
ATOM 1527  C CB   . ASP A 1 33 ? -4.310  -2.014  6.594   1.00 0.00 ? 33 ASP A CB   2  
ATOM 1528  C CG   . ASP A 1 33 ? -5.463  -2.895  7.032   1.00 0.00 ? 33 ASP A CG   2  
ATOM 1529  O OD1  . ASP A 1 33 ? -5.314  -4.135  6.983   1.00 0.00 ? 33 ASP A OD1  2  
ATOM 1530  O OD2  . ASP A 1 33 ? -6.513  -2.346  7.425   1.00 0.00 ? 33 ASP A OD2  2  
ATOM 1531  H H    . ASP A 1 33 ? -1.952  -1.261  5.672   1.00 0.00 ? 33 ASP A H    2  
ATOM 1532  H HA   . ASP A 1 33 ? -3.634  -3.637  5.376   1.00 0.00 ? 33 ASP A HA   2  
ATOM 1533  H HB2  . ASP A 1 33 ? -3.604  -1.945  7.409   1.00 0.00 ? 33 ASP A HB2  2  
ATOM 1534  H HB3  . ASP A 1 33 ? -4.696  -1.029  6.374   1.00 0.00 ? 33 ASP A HB3  2  
ATOM 1535  N N    . VAL A 1 34 ? -4.462  -2.964  3.128   1.00 0.00 ? 34 VAL A N    2  
ATOM 1536  C CA   . VAL A 1 34 ? -5.114  -2.620  1.870   1.00 0.00 ? 34 VAL A CA   2  
ATOM 1537  C C    . VAL A 1 34 ? -6.605  -2.937  1.918   1.00 0.00 ? 34 VAL A C    2  
ATOM 1538  O O    . VAL A 1 34 ? -6.999  -4.099  2.013   1.00 0.00 ? 34 VAL A O    2  
ATOM 1539  C CB   . VAL A 1 34 ? -4.479  -3.371  0.685   1.00 0.00 ? 34 VAL A CB   2  
ATOM 1540  C CG1  . VAL A 1 34 ? -5.404  -3.345  -0.522  1.00 0.00 ? 34 VAL A CG1  2  
ATOM 1541  C CG2  . VAL A 1 34 ? -3.123  -2.773  0.340   1.00 0.00 ? 34 VAL A CG2  2  
ATOM 1542  H H    . VAL A 1 34 ? -4.143  -3.880  3.266   1.00 0.00 ? 34 VAL A H    2  
ATOM 1543  H HA   . VAL A 1 34 ? -4.987  -1.560  1.706   1.00 0.00 ? 34 VAL A HA   2  
ATOM 1544  H HB   . VAL A 1 34 ? -4.331  -4.401  0.975   1.00 0.00 ? 34 VAL A HB   2  
ATOM 1545  H HG11 . VAL A 1 34 ? -4.842  -3.592  -1.411  1.00 0.00 ? 34 VAL A HG11 2  
ATOM 1546  H HG12 . VAL A 1 34 ? -6.197  -4.066  -0.384  1.00 0.00 ? 34 VAL A HG12 2  
ATOM 1547  H HG13 . VAL A 1 34 ? -5.829  -2.358  -0.629  1.00 0.00 ? 34 VAL A HG13 2  
ATOM 1548  H HG21 . VAL A 1 34 ? -3.045  -1.787  0.775   1.00 0.00 ? 34 VAL A HG21 2  
ATOM 1549  H HG22 . VAL A 1 34 ? -2.340  -3.403  0.736   1.00 0.00 ? 34 VAL A HG22 2  
ATOM 1550  H HG23 . VAL A 1 34 ? -3.022  -2.703  -0.732  1.00 0.00 ? 34 VAL A HG23 2  
ATOM 1551  N N    . MET A 1 35 ? -7.428  -1.897  1.852   1.00 0.00 ? 35 MET A N    2  
ATOM 1552  C CA   . MET A 1 35 ? -8.876  -2.065  1.887   1.00 0.00 ? 35 MET A CA   2  
ATOM 1553  C C    . MET A 1 35 ? -9.454  -2.094  0.475   1.00 0.00 ? 35 MET A C    2  
ATOM 1554  O O    . MET A 1 35 ? -10.236 -2.981  0.134   1.00 0.00 ? 35 MET A O    2  
ATOM 1555  C CB   . MET A 1 35 ? -9.523  -0.937  2.692   1.00 0.00 ? 35 MET A CB   2  
ATOM 1556  C CG   . MET A 1 35 ? -9.248  -1.020  4.185   1.00 0.00 ? 35 MET A CG   2  
ATOM 1557  S SD   . MET A 1 35 ? -9.983  0.346   5.104   1.00 0.00 ? 35 MET A SD   2  
ATOM 1558  C CE   . MET A 1 35 ? -8.552  0.972   5.981   1.00 0.00 ? 35 MET A CE   2  
ATOM 1559  H H    . MET A 1 35 ? -7.054  -0.994  1.777   1.00 0.00 ? 35 MET A H    2  
ATOM 1560  H HA   . MET A 1 35 ? -9.089  -3.007  2.369   1.00 0.00 ? 35 MET A HA   2  
ATOM 1561  H HB2  . MET A 1 35 ? -9.148  0.009   2.330   1.00 0.00 ? 35 MET A HB2  2  
ATOM 1562  H HB3  . MET A 1 35 ? -10.592 -0.971  2.543   1.00 0.00 ? 35 MET A HB3  2  
ATOM 1563  H HG2  . MET A 1 35 ? -9.653  -1.947  4.561   1.00 0.00 ? 35 MET A HG2  2  
ATOM 1564  H HG3  . MET A 1 35 ? -8.179  -1.007  4.340   1.00 0.00 ? 35 MET A HG3  2  
ATOM 1565  H HE1  . MET A 1 35 ? -7.675  0.417   5.683   1.00 0.00 ? 35 MET A HE1  2  
ATOM 1566  H HE2  . MET A 1 35 ? -8.414  2.017   5.746   1.00 0.00 ? 35 MET A HE2  2  
ATOM 1567  H HE3  . MET A 1 35 ? -8.705  0.859   7.045   1.00 0.00 ? 35 MET A HE3  2  
ATOM 1568  N N    . GLN A 1 36 ? -9.064  -1.119  -0.339  1.00 0.00 ? 36 GLN A N    2  
ATOM 1569  C CA   . GLN A 1 36 ? -9.545  -1.034  -1.713  1.00 0.00 ? 36 GLN A CA   2  
ATOM 1570  C C    . GLN A 1 36 ? -8.395  -1.188  -2.703  1.00 0.00 ? 36 GLN A C    2  
ATOM 1571  O O    . GLN A 1 36 ? -7.233  -0.983  -2.355  1.00 0.00 ? 36 GLN A O    2  
ATOM 1572  C CB   . GLN A 1 36 ? -10.257 0.300   -1.945  1.00 0.00 ? 36 GLN A CB   2  
ATOM 1573  C CG   . GLN A 1 36 ? -11.360 0.228   -2.989  1.00 0.00 ? 36 GLN A CG   2  
ATOM 1574  C CD   . GLN A 1 36 ? -12.708 -0.120  -2.390  1.00 0.00 ? 36 GLN A CD   2  
ATOM 1575  O OE1  . GLN A 1 36 ? -12.881 -1.184  -1.795  1.00 0.00 ? 36 GLN A OE1  2  
ATOM 1576  N NE2  . GLN A 1 36 ? -13.675 0.778   -2.545  1.00 0.00 ? 36 GLN A NE2  2  
ATOM 1577  H H    . GLN A 1 36 ? -8.440  -0.441  -0.009  1.00 0.00 ? 36 GLN A H    2  
ATOM 1578  H HA   . GLN A 1 36 ? -10.248 -1.838  -1.869  1.00 0.00 ? 36 GLN A HA   2  
ATOM 1579  H HB2  . GLN A 1 36 ? -10.694 0.628   -1.013  1.00 0.00 ? 36 GLN A HB2  2  
ATOM 1580  H HB3  . GLN A 1 36 ? -9.531  1.031   -2.270  1.00 0.00 ? 36 GLN A HB3  2  
ATOM 1581  H HG2  . GLN A 1 36 ? -11.438 1.188   -3.478  1.00 0.00 ? 36 GLN A HG2  2  
ATOM 1582  H HG3  . GLN A 1 36 ? -11.100 -0.526  -3.717  1.00 0.00 ? 36 GLN A HG3  2  
ATOM 1583  H HE21 . GLN A 1 36 ? -13.465 1.603   -3.031  1.00 0.00 ? 36 GLN A HE21 2  
ATOM 1584  H HE22 . GLN A 1 36 ? -14.556 0.579   -2.168  1.00 0.00 ? 36 GLN A HE22 2  
ATOM 1585  N N    . GLN A 1 37 ? -8.729  -1.552  -3.937  1.00 0.00 ? 37 GLN A N    2  
ATOM 1586  C CA   . GLN A 1 37 ? -7.723  -1.735  -4.977  1.00 0.00 ? 37 GLN A CA   2  
ATOM 1587  C C    . GLN A 1 37 ? -8.051  -0.894  -6.206  1.00 0.00 ? 37 GLN A C    2  
ATOM 1588  O O    . GLN A 1 37 ? -9.216  -0.607  -6.481  1.00 0.00 ? 37 GLN A O    2  
ATOM 1589  C CB   . GLN A 1 37 ? -7.624  -3.211  -5.366  1.00 0.00 ? 37 GLN A CB   2  
ATOM 1590  C CG   . GLN A 1 37 ? -7.688  -4.159  -4.179  1.00 0.00 ? 37 GLN A CG   2  
ATOM 1591  C CD   . GLN A 1 37 ? -7.201  -5.554  -4.519  1.00 0.00 ? 37 GLN A CD   2  
ATOM 1592  O OE1  . GLN A 1 37 ? -6.421  -5.741  -5.453  1.00 0.00 ? 37 GLN A OE1  2  
ATOM 1593  N NE2  . GLN A 1 37 ? -7.659  -6.542  -3.761  1.00 0.00 ? 37 GLN A NE2  2  
ATOM 1594  H H    . GLN A 1 37 ? -9.672  -1.701  -4.153  1.00 0.00 ? 37 GLN A H    2  
ATOM 1595  H HA   . GLN A 1 37 ? -6.772  -1.413  -4.579  1.00 0.00 ? 37 GLN A HA   2  
ATOM 1596  H HB2  . GLN A 1 37 ? -8.437  -3.450  -6.035  1.00 0.00 ? 37 GLN A HB2  2  
ATOM 1597  H HB3  . GLN A 1 37 ? -6.687  -3.374  -5.879  1.00 0.00 ? 37 GLN A HB3  2  
ATOM 1598  H HG2  . GLN A 1 37 ? -7.072  -3.763  -3.385  1.00 0.00 ? 37 GLN A HG2  2  
ATOM 1599  H HG3  . GLN A 1 37 ? -8.712  -4.223  -3.841  1.00 0.00 ? 37 GLN A HG3  2  
ATOM 1600  H HE21 . GLN A 1 37 ? -8.279  -6.319  -3.034  1.00 0.00 ? 37 GLN A HE21 2  
ATOM 1601  H HE22 . GLN A 1 37 ? -7.362  -7.454  -3.958  1.00 0.00 ? 37 GLN A HE22 2  
ATOM 1602  N N    . CYS A 1 38 ? -7.016  -0.502  -6.941  1.00 0.00 ? 38 CYS A N    2  
ATOM 1603  C CA   . CYS A 1 38 ? -7.194  0.308   -8.141  1.00 0.00 ? 38 CYS A CA   2  
ATOM 1604  C C    . CYS A 1 38 ? -7.085  -0.549  -9.397  1.00 0.00 ? 38 CYS A C    2  
ATOM 1605  O O    . CYS A 1 38 ? -6.586  -1.674  -9.352  1.00 0.00 ? 38 CYS A O    2  
ATOM 1606  C CB   . CYS A 1 38 ? -6.156  1.430   -8.183  1.00 0.00 ? 38 CYS A CB   2  
ATOM 1607  S SG   . CYS A 1 38 ? -6.317  2.636   -6.845  1.00 0.00 ? 38 CYS A SG   2  
ATOM 1608  H H    . CYS A 1 38 ? -6.111  -0.762  -6.671  1.00 0.00 ? 38 CYS A H    2  
ATOM 1609  H HA   . CYS A 1 38 ? -8.181  0.744   -8.102  1.00 0.00 ? 38 CYS A HA   2  
ATOM 1610  H HB2  . CYS A 1 38 ? -5.168  0.999   -8.118  1.00 0.00 ? 38 CYS A HB2  2  
ATOM 1611  H HB3  . CYS A 1 38 ? -6.248  1.961   -9.119  1.00 0.00 ? 38 CYS A HB3  2  
ATOM 1612  H HG   . CYS A 1 38 ? -5.868  3.800   -7.288  1.00 0.00 ? 38 CYS A HG   2  
ATOM 1613  N N    . ASP A 1 39 ? -7.557  -0.012  -10.517 1.00 0.00 ? 39 ASP A N    2  
ATOM 1614  C CA   . ASP A 1 39 ? -7.513  -0.728  -11.786 1.00 0.00 ? 39 ASP A CA   2  
ATOM 1615  C C    . ASP A 1 39 ? -6.266  -0.352  -12.580 1.00 0.00 ? 39 ASP A C    2  
ATOM 1616  O O    . ASP A 1 39 ? -5.913  -1.017  -13.554 1.00 0.00 ? 39 ASP A O    2  
ATOM 1617  C CB   . ASP A 1 39 ? -8.766  -0.428  -12.610 1.00 0.00 ? 39 ASP A CB   2  
ATOM 1618  C CG   . ASP A 1 39 ? -9.981  -1.185  -12.111 1.00 0.00 ? 39 ASP A CG   2  
ATOM 1619  O OD1  . ASP A 1 39 ? -10.028 -2.420  -12.295 1.00 0.00 ? 39 ASP A OD1  2  
ATOM 1620  O OD2  . ASP A 1 39 ? -10.885 -0.543  -11.536 1.00 0.00 ? 39 ASP A OD2  2  
ATOM 1621  H H    . ASP A 1 39 ? -7.943  0.889   -10.489 1.00 0.00 ? 39 ASP A H    2  
ATOM 1622  H HA   . ASP A 1 39 ? -7.480  -1.785  -11.570 1.00 0.00 ? 39 ASP A HA   2  
ATOM 1623  H HB2  . ASP A 1 39 ? -8.979  0.630   -12.557 1.00 0.00 ? 39 ASP A HB2  2  
ATOM 1624  H HB3  . ASP A 1 39 ? -8.589  -0.705  -13.638 1.00 0.00 ? 39 ASP A HB3  2  
ATOM 1625  N N    . ASP A 1 40 ? -5.603  0.719   -12.158 1.00 0.00 ? 40 ASP A N    2  
ATOM 1626  C CA   . ASP A 1 40 ? -4.395  1.185   -12.829 1.00 0.00 ? 40 ASP A CA   2  
ATOM 1627  C C    . ASP A 1 40 ? -3.150  0.577   -12.190 1.00 0.00 ? 40 ASP A C    2  
ATOM 1628  O O    . ASP A 1 40 ? -2.032  1.029   -12.433 1.00 0.00 ? 40 ASP A O    2  
ATOM 1629  C CB   . ASP A 1 40 ? -4.315  2.712   -12.780 1.00 0.00 ? 40 ASP A CB   2  
ATOM 1630  C CG   . ASP A 1 40 ? -4.970  3.286   -11.540 1.00 0.00 ? 40 ASP A CG   2  
ATOM 1631  O OD1  . ASP A 1 40 ? -6.210  3.439   -11.540 1.00 0.00 ? 40 ASP A OD1  2  
ATOM 1632  O OD2  . ASP A 1 40 ? -4.244  3.583   -10.568 1.00 0.00 ? 40 ASP A OD2  2  
ATOM 1633  H H    . ASP A 1 40 ? -5.934  1.208   -11.375 1.00 0.00 ? 40 ASP A H    2  
ATOM 1634  H HA   . ASP A 1 40 ? -4.446  0.869   -13.860 1.00 0.00 ? 40 ASP A HA   2  
ATOM 1635  H HB2  . ASP A 1 40 ? -3.277  3.012   -12.788 1.00 0.00 ? 40 ASP A HB2  2  
ATOM 1636  H HB3  . ASP A 1 40 ? -4.810  3.119   -13.649 1.00 0.00 ? 40 ASP A HB3  2  
ATOM 1637  N N    . GLY A 1 41 ? -3.352  -0.450  -11.371 1.00 0.00 ? 41 GLY A N    2  
ATOM 1638  C CA   . GLY A 1 41 ? -2.237  -1.102  -10.709 1.00 0.00 ? 41 GLY A CA   2  
ATOM 1639  C C    . GLY A 1 41 ? -1.830  -0.398  -9.430  1.00 0.00 ? 41 GLY A C    2  
ATOM 1640  O O    . GLY A 1 41 ? -0.642  -0.271  -9.135  1.00 0.00 ? 41 GLY A O    2  
ATOM 1641  H H    . GLY A 1 41 ? -4.266  -0.768  -11.215 1.00 0.00 ? 41 GLY A H    2  
ATOM 1642  H HA2  . GLY A 1 41 ? -2.516  -2.119  -10.475 1.00 0.00 ? 41 GLY A HA2  2  
ATOM 1643  H HA3  . GLY A 1 41 ? -1.393  -1.117  -11.383 1.00 0.00 ? 41 GLY A HA3  2  
ATOM 1644  N N    . TRP A 1 42 ? -2.818  0.062   -8.670  1.00 0.00 ? 42 TRP A N    2  
ATOM 1645  C CA   . TRP A 1 42 ? -2.555  0.759   -7.416  1.00 0.00 ? 42 TRP A CA   2  
ATOM 1646  C C    . TRP A 1 42 ? -3.411  0.191   -6.289  1.00 0.00 ? 42 TRP A C    2  
ATOM 1647  O O    . TRP A 1 42 ? -4.323  -0.600  -6.527  1.00 0.00 ? 42 TRP A O    2  
ATOM 1648  C CB   . TRP A 1 42 ? -2.827  2.256   -7.575  1.00 0.00 ? 42 TRP A CB   2  
ATOM 1649  C CG   . TRP A 1 42 ? -1.676  3.009   -8.171  1.00 0.00 ? 42 TRP A CG   2  
ATOM 1650  C CD1  . TRP A 1 42 ? -1.159  2.856   -9.425  1.00 0.00 ? 42 TRP A CD1  2  
ATOM 1651  C CD2  . TRP A 1 42 ? -0.898  4.029   -7.535  1.00 0.00 ? 42 TRP A CD2  2  
ATOM 1652  N NE1  . TRP A 1 42 ? -0.106  3.721   -9.608  1.00 0.00 ? 42 TRP A NE1  2  
ATOM 1653  C CE2  . TRP A 1 42 ? 0.073   4.452   -8.464  1.00 0.00 ? 42 TRP A CE2  2  
ATOM 1654  C CE3  . TRP A 1 42 ? -0.929  4.629   -6.273  1.00 0.00 ? 42 TRP A CE3  2  
ATOM 1655  C CZ2  . TRP A 1 42 ? 1.003   5.445   -8.168  1.00 0.00 ? 42 TRP A CZ2  2  
ATOM 1656  C CZ3  . TRP A 1 42 ? -0.005  5.614   -5.981  1.00 0.00 ? 42 TRP A CZ3  2  
ATOM 1657  C CH2  . TRP A 1 42 ? 0.950   6.015   -6.925  1.00 0.00 ? 42 TRP A CH2  2  
ATOM 1658  H H    . TRP A 1 42 ? -3.745  -0.070  -8.959  1.00 0.00 ? 42 TRP A H    2  
ATOM 1659  H HA   . TRP A 1 42 ? -1.514  0.616   -7.170  1.00 0.00 ? 42 TRP A HA   2  
ATOM 1660  H HB2  . TRP A 1 42 ? -3.684  2.395   -8.217  1.00 0.00 ? 42 TRP A HB2  2  
ATOM 1661  H HB3  . TRP A 1 42 ? -3.037  2.681   -6.604  1.00 0.00 ? 42 TRP A HB3  2  
ATOM 1662  H HD1  . TRP A 1 42 ? -1.531  2.154   -10.155 1.00 0.00 ? 42 TRP A HD1  2  
ATOM 1663  H HE1  . TRP A 1 42 ? 0.427   3.802   -10.427 1.00 0.00 ? 42 TRP A HE1  2  
ATOM 1664  H HE3  . TRP A 1 42 ? -1.658  4.334   -5.533  1.00 0.00 ? 42 TRP A HE3  2  
ATOM 1665  H HZ2  . TRP A 1 42 ? 1.745   5.765   -8.885  1.00 0.00 ? 42 TRP A HZ2  2  
ATOM 1666  H HZ3  . TRP A 1 42 ? -0.013  6.088   -5.011  1.00 0.00 ? 42 TRP A HZ3  2  
ATOM 1667  H HH2  . TRP A 1 42 ? 1.652   6.788   -6.653  1.00 0.00 ? 42 TRP A HH2  2  
ATOM 1668  N N    . PHE A 1 43 ? -3.111  0.601   -5.061  1.00 0.00 ? 43 PHE A N    2  
ATOM 1669  C CA   . PHE A 1 43 ? -3.852  0.132   -3.896  1.00 0.00 ? 43 PHE A CA   2  
ATOM 1670  C C    . PHE A 1 43 ? -4.173  1.288   -2.954  1.00 0.00 ? 43 PHE A C    2  
ATOM 1671  O O    . PHE A 1 43 ? -3.396  2.234   -2.826  1.00 0.00 ? 43 PHE A O    2  
ATOM 1672  C CB   . PHE A 1 43 ? -3.051  -0.939  -3.153  1.00 0.00 ? 43 PHE A CB   2  
ATOM 1673  C CG   . PHE A 1 43 ? -2.907  -2.221  -3.922  1.00 0.00 ? 43 PHE A CG   2  
ATOM 1674  C CD1  . PHE A 1 43 ? -3.990  -2.772  -4.587  1.00 0.00 ? 43 PHE A CD1  2  
ATOM 1675  C CD2  . PHE A 1 43 ? -1.687  -2.877  -3.978  1.00 0.00 ? 43 PHE A CD2  2  
ATOM 1676  C CE1  . PHE A 1 43 ? -3.860  -3.951  -5.296  1.00 0.00 ? 43 PHE A CE1  2  
ATOM 1677  C CE2  . PHE A 1 43 ? -1.551  -4.056  -4.686  1.00 0.00 ? 43 PHE A CE2  2  
ATOM 1678  C CZ   . PHE A 1 43 ? -2.639  -4.595  -5.345  1.00 0.00 ? 43 PHE A CZ   2  
ATOM 1679  H H    . PHE A 1 43 ? -2.372  1.233   -4.935  1.00 0.00 ? 43 PHE A H    2  
ATOM 1680  H HA   . PHE A 1 43 ? -4.777  -0.300  -4.245  1.00 0.00 ? 43 PHE A HA   2  
ATOM 1681  H HB2  . PHE A 1 43 ? -2.061  -0.562  -2.949  1.00 0.00 ? 43 PHE A HB2  2  
ATOM 1682  H HB3  . PHE A 1 43 ? -3.545  -1.165  -2.219  1.00 0.00 ? 43 PHE A HB3  2  
ATOM 1683  H HD1  . PHE A 1 43 ? -4.946  -2.269  -4.550  1.00 0.00 ? 43 PHE A HD1  2  
ATOM 1684  H HD2  . PHE A 1 43 ? -0.835  -2.458  -3.463  1.00 0.00 ? 43 PHE A HD2  2  
ATOM 1685  H HE1  . PHE A 1 43 ? -4.713  -4.369  -5.810  1.00 0.00 ? 43 PHE A HE1  2  
ATOM 1686  H HE2  . PHE A 1 43 ? -0.595  -4.557  -4.722  1.00 0.00 ? 43 PHE A HE2  2  
ATOM 1687  H HZ   . PHE A 1 43 ? -2.535  -5.516  -5.899  1.00 0.00 ? 43 PHE A HZ   2  
ATOM 1688  N N    . VAL A 1 44 ? -5.326  1.205   -2.296  1.00 0.00 ? 44 VAL A N    2  
ATOM 1689  C CA   . VAL A 1 44 ? -5.751  2.243   -1.365  1.00 0.00 ? 44 VAL A CA   2  
ATOM 1690  C C    . VAL A 1 44 ? -6.055  1.658   0.009   1.00 0.00 ? 44 VAL A C    2  
ATOM 1691  O O    . VAL A 1 44 ? -6.967  0.845   0.162   1.00 0.00 ? 44 VAL A O    2  
ATOM 1692  C CB   . VAL A 1 44 ? -6.997  2.985   -1.883  1.00 0.00 ? 44 VAL A CB   2  
ATOM 1693  C CG1  . VAL A 1 44 ? -7.416  4.072   -0.905  1.00 0.00 ? 44 VAL A CG1  2  
ATOM 1694  C CG2  . VAL A 1 44 ? -6.734  3.570   -3.262  1.00 0.00 ? 44 VAL A CG2  2  
ATOM 1695  H H    . VAL A 1 44 ? -5.903  0.426   -2.440  1.00 0.00 ? 44 VAL A H    2  
ATOM 1696  H HA   . VAL A 1 44 ? -4.946  2.958   -1.271  1.00 0.00 ? 44 VAL A HA   2  
ATOM 1697  H HB   . VAL A 1 44 ? -7.806  2.274   -1.964  1.00 0.00 ? 44 VAL A HB   2  
ATOM 1698  H HG11 . VAL A 1 44 ? -6.597  4.289   -0.235  1.00 0.00 ? 44 VAL A HG11 2  
ATOM 1699  H HG12 . VAL A 1 44 ? -7.682  4.965   -1.451  1.00 0.00 ? 44 VAL A HG12 2  
ATOM 1700  H HG13 . VAL A 1 44 ? -8.267  3.733   -0.333  1.00 0.00 ? 44 VAL A HG13 2  
ATOM 1701  H HG21 . VAL A 1 44 ? -7.671  3.691   -3.785  1.00 0.00 ? 44 VAL A HG21 2  
ATOM 1702  H HG22 . VAL A 1 44 ? -6.251  4.531   -3.160  1.00 0.00 ? 44 VAL A HG22 2  
ATOM 1703  H HG23 . VAL A 1 44 ? -6.094  2.903   -3.820  1.00 0.00 ? 44 VAL A HG23 2  
ATOM 1704  N N    . GLY A 1 45 ? -5.286  2.077   1.009   1.00 0.00 ? 45 GLY A N    2  
ATOM 1705  C CA   . GLY A 1 45 ? -5.489  1.584   2.359   1.00 0.00 ? 45 GLY A CA   2  
ATOM 1706  C C    . GLY A 1 45 ? -4.773  2.425   3.397   1.00 0.00 ? 45 GLY A C    2  
ATOM 1707  O O    . GLY A 1 45 ? -4.649  3.640   3.246   1.00 0.00 ? 45 GLY A O    2  
ATOM 1708  H H    . GLY A 1 45 ? -4.574  2.726   0.829   1.00 0.00 ? 45 GLY A H    2  
ATOM 1709  H HA2  . GLY A 1 45 ? -6.547  1.587   2.576   1.00 0.00 ? 45 GLY A HA2  2  
ATOM 1710  H HA3  . GLY A 1 45 ? -5.123  0.570   2.419   1.00 0.00 ? 45 GLY A HA3  2  
ATOM 1711  N N    . VAL A 1 46 ? -4.299  1.776   4.457   1.00 0.00 ? 46 VAL A N    2  
ATOM 1712  C CA   . VAL A 1 46 ? -3.592  2.472   5.525   1.00 0.00 ? 46 VAL A CA   2  
ATOM 1713  C C    . VAL A 1 46 ? -2.254  1.805   5.823   1.00 0.00 ? 46 VAL A C    2  
ATOM 1714  O O    . VAL A 1 46 ? -2.057  0.626   5.529   1.00 0.00 ? 46 VAL A O    2  
ATOM 1715  C CB   . VAL A 1 46 ? -4.429  2.516   6.817   1.00 0.00 ? 46 VAL A CB   2  
ATOM 1716  C CG1  . VAL A 1 46 ? -3.644  3.176   7.940   1.00 0.00 ? 46 VAL A CG1  2  
ATOM 1717  C CG2  . VAL A 1 46 ? -5.743  3.243   6.575   1.00 0.00 ? 46 VAL A CG2  2  
ATOM 1718  H H    . VAL A 1 46 ? -4.429  0.807   4.522   1.00 0.00 ? 46 VAL A H    2  
ATOM 1719  H HA   . VAL A 1 46 ? -3.413  3.487   5.202   1.00 0.00 ? 46 VAL A HA   2  
ATOM 1720  H HB   . VAL A 1 46 ? -4.653  1.501   7.113   1.00 0.00 ? 46 VAL A HB   2  
ATOM 1721  H HG11 . VAL A 1 46 ? -3.352  4.171   7.638   1.00 0.00 ? 46 VAL A HG11 2  
ATOM 1722  H HG12 . VAL A 1 46 ? -4.261  3.234   8.826   1.00 0.00 ? 46 VAL A HG12 2  
ATOM 1723  H HG13 . VAL A 1 46 ? -2.761  2.592   8.154   1.00 0.00 ? 46 VAL A HG13 2  
ATOM 1724  H HG21 . VAL A 1 46 ? -6.101  3.658   7.506   1.00 0.00 ? 46 VAL A HG21 2  
ATOM 1725  H HG22 . VAL A 1 46 ? -5.588  4.040   5.863   1.00 0.00 ? 46 VAL A HG22 2  
ATOM 1726  H HG23 . VAL A 1 46 ? -6.473  2.549   6.185   1.00 0.00 ? 46 VAL A HG23 2  
ATOM 1727  N N    . SER A 1 47 ? -1.336  2.568   6.409   1.00 0.00 ? 47 SER A N    2  
ATOM 1728  C CA   . SER A 1 47 ? -0.014  2.052   6.744   1.00 0.00 ? 47 SER A CA   2  
ATOM 1729  C C    . SER A 1 47 ? -0.018  1.401   8.124   1.00 0.00 ? 47 SER A C    2  
ATOM 1730  O O    . SER A 1 47 ? -1.030  1.415   8.825   1.00 0.00 ? 47 SER A O    2  
ATOM 1731  C CB   . SER A 1 47 ? 1.022   3.177   6.702   1.00 0.00 ? 47 SER A CB   2  
ATOM 1732  O OG   . SER A 1 47 ? 2.298   2.711   7.103   1.00 0.00 ? 47 SER A OG   2  
ATOM 1733  H H    . SER A 1 47 ? -1.553  3.500   6.619   1.00 0.00 ? 47 SER A H    2  
ATOM 1734  H HA   . SER A 1 47 ? 0.247   1.306   6.008   1.00 0.00 ? 47 SER A HA   2  
ATOM 1735  H HB2  . SER A 1 47 ? 1.092   3.561   5.695   1.00 0.00 ? 47 SER A HB2  2  
ATOM 1736  H HB3  . SER A 1 47 ? 0.715   3.970   7.368   1.00 0.00 ? 47 SER A HB3  2  
ATOM 1737  H HG   . SER A 1 47 ? 2.872   3.460   7.280   1.00 0.00 ? 47 SER A HG   2  
ATOM 1738  N N    . ARG A 1 48 ? 1.120   0.831   8.506   1.00 0.00 ? 48 ARG A N    2  
ATOM 1739  C CA   . ARG A 1 48 ? 1.248   0.174   9.801   1.00 0.00 ? 48 ARG A CA   2  
ATOM 1740  C C    . ARG A 1 48 ? 2.300   0.868   10.662  1.00 0.00 ? 48 ARG A C    2  
ATOM 1741  O O    . ARG A 1 48 ? 2.541   0.474   11.803  1.00 0.00 ? 48 ARG A O    2  
ATOM 1742  C CB   . ARG A 1 48 ? 1.618   -1.299  9.615   1.00 0.00 ? 48 ARG A CB   2  
ATOM 1743  C CG   . ARG A 1 48 ? 0.510   -2.131  8.991   1.00 0.00 ? 48 ARG A CG   2  
ATOM 1744  C CD   . ARG A 1 48 ? -0.625  -2.374  9.974   1.00 0.00 ? 48 ARG A CD   2  
ATOM 1745  N NE   . ARG A 1 48 ? -1.340  -3.615  9.689   1.00 0.00 ? 48 ARG A NE   2  
ATOM 1746  C CZ   . ARG A 1 48 ? -2.179  -4.192  10.541  1.00 0.00 ? 48 ARG A CZ   2  
ATOM 1747  N NH1  . ARG A 1 48 ? -2.407  -3.643  11.727  1.00 0.00 ? 48 ARG A NH1  2  
ATOM 1748  N NH2  . ARG A 1 48 ? -2.793  -5.321  10.209  1.00 0.00 ? 48 ARG A NH2  2  
ATOM 1749  H H    . ARG A 1 48 ? 1.892   0.853   7.902   1.00 0.00 ? 48 ARG A H    2  
ATOM 1750  H HA   . ARG A 1 48 ? 0.293   0.235   10.300  1.00 0.00 ? 48 ARG A HA   2  
ATOM 1751  H HB2  . ARG A 1 48 ? 2.488   -1.362  8.977   1.00 0.00 ? 48 ARG A HB2  2  
ATOM 1752  H HB3  . ARG A 1 48 ? 1.857   -1.722  10.579  1.00 0.00 ? 48 ARG A HB3  2  
ATOM 1753  H HG2  . ARG A 1 48 ? 0.120   -1.608  8.130   1.00 0.00 ? 48 ARG A HG2  2  
ATOM 1754  H HG3  . ARG A 1 48 ? 0.917   -3.082  8.682   1.00 0.00 ? 48 ARG A HG3  2  
ATOM 1755  H HD2  . ARG A 1 48 ? -0.215  -2.427  10.971  1.00 0.00 ? 48 ARG A HD2  2  
ATOM 1756  H HD3  . ARG A 1 48 ? -1.318  -1.548  9.914   1.00 0.00 ? 48 ARG A HD3  2  
ATOM 1757  H HE   . ARG A 1 48 ? -1.187  -4.037  8.818   1.00 0.00 ? 48 ARG A HE   2  
ATOM 1758  H HH11 . ARG A 1 48 ? -1.947  -2.792  11.979  1.00 0.00 ? 48 ARG A HH11 2  
ATOM 1759  H HH12 . ARG A 1 48 ? -3.040  -4.079  12.367  1.00 0.00 ? 48 ARG A HH12 2  
ATOM 1760  H HH21 . ARG A 1 48 ? -2.623  -5.738  9.317   1.00 0.00 ? 48 ARG A HH21 2  
ATOM 1761  H HH22 . ARG A 1 48 ? -3.424  -5.755  10.852  1.00 0.00 ? 48 ARG A HH22 2  
ATOM 1762  N N    . ARG A 1 49 ? 2.922   1.903   10.106  1.00 0.00 ? 49 ARG A N    2  
ATOM 1763  C CA   . ARG A 1 49 ? 3.948   2.651   10.822  1.00 0.00 ? 49 ARG A CA   2  
ATOM 1764  C C    . ARG A 1 49 ? 3.444   4.041   11.200  1.00 0.00 ? 49 ARG A C    2  
ATOM 1765  O O    . ARG A 1 49 ? 3.766   4.561   12.269  1.00 0.00 ? 49 ARG A O    2  
ATOM 1766  C CB   . ARG A 1 49 ? 5.212   2.770   9.968   1.00 0.00 ? 49 ARG A CB   2  
ATOM 1767  C CG   . ARG A 1 49 ? 6.346   3.511   10.658  1.00 0.00 ? 49 ARG A CG   2  
ATOM 1768  C CD   . ARG A 1 49 ? 6.918   2.702   11.811  1.00 0.00 ? 49 ARG A CD   2  
ATOM 1769  N NE   . ARG A 1 49 ? 7.726   1.578   11.345  1.00 0.00 ? 49 ARG A NE   2  
ATOM 1770  C CZ   . ARG A 1 49 ? 8.211   0.639   12.148  1.00 0.00 ? 49 ARG A CZ   2  
ATOM 1771  N NH1  . ARG A 1 49 ? 7.972   0.688   13.452  1.00 0.00 ? 49 ARG A NH1  2  
ATOM 1772  N NH2  . ARG A 1 49 ? 8.937   -0.353  11.649  1.00 0.00 ? 49 ARG A NH2  2  
ATOM 1773  H H    . ARG A 1 49 ? 2.686   2.169   9.193   1.00 0.00 ? 49 ARG A H    2  
ATOM 1774  H HA   . ARG A 1 49 ? 4.185   2.109   11.725  1.00 0.00 ? 49 ARG A HA   2  
ATOM 1775  H HB2  . ARG A 1 49 ? 5.559   1.778   9.718   1.00 0.00 ? 49 ARG A HB2  2  
ATOM 1776  H HB3  . ARG A 1 49 ? 4.968   3.297   9.058   1.00 0.00 ? 49 ARG A HB3  2  
ATOM 1777  H HG2  . ARG A 1 49 ? 7.131   3.698   9.940   1.00 0.00 ? 49 ARG A HG2  2  
ATOM 1778  H HG3  . ARG A 1 49 ? 5.972   4.450   11.038  1.00 0.00 ? 49 ARG A HG3  2  
ATOM 1779  H HD2  . ARG A 1 49 ? 7.536   3.350   12.416  1.00 0.00 ? 49 ARG A HD2  2  
ATOM 1780  H HD3  . ARG A 1 49 ? 6.102   2.324   12.408  1.00 0.00 ? 49 ARG A HD3  2  
ATOM 1781  H HE   . ARG A 1 49 ? 7.914   1.523   10.385  1.00 0.00 ? 49 ARG A HE   2  
ATOM 1782  H HH11 . ARG A 1 49 ? 7.424   1.433   13.831  1.00 0.00 ? 49 ARG A HH11 2  
ATOM 1783  H HH12 . ARG A 1 49 ? 8.338   -0.022  14.054  1.00 0.00 ? 49 ARG A HH12 2  
ATOM 1784  H HH21 . ARG A 1 49 ? 9.120   -0.394  10.667  1.00 0.00 ? 49 ARG A HH21 2  
ATOM 1785  H HH22 . ARG A 1 49 ? 9.302   -1.060  12.254  1.00 0.00 ? 49 ARG A HH22 2  
ATOM 1786  N N    . THR A 1 50 ? 2.652   4.638   10.316  1.00 0.00 ? 50 THR A N    2  
ATOM 1787  C CA   . THR A 1 50 ? 2.104   5.967   10.555  1.00 0.00 ? 50 THR A CA   2  
ATOM 1788  C C    . THR A 1 50 ? 0.590   5.917   10.723  1.00 0.00 ? 50 THR A C    2  
ATOM 1789  O O    . THR A 1 50 ? -0.019  6.858   11.231  1.00 0.00 ? 50 THR A O    2  
ATOM 1790  C CB   . THR A 1 50 ? 2.450   6.933   9.406   1.00 0.00 ? 50 THR A CB   2  
ATOM 1791  O OG1  . THR A 1 50 ? 2.033   6.375   8.155   1.00 0.00 ? 50 THR A OG1  2  
ATOM 1792  C CG2  . THR A 1 50 ? 3.944   7.215   9.367   1.00 0.00 ? 50 THR A CG2  2  
ATOM 1793  H H    . THR A 1 50 ? 2.431   4.173   9.482   1.00 0.00 ? 50 THR A H    2  
ATOM 1794  H HA   . THR A 1 50 ? 2.545   6.351   11.464  1.00 0.00 ? 50 THR A HA   2  
ATOM 1795  H HB   . THR A 1 50 ? 1.926   7.864   9.568   1.00 0.00 ? 50 THR A HB   2  
ATOM 1796  H HG1  . THR A 1 50 ? 2.009   7.065   7.488   1.00 0.00 ? 50 THR A HG1  2  
ATOM 1797  H HG21 . THR A 1 50 ? 4.238   7.724   10.274  1.00 0.00 ? 50 THR A HG21 2  
ATOM 1798  H HG22 . THR A 1 50 ? 4.171   7.839   8.515   1.00 0.00 ? 50 THR A HG22 2  
ATOM 1799  H HG23 . THR A 1 50 ? 4.484   6.284   9.286   1.00 0.00 ? 50 THR A HG23 2  
ATOM 1800  N N    . GLN A 1 51 ? -0.011  4.812   10.293  1.00 0.00 ? 51 GLN A N    2  
ATOM 1801  C CA   . GLN A 1 51 ? -1.456  4.640   10.396  1.00 0.00 ? 51 GLN A CA   2  
ATOM 1802  C C    . GLN A 1 51 ? -2.191  5.733   9.627   1.00 0.00 ? 51 GLN A C    2  
ATOM 1803  O O    . GLN A 1 51 ? -3.262  6.181   10.035  1.00 0.00 ? 51 GLN A O    2  
ATOM 1804  C CB   . GLN A 1 51 ? -1.889  4.653   11.863  1.00 0.00 ? 51 GLN A CB   2  
ATOM 1805  C CG   . GLN A 1 51 ? -1.721  3.312   12.559  1.00 0.00 ? 51 GLN A CG   2  
ATOM 1806  C CD   . GLN A 1 51 ? -1.775  3.427   14.070  1.00 0.00 ? 51 GLN A CD   2  
ATOM 1807  O OE1  . GLN A 1 51 ? -2.411  4.331   14.612  1.00 0.00 ? 51 GLN A OE1  2  
ATOM 1808  N NE2  . GLN A 1 51 ? -1.107  2.509   14.758  1.00 0.00 ? 51 GLN A NE2  2  
ATOM 1809  H H    . GLN A 1 51 ? 0.528   4.097   9.897   1.00 0.00 ? 51 GLN A H    2  
ATOM 1810  H HA   . GLN A 1 51 ? -1.707  3.683   9.965   1.00 0.00 ? 51 GLN A HA   2  
ATOM 1811  H HB2  . GLN A 1 51 ? -1.299  5.386   12.394  1.00 0.00 ? 51 GLN A HB2  2  
ATOM 1812  H HB3  . GLN A 1 51 ? -2.930  4.934   11.916  1.00 0.00 ? 51 GLN A HB3  2  
ATOM 1813  H HG2  . GLN A 1 51 ? -2.513  2.652   12.236  1.00 0.00 ? 51 GLN A HG2  2  
ATOM 1814  H HG3  . GLN A 1 51 ? -0.767  2.892   12.278  1.00 0.00 ? 51 GLN A HG3  2  
ATOM 1815  H HE21 . GLN A 1 51 ? -0.622  1.819   14.258  1.00 0.00 ? 51 GLN A HE21 2  
ATOM 1816  H HE22 . GLN A 1 51 ? -1.124  2.560   15.735  1.00 0.00 ? 51 GLN A HE22 2  
ATOM 1817  N N    . LYS A 1 52 ? -1.608  6.158   8.511   1.00 0.00 ? 52 LYS A N    2  
ATOM 1818  C CA   . LYS A 1 52 ? -2.207  7.198   7.683   1.00 0.00 ? 52 LYS A CA   2  
ATOM 1819  C C    . LYS A 1 52 ? -2.933  6.590   6.488   1.00 0.00 ? 52 LYS A C    2  
ATOM 1820  O O    . LYS A 1 52 ? -2.602  5.493   6.039   1.00 0.00 ? 52 LYS A O    2  
ATOM 1821  C CB   . LYS A 1 52 ? -1.133  8.174   7.198   1.00 0.00 ? 52 LYS A CB   2  
ATOM 1822  C CG   . LYS A 1 52 ? -0.441  8.926   8.323   1.00 0.00 ? 52 LYS A CG   2  
ATOM 1823  C CD   . LYS A 1 52 ? -1.231  10.155  8.740   1.00 0.00 ? 52 LYS A CD   2  
ATOM 1824  C CE   . LYS A 1 52 ? -0.848  11.371  7.911   1.00 0.00 ? 52 LYS A CE   2  
ATOM 1825  N NZ   . LYS A 1 52 ? -1.443  12.623  8.456   1.00 0.00 ? 52 LYS A NZ   2  
ATOM 1826  H H    . LYS A 1 52 ? -0.753  5.762   8.237   1.00 0.00 ? 52 LYS A H    2  
ATOM 1827  H HA   . LYS A 1 52 ? -2.921  7.734   8.289   1.00 0.00 ? 52 LYS A HA   2  
ATOM 1828  H HB2  . LYS A 1 52 ? -0.384  7.623   6.648   1.00 0.00 ? 52 LYS A HB2  2  
ATOM 1829  H HB3  . LYS A 1 52 ? -1.591  8.897   6.539   1.00 0.00 ? 52 LYS A HB3  2  
ATOM 1830  H HG2  . LYS A 1 52 ? -0.341  8.269   9.174   1.00 0.00 ? 52 LYS A HG2  2  
ATOM 1831  H HG3  . LYS A 1 52 ? 0.539   9.235   7.988   1.00 0.00 ? 52 LYS A HG3  2  
ATOM 1832  H HD2  . LYS A 1 52 ? -2.284  9.959   8.605   1.00 0.00 ? 52 LYS A HD2  2  
ATOM 1833  H HD3  . LYS A 1 52 ? -1.032  10.363  9.782   1.00 0.00 ? 52 LYS A HD3  2  
ATOM 1834  H HE2  . LYS A 1 52 ? 0.227   11.466  7.909   1.00 0.00 ? 52 LYS A HE2  2  
ATOM 1835  H HE3  . LYS A 1 52 ? -1.199  11.226  6.900   1.00 0.00 ? 52 LYS A HE3  2  
ATOM 1836  H HZ1  . LYS A 1 52 ? -0.755  13.110  9.065   1.00 0.00 ? 52 LYS A HZ1  2  
ATOM 1837  H HZ2  . LYS A 1 52 ? -2.290  12.402  9.017   1.00 0.00 ? 52 LYS A HZ2  2  
ATOM 1838  H HZ3  . LYS A 1 52 ? -1.712  13.259  7.678   1.00 0.00 ? 52 LYS A HZ3  2  
ATOM 1839  N N    . PHE A 1 53 ? -3.925  7.311   5.975   1.00 0.00 ? 53 PHE A N    2  
ATOM 1840  C CA   . PHE A 1 53 ? -4.698  6.843   4.830   1.00 0.00 ? 53 PHE A CA   2  
ATOM 1841  C C    . PHE A 1 53 ? -4.285  7.577   3.558   1.00 0.00 ? 53 PHE A C    2  
ATOM 1842  O O    . PHE A 1 53 ? -4.012  8.776   3.581   1.00 0.00 ? 53 PHE A O    2  
ATOM 1843  C CB   . PHE A 1 53 ? -6.194  7.040   5.084   1.00 0.00 ? 53 PHE A CB   2  
ATOM 1844  C CG   . PHE A 1 53 ? -7.069  6.220   4.179   1.00 0.00 ? 53 PHE A CG   2  
ATOM 1845  C CD1  . PHE A 1 53 ? -7.313  6.625   2.877   1.00 0.00 ? 53 PHE A CD1  2  
ATOM 1846  C CD2  . PHE A 1 53 ? -7.645  5.044   4.631   1.00 0.00 ? 53 PHE A CD2  2  
ATOM 1847  C CE1  . PHE A 1 53 ? -8.118  5.872   2.042   1.00 0.00 ? 53 PHE A CE1  2  
ATOM 1848  C CE2  . PHE A 1 53 ? -8.451  4.287   3.801   1.00 0.00 ? 53 PHE A CE2  2  
ATOM 1849  C CZ   . PHE A 1 53 ? -8.686  4.701   2.505   1.00 0.00 ? 53 PHE A CZ   2  
ATOM 1850  H H    . PHE A 1 53 ? -4.142  8.179   6.376   1.00 0.00 ? 53 PHE A H    2  
ATOM 1851  H HA   . PHE A 1 53 ? -4.498  5.790   4.705   1.00 0.00 ? 53 PHE A HA   2  
ATOM 1852  H HB2  . PHE A 1 53 ? -6.419  6.763   6.103   1.00 0.00 ? 53 PHE A HB2  2  
ATOM 1853  H HB3  . PHE A 1 53 ? -6.443  8.080   4.935   1.00 0.00 ? 53 PHE A HB3  2  
ATOM 1854  H HD1  . PHE A 1 53 ? -6.868  7.539   2.513   1.00 0.00 ? 53 PHE A HD1  2  
ATOM 1855  H HD2  . PHE A 1 53 ? -7.461  4.719   5.645   1.00 0.00 ? 53 PHE A HD2  2  
ATOM 1856  H HE1  . PHE A 1 53 ? -8.301  6.198   1.029   1.00 0.00 ? 53 PHE A HE1  2  
ATOM 1857  H HE2  . PHE A 1 53 ? -8.893  3.372   4.166   1.00 0.00 ? 53 PHE A HE2  2  
ATOM 1858  H HZ   . PHE A 1 53 ? -9.316  4.112   1.855   1.00 0.00 ? 53 PHE A HZ   2  
ATOM 1859  N N    . GLY A 1 54 ? -4.242  6.847   2.448   1.00 0.00 ? 54 GLY A N    2  
ATOM 1860  C CA   . GLY A 1 54 ? -3.861  7.444   1.181   1.00 0.00 ? 54 GLY A CA   2  
ATOM 1861  C C    . GLY A 1 54 ? -3.830  6.435   0.051   1.00 0.00 ? 54 GLY A C    2  
ATOM 1862  O O    . GLY A 1 54 ? -4.538  5.428   0.087   1.00 0.00 ? 54 GLY A O    2  
ATOM 1863  H H    . GLY A 1 54 ? -4.470  5.894   2.490   1.00 0.00 ? 54 GLY A H    2  
ATOM 1864  H HA2  . GLY A 1 54 ? -4.567  8.223   0.936   1.00 0.00 ? 54 GLY A HA2  2  
ATOM 1865  H HA3  . GLY A 1 54 ? -2.878  7.881   1.284   1.00 0.00 ? 54 GLY A HA3  2  
ATOM 1866  N N    . THR A 1 55 ? -3.009  6.704   -0.959  1.00 0.00 ? 55 THR A N    2  
ATOM 1867  C CA   . THR A 1 55 ? -2.891  5.814   -2.107  1.00 0.00 ? 55 THR A CA   2  
ATOM 1868  C C    . THR A 1 55 ? -1.432  5.606   -2.494  1.00 0.00 ? 55 THR A C    2  
ATOM 1869  O O    . THR A 1 55 ? -0.654  6.559   -2.557  1.00 0.00 ? 55 THR A O    2  
ATOM 1870  C CB   . THR A 1 55 ? -3.660  6.362   -3.324  1.00 0.00 ? 55 THR A CB   2  
ATOM 1871  O OG1  . THR A 1 55 ? -3.378  5.567   -4.481  1.00 0.00 ? 55 THR A OG1  2  
ATOM 1872  C CG2  . THR A 1 55 ? -3.283  7.811   -3.595  1.00 0.00 ? 55 THR A CG2  2  
ATOM 1873  H H    . THR A 1 55 ? -2.470  7.523   -0.931  1.00 0.00 ? 55 THR A H    2  
ATOM 1874  H HA   . THR A 1 55 ? -3.321  4.861   -1.836  1.00 0.00 ? 55 THR A HA   2  
ATOM 1875  H HB   . THR A 1 55 ? -4.719  6.315   -3.113  1.00 0.00 ? 55 THR A HB   2  
ATOM 1876  H HG1  . THR A 1 55 ? -3.605  6.061   -5.273  1.00 0.00 ? 55 THR A HG1  2  
ATOM 1877  H HG21 . THR A 1 55 ? -2.234  7.870   -3.843  1.00 0.00 ? 55 THR A HG21 2  
ATOM 1878  H HG22 . THR A 1 55 ? -3.479  8.404   -2.714  1.00 0.00 ? 55 THR A HG22 2  
ATOM 1879  H HG23 . THR A 1 55 ? -3.869  8.187   -4.420  1.00 0.00 ? 55 THR A HG23 2  
ATOM 1880  N N    . PHE A 1 56 ? -1.065  4.355   -2.754  1.00 0.00 ? 56 PHE A N    2  
ATOM 1881  C CA   . PHE A 1 56 ? 0.302   4.023   -3.135  1.00 0.00 ? 56 PHE A CA   2  
ATOM 1882  C C    . PHE A 1 56 ? 0.319   2.945   -4.215  1.00 0.00 ? 56 PHE A C    2  
ATOM 1883  O O    . PHE A 1 56 ? -0.608  2.145   -4.344  1.00 0.00 ? 56 PHE A O    2  
ATOM 1884  C CB   . PHE A 1 56 ? 1.094   3.549   -1.914  1.00 0.00 ? 56 PHE A CB   2  
ATOM 1885  C CG   . PHE A 1 56 ? 0.322   2.617   -1.024  1.00 0.00 ? 56 PHE A CG   2  
ATOM 1886  C CD1  . PHE A 1 56 ? -0.606  3.110   -0.121  1.00 0.00 ? 56 PHE A CD1  2  
ATOM 1887  C CD2  . PHE A 1 56 ? 0.525   1.248   -1.091  1.00 0.00 ? 56 PHE A CD2  2  
ATOM 1888  C CE1  . PHE A 1 56 ? -1.318  2.255   0.699   1.00 0.00 ? 56 PHE A CE1  2  
ATOM 1889  C CE2  . PHE A 1 56 ? -0.184  0.388   -0.274  1.00 0.00 ? 56 PHE A CE2  2  
ATOM 1890  C CZ   . PHE A 1 56 ? -1.106  0.892   0.623   1.00 0.00 ? 56 PHE A CZ   2  
ATOM 1891  H H    . PHE A 1 56 ? -1.731  3.639   -2.687  1.00 0.00 ? 56 PHE A H    2  
ATOM 1892  H HA   . PHE A 1 56 ? 0.763   4.916   -3.528  1.00 0.00 ? 56 PHE A HA   2  
ATOM 1893  H HB2  . PHE A 1 56 ? 1.980   3.031   -2.247  1.00 0.00 ? 56 PHE A HB2  2  
ATOM 1894  H HB3  . PHE A 1 56 ? 1.383   4.408   -1.327  1.00 0.00 ? 56 PHE A HB3  2  
ATOM 1895  H HD1  . PHE A 1 56 ? -0.772  4.176   -0.060  1.00 0.00 ? 56 PHE A HD1  2  
ATOM 1896  H HD2  . PHE A 1 56 ? 1.246   0.852   -1.791  1.00 0.00 ? 56 PHE A HD2  2  
ATOM 1897  H HE1  . PHE A 1 56 ? -2.037  2.652   1.399   1.00 0.00 ? 56 PHE A HE1  2  
ATOM 1898  H HE2  . PHE A 1 56 ? -0.017  -0.677  -0.335  1.00 0.00 ? 56 PHE A HE2  2  
ATOM 1899  H HZ   . PHE A 1 56 ? -1.662  0.222   1.262   1.00 0.00 ? 56 PHE A HZ   2  
ATOM 1900  N N    . PRO A 1 57 ? 1.398   2.923   -5.012  1.00 0.00 ? 57 PRO A N    2  
ATOM 1901  C CA   . PRO A 1 57 ? 1.562   1.949   -6.095  1.00 0.00 ? 57 PRO A CA   2  
ATOM 1902  C C    . PRO A 1 57 ? 1.797   0.536   -5.573  1.00 0.00 ? 57 PRO A C    2  
ATOM 1903  O O    . PRO A 1 57 ? 2.871   0.223   -5.061  1.00 0.00 ? 57 PRO A O    2  
ATOM 1904  C CB   . PRO A 1 57 ? 2.799   2.455   -6.842  1.00 0.00 ? 57 PRO A CB   2  
ATOM 1905  C CG   . PRO A 1 57 ? 3.566   3.228   -5.826  1.00 0.00 ? 57 PRO A CG   2  
ATOM 1906  C CD   . PRO A 1 57 ? 2.541   3.846   -4.916  1.00 0.00 ? 57 PRO A CD   2  
ATOM 1907  H HA   . PRO A 1 57 ? 0.712   1.949   -6.761  1.00 0.00 ? 57 PRO A HA   2  
ATOM 1908  H HB2  . PRO A 1 57 ? 3.368   1.614   -7.213  1.00 0.00 ? 57 PRO A HB2  2  
ATOM 1909  H HB3  . PRO A 1 57 ? 2.494   3.082   -7.667  1.00 0.00 ? 57 PRO A HB3  2  
ATOM 1910  H HG2  . PRO A 1 57 ? 4.210   2.565   -5.269  1.00 0.00 ? 57 PRO A HG2  2  
ATOM 1911  H HG3  . PRO A 1 57 ? 4.147   3.998   -6.312  1.00 0.00 ? 57 PRO A HG3  2  
ATOM 1912  H HD2  . PRO A 1 57 ? 2.914   3.893   -3.903  1.00 0.00 ? 57 PRO A HD2  2  
ATOM 1913  H HD3  . PRO A 1 57 ? 2.270   4.831   -5.266  1.00 0.00 ? 57 PRO A HD3  2  
ATOM 1914  N N    . GLY A 1 58 ? 0.785   -0.316  -5.707  1.00 0.00 ? 58 GLY A N    2  
ATOM 1915  C CA   . GLY A 1 58 ? 0.902   -1.686  -5.245  1.00 0.00 ? 58 GLY A CA   2  
ATOM 1916  C C    . GLY A 1 58 ? 2.183   -2.348  -5.711  1.00 0.00 ? 58 GLY A C    2  
ATOM 1917  O O    . GLY A 1 58 ? 2.683   -3.270  -5.067  1.00 0.00 ? 58 GLY A O    2  
ATOM 1918  H H    . GLY A 1 58 ? -0.049  -0.011  -6.124  1.00 0.00 ? 58 GLY A H    2  
ATOM 1919  H HA2  . GLY A 1 58 ? 0.876   -1.694  -4.165  1.00 0.00 ? 58 GLY A HA2  2  
ATOM 1920  H HA3  . GLY A 1 58 ? 0.061   -2.253  -5.619  1.00 0.00 ? 58 GLY A HA3  2  
ATOM 1921  N N    . ASN A 1 59 ? 2.716   -1.878  -6.834  1.00 0.00 ? 59 ASN A N    2  
ATOM 1922  C CA   . ASN A 1 59 ? 3.946   -2.432  -7.387  1.00 0.00 ? 59 ASN A CA   2  
ATOM 1923  C C    . ASN A 1 59 ? 5.048   -2.469  -6.332  1.00 0.00 ? 59 ASN A C    2  
ATOM 1924  O O    . ASN A 1 59 ? 6.015   -3.221  -6.456  1.00 0.00 ? 59 ASN A O    2  
ATOM 1925  C CB   . ASN A 1 59 ? 4.405   -1.608  -8.592  1.00 0.00 ? 59 ASN A CB   2  
ATOM 1926  C CG   . ASN A 1 59 ? 3.249   -1.186  -9.478  1.00 0.00 ? 59 ASN A CG   2  
ATOM 1927  O OD1  . ASN A 1 59 ? 2.651   -2.009  -10.170 1.00 0.00 ? 59 ASN A OD1  2  
ATOM 1928  N ND2  . ASN A 1 59 ? 2.929   0.103   -9.459  1.00 0.00 ? 59 ASN A ND2  2  
ATOM 1929  H H    . ASN A 1 59 ? 2.271   -1.141  -7.303  1.00 0.00 ? 59 ASN A H    2  
ATOM 1930  H HA   . ASN A 1 59 ? 3.739   -3.441  -7.710  1.00 0.00 ? 59 ASN A HA   2  
ATOM 1931  H HB2  . ASN A 1 59 ? 4.908   -0.718  -8.241  1.00 0.00 ? 59 ASN A HB2  2  
ATOM 1932  H HB3  . ASN A 1 59 ? 5.092   -2.195  -9.182  1.00 0.00 ? 59 ASN A HB3  2  
ATOM 1933  H HD21 . ASN A 1 59 ? 3.450   0.701   -8.883  1.00 0.00 ? 59 ASN A HD21 2  
ATOM 1934  H HD22 . ASN A 1 59 ? 2.185   0.403   -10.022 1.00 0.00 ? 59 ASN A HD22 2  
ATOM 1935  N N    . TYR A 1 60 ? 4.895   -1.652  -5.296  1.00 0.00 ? 60 TYR A N    2  
ATOM 1936  C CA   . TYR A 1 60 ? 5.878   -1.589  -4.221  1.00 0.00 ? 60 TYR A CA   2  
ATOM 1937  C C    . TYR A 1 60 ? 5.525   -2.566  -3.103  1.00 0.00 ? 60 TYR A C    2  
ATOM 1938  O O    . TYR A 1 60 ? 6.404   -3.093  -2.422  1.00 0.00 ? 60 TYR A O    2  
ATOM 1939  C CB   . TYR A 1 60 ? 5.964   -0.168  -3.663  1.00 0.00 ? 60 TYR A CB   2  
ATOM 1940  C CG   . TYR A 1 60 ? 6.843   0.751   -4.481  1.00 0.00 ? 60 TYR A CG   2  
ATOM 1941  C CD1  . TYR A 1 60 ? 6.437   1.200   -5.731  1.00 0.00 ? 60 TYR A CD1  2  
ATOM 1942  C CD2  . TYR A 1 60 ? 8.079   1.170   -4.003  1.00 0.00 ? 60 TYR A CD2  2  
ATOM 1943  C CE1  . TYR A 1 60 ? 7.237   2.040   -6.483  1.00 0.00 ? 60 TYR A CE1  2  
ATOM 1944  C CE2  . TYR A 1 60 ? 8.884   2.010   -4.747  1.00 0.00 ? 60 TYR A CE2  2  
ATOM 1945  C CZ   . TYR A 1 60 ? 8.460   2.442   -5.986  1.00 0.00 ? 60 TYR A CZ   2  
ATOM 1946  O OH   . TYR A 1 60 ? 9.260   3.278   -6.731  1.00 0.00 ? 60 TYR A OH   2  
ATOM 1947  H H    . TYR A 1 60 ? 4.103   -1.076  -5.254  1.00 0.00 ? 60 TYR A H    2  
ATOM 1948  H HA   . TYR A 1 60 ? 6.838   -1.863  -4.632  1.00 0.00 ? 60 TYR A HA   2  
ATOM 1949  H HB2  . TYR A 1 60 ? 4.974   0.261   -3.633  1.00 0.00 ? 60 TYR A HB2  2  
ATOM 1950  H HB3  . TYR A 1 60 ? 6.365   -0.206  -2.660  1.00 0.00 ? 60 TYR A HB3  2  
ATOM 1951  H HD1  . TYR A 1 60 ? 5.480   0.883   -6.118  1.00 0.00 ? 60 TYR A HD1  2  
ATOM 1952  H HD2  . TYR A 1 60 ? 8.409   0.829   -3.032  1.00 0.00 ? 60 TYR A HD2  2  
ATOM 1953  H HE1  . TYR A 1 60 ? 6.905   2.378   -7.453  1.00 0.00 ? 60 TYR A HE1  2  
ATOM 1954  H HE2  . TYR A 1 60 ? 9.842   2.325   -4.359  1.00 0.00 ? 60 TYR A HE2  2  
ATOM 1955  H HH   . TYR A 1 60 ? 8.812   4.117   -6.861  1.00 0.00 ? 60 TYR A HH   2  
ATOM 1956  N N    . VAL A 1 61 ? 4.229   -2.803  -2.920  1.00 0.00 ? 61 VAL A N    2  
ATOM 1957  C CA   . VAL A 1 61 ? 3.758   -3.717  -1.887  1.00 0.00 ? 61 VAL A CA   2  
ATOM 1958  C C    . VAL A 1 61 ? 3.282   -5.033  -2.493  1.00 0.00 ? 61 VAL A C    2  
ATOM 1959  O O    . VAL A 1 61 ? 3.234   -5.185  -3.713  1.00 0.00 ? 61 VAL A O    2  
ATOM 1960  C CB   . VAL A 1 61 ? 2.610   -3.096  -1.069  1.00 0.00 ? 61 VAL A CB   2  
ATOM 1961  C CG1  . VAL A 1 61 ? 3.067   -1.810  -0.398  1.00 0.00 ? 61 VAL A CG1  2  
ATOM 1962  C CG2  . VAL A 1 61 ? 1.401   -2.843  -1.957  1.00 0.00 ? 61 VAL A CG2  2  
ATOM 1963  H H    . VAL A 1 61 ? 3.575   -2.353  -3.495  1.00 0.00 ? 61 VAL A H    2  
ATOM 1964  H HA   . VAL A 1 61 ? 4.581   -3.918  -1.217  1.00 0.00 ? 61 VAL A HA   2  
ATOM 1965  H HB   . VAL A 1 61 ? 2.324   -3.797  -0.298  1.00 0.00 ? 61 VAL A HB   2  
ATOM 1966  H HG11 . VAL A 1 61 ? 2.213   -1.172  -0.224  1.00 0.00 ? 61 VAL A HG11 2  
ATOM 1967  H HG12 . VAL A 1 61 ? 3.541   -2.045  0.544   1.00 0.00 ? 61 VAL A HG12 2  
ATOM 1968  H HG13 . VAL A 1 61 ? 3.772   -1.301  -1.039  1.00 0.00 ? 61 VAL A HG13 2  
ATOM 1969  H HG21 . VAL A 1 61 ? 1.479   -3.444  -2.851  1.00 0.00 ? 61 VAL A HG21 2  
ATOM 1970  H HG22 . VAL A 1 61 ? 0.499   -3.108  -1.423  1.00 0.00 ? 61 VAL A HG22 2  
ATOM 1971  H HG23 . VAL A 1 61 ? 1.364   -1.798  -2.227  1.00 0.00 ? 61 VAL A HG23 2  
ATOM 1972  N N    . ALA A 1 62 ? 2.930   -5.982  -1.631  1.00 0.00 ? 62 ALA A N    2  
ATOM 1973  C CA   . ALA A 1 62 ? 2.454   -7.284  -2.081  1.00 0.00 ? 62 ALA A CA   2  
ATOM 1974  C C    . ALA A 1 62 ? 1.539   -7.923  -1.043  1.00 0.00 ? 62 ALA A C    2  
ATOM 1975  O O    . ALA A 1 62 ? 1.668   -7.693  0.160   1.00 0.00 ? 62 ALA A O    2  
ATOM 1976  C CB   . ALA A 1 62 ? 3.631   -8.199  -2.384  1.00 0.00 ? 62 ALA A CB   2  
ATOM 1977  H H    . ALA A 1 62 ? 2.990   -5.801  -0.670  1.00 0.00 ? 62 ALA A H    2  
ATOM 1978  H HA   . ALA A 1 62 ? 1.898   -7.139  -2.996  1.00 0.00 ? 62 ALA A HA   2  
ATOM 1979  H HB1  . ALA A 1 62 ? 3.321   -8.966  -3.079  1.00 0.00 ? 62 ALA A HB1  2  
ATOM 1980  H HB2  . ALA A 1 62 ? 4.434   -7.622  -2.819  1.00 0.00 ? 62 ALA A HB2  2  
ATOM 1981  H HB3  . ALA A 1 62 ? 3.974   -8.660  -1.469  1.00 0.00 ? 62 ALA A HB3  2  
ATOM 1982  N N    . PRO A 1 63 ? 0.589   -8.745  -1.515  1.00 0.00 ? 63 PRO A N    2  
ATOM 1983  C CA   . PRO A 1 63 ? -0.367  -9.433  -0.644  1.00 0.00 ? 63 PRO A CA   2  
ATOM 1984  C C    . PRO A 1 63 ? 0.294   -10.521 0.197   1.00 0.00 ? 63 PRO A C    2  
ATOM 1985  O O    . PRO A 1 63 ? 0.662   -11.578 -0.316  1.00 0.00 ? 63 PRO A O    2  
ATOM 1986  C CB   . PRO A 1 63 ? -1.364  -10.050 -1.628  1.00 0.00 ? 63 PRO A CB   2  
ATOM 1987  C CG   . PRO A 1 63 ? -0.596  -10.211 -2.894  1.00 0.00 ? 63 PRO A CG   2  
ATOM 1988  C CD   . PRO A 1 63 ? 0.377   -9.065  -2.937  1.00 0.00 ? 63 PRO A CD   2  
ATOM 1989  H HA   . PRO A 1 63 ? -0.882  -8.741  0.006   1.00 0.00 ? 63 PRO A HA   2  
ATOM 1990  H HB2  . PRO A 1 63 ? -1.706  -11.003 -1.249  1.00 0.00 ? 63 PRO A HB2  2  
ATOM 1991  H HB3  . PRO A 1 63 ? -2.205  -9.385  -1.758  1.00 0.00 ? 63 PRO A HB3  2  
ATOM 1992  H HG2  . PRO A 1 63 ? -0.067  -11.151 -2.886  1.00 0.00 ? 63 PRO A HG2  2  
ATOM 1993  H HG3  . PRO A 1 63 ? -1.267  -10.163 -3.739  1.00 0.00 ? 63 PRO A HG3  2  
ATOM 1994  H HD2  . PRO A 1 63 ? 1.301   -9.371  -3.405  1.00 0.00 ? 63 PRO A HD2  2  
ATOM 1995  H HD3  . PRO A 1 63 ? -0.053  -8.224  -3.461  1.00 0.00 ? 63 PRO A HD3  2  
ATOM 1996  N N    . VAL A 1 64 ? 0.440   -10.255 1.491   1.00 0.00 ? 64 VAL A N    2  
ATOM 1997  C CA   . VAL A 1 64 ? 1.055   -11.212 2.403   1.00 0.00 ? 64 VAL A CA   2  
ATOM 1998  C C    . VAL A 1 64 ? 0.034   -12.227 2.905   1.00 0.00 ? 64 VAL A C    2  
ATOM 1999  O O    . VAL A 1 64 ? 0.393   -13.324 3.334   1.00 0.00 ? 64 VAL A O    2  
ATOM 2000  C CB   . VAL A 1 64 ? 1.695   -10.504 3.612   1.00 0.00 ? 64 VAL A CB   2  
ATOM 2001  C CG1  . VAL A 1 64 ? 0.751   -9.453  4.177   1.00 0.00 ? 64 VAL A CG1  2  
ATOM 2002  C CG2  . VAL A 1 64 ? 2.079   -11.516 4.680   1.00 0.00 ? 64 VAL A CG2  2  
ATOM 2003  H H    . VAL A 1 64 ? 0.126   -9.395  1.841   1.00 0.00 ? 64 VAL A H    2  
ATOM 2004  H HA   . VAL A 1 64 ? 1.833   -11.734 1.865   1.00 0.00 ? 64 VAL A HA   2  
ATOM 2005  H HB   . VAL A 1 64 ? 2.593   -10.006 3.278   1.00 0.00 ? 64 VAL A HB   2  
ATOM 2006  H HG11 . VAL A 1 64 ? -0.251  -9.640  3.819   1.00 0.00 ? 64 VAL A HG11 2  
ATOM 2007  H HG12 . VAL A 1 64 ? 0.764   -9.500  5.256   1.00 0.00 ? 64 VAL A HG12 2  
ATOM 2008  H HG13 . VAL A 1 64 ? 1.070   -8.473  3.855   1.00 0.00 ? 64 VAL A HG13 2  
ATOM 2009  H HG21 . VAL A 1 64 ? 1.207   -11.769 5.265   1.00 0.00 ? 64 VAL A HG21 2  
ATOM 2010  H HG22 . VAL A 1 64 ? 2.467   -12.408 4.209   1.00 0.00 ? 64 VAL A HG22 2  
ATOM 2011  H HG23 . VAL A 1 64 ? 2.835   -11.092 5.324   1.00 0.00 ? 64 VAL A HG23 2  
ATOM 2012  N N    . SER A 1 65 ? -1.241  -11.854 2.847   1.00 0.00 ? 65 SER A N    2  
ATOM 2013  C CA   . SER A 1 65 ? -2.315  -12.731 3.299   1.00 0.00 ? 65 SER A CA   2  
ATOM 2014  C C    . SER A 1 65 ? -2.128  -14.144 2.753   1.00 0.00 ? 65 SER A C    2  
ATOM 2015  O O    . SER A 1 65 ? -2.425  -15.127 3.430   1.00 0.00 ? 65 SER A O    2  
ATOM 2016  C CB   . SER A 1 65 ? -3.672  -12.178 2.860   1.00 0.00 ? 65 SER A CB   2  
ATOM 2017  O OG   . SER A 1 65 ? -4.715  -13.091 3.156   1.00 0.00 ? 65 SER A OG   2  
ATOM 2018  H H    . SER A 1 65 ? -1.463  -10.967 2.495   1.00 0.00 ? 65 SER A H    2  
ATOM 2019  H HA   . SER A 1 65 ? -2.282  -12.767 4.378   1.00 0.00 ? 65 SER A HA   2  
ATOM 2020  H HB2  . SER A 1 65 ? -3.864  -11.251 3.379   1.00 0.00 ? 65 SER A HB2  2  
ATOM 2021  H HB3  . SER A 1 65 ? -3.657  -11.999 1.795   1.00 0.00 ? 65 SER A HB3  2  
ATOM 2022  H HG   . SER A 1 65 ? -5.273  -12.727 3.848   1.00 0.00 ? 65 SER A HG   2  
ATOM 2023  N N    . GLY A 1 66 ? -1.634  -14.236 1.522   1.00 0.00 ? 66 GLY A N    2  
ATOM 2024  C CA   . GLY A 1 66 ? -1.417  -15.531 0.905   1.00 0.00 ? 66 GLY A CA   2  
ATOM 2025  C C    . GLY A 1 66 ? -2.485  -15.874 -0.115  1.00 0.00 ? 66 GLY A C    2  
ATOM 2026  O O    . GLY A 1 66 ? -3.166  -14.999 -0.650  1.00 0.00 ? 66 GLY A O    2  
ATOM 2027  H H    . GLY A 1 66 ? -1.416  -13.417 1.029   1.00 0.00 ? 66 GLY A H    2  
ATOM 2028  H HA2  . GLY A 1 66 ? -0.454  -15.527 0.415   1.00 0.00 ? 66 GLY A HA2  2  
ATOM 2029  H HA3  . GLY A 1 66 ? -1.414  -16.288 1.675   1.00 0.00 ? 66 GLY A HA3  2  
ATOM 2030  N N    . PRO A 1 67 ? -2.642  -17.176 -0.398  1.00 0.00 ? 67 PRO A N    2  
ATOM 2031  C CA   . PRO A 1 67 ? -3.632  -17.662 -1.363  1.00 0.00 ? 67 PRO A CA   2  
ATOM 2032  C C    . PRO A 1 67 ? -5.062  -17.499 -0.858  1.00 0.00 ? 67 PRO A C    2  
ATOM 2033  O O    . PRO A 1 67 ? -5.563  -18.333 -0.104  1.00 0.00 ? 67 PRO A O    2  
ATOM 2034  C CB   . PRO A 1 67 ? -3.284  -19.145 -1.511  1.00 0.00 ? 67 PRO A CB   2  
ATOM 2035  C CG   . PRO A 1 67 ? -2.607  -19.505 -0.234  1.00 0.00 ? 67 PRO A CG   2  
ATOM 2036  C CD   . PRO A 1 67 ? -1.865  -18.273 0.203   1.00 0.00 ? 67 PRO A CD   2  
ATOM 2037  H HA   . PRO A 1 67 ? -3.530  -17.169 -2.318  1.00 0.00 ? 67 PRO A HA   2  
ATOM 2038  H HB2  . PRO A 1 67 ? -4.189  -19.718 -1.655  1.00 0.00 ? 67 PRO A HB2  2  
ATOM 2039  H HB3  . PRO A 1 67 ? -2.627  -19.281 -2.358  1.00 0.00 ? 67 PRO A HB3  2  
ATOM 2040  H HG2  . PRO A 1 67 ? -3.342  -19.783 0.506   1.00 0.00 ? 67 PRO A HG2  2  
ATOM 2041  H HG3  . PRO A 1 67 ? -1.916  -20.319 -0.402  1.00 0.00 ? 67 PRO A HG3  2  
ATOM 2042  H HD2  . PRO A 1 67 ? -1.860  -18.197 1.280   1.00 0.00 ? 67 PRO A HD2  2  
ATOM 2043  H HD3  . PRO A 1 67 ? -0.855  -18.284 -0.181  1.00 0.00 ? 67 PRO A HD3  2  
ATOM 2044  N N    . SER A 1 68 ? -5.714  -16.420 -1.280  1.00 0.00 ? 68 SER A N    2  
ATOM 2045  C CA   . SER A 1 68 ? -7.085  -16.146 -0.868  1.00 0.00 ? 68 SER A CA   2  
ATOM 2046  C C    . SER A 1 68 ? -8.045  -16.286 -2.046  1.00 0.00 ? 68 SER A C    2  
ATOM 2047  O O    . SER A 1 68 ? -8.344  -15.311 -2.736  1.00 0.00 ? 68 SER A O    2  
ATOM 2048  C CB   . SER A 1 68 ? -7.191  -14.741 -0.273  1.00 0.00 ? 68 SER A CB   2  
ATOM 2049  O OG   . SER A 1 68 ? -6.717  -13.765 -1.185  1.00 0.00 ? 68 SER A OG   2  
ATOM 2050  H H    . SER A 1 68 ? -5.260  -15.792 -1.881  1.00 0.00 ? 68 SER A H    2  
ATOM 2051  H HA   . SER A 1 68 ? -7.355  -16.869 -0.112  1.00 0.00 ? 68 SER A HA   2  
ATOM 2052  H HB2  . SER A 1 68 ? -8.223  -14.527 -0.040  1.00 0.00 ? 68 SER A HB2  2  
ATOM 2053  H HB3  . SER A 1 68 ? -6.599  -14.689 0.630   1.00 0.00 ? 68 SER A HB3  2  
ATOM 2054  H HG   . SER A 1 68 ? -7.179  -12.936 -1.036  1.00 0.00 ? 68 SER A HG   2  
ATOM 2055  N N    . SER A 1 69 ? -8.523  -17.505 -2.270  1.00 0.00 ? 69 SER A N    2  
ATOM 2056  C CA   . SER A 1 69 ? -9.446  -17.775 -3.367  1.00 0.00 ? 69 SER A CA   2  
ATOM 2057  C C    . SER A 1 69 ? -10.788 -18.272 -2.838  1.00 0.00 ? 69 SER A C    2  
ATOM 2058  O O    . SER A 1 69 ? -10.865 -18.853 -1.756  1.00 0.00 ? 69 SER A O    2  
ATOM 2059  C CB   . SER A 1 69 ? -8.847  -18.808 -4.323  1.00 0.00 ? 69 SER A CB   2  
ATOM 2060  O OG   . SER A 1 69 ? -8.614  -20.040 -3.662  1.00 0.00 ? 69 SER A OG   2  
ATOM 2061  H H    . SER A 1 69 ? -8.247  -18.242 -1.685  1.00 0.00 ? 69 SER A H    2  
ATOM 2062  H HA   . SER A 1 69 ? -9.604  -16.850 -3.902  1.00 0.00 ? 69 SER A HA   2  
ATOM 2063  H HB2  . SER A 1 69 ? -9.530  -18.976 -5.141  1.00 0.00 ? 69 SER A HB2  2  
ATOM 2064  H HB3  . SER A 1 69 ? -7.909  -18.436 -4.708  1.00 0.00 ? 69 SER A HB3  2  
ATOM 2065  H HG   . SER A 1 69 ? -8.275  -19.871 -2.780  1.00 0.00 ? 69 SER A HG   2  
ATOM 2066  N N    . GLY A 1 70 ? -11.845 -18.039 -3.611  1.00 0.00 ? 70 GLY A N    2  
ATOM 2067  C CA   . GLY A 1 70 ? -13.170 -18.470 -3.205  1.00 0.00 ? 70 GLY A CA   2  
ATOM 2068  C C    . GLY A 1 70 ? -14.213 -17.385 -3.389  1.00 0.00 ? 70 GLY A C    2  
ATOM 2069  O O    . GLY A 1 70 ? -14.122 -16.317 -2.784  1.00 0.00 ? 70 GLY A O    2  
ATOM 2070  H H    . GLY A 1 70 ? -11.723 -17.572 -4.464  1.00 0.00 ? 70 GLY A H    2  
ATOM 2071  H HA2  . GLY A 1 70 ? -13.453 -19.331 -3.791  1.00 0.00 ? 70 GLY A HA2  2  
ATOM 2072  H HA3  . GLY A 1 70 ? -13.141 -18.751 -2.162  1.00 0.00 ? 70 GLY A HA3  2  
ATOM 2073  N N    . GLY A 1 1  ? -20.172 -5.292  19.303  1.00 0.00 ? 1  GLY A N    3  
ATOM 2074  C CA   . GLY A 1 1  ? -19.398 -5.251  18.076  1.00 0.00 ? 1  GLY A CA   3  
ATOM 2075  C C    . GLY A 1 1  ? -20.006 -4.330  17.038  1.00 0.00 ? 1  GLY A C    3  
ATOM 2076  O O    . GLY A 1 1  ? -20.909 -3.551  17.341  1.00 0.00 ? 1  GLY A O    3  
ATOM 2077  H H1   . GLY A 1 1  ? -21.129 -5.080  19.284  1.00 0.00 ? 1  GLY A H1   3  
ATOM 2078  H HA2  . GLY A 1 1  ? -18.399 -4.911  18.305  1.00 0.00 ? 1  GLY A HA2  3  
ATOM 2079  H HA3  . GLY A 1 1  ? -19.343 -6.249  17.667  1.00 0.00 ? 1  GLY A HA3  3  
ATOM 2080  N N    . SER A 1 2  ? -19.508 -4.417  15.808  1.00 0.00 ? 2  SER A N    3  
ATOM 2081  C CA   . SER A 1 2  ? -20.004 -3.580  14.722  1.00 0.00 ? 2  SER A CA   3  
ATOM 2082  C C    . SER A 1 2  ? -19.582 -4.142  13.367  1.00 0.00 ? 2  SER A C    3  
ATOM 2083  O O    . SER A 1 2  ? -18.431 -4.532  13.176  1.00 0.00 ? 2  SER A O    3  
ATOM 2084  C CB   . SER A 1 2  ? -19.488 -2.148  14.876  1.00 0.00 ? 2  SER A CB   3  
ATOM 2085  O OG   . SER A 1 2  ? -20.057 -1.293  13.900  1.00 0.00 ? 2  SER A OG   3  
ATOM 2086  H H    . SER A 1 2  ? -18.789 -5.058  15.628  1.00 0.00 ? 2  SER A H    3  
ATOM 2087  H HA   . SER A 1 2  ? -21.083 -3.572  14.775  1.00 0.00 ? 2  SER A HA   3  
ATOM 2088  H HB2  . SER A 1 2  ? -19.747 -1.779  15.856  1.00 0.00 ? 2  SER A HB2  3  
ATOM 2089  H HB3  . SER A 1 2  ? -18.414 -2.142  14.761  1.00 0.00 ? 2  SER A HB3  3  
ATOM 2090  H HG   . SER A 1 2  ? -20.957 -1.572  13.715  1.00 0.00 ? 2  SER A HG   3  
ATOM 2091  N N    . SER A 1 3  ? -20.524 -4.179  12.430  1.00 0.00 ? 3  SER A N    3  
ATOM 2092  C CA   . SER A 1 3  ? -20.252 -4.696  11.094  1.00 0.00 ? 3  SER A CA   3  
ATOM 2093  C C    . SER A 1 3  ? -19.364 -3.734  10.309  1.00 0.00 ? 3  SER A C    3  
ATOM 2094  O O    . SER A 1 3  ? -19.315 -2.540  10.599  1.00 0.00 ? 3  SER A O    3  
ATOM 2095  C CB   . SER A 1 3  ? -21.562 -4.929  10.338  1.00 0.00 ? 3  SER A CB   3  
ATOM 2096  O OG   . SER A 1 3  ? -22.261 -3.712  10.141  1.00 0.00 ? 3  SER A OG   3  
ATOM 2097  H H    . SER A 1 3  ? -21.423 -3.852  12.643  1.00 0.00 ? 3  SER A H    3  
ATOM 2098  H HA   . SER A 1 3  ? -19.736 -5.638  11.201  1.00 0.00 ? 3  SER A HA   3  
ATOM 2099  H HB2  . SER A 1 3  ? -21.346 -5.367  9.376   1.00 0.00 ? 3  SER A HB2  3  
ATOM 2100  H HB3  . SER A 1 3  ? -22.188 -5.602  10.908  1.00 0.00 ? 3  SER A HB3  3  
ATOM 2101  H HG   . SER A 1 3  ? -22.528 -3.355  10.990  1.00 0.00 ? 3  SER A HG   3  
ATOM 2102  N N    . GLY A 1 4  ? -18.663 -4.266  9.313   1.00 0.00 ? 4  GLY A N    3  
ATOM 2103  C CA   . GLY A 1 4  ? -17.785 -3.443  8.501   1.00 0.00 ? 4  GLY A CA   3  
ATOM 2104  C C    . GLY A 1 4  ? -16.667 -4.242  7.863   1.00 0.00 ? 4  GLY A C    3  
ATOM 2105  O O    . GLY A 1 4  ? -16.755 -5.465  7.749   1.00 0.00 ? 4  GLY A O    3  
ATOM 2106  H H    . GLY A 1 4  ? -18.742 -5.225  9.127   1.00 0.00 ? 4  GLY A H    3  
ATOM 2107  H HA2  . GLY A 1 4  ? -18.368 -2.973  7.723   1.00 0.00 ? 4  GLY A HA2  3  
ATOM 2108  H HA3  . GLY A 1 4  ? -17.352 -2.675  9.126   1.00 0.00 ? 4  GLY A HA3  3  
ATOM 2109  N N    . SER A 1 5  ? -15.612 -3.550  7.444   1.00 0.00 ? 5  SER A N    3  
ATOM 2110  C CA   . SER A 1 5  ? -14.473 -4.203  6.808   1.00 0.00 ? 5  SER A CA   3  
ATOM 2111  C C    . SER A 1 5  ? -13.204 -4.004  7.631   1.00 0.00 ? 5  SER A C    3  
ATOM 2112  O O    . SER A 1 5  ? -13.118 -3.087  8.447   1.00 0.00 ? 5  SER A O    3  
ATOM 2113  C CB   . SER A 1 5  ? -14.269 -3.655  5.394   1.00 0.00 ? 5  SER A CB   3  
ATOM 2114  O OG   . SER A 1 5  ? -13.791 -2.321  5.428   1.00 0.00 ? 5  SER A OG   3  
ATOM 2115  H H    . SER A 1 5  ? -15.601 -2.577  7.562   1.00 0.00 ? 5  SER A H    3  
ATOM 2116  H HA   . SER A 1 5  ? -14.688 -5.259  6.748   1.00 0.00 ? 5  SER A HA   3  
ATOM 2117  H HB2  . SER A 1 5  ? -13.549 -4.269  4.874   1.00 0.00 ? 5  SER A HB2  3  
ATOM 2118  H HB3  . SER A 1 5  ? -15.210 -3.675  4.864   1.00 0.00 ? 5  SER A HB3  3  
ATOM 2119  H HG   . SER A 1 5  ? -13.712 -1.987  4.532   1.00 0.00 ? 5  SER A HG   3  
ATOM 2120  N N    . SER A 1 6  ? -12.222 -4.872  7.410   1.00 0.00 ? 6  SER A N    3  
ATOM 2121  C CA   . SER A 1 6  ? -10.958 -4.796  8.133   1.00 0.00 ? 6  SER A CA   3  
ATOM 2122  C C    . SER A 1 6  ? -9.803  -4.506  7.180   1.00 0.00 ? 6  SER A C    3  
ATOM 2123  O O    . SER A 1 6  ? -8.902  -3.730  7.496   1.00 0.00 ? 6  SER A O    3  
ATOM 2124  C CB   . SER A 1 6  ? -10.697 -6.102  8.886   1.00 0.00 ? 6  SER A CB   3  
ATOM 2125  O OG   . SER A 1 6  ? -11.325 -6.093  10.156  1.00 0.00 ? 6  SER A OG   3  
ATOM 2126  H H    . SER A 1 6  ? -12.351 -5.582  6.746   1.00 0.00 ? 6  SER A H    3  
ATOM 2127  H HA   . SER A 1 6  ? -11.032 -3.988  8.846   1.00 0.00 ? 6  SER A HA   3  
ATOM 2128  H HB2  . SER A 1 6  ? -11.085 -6.929  8.312   1.00 0.00 ? 6  SER A HB2  3  
ATOM 2129  H HB3  . SER A 1 6  ? -9.633  -6.228  9.025   1.00 0.00 ? 6  SER A HB3  3  
ATOM 2130  H HG   . SER A 1 6  ? -11.938 -6.829  10.216  1.00 0.00 ? 6  SER A HG   3  
ATOM 2131  N N    . GLY A 1 7  ? -9.837  -5.136  6.010   1.00 0.00 ? 7  GLY A N    3  
ATOM 2132  C CA   . GLY A 1 7  ? -8.789  -4.933  5.027   1.00 0.00 ? 7  GLY A CA   3  
ATOM 2133  C C    . GLY A 1 7  ? -7.830  -6.106  4.952   1.00 0.00 ? 7  GLY A C    3  
ATOM 2134  O O    . GLY A 1 7  ? -7.623  -6.813  5.938   1.00 0.00 ? 7  GLY A O    3  
ATOM 2135  H H    . GLY A 1 7  ? -10.581 -5.743  5.812   1.00 0.00 ? 7  GLY A H    3  
ATOM 2136  H HA2  . GLY A 1 7  ? -9.242  -4.789  4.058   1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2137  H HA3  . GLY A 1 7  ? -8.232  -4.045  5.289   1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2138  N N    . THR A 1 8  ? -7.245  -6.315  3.777   1.00 0.00 ? 8  THR A N    3  
ATOM 2139  C CA   . THR A 1 8  ? -6.306  -7.411  3.575   1.00 0.00 ? 8  THR A CA   3  
ATOM 2140  C C    . THR A 1 8  ? -4.885  -6.992  3.937   1.00 0.00 ? 8  THR A C    3  
ATOM 2141  O O    . THR A 1 8  ? -4.443  -5.884  3.634   1.00 0.00 ? 8  THR A O    3  
ATOM 2142  C CB   . THR A 1 8  ? -6.326  -7.908  2.117   1.00 0.00 ? 8  THR A CB   3  
ATOM 2143  O OG1  . THR A 1 8  ? -7.624  -8.417  1.792   1.00 0.00 ? 8  THR A OG1  3  
ATOM 2144  C CG2  . THR A 1 8  ? -5.281  -8.991  1.900   1.00 0.00 ? 8  THR A CG2  3  
ATOM 2145  H H    . THR A 1 8  ? -7.450  -5.717  3.028   1.00 0.00 ? 8  THR A H    3  
ATOM 2146  H HA   . THR A 1 8  ? -6.604  -8.228  4.216   1.00 0.00 ? 8  THR A HA   3  
ATOM 2147  H HB   . THR A 1 8  ? -6.101  -7.075  1.466   1.00 0.00 ? 8  THR A HB   3  
ATOM 2148  H HG1  . THR A 1 8  ? -7.678  -9.342  2.044   1.00 0.00 ? 8  THR A HG1  3  
ATOM 2149  H HG21 . THR A 1 8  ? -4.402  -8.767  2.486   1.00 0.00 ? 8  THR A HG21 3  
ATOM 2150  H HG22 . THR A 1 8  ? -5.017  -9.032  0.854   1.00 0.00 ? 8  THR A HG22 3  
ATOM 2151  H HG23 . THR A 1 8  ? -5.683  -9.945  2.206   1.00 0.00 ? 8  THR A HG23 3  
ATOM 2152  N N    . PRO A 1 9  ? -4.151  -7.897  4.601   1.00 0.00 ? 9  PRO A N    3  
ATOM 2153  C CA   . PRO A 1 9  ? -2.769  -7.644  5.018   1.00 0.00 ? 9  PRO A CA   3  
ATOM 2154  C C    . PRO A 1 9  ? -1.808  -7.588  3.835   1.00 0.00 ? 9  PRO A C    3  
ATOM 2155  O O    . PRO A 1 9  ? -1.981  -8.303  2.848   1.00 0.00 ? 9  PRO A O    3  
ATOM 2156  C CB   . PRO A 1 9  ? -2.444  -8.841  5.914   1.00 0.00 ? 9  PRO A CB   3  
ATOM 2157  C CG   . PRO A 1 9  ? -3.354  -9.924  5.446   1.00 0.00 ? 9  PRO A CG   3  
ATOM 2158  C CD   . PRO A 1 9  ? -4.615  -9.238  4.996   1.00 0.00 ? 9  PRO A CD   3  
ATOM 2159  H HA   . PRO A 1 9  ? -2.688  -6.731  5.589   1.00 0.00 ? 9  PRO A HA   3  
ATOM 2160  H HB2  . PRO A 1 9  ? -1.406  -9.116  5.790   1.00 0.00 ? 9  PRO A HB2  3  
ATOM 2161  H HB3  . PRO A 1 9  ? -2.633  -8.585  6.946   1.00 0.00 ? 9  PRO A HB3  3  
ATOM 2162  H HG2  . PRO A 1 9  ? -2.901  -10.454 4.623   1.00 0.00 ? 9  PRO A HG2  3  
ATOM 2163  H HG3  . PRO A 1 9  ? -3.567  -10.601 6.260   1.00 0.00 ? 9  PRO A HG3  3  
ATOM 2164  H HD2  . PRO A 1 9  ? -5.048  -9.760  4.155   1.00 0.00 ? 9  PRO A HD2  3  
ATOM 2165  H HD3  . PRO A 1 9  ? -5.322  -9.177  5.809   1.00 0.00 ? 9  PRO A HD3  3  
ATOM 2166  N N    . TYR A 1 10 ? -0.796  -6.735  3.941   1.00 0.00 ? 10 TYR A N    3  
ATOM 2167  C CA   . TYR A 1 10 ? 0.192   -6.585  2.879   1.00 0.00 ? 10 TYR A CA   3  
ATOM 2168  C C    . TYR A 1 10 ? 1.568   -6.265  3.456   1.00 0.00 ? 10 TYR A C    3  
ATOM 2169  O O    . TYR A 1 10 ? 1.723   -6.101  4.666   1.00 0.00 ? 10 TYR A O    3  
ATOM 2170  C CB   . TYR A 1 10 ? -0.235  -5.482  1.909   1.00 0.00 ? 10 TYR A CB   3  
ATOM 2171  C CG   . TYR A 1 10 ? -1.151  -5.965  0.808   1.00 0.00 ? 10 TYR A CG   3  
ATOM 2172  C CD1  . TYR A 1 10 ? -2.463  -6.333  1.081   1.00 0.00 ? 10 TYR A CD1  3  
ATOM 2173  C CD2  . TYR A 1 10 ? -0.705  -6.055  -0.505  1.00 0.00 ? 10 TYR A CD2  3  
ATOM 2174  C CE1  . TYR A 1 10 ? -3.304  -6.776  0.078   1.00 0.00 ? 10 TYR A CE1  3  
ATOM 2175  C CE2  . TYR A 1 10 ? -1.539  -6.495  -1.514  1.00 0.00 ? 10 TYR A CE2  3  
ATOM 2176  C CZ   . TYR A 1 10 ? -2.837  -6.855  -1.218  1.00 0.00 ? 10 TYR A CZ   3  
ATOM 2177  O OH   . TYR A 1 10 ? -3.670  -7.296  -2.221  1.00 0.00 ? 10 TYR A OH   3  
ATOM 2178  H H    . TYR A 1 10 ? -0.711  -6.192  4.753   1.00 0.00 ? 10 TYR A H    3  
ATOM 2179  H HA   . TYR A 1 10 ? 0.247   -7.520  2.343   1.00 0.00 ? 10 TYR A HA   3  
ATOM 2180  H HB2  . TYR A 1 10 ? -0.755  -4.711  2.458   1.00 0.00 ? 10 TYR A HB2  3  
ATOM 2181  H HB3  . TYR A 1 10 ? 0.644   -5.057  1.448   1.00 0.00 ? 10 TYR A HB3  3  
ATOM 2182  H HD1  . TYR A 1 10 ? -2.826  -6.270  2.096   1.00 0.00 ? 10 TYR A HD1  3  
ATOM 2183  H HD2  . TYR A 1 10 ? 0.313   -5.773  -0.733  1.00 0.00 ? 10 TYR A HD2  3  
ATOM 2184  H HE1  . TYR A 1 10 ? -4.321  -7.058  0.309   1.00 0.00 ? 10 TYR A HE1  3  
ATOM 2185  H HE2  . TYR A 1 10 ? -1.174  -6.558  -2.528  1.00 0.00 ? 10 TYR A HE2  3  
ATOM 2186  H HH   . TYR A 1 10 ? -3.999  -8.171  -2.002  1.00 0.00 ? 10 TYR A HH   3  
ATOM 2187  N N    . ARG A 1 11 ? 2.564   -6.179  2.580   1.00 0.00 ? 11 ARG A N    3  
ATOM 2188  C CA   . ARG A 1 11 ? 3.927   -5.880  3.000   1.00 0.00 ? 11 ARG A CA   3  
ATOM 2189  C C    . ARG A 1 11 ? 4.666   -5.088  1.926   1.00 0.00 ? 11 ARG A C    3  
ATOM 2190  O O    . ARG A 1 11 ? 4.633   -5.441  0.748   1.00 0.00 ? 11 ARG A O    3  
ATOM 2191  C CB   . ARG A 1 11 ? 4.684   -7.173  3.307   1.00 0.00 ? 11 ARG A CB   3  
ATOM 2192  C CG   . ARG A 1 11 ? 6.187   -6.984  3.435   1.00 0.00 ? 11 ARG A CG   3  
ATOM 2193  C CD   . ARG A 1 11 ? 6.886   -8.290  3.778   1.00 0.00 ? 11 ARG A CD   3  
ATOM 2194  N NE   . ARG A 1 11 ? 6.927   -9.204  2.640   1.00 0.00 ? 11 ARG A NE   3  
ATOM 2195  C CZ   . ARG A 1 11 ? 7.159   -10.507 2.752   1.00 0.00 ? 11 ARG A CZ   3  
ATOM 2196  N NH1  . ARG A 1 11 ? 7.370   -11.046 3.944   1.00 0.00 ? 11 ARG A NH1  3  
ATOM 2197  N NH2  . ARG A 1 11 ? 7.180   -11.274 1.669   1.00 0.00 ? 11 ARG A NH2  3  
ATOM 2198  H H    . ARG A 1 11 ? 2.377   -6.320  1.628   1.00 0.00 ? 11 ARG A H    3  
ATOM 2199  H HA   . ARG A 1 11 ? 3.874   -5.283  3.899   1.00 0.00 ? 11 ARG A HA   3  
ATOM 2200  H HB2  . ARG A 1 11 ? 4.315   -7.582  4.236   1.00 0.00 ? 11 ARG A HB2  3  
ATOM 2201  H HB3  . ARG A 1 11 ? 4.499   -7.881  2.513   1.00 0.00 ? 11 ARG A HB3  3  
ATOM 2202  H HG2  . ARG A 1 11 ? 6.576   -6.616  2.497   1.00 0.00 ? 11 ARG A HG2  3  
ATOM 2203  H HG3  . ARG A 1 11 ? 6.384   -6.264  4.216   1.00 0.00 ? 11 ARG A HG3  3  
ATOM 2204  H HD2  . ARG A 1 11 ? 7.897   -8.071  4.088   1.00 0.00 ? 11 ARG A HD2  3  
ATOM 2205  H HD3  . ARG A 1 11 ? 6.355   -8.764  4.590   1.00 0.00 ? 11 ARG A HD3  3  
ATOM 2206  H HE   . ARG A 1 11 ? 6.773   -8.827  1.749   1.00 0.00 ? 11 ARG A HE   3  
ATOM 2207  H HH11 . ARG A 1 11 ? 7.353   -10.471 4.762   1.00 0.00 ? 11 ARG A HH11 3  
ATOM 2208  H HH12 . ARG A 1 11 ? 7.543   -12.028 4.026   1.00 0.00 ? 11 ARG A HH12 3  
ATOM 2209  H HH21 . ARG A 1 11 ? 7.021   -10.871 0.768   1.00 0.00 ? 11 ARG A HH21 3  
ATOM 2210  H HH22 . ARG A 1 11 ? 7.355   -12.254 1.754   1.00 0.00 ? 11 ARG A HH22 3  
ATOM 2211  N N    . ALA A 1 12 ? 5.331   -4.015  2.341   1.00 0.00 ? 12 ALA A N    3  
ATOM 2212  C CA   . ALA A 1 12 ? 6.079   -3.173  1.415   1.00 0.00 ? 12 ALA A CA   3  
ATOM 2213  C C    . ALA A 1 12 ? 7.425   -3.801  1.069   1.00 0.00 ? 12 ALA A C    3  
ATOM 2214  O O    . ALA A 1 12 ? 8.349   -3.798  1.881   1.00 0.00 ? 12 ALA A O    3  
ATOM 2215  C CB   . ALA A 1 12 ? 6.278   -1.786  2.006   1.00 0.00 ? 12 ALA A CB   3  
ATOM 2216  H H    . ALA A 1 12 ? 5.320   -3.784  3.294   1.00 0.00 ? 12 ALA A H    3  
ATOM 2217  H HA   . ALA A 1 12 ? 5.497   -3.073  0.511   1.00 0.00 ? 12 ALA A HA   3  
ATOM 2218  H HB1  . ALA A 1 12 ? 5.837   -1.049  1.350   1.00 0.00 ? 12 ALA A HB1  3  
ATOM 2219  H HB2  . ALA A 1 12 ? 5.804   -1.736  2.975   1.00 0.00 ? 12 ALA A HB2  3  
ATOM 2220  H HB3  . ALA A 1 12 ? 7.334   -1.587  2.111   1.00 0.00 ? 12 ALA A HB3  3  
ATOM 2221  N N    . MET A 1 13 ? 7.528   -4.338  -0.143  1.00 0.00 ? 13 MET A N    3  
ATOM 2222  C CA   . MET A 1 13 ? 8.762   -4.969  -0.596  1.00 0.00 ? 13 MET A CA   3  
ATOM 2223  C C    . MET A 1 13 ? 9.898   -3.953  -0.666  1.00 0.00 ? 13 MET A C    3  
ATOM 2224  O O    . MET A 1 13 ? 11.072  -4.322  -0.688  1.00 0.00 ? 13 MET A O    3  
ATOM 2225  C CB   . MET A 1 13 ? 8.555   -5.616  -1.967  1.00 0.00 ? 13 MET A CB   3  
ATOM 2226  C CG   . MET A 1 13 ? 7.325   -6.506  -2.040  1.00 0.00 ? 13 MET A CG   3  
ATOM 2227  S SD   . MET A 1 13 ? 7.455   -7.766  -3.323  1.00 0.00 ? 13 MET A SD   3  
ATOM 2228  C CE   . MET A 1 13 ? 6.652   -6.938  -4.693  1.00 0.00 ? 13 MET A CE   3  
ATOM 2229  H H    . MET A 1 13 ? 6.756   -4.310  -0.746  1.00 0.00 ? 13 MET A H    3  
ATOM 2230  H HA   . MET A 1 13 ? 9.024   -5.735  0.117   1.00 0.00 ? 13 MET A HA   3  
ATOM 2231  H HB2  . MET A 1 13 ? 8.453   -4.837  -2.708  1.00 0.00 ? 13 MET A HB2  3  
ATOM 2232  H HB3  . MET A 1 13 ? 9.421   -6.215  -2.204  1.00 0.00 ? 13 MET A HB3  3  
ATOM 2233  H HG2  . MET A 1 13 ? 7.195   -6.996  -1.087  1.00 0.00 ? 13 MET A HG2  3  
ATOM 2234  H HG3  . MET A 1 13 ? 6.463   -5.889  -2.246  1.00 0.00 ? 13 MET A HG3  3  
ATOM 2235  H HE1  . MET A 1 13 ? 7.018   -7.345  -5.624  1.00 0.00 ? 13 MET A HE1  3  
ATOM 2236  H HE2  . MET A 1 13 ? 5.585   -7.089  -4.629  1.00 0.00 ? 13 MET A HE2  3  
ATOM 2237  H HE3  . MET A 1 13 ? 6.870   -5.881  -4.652  1.00 0.00 ? 13 MET A HE3  3  
ATOM 2238  N N    . TYR A 1 14 ? 9.540   -2.674  -0.702  1.00 0.00 ? 14 TYR A N    3  
ATOM 2239  C CA   . TYR A 1 14 ? 10.530  -1.606  -0.773  1.00 0.00 ? 14 TYR A CA   3  
ATOM 2240  C C    . TYR A 1 14 ? 9.965   -0.303  -0.215  1.00 0.00 ? 14 TYR A C    3  
ATOM 2241  O O    . TYR A 1 14 ? 8.767   -0.040  -0.315  1.00 0.00 ? 14 TYR A O    3  
ATOM 2242  C CB   . TYR A 1 14 ? 10.986  -1.399  -2.218  1.00 0.00 ? 14 TYR A CB   3  
ATOM 2243  C CG   . TYR A 1 14 ? 10.943  -2.659  -3.052  1.00 0.00 ? 14 TYR A CG   3  
ATOM 2244  C CD1  . TYR A 1 14 ? 11.974  -3.589  -2.995  1.00 0.00 ? 14 TYR A CD1  3  
ATOM 2245  C CD2  . TYR A 1 14 ? 9.872   -2.920  -3.899  1.00 0.00 ? 14 TYR A CD2  3  
ATOM 2246  C CE1  . TYR A 1 14 ? 11.939  -4.742  -3.756  1.00 0.00 ? 14 TYR A CE1  3  
ATOM 2247  C CE2  . TYR A 1 14 ? 9.829   -4.070  -4.662  1.00 0.00 ? 14 TYR A CE2  3  
ATOM 2248  C CZ   . TYR A 1 14 ? 10.865  -4.978  -4.588  1.00 0.00 ? 14 TYR A CZ   3  
ATOM 2249  O OH   . TYR A 1 14 ? 10.826  -6.124  -5.348  1.00 0.00 ? 14 TYR A OH   3  
ATOM 2250  H H    . TYR A 1 14 ? 8.588   -2.443  -0.682  1.00 0.00 ? 14 TYR A H    3  
ATOM 2251  H HA   . TYR A 1 14 ? 11.380  -1.901  -0.176  1.00 0.00 ? 14 TYR A HA   3  
ATOM 2252  H HB2  . TYR A 1 14 ? 10.347  -0.668  -2.689  1.00 0.00 ? 14 TYR A HB2  3  
ATOM 2253  H HB3  . TYR A 1 14 ? 12.003  -1.035  -2.218  1.00 0.00 ? 14 TYR A HB3  3  
ATOM 2254  H HD1  . TYR A 1 14 ? 12.814  -3.402  -2.342  1.00 0.00 ? 14 TYR A HD1  3  
ATOM 2255  H HD2  . TYR A 1 14 ? 9.063   -2.206  -3.955  1.00 0.00 ? 14 TYR A HD2  3  
ATOM 2256  H HE1  . TYR A 1 14 ? 12.750  -5.453  -3.698  1.00 0.00 ? 14 TYR A HE1  3  
ATOM 2257  H HE2  . TYR A 1 14 ? 8.988   -4.255  -5.314  1.00 0.00 ? 14 TYR A HE2  3  
ATOM 2258  H HH   . TYR A 1 14 ? 11.386  -6.015  -6.120  1.00 0.00 ? 14 TYR A HH   3  
ATOM 2259  N N    . GLN A 1 15 ? 10.838  0.509   0.372   1.00 0.00 ? 15 GLN A N    3  
ATOM 2260  C CA   . GLN A 1 15 ? 10.428  1.785   0.947   1.00 0.00 ? 15 GLN A CA   3  
ATOM 2261  C C    . GLN A 1 15 ? 9.943   2.740   -0.139  1.00 0.00 ? 15 GLN A C    3  
ATOM 2262  O O    . GLN A 1 15 ? 10.509  2.793   -1.231  1.00 0.00 ? 15 GLN A O    3  
ATOM 2263  C CB   . GLN A 1 15 ? 11.587  2.418   1.719   1.00 0.00 ? 15 GLN A CB   3  
ATOM 2264  C CG   . GLN A 1 15 ? 11.221  3.725   2.402   1.00 0.00 ? 15 GLN A CG   3  
ATOM 2265  C CD   . GLN A 1 15 ? 12.429  4.600   2.674   1.00 0.00 ? 15 GLN A CD   3  
ATOM 2266  O OE1  . GLN A 1 15 ? 12.798  5.442   1.855   1.00 0.00 ? 15 GLN A OE1  3  
ATOM 2267  N NE2  . GLN A 1 15 ? 13.053  4.404   3.830   1.00 0.00 ? 15 GLN A NE2  3  
ATOM 2268  H H    . GLN A 1 15 ? 11.780  0.244   0.421   1.00 0.00 ? 15 GLN A H    3  
ATOM 2269  H HA   . GLN A 1 15 ? 9.614   1.594   1.630   1.00 0.00 ? 15 GLN A HA   3  
ATOM 2270  H HB2  . GLN A 1 15 ? 11.923  1.723   2.474   1.00 0.00 ? 15 GLN A HB2  3  
ATOM 2271  H HB3  . GLN A 1 15 ? 12.398  2.610   1.032   1.00 0.00 ? 15 GLN A HB3  3  
ATOM 2272  H HG2  . GLN A 1 15 ? 10.538  4.270   1.767   1.00 0.00 ? 15 GLN A HG2  3  
ATOM 2273  H HG3  . GLN A 1 15 ? 10.737  3.502   3.341   1.00 0.00 ? 15 GLN A HG3  3  
ATOM 2274  H HE21 . GLN A 1 15 ? 12.704  3.715   4.433   1.00 0.00 ? 15 GLN A HE21 3  
ATOM 2275  H HE22 . GLN A 1 15 ? 13.838  4.955   4.031   1.00 0.00 ? 15 GLN A HE22 3  
ATOM 2276  N N    . TYR A 1 16 ? 8.892   3.493   0.168   1.00 0.00 ? 16 TYR A N    3  
ATOM 2277  C CA   . TYR A 1 16 ? 8.330   4.444   -0.783  1.00 0.00 ? 16 TYR A CA   3  
ATOM 2278  C C    . TYR A 1 16 ? 8.520   5.877   -0.297  1.00 0.00 ? 16 TYR A C    3  
ATOM 2279  O O    . TYR A 1 16 ? 8.556   6.137   0.906   1.00 0.00 ? 16 TYR A O    3  
ATOM 2280  C CB   . TYR A 1 16 ? 6.842   4.160   -1.001  1.00 0.00 ? 16 TYR A CB   3  
ATOM 2281  C CG   . TYR A 1 16 ? 6.192   5.079   -2.010  1.00 0.00 ? 16 TYR A CG   3  
ATOM 2282  C CD1  . TYR A 1 16 ? 6.424   4.925   -3.371  1.00 0.00 ? 16 TYR A CD1  3  
ATOM 2283  C CD2  . TYR A 1 16 ? 5.344   6.102   -1.602  1.00 0.00 ? 16 TYR A CD2  3  
ATOM 2284  C CE1  . TYR A 1 16 ? 5.833   5.763   -4.296  1.00 0.00 ? 16 TYR A CE1  3  
ATOM 2285  C CE2  . TYR A 1 16 ? 4.747   6.944   -2.521  1.00 0.00 ? 16 TYR A CE2  3  
ATOM 2286  C CZ   . TYR A 1 16 ? 4.995   6.771   -3.866  1.00 0.00 ? 16 TYR A CZ   3  
ATOM 2287  O OH   . TYR A 1 16 ? 4.403   7.607   -4.785  1.00 0.00 ? 16 TYR A OH   3  
ATOM 2288  H H    . TYR A 1 16 ? 8.484   3.405   1.054   1.00 0.00 ? 16 TYR A H    3  
ATOM 2289  H HA   . TYR A 1 16 ? 8.850   4.322   -1.722  1.00 0.00 ? 16 TYR A HA   3  
ATOM 2290  H HB2  . TYR A 1 16 ? 6.724   3.147   -1.352  1.00 0.00 ? 16 TYR A HB2  3  
ATOM 2291  H HB3  . TYR A 1 16 ? 6.320   4.275   -0.062  1.00 0.00 ? 16 TYR A HB3  3  
ATOM 2292  H HD1  . TYR A 1 16 ? 7.081   4.134   -3.704  1.00 0.00 ? 16 TYR A HD1  3  
ATOM 2293  H HD2  . TYR A 1 16 ? 5.152   6.236   -0.547  1.00 0.00 ? 16 TYR A HD2  3  
ATOM 2294  H HE1  . TYR A 1 16 ? 6.026   5.627   -5.350  1.00 0.00 ? 16 TYR A HE1  3  
ATOM 2295  H HE2  . TYR A 1 16 ? 4.092   7.734   -2.184  1.00 0.00 ? 16 TYR A HE2  3  
ATOM 2296  H HH   . TYR A 1 16 ? 5.080   8.016   -5.328  1.00 0.00 ? 16 TYR A HH   3  
ATOM 2297  N N    . ARG A 1 17 ? 8.640   6.804   -1.242  1.00 0.00 ? 17 ARG A N    3  
ATOM 2298  C CA   . ARG A 1 17 ? 8.827   8.212   -0.911  1.00 0.00 ? 17 ARG A CA   3  
ATOM 2299  C C    . ARG A 1 17 ? 7.719   9.065   -1.521  1.00 0.00 ? 17 ARG A C    3  
ATOM 2300  O O    . ARG A 1 17 ? 7.839   9.581   -2.633  1.00 0.00 ? 17 ARG A O    3  
ATOM 2301  C CB   . ARG A 1 17 ? 10.190  8.698   -1.407  1.00 0.00 ? 17 ARG A CB   3  
ATOM 2302  C CG   . ARG A 1 17 ? 11.363  8.103   -0.644  1.00 0.00 ? 17 ARG A CG   3  
ATOM 2303  C CD   . ARG A 1 17 ? 12.642  8.887   -0.889  1.00 0.00 ? 17 ARG A CD   3  
ATOM 2304  N NE   . ARG A 1 17 ? 13.185  8.647   -2.224  1.00 0.00 ? 17 ARG A NE   3  
ATOM 2305  C CZ   . ARG A 1 17 ? 14.230  9.299   -2.721  1.00 0.00 ? 17 ARG A CZ   3  
ATOM 2306  N NH1  . ARG A 1 17 ? 14.841  10.227  -1.998  1.00 0.00 ? 17 ARG A NH1  3  
ATOM 2307  N NH2  . ARG A 1 17 ? 14.665  9.024   -3.944  1.00 0.00 ? 17 ARG A NH2  3  
ATOM 2308  H H    . ARG A 1 17 ? 8.603   6.536   -2.184  1.00 0.00 ? 17 ARG A H    3  
ATOM 2309  H HA   . ARG A 1 17 ? 8.790   8.309   0.163   1.00 0.00 ? 17 ARG A HA   3  
ATOM 2310  H HB2  . ARG A 1 17 ? 10.296  8.434   -2.449  1.00 0.00 ? 17 ARG A HB2  3  
ATOM 2311  H HB3  . ARG A 1 17 ? 10.233  9.772   -1.310  1.00 0.00 ? 17 ARG A HB3  3  
ATOM 2312  H HG2  . ARG A 1 17 ? 11.140  8.121   0.412   1.00 0.00 ? 17 ARG A HG2  3  
ATOM 2313  H HG3  . ARG A 1 17 ? 11.509  7.082   -0.966  1.00 0.00 ? 17 ARG A HG3  3  
ATOM 2314  H HD2  . ARG A 1 17 ? 12.429  9.940   -0.783  1.00 0.00 ? 17 ARG A HD2  3  
ATOM 2315  H HD3  . ARG A 1 17 ? 13.376  8.593   -0.154  1.00 0.00 ? 17 ARG A HD3  3  
ATOM 2316  H HE   . ARG A 1 17 ? 12.748  7.965   -2.775  1.00 0.00 ? 17 ARG A HE   3  
ATOM 2317  H HH11 . ARG A 1 17 ? 14.516  10.436  -1.076  1.00 0.00 ? 17 ARG A HH11 3  
ATOM 2318  H HH12 . ARG A 1 17 ? 15.628  10.717  -2.375  1.00 0.00 ? 17 ARG A HH12 3  
ATOM 2319  H HH21 . ARG A 1 17 ? 14.207  8.325   -4.492  1.00 0.00 ? 17 ARG A HH21 3  
ATOM 2320  H HH22 . ARG A 1 17 ? 15.451  9.516   -4.317  1.00 0.00 ? 17 ARG A HH22 3  
ATOM 2321  N N    . PRO A 1 18 ? 6.613   9.218   -0.778  1.00 0.00 ? 18 PRO A N    3  
ATOM 2322  C CA   . PRO A 1 18 ? 5.462   10.009  -1.225  1.00 0.00 ? 18 PRO A CA   3  
ATOM 2323  C C    . PRO A 1 18 ? 5.763   11.503  -1.260  1.00 0.00 ? 18 PRO A C    3  
ATOM 2324  O O    . PRO A 1 18 ? 6.151   12.090  -0.251  1.00 0.00 ? 18 PRO A O    3  
ATOM 2325  C CB   . PRO A 1 18 ? 4.392   9.703   -0.173  1.00 0.00 ? 18 PRO A CB   3  
ATOM 2326  C CG   . PRO A 1 18 ? 5.158   9.322   1.047   1.00 0.00 ? 18 PRO A CG   3  
ATOM 2327  C CD   . PRO A 1 18 ? 6.401   8.632   0.556   1.00 0.00 ? 18 PRO A CD   3  
ATOM 2328  H HA   . PRO A 1 18 ? 5.115   9.689   -2.197  1.00 0.00 ? 18 PRO A HA   3  
ATOM 2329  H HB2  . PRO A 1 18 ? 3.789   10.585  -0.003  1.00 0.00 ? 18 PRO A HB2  3  
ATOM 2330  H HB3  . PRO A 1 18 ? 3.766   8.893   -0.515  1.00 0.00 ? 18 PRO A HB3  3  
ATOM 2331  H HG2  . PRO A 1 18 ? 5.417   10.207  1.609   1.00 0.00 ? 18 PRO A HG2  3  
ATOM 2332  H HG3  . PRO A 1 18 ? 4.570   8.649   1.653   1.00 0.00 ? 18 PRO A HG3  3  
ATOM 2333  H HD2  . PRO A 1 18 ? 7.234   8.847   1.209   1.00 0.00 ? 18 PRO A HD2  3  
ATOM 2334  H HD3  . PRO A 1 18 ? 6.238   7.567   0.487   1.00 0.00 ? 18 PRO A HD3  3  
ATOM 2335  N N    . GLN A 1 19 ? 5.581   12.111  -2.428  1.00 0.00 ? 19 GLN A N    3  
ATOM 2336  C CA   . GLN A 1 19 ? 5.834   13.537  -2.593  1.00 0.00 ? 19 GLN A CA   3  
ATOM 2337  C C    . GLN A 1 19 ? 4.841   14.364  -1.783  1.00 0.00 ? 19 GLN A C    3  
ATOM 2338  O O    . GLN A 1 19 ? 5.176   15.436  -1.280  1.00 0.00 ? 19 GLN A O    3  
ATOM 2339  C CB   . GLN A 1 19 ? 5.752   13.924  -4.071  1.00 0.00 ? 19 GLN A CB   3  
ATOM 2340  C CG   . GLN A 1 19 ? 6.776   13.215  -4.943  1.00 0.00 ? 19 GLN A CG   3  
ATOM 2341  C CD   . GLN A 1 19 ? 8.191   13.697  -4.690  1.00 0.00 ? 19 GLN A CD   3  
ATOM 2342  O OE1  . GLN A 1 19 ? 8.909   13.141  -3.858  1.00 0.00 ? 19 GLN A OE1  3  
ATOM 2343  N NE2  . GLN A 1 19 ? 8.601   14.736  -5.408  1.00 0.00 ? 19 GLN A NE2  3  
ATOM 2344  H H    . GLN A 1 19 ? 5.271   11.589  -3.196  1.00 0.00 ? 19 GLN A H    3  
ATOM 2345  H HA   . GLN A 1 19 ? 6.831   13.741  -2.233  1.00 0.00 ? 19 GLN A HA   3  
ATOM 2346  H HB2  . GLN A 1 19 ? 4.767   13.680  -4.440  1.00 0.00 ? 19 GLN A HB2  3  
ATOM 2347  H HB3  . GLN A 1 19 ? 5.909   14.988  -4.162  1.00 0.00 ? 19 GLN A HB3  3  
ATOM 2348  H HG2  . GLN A 1 19 ? 6.732   12.155  -4.740  1.00 0.00 ? 19 GLN A HG2  3  
ATOM 2349  H HG3  . GLN A 1 19 ? 6.531   13.393  -5.980  1.00 0.00 ? 19 GLN A HG3  3  
ATOM 2350  H HE21 . GLN A 1 19 ? 7.974   15.129  -6.052  1.00 0.00 ? 19 GLN A HE21 3  
ATOM 2351  H HE22 . GLN A 1 19 ? 9.510   15.068  -5.264  1.00 0.00 ? 19 GLN A HE22 3  
ATOM 2352  N N    . ASN A 1 20 ? 3.618   13.858  -1.663  1.00 0.00 ? 20 ASN A N    3  
ATOM 2353  C CA   . ASN A 1 20 ? 2.575   14.551  -0.914  1.00 0.00 ? 20 ASN A CA   3  
ATOM 2354  C C    . ASN A 1 20 ? 1.895   13.607  0.072   1.00 0.00 ? 20 ASN A C    3  
ATOM 2355  O O    . ASN A 1 20 ? 2.009   12.387  -0.043  1.00 0.00 ? 20 ASN A O    3  
ATOM 2356  C CB   . ASN A 1 20 ? 1.537   15.140  -1.872  1.00 0.00 ? 20 ASN A CB   3  
ATOM 2357  C CG   . ASN A 1 20 ? 0.968   14.101  -2.818  1.00 0.00 ? 20 ASN A CG   3  
ATOM 2358  O OD1  . ASN A 1 20 ? 0.966   12.907  -2.518  1.00 0.00 ? 20 ASN A OD1  3  
ATOM 2359  N ND2  . ASN A 1 20 ? 0.481   14.552  -3.968  1.00 0.00 ? 20 ASN A ND2  3  
ATOM 2360  H H    . ASN A 1 20 ? 3.411   12.999  -2.087  1.00 0.00 ? 20 ASN A H    3  
ATOM 2361  H HA   . ASN A 1 20 ? 3.040   15.354  -0.363  1.00 0.00 ? 20 ASN A HA   3  
ATOM 2362  H HB2  . ASN A 1 20 ? 0.724   15.560  -1.297  1.00 0.00 ? 20 ASN A HB2  3  
ATOM 2363  H HB3  . ASN A 1 20 ? 1.998   15.921  -2.458  1.00 0.00 ? 20 ASN A HB3  3  
ATOM 2364  H HD21 . ASN A 1 20 ? 0.516   15.516  -4.140  1.00 0.00 ? 20 ASN A HD21 3  
ATOM 2365  H HD22 . ASN A 1 20 ? 0.106   13.902  -4.598  1.00 0.00 ? 20 ASN A HD22 3  
ATOM 2366  N N    . GLU A 1 21 ? 1.188   14.180  1.041   1.00 0.00 ? 21 GLU A N    3  
ATOM 2367  C CA   . GLU A 1 21 ? 0.490   13.389  2.047   1.00 0.00 ? 21 GLU A CA   3  
ATOM 2368  C C    . GLU A 1 21 ? -0.523  12.451  1.396   1.00 0.00 ? 21 GLU A C    3  
ATOM 2369  O O    . GLU A 1 21 ? -0.778  11.354  1.893   1.00 0.00 ? 21 GLU A O    3  
ATOM 2370  C CB   . GLU A 1 21 ? -0.217  14.305  3.048   1.00 0.00 ? 21 GLU A CB   3  
ATOM 2371  C CG   . GLU A 1 21 ? -1.279  15.191  2.418   1.00 0.00 ? 21 GLU A CG   3  
ATOM 2372  C CD   . GLU A 1 21 ? -1.475  16.493  3.170   1.00 0.00 ? 21 GLU A CD   3  
ATOM 2373  O OE1  . GLU A 1 21 ? -1.183  16.525  4.384   1.00 0.00 ? 21 GLU A OE1  3  
ATOM 2374  O OE2  . GLU A 1 21 ? -1.920  17.478  2.546   1.00 0.00 ? 21 GLU A OE2  3  
ATOM 2375  H H    . GLU A 1 21 ? 1.135   15.158  1.080   1.00 0.00 ? 21 GLU A H    3  
ATOM 2376  H HA   . GLU A 1 21 ? 1.224   12.797  2.572   1.00 0.00 ? 21 GLU A HA   3  
ATOM 2377  H HB2  . GLU A 1 21 ? -0.689  13.696  3.805   1.00 0.00 ? 21 GLU A HB2  3  
ATOM 2378  H HB3  . GLU A 1 21 ? 0.519   14.941  3.518   1.00 0.00 ? 21 GLU A HB3  3  
ATOM 2379  H HG2  . GLU A 1 21 ? -0.984  15.420  1.405   1.00 0.00 ? 21 GLU A HG2  3  
ATOM 2380  H HG3  . GLU A 1 21 ? -2.217  14.655  2.406   1.00 0.00 ? 21 GLU A HG3  3  
ATOM 2381  N N    . ASP A 1 22 ? -1.097  12.892  0.282   1.00 0.00 ? 22 ASP A N    3  
ATOM 2382  C CA   . ASP A 1 22 ? -2.082  12.093  -0.438  1.00 0.00 ? 22 ASP A CA   3  
ATOM 2383  C C    . ASP A 1 22 ? -1.635  10.638  -0.535  1.00 0.00 ? 22 ASP A C    3  
ATOM 2384  O O    . ASP A 1 22 ? -2.401  9.723   -0.234  1.00 0.00 ? 22 ASP A O    3  
ATOM 2385  C CB   . ASP A 1 22 ? -2.307  12.664  -1.839  1.00 0.00 ? 22 ASP A CB   3  
ATOM 2386  C CG   . ASP A 1 22 ? -3.335  13.779  -1.851  1.00 0.00 ? 22 ASP A CG   3  
ATOM 2387  O OD1  . ASP A 1 22 ? -2.977  14.920  -1.491  1.00 0.00 ? 22 ASP A OD1  3  
ATOM 2388  O OD2  . ASP A 1 22 ? -4.496  13.510  -2.222  1.00 0.00 ? 22 ASP A OD2  3  
ATOM 2389  H H    . ASP A 1 22 ? -0.852  13.776  -0.065  1.00 0.00 ? 22 ASP A H    3  
ATOM 2390  H HA   . ASP A 1 22 ? -3.010  12.136  0.111   1.00 0.00 ? 22 ASP A HA   3  
ATOM 2391  H HB2  . ASP A 1 22 ? -1.373  13.057  -2.216  1.00 0.00 ? 22 ASP A HB2  3  
ATOM 2392  H HB3  . ASP A 1 22 ? -2.650  11.875  -2.492  1.00 0.00 ? 22 ASP A HB3  3  
ATOM 2393  N N    . GLU A 1 23 ? -0.391  10.432  -0.957  1.00 0.00 ? 23 GLU A N    3  
ATOM 2394  C CA   . GLU A 1 23 ? 0.156   9.088   -1.095  1.00 0.00 ? 23 GLU A CA   3  
ATOM 2395  C C    . GLU A 1 23 ? 0.665   8.568   0.246   1.00 0.00 ? 23 GLU A C    3  
ATOM 2396  O O    . GLU A 1 23 ? 1.252   9.313   1.032   1.00 0.00 ? 23 GLU A O    3  
ATOM 2397  C CB   . GLU A 1 23 ? 1.290   9.077   -2.123  1.00 0.00 ? 23 GLU A CB   3  
ATOM 2398  C CG   . GLU A 1 23 ? 0.934   9.767   -3.429  1.00 0.00 ? 23 GLU A CG   3  
ATOM 2399  C CD   . GLU A 1 23 ? 2.043   9.674   -4.459  1.00 0.00 ? 23 GLU A CD   3  
ATOM 2400  O OE1  . GLU A 1 23 ? 3.130   10.236  -4.212  1.00 0.00 ? 23 GLU A OE1  3  
ATOM 2401  O OE2  . GLU A 1 23 ? 1.823   9.039   -5.512  1.00 0.00 ? 23 GLU A OE2  3  
ATOM 2402  H H    . GLU A 1 23 ? 0.171   11.203  -1.182  1.00 0.00 ? 23 GLU A H    3  
ATOM 2403  H HA   . GLU A 1 23 ? -0.636  8.441   -1.441  1.00 0.00 ? 23 GLU A HA   3  
ATOM 2404  H HB2  . GLU A 1 23 ? 2.149   9.575   -1.698  1.00 0.00 ? 23 GLU A HB2  3  
ATOM 2405  H HB3  . GLU A 1 23 ? 1.551   8.053   -2.341  1.00 0.00 ? 23 GLU A HB3  3  
ATOM 2406  H HG2  . GLU A 1 23 ? 0.046   9.306   -3.835  1.00 0.00 ? 23 GLU A HG2  3  
ATOM 2407  H HG3  . GLU A 1 23 ? 0.736   10.810  -3.228  1.00 0.00 ? 23 GLU A HG3  3  
ATOM 2408  N N    . LEU A 1 24 ? 0.437   7.284   0.501   1.00 0.00 ? 24 LEU A N    3  
ATOM 2409  C CA   . LEU A 1 24 ? 0.872   6.663   1.747   1.00 0.00 ? 24 LEU A CA   3  
ATOM 2410  C C    . LEU A 1 24 ? 2.323   6.202   1.649   1.00 0.00 ? 24 LEU A C    3  
ATOM 2411  O O    . LEU A 1 24 ? 2.700   5.506   0.707   1.00 0.00 ? 24 LEU A O    3  
ATOM 2412  C CB   . LEU A 1 24 ? -0.030  5.475   2.090   1.00 0.00 ? 24 LEU A CB   3  
ATOM 2413  C CG   . LEU A 1 24 ? -0.023  5.027   3.552   1.00 0.00 ? 24 LEU A CG   3  
ATOM 2414  C CD1  . LEU A 1 24 ? -0.543  6.137   4.452   1.00 0.00 ? 24 LEU A CD1  3  
ATOM 2415  C CD2  . LEU A 1 24 ? -0.853  3.763   3.726   1.00 0.00 ? 24 LEU A CD2  3  
ATOM 2416  H H    . LEU A 1 24 ? -0.035  6.741   -0.164  1.00 0.00 ? 24 LEU A H    3  
ATOM 2417  H HA   . LEU A 1 24 ? 0.794   7.401   2.531   1.00 0.00 ? 24 LEU A HA   3  
ATOM 2418  H HB2  . LEU A 1 24 ? -1.042  5.744   1.831   1.00 0.00 ? 24 LEU A HB2  3  
ATOM 2419  H HB3  . LEU A 1 24 ? 0.284   4.637   1.484   1.00 0.00 ? 24 LEU A HB3  3  
ATOM 2420  H HG   . LEU A 1 24 ? 0.993   4.805   3.849   1.00 0.00 ? 24 LEU A HG   3  
ATOM 2421  H HD11 . LEU A 1 24 ? 0.154   6.961   4.447   1.00 0.00 ? 24 LEU A HD11 3  
ATOM 2422  H HD12 . LEU A 1 24 ? -0.649  5.762   5.460   1.00 0.00 ? 24 LEU A HD12 3  
ATOM 2423  H HD13 . LEU A 1 24 ? -1.503  6.474   4.091   1.00 0.00 ? 24 LEU A HD13 3  
ATOM 2424  H HD21 . LEU A 1 24 ? -1.357  3.534   2.799   1.00 0.00 ? 24 LEU A HD21 3  
ATOM 2425  H HD22 . LEU A 1 24 ? -1.585  3.918   4.506   1.00 0.00 ? 24 LEU A HD22 3  
ATOM 2426  H HD23 . LEU A 1 24 ? -0.205  2.943   3.997   1.00 0.00 ? 24 LEU A HD23 3  
ATOM 2427  N N    . GLU A 1 25 ? 3.131   6.594   2.629   1.00 0.00 ? 25 GLU A N    3  
ATOM 2428  C CA   . GLU A 1 25 ? 4.540   6.220   2.652   1.00 0.00 ? 25 GLU A CA   3  
ATOM 2429  C C    . GLU A 1 25 ? 4.706   4.751   3.029   1.00 0.00 ? 25 GLU A C    3  
ATOM 2430  O O    . GLU A 1 25 ? 3.816   4.148   3.631   1.00 0.00 ? 25 GLU A O    3  
ATOM 2431  C CB   . GLU A 1 25 ? 5.308   7.101   3.639   1.00 0.00 ? 25 GLU A CB   3  
ATOM 2432  C CG   . GLU A 1 25 ? 6.811   7.099   3.414   1.00 0.00 ? 25 GLU A CG   3  
ATOM 2433  C CD   . GLU A 1 25 ? 7.501   8.279   4.072   1.00 0.00 ? 25 GLU A CD   3  
ATOM 2434  O OE1  . GLU A 1 25 ? 6.918   8.860   5.011   1.00 0.00 ? 25 GLU A OE1  3  
ATOM 2435  O OE2  . GLU A 1 25 ? 8.624   8.620   3.647   1.00 0.00 ? 25 GLU A OE2  3  
ATOM 2436  H H    . GLU A 1 25 ? 2.771   7.148   3.352   1.00 0.00 ? 25 GLU A H    3  
ATOM 2437  H HA   . GLU A 1 25 ? 4.940   6.372   1.661   1.00 0.00 ? 25 GLU A HA   3  
ATOM 2438  H HB2  . GLU A 1 25 ? 4.953   8.117   3.549   1.00 0.00 ? 25 GLU A HB2  3  
ATOM 2439  H HB3  . GLU A 1 25 ? 5.115   6.750   4.642   1.00 0.00 ? 25 GLU A HB3  3  
ATOM 2440  H HG2  . GLU A 1 25 ? 7.222   6.188   3.823   1.00 0.00 ? 25 GLU A HG2  3  
ATOM 2441  H HG3  . GLU A 1 25 ? 7.004   7.135   2.352   1.00 0.00 ? 25 GLU A HG3  3  
ATOM 2442  N N    . LEU A 1 26 ? 5.851   4.180   2.671   1.00 0.00 ? 26 LEU A N    3  
ATOM 2443  C CA   . LEU A 1 26 ? 6.136   2.781   2.971   1.00 0.00 ? 26 LEU A CA   3  
ATOM 2444  C C    . LEU A 1 26 ? 7.610   2.586   3.311   1.00 0.00 ? 26 LEU A C    3  
ATOM 2445  O O    . LEU A 1 26 ? 8.438   3.457   3.048   1.00 0.00 ? 26 LEU A O    3  
ATOM 2446  C CB   . LEU A 1 26 ? 5.753   1.897   1.783   1.00 0.00 ? 26 LEU A CB   3  
ATOM 2447  C CG   . LEU A 1 26 ? 4.344   2.095   1.225   1.00 0.00 ? 26 LEU A CG   3  
ATOM 2448  C CD1  . LEU A 1 26 ? 4.212   1.436   -0.140  1.00 0.00 ? 26 LEU A CD1  3  
ATOM 2449  C CD2  . LEU A 1 26 ? 3.305   1.541   2.189   1.00 0.00 ? 26 LEU A CD2  3  
ATOM 2450  H H    . LEU A 1 26 ? 6.522   4.711   2.194   1.00 0.00 ? 26 LEU A H    3  
ATOM 2451  H HA   . LEU A 1 26 ? 5.541   2.498   3.826   1.00 0.00 ? 26 LEU A HA   3  
ATOM 2452  H HB2  . LEU A 1 26 ? 6.455   2.091   0.986   1.00 0.00 ? 26 LEU A HB2  3  
ATOM 2453  H HB3  . LEU A 1 26 ? 5.844   0.866   2.096   1.00 0.00 ? 26 LEU A HB3  3  
ATOM 2454  H HG   . LEU A 1 26 ? 4.157   3.153   1.102   1.00 0.00 ? 26 LEU A HG   3  
ATOM 2455  H HD11 . LEU A 1 26 ? 4.296   0.365   -0.032  1.00 0.00 ? 26 LEU A HD11 3  
ATOM 2456  H HD12 . LEU A 1 26 ? 4.996   1.795   -0.790  1.00 0.00 ? 26 LEU A HD12 3  
ATOM 2457  H HD13 . LEU A 1 26 ? 3.250   1.681   -0.566  1.00 0.00 ? 26 LEU A HD13 3  
ATOM 2458  H HD21 . LEU A 1 26 ? 2.715   0.788   1.688   1.00 0.00 ? 26 LEU A HD21 3  
ATOM 2459  H HD22 . LEU A 1 26 ? 2.660   2.342   2.521   1.00 0.00 ? 26 LEU A HD22 3  
ATOM 2460  H HD23 . LEU A 1 26 ? 3.803   1.102   3.041   1.00 0.00 ? 26 LEU A HD23 3  
ATOM 2461  N N    . ARG A 1 27 ? 7.929   1.436   3.895   1.00 0.00 ? 27 ARG A N    3  
ATOM 2462  C CA   . ARG A 1 27 ? 9.304   1.126   4.270   1.00 0.00 ? 27 ARG A CA   3  
ATOM 2463  C C    . ARG A 1 27 ? 9.589   -0.364  4.106   1.00 0.00 ? 27 ARG A C    3  
ATOM 2464  O O    . ARG A 1 27 ? 8.811   -1.207  4.551   1.00 0.00 ? 27 ARG A O    3  
ATOM 2465  C CB   . ARG A 1 27 ? 9.568   1.550   5.716   1.00 0.00 ? 27 ARG A CB   3  
ATOM 2466  C CG   . ARG A 1 27 ? 10.981  1.251   6.190   1.00 0.00 ? 27 ARG A CG   3  
ATOM 2467  C CD   . ARG A 1 27 ? 11.112  1.419   7.695   1.00 0.00 ? 27 ARG A CD   3  
ATOM 2468  N NE   . ARG A 1 27 ? 12.433  1.025   8.178   1.00 0.00 ? 27 ARG A NE   3  
ATOM 2469  C CZ   . ARG A 1 27 ? 12.806  -0.238  8.348   1.00 0.00 ? 27 ARG A CZ   3  
ATOM 2470  N NH1  . ARG A 1 27 ? 11.964  -1.225  8.075   1.00 0.00 ? 27 ARG A NH1  3  
ATOM 2471  N NH2  . ARG A 1 27 ? 14.026  -0.517  8.791   1.00 0.00 ? 27 ARG A NH2  3  
ATOM 2472  H H    . ARG A 1 27 ? 7.224   0.780   4.080   1.00 0.00 ? 27 ARG A H    3  
ATOM 2473  H HA   . ARG A 1 27 ? 9.960   1.680   3.616   1.00 0.00 ? 27 ARG A HA   3  
ATOM 2474  H HB2  . ARG A 1 27 ? 9.401   2.613   5.804   1.00 0.00 ? 27 ARG A HB2  3  
ATOM 2475  H HB3  . ARG A 1 27 ? 8.878   1.030   6.363   1.00 0.00 ? 27 ARG A HB3  3  
ATOM 2476  H HG2  . ARG A 1 27 ? 11.231  0.233   5.930   1.00 0.00 ? 27 ARG A HG2  3  
ATOM 2477  H HG3  . ARG A 1 27 ? 11.666  1.927   5.700   1.00 0.00 ? 27 ARG A HG3  3  
ATOM 2478  H HD2  . ARG A 1 27 ? 10.943  2.456   7.945   1.00 0.00 ? 27 ARG A HD2  3  
ATOM 2479  H HD3  . ARG A 1 27 ? 10.365  0.807   8.178   1.00 0.00 ? 27 ARG A HD3  3  
ATOM 2480  H HE   . ARG A 1 27 ? 13.071  1.738   8.385   1.00 0.00 ? 27 ARG A HE   3  
ATOM 2481  H HH11 . ARG A 1 27 ? 11.045  -1.018  7.740   1.00 0.00 ? 27 ARG A HH11 3  
ATOM 2482  H HH12 . ARG A 1 27 ? 12.248  -2.175  8.203   1.00 0.00 ? 27 ARG A HH12 3  
ATOM 2483  H HH21 . ARG A 1 27 ? 14.664  0.224   8.997   1.00 0.00 ? 27 ARG A HH21 3  
ATOM 2484  H HH22 . ARG A 1 27 ? 14.306  -1.468  8.918   1.00 0.00 ? 27 ARG A HH22 3  
ATOM 2485  N N    . GLU A 1 28 ? 10.710  -0.680  3.464   1.00 0.00 ? 28 GLU A N    3  
ATOM 2486  C CA   . GLU A 1 28 ? 11.096  -2.068  3.240   1.00 0.00 ? 28 GLU A CA   3  
ATOM 2487  C C    . GLU A 1 28 ? 10.985  -2.878  4.528   1.00 0.00 ? 28 GLU A C    3  
ATOM 2488  O O    . GLU A 1 28 ? 11.709  -2.633  5.493   1.00 0.00 ? 28 GLU A O    3  
ATOM 2489  C CB   . GLU A 1 28 ? 12.526  -2.142  2.700   1.00 0.00 ? 28 GLU A CB   3  
ATOM 2490  C CG   . GLU A 1 28 ? 12.996  -3.558  2.415   1.00 0.00 ? 28 GLU A CG   3  
ATOM 2491  C CD   . GLU A 1 28 ? 14.508  -3.673  2.369   1.00 0.00 ? 28 GLU A CD   3  
ATOM 2492  O OE1  . GLU A 1 28 ? 15.085  -3.463  1.282   1.00 0.00 ? 28 GLU A OE1  3  
ATOM 2493  O OE2  . GLU A 1 28 ? 15.113  -3.972  3.420   1.00 0.00 ? 28 GLU A OE2  3  
ATOM 2494  H H    . GLU A 1 28 ? 11.289  0.037   3.133   1.00 0.00 ? 28 GLU A H    3  
ATOM 2495  H HA   . GLU A 1 28 ? 10.422  -2.486  2.507   1.00 0.00 ? 28 GLU A HA   3  
ATOM 2496  H HB2  . GLU A 1 28 ? 12.581  -1.574  1.783   1.00 0.00 ? 28 GLU A HB2  3  
ATOM 2497  H HB3  . GLU A 1 28 ? 13.194  -1.702  3.425   1.00 0.00 ? 28 GLU A HB3  3  
ATOM 2498  H HG2  . GLU A 1 28 ? 12.625  -4.210  3.191   1.00 0.00 ? 28 GLU A HG2  3  
ATOM 2499  H HG3  . GLU A 1 28 ? 12.597  -3.872  1.461   1.00 0.00 ? 28 GLU A HG3  3  
ATOM 2500  N N    . GLY A 1 29 ? 10.072  -3.845  4.536   1.00 0.00 ? 29 GLY A N    3  
ATOM 2501  C CA   . GLY A 1 29 ? 9.882   -4.676  5.710   1.00 0.00 ? 29 GLY A CA   3  
ATOM 2502  C C    . GLY A 1 29 ? 8.786   -4.155  6.619   1.00 0.00 ? 29 GLY A C    3  
ATOM 2503  O O    . GLY A 1 29 ? 8.840   -4.336  7.835   1.00 0.00 ? 29 GLY A O    3  
ATOM 2504  H H    . GLY A 1 29 ? 9.523   -3.995  3.738   1.00 0.00 ? 29 GLY A H    3  
ATOM 2505  H HA2  . GLY A 1 29 ? 9.626   -5.676  5.393   1.00 0.00 ? 29 GLY A HA2  3  
ATOM 2506  H HA3  . GLY A 1 29 ? 10.807  -4.712  6.266   1.00 0.00 ? 29 GLY A HA3  3  
ATOM 2507  N N    . ASP A 1 30 ? 7.790   -3.504  6.028   1.00 0.00 ? 30 ASP A N    3  
ATOM 2508  C CA   . ASP A 1 30 ? 6.677   -2.953  6.792   1.00 0.00 ? 30 ASP A CA   3  
ATOM 2509  C C    . ASP A 1 30 ? 5.346   -3.501  6.285   1.00 0.00 ? 30 ASP A C    3  
ATOM 2510  O O    . ASP A 1 30 ? 5.170   -3.720  5.086   1.00 0.00 ? 30 ASP A O    3  
ATOM 2511  C CB   . ASP A 1 30 ? 6.679   -1.426  6.708   1.00 0.00 ? 30 ASP A CB   3  
ATOM 2512  C CG   . ASP A 1 30 ? 7.712   -0.798  7.623   1.00 0.00 ? 30 ASP A CG   3  
ATOM 2513  O OD1  . ASP A 1 30 ? 8.920   -0.990  7.375   1.00 0.00 ? 30 ASP A OD1  3  
ATOM 2514  O OD2  . ASP A 1 30 ? 7.311   -0.113  8.587   1.00 0.00 ? 30 ASP A OD2  3  
ATOM 2515  H H    . ASP A 1 30 ? 7.804   -3.392  5.054   1.00 0.00 ? 30 ASP A H    3  
ATOM 2516  H HA   . ASP A 1 30 ? 6.804   -3.248  7.822   1.00 0.00 ? 30 ASP A HA   3  
ATOM 2517  H HB2  . ASP A 1 30 ? 6.896   -1.128  5.693   1.00 0.00 ? 30 ASP A HB2  3  
ATOM 2518  H HB3  . ASP A 1 30 ? 5.704   -1.055  6.987   1.00 0.00 ? 30 ASP A HB3  3  
ATOM 2519  N N    . ARG A 1 31 ? 4.413   -3.721  7.206   1.00 0.00 ? 31 ARG A N    3  
ATOM 2520  C CA   . ARG A 1 31 ? 3.100   -4.245  6.852   1.00 0.00 ? 31 ARG A CA   3  
ATOM 2521  C C    . ARG A 1 31 ? 2.173   -3.124  6.390   1.00 0.00 ? 31 ARG A C    3  
ATOM 2522  O O    . ARG A 1 31 ? 2.363   -1.961  6.745   1.00 0.00 ? 31 ARG A O    3  
ATOM 2523  C CB   . ARG A 1 31 ? 2.480   -4.973  8.046   1.00 0.00 ? 31 ARG A CB   3  
ATOM 2524  C CG   . ARG A 1 31 ? 3.144   -6.304  8.359   1.00 0.00 ? 31 ARG A CG   3  
ATOM 2525  C CD   . ARG A 1 31 ? 2.634   -7.409  7.448   1.00 0.00 ? 31 ARG A CD   3  
ATOM 2526  N NE   . ARG A 1 31 ? 3.100   -8.727  7.872   1.00 0.00 ? 31 ARG A NE   3  
ATOM 2527  C CZ   . ARG A 1 31 ? 4.297   -9.217  7.567   1.00 0.00 ? 31 ARG A CZ   3  
ATOM 2528  N NH1  . ARG A 1 31 ? 5.144   -8.501  6.840   1.00 0.00 ? 31 ARG A NH1  3  
ATOM 2529  N NH2  . ARG A 1 31 ? 4.648   -10.424 7.990   1.00 0.00 ? 31 ARG A NH2  3  
ATOM 2530  H H    . ARG A 1 31 ? 4.613   -3.526  8.145   1.00 0.00 ? 31 ARG A H    3  
ATOM 2531  H HA   . ARG A 1 31 ? 3.229   -4.946  6.042   1.00 0.00 ? 31 ARG A HA   3  
ATOM 2532  H HB2  . ARG A 1 31 ? 2.559   -4.342  8.919   1.00 0.00 ? 31 ARG A HB2  3  
ATOM 2533  H HB3  . ARG A 1 31 ? 1.436   -5.157  7.838   1.00 0.00 ? 31 ARG A HB3  3  
ATOM 2534  H HG2  . ARG A 1 31 ? 4.211   -6.204  8.224   1.00 0.00 ? 31 ARG A HG2  3  
ATOM 2535  H HG3  . ARG A 1 31 ? 2.933   -6.569  9.385   1.00 0.00 ? 31 ARG A HG3  3  
ATOM 2536  H HD2  . ARG A 1 31 ? 1.555   -7.399  7.460   1.00 0.00 ? 31 ARG A HD2  3  
ATOM 2537  H HD3  . ARG A 1 31 ? 2.984   -7.220  6.444   1.00 0.00 ? 31 ARG A HD3  3  
ATOM 2538  H HE   . ARG A 1 31 ? 2.490   -9.273  8.410   1.00 0.00 ? 31 ARG A HE   3  
ATOM 2539  H HH11 . ARG A 1 31 ? 4.882   -7.591  6.521   1.00 0.00 ? 31 ARG A HH11 3  
ATOM 2540  H HH12 . ARG A 1 31 ? 6.045   -8.872  6.613   1.00 0.00 ? 31 ARG A HH12 3  
ATOM 2541  H HH21 . ARG A 1 31 ? 4.012   -10.967 8.538   1.00 0.00 ? 31 ARG A HH21 3  
ATOM 2542  H HH22 . ARG A 1 31 ? 5.549   -10.792 7.760   1.00 0.00 ? 31 ARG A HH22 3  
ATOM 2543  N N    . VAL A 1 32 ? 1.171   -3.482  5.594   1.00 0.00 ? 32 VAL A N    3  
ATOM 2544  C CA   . VAL A 1 32 ? 0.214   -2.508  5.083   1.00 0.00 ? 32 VAL A CA   3  
ATOM 2545  C C    . VAL A 1 32 ? -1.194  -3.090  5.040   1.00 0.00 ? 32 VAL A C    3  
ATOM 2546  O O    . VAL A 1 32 ? -1.384  -4.257  4.698   1.00 0.00 ? 32 VAL A O    3  
ATOM 2547  C CB   . VAL A 1 32 ? 0.602   -2.028  3.672   1.00 0.00 ? 32 VAL A CB   3  
ATOM 2548  C CG1  . VAL A 1 32 ? -0.176  -0.774  3.301   1.00 0.00 ? 32 VAL A CG1  3  
ATOM 2549  C CG2  . VAL A 1 32 ? 2.101   -1.780  3.587   1.00 0.00 ? 32 VAL A CG2  3  
ATOM 2550  H H    . VAL A 1 32 ? 1.071   -4.425  5.345   1.00 0.00 ? 32 VAL A H    3  
ATOM 2551  H HA   . VAL A 1 32 ? 0.221   -1.654  5.745   1.00 0.00 ? 32 VAL A HA   3  
ATOM 2552  H HB   . VAL A 1 32 ? 0.347   -2.805  2.966   1.00 0.00 ? 32 VAL A HB   3  
ATOM 2553  H HG11 . VAL A 1 32 ? 0.107   0.033   3.961   1.00 0.00 ? 32 VAL A HG11 3  
ATOM 2554  H HG12 . VAL A 1 32 ? 0.047   -0.501  2.280   1.00 0.00 ? 32 VAL A HG12 3  
ATOM 2555  H HG13 . VAL A 1 32 ? -1.234  -0.965  3.401   1.00 0.00 ? 32 VAL A HG13 3  
ATOM 2556  H HG21 . VAL A 1 32 ? 2.328   -0.807  3.997   1.00 0.00 ? 32 VAL A HG21 3  
ATOM 2557  H HG22 . VAL A 1 32 ? 2.624   -2.538  4.150   1.00 0.00 ? 32 VAL A HG22 3  
ATOM 2558  H HG23 . VAL A 1 32 ? 2.415   -1.818  2.554   1.00 0.00 ? 32 VAL A HG23 3  
ATOM 2559  N N    . ASP A 1 33 ? -2.178  -2.269  5.390   1.00 0.00 ? 33 ASP A N    3  
ATOM 2560  C CA   . ASP A 1 33 ? -3.571  -2.701  5.391   1.00 0.00 ? 33 ASP A CA   3  
ATOM 2561  C C    . ASP A 1 33 ? -4.309  -2.158  4.171   1.00 0.00 ? 33 ASP A C    3  
ATOM 2562  O O    . ASP A 1 33 ? -4.683  -0.986  4.130   1.00 0.00 ? 33 ASP A O    3  
ATOM 2563  C CB   . ASP A 1 33 ? -4.269  -2.241  6.672   1.00 0.00 ? 33 ASP A CB   3  
ATOM 2564  C CG   . ASP A 1 33 ? -4.116  -3.237  7.804   1.00 0.00 ? 33 ASP A CG   3  
ATOM 2565  O OD1  . ASP A 1 33 ? -3.042  -3.249  8.443   1.00 0.00 ? 33 ASP A OD1  3  
ATOM 2566  O OD2  . ASP A 1 33 ? -5.069  -4.004  8.053   1.00 0.00 ? 33 ASP A OD2  3  
ATOM 2567  H H    . ASP A 1 33 ? -1.963  -1.349  5.654   1.00 0.00 ? 33 ASP A H    3  
ATOM 2568  H HA   . ASP A 1 33 ? -3.583  -3.780  5.353   1.00 0.00 ? 33 ASP A HA   3  
ATOM 2569  H HB2  . ASP A 1 33 ? -3.846  -1.298  6.986   1.00 0.00 ? 33 ASP A HB2  3  
ATOM 2570  H HB3  . ASP A 1 33 ? -5.322  -2.109  6.472   1.00 0.00 ? 33 ASP A HB3  3  
ATOM 2571  N N    . VAL A 1 34 ? -4.514  -3.019  3.179   1.00 0.00 ? 34 VAL A N    3  
ATOM 2572  C CA   . VAL A 1 34 ? -5.207  -2.626  1.958   1.00 0.00 ? 34 VAL A CA   3  
ATOM 2573  C C    . VAL A 1 34 ? -6.702  -2.908  2.059   1.00 0.00 ? 34 VAL A C    3  
ATOM 2574  O O    . VAL A 1 34 ? -7.113  -4.004  2.439   1.00 0.00 ? 34 VAL A O    3  
ATOM 2575  C CB   . VAL A 1 34 ? -4.640  -3.361  0.729   1.00 0.00 ? 34 VAL A CB   3  
ATOM 2576  C CG1  . VAL A 1 34 ? -5.612  -3.280  -0.438  1.00 0.00 ? 34 VAL A CG1  3  
ATOM 2577  C CG2  . VAL A 1 34 ? -3.284  -2.788  0.345   1.00 0.00 ? 34 VAL A CG2  3  
ATOM 2578  H H    . VAL A 1 34 ? -4.192  -3.940  3.271   1.00 0.00 ? 34 VAL A H    3  
ATOM 2579  H HA   . VAL A 1 34 ? -5.060  -1.565  1.816   1.00 0.00 ? 34 VAL A HA   3  
ATOM 2580  H HB   . VAL A 1 34 ? -4.507  -4.402  0.987   1.00 0.00 ? 34 VAL A HB   3  
ATOM 2581  H HG11 . VAL A 1 34 ? -6.223  -4.170  -0.460  1.00 0.00 ? 34 VAL A HG11 3  
ATOM 2582  H HG12 . VAL A 1 34 ? -6.243  -2.411  -0.322  1.00 0.00 ? 34 VAL A HG12 3  
ATOM 2583  H HG13 . VAL A 1 34 ? -5.058  -3.202  -1.362  1.00 0.00 ? 34 VAL A HG13 3  
ATOM 2584  H HG21 . VAL A 1 34 ? -3.260  -1.734  0.580   1.00 0.00 ? 34 VAL A HG21 3  
ATOM 2585  H HG22 . VAL A 1 34 ? -2.508  -3.298  0.898   1.00 0.00 ? 34 VAL A HG22 3  
ATOM 2586  H HG23 . VAL A 1 34 ? -3.121  -2.925  -0.713  1.00 0.00 ? 34 VAL A HG23 3  
ATOM 2587  N N    . MET A 1 35 ? -7.511  -1.911  1.717   1.00 0.00 ? 35 MET A N    3  
ATOM 2588  C CA   . MET A 1 35 ? -8.962  -2.053  1.768   1.00 0.00 ? 35 MET A CA   3  
ATOM 2589  C C    . MET A 1 35 ? -9.580  -1.819  0.393   1.00 0.00 ? 35 MET A C    3  
ATOM 2590  O O    . MET A 1 35 ? -10.551 -2.477  0.020   1.00 0.00 ? 35 MET A O    3  
ATOM 2591  C CB   . MET A 1 35 ? -9.556  -1.072  2.780   1.00 0.00 ? 35 MET A CB   3  
ATOM 2592  C CG   . MET A 1 35 ? -8.968  0.327   2.688   1.00 0.00 ? 35 MET A CG   3  
ATOM 2593  S SD   . MET A 1 35 ? -9.602  1.432   3.964   1.00 0.00 ? 35 MET A SD   3  
ATOM 2594  C CE   . MET A 1 35 ? -8.494  1.054   5.320   1.00 0.00 ? 35 MET A CE   3  
ATOM 2595  H H    . MET A 1 35 ? -7.125  -1.060  1.421   1.00 0.00 ? 35 MET A H    3  
ATOM 2596  H HA   . MET A 1 35 ? -9.185  -3.061  2.083   1.00 0.00 ? 35 MET A HA   3  
ATOM 2597  H HB2  . MET A 1 35 ? -10.621 -1.003  2.615   1.00 0.00 ? 35 MET A HB2  3  
ATOM 2598  H HB3  . MET A 1 35 ? -9.378  -1.448  3.776   1.00 0.00 ? 35 MET A HB3  3  
ATOM 2599  H HG2  . MET A 1 35 ? -7.896  0.261   2.791   1.00 0.00 ? 35 MET A HG2  3  
ATOM 2600  H HG3  . MET A 1 35 ? -9.210  0.741   1.720   1.00 0.00 ? 35 MET A HG3  3  
ATOM 2601  H HE1  . MET A 1 35 ? -7.868  0.217   5.050   1.00 0.00 ? 35 MET A HE1  3  
ATOM 2602  H HE2  . MET A 1 35 ? -7.875  1.914   5.529   1.00 0.00 ? 35 MET A HE2  3  
ATOM 2603  H HE3  . MET A 1 35 ? -9.072  0.804   6.198   1.00 0.00 ? 35 MET A HE3  3  
ATOM 2604  N N    . GLN A 1 36 ? -9.010  -0.879  -0.355  1.00 0.00 ? 36 GLN A N    3  
ATOM 2605  C CA   . GLN A 1 36 ? -9.507  -0.559  -1.688  1.00 0.00 ? 36 GLN A CA   3  
ATOM 2606  C C    . GLN A 1 36 ? -8.391  -0.655  -2.723  1.00 0.00 ? 36 GLN A C    3  
ATOM 2607  O O    . GLN A 1 36 ? -7.220  -0.442  -2.407  1.00 0.00 ? 36 GLN A O    3  
ATOM 2608  C CB   . GLN A 1 36 ? -10.115 0.844   -1.706  1.00 0.00 ? 36 GLN A CB   3  
ATOM 2609  C CG   . GLN A 1 36 ? -10.702 1.237   -3.052  1.00 0.00 ? 36 GLN A CG   3  
ATOM 2610  C CD   . GLN A 1 36 ? -9.696  1.935   -3.946  1.00 0.00 ? 36 GLN A CD   3  
ATOM 2611  O OE1  . GLN A 1 36 ? -8.563  1.479   -4.099  1.00 0.00 ? 36 GLN A OE1  3  
ATOM 2612  N NE2  . GLN A 1 36 ? -10.107 3.048   -4.542  1.00 0.00 ? 36 GLN A NE2  3  
ATOM 2613  H H    . GLN A 1 36 ? -8.239  -0.389  -0.002  1.00 0.00 ? 36 GLN A H    3  
ATOM 2614  H HA   . GLN A 1 36 ? -10.274 -1.277  -1.937  1.00 0.00 ? 36 GLN A HA   3  
ATOM 2615  H HB2  . GLN A 1 36 ? -10.901 0.893   -0.966  1.00 0.00 ? 36 GLN A HB2  3  
ATOM 2616  H HB3  . GLN A 1 36 ? -9.347  1.560   -1.450  1.00 0.00 ? 36 GLN A HB3  3  
ATOM 2617  H HG2  . GLN A 1 36 ? -11.047 0.345   -3.553  1.00 0.00 ? 36 GLN A HG2  3  
ATOM 2618  H HG3  . GLN A 1 36 ? -11.537 1.901   -2.886  1.00 0.00 ? 36 GLN A HG3  3  
ATOM 2619  H HE21 . GLN A 1 36 ? -11.024 3.352   -4.373  1.00 0.00 ? 36 GLN A HE21 3  
ATOM 2620  H HE22 . GLN A 1 36 ? -9.478  3.520   -5.125  1.00 0.00 ? 36 GLN A HE22 3  
ATOM 2621  N N    . GLN A 1 37 ? -8.761  -0.978  -3.958  1.00 0.00 ? 37 GLN A N    3  
ATOM 2622  C CA   . GLN A 1 37 ? -7.790  -1.103  -5.038  1.00 0.00 ? 37 GLN A CA   3  
ATOM 2623  C C    . GLN A 1 37 ? -8.217  -0.284  -6.251  1.00 0.00 ? 37 GLN A C    3  
ATOM 2624  O O    . GLN A 1 37 ? -9.407  -0.059  -6.473  1.00 0.00 ? 37 GLN A O    3  
ATOM 2625  C CB   . GLN A 1 37 ? -7.621  -2.572  -5.433  1.00 0.00 ? 37 GLN A CB   3  
ATOM 2626  C CG   . GLN A 1 37 ? -7.691  -3.530  -4.255  1.00 0.00 ? 37 GLN A CG   3  
ATOM 2627  C CD   . GLN A 1 37 ? -7.050  -4.871  -4.555  1.00 0.00 ? 37 GLN A CD   3  
ATOM 2628  O OE1  . GLN A 1 37 ? -6.750  -5.184  -5.707  1.00 0.00 ? 37 GLN A OE1  3  
ATOM 2629  N NE2  . GLN A 1 37 ? -6.835  -5.670  -3.516  1.00 0.00 ? 37 GLN A NE2  3  
ATOM 2630  H H    . GLN A 1 37 ? -9.709  -1.136  -4.146  1.00 0.00 ? 37 GLN A H    3  
ATOM 2631  H HA   . GLN A 1 37 ? -6.845  -0.726  -4.679  1.00 0.00 ? 37 GLN A HA   3  
ATOM 2632  H HB2  . GLN A 1 37 ? -8.401  -2.836  -6.131  1.00 0.00 ? 37 GLN A HB2  3  
ATOM 2633  H HB3  . GLN A 1 37 ? -6.662  -2.695  -5.913  1.00 0.00 ? 37 GLN A HB3  3  
ATOM 2634  H HG2  . GLN A 1 37 ? -7.180  -3.085  -3.414  1.00 0.00 ? 37 GLN A HG2  3  
ATOM 2635  H HG3  . GLN A 1 37 ? -8.727  -3.692  -4.000  1.00 0.00 ? 37 GLN A HG3  3  
ATOM 2636  H HE21 . GLN A 1 37 ? -7.101  -5.354  -2.627  1.00 0.00 ? 37 GLN A HE21 3  
ATOM 2637  H HE22 . GLN A 1 37 ? -6.423  -6.543  -3.682  1.00 0.00 ? 37 GLN A HE22 3  
ATOM 2638  N N    . CYS A 1 38 ? -7.239  0.159   -7.033  1.00 0.00 ? 38 CYS A N    3  
ATOM 2639  C CA   . CYS A 1 38 ? -7.513  0.955   -8.224  1.00 0.00 ? 38 CYS A CA   3  
ATOM 2640  C C    . CYS A 1 38 ? -7.384  0.107   -9.486  1.00 0.00 ? 38 CYS A C    3  
ATOM 2641  O O    . CYS A 1 38 ? -6.797  -0.974  -9.462  1.00 0.00 ? 38 CYS A O    3  
ATOM 2642  C CB   . CYS A 1 38 ? -6.559  2.148   -8.297  1.00 0.00 ? 38 CYS A CB   3  
ATOM 2643  S SG   . CYS A 1 38 ? -6.886  3.272   -9.675  1.00 0.00 ? 38 CYS A SG   3  
ATOM 2644  H H    . CYS A 1 38 ? -6.310  -0.054  -6.805  1.00 0.00 ? 38 CYS A H    3  
ATOM 2645  H HA   . CYS A 1 38 ? -8.526  1.319   -8.152  1.00 0.00 ? 38 CYS A HA   3  
ATOM 2646  H HB2  . CYS A 1 38 ? -6.636  2.718   -7.383  1.00 0.00 ? 38 CYS A HB2  3  
ATOM 2647  H HB3  . CYS A 1 38 ? -5.547  1.784   -8.401  1.00 0.00 ? 38 CYS A HB3  3  
ATOM 2648  H HG   . CYS A 1 38 ? -6.801  4.513   -9.218  1.00 0.00 ? 38 CYS A HG   3  
ATOM 2649  N N    . ASP A 1 39 ? -7.939  0.605   -10.586 1.00 0.00 ? 39 ASP A N    3  
ATOM 2650  C CA   . ASP A 1 39 ? -7.887  -0.106  -11.858 1.00 0.00 ? 39 ASP A CA   3  
ATOM 2651  C C    . ASP A 1 39 ? -6.550  0.126   -12.556 1.00 0.00 ? 39 ASP A C    3  
ATOM 2652  O O    . ASP A 1 39 ? -6.033  -0.759  -13.238 1.00 0.00 ? 39 ASP A O    3  
ATOM 2653  C CB   . ASP A 1 39 ? -9.034  0.341   -12.764 1.00 0.00 ? 39 ASP A CB   3  
ATOM 2654  C CG   . ASP A 1 39 ? -9.406  -0.711  -13.790 1.00 0.00 ? 39 ASP A CG   3  
ATOM 2655  O OD1  . ASP A 1 39 ? -9.577  -1.885  -13.400 1.00 0.00 ? 39 ASP A OD1  3  
ATOM 2656  O OD2  . ASP A 1 39 ? -9.526  -0.361  -14.983 1.00 0.00 ? 39 ASP A OD2  3  
ATOM 2657  H H    . ASP A 1 39 ? -8.393  1.472   -10.541 1.00 0.00 ? 39 ASP A H    3  
ATOM 2658  H HA   . ASP A 1 39 ? -7.993  -1.161  -11.652 1.00 0.00 ? 39 ASP A HA   3  
ATOM 2659  H HB2  . ASP A 1 39 ? -9.904  0.549   -12.158 1.00 0.00 ? 39 ASP A HB2  3  
ATOM 2660  H HB3  . ASP A 1 39 ? -8.742  1.240   -13.286 1.00 0.00 ? 39 ASP A HB3  3  
ATOM 2661  N N    . ASP A 1 40 ? -5.998  1.321   -12.382 1.00 0.00 ? 40 ASP A N    3  
ATOM 2662  C CA   . ASP A 1 40 ? -4.721  1.670   -12.995 1.00 0.00 ? 40 ASP A CA   3  
ATOM 2663  C C    . ASP A 1 40 ? -3.624  0.708   -12.551 1.00 0.00 ? 40 ASP A C    3  
ATOM 2664  O O    . ASP A 1 40 ? -2.712  0.395   -13.315 1.00 0.00 ? 40 ASP A O    3  
ATOM 2665  C CB   . ASP A 1 40 ? -4.334  3.105   -12.636 1.00 0.00 ? 40 ASP A CB   3  
ATOM 2666  C CG   . ASP A 1 40 ? -5.118  4.132   -13.430 1.00 0.00 ? 40 ASP A CG   3  
ATOM 2667  O OD1  . ASP A 1 40 ? -5.290  3.933   -14.651 1.00 0.00 ? 40 ASP A OD1  3  
ATOM 2668  O OD2  . ASP A 1 40 ? -5.560  5.134   -12.831 1.00 0.00 ? 40 ASP A OD2  3  
ATOM 2669  H H    . ASP A 1 40 ? -6.459  1.985   -11.827 1.00 0.00 ? 40 ASP A H    3  
ATOM 2670  H HA   . ASP A 1 40 ? -4.836  1.595   -14.066 1.00 0.00 ? 40 ASP A HA   3  
ATOM 2671  H HB2  . ASP A 1 40 ? -4.523  3.270   -11.586 1.00 0.00 ? 40 ASP A HB2  3  
ATOM 2672  H HB3  . ASP A 1 40 ? -3.282  3.248   -12.836 1.00 0.00 ? 40 ASP A HB3  3  
ATOM 2673  N N    . GLY A 1 41 ? -3.719  0.242   -11.309 1.00 0.00 ? 41 GLY A N    3  
ATOM 2674  C CA   . GLY A 1 41 ? -2.728  -0.679  -10.784 1.00 0.00 ? 41 GLY A CA   3  
ATOM 2675  C C    . GLY A 1 41 ? -2.210  -0.259  -9.423  1.00 0.00 ? 41 GLY A C    3  
ATOM 2676  O O    . GLY A 1 41 ? -1.239  -0.824  -8.920  1.00 0.00 ? 41 GLY A O    3  
ATOM 2677  H H    . GLY A 1 41 ? -4.469  0.526   -10.745 1.00 0.00 ? 41 GLY A H    3  
ATOM 2678  H HA2  . GLY A 1 41 ? -3.171  -1.660  -10.702 1.00 0.00 ? 41 GLY A HA2  3  
ATOM 2679  H HA3  . GLY A 1 41 ? -1.897  -0.726  -11.473 1.00 0.00 ? 41 GLY A HA3  3  
ATOM 2680  N N    . TRP A 1 42 ? -2.857  0.736   -8.827  1.00 0.00 ? 42 TRP A N    3  
ATOM 2681  C CA   . TRP A 1 42 ? -2.455  1.232   -7.516  1.00 0.00 ? 42 TRP A CA   3  
ATOM 2682  C C    . TRP A 1 42 ? -3.404  0.736   -6.431  1.00 0.00 ? 42 TRP A C    3  
ATOM 2683  O O    . TRP A 1 42 ? -4.562  0.418   -6.703  1.00 0.00 ? 42 TRP A O    3  
ATOM 2684  C CB   . TRP A 1 42 ? -2.417  2.761   -7.516  1.00 0.00 ? 42 TRP A CB   3  
ATOM 2685  C CG   . TRP A 1 42 ? -1.131  3.323   -8.044  1.00 0.00 ? 42 TRP A CG   3  
ATOM 2686  C CD1  . TRP A 1 42 ? -0.508  2.987   -9.212  1.00 0.00 ? 42 TRP A CD1  3  
ATOM 2687  C CD2  . TRP A 1 42 ? -0.311  4.318   -7.421  1.00 0.00 ? 42 TRP A CD2  3  
ATOM 2688  N NE1  . TRP A 1 42 ? 0.650   3.713   -9.353  1.00 0.00 ? 42 TRP A NE1  3  
ATOM 2689  C CE2  . TRP A 1 42 ? 0.793   4.537   -8.268  1.00 0.00 ? 42 TRP A CE2  3  
ATOM 2690  C CE3  . TRP A 1 42 ? -0.403  5.046   -6.232  1.00 0.00 ? 42 TRP A CE3  3  
ATOM 2691  C CZ2  . TRP A 1 42 ? 1.796   5.453   -7.960  1.00 0.00 ? 42 TRP A CZ2  3  
ATOM 2692  C CZ3  . TRP A 1 42 ? 0.594   5.954   -5.928  1.00 0.00 ? 42 TRP A CZ3  3  
ATOM 2693  C CH2  . TRP A 1 42 ? 1.681   6.152   -6.789  1.00 0.00 ? 42 TRP A CH2  3  
ATOM 2694  H H    . TRP A 1 42 ? -3.625  1.146   -9.279  1.00 0.00 ? 42 TRP A H    3  
ATOM 2695  H HA   . TRP A 1 42 ? -1.463  0.856   -7.310  1.00 0.00 ? 42 TRP A HA   3  
ATOM 2696  H HB2  . TRP A 1 42 ? -3.221  3.135   -8.132  1.00 0.00 ? 42 TRP A HB2  3  
ATOM 2697  H HB3  . TRP A 1 42 ? -2.547  3.118   -6.505  1.00 0.00 ? 42 TRP A HB3  3  
ATOM 2698  H HD1  . TRP A 1 42 ? -0.881  2.255   -9.911  1.00 0.00 ? 42 TRP A HD1  3  
ATOM 2699  H HE1  . TRP A 1 42 ? 1.271   3.652   -10.108 1.00 0.00 ? 42 TRP A HE1  3  
ATOM 2700  H HE3  . TRP A 1 42 ? -1.233  4.907   -5.555  1.00 0.00 ? 42 TRP A HE3  3  
ATOM 2701  H HZ2  . TRP A 1 42 ? 2.640   5.617   -8.614  1.00 0.00 ? 42 TRP A HZ2  3  
ATOM 2702  H HZ3  . TRP A 1 42 ? 0.540   6.525   -5.013  1.00 0.00 ? 42 TRP A HZ3  3  
ATOM 2703  H HH2  . TRP A 1 42 ? 2.436   6.871   -6.512  1.00 0.00 ? 42 TRP A HH2  3  
ATOM 2704  N N    . PHE A 1 43 ? -2.907  0.671   -5.200  1.00 0.00 ? 43 PHE A N    3  
ATOM 2705  C CA   . PHE A 1 43 ? -3.712  0.212   -4.074  1.00 0.00 ? 43 PHE A CA   3  
ATOM 2706  C C    . PHE A 1 43 ? -4.036  1.367   -3.131  1.00 0.00 ? 43 PHE A C    3  
ATOM 2707  O O    . PHE A 1 43 ? -3.339  2.381   -3.110  1.00 0.00 ? 43 PHE A O    3  
ATOM 2708  C CB   . PHE A 1 43 ? -2.977  -0.892  -3.311  1.00 0.00 ? 43 PHE A CB   3  
ATOM 2709  C CG   . PHE A 1 43 ? -2.878  -2.183  -4.073  1.00 0.00 ? 43 PHE A CG   3  
ATOM 2710  C CD1  . PHE A 1 43 ? -3.978  -2.691  -4.746  1.00 0.00 ? 43 PHE A CD1  3  
ATOM 2711  C CD2  . PHE A 1 43 ? -1.686  -2.888  -4.116  1.00 0.00 ? 43 PHE A CD2  3  
ATOM 2712  C CE1  . PHE A 1 43 ? -3.891  -3.879  -5.448  1.00 0.00 ? 43 PHE A CE1  3  
ATOM 2713  C CE2  . PHE A 1 43 ? -1.593  -4.075  -4.817  1.00 0.00 ? 43 PHE A CE2  3  
ATOM 2714  C CZ   . PHE A 1 43 ? -2.697  -4.572  -5.483  1.00 0.00 ? 43 PHE A CZ   3  
ATOM 2715  H H    . PHE A 1 43 ? -1.976  0.938   -5.046  1.00 0.00 ? 43 PHE A H    3  
ATOM 2716  H HA   . PHE A 1 43 ? -4.634  -0.186  -4.467  1.00 0.00 ? 43 PHE A HA   3  
ATOM 2717  H HB2  . PHE A 1 43 ? -1.974  -0.561  -3.090  1.00 0.00 ? 43 PHE A HB2  3  
ATOM 2718  H HB3  . PHE A 1 43 ? -3.499  -1.090  -2.387  1.00 0.00 ? 43 PHE A HB3  3  
ATOM 2719  H HD1  . PHE A 1 43 ? -4.913  -2.149  -4.719  1.00 0.00 ? 43 PHE A HD1  3  
ATOM 2720  H HD2  . PHE A 1 43 ? -0.823  -2.502  -3.595  1.00 0.00 ? 43 PHE A HD2  3  
ATOM 2721  H HE1  . PHE A 1 43 ? -4.756  -4.264  -5.968  1.00 0.00 ? 43 PHE A HE1  3  
ATOM 2722  H HE2  . PHE A 1 43 ? -0.658  -4.616  -4.843  1.00 0.00 ? 43 PHE A HE2  3  
ATOM 2723  H HZ   . PHE A 1 43 ? -2.626  -5.499  -6.032  1.00 0.00 ? 43 PHE A HZ   3  
ATOM 2724  N N    . VAL A 1 44 ? -5.101  1.206   -2.351  1.00 0.00 ? 44 VAL A N    3  
ATOM 2725  C CA   . VAL A 1 44 ? -5.519  2.234   -1.406  1.00 0.00 ? 44 VAL A CA   3  
ATOM 2726  C C    . VAL A 1 44 ? -5.833  1.630   -0.041  1.00 0.00 ? 44 VAL A C    3  
ATOM 2727  O O    . VAL A 1 44 ? -6.763  0.837   0.099   1.00 0.00 ? 44 VAL A O    3  
ATOM 2728  C CB   . VAL A 1 44 ? -6.757  2.996   -1.915  1.00 0.00 ? 44 VAL A CB   3  
ATOM 2729  C CG1  . VAL A 1 44 ? -7.171  4.068   -0.920  1.00 0.00 ? 44 VAL A CG1  3  
ATOM 2730  C CG2  . VAL A 1 44 ? -6.482  3.603   -3.283  1.00 0.00 ? 44 VAL A CG2  3  
ATOM 2731  H H    . VAL A 1 44 ? -5.617  0.375   -2.414  1.00 0.00 ? 44 VAL A H    3  
ATOM 2732  H HA   . VAL A 1 44 ? -4.707  2.939   -1.298  1.00 0.00 ? 44 VAL A HA   3  
ATOM 2733  H HB   . VAL A 1 44 ? -7.571  2.293   -2.014  1.00 0.00 ? 44 VAL A HB   3  
ATOM 2734  H HG11 . VAL A 1 44 ? -6.954  3.731   0.083   1.00 0.00 ? 44 VAL A HG11 3  
ATOM 2735  H HG12 . VAL A 1 44 ? -6.624  4.978   -1.122  1.00 0.00 ? 44 VAL A HG12 3  
ATOM 2736  H HG13 . VAL A 1 44 ? -8.230  4.257   -1.014  1.00 0.00 ? 44 VAL A HG13 3  
ATOM 2737  H HG21 . VAL A 1 44 ? -6.481  4.680   -3.204  1.00 0.00 ? 44 VAL A HG21 3  
ATOM 2738  H HG22 . VAL A 1 44 ? -5.519  3.267   -3.639  1.00 0.00 ? 44 VAL A HG22 3  
ATOM 2739  H HG23 . VAL A 1 44 ? -7.250  3.293   -3.976  1.00 0.00 ? 44 VAL A HG23 3  
ATOM 2740  N N    . GLY A 1 45 ? -5.051  2.012   0.964   1.00 0.00 ? 45 GLY A N    3  
ATOM 2741  C CA   . GLY A 1 45 ? -5.263  1.499   2.305   1.00 0.00 ? 45 GLY A CA   3  
ATOM 2742  C C    . GLY A 1 45 ? -4.577  2.341   3.362   1.00 0.00 ? 45 GLY A C    3  
ATOM 2743  O O    . GLY A 1 45 ? -4.402  3.547   3.188   1.00 0.00 ? 45 GLY A O    3  
ATOM 2744  H H    . GLY A 1 45 ? -4.325  2.648   0.793   1.00 0.00 ? 45 GLY A H    3  
ATOM 2745  H HA2  . GLY A 1 45 ? -6.323  1.478   2.507   1.00 0.00 ? 45 GLY A HA2  3  
ATOM 2746  H HA3  . GLY A 1 45 ? -4.876  0.492   2.357   1.00 0.00 ? 45 GLY A HA3  3  
ATOM 2747  N N    . VAL A 1 46 ? -4.190  1.705   4.463   1.00 0.00 ? 46 VAL A N    3  
ATOM 2748  C CA   . VAL A 1 46 ? -3.520  2.404   5.554   1.00 0.00 ? 46 VAL A CA   3  
ATOM 2749  C C    . VAL A 1 46 ? -2.140  1.813   5.820   1.00 0.00 ? 46 VAL A C    3  
ATOM 2750  O O    . VAL A 1 46 ? -1.883  0.649   5.516   1.00 0.00 ? 46 VAL A O    3  
ATOM 2751  C CB   . VAL A 1 46 ? -4.350  2.347   6.850   1.00 0.00 ? 46 VAL A CB   3  
ATOM 2752  C CG1  . VAL A 1 46 ? -3.607  3.026   7.991   1.00 0.00 ? 46 VAL A CG1  3  
ATOM 2753  C CG2  . VAL A 1 46 ? -5.715  2.984   6.637   1.00 0.00 ? 46 VAL A CG2  3  
ATOM 2754  H H    . VAL A 1 46 ? -4.357  0.743   4.544   1.00 0.00 ? 46 VAL A H    3  
ATOM 2755  H HA   . VAL A 1 46 ? -3.409  3.440   5.268   1.00 0.00 ? 46 VAL A HA   3  
ATOM 2756  H HB   . VAL A 1 46 ? -4.497  1.310   7.114   1.00 0.00 ? 46 VAL A HB   3  
ATOM 2757  H HG11 . VAL A 1 46 ? -4.276  3.155   8.829   1.00 0.00 ? 46 VAL A HG11 3  
ATOM 2758  H HG12 . VAL A 1 46 ? -2.767  2.416   8.288   1.00 0.00 ? 46 VAL A HG12 3  
ATOM 2759  H HG13 . VAL A 1 46 ? -3.252  3.993   7.663   1.00 0.00 ? 46 VAL A HG13 3  
ATOM 2760  H HG21 . VAL A 1 46 ? -5.635  4.054   6.761   1.00 0.00 ? 46 VAL A HG21 3  
ATOM 2761  H HG22 . VAL A 1 46 ? -6.064  2.762   5.639   1.00 0.00 ? 46 VAL A HG22 3  
ATOM 2762  H HG23 . VAL A 1 46 ? -6.414  2.589   7.359   1.00 0.00 ? 46 VAL A HG23 3  
ATOM 2763  N N    . SER A 1 47 ? -1.255  2.624   6.391   1.00 0.00 ? 47 SER A N    3  
ATOM 2764  C CA   . SER A 1 47 ? 0.101   2.183   6.696   1.00 0.00 ? 47 SER A CA   3  
ATOM 2765  C C    . SER A 1 47 ? 0.174   1.581   8.097   1.00 0.00 ? 47 SER A C    3  
ATOM 2766  O O    . SER A 1 47 ? -0.788  1.643   8.862   1.00 0.00 ? 47 SER A O    3  
ATOM 2767  C CB   . SER A 1 47 ? 1.079   3.353   6.580   1.00 0.00 ? 47 SER A CB   3  
ATOM 2768  O OG   . SER A 1 47 ? 2.353   3.006   7.095   1.00 0.00 ? 47 SER A OG   3  
ATOM 2769  H H    . SER A 1 47 ? -1.521  3.542   6.611   1.00 0.00 ? 47 SER A H    3  
ATOM 2770  H HA   . SER A 1 47 ? 0.372   1.425   5.977   1.00 0.00 ? 47 SER A HA   3  
ATOM 2771  H HB2  . SER A 1 47 ? 1.186   3.627   5.541   1.00 0.00 ? 47 SER A HB2  3  
ATOM 2772  H HB3  . SER A 1 47 ? 0.695   4.196   7.136   1.00 0.00 ? 47 SER A HB3  3  
ATOM 2773  H HG   . SER A 1 47 ? 3.022   3.572   6.702   1.00 0.00 ? 47 SER A HG   3  
ATOM 2774  N N    . ARG A 1 48 ? 1.323   0.999   8.424   1.00 0.00 ? 48 ARG A N    3  
ATOM 2775  C CA   . ARG A 1 48 ? 1.523   0.385   9.731   1.00 0.00 ? 48 ARG A CA   3  
ATOM 2776  C C    . ARG A 1 48 ? 2.620   1.107   10.509  1.00 0.00 ? 48 ARG A C    3  
ATOM 2777  O O    . ARG A 1 48 ? 3.064   0.637   11.557  1.00 0.00 ? 48 ARG A O    3  
ATOM 2778  C CB   . ARG A 1 48 ? 1.884   -1.093  9.574   1.00 0.00 ? 48 ARG A CB   3  
ATOM 2779  C CG   . ARG A 1 48 ? 0.726   -1.955  9.097   1.00 0.00 ? 48 ARG A CG   3  
ATOM 2780  C CD   . ARG A 1 48 ? -0.370  -2.045  10.147  1.00 0.00 ? 48 ARG A CD   3  
ATOM 2781  N NE   . ARG A 1 48 ? 0.141   -2.508  11.434  1.00 0.00 ? 48 ARG A NE   3  
ATOM 2782  C CZ   . ARG A 1 48 ? -0.622  -2.691  12.506  1.00 0.00 ? 48 ARG A CZ   3  
ATOM 2783  N NH1  . ARG A 1 48 ? -1.925  -2.451  12.445  1.00 0.00 ? 48 ARG A NH1  3  
ATOM 2784  N NH2  . ARG A 1 48 ? -0.083  -3.115  13.642  1.00 0.00 ? 48 ARG A NH2  3  
ATOM 2785  H H    . ARG A 1 48 ? 2.054   0.982   7.771   1.00 0.00 ? 48 ARG A H    3  
ATOM 2786  H HA   . ARG A 1 48 ? 0.597   0.465   10.280  1.00 0.00 ? 48 ARG A HA   3  
ATOM 2787  H HB2  . ARG A 1 48 ? 2.688   -1.181  8.858   1.00 0.00 ? 48 ARG A HB2  3  
ATOM 2788  H HB3  . ARG A 1 48 ? 2.218   -1.473  10.527  1.00 0.00 ? 48 ARG A HB3  3  
ATOM 2789  H HG2  . ARG A 1 48 ? 0.313   -1.522  8.198   1.00 0.00 ? 48 ARG A HG2  3  
ATOM 2790  H HG3  . ARG A 1 48 ? 1.093   -2.948  8.885   1.00 0.00 ? 48 ARG A HG3  3  
ATOM 2791  H HD2  . ARG A 1 48 ? -0.808  -1.067  10.276  1.00 0.00 ? 48 ARG A HD2  3  
ATOM 2792  H HD3  . ARG A 1 48 ? -1.126  -2.734  9.801   1.00 0.00 ? 48 ARG A HD3  3  
ATOM 2793  H HE   . ARG A 1 48 ? 1.101   -2.692  11.502  1.00 0.00 ? 48 ARG A HE   3  
ATOM 2794  H HH11 . ARG A 1 48 ? -2.334  -2.132  11.590  1.00 0.00 ? 48 ARG A HH11 3  
ATOM 2795  H HH12 . ARG A 1 48 ? -2.498  -2.590  13.253  1.00 0.00 ? 48 ARG A HH12 3  
ATOM 2796  H HH21 . ARG A 1 48 ? 0.898   -3.297  13.692  1.00 0.00 ? 48 ARG A HH21 3  
ATOM 2797  H HH22 . ARG A 1 48 ? -0.658  -3.252  14.447  1.00 0.00 ? 48 ARG A HH22 3  
ATOM 2798  N N    . ARG A 1 49 ? 3.052   2.251   9.988   1.00 0.00 ? 49 ARG A N    3  
ATOM 2799  C CA   . ARG A 1 49 ? 4.098   3.037   10.632  1.00 0.00 ? 49 ARG A CA   3  
ATOM 2800  C C    . ARG A 1 49 ? 3.609   4.451   10.933  1.00 0.00 ? 49 ARG A C    3  
ATOM 2801  O O    . ARG A 1 49 ? 3.879   5.000   12.001  1.00 0.00 ? 49 ARG A O    3  
ATOM 2802  C CB   . ARG A 1 49 ? 5.343   3.094   9.745   1.00 0.00 ? 49 ARG A CB   3  
ATOM 2803  C CG   . ARG A 1 49 ? 6.609   3.474   10.495  1.00 0.00 ? 49 ARG A CG   3  
ATOM 2804  C CD   . ARG A 1 49 ? 7.166   2.298   11.281  1.00 0.00 ? 49 ARG A CD   3  
ATOM 2805  N NE   . ARG A 1 49 ? 8.510   2.563   11.785  1.00 0.00 ? 49 ARG A NE   3  
ATOM 2806  C CZ   . ARG A 1 49 ? 8.755   3.219   12.914  1.00 0.00 ? 49 ARG A CZ   3  
ATOM 2807  N NH1  . ARG A 1 49 ? 7.752   3.673   13.652  1.00 0.00 ? 49 ARG A NH1  3  
ATOM 2808  N NH2  . ARG A 1 49 ? 10.006  3.422   13.307  1.00 0.00 ? 49 ARG A NH2  3  
ATOM 2809  H H    . ARG A 1 49 ? 2.660   2.574   9.150   1.00 0.00 ? 49 ARG A H    3  
ATOM 2810  H HA   . ARG A 1 49 ? 4.352   2.551   11.563  1.00 0.00 ? 49 ARG A HA   3  
ATOM 2811  H HB2  . ARG A 1 49 ? 5.495   2.124   9.295   1.00 0.00 ? 49 ARG A HB2  3  
ATOM 2812  H HB3  . ARG A 1 49 ? 5.180   3.822   8.965   1.00 0.00 ? 49 ARG A HB3  3  
ATOM 2813  H HG2  . ARG A 1 49 ? 7.352   3.803   9.784   1.00 0.00 ? 49 ARG A HG2  3  
ATOM 2814  H HG3  . ARG A 1 49 ? 6.382   4.278   11.180  1.00 0.00 ? 49 ARG A HG3  3  
ATOM 2815  H HD2  . ARG A 1 49 ? 6.512   2.097   12.116  1.00 0.00 ? 49 ARG A HD2  3  
ATOM 2816  H HD3  . ARG A 1 49 ? 7.198   1.434   10.634  1.00 0.00 ? 49 ARG A HD3  3  
ATOM 2817  H HE   . ARG A 1 49 ? 9.267   2.237   11.255  1.00 0.00 ? 49 ARG A HE   3  
ATOM 2818  H HH11 . ARG A 1 49 ? 6.808   3.521   13.359  1.00 0.00 ? 49 ARG A HH11 3  
ATOM 2819  H HH12 . ARG A 1 49 ? 7.939   4.165   14.503  1.00 0.00 ? 49 ARG A HH12 3  
ATOM 2820  H HH21 . ARG A 1 49 ? 10.765  3.081   12.753  1.00 0.00 ? 49 ARG A HH21 3  
ATOM 2821  H HH22 . ARG A 1 49 ? 10.190  3.915   14.157  1.00 0.00 ? 49 ARG A HH22 3  
ATOM 2822  N N    . THR A 1 50 ? 2.887   5.036   9.982   1.00 0.00 ? 50 THR A N    3  
ATOM 2823  C CA   . THR A 1 50 ? 2.361   6.386   10.143  1.00 0.00 ? 50 THR A CA   3  
ATOM 2824  C C    . THR A 1 50 ? 0.857   6.365   10.386  1.00 0.00 ? 50 THR A C    3  
ATOM 2825  O O    . THR A 1 50 ? 0.278   7.355   10.832  1.00 0.00 ? 50 THR A O    3  
ATOM 2826  C CB   . THR A 1 50 ? 2.658   7.255   8.906   1.00 0.00 ? 50 THR A CB   3  
ATOM 2827  O OG1  . THR A 1 50 ? 2.209   6.590   7.721   1.00 0.00 ? 50 THR A OG1  3  
ATOM 2828  C CG2  . THR A 1 50 ? 4.146   7.550   8.797   1.00 0.00 ? 50 THR A CG2  3  
ATOM 2829  H H    . THR A 1 50 ? 2.705   4.547   9.152   1.00 0.00 ? 50 THR A H    3  
ATOM 2830  H HA   . THR A 1 50 ? 2.848   6.834   10.997  1.00 0.00 ? 50 THR A HA   3  
ATOM 2831  H HB   . THR A 1 50 ? 2.127   8.191   9.008   1.00 0.00 ? 50 THR A HB   3  
ATOM 2832  H HG1  . THR A 1 50 ? 1.880   7.239   7.094   1.00 0.00 ? 50 THR A HG1  3  
ATOM 2833  H HG21 . THR A 1 50 ? 4.461   8.135   9.648   1.00 0.00 ? 50 THR A HG21 3  
ATOM 2834  H HG22 . THR A 1 50 ? 4.338   8.103   7.889   1.00 0.00 ? 50 THR A HG22 3  
ATOM 2835  H HG23 . THR A 1 50 ? 4.696   6.622   8.775   1.00 0.00 ? 50 THR A HG23 3  
ATOM 2836  N N    . GLN A 1 51 ? 0.230   5.230   10.091  1.00 0.00 ? 51 GLN A N    3  
ATOM 2837  C CA   . GLN A 1 51 ? -1.208  5.081   10.278  1.00 0.00 ? 51 GLN A CA   3  
ATOM 2838  C C    . GLN A 1 51 ? -1.975  6.091   9.430   1.00 0.00 ? 51 GLN A C    3  
ATOM 2839  O O    . GLN A 1 51 ? -3.062  6.532   9.802   1.00 0.00 ? 51 GLN A O    3  
ATOM 2840  C CB   . GLN A 1 51 ? -1.572  5.256   11.754  1.00 0.00 ? 51 GLN A CB   3  
ATOM 2841  C CG   . GLN A 1 51 ? -1.074  4.128   12.641  1.00 0.00 ? 51 GLN A CG   3  
ATOM 2842  C CD   . GLN A 1 51 ? 0.349   4.346   13.118  1.00 0.00 ? 51 GLN A CD   3  
ATOM 2843  O OE1  . GLN A 1 51 ? 1.285   4.386   12.319  1.00 0.00 ? 51 GLN A OE1  3  
ATOM 2844  N NE2  . GLN A 1 51 ? 0.519   4.487   14.428  1.00 0.00 ? 51 GLN A NE2  3  
ATOM 2845  H H    . GLN A 1 51 ? 0.747   4.476   9.739   1.00 0.00 ? 51 GLN A H    3  
ATOM 2846  H HA   . GLN A 1 51 ? -1.482  4.085   9.965   1.00 0.00 ? 51 GLN A HA   3  
ATOM 2847  H HB2  . GLN A 1 51 ? -1.145  6.182   12.110  1.00 0.00 ? 51 GLN A HB2  3  
ATOM 2848  H HB3  . GLN A 1 51 ? -2.647  5.307   11.843  1.00 0.00 ? 51 GLN A HB3  3  
ATOM 2849  H HG2  . GLN A 1 51 ? -1.719  4.054   13.504  1.00 0.00 ? 51 GLN A HG2  3  
ATOM 2850  H HG3  . GLN A 1 51 ? -1.114  3.204   12.083  1.00 0.00 ? 51 GLN A HG3  3  
ATOM 2851  H HE21 . GLN A 1 51 ? -0.272  4.443   15.004  1.00 0.00 ? 51 GLN A HE21 3  
ATOM 2852  H HE22 . GLN A 1 51 ? 1.428   4.629   14.764  1.00 0.00 ? 51 GLN A HE22 3  
ATOM 2853  N N    . LYS A 1 52 ? -1.401  6.452   8.287   1.00 0.00 ? 52 LYS A N    3  
ATOM 2854  C CA   . LYS A 1 52 ? -2.030  7.409   7.384   1.00 0.00 ? 52 LYS A CA   3  
ATOM 2855  C C    . LYS A 1 52 ? -2.878  6.693   6.337   1.00 0.00 ? 52 LYS A C    3  
ATOM 2856  O O    . LYS A 1 52 ? -2.736  5.488   6.128   1.00 0.00 ? 52 LYS A O    3  
ATOM 2857  C CB   . LYS A 1 52 ? -0.966  8.266   6.695   1.00 0.00 ? 52 LYS A CB   3  
ATOM 2858  C CG   . LYS A 1 52 ? -0.369  9.334   7.595   1.00 0.00 ? 52 LYS A CG   3  
ATOM 2859  C CD   . LYS A 1 52 ? 0.255   10.459  6.787   1.00 0.00 ? 52 LYS A CD   3  
ATOM 2860  C CE   . LYS A 1 52 ? 1.414   11.104  7.532   1.00 0.00 ? 52 LYS A CE   3  
ATOM 2861  N NZ   . LYS A 1 52 ? 2.691   10.372  7.312   1.00 0.00 ? 52 LYS A NZ   3  
ATOM 2862  H H    . LYS A 1 52 ? -0.534  6.065   8.045   1.00 0.00 ? 52 LYS A H    3  
ATOM 2863  H HA   . LYS A 1 52 ? -2.671  8.049   7.972   1.00 0.00 ? 52 LYS A HA   3  
ATOM 2864  H HB2  . LYS A 1 52 ? -0.168  7.623   6.355   1.00 0.00 ? 52 LYS A HB2  3  
ATOM 2865  H HB3  . LYS A 1 52 ? -1.413  8.754   5.840   1.00 0.00 ? 52 LYS A HB3  3  
ATOM 2866  H HG2  . LYS A 1 52 ? -1.149  9.743   8.219   1.00 0.00 ? 52 LYS A HG2  3  
ATOM 2867  H HG3  . LYS A 1 52 ? 0.393   8.883   8.216   1.00 0.00 ? 52 LYS A HG3  3  
ATOM 2868  H HD2  . LYS A 1 52 ? 0.621   10.060  5.852   1.00 0.00 ? 52 LYS A HD2  3  
ATOM 2869  H HD3  . LYS A 1 52 ? -0.497  11.210  6.590   1.00 0.00 ? 52 LYS A HD3  3  
ATOM 2870  H HE2  . LYS A 1 52 ? 1.527   12.120  7.185   1.00 0.00 ? 52 LYS A HE2  3  
ATOM 2871  H HE3  . LYS A 1 52 ? 1.188   11.108  8.588   1.00 0.00 ? 52 LYS A HE3  3  
ATOM 2872  H HZ1  . LYS A 1 52 ? 3.346   10.955  6.753   1.00 0.00 ? 52 LYS A HZ1  3  
ATOM 2873  H HZ2  . LYS A 1 52 ? 2.511   9.485   6.799   1.00 0.00 ? 52 LYS A HZ2  3  
ATOM 2874  H HZ3  . LYS A 1 52 ? 3.137   10.147  8.225   1.00 0.00 ? 52 LYS A HZ3  3  
ATOM 2875  N N    . PHE A 1 53 ? -3.757  7.442   5.681   1.00 0.00 ? 53 PHE A N    3  
ATOM 2876  C CA   . PHE A 1 53 ? -4.627  6.879   4.655   1.00 0.00 ? 53 PHE A CA   3  
ATOM 2877  C C    . PHE A 1 53 ? -4.421  7.586   3.319   1.00 0.00 ? 53 PHE A C    3  
ATOM 2878  O O    . PHE A 1 53 ? -4.268  8.806   3.266   1.00 0.00 ? 53 PHE A O    3  
ATOM 2879  C CB   . PHE A 1 53 ? -6.092  6.988   5.082   1.00 0.00 ? 53 PHE A CB   3  
ATOM 2880  C CG   . PHE A 1 53 ? -7.052  6.409   4.083   1.00 0.00 ? 53 PHE A CG   3  
ATOM 2881  C CD1  . PHE A 1 53 ? -7.227  5.038   3.984   1.00 0.00 ? 53 PHE A CD1  3  
ATOM 2882  C CD2  . PHE A 1 53 ? -7.780  7.236   3.242   1.00 0.00 ? 53 PHE A CD2  3  
ATOM 2883  C CE1  . PHE A 1 53 ? -8.111  4.502   3.066   1.00 0.00 ? 53 PHE A CE1  3  
ATOM 2884  C CE2  . PHE A 1 53 ? -8.665  6.705   2.323   1.00 0.00 ? 53 PHE A CE2  3  
ATOM 2885  C CZ   . PHE A 1 53 ? -8.830  5.337   2.234   1.00 0.00 ? 53 PHE A CZ   3  
ATOM 2886  H H    . PHE A 1 53 ? -3.823  8.397   5.892   1.00 0.00 ? 53 PHE A H    3  
ATOM 2887  H HA   . PHE A 1 53 ? -4.371  5.837   4.540   1.00 0.00 ? 53 PHE A HA   3  
ATOM 2888  H HB2  . PHE A 1 53 ? -6.228  6.463   6.015   1.00 0.00 ? 53 PHE A HB2  3  
ATOM 2889  H HB3  . PHE A 1 53 ? -6.342  8.029   5.220   1.00 0.00 ? 53 PHE A HB3  3  
ATOM 2890  H HD1  . PHE A 1 53 ? -6.665  4.384   4.636   1.00 0.00 ? 53 PHE A HD1  3  
ATOM 2891  H HD2  . PHE A 1 53 ? -7.652  8.306   3.310   1.00 0.00 ? 53 PHE A HD2  3  
ATOM 2892  H HE1  . PHE A 1 53 ? -8.237  3.432   3.000   1.00 0.00 ? 53 PHE A HE1  3  
ATOM 2893  H HE2  . PHE A 1 53 ? -9.226  7.360   1.672   1.00 0.00 ? 53 PHE A HE2  3  
ATOM 2894  H HZ   . PHE A 1 53 ? -9.521  4.920   1.516   1.00 0.00 ? 53 PHE A HZ   3  
ATOM 2895  N N    . GLY A 1 54 ? -4.417  6.810   2.239   1.00 0.00 ? 54 GLY A N    3  
ATOM 2896  C CA   . GLY A 1 54 ? -4.228  7.378   0.917   1.00 0.00 ? 54 GLY A CA   3  
ATOM 2897  C C    . GLY A 1 54 ? -4.097  6.317   -0.157  1.00 0.00 ? 54 GLY A C    3  
ATOM 2898  O O    . GLY A 1 54 ? -4.676  5.235   -0.047  1.00 0.00 ? 54 GLY A O    3  
ATOM 2899  H H    . GLY A 1 54 ? -4.544  5.843   2.341   1.00 0.00 ? 54 GLY A H    3  
ATOM 2900  H HA2  . GLY A 1 54 ? -5.073  8.009   0.685   1.00 0.00 ? 54 GLY A HA2  3  
ATOM 2901  H HA3  . GLY A 1 54 ? -3.332  7.981   0.922   1.00 0.00 ? 54 GLY A HA3  3  
ATOM 2902  N N    . THR A 1 55 ? -3.335  6.625   -1.201  1.00 0.00 ? 55 THR A N    3  
ATOM 2903  C CA   . THR A 1 55 ? -3.131  5.691   -2.302  1.00 0.00 ? 55 THR A CA   3  
ATOM 2904  C C    . THR A 1 55 ? -1.647  5.498   -2.592  1.00 0.00 ? 55 THR A C    3  
ATOM 2905  O O    . THR A 1 55 ? -0.886  6.464   -2.655  1.00 0.00 ? 55 THR A O    3  
ATOM 2906  C CB   . THR A 1 55 ? -3.836  6.172   -3.584  1.00 0.00 ? 55 THR A CB   3  
ATOM 2907  O OG1  . THR A 1 55 ? -3.403  5.390   -4.703  1.00 0.00 ? 55 THR A OG1  3  
ATOM 2908  C CG2  . THR A 1 55 ? -3.544  7.642   -3.843  1.00 0.00 ? 55 THR A CG2  3  
ATOM 2909  H H    . THR A 1 55 ? -2.899  7.502   -1.232  1.00 0.00 ? 55 THR A H    3  
ATOM 2910  H HA   . THR A 1 55 ? -3.559  4.741   -2.016  1.00 0.00 ? 55 THR A HA   3  
ATOM 2911  H HB   . THR A 1 55 ? -4.902  6.048   -3.459  1.00 0.00 ? 55 THR A HB   3  
ATOM 2912  H HG1  . THR A 1 55 ? -3.808  5.728   -5.506  1.00 0.00 ? 55 THR A HG1  3  
ATOM 2913  H HG21 . THR A 1 55 ? -4.149  7.990   -4.667  1.00 0.00 ? 55 THR A HG21 3  
ATOM 2914  H HG22 . THR A 1 55 ? -2.499  7.765   -4.086  1.00 0.00 ? 55 THR A HG22 3  
ATOM 2915  H HG23 . THR A 1 55 ? -3.778  8.216   -2.959  1.00 0.00 ? 55 THR A HG23 3  
ATOM 2916  N N    . PHE A 1 56 ? -1.242  4.245   -2.769  1.00 0.00 ? 56 PHE A N    3  
ATOM 2917  C CA   . PHE A 1 56 ? 0.152   3.926   -3.053  1.00 0.00 ? 56 PHE A CA   3  
ATOM 2918  C C    . PHE A 1 56 ? 0.256   2.879   -4.159  1.00 0.00 ? 56 PHE A C    3  
ATOM 2919  O O    . PHE A 1 56 ? -0.671  2.108   -4.408  1.00 0.00 ? 56 PHE A O    3  
ATOM 2920  C CB   . PHE A 1 56 ? 0.849   3.419   -1.789  1.00 0.00 ? 56 PHE A CB   3  
ATOM 2921  C CG   . PHE A 1 56 ? 0.019   2.455   -0.992  1.00 0.00 ? 56 PHE A CG   3  
ATOM 2922  C CD1  . PHE A 1 56 ? -0.893  2.915   -0.056  1.00 0.00 ? 56 PHE A CD1  3  
ATOM 2923  C CD2  . PHE A 1 56 ? 0.151   1.088   -1.178  1.00 0.00 ? 56 PHE A CD2  3  
ATOM 2924  C CE1  . PHE A 1 56 ? -1.660  2.030   0.679   1.00 0.00 ? 56 PHE A CE1  3  
ATOM 2925  C CE2  . PHE A 1 56 ? -0.613  0.199   -0.446  1.00 0.00 ? 56 PHE A CE2  3  
ATOM 2926  C CZ   . PHE A 1 56 ? -1.518  0.670   0.485   1.00 0.00 ? 56 PHE A CZ   3  
ATOM 2927  H H    . PHE A 1 56 ? -1.896  3.518   -2.707  1.00 0.00 ? 56 PHE A H    3  
ATOM 2928  H HA   . PHE A 1 56 ? 0.638   4.831   -3.384  1.00 0.00 ? 56 PHE A HA   3  
ATOM 2929  H HB2  . PHE A 1 56 ? 1.764   2.918   -2.067  1.00 0.00 ? 56 PHE A HB2  3  
ATOM 2930  H HB3  . PHE A 1 56 ? 1.084   4.261   -1.155  1.00 0.00 ? 56 PHE A HB3  3  
ATOM 2931  H HD1  . PHE A 1 56 ? -1.004  3.979   0.098   1.00 0.00 ? 56 PHE A HD1  3  
ATOM 2932  H HD2  . PHE A 1 56 ? 0.859   0.718   -1.904  1.00 0.00 ? 56 PHE A HD2  3  
ATOM 2933  H HE1  . PHE A 1 56 ? -2.366  2.402   1.406   1.00 0.00 ? 56 PHE A HE1  3  
ATOM 2934  H HE2  . PHE A 1 56 ? -0.500  -0.864  -0.600  1.00 0.00 ? 56 PHE A HE2  3  
ATOM 2935  H HZ   . PHE A 1 56 ? -2.116  -0.023  1.057   1.00 0.00 ? 56 PHE A HZ   3  
ATOM 2936  N N    . PRO A 1 57 ? 1.412   2.850   -4.838  1.00 0.00 ? 57 PRO A N    3  
ATOM 2937  C CA   . PRO A 1 57 ? 1.666   1.903   -5.928  1.00 0.00 ? 57 PRO A CA   3  
ATOM 2938  C C    . PRO A 1 57 ? 1.810   0.469   -5.429  1.00 0.00 ? 57 PRO A C    3  
ATOM 2939  O O    . PRO A 1 57 ? 2.699   0.164   -4.635  1.00 0.00 ? 57 PRO A O    3  
ATOM 2940  C CB   . PRO A 1 57 ? 2.985   2.396   -6.527  1.00 0.00 ? 57 PRO A CB   3  
ATOM 2941  C CG   . PRO A 1 57 ? 3.660   3.118   -5.412  1.00 0.00 ? 57 PRO A CG   3  
ATOM 2942  C CD   . PRO A 1 57 ? 2.561   3.738   -4.595  1.00 0.00 ? 57 PRO A CD   3  
ATOM 2943  H HA   . PRO A 1 57 ? 0.890   1.945   -6.679  1.00 0.00 ? 57 PRO A HA   3  
ATOM 2944  H HB2  . PRO A 1 57 ? 3.570   1.550   -6.862  1.00 0.00 ? 57 PRO A HB2  3  
ATOM 2945  H HB3  . PRO A 1 57 ? 2.784   3.053   -7.359  1.00 0.00 ? 57 PRO A HB3  3  
ATOM 2946  H HG2  . PRO A 1 57 ? 4.226   2.422   -4.813  1.00 0.00 ? 57 PRO A HG2  3  
ATOM 2947  H HG3  . PRO A 1 57 ? 4.308   3.885   -5.812  1.00 0.00 ? 57 PRO A HG3  3  
ATOM 2948  H HD2  . PRO A 1 57 ? 2.827   3.747   -3.549  1.00 0.00 ? 57 PRO A HD2  3  
ATOM 2949  H HD3  . PRO A 1 57 ? 2.352   4.740   -4.941  1.00 0.00 ? 57 PRO A HD3  3  
ATOM 2950  N N    . GLY A 1 58 ? 0.929   -0.409  -5.900  1.00 0.00 ? 58 GLY A N    3  
ATOM 2951  C CA   . GLY A 1 58 ? 0.976   -1.800  -5.490  1.00 0.00 ? 58 GLY A CA   3  
ATOM 2952  C C    . GLY A 1 58 ? 2.249   -2.493  -5.935  1.00 0.00 ? 58 GLY A C    3  
ATOM 2953  O O    . GLY A 1 58 ? 2.523   -3.621  -5.530  1.00 0.00 ? 58 GLY A O    3  
ATOM 2954  H H    . GLY A 1 58 ? 0.241   -0.109  -6.531  1.00 0.00 ? 58 GLY A H    3  
ATOM 2955  H HA2  . GLY A 1 58 ? 0.909   -1.849  -4.413  1.00 0.00 ? 58 GLY A HA2  3  
ATOM 2956  H HA3  . GLY A 1 58 ? 0.130   -2.318  -5.917  1.00 0.00 ? 58 GLY A HA3  3  
ATOM 2957  N N    . ASN A 1 59 ? 3.028   -1.815  -6.772  1.00 0.00 ? 59 ASN A N    3  
ATOM 2958  C CA   . ASN A 1 59 ? 4.278   -2.374  -7.274  1.00 0.00 ? 59 ASN A CA   3  
ATOM 2959  C C    . ASN A 1 59 ? 5.348   -2.379  -6.187  1.00 0.00 ? 59 ASN A C    3  
ATOM 2960  O O    . ASN A 1 59 ? 6.407   -2.985  -6.346  1.00 0.00 ? 59 ASN A O    3  
ATOM 2961  C CB   . ASN A 1 59 ? 4.768   -1.575  -8.484  1.00 0.00 ? 59 ASN A CB   3  
ATOM 2962  C CG   . ASN A 1 59 ? 3.663   -1.310  -9.488  1.00 0.00 ? 59 ASN A CG   3  
ATOM 2963  O OD1  . ASN A 1 59 ? 3.358   -2.155  -10.329 1.00 0.00 ? 59 ASN A OD1  3  
ATOM 2964  N ND2  . ASN A 1 59 ? 3.058   -0.131  -9.404  1.00 0.00 ? 59 ASN A ND2  3  
ATOM 2965  H H    . ASN A 1 59 ? 2.756   -0.918  -7.059  1.00 0.00 ? 59 ASN A H    3  
ATOM 2966  H HA   . ASN A 1 59 ? 4.087   -3.391  -7.580  1.00 0.00 ? 59 ASN A HA   3  
ATOM 2967  H HB2  . ASN A 1 59 ? 5.156   -0.625  -8.146  1.00 0.00 ? 59 ASN A HB2  3  
ATOM 2968  H HB3  . ASN A 1 59 ? 5.554   -2.126  -8.978  1.00 0.00 ? 59 ASN A HB3  3  
ATOM 2969  H HD21 . ASN A 1 59 ? 3.353   0.494   -8.709  1.00 0.00 ? 59 ASN A HD21 3  
ATOM 2970  H HD22 . ASN A 1 59 ? 2.339   0.067   -10.041 1.00 0.00 ? 59 ASN A HD22 3  
ATOM 2971  N N    . TYR A 1 60 ? 5.063   -1.699  -5.082  1.00 0.00 ? 60 TYR A N    3  
ATOM 2972  C CA   . TYR A 1 60 ? 6.000   -1.623  -3.968  1.00 0.00 ? 60 TYR A CA   3  
ATOM 2973  C C    . TYR A 1 60 ? 5.621   -2.611  -2.868  1.00 0.00 ? 60 TYR A C    3  
ATOM 2974  O O    . TYR A 1 60 ? 6.483   -3.129  -2.159  1.00 0.00 ? 60 TYR A O    3  
ATOM 2975  C CB   . TYR A 1 60 ? 6.039   -0.203  -3.402  1.00 0.00 ? 60 TYR A CB   3  
ATOM 2976  C CG   . TYR A 1 60 ? 6.856   0.759   -4.235  1.00 0.00 ? 60 TYR A CG   3  
ATOM 2977  C CD1  . TYR A 1 60 ? 6.393   1.209   -5.466  1.00 0.00 ? 60 TYR A CD1  3  
ATOM 2978  C CD2  . TYR A 1 60 ? 8.091   1.217   -3.793  1.00 0.00 ? 60 TYR A CD2  3  
ATOM 2979  C CE1  . TYR A 1 60 ? 7.136   2.087   -6.231  1.00 0.00 ? 60 TYR A CE1  3  
ATOM 2980  C CE2  . TYR A 1 60 ? 8.840   2.096   -4.550  1.00 0.00 ? 60 TYR A CE2  3  
ATOM 2981  C CZ   . TYR A 1 60 ? 8.359   2.528   -5.769  1.00 0.00 ? 60 TYR A CZ   3  
ATOM 2982  O OH   . TYR A 1 60 ? 9.102   3.402   -6.527  1.00 0.00 ? 60 TYR A OH   3  
ATOM 2983  H H    . TYR A 1 60 ? 4.202   -1.236  -5.013  1.00 0.00 ? 60 TYR A H    3  
ATOM 2984  H HA   . TYR A 1 60 ? 6.981   -1.878  -4.342  1.00 0.00 ? 60 TYR A HA   3  
ATOM 2985  H HB2  . TYR A 1 60 ? 5.033   0.182   -3.344  1.00 0.00 ? 60 TYR A HB2  3  
ATOM 2986  H HB3  . TYR A 1 60 ? 6.467   -0.229  -2.410  1.00 0.00 ? 60 TYR A HB3  3  
ATOM 2987  H HD1  . TYR A 1 60 ? 5.435   0.861   -5.825  1.00 0.00 ? 60 TYR A HD1  3  
ATOM 2988  H HD2  . TYR A 1 60 ? 8.465   0.876   -2.838  1.00 0.00 ? 60 TYR A HD2  3  
ATOM 2989  H HE1  . TYR A 1 60 ? 6.760   2.425   -7.185  1.00 0.00 ? 60 TYR A HE1  3  
ATOM 2990  H HE2  . TYR A 1 60 ? 9.797   2.441   -4.189  1.00 0.00 ? 60 TYR A HE2  3  
ATOM 2991  H HH   . TYR A 1 60 ? 10.037  3.251   -6.366  1.00 0.00 ? 60 TYR A HH   3  
ATOM 2992  N N    . VAL A 1 61 ? 4.324   -2.866  -2.733  1.00 0.00 ? 61 VAL A N    3  
ATOM 2993  C CA   . VAL A 1 61 ? 3.828   -3.792  -1.722  1.00 0.00 ? 61 VAL A CA   3  
ATOM 2994  C C    . VAL A 1 61 ? 3.361   -5.098  -2.354  1.00 0.00 ? 61 VAL A C    3  
ATOM 2995  O O    . VAL A 1 61 ? 3.342   -5.235  -3.577  1.00 0.00 ? 61 VAL A O    3  
ATOM 2996  C CB   . VAL A 1 61 ? 2.665   -3.177  -0.920  1.00 0.00 ? 61 VAL A CB   3  
ATOM 2997  C CG1  . VAL A 1 61 ? 3.105   -1.887  -0.245  1.00 0.00 ? 61 VAL A CG1  3  
ATOM 2998  C CG2  . VAL A 1 61 ? 1.466   -2.935  -1.823  1.00 0.00 ? 61 VAL A CG2  3  
ATOM 2999  H H    . VAL A 1 61 ? 3.685   -2.421  -3.328  1.00 0.00 ? 61 VAL A H    3  
ATOM 3000  H HA   . VAL A 1 61 ? 4.637   -4.004  -1.038  1.00 0.00 ? 61 VAL A HA   3  
ATOM 3001  H HB   . VAL A 1 61 ? 2.375   -3.879  -0.151  1.00 0.00 ? 61 VAL A HB   3  
ATOM 3002  H HG11 . VAL A 1 61 ? 3.878   -1.418  -0.836  1.00 0.00 ? 61 VAL A HG11 3  
ATOM 3003  H HG12 . VAL A 1 61 ? 2.260   -1.219  -0.160  1.00 0.00 ? 61 VAL A HG12 3  
ATOM 3004  H HG13 . VAL A 1 61 ? 3.490   -2.109  0.740   1.00 0.00 ? 61 VAL A HG13 3  
ATOM 3005  H HG21 . VAL A 1 61 ? 1.586   -3.494  -2.738  1.00 0.00 ? 61 VAL A HG21 3  
ATOM 3006  H HG22 . VAL A 1 61 ? 0.565   -3.257  -1.320  1.00 0.00 ? 61 VAL A HG22 3  
ATOM 3007  H HG23 . VAL A 1 61 ? 1.393   -1.882  -2.051  1.00 0.00 ? 61 VAL A HG23 3  
ATOM 3008  N N    . ALA A 1 62 ? 2.984   -6.055  -1.513  1.00 0.00 ? 62 ALA A N    3  
ATOM 3009  C CA   . ALA A 1 62 ? 2.513   -7.349  -1.989  1.00 0.00 ? 62 ALA A CA   3  
ATOM 3010  C C    . ALA A 1 62 ? 1.591   -8.008  -0.969  1.00 0.00 ? 62 ALA A C    3  
ATOM 3011  O O    . ALA A 1 62 ? 1.715   -7.804  0.239   1.00 0.00 ? 62 ALA A O    3  
ATOM 3012  C CB   . ALA A 1 62 ? 3.694   -8.258  -2.300  1.00 0.00 ? 62 ALA A CB   3  
ATOM 3013  H H    . ALA A 1 62 ? 3.021   -5.885  -0.548  1.00 0.00 ? 62 ALA A H    3  
ATOM 3014  H HA   . ALA A 1 62 ? 1.963   -7.188  -2.906  1.00 0.00 ? 62 ALA A HA   3  
ATOM 3015  H HB1  . ALA A 1 62 ? 3.863   -8.273  -3.367  1.00 0.00 ? 62 ALA A HB1  3  
ATOM 3016  H HB2  . ALA A 1 62 ? 4.576   -7.885  -1.801  1.00 0.00 ? 62 ALA A HB2  3  
ATOM 3017  H HB3  . ALA A 1 62 ? 3.479   -9.258  -1.955  1.00 0.00 ? 62 ALA A HB3  3  
ATOM 3018  N N    . PRO A 1 63 ? 0.643   -8.818  -1.463  1.00 0.00 ? 63 PRO A N    3  
ATOM 3019  C CA   . PRO A 1 63 ? -0.319  -9.523  -0.611  1.00 0.00 ? 63 PRO A CA   3  
ATOM 3020  C C    . PRO A 1 63 ? 0.335   -10.629 0.210   1.00 0.00 ? 63 PRO A C    3  
ATOM 3021  O O    . PRO A 1 63 ? 0.748   -11.655 -0.330  1.00 0.00 ? 63 PRO A O    3  
ATOM 3022  C CB   . PRO A 1 63 ? -1.312  -10.117 -1.613  1.00 0.00 ? 63 PRO A CB   3  
ATOM 3023  C CG   . PRO A 1 63 ? -0.538  -10.252 -2.879  1.00 0.00 ? 63 PRO A CG   3  
ATOM 3024  C CD   . PRO A 1 63 ? 0.437   -9.108  -2.892  1.00 0.00 ? 63 PRO A CD   3  
ATOM 3025  H HA   . PRO A 1 63 ? -0.836  -8.843  0.050   1.00 0.00 ? 63 PRO A HA   3  
ATOM 3026  H HB2  . PRO A 1 63 ? -1.658  -11.077 -1.256  1.00 0.00 ? 63 PRO A HB2  3  
ATOM 3027  H HB3  . PRO A 1 63 ? -2.151  -9.448  -1.734  1.00 0.00 ? 63 PRO A HB3  3  
ATOM 3028  H HG2  . PRO A 1 63 ? -0.011  -11.194 -2.888  1.00 0.00 ? 63 PRO A HG2  3  
ATOM 3029  H HG3  . PRO A 1 63 ? -1.205  -10.186 -3.726  1.00 0.00 ? 63 PRO A HG3  3  
ATOM 3030  H HD2  . PRO A 1 63 ? 1.362   -9.406  -3.363  1.00 0.00 ? 63 PRO A HD2  3  
ATOM 3031  H HD3  . PRO A 1 63 ? 0.011   -8.255  -3.401  1.00 0.00 ? 63 PRO A HD3  3  
ATOM 3032  N N    . VAL A 1 64 ? 0.426   -10.413 1.518   1.00 0.00 ? 64 VAL A N    3  
ATOM 3033  C CA   . VAL A 1 64 ? 1.029   -11.393 2.414   1.00 0.00 ? 64 VAL A CA   3  
ATOM 3034  C C    . VAL A 1 64 ? -0.008  -12.392 2.913   1.00 0.00 ? 64 VAL A C    3  
ATOM 3035  O O    . VAL A 1 64 ? 0.336   -13.474 3.389   1.00 0.00 ? 64 VAL A O    3  
ATOM 3036  C CB   . VAL A 1 64 ? 1.694   -10.712 3.625   1.00 0.00 ? 64 VAL A CB   3  
ATOM 3037  C CG1  . VAL A 1 64 ? 0.802   -9.608  4.173   1.00 0.00 ? 64 VAL A CG1  3  
ATOM 3038  C CG2  . VAL A 1 64 ? 2.013   -11.736 4.703   1.00 0.00 ? 64 VAL A CG2  3  
ATOM 3039  H H    . VAL A 1 64 ? 0.079   -9.576  1.890   1.00 0.00 ? 64 VAL A H    3  
ATOM 3040  H HA   . VAL A 1 64 ? 1.792   -11.925 1.863   1.00 0.00 ? 64 VAL A HA   3  
ATOM 3041  H HB   . VAL A 1 64 ? 2.621   -10.265 3.297   1.00 0.00 ? 64 VAL A HB   3  
ATOM 3042  H HG11 . VAL A 1 64 ? -0.198  -9.728  3.785   1.00 0.00 ? 64 VAL A HG11 3  
ATOM 3043  H HG12 . VAL A 1 64 ? 0.781   -9.665  5.252   1.00 0.00 ? 64 VAL A HG12 3  
ATOM 3044  H HG13 . VAL A 1 64 ? 1.192   -8.647  3.871   1.00 0.00 ? 64 VAL A HG13 3  
ATOM 3045  H HG21 . VAL A 1 64 ? 1.094   -12.164 5.075   1.00 0.00 ? 64 VAL A HG21 3  
ATOM 3046  H HG22 . VAL A 1 64 ? 2.632   -12.518 4.286   1.00 0.00 ? 64 VAL A HG22 3  
ATOM 3047  H HG23 . VAL A 1 64 ? 2.540   -11.254 5.514   1.00 0.00 ? 64 VAL A HG23 3  
ATOM 3048  N N    . SER A 1 65 ? -1.280  -12.023 2.801   1.00 0.00 ? 65 SER A N    3  
ATOM 3049  C CA   . SER A 1 65 ? -2.368  -12.886 3.244   1.00 0.00 ? 65 SER A CA   3  
ATOM 3050  C C    . SER A 1 65 ? -2.245  -14.276 2.628   1.00 0.00 ? 65 SER A C    3  
ATOM 3051  O O    . SER A 1 65 ? -2.788  -15.249 3.149   1.00 0.00 ? 65 SER A O    3  
ATOM 3052  C CB   . SER A 1 65 ? -3.719  -12.270 2.875   1.00 0.00 ? 65 SER A CB   3  
ATOM 3053  O OG   . SER A 1 65 ? -4.122  -12.667 1.575   1.00 0.00 ? 65 SER A OG   3  
ATOM 3054  H H    . SER A 1 65 ? -1.491  -11.148 2.413   1.00 0.00 ? 65 SER A H    3  
ATOM 3055  H HA   . SER A 1 65 ? -2.305  -12.975 4.319   1.00 0.00 ? 65 SER A HA   3  
ATOM 3056  H HB2  . SER A 1 65 ? -4.465  -12.592 3.584   1.00 0.00 ? 65 SER A HB2  3  
ATOM 3057  H HB3  . SER A 1 65 ? -3.639  -11.193 2.901   1.00 0.00 ? 65 SER A HB3  3  
ATOM 3058  H HG   . SER A 1 65 ? -3.413  -12.492 0.952   1.00 0.00 ? 65 SER A HG   3  
ATOM 3059  N N    . GLY A 1 66 ? -1.526  -14.361 1.513   1.00 0.00 ? 66 GLY A N    3  
ATOM 3060  C CA   . GLY A 1 66 ? -1.343  -15.635 0.842   1.00 0.00 ? 66 GLY A CA   3  
ATOM 3061  C C    . GLY A 1 66 ? -1.129  -16.777 1.816   1.00 0.00 ? 66 GLY A C    3  
ATOM 3062  O O    . GLY A 1 66 ? -0.537  -16.609 2.882   1.00 0.00 ? 66 GLY A O    3  
ATOM 3063  H H    . GLY A 1 66 ? -1.116  -13.551 1.142   1.00 0.00 ? 66 GLY A H    3  
ATOM 3064  H HA2  . GLY A 1 66 ? -2.219  -15.843 0.245   1.00 0.00 ? 66 GLY A HA2  3  
ATOM 3065  H HA3  . GLY A 1 66 ? -0.484  -15.566 0.191   1.00 0.00 ? 66 GLY A HA3  3  
ATOM 3066  N N    . PRO A 1 67 ? -1.621  -17.970 1.451   1.00 0.00 ? 67 PRO A N    3  
ATOM 3067  C CA   . PRO A 1 67 ? -1.493  -19.168 2.287   1.00 0.00 ? 67 PRO A CA   3  
ATOM 3068  C C    . PRO A 1 67 ? -0.056  -19.672 2.361   1.00 0.00 ? 67 PRO A C    3  
ATOM 3069  O O    . PRO A 1 67 ? 0.763   -19.373 1.492   1.00 0.00 ? 67 PRO A O    3  
ATOM 3070  C CB   . PRO A 1 67 ? -2.383  -20.191 1.578   1.00 0.00 ? 67 PRO A CB   3  
ATOM 3071  C CG   . PRO A 1 67 ? -2.418  -19.744 0.158   1.00 0.00 ? 67 PRO A CG   3  
ATOM 3072  C CD   . PRO A 1 67 ? -2.338  -18.243 0.194   1.00 0.00 ? 67 PRO A CD   3  
ATOM 3073  H HA   . PRO A 1 67 ? -1.865  -18.995 3.286   1.00 0.00 ? 67 PRO A HA   3  
ATOM 3074  H HB2  . PRO A 1 67 ? -1.948  -21.177 1.672   1.00 0.00 ? 67 PRO A HB2  3  
ATOM 3075  H HB3  . PRO A 1 67 ? -3.369  -20.183 2.019   1.00 0.00 ? 67 PRO A HB3  3  
ATOM 3076  H HG2  . PRO A 1 67 ? -1.574  -20.152 -0.377  1.00 0.00 ? 67 PRO A HG2  3  
ATOM 3077  H HG3  . PRO A 1 67 ? -3.343  -20.058 -0.303  1.00 0.00 ? 67 PRO A HG3  3  
ATOM 3078  H HD2  . PRO A 1 67 ? -1.782  -17.874 -0.655  1.00 0.00 ? 67 PRO A HD2  3  
ATOM 3079  H HD3  . PRO A 1 67 ? -3.328  -17.812 0.215   1.00 0.00 ? 67 PRO A HD3  3  
ATOM 3080  N N    . SER A 1 68 ? 0.244   -20.439 3.405   1.00 0.00 ? 68 SER A N    3  
ATOM 3081  C CA   . SER A 1 68 ? 1.584   -20.982 3.594   1.00 0.00 ? 68 SER A CA   3  
ATOM 3082  C C    . SER A 1 68 ? 1.521   -22.402 4.149   1.00 0.00 ? 68 SER A C    3  
ATOM 3083  O O    . SER A 1 68 ? 1.096   -22.619 5.284   1.00 0.00 ? 68 SER A O    3  
ATOM 3084  C CB   . SER A 1 68 ? 2.390   -20.089 4.539   1.00 0.00 ? 68 SER A CB   3  
ATOM 3085  O OG   . SER A 1 68 ? 3.781   -20.329 4.404   1.00 0.00 ? 68 SER A OG   3  
ATOM 3086  H H    . SER A 1 68 ? -0.453  -20.642 4.064   1.00 0.00 ? 68 SER A H    3  
ATOM 3087  H HA   . SER A 1 68 ? 2.071   -21.006 2.631   1.00 0.00 ? 68 SER A HA   3  
ATOM 3088  H HB2  . SER A 1 68 ? 2.192   -19.054 4.308   1.00 0.00 ? 68 SER A HB2  3  
ATOM 3089  H HB3  . SER A 1 68 ? 2.099   -20.293 5.559   1.00 0.00 ? 68 SER A HB3  3  
ATOM 3090  H HG   . SER A 1 68 ? 3.925   -21.246 4.157   1.00 0.00 ? 68 SER A HG   3  
ATOM 3091  N N    . SER A 1 69 ? 1.946   -23.367 3.339   1.00 0.00 ? 69 SER A N    3  
ATOM 3092  C CA   . SER A 1 69 ? 1.935   -24.767 3.746   1.00 0.00 ? 69 SER A CA   3  
ATOM 3093  C C    . SER A 1 69 ? 2.979   -25.027 4.828   1.00 0.00 ? 69 SER A C    3  
ATOM 3094  O O    . SER A 1 69 ? 3.974   -24.311 4.930   1.00 0.00 ? 69 SER A O    3  
ATOM 3095  C CB   . SER A 1 69 ? 2.196   -25.672 2.541   1.00 0.00 ? 69 SER A CB   3  
ATOM 3096  O OG   . SER A 1 69 ? 2.224   -27.036 2.925   1.00 0.00 ? 69 SER A OG   3  
ATOM 3097  H H    . SER A 1 69 ? 2.273   -23.131 2.446   1.00 0.00 ? 69 SER A H    3  
ATOM 3098  H HA   . SER A 1 69 ? 0.957   -24.988 4.147   1.00 0.00 ? 69 SER A HA   3  
ATOM 3099  H HB2  . SER A 1 69 ? 1.413   -25.532 1.812   1.00 0.00 ? 69 SER A HB2  3  
ATOM 3100  H HB3  . SER A 1 69 ? 3.149   -25.415 2.101   1.00 0.00 ? 69 SER A HB3  3  
ATOM 3101  H HG   . SER A 1 69 ? 1.618   -27.176 3.656   1.00 0.00 ? 69 SER A HG   3  
ATOM 3102  N N    . GLY A 1 70 ? 2.744   -26.058 5.634   1.00 0.00 ? 70 GLY A N    3  
ATOM 3103  C CA   . GLY A 1 70 ? 3.672   -26.395 6.697   1.00 0.00 ? 70 GLY A CA   3  
ATOM 3104  C C    . GLY A 1 70 ? 3.109   -27.429 7.652   1.00 0.00 ? 70 GLY A C    3  
ATOM 3105  O O    . GLY A 1 70 ? 2.278   -27.111 8.503   1.00 0.00 ? 70 GLY A O    3  
ATOM 3106  H H    . GLY A 1 70 ? 1.933   -26.594 5.505   1.00 0.00 ? 70 GLY A H    3  
ATOM 3107  H HA2  . GLY A 1 70 ? 4.580   -26.781 6.259   1.00 0.00 ? 70 GLY A HA2  3  
ATOM 3108  H HA3  . GLY A 1 70 ? 3.905   -25.498 7.253   1.00 0.00 ? 70 GLY A HA3  3  
ATOM 3109  N N    . GLY A 1 1  ? -25.057 -0.496  3.338   1.00 0.00 ? 1  GLY A N    4  
ATOM 3110  C CA   . GLY A 1 1  ? -24.004 0.390   2.876   1.00 0.00 ? 1  GLY A CA   4  
ATOM 3111  C C    . GLY A 1 1  ? -22.692 0.155   3.596   1.00 0.00 ? 1  GLY A C    4  
ATOM 3112  O O    . GLY A 1 1  ? -22.555 0.483   4.774   1.00 0.00 ? 1  GLY A O    4  
ATOM 3113  H H1   . GLY A 1 1  ? -25.534 -0.294  4.171   1.00 0.00 ? 1  GLY A H1   4  
ATOM 3114  H HA2  . GLY A 1 1  ? -23.856 0.233   1.818   1.00 0.00 ? 1  GLY A HA2  4  
ATOM 3115  H HA3  . GLY A 1 1  ? -24.312 1.412   3.038   1.00 0.00 ? 1  GLY A HA3  4  
ATOM 3116  N N    . SER A 1 2  ? -21.723 -0.417  2.887   1.00 0.00 ? 2  SER A N    4  
ATOM 3117  C CA   . SER A 1 2  ? -20.416 -0.701  3.468   1.00 0.00 ? 2  SER A CA   4  
ATOM 3118  C C    . SER A 1 2  ? -19.299 -0.150  2.587   1.00 0.00 ? 2  SER A C    4  
ATOM 3119  O O    . SER A 1 2  ? -19.118 -0.585  1.450   1.00 0.00 ? 2  SER A O    4  
ATOM 3120  C CB   . SER A 1 2  ? -20.235 -2.209  3.657   1.00 0.00 ? 2  SER A CB   4  
ATOM 3121  O OG   . SER A 1 2  ? -21.197 -2.728  4.559   1.00 0.00 ? 2  SER A OG   4  
ATOM 3122  H H    . SER A 1 2  ? -21.893 -0.656  1.952   1.00 0.00 ? 2  SER A H    4  
ATOM 3123  H HA   . SER A 1 2  ? -20.370 -0.218  4.432   1.00 0.00 ? 2  SER A HA   4  
ATOM 3124  H HB2  . SER A 1 2  ? -20.348 -2.704  2.705   1.00 0.00 ? 2  SER A HB2  4  
ATOM 3125  H HB3  . SER A 1 2  ? -19.248 -2.403  4.050   1.00 0.00 ? 2  SER A HB3  4  
ATOM 3126  H HG   . SER A 1 2  ? -22.079 -2.542  4.230   1.00 0.00 ? 2  SER A HG   4  
ATOM 3127  N N    . SER A 1 3  ? -18.552 0.811   3.122   1.00 0.00 ? 3  SER A N    4  
ATOM 3128  C CA   . SER A 1 3  ? -17.455 1.425   2.385   1.00 0.00 ? 3  SER A CA   4  
ATOM 3129  C C    . SER A 1 3  ? -16.108 1.029   2.984   1.00 0.00 ? 3  SER A C    4  
ATOM 3130  O O    . SER A 1 3  ? -15.656 1.616   3.965   1.00 0.00 ? 3  SER A O    4  
ATOM 3131  C CB   . SER A 1 3  ? -17.599 2.948   2.389   1.00 0.00 ? 3  SER A CB   4  
ATOM 3132  O OG   . SER A 1 3  ? -16.608 3.557   1.579   1.00 0.00 ? 3  SER A OG   4  
ATOM 3133  H H    . SER A 1 3  ? -18.746 1.115   4.034   1.00 0.00 ? 3  SER A H    4  
ATOM 3134  H HA   . SER A 1 3  ? -17.500 1.071   1.366   1.00 0.00 ? 3  SER A HA   4  
ATOM 3135  H HB2  . SER A 1 3  ? -18.572 3.216   2.008   1.00 0.00 ? 3  SER A HB2  4  
ATOM 3136  H HB3  . SER A 1 3  ? -17.495 3.314   3.401   1.00 0.00 ? 3  SER A HB3  4  
ATOM 3137  H HG   . SER A 1 3  ? -15.743 3.217   1.821   1.00 0.00 ? 3  SER A HG   4  
ATOM 3138  N N    . GLY A 1 4  ? -15.473 0.026   2.384   1.00 0.00 ? 4  GLY A N    4  
ATOM 3139  C CA   . GLY A 1 4  ? -14.186 -0.433  2.871   1.00 0.00 ? 4  GLY A CA   4  
ATOM 3140  C C    . GLY A 1 4  ? -14.217 -0.791  4.343   1.00 0.00 ? 4  GLY A C    4  
ATOM 3141  O O    . GLY A 1 4  ? -13.738 -0.030  5.185   1.00 0.00 ? 4  GLY A O    4  
ATOM 3142  H H    . GLY A 1 4  ? -15.882 -0.405  1.605   1.00 0.00 ? 4  GLY A H    4  
ATOM 3143  H HA2  . GLY A 1 4  ? -13.889 -1.303  2.305   1.00 0.00 ? 4  GLY A HA2  4  
ATOM 3144  H HA3  . GLY A 1 4  ? -13.456 0.349   2.718   1.00 0.00 ? 4  GLY A HA3  4  
ATOM 3145  N N    . SER A 1 5  ? -14.783 -1.952  4.656   1.00 0.00 ? 5  SER A N    4  
ATOM 3146  C CA   . SER A 1 5  ? -14.879 -2.407  6.038   1.00 0.00 ? 5  SER A CA   4  
ATOM 3147  C C    . SER A 1 5  ? -13.667 -3.253  6.418   1.00 0.00 ? 5  SER A C    4  
ATOM 3148  O O    . SER A 1 5  ? -12.948 -2.935  7.365   1.00 0.00 ? 5  SER A O    4  
ATOM 3149  C CB   . SER A 1 5  ? -16.163 -3.215  6.243   1.00 0.00 ? 5  SER A CB   4  
ATOM 3150  O OG   . SER A 1 5  ? -17.242 -2.372  6.608   1.00 0.00 ? 5  SER A OG   4  
ATOM 3151  H H    . SER A 1 5  ? -15.146 -2.515  3.941   1.00 0.00 ? 5  SER A H    4  
ATOM 3152  H HA   . SER A 1 5  ? -14.908 -1.535  6.674   1.00 0.00 ? 5  SER A HA   4  
ATOM 3153  H HB2  . SER A 1 5  ? -16.414 -3.725  5.326   1.00 0.00 ? 5  SER A HB2  4  
ATOM 3154  H HB3  . SER A 1 5  ? -16.007 -3.941  7.028   1.00 0.00 ? 5  SER A HB3  4  
ATOM 3155  H HG   . SER A 1 5  ? -17.616 -1.972  5.819   1.00 0.00 ? 5  SER A HG   4  
ATOM 3156  N N    . SER A 1 6  ? -13.449 -4.331  5.672   1.00 0.00 ? 6  SER A N    4  
ATOM 3157  C CA   . SER A 1 6  ? -12.326 -5.225  5.932   1.00 0.00 ? 6  SER A CA   4  
ATOM 3158  C C    . SER A 1 6  ? -11.101 -4.808  5.123   1.00 0.00 ? 6  SER A C    4  
ATOM 3159  O O    . SER A 1 6  ? -11.220 -4.158  4.086   1.00 0.00 ? 6  SER A O    4  
ATOM 3160  C CB   . SER A 1 6  ? -12.708 -6.668  5.595   1.00 0.00 ? 6  SER A CB   4  
ATOM 3161  O OG   . SER A 1 6  ? -11.788 -7.584  6.161   1.00 0.00 ? 6  SER A OG   4  
ATOM 3162  H H    . SER A 1 6  ? -14.058 -4.531  4.931   1.00 0.00 ? 6  SER A H    4  
ATOM 3163  H HA   . SER A 1 6  ? -12.088 -5.161  6.983   1.00 0.00 ? 6  SER A HA   4  
ATOM 3164  H HB2  . SER A 1 6  ? -13.692 -6.878  5.984   1.00 0.00 ? 6  SER A HB2  4  
ATOM 3165  H HB3  . SER A 1 6  ? -12.710 -6.795  4.521   1.00 0.00 ? 6  SER A HB3  4  
ATOM 3166  H HG   . SER A 1 6  ? -11.586 -7.321  7.062   1.00 0.00 ? 6  SER A HG   4  
ATOM 3167  N N    . GLY A 1 7  ? -9.923  -5.189  5.608   1.00 0.00 ? 7  GLY A N    4  
ATOM 3168  C CA   . GLY A 1 7  ? -8.692  -4.846  4.919   1.00 0.00 ? 7  GLY A CA   4  
ATOM 3169  C C    . GLY A 1 7  ? -7.711  -6.000  4.878   1.00 0.00 ? 7  GLY A C    4  
ATOM 3170  O O    . GLY A 1 7  ? -7.438  -6.631  5.900   1.00 0.00 ? 7  GLY A O    4  
ATOM 3171  H H    . GLY A 1 7  ? -9.889  -5.706  6.440   1.00 0.00 ? 7  GLY A H    4  
ATOM 3172  H HA2  . GLY A 1 7  ? -8.929  -4.552  3.908   1.00 0.00 ? 7  GLY A HA2  4  
ATOM 3173  H HA3  . GLY A 1 7  ? -8.229  -4.013  5.427   1.00 0.00 ? 7  GLY A HA3  4  
ATOM 3174  N N    . THR A 1 8  ? -7.178  -6.280  3.692   1.00 0.00 ? 8  THR A N    4  
ATOM 3175  C CA   . THR A 1 8  ? -6.223  -7.368  3.521   1.00 0.00 ? 8  THR A CA   4  
ATOM 3176  C C    . THR A 1 8  ? -4.809  -6.919  3.871   1.00 0.00 ? 8  THR A C    4  
ATOM 3177  O O    . THR A 1 8  ? -4.381  -5.815  3.535   1.00 0.00 ? 8  THR A O    4  
ATOM 3178  C CB   . THR A 1 8  ? -6.236  -7.904  2.077   1.00 0.00 ? 8  THR A CB   4  
ATOM 3179  O OG1  . THR A 1 8  ? -7.532  -8.426  1.760   1.00 0.00 ? 8  THR A OG1  4  
ATOM 3180  C CG2  . THR A 1 8  ? -5.188  -8.992  1.894   1.00 0.00 ? 8  THR A CG2  4  
ATOM 3181  H H    . THR A 1 8  ? -7.435  -5.741  2.915   1.00 0.00 ? 8  THR A H    4  
ATOM 3182  H HA   . THR A 1 8  ? -6.510  -8.171  4.184   1.00 0.00 ? 8  THR A HA   4  
ATOM 3183  H HB   . THR A 1 8  ? -6.010  -7.090  1.404   1.00 0.00 ? 8  THR A HB   4  
ATOM 3184  H HG1  . THR A 1 8  ? -7.724  -9.174  2.330   1.00 0.00 ? 8  THR A HG1  4  
ATOM 3185  H HG21 . THR A 1 8  ? -5.571  -9.928  2.272   1.00 0.00 ? 8  THR A HG21 4  
ATOM 3186  H HG22 . THR A 1 8  ? -4.293  -8.724  2.436   1.00 0.00 ? 8  THR A HG22 4  
ATOM 3187  H HG23 . THR A 1 8  ? -4.956  -9.095  0.845   1.00 0.00 ? 8  THR A HG23 4  
ATOM 3188  N N    . PRO A 1 9  ? -4.064  -7.794  4.563   1.00 0.00 ? 9  PRO A N    4  
ATOM 3189  C CA   . PRO A 1 9  ? -2.686  -7.509  4.973   1.00 0.00 ? 9  PRO A CA   4  
ATOM 3190  C C    . PRO A 1 9  ? -1.724  -7.476  3.790   1.00 0.00 ? 9  PRO A C    4  
ATOM 3191  O O    . PRO A 1 9  ? -1.895  -8.213  2.819   1.00 0.00 ? 9  PRO A O    4  
ATOM 3192  C CB   . PRO A 1 9  ? -2.346  -8.674  5.906   1.00 0.00 ? 9  PRO A CB   4  
ATOM 3193  C CG   . PRO A 1 9  ? -3.241  -9.782  5.471   1.00 0.00 ? 9  PRO A CG   4  
ATOM 3194  C CD   . PRO A 1 9  ? -4.510  -9.128  4.998   1.00 0.00 ? 9  PRO A CD   4  
ATOM 3195  H HA   . PRO A 1 9  ? -2.618  -6.578  5.517   1.00 0.00 ? 9  PRO A HA   4  
ATOM 3196  H HB2  . PRO A 1 9  ? -1.304  -8.938  5.792   1.00 0.00 ? 9  PRO A HB2  4  
ATOM 3197  H HB3  . PRO A 1 9  ? -2.540  -8.389  6.929   1.00 0.00 ? 9  PRO A HB3  4  
ATOM 3198  H HG2  . PRO A 1 9  ? -2.779  -10.332 4.665   1.00 0.00 ? 9  PRO A HG2  4  
ATOM 3199  H HG3  . PRO A 1 9  ? -3.446  -10.437 6.305   1.00 0.00 ? 9  PRO A HG3  4  
ATOM 3200  H HD2  . PRO A 1 9  ? -4.934  -9.681  4.173   1.00 0.00 ? 9  PRO A HD2  4  
ATOM 3201  H HD3  . PRO A 1 9  ? -5.219  -9.052  5.809   1.00 0.00 ? 9  PRO A HD3  4  
ATOM 3202  N N    . TYR A 1 10 ? -0.714  -6.619  3.879   1.00 0.00 ? 10 TYR A N    4  
ATOM 3203  C CA   . TYR A 1 10 ? 0.274   -6.489  2.815   1.00 0.00 ? 10 TYR A CA   4  
ATOM 3204  C C    . TYR A 1 10 ? 1.657   -6.192  3.388   1.00 0.00 ? 10 TYR A C    4  
ATOM 3205  O O    . TYR A 1 10 ? 1.814   -6.004  4.594   1.00 0.00 ? 10 TYR A O    4  
ATOM 3206  C CB   . TYR A 1 10 ? -0.135  -5.381  1.843   1.00 0.00 ? 10 TYR A CB   4  
ATOM 3207  C CG   . TYR A 1 10 ? -1.002  -5.865  0.702   1.00 0.00 ? 10 TYR A CG   4  
ATOM 3208  C CD1  . TYR A 1 10 ? -2.341  -6.174  0.905   1.00 0.00 ? 10 TYR A CD1  4  
ATOM 3209  C CD2  . TYR A 1 10 ? -0.481  -6.015  -0.577  1.00 0.00 ? 10 TYR A CD2  4  
ATOM 3210  C CE1  . TYR A 1 10 ? -3.137  -6.618  -0.134  1.00 0.00 ? 10 TYR A CE1  4  
ATOM 3211  C CE2  . TYR A 1 10 ? -1.270  -6.457  -1.622  1.00 0.00 ? 10 TYR A CE2  4  
ATOM 3212  C CZ   . TYR A 1 10 ? -2.597  -6.757  -1.395  1.00 0.00 ? 10 TYR A CZ   4  
ATOM 3213  O OH   . TYR A 1 10 ? -3.385  -7.199  -2.433  1.00 0.00 ? 10 TYR A OH   4  
ATOM 3214  H H    . TYR A 1 10 ? -0.631  -6.058  4.679   1.00 0.00 ? 10 TYR A H    4  
ATOM 3215  H HA   . TYR A 1 10 ? 0.312   -7.427  2.280   1.00 0.00 ? 10 TYR A HA   4  
ATOM 3216  H HB2  . TYR A 1 10 ? -0.688  -4.625  2.380   1.00 0.00 ? 10 TYR A HB2  4  
ATOM 3217  H HB3  . TYR A 1 10 ? 0.754   -4.937  1.419   1.00 0.00 ? 10 TYR A HB3  4  
ATOM 3218  H HD1  . TYR A 1 10 ? -2.762  -6.064  1.894   1.00 0.00 ? 10 TYR A HD1  4  
ATOM 3219  H HD2  . TYR A 1 10 ? 0.559   -5.779  -0.751  1.00 0.00 ? 10 TYR A HD2  4  
ATOM 3220  H HE1  . TYR A 1 10 ? -4.176  -6.853  0.043   1.00 0.00 ? 10 TYR A HE1  4  
ATOM 3221  H HE2  . TYR A 1 10 ? -0.847  -6.566  -2.610  1.00 0.00 ? 10 TYR A HE2  4  
ATOM 3222  H HH   . TYR A 1 10 ? -4.308  -7.033  -2.226  1.00 0.00 ? 10 TYR A HH   4  
ATOM 3223  N N    . ARG A 1 11 ? 2.656   -6.153  2.513   1.00 0.00 ? 11 ARG A N    4  
ATOM 3224  C CA   . ARG A 1 11 ? 4.026   -5.880  2.930   1.00 0.00 ? 11 ARG A CA   4  
ATOM 3225  C C    . ARG A 1 11 ? 4.774   -5.091  1.860   1.00 0.00 ? 11 ARG A C    4  
ATOM 3226  O O    . ARG A 1 11 ? 4.890   -5.532  0.717   1.00 0.00 ? 11 ARG A O    4  
ATOM 3227  C CB   . ARG A 1 11 ? 4.763   -7.189  3.222   1.00 0.00 ? 11 ARG A CB   4  
ATOM 3228  C CG   . ARG A 1 11 ? 6.252   -7.007  3.468   1.00 0.00 ? 11 ARG A CG   4  
ATOM 3229  C CD   . ARG A 1 11 ? 6.813   -8.123  4.337   1.00 0.00 ? 11 ARG A CD   4  
ATOM 3230  N NE   . ARG A 1 11 ? 8.249   -8.299  4.141   1.00 0.00 ? 11 ARG A NE   4  
ATOM 3231  C CZ   . ARG A 1 11 ? 8.786   -8.766  3.019   1.00 0.00 ? 11 ARG A CZ   4  
ATOM 3232  N NH1  . ARG A 1 11 ? 8.009   -9.100  1.998   1.00 0.00 ? 11 ARG A NH1  4  
ATOM 3233  N NH2  . ARG A 1 11 ? 10.102  -8.898  2.917   1.00 0.00 ? 11 ARG A NH2  4  
ATOM 3234  H H    . ARG A 1 11 ? 2.469   -6.311  1.564   1.00 0.00 ? 11 ARG A H    4  
ATOM 3235  H HA   . ARG A 1 11 ? 3.987   -5.290  3.834   1.00 0.00 ? 11 ARG A HA   4  
ATOM 3236  H HB2  . ARG A 1 11 ? 4.329   -7.645  4.099   1.00 0.00 ? 11 ARG A HB2  4  
ATOM 3237  H HB3  . ARG A 1 11 ? 4.638   -7.853  2.381   1.00 0.00 ? 11 ARG A HB3  4  
ATOM 3238  H HG2  . ARG A 1 11 ? 6.768   -7.012  2.519   1.00 0.00 ? 11 ARG A HG2  4  
ATOM 3239  H HG3  . ARG A 1 11 ? 6.413   -6.062  3.964   1.00 0.00 ? 11 ARG A HG3  4  
ATOM 3240  H HD2  . ARG A 1 11 ? 6.628   -7.882  5.373   1.00 0.00 ? 11 ARG A HD2  4  
ATOM 3241  H HD3  . ARG A 1 11 ? 6.308   -9.044  4.086   1.00 0.00 ? 11 ARG A HD3  4  
ATOM 3242  H HE   . ARG A 1 11 ? 8.842   -8.059  4.883   1.00 0.00 ? 11 ARG A HE   4  
ATOM 3243  H HH11 . ARG A 1 11 ? 7.017   -9.001  2.071   1.00 0.00 ? 11 ARG A HH11 4  
ATOM 3244  H HH12 . ARG A 1 11 ? 8.416   -9.450  1.153   1.00 0.00 ? 11 ARG A HH12 4  
ATOM 3245  H HH21 . ARG A 1 11 ? 10.691  -8.647  3.684   1.00 0.00 ? 11 ARG A HH21 4  
ATOM 3246  H HH22 . ARG A 1 11 ? 10.505  -9.249  2.072   1.00 0.00 ? 11 ARG A HH22 4  
ATOM 3247  N N    . ALA A 1 12 ? 5.279   -3.921  2.239   1.00 0.00 ? 12 ALA A N    4  
ATOM 3248  C CA   . ALA A 1 12 ? 6.017   -3.071  1.312   1.00 0.00 ? 12 ALA A CA   4  
ATOM 3249  C C    . ALA A 1 12 ? 7.336   -3.718  0.905   1.00 0.00 ? 12 ALA A C    4  
ATOM 3250  O O    . ALA A 1 12 ? 8.292   -3.740  1.679   1.00 0.00 ? 12 ALA A O    4  
ATOM 3251  C CB   . ALA A 1 12 ? 6.266   -1.705  1.934   1.00 0.00 ? 12 ALA A CB   4  
ATOM 3252  H H    . ALA A 1 12 ? 5.154   -3.624  3.164   1.00 0.00 ? 12 ALA A H    4  
ATOM 3253  H HA   . ALA A 1 12 ? 5.408   -2.933  0.430   1.00 0.00 ? 12 ALA A HA   4  
ATOM 3254  H HB1  . ALA A 1 12 ? 7.057   -1.783  2.666   1.00 0.00 ? 12 ALA A HB1  4  
ATOM 3255  H HB2  . ALA A 1 12 ? 6.556   -1.007  1.163   1.00 0.00 ? 12 ALA A HB2  4  
ATOM 3256  H HB3  . ALA A 1 12 ? 5.363   -1.358  2.413   1.00 0.00 ? 12 ALA A HB3  4  
ATOM 3257  N N    . MET A 1 13 ? 7.380   -4.246  -0.314  1.00 0.00 ? 13 MET A N    4  
ATOM 3258  C CA   . MET A 1 13 ? 8.583   -4.893  -0.823  1.00 0.00 ? 13 MET A CA   4  
ATOM 3259  C C    . MET A 1 13 ? 9.730   -3.894  -0.940  1.00 0.00 ? 13 MET A C    4  
ATOM 3260  O O    . MET A 1 13 ? 10.901  -4.267  -0.865  1.00 0.00 ? 13 MET A O    4  
ATOM 3261  C CB   . MET A 1 13 ? 8.307   -5.532  -2.186  1.00 0.00 ? 13 MET A CB   4  
ATOM 3262  C CG   . MET A 1 13 ? 7.113   -6.473  -2.185  1.00 0.00 ? 13 MET A CG   4  
ATOM 3263  S SD   . MET A 1 13 ? 7.214   -7.724  -3.478  1.00 0.00 ? 13 MET A SD   4  
ATOM 3264  C CE   . MET A 1 13 ? 6.404   -6.877  -4.833  1.00 0.00 ? 13 MET A CE   4  
ATOM 3265  H H    . MET A 1 13 ? 6.585   -4.198  -0.885  1.00 0.00 ? 13 MET A H    4  
ATOM 3266  H HA   . MET A 1 13 ? 8.865   -5.666  -0.124  1.00 0.00 ? 13 MET A HA   4  
ATOM 3267  H HB2  . MET A 1 13 ? 8.121   -4.749  -2.906  1.00 0.00 ? 13 MET A HB2  4  
ATOM 3268  H HB3  . MET A 1 13 ? 9.178   -6.092  -2.491  1.00 0.00 ? 13 MET A HB3  4  
ATOM 3269  H HG2  . MET A 1 13 ? 7.062   -6.969  -1.227  1.00 0.00 ? 13 MET A HG2  4  
ATOM 3270  H HG3  . MET A 1 13 ? 6.215   -5.891  -2.334  1.00 0.00 ? 13 MET A HG3  4  
ATOM 3271  H HE1  . MET A 1 13 ? 5.492   -6.421  -4.479  1.00 0.00 ? 13 MET A HE1  4  
ATOM 3272  H HE2  . MET A 1 13 ? 7.060   -6.114  -5.224  1.00 0.00 ? 13 MET A HE2  4  
ATOM 3273  H HE3  . MET A 1 13 ? 6.172   -7.588  -5.614  1.00 0.00 ? 13 MET A HE3  4  
ATOM 3274  N N    . TYR A 1 14 ? 9.386   -2.624  -1.125  1.00 0.00 ? 14 TYR A N    4  
ATOM 3275  C CA   . TYR A 1 14 ? 10.387  -1.573  -1.255  1.00 0.00 ? 14 TYR A CA   4  
ATOM 3276  C C    . TYR A 1 14 ? 9.871   -0.255  -0.685  1.00 0.00 ? 14 TYR A C    4  
ATOM 3277  O O    . TYR A 1 14 ? 8.721   0.122   -0.910  1.00 0.00 ? 14 TYR A O    4  
ATOM 3278  C CB   . TYR A 1 14 ? 10.776  -1.388  -2.723  1.00 0.00 ? 14 TYR A CB   4  
ATOM 3279  C CG   . TYR A 1 14 ? 10.735  -2.669  -3.526  1.00 0.00 ? 14 TYR A CG   4  
ATOM 3280  C CD1  . TYR A 1 14 ? 11.767  -3.595  -3.446  1.00 0.00 ? 14 TYR A CD1  4  
ATOM 3281  C CD2  . TYR A 1 14 ? 9.664   -2.952  -4.365  1.00 0.00 ? 14 TYR A CD2  4  
ATOM 3282  C CE1  . TYR A 1 14 ? 11.735  -4.766  -4.178  1.00 0.00 ? 14 TYR A CE1  4  
ATOM 3283  C CE2  . TYR A 1 14 ? 9.623   -4.122  -5.099  1.00 0.00 ? 14 TYR A CE2  4  
ATOM 3284  C CZ   . TYR A 1 14 ? 10.660  -5.025  -5.002  1.00 0.00 ? 14 TYR A CZ   4  
ATOM 3285  O OH   . TYR A 1 14 ? 10.623  -6.190  -5.734  1.00 0.00 ? 14 TYR A OH   4  
ATOM 3286  H H    . TYR A 1 14 ? 8.436   -2.389  -1.176  1.00 0.00 ? 14 TYR A H    4  
ATOM 3287  H HA   . TYR A 1 14 ? 11.261  -1.875  -0.697  1.00 0.00 ? 14 TYR A HA   4  
ATOM 3288  H HB2  . TYR A 1 14 ? 10.096  -0.688  -3.183  1.00 0.00 ? 14 TYR A HB2  4  
ATOM 3289  H HB3  . TYR A 1 14 ? 11.780  -0.995  -2.776  1.00 0.00 ? 14 TYR A HB3  4  
ATOM 3290  H HD1  . TYR A 1 14 ? 12.608  -3.390  -2.798  1.00 0.00 ? 14 TYR A HD1  4  
ATOM 3291  H HD2  . TYR A 1 14 ? 8.854   -2.242  -4.439  1.00 0.00 ? 14 TYR A HD2  4  
ATOM 3292  H HE1  . TYR A 1 14 ? 12.547  -5.475  -4.102  1.00 0.00 ? 14 TYR A HE1  4  
ATOM 3293  H HE2  . TYR A 1 14 ? 8.781   -4.324  -5.746  1.00 0.00 ? 14 TYR A HE2  4  
ATOM 3294  H HH   . TYR A 1 14 ? 11.508  -6.407  -6.036  1.00 0.00 ? 14 TYR A HH   4  
ATOM 3295  N N    . GLN A 1 15 ? 10.730  0.439   0.054   1.00 0.00 ? 15 GLN A N    4  
ATOM 3296  C CA   . GLN A 1 15 ? 10.361  1.715   0.657   1.00 0.00 ? 15 GLN A CA   4  
ATOM 3297  C C    . GLN A 1 15 ? 9.852   2.690   -0.399  1.00 0.00 ? 15 GLN A C    4  
ATOM 3298  O O    . GLN A 1 15 ? 10.337  2.702   -1.531  1.00 0.00 ? 15 GLN A O    4  
ATOM 3299  C CB   . GLN A 1 15 ? 11.558  2.320   1.393   1.00 0.00 ? 15 GLN A CB   4  
ATOM 3300  C CG   . GLN A 1 15 ? 11.279  3.694   1.980   1.00 0.00 ? 15 GLN A CG   4  
ATOM 3301  C CD   . GLN A 1 15 ? 12.504  4.313   2.624   1.00 0.00 ? 15 GLN A CD   4  
ATOM 3302  O OE1  . GLN A 1 15 ? 13.539  4.483   1.980   1.00 0.00 ? 15 GLN A OE1  4  
ATOM 3303  N NE2  . GLN A 1 15 ? 12.393  4.653   3.903   1.00 0.00 ? 15 GLN A NE2  4  
ATOM 3304  H H    . GLN A 1 15 ? 11.632  0.086   0.198   1.00 0.00 ? 15 GLN A H    4  
ATOM 3305  H HA   . GLN A 1 15 ? 9.570   1.529   1.368   1.00 0.00 ? 15 GLN A HA   4  
ATOM 3306  H HB2  . GLN A 1 15 ? 11.842  1.659   2.198   1.00 0.00 ? 15 GLN A HB2  4  
ATOM 3307  H HB3  . GLN A 1 15 ? 12.382  2.409   0.701   1.00 0.00 ? 15 GLN A HB3  4  
ATOM 3308  H HG2  . GLN A 1 15 ? 10.939  4.347   1.190   1.00 0.00 ? 15 GLN A HG2  4  
ATOM 3309  H HG3  . GLN A 1 15 ? 10.505  3.602   2.728   1.00 0.00 ? 15 GLN A HG3  4  
ATOM 3310  H HE21 . GLN A 1 15 ? 11.537  4.487   4.353   1.00 0.00 ? 15 GLN A HE21 4  
ATOM 3311  H HE22 . GLN A 1 15 ? 13.169  5.054   4.345   1.00 0.00 ? 15 GLN A HE22 4  
ATOM 3312  N N    . TYR A 1 16 ? 8.873   3.504   -0.023  1.00 0.00 ? 16 TYR A N    4  
ATOM 3313  C CA   . TYR A 1 16 ? 8.296   4.481   -0.939  1.00 0.00 ? 16 TYR A CA   4  
ATOM 3314  C C    . TYR A 1 16 ? 8.418   5.894   -0.377  1.00 0.00 ? 16 TYR A C    4  
ATOM 3315  O O    . TYR A 1 16 ? 8.078   6.146   0.779   1.00 0.00 ? 16 TYR A O    4  
ATOM 3316  C CB   . TYR A 1 16 ? 6.827   4.153   -1.209  1.00 0.00 ? 16 TYR A CB   4  
ATOM 3317  C CG   . TYR A 1 16 ? 6.177   5.071   -2.219  1.00 0.00 ? 16 TYR A CG   4  
ATOM 3318  C CD1  . TYR A 1 16 ? 6.346   4.868   -3.583  1.00 0.00 ? 16 TYR A CD1  4  
ATOM 3319  C CD2  . TYR A 1 16 ? 5.392   6.142   -1.809  1.00 0.00 ? 16 TYR A CD2  4  
ATOM 3320  C CE1  . TYR A 1 16 ? 5.755   5.705   -4.509  1.00 0.00 ? 16 TYR A CE1  4  
ATOM 3321  C CE2  . TYR A 1 16 ? 4.796   6.984   -2.728  1.00 0.00 ? 16 TYR A CE2  4  
ATOM 3322  C CZ   . TYR A 1 16 ? 4.981   6.762   -4.077  1.00 0.00 ? 16 TYR A CZ   4  
ATOM 3323  O OH   . TYR A 1 16 ? 4.389   7.597   -4.996  1.00 0.00 ? 16 TYR A OH   4  
ATOM 3324  H H    . TYR A 1 16 ? 8.528   3.447   0.893   1.00 0.00 ? 16 TYR A H    4  
ATOM 3325  H HA   . TYR A 1 16 ? 8.844   4.427   -1.869  1.00 0.00 ? 16 TYR A HA   4  
ATOM 3326  H HB2  . TYR A 1 16 ? 6.753   3.144   -1.584  1.00 0.00 ? 16 TYR A HB2  4  
ATOM 3327  H HB3  . TYR A 1 16 ? 6.272   4.230   -0.285  1.00 0.00 ? 16 TYR A HB3  4  
ATOM 3328  H HD1  . TYR A 1 16 ? 6.953   4.039   -3.918  1.00 0.00 ? 16 TYR A HD1  4  
ATOM 3329  H HD2  . TYR A 1 16 ? 5.250   6.314   -0.752  1.00 0.00 ? 16 TYR A HD2  4  
ATOM 3330  H HE1  . TYR A 1 16 ? 5.899   5.531   -5.565  1.00 0.00 ? 16 TYR A HE1  4  
ATOM 3331  H HE2  . TYR A 1 16 ? 4.190   7.812   -2.390  1.00 0.00 ? 16 TYR A HE2  4  
ATOM 3332  H HH   . TYR A 1 16 ? 4.190   7.104   -5.795  1.00 0.00 ? 16 TYR A HH   4  
ATOM 3333  N N    . ARG A 1 17 ? 8.906   6.813   -1.203  1.00 0.00 ? 17 ARG A N    4  
ATOM 3334  C CA   . ARG A 1 17 ? 9.075   8.201   -0.790  1.00 0.00 ? 17 ARG A CA   4  
ATOM 3335  C C    . ARG A 1 17 ? 8.014   9.091   -1.431  1.00 0.00 ? 17 ARG A C    4  
ATOM 3336  O O    . ARG A 1 17 ? 8.211   9.657   -2.507  1.00 0.00 ? 17 ARG A O    4  
ATOM 3337  C CB   . ARG A 1 17 ? 10.471  8.701   -1.165  1.00 0.00 ? 17 ARG A CB   4  
ATOM 3338  C CG   . ARG A 1 17 ? 11.570  8.180   -0.254  1.00 0.00 ? 17 ARG A CG   4  
ATOM 3339  C CD   . ARG A 1 17 ? 12.719  9.169   -0.144  1.00 0.00 ? 17 ARG A CD   4  
ATOM 3340  N NE   . ARG A 1 17 ? 13.736  8.724   0.805   1.00 0.00 ? 17 ARG A NE   4  
ATOM 3341  C CZ   . ARG A 1 17 ? 14.579  9.547   1.419   1.00 0.00 ? 17 ARG A CZ   4  
ATOM 3342  N NH1  . ARG A 1 17 ? 14.526  10.851  1.185   1.00 0.00 ? 17 ARG A NH1  4  
ATOM 3343  N NH2  . ARG A 1 17 ? 15.477  9.066   2.269   1.00 0.00 ? 17 ARG A NH2  4  
ATOM 3344  H H    . ARG A 1 17 ? 9.161   6.551   -2.113  1.00 0.00 ? 17 ARG A H    4  
ATOM 3345  H HA   . ARG A 1 17 ? 8.963   8.243   0.283   1.00 0.00 ? 17 ARG A HA   4  
ATOM 3346  H HB2  . ARG A 1 17 ? 10.693  8.390   -2.175  1.00 0.00 ? 17 ARG A HB2  4  
ATOM 3347  H HB3  . ARG A 1 17 ? 10.477  9.780   -1.120  1.00 0.00 ? 17 ARG A HB3  4  
ATOM 3348  H HG2  . ARG A 1 17 ? 11.159  8.012   0.731   1.00 0.00 ? 17 ARG A HG2  4  
ATOM 3349  H HG3  . ARG A 1 17 ? 11.944  7.249   -0.653  1.00 0.00 ? 17 ARG A HG3  4  
ATOM 3350  H HD2  . ARG A 1 17 ? 13.173  9.282   -1.117  1.00 0.00 ? 17 ARG A HD2  4  
ATOM 3351  H HD3  . ARG A 1 17 ? 12.327  10.121  0.183   1.00 0.00 ? 17 ARG A HD3  4  
ATOM 3352  H HE   . ARG A 1 17 ? 13.793  7.764   0.992   1.00 0.00 ? 17 ARG A HE   4  
ATOM 3353  H HH11 . ARG A 1 17 ? 13.849  11.216  0.546   1.00 0.00 ? 17 ARG A HH11 4  
ATOM 3354  H HH12 . ARG A 1 17 ? 15.160  11.469  1.650   1.00 0.00 ? 17 ARG A HH12 4  
ATOM 3355  H HH21 . ARG A 1 17 ? 15.520  8.084   2.448   1.00 0.00 ? 17 ARG A HH21 4  
ATOM 3356  H HH22 . ARG A 1 17 ? 16.110  9.686   2.731   1.00 0.00 ? 17 ARG A HH22 4  
ATOM 3357  N N    . PRO A 1 18 ? 6.862   9.219   -0.757  1.00 0.00 ? 18 PRO A N    4  
ATOM 3358  C CA   . PRO A 1 18 ? 5.748   10.039  -1.242  1.00 0.00 ? 18 PRO A CA   4  
ATOM 3359  C C    . PRO A 1 18 ? 6.059   11.530  -1.186  1.00 0.00 ? 18 PRO A C    4  
ATOM 3360  O O    . PRO A 1 18 ? 6.361   12.071  -0.123  1.00 0.00 ? 18 PRO A O    4  
ATOM 3361  C CB   . PRO A 1 18 ? 4.608   9.694   -0.279  1.00 0.00 ? 18 PRO A CB   4  
ATOM 3362  C CG   . PRO A 1 18 ? 5.289   9.250   0.970   1.00 0.00 ? 18 PRO A CG   4  
ATOM 3363  C CD   . PRO A 1 18 ? 6.558   8.573   0.531   1.00 0.00 ? 18 PRO A CD   4  
ATOM 3364  H HA   . PRO A 1 18 ? 5.465   9.768   -2.248  1.00 0.00 ? 18 PRO A HA   4  
ATOM 3365  H HB2  . PRO A 1 18 ? 4.001   10.571  -0.108  1.00 0.00 ? 18 PRO A HB2  4  
ATOM 3366  H HB3  . PRO A 1 18 ? 4.003   8.906   -0.700  1.00 0.00 ? 18 PRO A HB3  4  
ATOM 3367  H HG2  . PRO A 1 18 ? 5.514   10.104  1.589   1.00 0.00 ? 18 PRO A HG2  4  
ATOM 3368  H HG3  . PRO A 1 18 ? 4.658   8.554   1.503   1.00 0.00 ? 18 PRO A HG3  4  
ATOM 3369  H HD2  . PRO A 1 18 ? 7.347   8.750   1.247   1.00 0.00 ? 18 PRO A HD2  4  
ATOM 3370  H HD3  . PRO A 1 18 ? 6.395   7.513   0.401   1.00 0.00 ? 18 PRO A HD3  4  
ATOM 3371  N N    . GLN A 1 19 ? 5.982   12.189  -2.338  1.00 0.00 ? 19 GLN A N    4  
ATOM 3372  C CA   . GLN A 1 19 ? 6.256   13.619  -2.419  1.00 0.00 ? 19 GLN A CA   4  
ATOM 3373  C C    . GLN A 1 19 ? 5.087   14.430  -1.870  1.00 0.00 ? 19 GLN A C    4  
ATOM 3374  O O    . GLN A 1 19 ? 5.252   15.578  -1.463  1.00 0.00 ? 19 GLN A O    4  
ATOM 3375  C CB   . GLN A 1 19 ? 6.538   14.024  -3.867  1.00 0.00 ? 19 GLN A CB   4  
ATOM 3376  C CG   . GLN A 1 19 ? 7.803   13.403  -4.437  1.00 0.00 ? 19 GLN A CG   4  
ATOM 3377  C CD   . GLN A 1 19 ? 7.926   13.600  -5.935  1.00 0.00 ? 19 GLN A CD   4  
ATOM 3378  O OE1  . GLN A 1 19 ? 6.975   13.372  -6.683  1.00 0.00 ? 19 GLN A OE1  4  
ATOM 3379  N NE2  . GLN A 1 19 ? 9.101   14.027  -6.382  1.00 0.00 ? 19 GLN A NE2  4  
ATOM 3380  H H    . GLN A 1 19 ? 5.737   11.703  -3.152  1.00 0.00 ? 19 GLN A H    4  
ATOM 3381  H HA   . GLN A 1 19 ? 7.131   13.823  -1.821  1.00 0.00 ? 19 GLN A HA   4  
ATOM 3382  H HB2  . GLN A 1 19 ? 5.705   13.721  -4.482  1.00 0.00 ? 19 GLN A HB2  4  
ATOM 3383  H HB3  . GLN A 1 19 ? 6.639   15.099  -3.914  1.00 0.00 ? 19 GLN A HB3  4  
ATOM 3384  H HG2  . GLN A 1 19 ? 8.659   13.856  -3.959  1.00 0.00 ? 19 GLN A HG2  4  
ATOM 3385  H HG3  . GLN A 1 19 ? 7.794   12.344  -4.228  1.00 0.00 ? 19 GLN A HG3  4  
ATOM 3386  H HE21 . GLN A 1 19 ? 9.814   14.187  -5.728  1.00 0.00 ? 19 GLN A HE21 4  
ATOM 3387  H HE22 . GLN A 1 19 ? 9.209   14.162  -7.346  1.00 0.00 ? 19 GLN A HE22 4  
ATOM 3388  N N    . ASN A 1 20 ? 3.904   13.823  -1.864  1.00 0.00 ? 20 ASN A N    4  
ATOM 3389  C CA   . ASN A 1 20 ? 2.706   14.489  -1.366  1.00 0.00 ? 20 ASN A CA   4  
ATOM 3390  C C    . ASN A 1 20 ? 2.055   13.676  -0.251  1.00 0.00 ? 20 ASN A C    4  
ATOM 3391  O O    . ASN A 1 20 ? 2.236   12.461  -0.169  1.00 0.00 ? 20 ASN A O    4  
ATOM 3392  C CB   . ASN A 1 20 ? 1.708   14.706  -2.504  1.00 0.00 ? 20 ASN A CB   4  
ATOM 3393  C CG   . ASN A 1 20 ? 0.385   15.263  -2.015  1.00 0.00 ? 20 ASN A CG   4  
ATOM 3394  O OD1  . ASN A 1 20 ? 0.349   16.125  -1.137  1.00 0.00 ? 20 ASN A OD1  4  
ATOM 3395  N ND2  . ASN A 1 20 ? -0.710  14.771  -2.582  1.00 0.00 ? 20 ASN A ND2  4  
ATOM 3396  H H    . ASN A 1 20 ? 3.835   12.906  -2.202  1.00 0.00 ? 20 ASN A H    4  
ATOM 3397  H HA   . ASN A 1 20 ? 3.001   15.449  -0.970  1.00 0.00 ? 20 ASN A HA   4  
ATOM 3398  H HB2  . ASN A 1 20 ? 2.128   15.402  -3.216  1.00 0.00 ? 20 ASN A HB2  4  
ATOM 3399  H HB3  . ASN A 1 20 ? 1.521   13.763  -2.996  1.00 0.00 ? 20 ASN A HB3  4  
ATOM 3400  H HD21 . ASN A 1 20 ? -0.605  14.086  -3.275  1.00 0.00 ? 20 ASN A HD21 4  
ATOM 3401  H HD22 . ASN A 1 20 ? -1.579  15.114  -2.285  1.00 0.00 ? 20 ASN A HD22 4  
ATOM 3402  N N    . GLU A 1 21 ? 1.297   14.355  0.604   1.00 0.00 ? 21 GLU A N    4  
ATOM 3403  C CA   . GLU A 1 21 ? 0.619   13.694  1.713   1.00 0.00 ? 21 GLU A CA   4  
ATOM 3404  C C    . GLU A 1 21 ? -0.345  12.626  1.204   1.00 0.00 ? 21 GLU A C    4  
ATOM 3405  O O    . GLU A 1 21 ? -0.335  11.490  1.677   1.00 0.00 ? 21 GLU A O    4  
ATOM 3406  C CB   . GLU A 1 21 ? -0.139  14.719  2.559   1.00 0.00 ? 21 GLU A CB   4  
ATOM 3407  C CG   . GLU A 1 21 ? -1.194  15.489  1.783   1.00 0.00 ? 21 GLU A CG   4  
ATOM 3408  C CD   . GLU A 1 21 ? -1.834  16.592  2.603   1.00 0.00 ? 21 GLU A CD   4  
ATOM 3409  O OE1  . GLU A 1 21 ? -2.227  16.321  3.757   1.00 0.00 ? 21 GLU A OE1  4  
ATOM 3410  O OE2  . GLU A 1 21 ? -1.941  17.726  2.092   1.00 0.00 ? 21 GLU A OE2  4  
ATOM 3411  H H    . GLU A 1 21 ? 1.191   15.322  0.486   1.00 0.00 ? 21 GLU A H    4  
ATOM 3412  H HA   . GLU A 1 21 ? 1.371   13.221  2.327   1.00 0.00 ? 21 GLU A HA   4  
ATOM 3413  H HB2  . GLU A 1 21 ? -0.625  14.206  3.376   1.00 0.00 ? 21 GLU A HB2  4  
ATOM 3414  H HB3  . GLU A 1 21 ? 0.569   15.428  2.963   1.00 0.00 ? 21 GLU A HB3  4  
ATOM 3415  H HG2  . GLU A 1 21 ? -0.732  15.931  0.913   1.00 0.00 ? 21 GLU A HG2  4  
ATOM 3416  H HG3  . GLU A 1 21 ? -1.965  14.801  1.469   1.00 0.00 ? 21 GLU A HG3  4  
ATOM 3417  N N    . ASP A 1 22 ? -1.176  13.001  0.238   1.00 0.00 ? 22 ASP A N    4  
ATOM 3418  C CA   . ASP A 1 22 ? -2.147  12.076  -0.336  1.00 0.00 ? 22 ASP A CA   4  
ATOM 3419  C C    . ASP A 1 22 ? -1.572  10.665  -0.416  1.00 0.00 ? 22 ASP A C    4  
ATOM 3420  O O    . ASP A 1 22 ? -2.227  9.696   -0.036  1.00 0.00 ? 22 ASP A O    4  
ATOM 3421  C CB   . ASP A 1 22 ? -2.570  12.547  -1.728  1.00 0.00 ? 22 ASP A CB   4  
ATOM 3422  C CG   . ASP A 1 22 ? -3.430  13.795  -1.680  1.00 0.00 ? 22 ASP A CG   4  
ATOM 3423  O OD1  . ASP A 1 22 ? -4.187  13.956  -0.700  1.00 0.00 ? 22 ASP A OD1  4  
ATOM 3424  O OD2  . ASP A 1 22 ? -3.345  14.611  -2.622  1.00 0.00 ? 22 ASP A OD2  4  
ATOM 3425  H H    . ASP A 1 22 ? -1.136  13.921  -0.097  1.00 0.00 ? 22 ASP A H    4  
ATOM 3426  H HA   . ASP A 1 22 ? -3.013  12.062  0.308   1.00 0.00 ? 22 ASP A HA   4  
ATOM 3427  H HB2  . ASP A 1 22 ? -1.688  12.763  -2.312  1.00 0.00 ? 22 ASP A HB2  4  
ATOM 3428  H HB3  . ASP A 1 22 ? -3.134  11.762  -2.211  1.00 0.00 ? 22 ASP A HB3  4  
ATOM 3429  N N    . GLU A 1 23 ? -0.344  10.560  -0.914  1.00 0.00 ? 23 GLU A N    4  
ATOM 3430  C CA   . GLU A 1 23 ? 0.318   9.267   -1.046  1.00 0.00 ? 23 GLU A CA   4  
ATOM 3431  C C    . GLU A 1 23 ? 0.779   8.751   0.314   1.00 0.00 ? 23 GLU A C    4  
ATOM 3432  O O    . GLU A 1 23 ? 1.224   9.522   1.165   1.00 0.00 ? 23 GLU A O    4  
ATOM 3433  C CB   . GLU A 1 23 ? 1.514   9.375   -1.995  1.00 0.00 ? 23 GLU A CB   4  
ATOM 3434  C CG   . GLU A 1 23 ? 1.185   10.057  -3.313  1.00 0.00 ? 23 GLU A CG   4  
ATOM 3435  C CD   . GLU A 1 23 ? 2.380   10.133  -4.243  1.00 0.00 ? 23 GLU A CD   4  
ATOM 3436  O OE1  . GLU A 1 23 ? 3.312   10.910  -3.949  1.00 0.00 ? 23 GLU A OE1  4  
ATOM 3437  O OE2  . GLU A 1 23 ? 2.383   9.416   -5.266  1.00 0.00 ? 23 GLU A OE2  4  
ATOM 3438  H H    . GLU A 1 23 ? 0.128   11.370  -1.200  1.00 0.00 ? 23 GLU A H    4  
ATOM 3439  H HA   . GLU A 1 23 ? -0.395  8.570   -1.459  1.00 0.00 ? 23 GLU A HA   4  
ATOM 3440  H HB2  . GLU A 1 23 ? 2.295   9.939   -1.506  1.00 0.00 ? 23 GLU A HB2  4  
ATOM 3441  H HB3  . GLU A 1 23 ? 1.879   8.382   -2.208  1.00 0.00 ? 23 GLU A HB3  4  
ATOM 3442  H HG2  . GLU A 1 23 ? 0.401   9.501   -3.804  1.00 0.00 ? 23 GLU A HG2  4  
ATOM 3443  H HG3  . GLU A 1 23 ? 0.842   11.060  -3.109  1.00 0.00 ? 23 GLU A HG3  4  
ATOM 3444  N N    . LEU A 1 24 ? 0.668   7.442   0.512   1.00 0.00 ? 24 LEU A N    4  
ATOM 3445  C CA   . LEU A 1 24 ? 1.073   6.821   1.768   1.00 0.00 ? 24 LEU A CA   4  
ATOM 3446  C C    . LEU A 1 24 ? 2.518   6.337   1.696   1.00 0.00 ? 24 LEU A C    4  
ATOM 3447  O O    . LEU A 1 24 ? 2.917   5.686   0.731   1.00 0.00 ? 24 LEU A O    4  
ATOM 3448  C CB   . LEU A 1 24 ? 0.147   5.650   2.102   1.00 0.00 ? 24 LEU A CB   4  
ATOM 3449  C CG   . LEU A 1 24 ? 0.116   5.216   3.568   1.00 0.00 ? 24 LEU A CG   4  
ATOM 3450  C CD1  . LEU A 1 24 ? -0.477  6.314   4.437   1.00 0.00 ? 24 LEU A CD1  4  
ATOM 3451  C CD2  . LEU A 1 24 ? -0.672  3.924   3.726   1.00 0.00 ? 24 LEU A CD2  4  
ATOM 3452  H H    . LEU A 1 24 ? 0.306   6.879   -0.204  1.00 0.00 ? 24 LEU A H    4  
ATOM 3453  H HA   . LEU A 1 24 ? 0.994   7.565   2.546   1.00 0.00 ? 24 LEU A HA   4  
ATOM 3454  H HB2  . LEU A 1 24 ? -0.855  5.930   1.819   1.00 0.00 ? 24 LEU A HB2  4  
ATOM 3455  H HB3  . LEU A 1 24 ? 0.463   4.801   1.512   1.00 0.00 ? 24 LEU A HB3  4  
ATOM 3456  H HG   . LEU A 1 24 ? 1.128   5.035   3.905   1.00 0.00 ? 24 LEU A HG   4  
ATOM 3457  H HD11 . LEU A 1 24 ? -1.504  6.074   4.669   1.00 0.00 ? 24 LEU A HD11 4  
ATOM 3458  H HD12 . LEU A 1 24 ? -0.438  7.254   3.907   1.00 0.00 ? 24 LEU A HD12 4  
ATOM 3459  H HD13 . LEU A 1 24 ? 0.090   6.394   5.353   1.00 0.00 ? 24 LEU A HD13 4  
ATOM 3460  H HD21 . LEU A 1 24 ? -1.027  3.599   2.759   1.00 0.00 ? 24 LEU A HD21 4  
ATOM 3461  H HD22 . LEU A 1 24 ? -1.515  4.094   4.379   1.00 0.00 ? 24 LEU A HD22 4  
ATOM 3462  H HD23 . LEU A 1 24 ? -0.035  3.163   4.150   1.00 0.00 ? 24 LEU A HD23 4  
ATOM 3463  N N    . GLU A 1 25 ? 3.296   6.659   2.725   1.00 0.00 ? 25 GLU A N    4  
ATOM 3464  C CA   . GLU A 1 25 ? 4.696   6.255   2.778   1.00 0.00 ? 25 GLU A CA   4  
ATOM 3465  C C    . GLU A 1 25 ? 4.824   4.782   3.153   1.00 0.00 ? 25 GLU A C    4  
ATOM 3466  O O    . GLU A 1 25 ? 4.002   4.245   3.896   1.00 0.00 ? 25 GLU A O    4  
ATOM 3467  C CB   . GLU A 1 25 ? 5.461   7.117   3.785   1.00 0.00 ? 25 GLU A CB   4  
ATOM 3468  C CG   . GLU A 1 25 ? 6.962   7.138   3.552   1.00 0.00 ? 25 GLU A CG   4  
ATOM 3469  C CD   . GLU A 1 25 ? 7.638   8.326   4.209   1.00 0.00 ? 25 GLU A CD   4  
ATOM 3470  O OE1  . GLU A 1 25 ? 7.469   8.503   5.433   1.00 0.00 ? 25 GLU A OE1  4  
ATOM 3471  O OE2  . GLU A 1 25 ? 8.337   9.078   3.498   1.00 0.00 ? 25 GLU A OE2  4  
ATOM 3472  H H    . GLU A 1 25 ? 2.920   7.180   3.465   1.00 0.00 ? 25 GLU A H    4  
ATOM 3473  H HA   . GLU A 1 25 ? 5.121   6.403   1.797   1.00 0.00 ? 25 GLU A HA   4  
ATOM 3474  H HB2  . GLU A 1 25 ? 5.094   8.131   3.724   1.00 0.00 ? 25 GLU A HB2  4  
ATOM 3475  H HB3  . GLU A 1 25 ? 5.277   6.737   4.779   1.00 0.00 ? 25 GLU A HB3  4  
ATOM 3476  H HG2  . GLU A 1 25 ? 7.389   6.232   3.957   1.00 0.00 ? 25 GLU A HG2  4  
ATOM 3477  H HG3  . GLU A 1 25 ? 7.149   7.178   2.489   1.00 0.00 ? 25 GLU A HG3  4  
ATOM 3478  N N    . LEU A 1 26 ? 5.861   4.133   2.633   1.00 0.00 ? 26 LEU A N    4  
ATOM 3479  C CA   . LEU A 1 26 ? 6.097   2.721   2.913   1.00 0.00 ? 26 LEU A CA   4  
ATOM 3480  C C    . LEU A 1 26 ? 7.530   2.491   3.382   1.00 0.00 ? 26 LEU A C    4  
ATOM 3481  O O    . LEU A 1 26 ? 8.373   3.384   3.294   1.00 0.00 ? 26 LEU A O    4  
ATOM 3482  C CB   . LEU A 1 26 ? 5.816   1.880   1.666   1.00 0.00 ? 26 LEU A CB   4  
ATOM 3483  C CG   . LEU A 1 26 ? 4.370   1.882   1.168   1.00 0.00 ? 26 LEU A CG   4  
ATOM 3484  C CD1  . LEU A 1 26 ? 4.267   1.171   -0.172  1.00 0.00 ? 26 LEU A CD1  4  
ATOM 3485  C CD2  . LEU A 1 26 ? 3.452   1.230   2.192   1.00 0.00 ? 26 LEU A CD2  4  
ATOM 3486  H H    . LEU A 1 26 ? 6.482   4.614   2.048   1.00 0.00 ? 26 LEU A H    4  
ATOM 3487  H HA   . LEU A 1 26 ? 5.421   2.421   3.699   1.00 0.00 ? 26 LEU A HA   4  
ATOM 3488  H HB2  . LEU A 1 26 ? 6.441   2.252   0.869   1.00 0.00 ? 26 LEU A HB2  4  
ATOM 3489  H HB3  . LEU A 1 26 ? 6.089   0.858   1.889   1.00 0.00 ? 26 LEU A HB3  4  
ATOM 3490  H HG   . LEU A 1 26 ? 4.045   2.904   1.028   1.00 0.00 ? 26 LEU A HG   4  
ATOM 3491  H HD11 . LEU A 1 26 ? 4.923   1.647   -0.885  1.00 0.00 ? 26 LEU A HD11 4  
ATOM 3492  H HD12 . LEU A 1 26 ? 3.249   1.222   -0.530  1.00 0.00 ? 26 LEU A HD12 4  
ATOM 3493  H HD13 . LEU A 1 26 ? 4.554   0.136   -0.054  1.00 0.00 ? 26 LEU A HD13 4  
ATOM 3494  H HD21 . LEU A 1 26 ? 2.899   0.431   1.721   1.00 0.00 ? 26 LEU A HD21 4  
ATOM 3495  H HD22 . LEU A 1 26 ? 2.762   1.967   2.576   1.00 0.00 ? 26 LEU A HD22 4  
ATOM 3496  H HD23 . LEU A 1 26 ? 4.043   0.832   3.003   1.00 0.00 ? 26 LEU A HD23 4  
ATOM 3497  N N    . ARG A 1 27 ? 7.800   1.288   3.878   1.00 0.00 ? 27 ARG A N    4  
ATOM 3498  C CA   . ARG A 1 27 ? 9.131   0.941   4.360   1.00 0.00 ? 27 ARG A CA   4  
ATOM 3499  C C    . ARG A 1 27 ? 9.456   -0.519  4.055   1.00 0.00 ? 27 ARG A C    4  
ATOM 3500  O O    . ARG A 1 27 ? 8.616   -1.401  4.233   1.00 0.00 ? 27 ARG A O    4  
ATOM 3501  C CB   . ARG A 1 27 ? 9.234   1.194   5.865   1.00 0.00 ? 27 ARG A CB   4  
ATOM 3502  C CG   . ARG A 1 27 ? 10.573  0.791   6.460   1.00 0.00 ? 27 ARG A CG   4  
ATOM 3503  C CD   . ARG A 1 27 ? 11.618  1.879   6.269   1.00 0.00 ? 27 ARG A CD   4  
ATOM 3504  N NE   . ARG A 1 27 ? 12.353  1.719   5.018   1.00 0.00 ? 27 ARG A NE   4  
ATOM 3505  C CZ   . ARG A 1 27 ? 13.305  0.810   4.836   1.00 0.00 ? 27 ARG A CZ   4  
ATOM 3506  N NH1  . ARG A 1 27 ? 13.635  -0.015  5.820   1.00 0.00 ? 27 ARG A NH1  4  
ATOM 3507  N NH2  . ARG A 1 27 ? 13.929  0.726   3.668   1.00 0.00 ? 27 ARG A NH2  4  
ATOM 3508  H H    . ARG A 1 27 ? 7.086   0.618   3.921   1.00 0.00 ? 27 ARG A H    4  
ATOM 3509  H HA   . ARG A 1 27 ? 9.844   1.570   3.848   1.00 0.00 ? 27 ARG A HA   4  
ATOM 3510  H HB2  . ARG A 1 27 ? 9.084   2.247   6.052   1.00 0.00 ? 27 ARG A HB2  4  
ATOM 3511  H HB3  . ARG A 1 27 ? 8.459   0.634   6.365   1.00 0.00 ? 27 ARG A HB3  4  
ATOM 3512  H HG2  . ARG A 1 27 ? 10.447  0.610   7.517   1.00 0.00 ? 27 ARG A HG2  4  
ATOM 3513  H HG3  . ARG A 1 27 ? 10.914  -0.113  5.976   1.00 0.00 ? 27 ARG A HG3  4  
ATOM 3514  H HD2  . ARG A 1 27 ? 11.122  2.838   6.264   1.00 0.00 ? 27 ARG A HD2  4  
ATOM 3515  H HD3  . ARG A 1 27 ? 12.314  1.839   7.093   1.00 0.00 ? 27 ARG A HD3  4  
ATOM 3516  H HE   . ARG A 1 27 ? 12.126  2.318   4.278   1.00 0.00 ? 27 ARG A HE   4  
ATOM 3517  H HH11 . ARG A 1 27 ? 13.166  0.045   6.701   1.00 0.00 ? 27 ARG A HH11 4  
ATOM 3518  H HH12 . ARG A 1 27 ? 14.351  -0.699  5.680   1.00 0.00 ? 27 ARG A HH12 4  
ATOM 3519  H HH21 . ARG A 1 27 ? 13.683  1.346   2.924   1.00 0.00 ? 27 ARG A HH21 4  
ATOM 3520  H HH22 . ARG A 1 27 ? 14.645  0.042   3.532   1.00 0.00 ? 27 ARG A HH22 4  
ATOM 3521  N N    . GLU A 1 28 ? 10.678  -0.764  3.595   1.00 0.00 ? 28 GLU A N    4  
ATOM 3522  C CA   . GLU A 1 28 ? 11.112  -2.117  3.265   1.00 0.00 ? 28 GLU A CA   4  
ATOM 3523  C C    . GLU A 1 28 ? 10.958  -3.046  4.465   1.00 0.00 ? 28 GLU A C    4  
ATOM 3524  O O    . GLU A 1 28 ? 11.711  -2.957  5.434   1.00 0.00 ? 28 GLU A O    4  
ATOM 3525  C CB   . GLU A 1 28 ? 12.569  -2.109  2.796   1.00 0.00 ? 28 GLU A CB   4  
ATOM 3526  C CG   . GLU A 1 28 ? 13.000  -3.403  2.127   1.00 0.00 ? 28 GLU A CG   4  
ATOM 3527  C CD   . GLU A 1 28 ? 14.503  -3.604  2.160   1.00 0.00 ? 28 GLU A CD   4  
ATOM 3528  O OE1  . GLU A 1 28 ? 15.190  -3.092  1.251   1.00 0.00 ? 28 GLU A OE1  4  
ATOM 3529  O OE2  . GLU A 1 28 ? 14.992  -4.273  3.094   1.00 0.00 ? 28 GLU A OE2  4  
ATOM 3530  H H    . GLU A 1 28 ? 11.303  -0.019  3.474   1.00 0.00 ? 28 GLU A H    4  
ATOM 3531  H HA   . GLU A 1 28 ? 10.488  -2.479  2.462   1.00 0.00 ? 28 GLU A HA   4  
ATOM 3532  H HB2  . GLU A 1 28 ? 12.704  -1.301  2.093   1.00 0.00 ? 28 GLU A HB2  4  
ATOM 3533  H HB3  . GLU A 1 28 ? 13.208  -1.940  3.651   1.00 0.00 ? 28 GLU A HB3  4  
ATOM 3534  H HG2  . GLU A 1 28 ? 12.530  -4.231  2.636   1.00 0.00 ? 28 GLU A HG2  4  
ATOM 3535  H HG3  . GLU A 1 28 ? 12.677  -3.385  1.096   1.00 0.00 ? 28 GLU A HG3  4  
ATOM 3536  N N    . GLY A 1 29 ? 9.974   -3.938  4.393   1.00 0.00 ? 29 GLY A N    4  
ATOM 3537  C CA   . GLY A 1 29 ? 9.737   -4.870  5.480   1.00 0.00 ? 29 GLY A CA   4  
ATOM 3538  C C    . GLY A 1 29 ? 8.679   -4.377  6.446   1.00 0.00 ? 29 GLY A C    4  
ATOM 3539  O O    . GLY A 1 29 ? 8.740   -4.662  7.643   1.00 0.00 ? 29 GLY A O    4  
ATOM 3540  H H    . GLY A 1 29 ? 9.405   -3.963  3.596   1.00 0.00 ? 29 GLY A H    4  
ATOM 3541  H HA2  . GLY A 1 29 ? 9.419   -5.816  5.065   1.00 0.00 ? 29 GLY A HA2  4  
ATOM 3542  H HA3  . GLY A 1 29 ? 10.661  -5.018  6.020   1.00 0.00 ? 29 GLY A HA3  4  
ATOM 3543  N N    . ASP A 1 30 ? 7.707   -3.635  5.928   1.00 0.00 ? 30 ASP A N    4  
ATOM 3544  C CA   . ASP A 1 30 ? 6.630   -3.100  6.754   1.00 0.00 ? 30 ASP A CA   4  
ATOM 3545  C C    . ASP A 1 30 ? 5.274   -3.607  6.274   1.00 0.00 ? 30 ASP A C    4  
ATOM 3546  O O    . ASP A 1 30 ? 5.045   -3.756  5.073   1.00 0.00 ? 30 ASP A O    4  
ATOM 3547  C CB   . ASP A 1 30 ? 6.654   -1.571  6.733   1.00 0.00 ? 30 ASP A CB   4  
ATOM 3548  C CG   . ASP A 1 30 ? 7.516   -0.991  7.836   1.00 0.00 ? 30 ASP A CG   4  
ATOM 3549  O OD1  . ASP A 1 30 ? 8.731   -1.280  7.855   1.00 0.00 ? 30 ASP A OD1  4  
ATOM 3550  O OD2  . ASP A 1 30 ? 6.977   -0.246  8.681   1.00 0.00 ? 30 ASP A OD2  4  
ATOM 3551  H H    . ASP A 1 30 ? 7.712   -3.443  4.967   1.00 0.00 ? 30 ASP A H    4  
ATOM 3552  H HA   . ASP A 1 30 ? 6.789   -3.440  7.767   1.00 0.00 ? 30 ASP A HA   4  
ATOM 3553  H HB2  . ASP A 1 30 ? 7.044   -1.237  5.783   1.00 0.00 ? 30 ASP A HB2  4  
ATOM 3554  H HB3  . ASP A 1 30 ? 5.647   -1.201  6.855   1.00 0.00 ? 30 ASP A HB3  4  
ATOM 3555  N N    . ARG A 1 31 ? 4.378   -3.871  7.219   1.00 0.00 ? 31 ARG A N    4  
ATOM 3556  C CA   . ARG A 1 31 ? 3.045   -4.363  6.893   1.00 0.00 ? 31 ARG A CA   4  
ATOM 3557  C C    . ARG A 1 31 ? 2.140   -3.222  6.437   1.00 0.00 ? 31 ARG A C    4  
ATOM 3558  O O    . ARG A 1 31 ? 2.291   -2.082  6.877   1.00 0.00 ? 31 ARG A O    4  
ATOM 3559  C CB   . ARG A 1 31 ? 2.427   -5.066  8.103   1.00 0.00 ? 31 ARG A CB   4  
ATOM 3560  C CG   . ARG A 1 31 ? 3.053   -6.417  8.408   1.00 0.00 ? 31 ARG A CG   4  
ATOM 3561  C CD   . ARG A 1 31 ? 2.569   -7.486  7.441   1.00 0.00 ? 31 ARG A CD   4  
ATOM 3562  N NE   . ARG A 1 31 ? 3.485   -8.623  7.379   1.00 0.00 ? 31 ARG A NE   4  
ATOM 3563  C CZ   . ARG A 1 31 ? 3.537   -9.575  8.304   1.00 0.00 ? 31 ARG A CZ   4  
ATOM 3564  N NH1  . ARG A 1 31 ? 2.730   -9.528  9.355   1.00 0.00 ? 31 ARG A NH1  4  
ATOM 3565  N NH2  . ARG A 1 31 ? 4.397   -10.578 8.178   1.00 0.00 ? 31 ARG A NH2  4  
ATOM 3566  H H    . ARG A 1 31 ? 4.619   -3.732  8.159   1.00 0.00 ? 31 ARG A H    4  
ATOM 3567  H HA   . ARG A 1 31 ? 3.142   -5.074  6.086   1.00 0.00 ? 31 ARG A HA   4  
ATOM 3568  H HB2  . ARG A 1 31 ? 2.546   -4.434  8.971   1.00 0.00 ? 31 ARG A HB2  4  
ATOM 3569  H HB3  . ARG A 1 31 ? 1.374   -5.215  7.918   1.00 0.00 ? 31 ARG A HB3  4  
ATOM 3570  H HG2  . ARG A 1 31 ? 4.126   -6.332  8.326   1.00 0.00 ? 31 ARG A HG2  4  
ATOM 3571  H HG3  . ARG A 1 31 ? 2.788   -6.707  9.414   1.00 0.00 ? 31 ARG A HG3  4  
ATOM 3572  H HD2  . ARG A 1 31 ? 1.600   -7.834  7.765   1.00 0.00 ? 31 ARG A HD2  4  
ATOM 3573  H HD3  . ARG A 1 31 ? 2.484   -7.050  6.457   1.00 0.00 ? 31 ARG A HD3  4  
ATOM 3574  H HE   . ARG A 1 31 ? 4.089   -8.677  6.611   1.00 0.00 ? 31 ARG A HE   4  
ATOM 3575  H HH11 . ARG A 1 31 ? 2.081   -8.774  9.453   1.00 0.00 ? 31 ARG A HH11 4  
ATOM 3576  H HH12 . ARG A 1 31 ? 2.771   -10.247 10.049  1.00 0.00 ? 31 ARG A HH12 4  
ATOM 3577  H HH21 . ARG A 1 31 ? 5.006   -10.617 7.386   1.00 0.00 ? 31 ARG A HH21 4  
ATOM 3578  H HH22 . ARG A 1 31 ? 4.435   -11.294 8.874   1.00 0.00 ? 31 ARG A HH22 4  
ATOM 3579  N N    . VAL A 1 32 ? 1.200   -3.536  5.551   1.00 0.00 ? 32 VAL A N    4  
ATOM 3580  C CA   . VAL A 1 32 ? 0.271   -2.538  5.036   1.00 0.00 ? 32 VAL A CA   4  
ATOM 3581  C C    . VAL A 1 32 ? -1.143  -3.100  4.942   1.00 0.00 ? 32 VAL A C    4  
ATOM 3582  O O    . VAL A 1 32 ? -1.344  -4.234  4.506   1.00 0.00 ? 32 VAL A O    4  
ATOM 3583  C CB   . VAL A 1 32 ? 0.704   -2.032  3.647   1.00 0.00 ? 32 VAL A CB   4  
ATOM 3584  C CG1  . VAL A 1 32 ? -0.041  -0.755  3.288   1.00 0.00 ? 32 VAL A CG1  4  
ATOM 3585  C CG2  . VAL A 1 32 ? 2.209   -1.811  3.606   1.00 0.00 ? 32 VAL A CG2  4  
ATOM 3586  H H    . VAL A 1 32 ? 1.130   -4.462  5.237   1.00 0.00 ? 32 VAL A H    4  
ATOM 3587  H HA   . VAL A 1 32 ? 0.270   -1.699  5.717   1.00 0.00 ? 32 VAL A HA   4  
ATOM 3588  H HB   . VAL A 1 32 ? 0.452   -2.787  2.917   1.00 0.00 ? 32 VAL A HB   4  
ATOM 3589  H HG11 . VAL A 1 32 ? -1.105  -0.929  3.353   1.00 0.00 ? 32 VAL A HG11 4  
ATOM 3590  H HG12 . VAL A 1 32 ? 0.240   0.031   3.973   1.00 0.00 ? 32 VAL A HG12 4  
ATOM 3591  H HG13 . VAL A 1 32 ? 0.214   -0.462  2.280   1.00 0.00 ? 32 VAL A HG13 4  
ATOM 3592  H HG21 . VAL A 1 32 ? 2.446   -0.866  4.072   1.00 0.00 ? 32 VAL A HG21 4  
ATOM 3593  H HG22 . VAL A 1 32 ? 2.705   -2.610  4.139   1.00 0.00 ? 32 VAL A HG22 4  
ATOM 3594  H HG23 . VAL A 1 32 ? 2.544   -1.801  2.580   1.00 0.00 ? 32 VAL A HG23 4  
ATOM 3595  N N    . ASP A 1 33 ? -2.120  -2.299  5.353   1.00 0.00 ? 33 ASP A N    4  
ATOM 3596  C CA   . ASP A 1 33 ? -3.517  -2.716  5.313   1.00 0.00 ? 33 ASP A CA   4  
ATOM 3597  C C    . ASP A 1 33 ? -4.211  -2.176  4.067   1.00 0.00 ? 33 ASP A C    4  
ATOM 3598  O O    . ASP A 1 33 ? -4.490  -0.981  3.967   1.00 0.00 ? 33 ASP A O    4  
ATOM 3599  C CB   . ASP A 1 33 ? -4.250  -2.237  6.568   1.00 0.00 ? 33 ASP A CB   4  
ATOM 3600  C CG   . ASP A 1 33 ? -3.956  -3.104  7.776   1.00 0.00 ? 33 ASP A CG   4  
ATOM 3601  O OD1  . ASP A 1 33 ? -2.772  -3.433  7.997   1.00 0.00 ? 33 ASP A OD1  4  
ATOM 3602  O OD2  . ASP A 1 33 ? -4.911  -3.452  8.502   1.00 0.00 ? 33 ASP A OD2  4  
ATOM 3603  H H    . ASP A 1 33 ? -1.897  -1.406  5.690   1.00 0.00 ? 33 ASP A H    4  
ATOM 3604  H HA   . ASP A 1 33 ? -3.541  -3.795  5.284   1.00 0.00 ? 33 ASP A HA   4  
ATOM 3605  H HB2  . ASP A 1 33 ? -3.944  -1.225  6.791   1.00 0.00 ? 33 ASP A HB2  4  
ATOM 3606  H HB3  . ASP A 1 33 ? -5.314  -2.255  6.384   1.00 0.00 ? 33 ASP A HB3  4  
ATOM 3607  N N    . VAL A 1 34 ? -4.485  -3.064  3.116   1.00 0.00 ? 34 VAL A N    4  
ATOM 3608  C CA   . VAL A 1 34 ? -5.146  -2.677  1.876   1.00 0.00 ? 34 VAL A CA   4  
ATOM 3609  C C    . VAL A 1 34 ? -6.640  -2.972  1.933   1.00 0.00 ? 34 VAL A C    4  
ATOM 3610  O O    . VAL A 1 34 ? -7.051  -4.085  2.262   1.00 0.00 ? 34 VAL A O    4  
ATOM 3611  C CB   . VAL A 1 34 ? -4.536  -3.406  0.664   1.00 0.00 ? 34 VAL A CB   4  
ATOM 3612  C CG1  . VAL A 1 34 ? -5.475  -3.335  -0.531  1.00 0.00 ? 34 VAL A CG1  4  
ATOM 3613  C CG2  . VAL A 1 34 ? -3.175  -2.820  0.319   1.00 0.00 ? 34 VAL A CG2  4  
ATOM 3614  H H    . VAL A 1 34 ? -4.238  -4.002  3.254   1.00 0.00 ? 34 VAL A H    4  
ATOM 3615  H HA   . VAL A 1 34 ? -5.003  -1.615  1.739   1.00 0.00 ? 34 VAL A HA   4  
ATOM 3616  H HB   . VAL A 1 34 ? -4.401  -4.445  0.925   1.00 0.00 ? 34 VAL A HB   4  
ATOM 3617  H HG11 . VAL A 1 34 ? -4.896  -3.247  -1.438  1.00 0.00 ? 34 VAL A HG11 4  
ATOM 3618  H HG12 . VAL A 1 34 ? -6.076  -4.231  -0.571  1.00 0.00 ? 34 VAL A HG12 4  
ATOM 3619  H HG13 . VAL A 1 34 ? -6.119  -2.473  -0.431  1.00 0.00 ? 34 VAL A HG13 4  
ATOM 3620  H HG21 . VAL A 1 34 ? -3.121  -2.639  -0.744  1.00 0.00 ? 34 VAL A HG21 4  
ATOM 3621  H HG22 . VAL A 1 34 ? -3.039  -1.889  0.850   1.00 0.00 ? 34 VAL A HG22 4  
ATOM 3622  H HG23 . VAL A 1 34 ? -2.400  -3.514  0.606   1.00 0.00 ? 34 VAL A HG23 4  
ATOM 3623  N N    . MET A 1 35 ? -7.449  -1.968  1.611   1.00 0.00 ? 35 MET A N    4  
ATOM 3624  C CA   . MET A 1 35 ? -8.899  -2.121  1.625   1.00 0.00 ? 35 MET A CA   4  
ATOM 3625  C C    . MET A 1 35 ? -9.477  -1.956  0.223   1.00 0.00 ? 35 MET A C    4  
ATOM 3626  O O    . MET A 1 35 ? -10.246 -2.796  -0.243  1.00 0.00 ? 35 MET A O    4  
ATOM 3627  C CB   . MET A 1 35 ? -9.532  -1.100  2.573   1.00 0.00 ? 35 MET A CB   4  
ATOM 3628  C CG   . MET A 1 35 ? -9.117  -1.280  4.024   1.00 0.00 ? 35 MET A CG   4  
ATOM 3629  S SD   . MET A 1 35 ? -9.583  0.122   5.059   1.00 0.00 ? 35 MET A SD   4  
ATOM 3630  C CE   . MET A 1 35 ? -7.973  0.696   5.595   1.00 0.00 ? 35 MET A CE   4  
ATOM 3631  H H    . MET A 1 35 ? -7.062  -1.104  1.358   1.00 0.00 ? 35 MET A H    4  
ATOM 3632  H HA   . MET A 1 35 ? -9.124  -3.116  1.979   1.00 0.00 ? 35 MET A HA   4  
ATOM 3633  H HB2  . MET A 1 35 ? -9.245  -0.108  2.259   1.00 0.00 ? 35 MET A HB2  4  
ATOM 3634  H HB3  . MET A 1 35 ? -10.607 -1.191  2.515   1.00 0.00 ? 35 MET A HB3  4  
ATOM 3635  H HG2  . MET A 1 35 ? -9.591  -2.169  4.414   1.00 0.00 ? 35 MET A HG2  4  
ATOM 3636  H HG3  . MET A 1 35 ? -8.044  -1.399  4.065   1.00 0.00 ? 35 MET A HG3  4  
ATOM 3637  H HE1  . MET A 1 35 ? -7.316  -0.150  5.733   1.00 0.00 ? 35 MET A HE1  4  
ATOM 3638  H HE2  . MET A 1 35 ? -7.559  1.355   4.847   1.00 0.00 ? 35 MET A HE2  4  
ATOM 3639  H HE3  . MET A 1 35 ? -8.075  1.229   6.529   1.00 0.00 ? 35 MET A HE3  4  
ATOM 3640  N N    . GLN A 1 36 ? -9.100  -0.869  -0.443  1.00 0.00 ? 36 GLN A N    4  
ATOM 3641  C CA   . GLN A 1 36 ? -9.582  -0.595  -1.792  1.00 0.00 ? 36 GLN A CA   4  
ATOM 3642  C C    . GLN A 1 36 ? -8.448  -0.696  -2.806  1.00 0.00 ? 36 GLN A C    4  
ATOM 3643  O O    . GLN A 1 36 ? -7.296  -0.399  -2.493  1.00 0.00 ? 36 GLN A O    4  
ATOM 3644  C CB   . GLN A 1 36 ? -10.218 0.795   -1.856  1.00 0.00 ? 36 GLN A CB   4  
ATOM 3645  C CG   . GLN A 1 36 ? -10.571 1.238   -3.267  1.00 0.00 ? 36 GLN A CG   4  
ATOM 3646  C CD   . GLN A 1 36 ? -10.738 2.740   -3.383  1.00 0.00 ? 36 GLN A CD   4  
ATOM 3647  O OE1  . GLN A 1 36 ? -10.404 3.486   -2.462  1.00 0.00 ? 36 GLN A OE1  4  
ATOM 3648  N NE2  . GLN A 1 36 ? -11.255 3.193   -4.519  1.00 0.00 ? 36 GLN A NE2  4  
ATOM 3649  H H    . GLN A 1 36 ? -8.485  -0.237  -0.018  1.00 0.00 ? 36 GLN A H    4  
ATOM 3650  H HA   . GLN A 1 36 ? -10.331 -1.334  -2.033  1.00 0.00 ? 36 GLN A HA   4  
ATOM 3651  H HB2  . GLN A 1 36 ? -11.122 0.792   -1.265  1.00 0.00 ? 36 GLN A HB2  4  
ATOM 3652  H HB3  . GLN A 1 36 ? -9.527  1.513   -1.440  1.00 0.00 ? 36 GLN A HB3  4  
ATOM 3653  H HG2  . GLN A 1 36 ? -9.784  0.926   -3.936  1.00 0.00 ? 36 GLN A HG2  4  
ATOM 3654  H HG3  . GLN A 1 36 ? -11.498 0.764   -3.557  1.00 0.00 ? 36 GLN A HG3  4  
ATOM 3655  H HE21 . GLN A 1 36 ? -11.499 2.540   -5.208  1.00 0.00 ? 36 GLN A HE21 4  
ATOM 3656  H HE22 . GLN A 1 36 ? -11.375 4.159   -4.620  1.00 0.00 ? 36 GLN A HE22 4  
ATOM 3657  N N    . GLN A 1 37 ? -8.784  -1.116  -4.022  1.00 0.00 ? 37 GLN A N    4  
ATOM 3658  C CA   . GLN A 1 37 ? -7.792  -1.257  -5.081  1.00 0.00 ? 37 GLN A CA   4  
ATOM 3659  C C    . GLN A 1 37 ? -8.115  -0.338  -6.255  1.00 0.00 ? 37 GLN A C    4  
ATOM 3660  O O    . GLN A 1 37 ? -9.275  0.010   -6.482  1.00 0.00 ? 37 GLN A O    4  
ATOM 3661  C CB   . GLN A 1 37 ? -7.727  -2.709  -5.558  1.00 0.00 ? 37 GLN A CB   4  
ATOM 3662  C CG   . GLN A 1 37 ? -7.705  -3.722  -4.424  1.00 0.00 ? 37 GLN A CG   4  
ATOM 3663  C CD   . GLN A 1 37 ? -7.451  -5.135  -4.909  1.00 0.00 ? 37 GLN A CD   4  
ATOM 3664  O OE1  . GLN A 1 37 ? -6.997  -5.346  -6.034  1.00 0.00 ? 37 GLN A OE1  4  
ATOM 3665  N NE2  . GLN A 1 37 ? -7.743  -6.114  -4.060  1.00 0.00 ? 37 GLN A NE2  4  
ATOM 3666  H H    . GLN A 1 37 ? -9.719  -1.337  -4.210  1.00 0.00 ? 37 GLN A H    4  
ATOM 3667  H HA   . GLN A 1 37 ? -6.832  -0.978  -4.676  1.00 0.00 ? 37 GLN A HA   4  
ATOM 3668  H HB2  . GLN A 1 37 ? -8.589  -2.912  -6.176  1.00 0.00 ? 37 GLN A HB2  4  
ATOM 3669  H HB3  . GLN A 1 37 ? -6.832  -2.842  -6.148  1.00 0.00 ? 37 GLN A HB3  4  
ATOM 3670  H HG2  . GLN A 1 37 ? -6.923  -3.450  -3.731  1.00 0.00 ? 37 GLN A HG2  4  
ATOM 3671  H HG3  . GLN A 1 37 ? -8.659  -3.696  -3.918  1.00 0.00 ? 37 GLN A HG3  4  
ATOM 3672  H HE21 . GLN A 1 37 ? -8.103  -5.871  -3.181  1.00 0.00 ? 37 GLN A HE21 4  
ATOM 3673  H HE22 . GLN A 1 37 ? -7.589  -7.037  -4.348  1.00 0.00 ? 37 GLN A HE22 4  
ATOM 3674  N N    . CYS A 1 38 ? -7.084  0.051   -6.996  1.00 0.00 ? 38 CYS A N    4  
ATOM 3675  C CA   . CYS A 1 38 ? -7.259  0.931   -8.147  1.00 0.00 ? 38 CYS A CA   4  
ATOM 3676  C C    . CYS A 1 38 ? -7.271  0.132   -9.446  1.00 0.00 ? 38 CYS A C    4  
ATOM 3677  O O    . CYS A 1 38 ? -6.558  -0.863  -9.581  1.00 0.00 ? 38 CYS A O    4  
ATOM 3678  C CB   . CYS A 1 38 ? -6.144  1.977   -8.188  1.00 0.00 ? 38 CYS A CB   4  
ATOM 3679  S SG   . CYS A 1 38 ? -6.562  3.465   -9.127  1.00 0.00 ? 38 CYS A SG   4  
ATOM 3680  H H    . CYS A 1 38 ? -6.184  -0.261  -6.766  1.00 0.00 ? 38 CYS A H    4  
ATOM 3681  H HA   . CYS A 1 38 ? -8.208  1.432   -8.038  1.00 0.00 ? 38 CYS A HA   4  
ATOM 3682  H HB2  . CYS A 1 38 ? -5.910  2.282   -7.178  1.00 0.00 ? 38 CYS A HB2  4  
ATOM 3683  H HB3  . CYS A 1 38 ? -5.266  1.539   -8.637  1.00 0.00 ? 38 CYS A HB3  4  
ATOM 3684  H HG   . CYS A 1 38 ? -6.420  3.188   -10.414 1.00 0.00 ? 38 CYS A HG   4  
ATOM 3685  N N    . ASP A 1 39 ? -8.086  0.573   -10.398 1.00 0.00 ? 39 ASP A N    4  
ATOM 3686  C CA   . ASP A 1 39 ? -8.191  -0.102  -11.686 1.00 0.00 ? 39 ASP A CA   4  
ATOM 3687  C C    . ASP A 1 39 ? -6.849  -0.101  -12.412 1.00 0.00 ? 39 ASP A C    4  
ATOM 3688  O O    . ASP A 1 39 ? -6.506  -1.059  -13.104 1.00 0.00 ? 39 ASP A O    4  
ATOM 3689  C CB   . ASP A 1 39 ? -9.255  0.574   -12.554 1.00 0.00 ? 39 ASP A CB   4  
ATOM 3690  C CG   . ASP A 1 39 ? -8.693  1.722   -13.369 1.00 0.00 ? 39 ASP A CG   4  
ATOM 3691  O OD1  . ASP A 1 39 ? -8.690  2.864   -12.863 1.00 0.00 ? 39 ASP A OD1  4  
ATOM 3692  O OD2  . ASP A 1 39 ? -8.256  1.479   -14.513 1.00 0.00 ? 39 ASP A OD2  4  
ATOM 3693  H H    . ASP A 1 39 ? -8.629  1.371   -10.230 1.00 0.00 ? 39 ASP A H    4  
ATOM 3694  H HA   . ASP A 1 39 ? -8.486  -1.124  -11.503 1.00 0.00 ? 39 ASP A HA   4  
ATOM 3695  H HB2  . ASP A 1 39 ? -9.672  -0.155  -13.233 1.00 0.00 ? 39 ASP A HB2  4  
ATOM 3696  H HB3  . ASP A 1 39 ? -10.039 0.957   -11.917 1.00 0.00 ? 39 ASP A HB3  4  
ATOM 3697  N N    . ASP A 1 40 ? -6.096  0.981   -12.249 1.00 0.00 ? 40 ASP A N    4  
ATOM 3698  C CA   . ASP A 1 40 ? -4.791  1.107   -12.889 1.00 0.00 ? 40 ASP A CA   4  
ATOM 3699  C C    . ASP A 1 40 ? -3.795  0.118   -12.291 1.00 0.00 ? 40 ASP A C    4  
ATOM 3700  O O    . ASP A 1 40 ? -2.965  -0.448  -13.001 1.00 0.00 ? 40 ASP A O    4  
ATOM 3701  C CB   . ASP A 1 40 ? -4.263  2.535   -12.741 1.00 0.00 ? 40 ASP A CB   4  
ATOM 3702  C CG   . ASP A 1 40 ? -3.342  2.932   -13.877 1.00 0.00 ? 40 ASP A CG   4  
ATOM 3703  O OD1  . ASP A 1 40 ? -3.839  3.106   -15.010 1.00 0.00 ? 40 ASP A OD1  4  
ATOM 3704  O OD2  . ASP A 1 40 ? -2.124  3.069   -13.635 1.00 0.00 ? 40 ASP A OD2  4  
ATOM 3705  H H    . ASP A 1 40 ? -6.424  1.712   -11.685 1.00 0.00 ? 40 ASP A H    4  
ATOM 3706  H HA   . ASP A 1 40 ? -4.913  0.886   -13.938 1.00 0.00 ? 40 ASP A HA   4  
ATOM 3707  H HB2  . ASP A 1 40 ? -5.097  3.221   -12.722 1.00 0.00 ? 40 ASP A HB2  4  
ATOM 3708  H HB3  . ASP A 1 40 ? -3.715  2.615   -11.813 1.00 0.00 ? 40 ASP A HB3  4  
ATOM 3709  N N    . GLY A 1 41 ? -3.883  -0.083  -10.979 1.00 0.00 ? 41 GLY A N    4  
ATOM 3710  C CA   . GLY A 1 41 ? -2.984  -1.003  -10.308 1.00 0.00 ? 41 GLY A CA   4  
ATOM 3711  C C    . GLY A 1 41 ? -2.637  -0.553  -8.903  1.00 0.00 ? 41 GLY A C    4  
ATOM 3712  O O    . GLY A 1 41 ? -2.319  -1.373  -8.042  1.00 0.00 ? 41 GLY A O    4  
ATOM 3713  H H    . GLY A 1 41 ? -4.565  0.396   -10.464 1.00 0.00 ? 41 GLY A H    4  
ATOM 3714  H HA2  . GLY A 1 41 ? -3.451  -1.975  -10.259 1.00 0.00 ? 41 GLY A HA2  4  
ATOM 3715  H HA3  . GLY A 1 41 ? -2.072  -1.081  -10.883 1.00 0.00 ? 41 GLY A HA3  4  
ATOM 3716  N N    . TRP A 1 42 ? -2.698  0.753   -8.670  1.00 0.00 ? 42 TRP A N    4  
ATOM 3717  C CA   . TRP A 1 42 ? -2.387  1.311   -7.358  1.00 0.00 ? 42 TRP A CA   4  
ATOM 3718  C C    . TRP A 1 42 ? -3.318  0.745   -6.291  1.00 0.00 ? 42 TRP A C    4  
ATOM 3719  O O    . TRP A 1 42 ? -4.437  0.328   -6.588  1.00 0.00 ? 42 TRP A O    4  
ATOM 3720  C CB   . TRP A 1 42 ? -2.495  2.836   -7.391  1.00 0.00 ? 42 TRP A CB   4  
ATOM 3721  C CG   . TRP A 1 42 ? -1.292  3.505   -7.983  1.00 0.00 ? 42 TRP A CG   4  
ATOM 3722  C CD1  . TRP A 1 42 ? -0.755  3.282   -9.219  1.00 0.00 ? 42 TRP A CD1  4  
ATOM 3723  C CD2  . TRP A 1 42 ? -0.474  4.503   -7.362  1.00 0.00 ? 42 TRP A CD2  4  
ATOM 3724  N NE1  . TRP A 1 42 ? 0.347   4.082   -9.404  1.00 0.00 ? 42 TRP A NE1  4  
ATOM 3725  C CE2  . TRP A 1 42 ? 0.539   4.841   -8.280  1.00 0.00 ? 42 TRP A CE2  4  
ATOM 3726  C CE3  . TRP A 1 42 ? -0.502  5.147   -6.122  1.00 0.00 ? 42 TRP A CE3  4  
ATOM 3727  C CZ2  . TRP A 1 42 ? 1.515   5.792   -7.994  1.00 0.00 ? 42 TRP A CZ2  4  
ATOM 3728  C CZ3  . TRP A 1 42 ? 0.468   6.090   -5.840  1.00 0.00 ? 42 TRP A CZ3  4  
ATOM 3729  C CH2  . TRP A 1 42 ? 1.465   6.406   -6.772  1.00 0.00 ? 42 TRP A CH2  4  
ATOM 3730  H H    . TRP A 1 42 ? -2.959  1.357   -9.396  1.00 0.00 ? 42 TRP A H    4  
ATOM 3731  H HA   . TRP A 1 42 ? -1.371  1.036   -7.116  1.00 0.00 ? 42 TRP A HA   4  
ATOM 3732  H HB2  . TRP A 1 42 ? -3.356  3.117   -7.980  1.00 0.00 ? 42 TRP A HB2  4  
ATOM 3733  H HB3  . TRP A 1 42 ? -2.619  3.202   -6.382  1.00 0.00 ? 42 TRP A HB3  4  
ATOM 3734  H HD1  . TRP A 1 42 ? -1.148  2.576   -9.934  1.00 0.00 ? 42 TRP A HD1  4  
ATOM 3735  H HE1  . TRP A 1 42 ? 0.903   4.106   -10.211 1.00 0.00 ? 42 TRP A HE1  4  
ATOM 3736  H HE3  . TRP A 1 42 ? -1.262  4.916   -5.390  1.00 0.00 ? 42 TRP A HE3  4  
ATOM 3737  H HZ2  . TRP A 1 42 ? 2.290   6.047   -8.703  1.00 0.00 ? 42 TRP A HZ2  4  
ATOM 3738  H HZ3  . TRP A 1 42 ? 0.463   6.597   -4.886  1.00 0.00 ? 42 TRP A HZ3  4  
ATOM 3739  H HH2  . TRP A 1 42 ? 2.202   7.149   -6.509  1.00 0.00 ? 42 TRP A HH2  4  
ATOM 3740  N N    . PHE A 1 43 ? -2.848  0.735   -5.048  1.00 0.00 ? 43 PHE A N    4  
ATOM 3741  C CA   . PHE A 1 43 ? -3.639  0.219   -3.937  1.00 0.00 ? 43 PHE A CA   4  
ATOM 3742  C C    . PHE A 1 43 ? -3.952  1.326   -2.933  1.00 0.00 ? 43 PHE A C    4  
ATOM 3743  O O    . PHE A 1 43 ? -3.137  2.218   -2.701  1.00 0.00 ? 43 PHE A O    4  
ATOM 3744  C CB   . PHE A 1 43 ? -2.895  -0.921  -3.239  1.00 0.00 ? 43 PHE A CB   4  
ATOM 3745  C CG   . PHE A 1 43 ? -2.916  -2.210  -4.011  1.00 0.00 ? 43 PHE A CG   4  
ATOM 3746  C CD1  . PHE A 1 43 ? -4.093  -2.678  -4.572  1.00 0.00 ? 43 PHE A CD1  4  
ATOM 3747  C CD2  . PHE A 1 43 ? -1.759  -2.954  -4.173  1.00 0.00 ? 43 PHE A CD2  4  
ATOM 3748  C CE1  . PHE A 1 43 ? -4.116  -3.863  -5.282  1.00 0.00 ? 43 PHE A CE1  4  
ATOM 3749  C CE2  . PHE A 1 43 ? -1.775  -4.140  -4.883  1.00 0.00 ? 43 PHE A CE2  4  
ATOM 3750  C CZ   . PHE A 1 43 ? -2.955  -4.596  -5.437  1.00 0.00 ? 43 PHE A CZ   4  
ATOM 3751  H H    . PHE A 1 43 ? -1.948  1.082   -4.874  1.00 0.00 ? 43 PHE A H    4  
ATOM 3752  H HA   . PHE A 1 43 ? -4.566  -0.159  -4.338  1.00 0.00 ? 43 PHE A HA   4  
ATOM 3753  H HB2  . PHE A 1 43 ? -1.864  -0.636  -3.099  1.00 0.00 ? 43 PHE A HB2  4  
ATOM 3754  H HB3  . PHE A 1 43 ? -3.349  -1.102  -2.277  1.00 0.00 ? 43 PHE A HB3  4  
ATOM 3755  H HD1  . PHE A 1 43 ? -5.002  -2.106  -4.451  1.00 0.00 ? 43 PHE A HD1  4  
ATOM 3756  H HD2  . PHE A 1 43 ? -0.835  -2.600  -3.740  1.00 0.00 ? 43 PHE A HD2  4  
ATOM 3757  H HE1  . PHE A 1 43 ? -5.041  -4.217  -5.714  1.00 0.00 ? 43 PHE A HE1  4  
ATOM 3758  H HE2  . PHE A 1 43 ? -0.867  -4.711  -5.003  1.00 0.00 ? 43 PHE A HE2  4  
ATOM 3759  H HZ   . PHE A 1 43 ? -2.971  -5.522  -5.993  1.00 0.00 ? 43 PHE A HZ   4  
ATOM 3760  N N    . VAL A 1 44 ? -5.141  1.260   -2.341  1.00 0.00 ? 44 VAL A N    4  
ATOM 3761  C CA   . VAL A 1 44 ? -5.563  2.255   -1.362  1.00 0.00 ? 44 VAL A CA   4  
ATOM 3762  C C    . VAL A 1 44 ? -5.876  1.605   -0.019  1.00 0.00 ? 44 VAL A C    4  
ATOM 3763  O O    . VAL A 1 44 ? -6.749  0.743   0.077   1.00 0.00 ? 44 VAL A O    4  
ATOM 3764  C CB   . VAL A 1 44 ? -6.803  3.028   -1.847  1.00 0.00 ? 44 VAL A CB   4  
ATOM 3765  C CG1  . VAL A 1 44 ? -7.206  4.084   -0.829  1.00 0.00 ? 44 VAL A CG1  4  
ATOM 3766  C CG2  . VAL A 1 44 ? -6.539  3.660   -3.206  1.00 0.00 ? 44 VAL A CG2  4  
ATOM 3767  H H    . VAL A 1 44 ? -5.747  0.524   -2.567  1.00 0.00 ? 44 VAL A H    4  
ATOM 3768  H HA   . VAL A 1 44 ? -4.754  2.958   -1.231  1.00 0.00 ? 44 VAL A HA   4  
ATOM 3769  H HB   . VAL A 1 44 ? -7.620  2.330   -1.951  1.00 0.00 ? 44 VAL A HB   4  
ATOM 3770  H HG11 . VAL A 1 44 ? -7.582  4.956   -1.345  1.00 0.00 ? 44 VAL A HG11 4  
ATOM 3771  H HG12 . VAL A 1 44 ? -7.976  3.687   -0.183  1.00 0.00 ? 44 VAL A HG12 4  
ATOM 3772  H HG13 . VAL A 1 44 ? -6.346  4.360   -0.237  1.00 0.00 ? 44 VAL A HG13 4  
ATOM 3773  H HG21 . VAL A 1 44 ? -7.095  3.128   -3.963  1.00 0.00 ? 44 VAL A HG21 4  
ATOM 3774  H HG22 . VAL A 1 44 ? -6.852  4.694   -3.190  1.00 0.00 ? 44 VAL A HG22 4  
ATOM 3775  H HG23 . VAL A 1 44 ? -5.484  3.606   -3.429  1.00 0.00 ? 44 VAL A HG23 4  
ATOM 3776  N N    . GLY A 1 45 ? -5.157  2.026   1.018   1.00 0.00 ? 45 GLY A N    4  
ATOM 3777  C CA   . GLY A 1 45 ? -5.373  1.475   2.343   1.00 0.00 ? 45 GLY A CA   4  
ATOM 3778  C C    . GLY A 1 45 ? -4.782  2.343   3.435   1.00 0.00 ? 45 GLY A C    4  
ATOM 3779  O O    . GLY A 1 45 ? -4.871  3.570   3.380   1.00 0.00 ? 45 GLY A O    4  
ATOM 3780  H H    . GLY A 1 45 ? -4.475  2.716   0.882   1.00 0.00 ? 45 GLY A H    4  
ATOM 3781  H HA2  . GLY A 1 45 ? -6.435  1.376   2.511   1.00 0.00 ? 45 GLY A HA2  4  
ATOM 3782  H HA3  . GLY A 1 45 ? -4.919  0.496   2.391   1.00 0.00 ? 45 GLY A HA3  4  
ATOM 3783  N N    . VAL A 1 46 ? -4.177  1.706   4.433   1.00 0.00 ? 46 VAL A N    4  
ATOM 3784  C CA   . VAL A 1 46 ? -3.568  2.428   5.544   1.00 0.00 ? 46 VAL A CA   4  
ATOM 3785  C C    . VAL A 1 46 ? -2.203  1.848   5.895   1.00 0.00 ? 46 VAL A C    4  
ATOM 3786  O O    . VAL A 1 46 ? -1.957  0.656   5.709   1.00 0.00 ? 46 VAL A O    4  
ATOM 3787  C CB   . VAL A 1 46 ? -4.466  2.393   6.795   1.00 0.00 ? 46 VAL A CB   4  
ATOM 3788  C CG1  . VAL A 1 46 ? -3.723  2.945   8.001   1.00 0.00 ? 46 VAL A CG1  4  
ATOM 3789  C CG2  . VAL A 1 46 ? -5.752  3.168   6.550   1.00 0.00 ? 46 VAL A CG2  4  
ATOM 3790  H H    . VAL A 1 46 ? -4.138  0.727   4.421   1.00 0.00 ? 46 VAL A H    4  
ATOM 3791  H HA   . VAL A 1 46 ? -3.445  3.459   5.244   1.00 0.00 ? 46 VAL A HA   4  
ATOM 3792  H HB   . VAL A 1 46 ? -4.724  1.364   6.999   1.00 0.00 ? 46 VAL A HB   4  
ATOM 3793  H HG11 . VAL A 1 46 ? -4.436  3.294   8.734   1.00 0.00 ? 46 VAL A HG11 4  
ATOM 3794  H HG12 . VAL A 1 46 ? -3.110  2.168   8.434   1.00 0.00 ? 46 VAL A HG12 4  
ATOM 3795  H HG13 . VAL A 1 46 ? -3.095  3.768   7.692   1.00 0.00 ? 46 VAL A HG13 4  
ATOM 3796  H HG21 . VAL A 1 46 ? -6.490  2.511   6.113   1.00 0.00 ? 46 VAL A HG21 4  
ATOM 3797  H HG22 . VAL A 1 46 ? -6.124  3.555   7.487   1.00 0.00 ? 46 VAL A HG22 4  
ATOM 3798  H HG23 . VAL A 1 46 ? -5.555  3.988   5.875   1.00 0.00 ? 46 VAL A HG23 4  
ATOM 3799  N N    . SER A 1 47 ? -1.318  2.698   6.404   1.00 0.00 ? 47 SER A N    4  
ATOM 3800  C CA   . SER A 1 47 ? 0.025   2.271   6.779   1.00 0.00 ? 47 SER A CA   4  
ATOM 3801  C C    . SER A 1 47 ? 0.039   1.701   8.194   1.00 0.00 ? 47 SER A C    4  
ATOM 3802  O O    . SER A 1 47 ? -0.967  1.745   8.902   1.00 0.00 ? 47 SER A O    4  
ATOM 3803  C CB   . SER A 1 47 ? 1.003   3.443   6.679   1.00 0.00 ? 47 SER A CB   4  
ATOM 3804  O OG   . SER A 1 47 ? 2.329   2.986   6.482   1.00 0.00 ? 47 SER A OG   4  
ATOM 3805  H H    . SER A 1 47 ? -1.573  3.637   6.528   1.00 0.00 ? 47 SER A H    4  
ATOM 3806  H HA   . SER A 1 47 ? 0.332   1.498   6.089   1.00 0.00 ? 47 SER A HA   4  
ATOM 3807  H HB2  . SER A 1 47 ? 0.724   4.072   5.847   1.00 0.00 ? 47 SER A HB2  4  
ATOM 3808  H HB3  . SER A 1 47 ? 0.965   4.019   7.593   1.00 0.00 ? 47 SER A HB3  4  
ATOM 3809  H HG   . SER A 1 47 ? 2.918   3.739   6.392   1.00 0.00 ? 47 SER A HG   4  
ATOM 3810  N N    . ARG A 1 48 ? 1.186   1.167   8.599   1.00 0.00 ? 48 ARG A N    4  
ATOM 3811  C CA   . ARG A 1 48 ? 1.332   0.587   9.928   1.00 0.00 ? 48 ARG A CA   4  
ATOM 3812  C C    . ARG A 1 48 ? 2.308   1.401   10.773  1.00 0.00 ? 48 ARG A C    4  
ATOM 3813  O O    . ARG A 1 48 ? 2.571   1.069   11.928  1.00 0.00 ? 48 ARG A O    4  
ATOM 3814  C CB   . ARG A 1 48 ? 1.815   -0.861  9.826   1.00 0.00 ? 48 ARG A CB   4  
ATOM 3815  C CG   . ARG A 1 48 ? 0.744   -1.828  9.348   1.00 0.00 ? 48 ARG A CG   4  
ATOM 3816  C CD   . ARG A 1 48 ? -0.366  -1.983  10.376  1.00 0.00 ? 48 ARG A CD   4  
ATOM 3817  N NE   . ARG A 1 48 ? 0.141   -2.454  11.662  1.00 0.00 ? 48 ARG A NE   4  
ATOM 3818  C CZ   . ARG A 1 48 ? -0.597  -2.518  12.765  1.00 0.00 ? 48 ARG A CZ   4  
ATOM 3819  N NH1  . ARG A 1 48 ? -1.869  -2.144  12.737  1.00 0.00 ? 48 ARG A NH1  4  
ATOM 3820  N NH2  . ARG A 1 48 ? -0.064  -2.957  13.897  1.00 0.00 ? 48 ARG A NH2  4  
ATOM 3821  H H    . ARG A 1 48 ? 1.953   1.161   7.988   1.00 0.00 ? 48 ARG A H    4  
ATOM 3822  H HA   . ARG A 1 48 ? 0.363   0.601   10.405  1.00 0.00 ? 48 ARG A HA   4  
ATOM 3823  H HB2  . ARG A 1 48 ? 2.643   -0.905  9.134   1.00 0.00 ? 48 ARG A HB2  4  
ATOM 3824  H HB3  . ARG A 1 48 ? 2.152   -1.185  10.799  1.00 0.00 ? 48 ARG A HB3  4  
ATOM 3825  H HG2  . ARG A 1 48 ? 0.318   -1.453  8.429   1.00 0.00 ? 48 ARG A HG2  4  
ATOM 3826  H HG3  . ARG A 1 48 ? 1.196   -2.792  9.171   1.00 0.00 ? 48 ARG A HG3  4  
ATOM 3827  H HD2  . ARG A 1 48 ? -0.844  -1.025  10.517  1.00 0.00 ? 48 ARG A HD2  4  
ATOM 3828  H HD3  . ARG A 1 48 ? -1.088  -2.694  10.002  1.00 0.00 ? 48 ARG A HD3  4  
ATOM 3829  H HE   . ARG A 1 48 ? 1.079   -2.735  11.705  1.00 0.00 ? 48 ARG A HE   4  
ATOM 3830  H HH11 . ARG A 1 48 ? -2.274  -1.813  11.885  1.00 0.00 ? 48 ARG A HH11 4  
ATOM 3831  H HH12 . ARG A 1 48 ? -2.423  -2.194  13.568  1.00 0.00 ? 48 ARG A HH12 4  
ATOM 3832  H HH21 . ARG A 1 48 ? 0.894   -3.240  13.922  1.00 0.00 ? 48 ARG A HH21 4  
ATOM 3833  H HH22 . ARG A 1 48 ? -0.620  -3.005  14.726  1.00 0.00 ? 48 ARG A HH22 4  
ATOM 3834  N N    . ARG A 1 49 ? 2.841   2.468   10.187  1.00 0.00 ? 49 ARG A N    4  
ATOM 3835  C CA   . ARG A 1 49 ? 3.789   3.329   10.885  1.00 0.00 ? 49 ARG A CA   4  
ATOM 3836  C C    . ARG A 1 49 ? 3.141   4.658   11.260  1.00 0.00 ? 49 ARG A C    4  
ATOM 3837  O O    . ARG A 1 49 ? 3.248   5.114   12.400  1.00 0.00 ? 49 ARG A O    4  
ATOM 3838  C CB   . ARG A 1 49 ? 5.022   3.578   10.013  1.00 0.00 ? 49 ARG A CB   4  
ATOM 3839  C CG   . ARG A 1 49 ? 5.965   4.627   10.578  1.00 0.00 ? 49 ARG A CG   4  
ATOM 3840  C CD   . ARG A 1 49 ? 7.333   4.559   9.919   1.00 0.00 ? 49 ARG A CD   4  
ATOM 3841  N NE   . ARG A 1 49 ? 7.293   5.000   8.527   1.00 0.00 ? 49 ARG A NE   4  
ATOM 3842  C CZ   . ARG A 1 49 ? 8.374   5.319   7.825   1.00 0.00 ? 49 ARG A CZ   4  
ATOM 3843  N NH1  . ARG A 1 49 ? 9.575   5.245   8.382   1.00 0.00 ? 49 ARG A NH1  4  
ATOM 3844  N NH2  . ARG A 1 49 ? 8.256   5.712   6.563   1.00 0.00 ? 49 ARG A NH2  4  
ATOM 3845  H H    . ARG A 1 49 ? 2.592   2.682   9.264   1.00 0.00 ? 49 ARG A H    4  
ATOM 3846  H HA   . ARG A 1 49 ? 4.094   2.823   11.788  1.00 0.00 ? 49 ARG A HA   4  
ATOM 3847  H HB2  . ARG A 1 49 ? 5.568   2.652   9.910   1.00 0.00 ? 49 ARG A HB2  4  
ATOM 3848  H HB3  . ARG A 1 49 ? 4.697   3.905   9.037   1.00 0.00 ? 49 ARG A HB3  4  
ATOM 3849  H HG2  . ARG A 1 49 ? 5.544   5.606   10.407  1.00 0.00 ? 49 ARG A HG2  4  
ATOM 3850  H HG3  . ARG A 1 49 ? 6.078   4.462   11.640  1.00 0.00 ? 49 ARG A HG3  4  
ATOM 3851  H HD2  . ARG A 1 49 ? 8.015   5.192   10.467  1.00 0.00 ? 49 ARG A HD2  4  
ATOM 3852  H HD3  . ARG A 1 49 ? 7.684   3.538   9.953   1.00 0.00 ? 49 ARG A HD3  4  
ATOM 3853  H HE   . ARG A 1 49 ? 6.415   5.061   8.096   1.00 0.00 ? 49 ARG A HE   4  
ATOM 3854  H HH11 . ARG A 1 49 ? 9.668   4.949   9.332   1.00 0.00 ? 49 ARG A HH11 4  
ATOM 3855  H HH12 . ARG A 1 49 ? 10.389  5.485   7.851   1.00 0.00 ? 49 ARG A HH12 4  
ATOM 3856  H HH21 . ARG A 1 49 ? 7.352   5.768   6.140   1.00 0.00 ? 49 ARG A HH21 4  
ATOM 3857  H HH22 . ARG A 1 49 ? 9.071   5.952   6.036   1.00 0.00 ? 49 ARG A HH22 4  
ATOM 3858  N N    . THR A 1 50 ? 2.470   5.278   10.295  1.00 0.00 ? 50 THR A N    4  
ATOM 3859  C CA   . THR A 1 50 ? 1.806   6.555   10.523  1.00 0.00 ? 50 THR A CA   4  
ATOM 3860  C C    . THR A 1 50 ? 0.291   6.391   10.553  1.00 0.00 ? 50 THR A C    4  
ATOM 3861  O O    . THR A 1 50 ? -0.446  7.370   10.661  1.00 0.00 ? 50 THR A O    4  
ATOM 3862  C CB   . THR A 1 50 ? 2.178   7.583   9.437   1.00 0.00 ? 50 THR A CB   4  
ATOM 3863  O OG1  . THR A 1 50 ? 1.742   7.120   8.154   1.00 0.00 ? 50 THR A OG1  4  
ATOM 3864  C CG2  . THR A 1 50 ? 3.680   7.823   9.411   1.00 0.00 ? 50 THR A CG2  4  
ATOM 3865  H H    . THR A 1 50 ? 2.420   4.864   9.407   1.00 0.00 ? 50 THR A H    4  
ATOM 3866  H HA   . THR A 1 50 ? 2.137   6.936   11.478  1.00 0.00 ? 50 THR A HA   4  
ATOM 3867  H HB   . THR A 1 50 ? 1.683   8.517   9.662   1.00 0.00 ? 50 THR A HB   4  
ATOM 3868  H HG1  . THR A 1 50 ? 0.852   6.767   8.227   1.00 0.00 ? 50 THR A HG1  4  
ATOM 3869  H HG21 . THR A 1 50 ? 4.186   6.911   9.131   1.00 0.00 ? 50 THR A HG21 4  
ATOM 3870  H HG22 . THR A 1 50 ? 4.012   8.132   10.392  1.00 0.00 ? 50 THR A HG22 4  
ATOM 3871  H HG23 . THR A 1 50 ? 3.908   8.597   8.694   1.00 0.00 ? 50 THR A HG23 4  
ATOM 3872  N N    . GLN A 1 51 ? -0.166  5.146   10.457  1.00 0.00 ? 51 GLN A N    4  
ATOM 3873  C CA   . GLN A 1 51 ? -1.595  4.855   10.473  1.00 0.00 ? 51 GLN A CA   4  
ATOM 3874  C C    . GLN A 1 51 ? -2.369  5.878   9.649   1.00 0.00 ? 51 GLN A C    4  
ATOM 3875  O O    . GLN A 1 51 ? -3.478  6.272   10.010  1.00 0.00 ? 51 GLN A O    4  
ATOM 3876  C CB   . GLN A 1 51 ? -2.117  4.840   11.911  1.00 0.00 ? 51 GLN A CB   4  
ATOM 3877  C CG   . GLN A 1 51 ? -1.995  6.181   12.616  1.00 0.00 ? 51 GLN A CG   4  
ATOM 3878  C CD   . GLN A 1 51 ? -2.836  6.258   13.875  1.00 0.00 ? 51 GLN A CD   4  
ATOM 3879  O OE1  . GLN A 1 51 ? -3.899  5.642   13.963  1.00 0.00 ? 51 GLN A OE1  4  
ATOM 3880  N NE2  . GLN A 1 51 ? -2.365  7.017   14.857  1.00 0.00 ? 51 GLN A NE2  4  
ATOM 3881  H H    . GLN A 1 51 ? 0.472   4.408   10.373  1.00 0.00 ? 51 GLN A H    4  
ATOM 3882  H HA   . GLN A 1 51 ? -1.738  3.877   10.038  1.00 0.00 ? 51 GLN A HA   4  
ATOM 3883  H HB2  . GLN A 1 51 ? -3.159  4.557   11.900  1.00 0.00 ? 51 GLN A HB2  4  
ATOM 3884  H HB3  . GLN A 1 51 ? -1.560  4.109   12.477  1.00 0.00 ? 51 GLN A HB3  4  
ATOM 3885  H HG2  . GLN A 1 51 ? -0.961  6.340   12.884  1.00 0.00 ? 51 GLN A HG2  4  
ATOM 3886  H HG3  . GLN A 1 51 ? -2.314  6.960   11.939  1.00 0.00 ? 51 GLN A HG3  4  
ATOM 3887  H HE21 . GLN A 1 51 ? -1.512  7.479   14.716  1.00 0.00 ? 51 GLN A HE21 4  
ATOM 3888  H HE22 . GLN A 1 51 ? -2.889  7.085   15.682  1.00 0.00 ? 51 GLN A HE22 4  
ATOM 3889  N N    . LYS A 1 52 ? -1.776  6.306   8.539   1.00 0.00 ? 52 LYS A N    4  
ATOM 3890  C CA   . LYS A 1 52 ? -2.409  7.283   7.661   1.00 0.00 ? 52 LYS A CA   4  
ATOM 3891  C C    . LYS A 1 52 ? -3.137  6.592   6.513   1.00 0.00 ? 52 LYS A C    4  
ATOM 3892  O O    . LYS A 1 52 ? -2.902  5.416   6.234   1.00 0.00 ? 52 LYS A O    4  
ATOM 3893  C CB   . LYS A 1 52 ? -1.364  8.254   7.106   1.00 0.00 ? 52 LYS A CB   4  
ATOM 3894  C CG   . LYS A 1 52 ? -0.880  9.273   8.123   1.00 0.00 ? 52 LYS A CG   4  
ATOM 3895  C CD   . LYS A 1 52 ? -0.378  10.538  7.448   1.00 0.00 ? 52 LYS A CD   4  
ATOM 3896  C CE   . LYS A 1 52 ? 0.717   11.208  8.265   1.00 0.00 ? 52 LYS A CE   4  
ATOM 3897  N NZ   . LYS A 1 52 ? 2.070   10.714  7.888   1.00 0.00 ? 52 LYS A NZ   4  
ATOM 3898  H H    . LYS A 1 52 ? -0.891  5.955   8.304   1.00 0.00 ? 52 LYS A H    4  
ATOM 3899  H HA   . LYS A 1 52 ? -3.128  7.837   8.245   1.00 0.00 ? 52 LYS A HA   4  
ATOM 3900  H HB2  . LYS A 1 52 ? -0.512  7.687   6.762   1.00 0.00 ? 52 LYS A HB2  4  
ATOM 3901  H HB3  . LYS A 1 52 ? -1.794  8.787   6.270   1.00 0.00 ? 52 LYS A HB3  4  
ATOM 3902  H HG2  . LYS A 1 52 ? -1.698  9.529   8.780   1.00 0.00 ? 52 LYS A HG2  4  
ATOM 3903  H HG3  . LYS A 1 52 ? -0.075  8.839   8.699   1.00 0.00 ? 52 LYS A HG3  4  
ATOM 3904  H HD2  . LYS A 1 52 ? 0.018   10.285  6.476   1.00 0.00 ? 52 LYS A HD2  4  
ATOM 3905  H HD3  . LYS A 1 52 ? -1.203  11.227  7.335   1.00 0.00 ? 52 LYS A HD3  4  
ATOM 3906  H HE2  . LYS A 1 52 ? 0.673   12.273  8.097   1.00 0.00 ? 52 LYS A HE2  4  
ATOM 3907  H HE3  . LYS A 1 52 ? 0.545   11.001  9.311   1.00 0.00 ? 52 LYS A HE3  4  
ATOM 3908  H HZ1  . LYS A 1 52 ? 2.477   10.158  8.668   1.00 0.00 ? 52 LYS A HZ1  4  
ATOM 3909  H HZ2  . LYS A 1 52 ? 2.700   11.516  7.685   1.00 0.00 ? 52 LYS A HZ2  4  
ATOM 3910  H HZ3  . LYS A 1 52 ? 2.009   10.111  7.043   1.00 0.00 ? 52 LYS A HZ3  4  
ATOM 3911  N N    . PHE A 1 53 ? -4.020  7.330   5.848   1.00 0.00 ? 53 PHE A N    4  
ATOM 3912  C CA   . PHE A 1 53 ? -4.781  6.788   4.729   1.00 0.00 ? 53 PHE A CA   4  
ATOM 3913  C C    . PHE A 1 53 ? -4.463  7.539   3.439   1.00 0.00 ? 53 PHE A C    4  
ATOM 3914  O O    . PHE A 1 53 ? -4.511  8.768   3.396   1.00 0.00 ? 53 PHE A O    4  
ATOM 3915  C CB   . PHE A 1 53 ? -6.281  6.865   5.020   1.00 0.00 ? 53 PHE A CB   4  
ATOM 3916  C CG   . PHE A 1 53 ? -7.118  6.050   4.075   1.00 0.00 ? 53 PHE A CG   4  
ATOM 3917  C CD1  . PHE A 1 53 ? -7.318  6.469   2.769   1.00 0.00 ? 53 PHE A CD1  4  
ATOM 3918  C CD2  . PHE A 1 53 ? -7.704  4.866   4.492   1.00 0.00 ? 53 PHE A CD2  4  
ATOM 3919  C CE1  . PHE A 1 53 ? -8.088  5.722   1.898   1.00 0.00 ? 53 PHE A CE1  4  
ATOM 3920  C CE2  . PHE A 1 53 ? -8.475  4.115   3.625   1.00 0.00 ? 53 PHE A CE2  4  
ATOM 3921  C CZ   . PHE A 1 53 ? -8.666  4.543   2.326   1.00 0.00 ? 53 PHE A CZ   4  
ATOM 3922  H H    . PHE A 1 53 ? -4.163  8.262   6.117   1.00 0.00 ? 53 PHE A H    4  
ATOM 3923  H HA   . PHE A 1 53 ? -4.499  5.753   4.607   1.00 0.00 ? 53 PHE A HA   4  
ATOM 3924  H HB2  . PHE A 1 53 ? -6.466  6.503   6.021   1.00 0.00 ? 53 PHE A HB2  4  
ATOM 3925  H HB3  . PHE A 1 53 ? -6.602  7.893   4.948   1.00 0.00 ? 53 PHE A HB3  4  
ATOM 3926  H HD1  . PHE A 1 53 ? -6.865  7.390   2.433   1.00 0.00 ? 53 PHE A HD1  4  
ATOM 3927  H HD2  . PHE A 1 53 ? -7.555  4.530   5.509   1.00 0.00 ? 53 PHE A HD2  4  
ATOM 3928  H HE1  . PHE A 1 53 ? -8.236  6.059   0.883   1.00 0.00 ? 53 PHE A HE1  4  
ATOM 3929  H HE2  . PHE A 1 53 ? -8.926  3.194   3.964   1.00 0.00 ? 53 PHE A HE2  4  
ATOM 3930  H HZ   . PHE A 1 53 ? -9.269  3.958   1.648   1.00 0.00 ? 53 PHE A HZ   4  
ATOM 3931  N N    . GLY A 1 54 ? -4.138  6.791   2.390   1.00 0.00 ? 54 GLY A N    4  
ATOM 3932  C CA   . GLY A 1 54 ? -3.815  7.402   1.114   1.00 0.00 ? 54 GLY A CA   4  
ATOM 3933  C C    . GLY A 1 54 ? -3.761  6.393   -0.016  1.00 0.00 ? 54 GLY A C    4  
ATOM 3934  O O    . GLY A 1 54 ? -4.398  5.341   0.049   1.00 0.00 ? 54 GLY A O    4  
ATOM 3935  H H    . GLY A 1 54 ? -4.116  5.815   2.483   1.00 0.00 ? 54 GLY A H    4  
ATOM 3936  H HA2  . GLY A 1 54 ? -4.565  8.145   0.883   1.00 0.00 ? 54 GLY A HA2  4  
ATOM 3937  H HA3  . GLY A 1 54 ? -2.854  7.888   1.193   1.00 0.00 ? 54 GLY A HA3  4  
ATOM 3938  N N    . THR A 1 55 ? -2.999  6.713   -1.057  1.00 0.00 ? 55 THR A N    4  
ATOM 3939  C CA   . THR A 1 55 ? -2.866  5.827   -2.207  1.00 0.00 ? 55 THR A CA   4  
ATOM 3940  C C    . THR A 1 55 ? -1.402  5.630   -2.583  1.00 0.00 ? 55 THR A C    4  
ATOM 3941  O O    . THR A 1 55 ? -0.637  6.591   -2.667  1.00 0.00 ? 55 THR A O    4  
ATOM 3942  C CB   . THR A 1 55 ? -3.628  6.375   -3.428  1.00 0.00 ? 55 THR A CB   4  
ATOM 3943  O OG1  . THR A 1 55 ? -3.325  5.591   -4.587  1.00 0.00 ? 55 THR A OG1  4  
ATOM 3944  C CG2  . THR A 1 55 ? -3.265  7.830   -3.685  1.00 0.00 ? 55 THR A CG2  4  
ATOM 3945  H H    . THR A 1 55 ? -2.515  7.565   -1.050  1.00 0.00 ? 55 THR A H    4  
ATOM 3946  H HA   . THR A 1 55 ? -3.292  4.870   -1.943  1.00 0.00 ? 55 THR A HA   4  
ATOM 3947  H HB   . THR A 1 55 ? -4.689  6.314   -3.229  1.00 0.00 ? 55 THR A HB   4  
ATOM 3948  H HG1  . THR A 1 55 ? -3.881  5.871   -5.318  1.00 0.00 ? 55 THR A HG1  4  
ATOM 3949  H HG21 . THR A 1 55 ? -4.158  8.386   -3.932  1.00 0.00 ? 55 THR A HG21 4  
ATOM 3950  H HG22 . THR A 1 55 ? -2.567  7.887   -4.507  1.00 0.00 ? 55 THR A HG22 4  
ATOM 3951  H HG23 . THR A 1 55 ? -2.814  8.249   -2.799  1.00 0.00 ? 55 THR A HG23 4  
ATOM 3952  N N    . PHE A 1 56 ? -1.017  4.378   -2.809  1.00 0.00 ? 56 PHE A N    4  
ATOM 3953  C CA   . PHE A 1 56 ? 0.357   4.055   -3.176  1.00 0.00 ? 56 PHE A CA   4  
ATOM 3954  C C    . PHE A 1 56 ? 0.392   2.973   -4.251  1.00 0.00 ? 56 PHE A C    4  
ATOM 3955  O O    . PHE A 1 56 ? -0.546  2.193   -4.413  1.00 0.00 ? 56 PHE A O    4  
ATOM 3956  C CB   . PHE A 1 56 ? 1.140   3.594   -1.945  1.00 0.00 ? 56 PHE A CB   4  
ATOM 3957  C CG   . PHE A 1 56 ? 0.368   2.660   -1.058  1.00 0.00 ? 56 PHE A CG   4  
ATOM 3958  C CD1  . PHE A 1 56 ? -0.594  3.148   -0.188  1.00 0.00 ? 56 PHE A CD1  4  
ATOM 3959  C CD2  . PHE A 1 56 ? 0.604   1.295   -1.092  1.00 0.00 ? 56 PHE A CD2  4  
ATOM 3960  C CE1  . PHE A 1 56 ? -1.308  2.292   0.630   1.00 0.00 ? 56 PHE A CE1  4  
ATOM 3961  C CE2  . PHE A 1 56 ? -0.107  0.435   -0.277  1.00 0.00 ? 56 PHE A CE2  4  
ATOM 3962  C CZ   . PHE A 1 56 ? -1.062  0.934   0.586   1.00 0.00 ? 56 PHE A CZ   4  
ATOM 3963  H H    . PHE A 1 56 ? -1.673  3.655   -2.726  1.00 0.00 ? 56 PHE A H    4  
ATOM 3964  H HA   . PHE A 1 56 ? 0.813   4.950   -3.568  1.00 0.00 ? 56 PHE A HA   4  
ATOM 3965  H HB2  . PHE A 1 56 ? 2.033   3.080   -2.268  1.00 0.00 ? 56 PHE A HB2  4  
ATOM 3966  H HB3  . PHE A 1 56 ? 1.418   4.457   -1.360  1.00 0.00 ? 56 PHE A HB3  4  
ATOM 3967  H HD1  . PHE A 1 56 ? -0.787  4.211   -0.153  1.00 0.00 ? 56 PHE A HD1  4  
ATOM 3968  H HD2  . PHE A 1 56 ? 1.352   0.904   -1.766  1.00 0.00 ? 56 PHE A HD2  4  
ATOM 3969  H HE1  . PHE A 1 56 ? -2.054  2.686   1.304   1.00 0.00 ? 56 PHE A HE1  4  
ATOM 3970  H HE2  . PHE A 1 56 ? 0.087   -0.627  -0.313  1.00 0.00 ? 56 PHE A HE2  4  
ATOM 3971  H HZ   . PHE A 1 56 ? -1.619  0.263   1.224   1.00 0.00 ? 56 PHE A HZ   4  
ATOM 3972  N N    . PRO A 1 57 ? 1.501   2.924   -5.004  1.00 0.00 ? 57 PRO A N    4  
ATOM 3973  C CA   . PRO A 1 57 ? 1.686   1.942   -6.077  1.00 0.00 ? 57 PRO A CA   4  
ATOM 3974  C C    . PRO A 1 57 ? 1.869   0.526   -5.541  1.00 0.00 ? 57 PRO A C    4  
ATOM 3975  O O    . PRO A 1 57 ? 2.924   0.185   -5.008  1.00 0.00 ? 57 PRO A O    4  
ATOM 3976  C CB   . PRO A 1 57 ? 2.962   2.418   -6.776  1.00 0.00 ? 57 PRO A CB   4  
ATOM 3977  C CG   . PRO A 1 57 ? 3.705   3.178   -5.733  1.00 0.00 ? 57 PRO A CG   4  
ATOM 3978  C CD   . PRO A 1 57 ? 2.659   3.822   -4.866  1.00 0.00 ? 57 PRO A CD   4  
ATOM 3979  H HA   . PRO A 1 57 ? 0.863   1.958   -6.776  1.00 0.00 ? 57 PRO A HA   4  
ATOM 3980  H HB2  . PRO A 1 57 ? 3.527   1.563   -7.121  1.00 0.00 ? 57 PRO A HB2  4  
ATOM 3981  H HB3  . PRO A 1 57 ? 2.704   3.048   -7.614  1.00 0.00 ? 57 PRO A HB3  4  
ATOM 3982  H HG2  . PRO A 1 57 ? 4.312   2.503   -5.149  1.00 0.00 ? 57 PRO A HG2  4  
ATOM 3983  H HG3  . PRO A 1 57 ? 4.322   3.933   -6.198  1.00 0.00 ? 57 PRO A HG3  4  
ATOM 3984  H HD2  . PRO A 1 57 ? 2.994   3.866   -3.840  1.00 0.00 ? 57 PRO A HD2  4  
ATOM 3985  H HD3  . PRO A 1 57 ? 2.424   4.812   -5.230  1.00 0.00 ? 57 PRO A HD3  4  
ATOM 3986  N N    . GLY A 1 58 ? 0.834   -0.296  -5.688  1.00 0.00 ? 58 GLY A N    4  
ATOM 3987  C CA   . GLY A 1 58 ? 0.902   -1.666  -5.214  1.00 0.00 ? 58 GLY A CA   4  
ATOM 3988  C C    . GLY A 1 58 ? 2.151   -2.382  -5.688  1.00 0.00 ? 58 GLY A C    4  
ATOM 3989  O O    . GLY A 1 58 ? 2.548   -3.395  -5.114  1.00 0.00 ? 58 GLY A O    4  
ATOM 3990  H H    . GLY A 1 58 ? 0.018   0.031   -6.121  1.00 0.00 ? 58 GLY A H    4  
ATOM 3991  H HA2  . GLY A 1 58 ? 0.888   -1.663  -4.134  1.00 0.00 ? 58 GLY A HA2  4  
ATOM 3992  H HA3  . GLY A 1 58 ? 0.036   -2.202  -5.574  1.00 0.00 ? 58 GLY A HA3  4  
ATOM 3993  N N    . ASN A 1 59 ? 2.771   -1.855  -6.738  1.00 0.00 ? 59 ASN A N    4  
ATOM 3994  C CA   . ASN A 1 59 ? 3.982   -2.452  -7.290  1.00 0.00 ? 59 ASN A CA   4  
ATOM 3995  C C    . ASN A 1 59 ? 5.098   -2.479  -6.250  1.00 0.00 ? 59 ASN A C    4  
ATOM 3996  O O    . ASN A 1 59 ? 6.088   -3.194  -6.406  1.00 0.00 ? 59 ASN A O    4  
ATOM 3997  C CB   . ASN A 1 59 ? 4.440   -1.677  -8.527  1.00 0.00 ? 59 ASN A CB   4  
ATOM 3998  C CG   . ASN A 1 59 ? 3.349   -1.562  -9.574  1.00 0.00 ? 59 ASN A CG   4  
ATOM 3999  O OD1  . ASN A 1 59 ? 3.117   -2.490  -10.349 1.00 0.00 ? 59 ASN A OD1  4  
ATOM 4000  N ND2  . ASN A 1 59 ? 2.674   -0.419  -9.602  1.00 0.00 ? 59 ASN A ND2  4  
ATOM 4001  H H    . ASN A 1 59 ? 2.406   -1.045  -7.153  1.00 0.00 ? 59 ASN A H    4  
ATOM 4002  H HA   . ASN A 1 59 ? 3.749   -3.467  -7.578  1.00 0.00 ? 59 ASN A HA   4  
ATOM 4003  H HB2  . ASN A 1 59 ? 4.734   -0.680  -8.231  1.00 0.00 ? 59 ASN A HB2  4  
ATOM 4004  H HB3  . ASN A 1 59 ? 5.286   -2.181  -8.968  1.00 0.00 ? 59 ASN A HB3  4  
ATOM 4005  H HD21 . ASN A 1 59 ? 2.914   0.277   -8.954  1.00 0.00 ? 59 ASN A HD21 4  
ATOM 4006  H HD22 . ASN A 1 59 ? 1.963   -0.318  -10.269 1.00 0.00 ? 59 ASN A HD22 4  
ATOM 4007  N N    . TYR A 1 60 ? 4.930   -1.696  -5.191  1.00 0.00 ? 60 TYR A N    4  
ATOM 4008  C CA   . TYR A 1 60 ? 5.924   -1.628  -4.126  1.00 0.00 ? 60 TYR A CA   4  
ATOM 4009  C C    . TYR A 1 60 ? 5.567   -2.578  -2.986  1.00 0.00 ? 60 TYR A C    4  
ATOM 4010  O O    . TYR A 1 60 ? 6.435   -3.007  -2.226  1.00 0.00 ? 60 TYR A O    4  
ATOM 4011  C CB   . TYR A 1 60 ? 6.037   -0.198  -3.596  1.00 0.00 ? 60 TYR A CB   4  
ATOM 4012  C CG   . TYR A 1 60 ? 6.918   0.693   -4.442  1.00 0.00 ? 60 TYR A CG   4  
ATOM 4013  C CD1  . TYR A 1 60 ? 6.548   1.043   -5.735  1.00 0.00 ? 60 TYR A CD1  4  
ATOM 4014  C CD2  . TYR A 1 60 ? 8.121   1.185   -3.950  1.00 0.00 ? 60 TYR A CD2  4  
ATOM 4015  C CE1  . TYR A 1 60 ? 7.350   1.856   -6.513  1.00 0.00 ? 60 TYR A CE1  4  
ATOM 4016  C CE2  . TYR A 1 60 ? 8.928   2.000   -4.719  1.00 0.00 ? 60 TYR A CE2  4  
ATOM 4017  C CZ   . TYR A 1 60 ? 8.539   2.333   -6.000  1.00 0.00 ? 60 TYR A CZ   4  
ATOM 4018  O OH   . TYR A 1 60 ? 9.341   3.143   -6.770  1.00 0.00 ? 60 TYR A OH   4  
ATOM 4019  H H    . TYR A 1 60 ? 4.120   -1.149  -5.123  1.00 0.00 ? 60 TYR A H    4  
ATOM 4020  H HA   . TYR A 1 60 ? 6.876   -1.924  -4.541  1.00 0.00 ? 60 TYR A HA   4  
ATOM 4021  H HB2  . TYR A 1 60 ? 5.054   0.245   -3.562  1.00 0.00 ? 60 TYR A HB2  4  
ATOM 4022  H HB3  . TYR A 1 60 ? 6.451   -0.223  -2.598  1.00 0.00 ? 60 TYR A HB3  4  
ATOM 4023  H HD1  . TYR A 1 60 ? 5.617   0.668   -6.134  1.00 0.00 ? 60 TYR A HD1  4  
ATOM 4024  H HD2  . TYR A 1 60 ? 8.423   0.922   -2.946  1.00 0.00 ? 60 TYR A HD2  4  
ATOM 4025  H HE1  . TYR A 1 60 ? 7.046   2.117   -7.516  1.00 0.00 ? 60 TYR A HE1  4  
ATOM 4026  H HE2  . TYR A 1 60 ? 9.859   2.373   -4.318  1.00 0.00 ? 60 TYR A HE2  4  
ATOM 4027  H HH   . TYR A 1 60 ? 9.421   4.004   -6.352  1.00 0.00 ? 60 TYR A HH   4  
ATOM 4028  N N    . VAL A 1 61 ? 4.283   -2.902  -2.875  1.00 0.00 ? 61 VAL A N    4  
ATOM 4029  C CA   . VAL A 1 61 ? 3.809   -3.802  -1.831  1.00 0.00 ? 61 VAL A CA   4  
ATOM 4030  C C    . VAL A 1 61 ? 3.338   -5.127  -2.419  1.00 0.00 ? 61 VAL A C    4  
ATOM 4031  O O    . VAL A 1 61 ? 3.224   -5.272  -3.636  1.00 0.00 ? 61 VAL A O    4  
ATOM 4032  C CB   . VAL A 1 61 ? 2.657   -3.172  -1.026  1.00 0.00 ? 61 VAL A CB   4  
ATOM 4033  C CG1  . VAL A 1 61 ? 3.073   -1.820  -0.466  1.00 0.00 ? 61 VAL A CG1  4  
ATOM 4034  C CG2  . VAL A 1 61 ? 1.413   -3.038  -1.893  1.00 0.00 ? 61 VAL A CG2  4  
ATOM 4035  H H    . VAL A 1 61 ? 3.639   -2.528  -3.512  1.00 0.00 ? 61 VAL A H    4  
ATOM 4036  H HA   . VAL A 1 61 ? 4.631   -3.991  -1.155  1.00 0.00 ? 61 VAL A HA   4  
ATOM 4037  H HB   . VAL A 1 61 ? 2.424   -3.824  -0.198  1.00 0.00 ? 61 VAL A HB   4  
ATOM 4038  H HG11 . VAL A 1 61 ? 2.193   -1.229  -0.260  1.00 0.00 ? 61 VAL A HG11 4  
ATOM 4039  H HG12 . VAL A 1 61 ? 3.633   -1.965  0.446   1.00 0.00 ? 61 VAL A HG12 4  
ATOM 4040  H HG13 . VAL A 1 61 ? 3.690   -1.306  -1.189  1.00 0.00 ? 61 VAL A HG13 4  
ATOM 4041  H HG21 . VAL A 1 61 ? 1.244   -1.997  -2.121  1.00 0.00 ? 61 VAL A HG21 4  
ATOM 4042  H HG22 . VAL A 1 61 ? 1.554   -3.589  -2.812  1.00 0.00 ? 61 VAL A HG22 4  
ATOM 4043  H HG23 . VAL A 1 61 ? 0.560   -3.435  -1.363  1.00 0.00 ? 61 VAL A HG23 4  
ATOM 4044  N N    . ALA A 1 62 ? 3.065   -6.092  -1.547  1.00 0.00 ? 62 ALA A N    4  
ATOM 4045  C CA   . ALA A 1 62 ? 2.604   -7.405  -1.979  1.00 0.00 ? 62 ALA A CA   4  
ATOM 4046  C C    . ALA A 1 62 ? 1.699   -8.042  -0.930  1.00 0.00 ? 62 ALA A C    4  
ATOM 4047  O O    . ALA A 1 62 ? 1.826   -7.793  0.269   1.00 0.00 ? 62 ALA A O    4  
ATOM 4048  C CB   . ALA A 1 62 ? 3.790   -8.310  -2.275  1.00 0.00 ? 62 ALA A CB   4  
ATOM 4049  H H    . ALA A 1 62 ? 3.175   -5.916  -0.589  1.00 0.00 ? 62 ALA A H    4  
ATOM 4050  H HA   . ALA A 1 62 ? 2.043   -7.277  -2.894  1.00 0.00 ? 62 ALA A HA   4  
ATOM 4051  H HB1  . ALA A 1 62 ? 4.547   -7.749  -2.804  1.00 0.00 ? 62 ALA A HB1  4  
ATOM 4052  H HB2  . ALA A 1 62 ? 4.199   -8.682  -1.348  1.00 0.00 ? 62 ALA A HB2  4  
ATOM 4053  H HB3  . ALA A 1 62 ? 3.466   -9.140  -2.885  1.00 0.00 ? 62 ALA A HB3  4  
ATOM 4054  N N    . PRO A 1 63 ? 0.761   -8.884  -1.389  1.00 0.00 ? 63 PRO A N    4  
ATOM 4055  C CA   . PRO A 1 63 ? -0.184  -9.574  -0.506  1.00 0.00 ? 63 PRO A CA   4  
ATOM 4056  C C    . PRO A 1 63 ? 0.494   -10.639 0.349   1.00 0.00 ? 63 PRO A C    4  
ATOM 4057  O O    . PRO A 1 63 ? 0.875   -11.699 -0.148  1.00 0.00 ? 63 PRO A O    4  
ATOM 4058  C CB   . PRO A 1 63 ? -1.173  -10.220 -1.480  1.00 0.00 ? 63 PRO A CB   4  
ATOM 4059  C CG   . PRO A 1 63 ? -0.404  -10.388 -2.745  1.00 0.00 ? 63 PRO A CG   4  
ATOM 4060  C CD   . PRO A 1 63 ? 0.552   -9.229  -2.806  1.00 0.00 ? 63 PRO A CD   4  
ATOM 4061  H HA   . PRO A 1 63 ? -0.708  -8.880  0.134   1.00 0.00 ? 63 PRO A HA   4  
ATOM 4062  H HB2  . PRO A 1 63 ? -1.500  -11.172 -1.086  1.00 0.00 ? 63 PRO A HB2  4  
ATOM 4063  H HB3  . PRO A 1 63 ? -2.023  -9.570  -1.619  1.00 0.00 ? 63 PRO A HB3  4  
ATOM 4064  H HG2  . PRO A 1 63 ? 0.139   -11.321 -2.723  1.00 0.00 ? 63 PRO A HG2  4  
ATOM 4065  H HG3  . PRO A 1 63 ? -1.077  -10.363 -3.589  1.00 0.00 ? 63 PRO A HG3  4  
ATOM 4066  H HD2  . PRO A 1 63 ? 1.479   -9.528  -3.271  1.00 0.00 ? 63 PRO A HD2  4  
ATOM 4067  H HD3  . PRO A 1 63 ? 0.108   -8.402  -3.341  1.00 0.00 ? 63 PRO A HD3  4  
ATOM 4068  N N    . VAL A 1 64 ? 0.641   -10.351 1.639   1.00 0.00 ? 64 VAL A N    4  
ATOM 4069  C CA   . VAL A 1 64 ? 1.271   -11.285 2.564   1.00 0.00 ? 64 VAL A CA   4  
ATOM 4070  C C    . VAL A 1 64 ? 0.285   -12.352 3.026   1.00 0.00 ? 64 VAL A C    4  
ATOM 4071  O O    . VAL A 1 64 ? 0.681   -13.435 3.455   1.00 0.00 ? 64 VAL A O    4  
ATOM 4072  C CB   . VAL A 1 64 ? 1.838   -10.557 3.797   1.00 0.00 ? 64 VAL A CB   4  
ATOM 4073  C CG1  . VAL A 1 64 ? 0.838   -9.538  4.322   1.00 0.00 ? 64 VAL A CG1  4  
ATOM 4074  C CG2  . VAL A 1 64 ? 2.211   -11.557 4.881   1.00 0.00 ? 64 VAL A CG2  4  
ATOM 4075  H H    . VAL A 1 64 ? 0.317   -9.490  1.976   1.00 0.00 ? 64 VAL A H    4  
ATOM 4076  H HA   . VAL A 1 64 ? 2.090   -11.765 2.047   1.00 0.00 ? 64 VAL A HA   4  
ATOM 4077  H HB   . VAL A 1 64 ? 2.733   -10.031 3.499   1.00 0.00 ? 64 VAL A HB   4  
ATOM 4078  H HG11 . VAL A 1 64 ? -0.158  -9.821  4.016   1.00 0.00 ? 64 VAL A HG11 4  
ATOM 4079  H HG12 . VAL A 1 64 ? 0.890   -9.505  5.400   1.00 0.00 ? 64 VAL A HG12 4  
ATOM 4080  H HG13 . VAL A 1 64 ? 1.074   -8.563  3.920   1.00 0.00 ? 64 VAL A HG13 4  
ATOM 4081  H HG21 . VAL A 1 64 ? 1.315   -11.906 5.372   1.00 0.00 ? 64 VAL A HG21 4  
ATOM 4082  H HG22 . VAL A 1 64 ? 2.726   -12.396 4.436   1.00 0.00 ? 64 VAL A HG22 4  
ATOM 4083  H HG23 . VAL A 1 64 ? 2.857   -11.081 5.604   1.00 0.00 ? 64 VAL A HG23 4  
ATOM 4084  N N    . SER A 1 65 ? -1.004  -12.038 2.934   1.00 0.00 ? 65 SER A N    4  
ATOM 4085  C CA   . SER A 1 65 ? -2.048  -12.968 3.346   1.00 0.00 ? 65 SER A CA   4  
ATOM 4086  C C    . SER A 1 65 ? -1.774  -14.367 2.804   1.00 0.00 ? 65 SER A C    4  
ATOM 4087  O O    . SER A 1 65 ? -2.080  -15.367 3.452   1.00 0.00 ? 65 SER A O    4  
ATOM 4088  C CB   . SER A 1 65 ? -3.415  -12.480 2.861   1.00 0.00 ? 65 SER A CB   4  
ATOM 4089  O OG   . SER A 1 65 ? -4.379  -13.517 2.925   1.00 0.00 ? 65 SER A OG   4  
ATOM 4090  H H    . SER A 1 65 ? -1.257  -11.158 2.583   1.00 0.00 ? 65 SER A H    4  
ATOM 4091  H HA   . SER A 1 65 ? -2.051  -13.006 4.425   1.00 0.00 ? 65 SER A HA   4  
ATOM 4092  H HB2  . SER A 1 65 ? -3.744  -11.661 3.483   1.00 0.00 ? 65 SER A HB2  4  
ATOM 4093  H HB3  . SER A 1 65 ? -3.332  -12.144 1.838   1.00 0.00 ? 65 SER A HB3  4  
ATOM 4094  H HG   . SER A 1 65 ? -4.569  -13.721 3.843   1.00 0.00 ? 65 SER A HG   4  
ATOM 4095  N N    . GLY A 1 66 ? -1.194  -14.429 1.609   1.00 0.00 ? 66 GLY A N    4  
ATOM 4096  C CA   . GLY A 1 66 ? -0.888  -15.710 0.999   1.00 0.00 ? 66 GLY A CA   4  
ATOM 4097  C C    . GLY A 1 66 ? -1.983  -16.184 0.065   1.00 0.00 ? 66 GLY A C    4  
ATOM 4098  O O    . GLY A 1 66 ? -2.854  -15.417 -0.345  1.00 0.00 ? 66 GLY A O    4  
ATOM 4099  H H    . GLY A 1 66 ? -0.972  -13.599 1.138   1.00 0.00 ? 66 GLY A H    4  
ATOM 4100  H HA2  . GLY A 1 66 ? 0.033   -15.620 0.441   1.00 0.00 ? 66 GLY A HA2  4  
ATOM 4101  H HA3  . GLY A 1 66 ? -0.753  -16.445 1.779   1.00 0.00 ? 66 GLY A HA3  4  
ATOM 4102  N N    . PRO A 1 67 ? -1.948  -17.478 -0.286  1.00 0.00 ? 67 PRO A N    4  
ATOM 4103  C CA   . PRO A 1 67 ? -2.938  -18.083 -1.183  1.00 0.00 ? 67 PRO A CA   4  
ATOM 4104  C C    . PRO A 1 67 ? -4.314  -18.195 -0.535  1.00 0.00 ? 67 PRO A C    4  
ATOM 4105  O O    . PRO A 1 67 ? -5.304  -18.484 -1.206  1.00 0.00 ? 67 PRO A O    4  
ATOM 4106  C CB   . PRO A 1 67 ? -2.362  -19.474 -1.460  1.00 0.00 ? 67 PRO A CB   4  
ATOM 4107  C CG   . PRO A 1 67 ? -1.505  -19.772 -0.279  1.00 0.00 ? 67 PRO A CG   4  
ATOM 4108  C CD   . PRO A 1 67 ? -0.939  -18.451 0.165   1.00 0.00 ? 67 PRO A CD   4  
ATOM 4109  H HA   . PRO A 1 67 ? -3.021  -17.534 -2.109  1.00 0.00 ? 67 PRO A HA   4  
ATOM 4110  H HB2  . PRO A 1 67 ? -3.169  -20.187 -1.554  1.00 0.00 ? 67 PRO A HB2  4  
ATOM 4111  H HB3  . PRO A 1 67 ? -1.785  -19.453 -2.372  1.00 0.00 ? 67 PRO A HB3  4  
ATOM 4112  H HG2  . PRO A 1 67 ? -2.102  -20.208 0.507   1.00 0.00 ? 67 PRO A HG2  4  
ATOM 4113  H HG3  . PRO A 1 67 ? -0.708  -20.443 -0.564  1.00 0.00 ? 67 PRO A HG3  4  
ATOM 4114  H HD2  . PRO A 1 67 ? -0.834  -18.428 1.240   1.00 0.00 ? 67 PRO A HD2  4  
ATOM 4115  H HD3  . PRO A 1 67 ? 0.013   -18.269 -0.312  1.00 0.00 ? 67 PRO A HD3  4  
ATOM 4116  N N    . SER A 1 68 ? -4.368  -17.965 0.773   1.00 0.00 ? 68 SER A N    4  
ATOM 4117  C CA   . SER A 1 68 ? -5.623  -18.043 1.511   1.00 0.00 ? 68 SER A CA   4  
ATOM 4118  C C    . SER A 1 68 ? -6.773  -17.466 0.692   1.00 0.00 ? 68 SER A C    4  
ATOM 4119  O O    . SER A 1 68 ? -6.699  -16.337 0.208   1.00 0.00 ? 68 SER A O    4  
ATOM 4120  C CB   . SER A 1 68 ? -5.504  -17.296 2.841   1.00 0.00 ? 68 SER A CB   4  
ATOM 4121  O OG   . SER A 1 68 ? -4.401  -17.768 3.595   1.00 0.00 ? 68 SER A OG   4  
ATOM 4122  H H    . SER A 1 68 ? -3.544  -17.739 1.253   1.00 0.00 ? 68 SER A H    4  
ATOM 4123  H HA   . SER A 1 68 ? -5.825  -19.085 1.711   1.00 0.00 ? 68 SER A HA   4  
ATOM 4124  H HB2  . SER A 1 68 ? -5.368  -16.243 2.648   1.00 0.00 ? 68 SER A HB2  4  
ATOM 4125  H HB3  . SER A 1 68 ? -6.408  -17.443 3.415   1.00 0.00 ? 68 SER A HB3  4  
ATOM 4126  H HG   . SER A 1 68 ? -4.074  -17.064 4.159   1.00 0.00 ? 68 SER A HG   4  
ATOM 4127  N N    . SER A 1 69 ? -7.835  -18.251 0.540   1.00 0.00 ? 69 SER A N    4  
ATOM 4128  C CA   . SER A 1 69 ? -9.000  -17.821 -0.224  1.00 0.00 ? 69 SER A CA   4  
ATOM 4129  C C    . SER A 1 69 ? -9.727  -16.684 0.487   1.00 0.00 ? 69 SER A C    4  
ATOM 4130  O O    . SER A 1 69 ? -9.700  -16.585 1.713   1.00 0.00 ? 69 SER A O    4  
ATOM 4131  C CB   . SER A 1 69 ? -9.956  -18.996 -0.441  1.00 0.00 ? 69 SER A CB   4  
ATOM 4132  O OG   . SER A 1 69 ? -10.505 -19.441 0.788   1.00 0.00 ? 69 SER A OG   4  
ATOM 4133  H H    . SER A 1 69 ? -7.834  -19.141 0.950   1.00 0.00 ? 69 SER A H    4  
ATOM 4134  H HA   . SER A 1 69 ? -8.655  -17.467 -1.184  1.00 0.00 ? 69 SER A HA   4  
ATOM 4135  H HB2  . SER A 1 69 ? -10.761 -18.686 -1.089  1.00 0.00 ? 69 SER A HB2  4  
ATOM 4136  H HB3  . SER A 1 69 ? -9.419  -19.814 -0.899  1.00 0.00 ? 69 SER A HB3  4  
ATOM 4137  H HG   . SER A 1 69 ? -9.802  -19.546 1.433   1.00 0.00 ? 69 SER A HG   4  
ATOM 4138  N N    . GLY A 1 70 ? -10.378 -15.826 -0.293  1.00 0.00 ? 70 GLY A N    4  
ATOM 4139  C CA   . GLY A 1 70 ? -11.103 -14.706 0.279   1.00 0.00 ? 70 GLY A CA   4  
ATOM 4140  C C    . GLY A 1 70 ? -10.181 -13.601 0.756   1.00 0.00 ? 70 GLY A C    4  
ATOM 4141  O O    . GLY A 1 70 ? -10.523 -12.421 0.675   1.00 0.00 ? 70 GLY A O    4  
ATOM 4142  H H    . GLY A 1 70 ? -10.365 -15.954 -1.264  1.00 0.00 ? 70 GLY A H    4  
ATOM 4143  H HA2  . GLY A 1 70 ? -11.772 -14.306 -0.468  1.00 0.00 ? 70 GLY A HA2  4  
ATOM 4144  H HA3  . GLY A 1 70 ? -11.685 -15.060 1.117   1.00 0.00 ? 70 GLY A HA3  4  
ATOM 4145  N N    . GLY A 1 1  ? -11.293 -9.774  23.274  1.00 0.00 ? 1  GLY A N    5  
ATOM 4146  C CA   . GLY A 1 1  ? -11.091 -8.717  22.301  1.00 0.00 ? 1  GLY A CA   5  
ATOM 4147  C C    . GLY A 1 1  ? -10.580 -9.241  20.974  1.00 0.00 ? 1  GLY A C    5  
ATOM 4148  O O    . GLY A 1 1  ? -9.476  -8.900  20.548  1.00 0.00 ? 1  GLY A O    5  
ATOM 4149  H H1   . GLY A 1 1  ? -11.922 -10.502 23.081  1.00 0.00 ? 1  GLY A H1   5  
ATOM 4150  H HA2  . GLY A 1 1  ? -12.030 -8.208  22.138  1.00 0.00 ? 1  GLY A HA2  5  
ATOM 4151  H HA3  . GLY A 1 1  ? -10.375 -8.012  22.696  1.00 0.00 ? 1  GLY A HA3  5  
ATOM 4152  N N    . SER A 1 2  ? -11.383 -10.073 20.318  1.00 0.00 ? 2  SER A N    5  
ATOM 4153  C CA   . SER A 1 2  ? -11.003 -10.649 19.034  1.00 0.00 ? 2  SER A CA   5  
ATOM 4154  C C    . SER A 1 2  ? -10.369 -9.595  18.132  1.00 0.00 ? 2  SER A C    5  
ATOM 4155  O O    . SER A 1 2  ? -10.837 -8.459  18.062  1.00 0.00 ? 2  SER A O    5  
ATOM 4156  C CB   . SER A 1 2  ? -12.224 -11.260 18.344  1.00 0.00 ? 2  SER A CB   5  
ATOM 4157  O OG   . SER A 1 2  ? -12.915 -12.140 19.214  1.00 0.00 ? 2  SER A OG   5  
ATOM 4158  H H    . SER A 1 2  ? -12.251 -10.306 20.710  1.00 0.00 ? 2  SER A H    5  
ATOM 4159  H HA   . SER A 1 2  ? -10.279 -11.428 19.221  1.00 0.00 ? 2  SER A HA   5  
ATOM 4160  H HB2  . SER A 1 2  ? -12.896 -10.470 18.042  1.00 0.00 ? 2  SER A HB2  5  
ATOM 4161  H HB3  . SER A 1 2  ? -11.903 -11.812 17.472  1.00 0.00 ? 2  SER A HB3  5  
ATOM 4162  H HG   . SER A 1 2  ? -12.536 -13.019 19.147  1.00 0.00 ? 2  SER A HG   5  
ATOM 4163  N N    . SER A 1 3  ? -9.300  -9.981  17.443  1.00 0.00 ? 3  SER A N    5  
ATOM 4164  C CA   . SER A 1 3  ? -8.597  -9.069  16.547  1.00 0.00 ? 3  SER A CA   5  
ATOM 4165  C C    . SER A 1 3  ? -9.226  -9.081  15.157  1.00 0.00 ? 3  SER A C    5  
ATOM 4166  O O    . SER A 1 3  ? -8.700  -9.698  14.231  1.00 0.00 ? 3  SER A O    5  
ATOM 4167  C CB   . SER A 1 3  ? -7.118  -9.450  16.454  1.00 0.00 ? 3  SER A CB   5  
ATOM 4168  O OG   . SER A 1 3  ? -6.378  -8.454  15.770  1.00 0.00 ? 3  SER A OG   5  
ATOM 4169  H H    . SER A 1 3  ? -8.974  -10.900 17.541  1.00 0.00 ? 3  SER A H    5  
ATOM 4170  H HA   . SER A 1 3  ? -8.679  -8.073  16.957  1.00 0.00 ? 3  SER A HA   5  
ATOM 4171  H HB2  . SER A 1 3  ? -6.715  -9.562  17.449  1.00 0.00 ? 3  SER A HB2  5  
ATOM 4172  H HB3  . SER A 1 3  ? -7.023  -10.384 15.920  1.00 0.00 ? 3  SER A HB3  5  
ATOM 4173  H HG   . SER A 1 3  ? -5.746  -8.873  15.181  1.00 0.00 ? 3  SER A HG   5  
ATOM 4174  N N    . GLY A 1 4  ? -10.356 -8.395  15.019  1.00 0.00 ? 4  GLY A N    5  
ATOM 4175  C CA   . GLY A 1 4  ? -11.039 -8.339  13.740  1.00 0.00 ? 4  GLY A CA   5  
ATOM 4176  C C    . GLY A 1 4  ? -10.411 -7.338  12.791  1.00 0.00 ? 4  GLY A C    5  
ATOM 4177  O O    . GLY A 1 4  ? -9.931  -6.287  13.215  1.00 0.00 ? 4  GLY A O    5  
ATOM 4178  H H    . GLY A 1 4  ? -10.730 -7.922  15.793  1.00 0.00 ? 4  GLY A H    5  
ATOM 4179  H HA2  . GLY A 1 4  ? -11.009 -9.318  13.285  1.00 0.00 ? 4  GLY A HA2  5  
ATOM 4180  H HA3  . GLY A 1 4  ? -12.070 -8.062  13.907  1.00 0.00 ? 4  GLY A HA3  5  
ATOM 4181  N N    . SER A 1 5  ? -10.413 -7.665  11.502  1.00 0.00 ? 5  SER A N    5  
ATOM 4182  C CA   . SER A 1 5  ? -9.835  -6.788  10.490  1.00 0.00 ? 5  SER A CA   5  
ATOM 4183  C C    . SER A 1 5  ? -10.601 -6.896  9.176   1.00 0.00 ? 5  SER A C    5  
ATOM 4184  O O    . SER A 1 5  ? -10.901 -7.994  8.707   1.00 0.00 ? 5  SER A O    5  
ATOM 4185  C CB   . SER A 1 5  ? -8.362  -7.137  10.266  1.00 0.00 ? 5  SER A CB   5  
ATOM 4186  O OG   . SER A 1 5  ? -7.640  -7.112  11.485  1.00 0.00 ? 5  SER A OG   5  
ATOM 4187  H H    . SER A 1 5  ? -10.812 -8.517  11.226  1.00 0.00 ? 5  SER A H    5  
ATOM 4188  H HA   . SER A 1 5  ? -9.904  -5.773  10.852  1.00 0.00 ? 5  SER A HA   5  
ATOM 4189  H HB2  . SER A 1 5  ? -8.290  -8.125  9.838   1.00 0.00 ? 5  SER A HB2  5  
ATOM 4190  H HB3  . SER A 1 5  ? -7.925  -6.418  9.587   1.00 0.00 ? 5  SER A HB3  5  
ATOM 4191  H HG   . SER A 1 5  ? -6.795  -6.678  11.348  1.00 0.00 ? 5  SER A HG   5  
ATOM 4192  N N    . SER A 1 6  ? -10.915 -5.747  8.585   1.00 0.00 ? 6  SER A N    5  
ATOM 4193  C CA   . SER A 1 6  ? -11.650 -5.711  7.326   1.00 0.00 ? 6  SER A CA   5  
ATOM 4194  C C    . SER A 1 6  ? -10.693 -5.710  6.138   1.00 0.00 ? 6  SER A C    5  
ATOM 4195  O O    . SER A 1 6  ? -10.774 -6.568  5.260   1.00 0.00 ? 6  SER A O    5  
ATOM 4196  C CB   . SER A 1 6  ? -12.549 -4.475  7.272   1.00 0.00 ? 6  SER A CB   5  
ATOM 4197  O OG   . SER A 1 6  ? -13.386 -4.402  8.413   1.00 0.00 ? 6  SER A OG   5  
ATOM 4198  H H    . SER A 1 6  ? -10.648 -4.904  9.008   1.00 0.00 ? 6  SER A H    5  
ATOM 4199  H HA   . SER A 1 6  ? -12.266 -6.597  7.276   1.00 0.00 ? 6  SER A HA   5  
ATOM 4200  H HB2  . SER A 1 6  ? -11.936 -3.588  7.233   1.00 0.00 ? 6  SER A HB2  5  
ATOM 4201  H HB3  . SER A 1 6  ? -13.169 -4.523  6.388   1.00 0.00 ? 6  SER A HB3  5  
ATOM 4202  H HG   . SER A 1 6  ? -12.950 -4.824  9.157   1.00 0.00 ? 6  SER A HG   5  
ATOM 4203  N N    . GLY A 1 7  ? -9.784  -4.739  6.119   1.00 0.00 ? 7  GLY A N    5  
ATOM 4204  C CA   . GLY A 1 7  ? -8.824  -4.643  5.035   1.00 0.00 ? 7  GLY A CA   5  
ATOM 4205  C C    . GLY A 1 7  ? -7.872  -5.822  4.998   1.00 0.00 ? 7  GLY A C    5  
ATOM 4206  O O    . GLY A 1 7  ? -7.610  -6.452  6.024   1.00 0.00 ? 7  GLY A O    5  
ATOM 4207  H H    . GLY A 1 7  ? -9.766  -4.083  6.846   1.00 0.00 ? 7  GLY A H    5  
ATOM 4208  H HA2  . GLY A 1 7  ? -9.359  -4.596  4.098   1.00 0.00 ? 7  GLY A HA2  5  
ATOM 4209  H HA3  . GLY A 1 7  ? -8.250  -3.736  5.157   1.00 0.00 ? 7  GLY A HA3  5  
ATOM 4210  N N    . THR A 1 8  ? -7.352  -6.125  3.812   1.00 0.00 ? 8  THR A N    5  
ATOM 4211  C CA   . THR A 1 8  ? -6.426  -7.238  3.645   1.00 0.00 ? 8  THR A CA   5  
ATOM 4212  C C    . THR A 1 8  ? -5.000  -6.822  3.985   1.00 0.00 ? 8  THR A C    5  
ATOM 4213  O O    . THR A 1 8  ? -4.546  -5.731  3.639   1.00 0.00 ? 8  THR A O    5  
ATOM 4214  C CB   . THR A 1 8  ? -6.460  -7.785  2.205   1.00 0.00 ? 8  THR A CB   5  
ATOM 4215  O OG1  . THR A 1 8  ? -7.766  -8.286  1.902   1.00 0.00 ? 8  THR A OG1  5  
ATOM 4216  C CG2  . THR A 1 8  ? -5.432  -8.891  2.023   1.00 0.00 ? 8  THR A CG2  5  
ATOM 4217  H H    . THR A 1 8  ? -7.599  -5.586  3.032   1.00 0.00 ? 8  THR A H    5  
ATOM 4218  H HA   . THR A 1 8  ? -6.730  -8.028  4.316   1.00 0.00 ? 8  THR A HA   5  
ATOM 4219  H HB   . THR A 1 8  ? -6.224  -6.979  1.525   1.00 0.00 ? 8  THR A HB   5  
ATOM 4220  H HG1  . THR A 1 8  ? -8.427  -7.645  2.177   1.00 0.00 ? 8  THR A HG1  5  
ATOM 4221  H HG21 . THR A 1 8  ? -5.821  -9.814  2.425   1.00 0.00 ? 8  THR A HG21 5  
ATOM 4222  H HG22 . THR A 1 8  ? -4.523  -8.627  2.542   1.00 0.00 ? 8  THR A HG22 5  
ATOM 4223  H HG23 . THR A 1 8  ? -5.222  -9.017  0.972   1.00 0.00 ? 8  THR A HG23 5  
ATOM 4224  N N    . PRO A 1 9  ? -4.273  -7.710  4.680   1.00 0.00 ? 9  PRO A N    5  
ATOM 4225  C CA   . PRO A 1 9  ? -2.886  -7.458  5.081   1.00 0.00 ? 9  PRO A CA   5  
ATOM 4226  C C    . PRO A 1 9  ? -1.930  -7.456  3.893   1.00 0.00 ? 9  PRO A C    5  
ATOM 4227  O O    . PRO A 1 9  ? -2.102  -8.223  2.945   1.00 0.00 ? 9  PRO A O    5  
ATOM 4228  C CB   . PRO A 1 9  ? -2.570  -8.624  6.020   1.00 0.00 ? 9  PRO A CB   5  
ATOM 4229  C CG   . PRO A 1 9  ? -3.495  -9.713  5.596   1.00 0.00 ? 9  PRO A CG   5  
ATOM 4230  C CD   . PRO A 1 9  ? -4.750  -9.030  5.125   1.00 0.00 ? 9  PRO A CD   5  
ATOM 4231  H HA   . PRO A 1 9  ? -2.792  -6.525  5.618   1.00 0.00 ? 9  PRO A HA   5  
ATOM 4232  H HB2  . PRO A 1 9  ? -1.536  -8.915  5.902   1.00 0.00 ? 9  PRO A HB2  5  
ATOM 4233  H HB3  . PRO A 1 9  ? -2.752  -8.328  7.042   1.00 0.00 ? 9  PRO A HB3  5  
ATOM 4234  H HG2  . PRO A 1 9  ? -3.052  -10.279 4.791   1.00 0.00 ? 9  PRO A HG2  5  
ATOM 4235  H HG3  . PRO A 1 9  ? -3.712  -10.357 6.435   1.00 0.00 ? 9  PRO A HG3  5  
ATOM 4236  H HD2  . PRO A 1 9  ? -5.192  -9.578  4.306   1.00 0.00 ? 9  PRO A HD2  5  
ATOM 4237  H HD3  . PRO A 1 9  ? -5.453  -8.931  5.939   1.00 0.00 ? 9  PRO A HD3  5  
ATOM 4238  N N    . TYR A 1 10 ? -0.923  -6.592  3.951   1.00 0.00 ? 10 TYR A N    5  
ATOM 4239  C CA   . TYR A 1 10 ? 0.060   -6.490  2.878   1.00 0.00 ? 10 TYR A CA   5  
ATOM 4240  C C    . TYR A 1 10 ? 1.451   -6.210  3.439   1.00 0.00 ? 10 TYR A C    5  
ATOM 4241  O O    . TYR A 1 10 ? 1.624   -6.043  4.646   1.00 0.00 ? 10 TYR A O    5  
ATOM 4242  C CB   . TYR A 1 10 ? -0.339  -5.387  1.896   1.00 0.00 ? 10 TYR A CB   5  
ATOM 4243  C CG   . TYR A 1 10 ? -1.214  -5.873  0.763   1.00 0.00 ? 10 TYR A CG   5  
ATOM 4244  C CD1  . TYR A 1 10 ? -2.546  -6.204  0.981   1.00 0.00 ? 10 TYR A CD1  5  
ATOM 4245  C CD2  . TYR A 1 10 ? -0.709  -6.002  -0.525  1.00 0.00 ? 10 TYR A CD2  5  
ATOM 4246  C CE1  . TYR A 1 10 ? -3.349  -6.648  -0.052  1.00 0.00 ? 10 TYR A CE1  5  
ATOM 4247  C CE2  . TYR A 1 10 ? -1.505  -6.444  -1.563  1.00 0.00 ? 10 TYR A CE2  5  
ATOM 4248  C CZ   . TYR A 1 10 ? -2.825  -6.766  -1.322  1.00 0.00 ? 10 TYR A CZ   5  
ATOM 4249  O OH   . TYR A 1 10 ? -3.621  -7.209  -2.353  1.00 0.00 ? 10 TYR A OH   5  
ATOM 4250  H H    . TYR A 1 10 ? -0.839  -6.007  4.733   1.00 0.00 ? 10 TYR A H    5  
ATOM 4251  H HA   . TYR A 1 10 ? 0.078   -7.435  2.355   1.00 0.00 ? 10 TYR A HA   5  
ATOM 4252  H HB2  . TYR A 1 10 ? -0.881  -4.620  2.428   1.00 0.00 ? 10 TYR A HB2  5  
ATOM 4253  H HB3  . TYR A 1 10 ? 0.554   -4.958  1.466   1.00 0.00 ? 10 TYR A HB3  5  
ATOM 4254  H HD1  . TYR A 1 10 ? -2.954  -6.110  1.977   1.00 0.00 ? 10 TYR A HD1  5  
ATOM 4255  H HD2  . TYR A 1 10 ? 0.325   -5.749  -0.711  1.00 0.00 ? 10 TYR A HD2  5  
ATOM 4256  H HE1  . TYR A 1 10 ? -4.382  -6.901  0.137   1.00 0.00 ? 10 TYR A HE1  5  
ATOM 4257  H HE2  . TYR A 1 10 ? -1.095  -6.537  -2.558  1.00 0.00 ? 10 TYR A HE2  5  
ATOM 4258  H HH   . TYR A 1 10 ? -4.151  -7.950  -2.052  1.00 0.00 ? 10 TYR A HH   5  
ATOM 4259  N N    . ARG A 1 11 ? 2.439   -6.159  2.552   1.00 0.00 ? 11 ARG A N    5  
ATOM 4260  C CA   . ARG A 1 11 ? 3.816   -5.899  2.957   1.00 0.00 ? 11 ARG A CA   5  
ATOM 4261  C C    . ARG A 1 11 ? 4.552   -5.092  1.891   1.00 0.00 ? 11 ARG A C    5  
ATOM 4262  O O    . ARG A 1 11 ? 4.526   -5.435  0.710   1.00 0.00 ? 11 ARG A O    5  
ATOM 4263  C CB   . ARG A 1 11 ? 4.551   -7.215  3.214   1.00 0.00 ? 11 ARG A CB   5  
ATOM 4264  C CG   . ARG A 1 11 ? 6.056   -7.055  3.351   1.00 0.00 ? 11 ARG A CG   5  
ATOM 4265  C CD   . ARG A 1 11 ? 6.648   -8.116  4.266   1.00 0.00 ? 11 ARG A CD   5  
ATOM 4266  N NE   . ARG A 1 11 ? 8.054   -8.375  3.965   1.00 0.00 ? 11 ARG A NE   5  
ATOM 4267  C CZ   . ARG A 1 11 ? 8.718   -9.435  4.414   1.00 0.00 ? 11 ARG A CZ   5  
ATOM 4268  N NH1  . ARG A 1 11 ? 8.107   -10.329 5.178   1.00 0.00 ? 11 ARG A NH1  5  
ATOM 4269  N NH2  . ARG A 1 11 ? 9.995   -9.602  4.097   1.00 0.00 ? 11 ARG A NH2  5  
ATOM 4270  H H    . ARG A 1 11 ? 2.239   -6.300  1.603   1.00 0.00 ? 11 ARG A H    5  
ATOM 4271  H HA   . ARG A 1 11 ? 3.790   -5.326  3.872   1.00 0.00 ? 11 ARG A HA   5  
ATOM 4272  H HB2  . ARG A 1 11 ? 4.174   -7.653  4.127   1.00 0.00 ? 11 ARG A HB2  5  
ATOM 4273  H HB3  . ARG A 1 11 ? 4.356   -7.889  2.394   1.00 0.00 ? 11 ARG A HB3  5  
ATOM 4274  H HG2  . ARG A 1 11 ? 6.509   -7.145  2.374   1.00 0.00 ? 11 ARG A HG2  5  
ATOM 4275  H HG3  . ARG A 1 11 ? 6.269   -6.079  3.760   1.00 0.00 ? 11 ARG A HG3  5  
ATOM 4276  H HD2  . ARG A 1 11 ? 6.566   -7.778  5.288   1.00 0.00 ? 11 ARG A HD2  5  
ATOM 4277  H HD3  . ARG A 1 11 ? 6.089   -9.031  4.143   1.00 0.00 ? 11 ARG A HD3  5  
ATOM 4278  H HE   . ARG A 1 11 ? 8.525   -7.727  3.402   1.00 0.00 ? 11 ARG A HE   5  
ATOM 4279  H HH11 . ARG A 1 11 ? 7.144   -10.207 5.418   1.00 0.00 ? 11 ARG A HH11 5  
ATOM 4280  H HH12 . ARG A 1 11 ? 8.609   -11.127 5.514   1.00 0.00 ? 11 ARG A HH12 5  
ATOM 4281  H HH21 . ARG A 1 11 ? 10.459  -8.930  3.520   1.00 0.00 ? 11 ARG A HH21 5  
ATOM 4282  H HH22 . ARG A 1 11 ? 10.494  -10.399 4.435   1.00 0.00 ? 11 ARG A HH22 5  
ATOM 4283  N N    . ALA A 1 12 ? 5.209   -4.018  2.318   1.00 0.00 ? 12 ALA A N    5  
ATOM 4284  C CA   . ALA A 1 12 ? 5.953   -3.164  1.402   1.00 0.00 ? 12 ALA A CA   5  
ATOM 4285  C C    . ALA A 1 12 ? 7.267   -3.818  0.986   1.00 0.00 ? 12 ALA A C    5  
ATOM 4286  O O    . ALA A 1 12 ? 8.224   -3.856  1.759   1.00 0.00 ? 12 ALA A O    5  
ATOM 4287  C CB   . ALA A 1 12 ? 6.216   -1.808  2.040   1.00 0.00 ? 12 ALA A CB   5  
ATOM 4288  H H    . ALA A 1 12 ? 5.193   -3.796  3.273   1.00 0.00 ? 12 ALA A H    5  
ATOM 4289  H HA   . ALA A 1 12 ? 5.346   -3.008  0.522   1.00 0.00 ? 12 ALA A HA   5  
ATOM 4290  H HB1  . ALA A 1 12 ? 6.961   -1.278  1.465   1.00 0.00 ? 12 ALA A HB1  5  
ATOM 4291  H HB2  . ALA A 1 12 ? 5.301   -1.236  2.059   1.00 0.00 ? 12 ALA A HB2  5  
ATOM 4292  H HB3  . ALA A 1 12 ? 6.573   -1.948  3.049   1.00 0.00 ? 12 ALA A HB3  5  
ATOM 4293  N N    . MET A 1 13 ? 7.304   -4.332  -0.239  1.00 0.00 ? 13 MET A N    5  
ATOM 4294  C CA   . MET A 1 13 ? 8.501   -4.985  -0.756  1.00 0.00 ? 13 MET A CA   5  
ATOM 4295  C C    . MET A 1 13 ? 9.663   -4.000  -0.844  1.00 0.00 ? 13 MET A C    5  
ATOM 4296  O O    . MET A 1 13 ? 10.828  -4.391  -0.771  1.00 0.00 ? 13 MET A O    5  
ATOM 4297  C CB   . MET A 1 13 ? 8.224   -5.588  -2.135  1.00 0.00 ? 13 MET A CB   5  
ATOM 4298  C CG   . MET A 1 13 ? 7.039   -6.540  -2.155  1.00 0.00 ? 13 MET A CG   5  
ATOM 4299  S SD   . MET A 1 13 ? 7.166   -7.781  -3.456  1.00 0.00 ? 13 MET A SD   5  
ATOM 4300  C CE   . MET A 1 13 ? 6.653   -6.828  -4.884  1.00 0.00 ? 13 MET A CE   5  
ATOM 4301  H H    . MET A 1 13 ? 6.509   -4.272  -0.808  1.00 0.00 ? 13 MET A H    5  
ATOM 4302  H HA   . MET A 1 13 ? 8.768   -5.778  -0.074  1.00 0.00 ? 13 MET A HA   5  
ATOM 4303  H HB2  . MET A 1 13 ? 8.026   -4.787  -2.832  1.00 0.00 ? 13 MET A HB2  5  
ATOM 4304  H HB3  . MET A 1 13 ? 9.099   -6.130  -2.461  1.00 0.00 ? 13 MET A HB3  5  
ATOM 4305  H HG2  . MET A 1 13 ? 6.983   -7.044  -1.201  1.00 0.00 ? 13 MET A HG2  5  
ATOM 4306  H HG3  . MET A 1 13 ? 6.137   -5.966  -2.309  1.00 0.00 ? 13 MET A HG3  5  
ATOM 4307  H HE1  . MET A 1 13 ? 7.300   -5.971  -4.996  1.00 0.00 ? 13 MET A HE1  5  
ATOM 4308  H HE2  . MET A 1 13 ? 6.714   -7.444  -5.768  1.00 0.00 ? 13 MET A HE2  5  
ATOM 4309  H HE3  . MET A 1 13 ? 5.634   -6.495  -4.746  1.00 0.00 ? 13 MET A HE3  5  
ATOM 4310  N N    . TYR A 1 14 ? 9.338   -2.721  -1.000  1.00 0.00 ? 14 TYR A N    5  
ATOM 4311  C CA   . TYR A 1 14 ? 10.354  -1.681  -1.100  1.00 0.00 ? 14 TYR A CA   5  
ATOM 4312  C C    . TYR A 1 14 ? 9.836   -0.358  -0.545  1.00 0.00 ? 14 TYR A C    5  
ATOM 4313  O O    . TYR A 1 14 ? 8.667   -0.015  -0.720  1.00 0.00 ? 14 TYR A O    5  
ATOM 4314  C CB   . TYR A 1 14 ? 10.789  -1.501  -2.556  1.00 0.00 ? 14 TYR A CB   5  
ATOM 4315  C CG   . TYR A 1 14 ? 10.722  -2.774  -3.369  1.00 0.00 ? 14 TYR A CG   5  
ATOM 4316  C CD1  . TYR A 1 14 ? 11.719  -3.737  -3.271  1.00 0.00 ? 14 TYR A CD1  5  
ATOM 4317  C CD2  . TYR A 1 14 ? 9.663   -3.014  -4.236  1.00 0.00 ? 14 TYR A CD2  5  
ATOM 4318  C CE1  . TYR A 1 14 ? 11.663  -4.901  -4.013  1.00 0.00 ? 14 TYR A CE1  5  
ATOM 4319  C CE2  . TYR A 1 14 ? 9.599   -4.176  -4.981  1.00 0.00 ? 14 TYR A CE2  5  
ATOM 4320  C CZ   . TYR A 1 14 ? 10.601  -5.116  -4.866  1.00 0.00 ? 14 TYR A CZ   5  
ATOM 4321  O OH   . TYR A 1 14 ? 10.541  -6.275  -5.606  1.00 0.00 ? 14 TYR A OH   5  
ATOM 4322  H H    . TYR A 1 14 ? 8.392   -2.471  -1.051  1.00 0.00 ? 14 TYR A H    5  
ATOM 4323  H HA   . TYR A 1 14 ? 11.208  -1.994  -0.517  1.00 0.00 ? 14 TYR A HA   5  
ATOM 4324  H HB2  . TYR A 1 14 ? 10.148  -0.773  -3.029  1.00 0.00 ? 14 TYR A HB2  5  
ATOM 4325  H HB3  . TYR A 1 14 ? 11.808  -1.145  -2.579  1.00 0.00 ? 14 TYR A HB3  5  
ATOM 4326  H HD1  . TYR A 1 14 ? 12.550  -3.566  -2.602  1.00 0.00 ? 14 TYR A HD1  5  
ATOM 4327  H HD2  . TYR A 1 14 ? 8.880   -2.275  -4.324  1.00 0.00 ? 14 TYR A HD2  5  
ATOM 4328  H HE1  . TYR A 1 14 ? 12.448  -5.639  -3.923  1.00 0.00 ? 14 TYR A HE1  5  
ATOM 4329  H HE2  . TYR A 1 14 ? 8.767   -4.344  -5.649  1.00 0.00 ? 14 TYR A HE2  5  
ATOM 4330  H HH   . TYR A 1 14 ? 11.244  -6.867  -5.331  1.00 0.00 ? 14 TYR A HH   5  
ATOM 4331  N N    . GLN A 1 15 ? 10.716  0.381   0.124   1.00 0.00 ? 15 GLN A N    5  
ATOM 4332  C CA   . GLN A 1 15 ? 10.348  1.666   0.705   1.00 0.00 ? 15 GLN A CA   5  
ATOM 4333  C C    . GLN A 1 15 ? 9.905   2.646   -0.377  1.00 0.00 ? 15 GLN A C    5  
ATOM 4334  O O    . GLN A 1 15 ? 10.469  2.675   -1.471  1.00 0.00 ? 15 GLN A O    5  
ATOM 4335  C CB   . GLN A 1 15 ? 11.524  2.251   1.488   1.00 0.00 ? 15 GLN A CB   5  
ATOM 4336  C CG   . GLN A 1 15 ? 11.193  3.551   2.204   1.00 0.00 ? 15 GLN A CG   5  
ATOM 4337  C CD   . GLN A 1 15 ? 12.415  4.212   2.809   1.00 0.00 ? 15 GLN A CD   5  
ATOM 4338  O OE1  . GLN A 1 15 ? 12.975  3.727   3.793   1.00 0.00 ? 15 GLN A OE1  5  
ATOM 4339  N NE2  . GLN A 1 15 ? 12.837  5.326   2.222   1.00 0.00 ? 15 GLN A NE2  5  
ATOM 4340  H H    . GLN A 1 15 ? 11.633  0.053   0.229   1.00 0.00 ? 15 GLN A H    5  
ATOM 4341  H HA   . GLN A 1 15 ? 9.524   1.500   1.381   1.00 0.00 ? 15 GLN A HA   5  
ATOM 4342  H HB2  . GLN A 1 15 ? 11.845  1.530   2.225   1.00 0.00 ? 15 GLN A HB2  5  
ATOM 4343  H HB3  . GLN A 1 15 ? 12.339  2.440   0.804   1.00 0.00 ? 15 GLN A HB3  5  
ATOM 4344  H HG2  . GLN A 1 15 ? 10.747  4.233   1.496   1.00 0.00 ? 15 GLN A HG2  5  
ATOM 4345  H HG3  . GLN A 1 15 ? 10.487  3.341   2.994   1.00 0.00 ? 15 GLN A HG3  5  
ATOM 4346  H HE21 . GLN A 1 15 ? 12.341  5.654   1.442   1.00 0.00 ? 15 GLN A HE21 5  
ATOM 4347  H HE22 . GLN A 1 15 ? 13.625  5.775   2.592   1.00 0.00 ? 15 GLN A HE22 5  
ATOM 4348  N N    . TYR A 1 16 ? 8.892   3.446   -0.065  1.00 0.00 ? 16 TYR A N    5  
ATOM 4349  C CA   . TYR A 1 16 ? 8.372   4.426   -1.011  1.00 0.00 ? 16 TYR A CA   5  
ATOM 4350  C C    . TYR A 1 16 ? 8.608   5.847   -0.510  1.00 0.00 ? 16 TYR A C    5  
ATOM 4351  O O    . TYR A 1 16 ? 8.687   6.087   0.695   1.00 0.00 ? 16 TYR A O    5  
ATOM 4352  C CB   . TYR A 1 16 ? 6.877   4.197   -1.244  1.00 0.00 ? 16 TYR A CB   5  
ATOM 4353  C CG   . TYR A 1 16 ? 6.292   5.072   -2.329  1.00 0.00 ? 16 TYR A CG   5  
ATOM 4354  C CD1  . TYR A 1 16 ? 6.638   4.884   -3.662  1.00 0.00 ? 16 TYR A CD1  5  
ATOM 4355  C CD2  . TYR A 1 16 ? 5.393   6.086   -2.022  1.00 0.00 ? 16 TYR A CD2  5  
ATOM 4356  C CE1  . TYR A 1 16 ? 6.107   5.682   -4.657  1.00 0.00 ? 16 TYR A CE1  5  
ATOM 4357  C CE2  . TYR A 1 16 ? 4.855   6.887   -3.011  1.00 0.00 ? 16 TYR A CE2  5  
ATOM 4358  C CZ   . TYR A 1 16 ? 5.216   6.682   -4.326  1.00 0.00 ? 16 TYR A CZ   5  
ATOM 4359  O OH   . TYR A 1 16 ? 4.683   7.478   -5.315  1.00 0.00 ? 16 TYR A OH   5  
ATOM 4360  H H    . TYR A 1 16 ? 8.484   3.376   0.823   1.00 0.00 ? 16 TYR A H    5  
ATOM 4361  H HA   . TYR A 1 16 ? 8.896   4.294   -1.947  1.00 0.00 ? 16 TYR A HA   5  
ATOM 4362  H HB2  . TYR A 1 16 ? 6.717   3.168   -1.526  1.00 0.00 ? 16 TYR A HB2  5  
ATOM 4363  H HB3  . TYR A 1 16 ? 6.342   4.402   -0.328  1.00 0.00 ? 16 TYR A HB3  5  
ATOM 4364  H HD1  . TYR A 1 16 ? 7.336   4.100   -3.917  1.00 0.00 ? 16 TYR A HD1  5  
ATOM 4365  H HD2  . TYR A 1 16 ? 5.112   6.244   -0.991  1.00 0.00 ? 16 TYR A HD2  5  
ATOM 4366  H HE1  . TYR A 1 16 ? 6.389   5.521   -5.687  1.00 0.00 ? 16 TYR A HE1  5  
ATOM 4367  H HE2  . TYR A 1 16 ? 4.158   7.670   -2.753  1.00 0.00 ? 16 TYR A HE2  5  
ATOM 4368  H HH   . TYR A 1 16 ? 3.849   7.846   -5.014  1.00 0.00 ? 16 TYR A HH   5  
ATOM 4369  N N    . ARG A 1 17 ? 8.720   6.786   -1.444  1.00 0.00 ? 17 ARG A N    5  
ATOM 4370  C CA   . ARG A 1 17 ? 8.948   8.184   -1.099  1.00 0.00 ? 17 ARG A CA   5  
ATOM 4371  C C    . ARG A 1 17 ? 7.856   9.074   -1.686  1.00 0.00 ? 17 ARG A C    5  
ATOM 4372  O O    . ARG A 1 17 ? 7.973   9.591   -2.797  1.00 0.00 ? 17 ARG A O    5  
ATOM 4373  C CB   . ARG A 1 17 ? 10.318  8.639   -1.605  1.00 0.00 ? 17 ARG A CB   5  
ATOM 4374  C CG   . ARG A 1 17 ? 11.480  8.099   -0.786  1.00 0.00 ? 17 ARG A CG   5  
ATOM 4375  C CD   . ARG A 1 17 ? 12.749  8.901   -1.023  1.00 0.00 ? 17 ARG A CD   5  
ATOM 4376  N NE   . ARG A 1 17 ? 13.898  8.325   -0.330  1.00 0.00 ? 17 ARG A NE   5  
ATOM 4377  C CZ   . ARG A 1 17 ? 14.043  8.339   0.990   1.00 0.00 ? 17 ARG A CZ   5  
ATOM 4378  N NH1  . ARG A 1 17 ? 13.116  8.897   1.756   1.00 0.00 ? 17 ARG A NH1  5  
ATOM 4379  N NH2  . ARG A 1 17 ? 15.117  7.795   1.547   1.00 0.00 ? 17 ARG A NH2  5  
ATOM 4380  H H    . ARG A 1 17 ? 8.648   6.532   -2.388  1.00 0.00 ? 17 ARG A H    5  
ATOM 4381  H HA   . ARG A 1 17 ? 8.925   8.268   -0.023  1.00 0.00 ? 17 ARG A HA   5  
ATOM 4382  H HB2  . ARG A 1 17 ? 10.441  8.308   -2.625  1.00 0.00 ? 17 ARG A HB2  5  
ATOM 4383  H HB3  . ARG A 1 17 ? 10.358  9.717   -1.578  1.00 0.00 ? 17 ARG A HB3  5  
ATOM 4384  H HG2  . ARG A 1 17 ? 11.224  8.151   0.262   1.00 0.00 ? 17 ARG A HG2  5  
ATOM 4385  H HG3  . ARG A 1 17 ? 11.656  7.071   -1.065  1.00 0.00 ? 17 ARG A HG3  5  
ATOM 4386  H HD2  . ARG A 1 17 ? 12.954  8.922   -2.083  1.00 0.00 ? 17 ARG A HD2  5  
ATOM 4387  H HD3  . ARG A 1 17 ? 12.593  9.909   -0.667  1.00 0.00 ? 17 ARG A HD3  5  
ATOM 4388  H HE   . ARG A 1 17 ? 14.596  7.908   -0.877  1.00 0.00 ? 17 ARG A HE   5  
ATOM 4389  H HH11 . ARG A 1 17 ? 12.305  9.307   1.339   1.00 0.00 ? 17 ARG A HH11 5  
ATOM 4390  H HH12 . ARG A 1 17 ? 13.226  8.905   2.750   1.00 0.00 ? 17 ARG A HH12 5  
ATOM 4391  H HH21 . ARG A 1 17 ? 15.818  7.373   0.973   1.00 0.00 ? 17 ARG A HH21 5  
ATOM 4392  H HH22 . ARG A 1 17 ? 15.225  7.806   2.541   1.00 0.00 ? 17 ARG A HH22 5  
ATOM 4393  N N    . PRO A 1 18 ? 6.768   9.257   -0.923  1.00 0.00 ? 18 PRO A N    5  
ATOM 4394  C CA   . PRO A 1 18 ? 5.634   10.084  -1.347  1.00 0.00 ? 18 PRO A CA   5  
ATOM 4395  C C    . PRO A 1 18 ? 5.981   11.568  -1.381  1.00 0.00 ? 18 PRO A C    5  
ATOM 4396  O O    . PRO A 1 18 ? 6.423   12.134  -0.381  1.00 0.00 ? 18 PRO A O    5  
ATOM 4397  C CB   . PRO A 1 18 ? 4.574   9.806   -0.278  1.00 0.00 ? 18 PRO A CB   5  
ATOM 4398  C CG   . PRO A 1 18 ? 5.349   9.396   0.926   1.00 0.00 ? 18 PRO A CG   5  
ATOM 4399  C CD   . PRO A 1 18 ? 6.561   8.671   0.412   1.00 0.00 ? 18 PRO A CD   5  
ATOM 4400  H HA   . PRO A 1 18 ? 5.261   9.780   -2.314  1.00 0.00 ? 18 PRO A HA   5  
ATOM 4401  H HB2  . PRO A 1 18 ? 4.002   10.704  -0.094  1.00 0.00 ? 18 PRO A HB2  5  
ATOM 4402  H HB3  . PRO A 1 18 ? 3.918   9.017   -0.613  1.00 0.00 ? 18 PRO A HB3  5  
ATOM 4403  H HG2  . PRO A 1 18 ? 5.644   10.269  1.488   1.00 0.00 ? 18 PRO A HG2  5  
ATOM 4404  H HG3  . PRO A 1 18 ? 4.751   8.738   1.540   1.00 0.00 ? 18 PRO A HG3  5  
ATOM 4405  H HD2  . PRO A 1 18 ? 7.412   8.857   1.051   1.00 0.00 ? 18 PRO A HD2  5  
ATOM 4406  H HD3  . PRO A 1 18 ? 6.365   7.611   0.341   1.00 0.00 ? 18 PRO A HD3  5  
ATOM 4407  N N    . GLN A 1 19 ? 5.776   12.193  -2.536  1.00 0.00 ? 19 GLN A N    5  
ATOM 4408  C CA   . GLN A 1 19 ? 6.068   13.612  -2.699  1.00 0.00 ? 19 GLN A CA   5  
ATOM 4409  C C    . GLN A 1 19 ? 5.052   14.466  -1.946  1.00 0.00 ? 19 GLN A C    5  
ATOM 4410  O O    . GLN A 1 19 ? 5.373   15.554  -1.471  1.00 0.00 ? 19 GLN A O    5  
ATOM 4411  C CB   . GLN A 1 19 ? 6.068   13.988  -4.181  1.00 0.00 ? 19 GLN A CB   5  
ATOM 4412  C CG   . GLN A 1 19 ? 4.693   13.924  -4.826  1.00 0.00 ? 19 GLN A CG   5  
ATOM 4413  C CD   . GLN A 1 19 ? 4.739   14.155  -6.323  1.00 0.00 ? 19 GLN A CD   5  
ATOM 4414  O OE1  . GLN A 1 19 ? 5.813   14.222  -6.920  1.00 0.00 ? 19 GLN A OE1  5  
ATOM 4415  N NE2  . GLN A 1 19 ? 3.569   14.279  -6.939  1.00 0.00 ? 19 GLN A NE2  5  
ATOM 4416  H H    . GLN A 1 19 ? 5.422   11.687  -3.296  1.00 0.00 ? 19 GLN A H    5  
ATOM 4417  H HA   . GLN A 1 19 ? 7.049   13.798  -2.289  1.00 0.00 ? 19 GLN A HA   5  
ATOM 4418  H HB2  . GLN A 1 19 ? 6.445   14.994  -4.286  1.00 0.00 ? 19 GLN A HB2  5  
ATOM 4419  H HB3  . GLN A 1 19 ? 6.722   13.311  -4.712  1.00 0.00 ? 19 GLN A HB3  5  
ATOM 4420  H HG2  . GLN A 1 19 ? 4.267   12.949  -4.641  1.00 0.00 ? 19 GLN A HG2  5  
ATOM 4421  H HG3  . GLN A 1 19 ? 4.065   14.680  -4.378  1.00 0.00 ? 19 GLN A HG3  5  
ATOM 4422  H HE21 . GLN A 1 19 ? 2.753   14.216  -6.399  1.00 0.00 ? 19 GLN A HE21 5  
ATOM 4423  H HE22 . GLN A 1 19 ? 3.569   14.430  -7.907  1.00 0.00 ? 19 GLN A HE22 5  
ATOM 4424  N N    . ASN A 1 20 ? 3.826   13.964  -1.842  1.00 0.00 ? 20 ASN A N    5  
ATOM 4425  C CA   . ASN A 1 20 ? 2.763   14.682  -1.148  1.00 0.00 ? 20 ASN A CA   5  
ATOM 4426  C C    . ASN A 1 20 ? 2.139   13.812  -0.061  1.00 0.00 ? 20 ASN A C    5  
ATOM 4427  O O    . ASN A 1 20 ? 2.251   12.587  -0.093  1.00 0.00 ? 20 ASN A O    5  
ATOM 4428  C CB   . ASN A 1 20 ? 1.687   15.127  -2.141  1.00 0.00 ? 20 ASN A CB   5  
ATOM 4429  C CG   . ASN A 1 20 ? 1.367   14.055  -3.165  1.00 0.00 ? 20 ASN A CG   5  
ATOM 4430  O OD1  . ASN A 1 20 ? 1.036   12.923  -2.813  1.00 0.00 ? 20 ASN A OD1  5  
ATOM 4431  N ND2  . ASN A 1 20 ? 1.464   14.409  -4.441  1.00 0.00 ? 20 ASN A ND2  5  
ATOM 4432  H H    . ASN A 1 20 ? 3.631   13.091  -2.242  1.00 0.00 ? 20 ASN A H    5  
ATOM 4433  H HA   . ASN A 1 20 ? 3.199   15.556  -0.688  1.00 0.00 ? 20 ASN A HA   5  
ATOM 4434  H HB2  . ASN A 1 20 ? 0.782   15.362  -1.600  1.00 0.00 ? 20 ASN A HB2  5  
ATOM 4435  H HB3  . ASN A 1 20 ? 2.029   16.008  -2.663  1.00 0.00 ? 20 ASN A HB3  5  
ATOM 4436  H HD21 . ASN A 1 20 ? 1.733   15.329  -4.648  1.00 0.00 ? 20 ASN A HD21 5  
ATOM 4437  H HD22 . ASN A 1 20 ? 1.262   13.736  -5.124  1.00 0.00 ? 20 ASN A HD22 5  
ATOM 4438  N N    . GLU A 1 21 ? 1.482   14.455  0.900   1.00 0.00 ? 21 GLU A N    5  
ATOM 4439  C CA   . GLU A 1 21 ? 0.841   13.739  1.996   1.00 0.00 ? 21 GLU A CA   5  
ATOM 4440  C C    . GLU A 1 21 ? -0.270  12.831  1.478   1.00 0.00 ? 21 GLU A C    5  
ATOM 4441  O O    . GLU A 1 21 ? -0.695  11.900  2.161   1.00 0.00 ? 21 GLU A O    5  
ATOM 4442  C CB   . GLU A 1 21 ? 0.273   14.728  3.017   1.00 0.00 ? 21 GLU A CB   5  
ATOM 4443  C CG   . GLU A 1 21 ? -0.839  15.603  2.462   1.00 0.00 ? 21 GLU A CG   5  
ATOM 4444  C CD   . GLU A 1 21 ? -0.315  16.865  1.805   1.00 0.00 ? 21 GLU A CD   5  
ATOM 4445  O OE1  . GLU A 1 21 ? -0.005  16.821  0.596   1.00 0.00 ? 21 GLU A OE1  5  
ATOM 4446  O OE2  . GLU A 1 21 ? -0.214  17.898  2.500   1.00 0.00 ? 21 GLU A OE2  5  
ATOM 4447  H H    . GLU A 1 21 ? 1.428   15.433  0.870   1.00 0.00 ? 21 GLU A H    5  
ATOM 4448  H HA   . GLU A 1 21 ? 1.591   13.131  2.478   1.00 0.00 ? 21 GLU A HA   5  
ATOM 4449  H HB2  . GLU A 1 21 ? -0.118  14.174  3.857   1.00 0.00 ? 21 GLU A HB2  5  
ATOM 4450  H HB3  . GLU A 1 21 ? 1.070   15.370  3.360   1.00 0.00 ? 21 GLU A HB3  5  
ATOM 4451  H HG2  . GLU A 1 21 ? -1.393  15.037  1.728   1.00 0.00 ? 21 GLU A HG2  5  
ATOM 4452  H HG3  . GLU A 1 21 ? -1.497  15.883  3.271   1.00 0.00 ? 21 GLU A HG3  5  
ATOM 4453  N N    . ASP A 1 22 ? -0.736  13.111  0.266   1.00 0.00 ? 22 ASP A N    5  
ATOM 4454  C CA   . ASP A 1 22 ? -1.798  12.320  -0.346  1.00 0.00 ? 22 ASP A CA   5  
ATOM 4455  C C    . ASP A 1 22 ? -1.407  10.847  -0.415  1.00 0.00 ? 22 ASP A C    5  
ATOM 4456  O O    . ASP A 1 22 ? -2.195  9.969   -0.065  1.00 0.00 ? 22 ASP A O    5  
ATOM 4457  C CB   . ASP A 1 22 ? -2.110  12.844  -1.749  1.00 0.00 ? 22 ASP A CB   5  
ATOM 4458  C CG   . ASP A 1 22 ? -2.793  14.197  -1.722  1.00 0.00 ? 22 ASP A CG   5  
ATOM 4459  O OD1  . ASP A 1 22 ? -3.653  14.410  -0.842  1.00 0.00 ? 22 ASP A OD1  5  
ATOM 4460  O OD2  . ASP A 1 22 ? -2.469  15.043  -2.582  1.00 0.00 ? 22 ASP A OD2  5  
ATOM 4461  H H    . ASP A 1 22 ? -0.357  13.867  -0.230  1.00 0.00 ? 22 ASP A H    5  
ATOM 4462  H HA   . ASP A 1 22 ? -2.680  12.417  0.269   1.00 0.00 ? 22 ASP A HA   5  
ATOM 4463  H HB2  . ASP A 1 22 ? -1.188  12.938  -2.304  1.00 0.00 ? 22 ASP A HB2  5  
ATOM 4464  H HB3  . ASP A 1 22 ? -2.759  12.142  -2.252  1.00 0.00 ? 22 ASP A HB3  5  
ATOM 4465  N N    . GLU A 1 23 ? -0.186  10.585  -0.870  1.00 0.00 ? 23 GLU A N    5  
ATOM 4466  C CA   . GLU A 1 23 ? 0.308   9.217   -0.987  1.00 0.00 ? 23 GLU A CA   5  
ATOM 4467  C C    . GLU A 1 23 ? 0.758   8.684   0.370   1.00 0.00 ? 23 GLU A C    5  
ATOM 4468  O O    . GLU A 1 23 ? 1.151   9.449   1.251   1.00 0.00 ? 23 GLU A O    5  
ATOM 4469  C CB   . GLU A 1 23 ? 1.467   9.154   -1.983  1.00 0.00 ? 23 GLU A CB   5  
ATOM 4470  C CG   . GLU A 1 23 ? 1.120   9.701   -3.357  1.00 0.00 ? 23 GLU A CG   5  
ATOM 4471  C CD   . GLU A 1 23 ? 2.171   9.371   -4.399  1.00 0.00 ? 23 GLU A CD   5  
ATOM 4472  O OE1  . GLU A 1 23 ? 3.370   9.365   -4.050  1.00 0.00 ? 23 GLU A OE1  5  
ATOM 4473  O OE2  . GLU A 1 23 ? 1.795   9.119   -5.563  1.00 0.00 ? 23 GLU A OE2  5  
ATOM 4474  H H    . GLU A 1 23 ? 0.396   11.327  -1.134  1.00 0.00 ? 23 GLU A H    5  
ATOM 4475  H HA   . GLU A 1 23 ? -0.502  8.603   -1.351  1.00 0.00 ? 23 GLU A HA   5  
ATOM 4476  H HB2  . GLU A 1 23 ? 2.296   9.724   -1.590  1.00 0.00 ? 23 GLU A HB2  5  
ATOM 4477  H HB3  . GLU A 1 23 ? 1.772   8.124   -2.096  1.00 0.00 ? 23 GLU A HB3  5  
ATOM 4478  H HG2  . GLU A 1 23 ? 0.178   9.278   -3.672  1.00 0.00 ? 23 GLU A HG2  5  
ATOM 4479  H HG3  . GLU A 1 23 ? 1.026   10.775  -3.290  1.00 0.00 ? 23 GLU A HG3  5  
ATOM 4480  N N    . LEU A 1 24 ? 0.698   7.367   0.530   1.00 0.00 ? 24 LEU A N    5  
ATOM 4481  C CA   . LEU A 1 24 ? 1.099   6.729   1.780   1.00 0.00 ? 24 LEU A CA   5  
ATOM 4482  C C    . LEU A 1 24 ? 2.542   6.240   1.703   1.00 0.00 ? 24 LEU A C    5  
ATOM 4483  O O    . LEU A 1 24 ? 2.905   5.488   0.799   1.00 0.00 ? 24 LEU A O    5  
ATOM 4484  C CB   . LEU A 1 24 ? 0.168   5.558   2.099   1.00 0.00 ? 24 LEU A CB   5  
ATOM 4485  C CG   . LEU A 1 24 ? -0.005  5.224   3.581   1.00 0.00 ? 24 LEU A CG   5  
ATOM 4486  C CD1  . LEU A 1 24 ? -0.586  6.412   4.332   1.00 0.00 ? 24 LEU A CD1  5  
ATOM 4487  C CD2  . LEU A 1 24 ? -0.892  3.998   3.751   1.00 0.00 ? 24 LEU A CD2  5  
ATOM 4488  H H    . LEU A 1 24 ? 0.377   6.809   -0.208  1.00 0.00 ? 24 LEU A H    5  
ATOM 4489  H HA   . LEU A 1 24 ? 1.022   7.465   2.566   1.00 0.00 ? 24 LEU A HA   5  
ATOM 4490  H HB2  . LEU A 1 24 ? -0.805  5.790   1.696   1.00 0.00 ? 24 LEU A HB2  5  
ATOM 4491  H HB3  . LEU A 1 24 ? 0.561   4.680   1.605   1.00 0.00 ? 24 LEU A HB3  5  
ATOM 4492  H HG   . LEU A 1 24 ? 0.962   4.999   4.009   1.00 0.00 ? 24 LEU A HG   5  
ATOM 4493  H HD11 . LEU A 1 24 ? 0.055   6.659   5.165   1.00 0.00 ? 24 LEU A HD11 5  
ATOM 4494  H HD12 . LEU A 1 24 ? -1.571  6.161   4.697   1.00 0.00 ? 24 LEU A HD12 5  
ATOM 4495  H HD13 . LEU A 1 24 ? -0.655  7.260   3.666   1.00 0.00 ? 24 LEU A HD13 5  
ATOM 4496  H HD21 . LEU A 1 24 ? -1.443  3.824   2.839   1.00 0.00 ? 24 LEU A HD21 5  
ATOM 4497  H HD22 . LEU A 1 24 ? -1.584  4.165   4.563   1.00 0.00 ? 24 LEU A HD22 5  
ATOM 4498  H HD23 . LEU A 1 24 ? -0.278  3.138   3.971   1.00 0.00 ? 24 LEU A HD23 5  
ATOM 4499  N N    . GLU A 1 25 ? 3.359   6.672   2.659   1.00 0.00 ? 25 GLU A N    5  
ATOM 4500  C CA   . GLU A 1 25 ? 4.762   6.277   2.699   1.00 0.00 ? 25 GLU A CA   5  
ATOM 4501  C C    . GLU A 1 25 ? 4.906   4.828   3.156   1.00 0.00 ? 25 GLU A C    5  
ATOM 4502  O O    . GLU A 1 25 ? 4.276   4.406   4.127   1.00 0.00 ? 25 GLU A O    5  
ATOM 4503  C CB   . GLU A 1 25 ? 5.548   7.199   3.634   1.00 0.00 ? 25 GLU A CB   5  
ATOM 4504  C CG   . GLU A 1 25 ? 7.049   7.165   3.402   1.00 0.00 ? 25 GLU A CG   5  
ATOM 4505  C CD   . GLU A 1 25 ? 7.791   8.199   4.226   1.00 0.00 ? 25 GLU A CD   5  
ATOM 4506  O OE1  . GLU A 1 25 ? 7.313   9.351   4.300   1.00 0.00 ? 25 GLU A OE1  5  
ATOM 4507  O OE2  . GLU A 1 25 ? 8.848   7.858   4.796   1.00 0.00 ? 25 GLU A OE2  5  
ATOM 4508  H H    . GLU A 1 25 ? 3.011   7.270   3.352   1.00 0.00 ? 25 GLU A H    5  
ATOM 4509  H HA   . GLU A 1 25 ? 5.161   6.368   1.700   1.00 0.00 ? 25 GLU A HA   5  
ATOM 4510  H HB2  . GLU A 1 25 ? 5.205   8.213   3.492   1.00 0.00 ? 25 GLU A HB2  5  
ATOM 4511  H HB3  . GLU A 1 25 ? 5.356   6.904   4.655   1.00 0.00 ? 25 GLU A HB3  5  
ATOM 4512  H HG2  . GLU A 1 25 ? 7.419   6.185   3.665   1.00 0.00 ? 25 GLU A HG2  5  
ATOM 4513  H HG3  . GLU A 1 25 ? 7.243   7.352   2.356   1.00 0.00 ? 25 GLU A HG3  5  
ATOM 4514  N N    . LEU A 1 26 ? 5.739   4.071   2.450   1.00 0.00 ? 26 LEU A N    5  
ATOM 4515  C CA   . LEU A 1 26 ? 5.967   2.669   2.782   1.00 0.00 ? 26 LEU A CA   5  
ATOM 4516  C C    . LEU A 1 26 ? 7.435   2.420   3.114   1.00 0.00 ? 26 LEU A C    5  
ATOM 4517  O O    . LEU A 1 26 ? 8.295   3.256   2.838   1.00 0.00 ? 26 LEU A O    5  
ATOM 4518  C CB   . LEU A 1 26 ? 5.536   1.773   1.620   1.00 0.00 ? 26 LEU A CB   5  
ATOM 4519  C CG   . LEU A 1 26 ? 4.083   1.916   1.166   1.00 0.00 ? 26 LEU A CG   5  
ATOM 4520  C CD1  . LEU A 1 26 ? 3.893   1.309   -0.216  1.00 0.00 ? 26 LEU A CD1  5  
ATOM 4521  C CD2  . LEU A 1 26 ? 3.144   1.264   2.170   1.00 0.00 ? 26 LEU A CD2  5  
ATOM 4522  H H    . LEU A 1 26 ? 6.213   4.464   1.688   1.00 0.00 ? 26 LEU A H    5  
ATOM 4523  H HA   . LEU A 1 26 ? 5.369   2.433   3.649   1.00 0.00 ? 26 LEU A HA   5  
ATOM 4524  H HB2  . LEU A 1 26 ? 6.169   1.999   0.776   1.00 0.00 ? 26 LEU A HB2  5  
ATOM 4525  H HB3  . LEU A 1 26 ? 5.690   0.746   1.920   1.00 0.00 ? 26 LEU A HB3  5  
ATOM 4526  H HG   . LEU A 1 26 ? 3.832   2.966   1.105   1.00 0.00 ? 26 LEU A HG   5  
ATOM 4527  H HD11 . LEU A 1 26 ? 4.626   0.532   -0.371  1.00 0.00 ? 26 LEU A HD11 5  
ATOM 4528  H HD12 . LEU A 1 26 ? 4.017   2.076   -0.966  1.00 0.00 ? 26 LEU A HD12 5  
ATOM 4529  H HD13 . LEU A 1 26 ? 2.900   0.889   -0.291  1.00 0.00 ? 26 LEU A HD13 5  
ATOM 4530  H HD21 . LEU A 1 26 ? 2.490   2.014   2.590   1.00 0.00 ? 26 LEU A HD21 5  
ATOM 4531  H HD22 . LEU A 1 26 ? 3.722   0.808   2.960   1.00 0.00 ? 26 LEU A HD22 5  
ATOM 4532  H HD23 . LEU A 1 26 ? 2.553   0.509   1.673   1.00 0.00 ? 26 LEU A HD23 5  
ATOM 4533  N N    . ARG A 1 27 ? 7.714   1.263   3.706   1.00 0.00 ? 27 ARG A N    5  
ATOM 4534  C CA   . ARG A 1 27 ? 9.077   0.903   4.075   1.00 0.00 ? 27 ARG A CA   5  
ATOM 4535  C C    . ARG A 1 27 ? 9.345   -0.573  3.792   1.00 0.00 ? 27 ARG A C    5  
ATOM 4536  O O    . ARG A 1 27 ? 8.483   -1.423  4.013   1.00 0.00 ? 27 ARG A O    5  
ATOM 4537  C CB   . ARG A 1 27 ? 9.325   1.202   5.554   1.00 0.00 ? 27 ARG A CB   5  
ATOM 4538  C CG   . ARG A 1 27 ? 10.615  0.603   6.090   1.00 0.00 ? 27 ARG A CG   5  
ATOM 4539  C CD   . ARG A 1 27 ? 10.671  0.668   7.608   1.00 0.00 ? 27 ARG A CD   5  
ATOM 4540  N NE   . ARG A 1 27 ? 11.897  0.077   8.136   1.00 0.00 ? 27 ARG A NE   5  
ATOM 4541  C CZ   . ARG A 1 27 ? 13.093  0.646   8.029   1.00 0.00 ? 27 ARG A CZ   5  
ATOM 4542  N NH1  . ARG A 1 27 ? 13.222  1.815   7.417   1.00 0.00 ? 27 ARG A NH1  5  
ATOM 4543  N NH2  . ARG A 1 27 ? 14.163  0.045   8.536   1.00 0.00 ? 27 ARG A NH2  5  
ATOM 4544  H H    . ARG A 1 27 ? 6.985   0.637   3.901   1.00 0.00 ? 27 ARG A H    5  
ATOM 4545  H HA   . ARG A 1 27 ? 9.751   1.499   3.478   1.00 0.00 ? 27 ARG A HA   5  
ATOM 4546  H HB2  . ARG A 1 27 ? 9.367   2.273   5.691   1.00 0.00 ? 27 ARG A HB2  5  
ATOM 4547  H HB3  . ARG A 1 27 ? 8.503   0.807   6.131   1.00 0.00 ? 27 ARG A HB3  5  
ATOM 4548  H HG2  . ARG A 1 27 ? 10.675  -0.431  5.783   1.00 0.00 ? 27 ARG A HG2  5  
ATOM 4549  H HG3  . ARG A 1 27 ? 11.451  1.151   5.683   1.00 0.00 ? 27 ARG A HG3  5  
ATOM 4550  H HD2  . ARG A 1 27 ? 10.622  1.703   7.913   1.00 0.00 ? 27 ARG A HD2  5  
ATOM 4551  H HD3  . ARG A 1 27 ? 9.823   0.134   8.009   1.00 0.00 ? 27 ARG A HD3  5  
ATOM 4552  H HE   . ARG A 1 27 ? 11.825  -0.787  8.593   1.00 0.00 ? 27 ARG A HE   5  
ATOM 4553  H HH11 . ARG A 1 27 ? 12.418  2.270   7.035   1.00 0.00 ? 27 ARG A HH11 5  
ATOM 4554  H HH12 . ARG A 1 27 ? 14.123  2.241   7.338   1.00 0.00 ? 27 ARG A HH12 5  
ATOM 4555  H HH21 . ARG A 1 27 ? 14.069  -0.836  8.998   1.00 0.00 ? 27 ARG A HH21 5  
ATOM 4556  H HH22 . ARG A 1 27 ? 15.062  0.474   8.454   1.00 0.00 ? 27 ARG A HH22 5  
ATOM 4557  N N    . GLU A 1 28 ? 10.545  -0.868  3.301   1.00 0.00 ? 28 GLU A N    5  
ATOM 4558  C CA   . GLU A 1 28 ? 10.925  -2.240  2.987   1.00 0.00 ? 28 GLU A CA   5  
ATOM 4559  C C    . GLU A 1 28 ? 10.798  -3.135  4.217   1.00 0.00 ? 28 GLU A C    5  
ATOM 4560  O O    . GLU A 1 28 ? 11.492  -2.939  5.214   1.00 0.00 ? 28 GLU A O    5  
ATOM 4561  C CB   . GLU A 1 28 ? 12.358  -2.287  2.455   1.00 0.00 ? 28 GLU A CB   5  
ATOM 4562  C CG   . GLU A 1 28 ? 12.749  -3.637  1.876   1.00 0.00 ? 28 GLU A CG   5  
ATOM 4563  C CD   . GLU A 1 28 ? 14.246  -3.778  1.684   1.00 0.00 ? 28 GLU A CD   5  
ATOM 4564  O OE1  . GLU A 1 28 ? 14.875  -2.816  1.195   1.00 0.00 ? 28 GLU A OE1  5  
ATOM 4565  O OE2  . GLU A 1 28 ? 14.790  -4.850  2.023   1.00 0.00 ? 28 GLU A OE2  5  
ATOM 4566  H H    . GLU A 1 28 ? 11.189  -0.146  3.147   1.00 0.00 ? 28 GLU A H    5  
ATOM 4567  H HA   . GLU A 1 28 ? 10.255  -2.603  2.223   1.00 0.00 ? 28 GLU A HA   5  
ATOM 4568  H HB2  . GLU A 1 28 ? 12.467  -1.541  1.681   1.00 0.00 ? 28 GLU A HB2  5  
ATOM 4569  H HB3  . GLU A 1 28 ? 13.037  -2.055  3.262   1.00 0.00 ? 28 GLU A HB3  5  
ATOM 4570  H HG2  . GLU A 1 28 ? 12.413  -4.413  2.547   1.00 0.00 ? 28 GLU A HG2  5  
ATOM 4571  H HG3  . GLU A 1 28 ? 12.265  -3.757  0.918   1.00 0.00 ? 28 GLU A HG3  5  
ATOM 4572  N N    . GLY A 1 29 ? 9.906   -4.117  4.138   1.00 0.00 ? 29 GLY A N    5  
ATOM 4573  C CA   . GLY A 1 29 ? 9.703   -5.027  5.251   1.00 0.00 ? 29 GLY A CA   5  
ATOM 4574  C C    . GLY A 1 29 ? 8.721   -4.486  6.270   1.00 0.00 ? 29 GLY A C    5  
ATOM 4575  O O    . GLY A 1 29 ? 8.924   -4.631  7.476   1.00 0.00 ? 29 GLY A O    5  
ATOM 4576  H H    . GLY A 1 29 ? 9.381   -4.225  3.318   1.00 0.00 ? 29 GLY A H    5  
ATOM 4577  H HA2  . GLY A 1 29 ? 9.331   -5.966  4.870   1.00 0.00 ? 29 GLY A HA2  5  
ATOM 4578  H HA3  . GLY A 1 29 ? 10.652  -5.198  5.738   1.00 0.00 ? 29 GLY A HA3  5  
ATOM 4579  N N    . ASP A 1 30 ? 7.655   -3.858  5.787   1.00 0.00 ? 30 ASP A N    5  
ATOM 4580  C CA   . ASP A 1 30 ? 6.637   -3.293  6.666   1.00 0.00 ? 30 ASP A CA   5  
ATOM 4581  C C    . ASP A 1 30 ? 5.243   -3.746  6.244   1.00 0.00 ? 30 ASP A C    5  
ATOM 4582  O O    . ASP A 1 30 ? 4.958   -3.885  5.055   1.00 0.00 ? 30 ASP A O    5  
ATOM 4583  C CB   . ASP A 1 30 ? 6.716   -1.765  6.655   1.00 0.00 ? 30 ASP A CB   5  
ATOM 4584  C CG   . ASP A 1 30 ? 7.708   -1.229  7.668   1.00 0.00 ? 30 ASP A CG   5  
ATOM 4585  O OD1  . ASP A 1 30 ? 8.772   -1.858  7.847   1.00 0.00 ? 30 ASP A OD1  5  
ATOM 4586  O OD2  . ASP A 1 30 ? 7.420   -0.181  8.282   1.00 0.00 ? 30 ASP A OD2  5  
ATOM 4587  H H    . ASP A 1 30 ? 7.549   -3.774  4.816   1.00 0.00 ? 30 ASP A H    5  
ATOM 4588  H HA   . ASP A 1 30 ? 6.829   -3.647  7.667   1.00 0.00 ? 30 ASP A HA   5  
ATOM 4589  H HB2  . ASP A 1 30 ? 7.019   -1.434  5.672   1.00 0.00 ? 30 ASP A HB2  5  
ATOM 4590  H HB3  . ASP A 1 30 ? 5.741   -1.360  6.882   1.00 0.00 ? 30 ASP A HB3  5  
ATOM 4591  N N    . ARG A 1 31 ? 4.378   -3.975  7.227   1.00 0.00 ? 31 ARG A N    5  
ATOM 4592  C CA   . ARG A 1 31 ? 3.014   -4.414  6.958   1.00 0.00 ? 31 ARG A CA   5  
ATOM 4593  C C    . ARG A 1 31 ? 2.138   -3.239  6.533   1.00 0.00 ? 31 ARG A C    5  
ATOM 4594  O O    . ARG A 1 31 ? 2.301   -2.121  7.020   1.00 0.00 ? 31 ARG A O    5  
ATOM 4595  C CB   . ARG A 1 31 ? 2.419   -5.086  8.197   1.00 0.00 ? 31 ARG A CB   5  
ATOM 4596  C CG   . ARG A 1 31 ? 2.914   -6.506  8.418   1.00 0.00 ? 31 ARG A CG   5  
ATOM 4597  C CD   . ARG A 1 31 ? 2.170   -7.498  7.537   1.00 0.00 ? 31 ARG A CD   5  
ATOM 4598  N NE   . ARG A 1 31 ? 0.971   -8.017  8.188   1.00 0.00 ? 31 ARG A NE   5  
ATOM 4599  C CZ   . ARG A 1 31 ? 0.998   -8.790  9.268   1.00 0.00 ? 31 ARG A CZ   5  
ATOM 4600  N NH1  . ARG A 1 31 ? 2.156   -9.131  9.815   1.00 0.00 ? 31 ARG A NH1  5  
ATOM 4601  N NH2  . ARG A 1 31 ? -0.137  -9.223  9.804   1.00 0.00 ? 31 ARG A NH2  5  
ATOM 4602  H H    . ARG A 1 31 ? 4.664   -3.846  8.156   1.00 0.00 ? 31 ARG A H    5  
ATOM 4603  H HA   . ARG A 1 31 ? 3.050   -5.132  6.153   1.00 0.00 ? 31 ARG A HA   5  
ATOM 4604  H HB2  . ARG A 1 31 ? 2.674   -4.500  9.068   1.00 0.00 ? 31 ARG A HB2  5  
ATOM 4605  H HB3  . ARG A 1 31 ? 1.344   -5.114  8.095   1.00 0.00 ? 31 ARG A HB3  5  
ATOM 4606  H HG2  . ARG A 1 31 ? 3.967   -6.551  8.182   1.00 0.00 ? 31 ARG A HG2  5  
ATOM 4607  H HG3  . ARG A 1 31 ? 2.762   -6.773  9.453   1.00 0.00 ? 31 ARG A HG3  5  
ATOM 4608  H HD2  . ARG A 1 31 ? 1.885   -7.002  6.621   1.00 0.00 ? 31 ARG A HD2  5  
ATOM 4609  H HD3  . ARG A 1 31 ? 2.830   -8.321  7.309   1.00 0.00 ? 31 ARG A HD3  5  
ATOM 4610  H HE   . ARG A 1 31 ? 0.104   -7.777  7.801   1.00 0.00 ? 31 ARG A HE   5  
ATOM 4611  H HH11 . ARG A 1 31 ? 3.012   -8.805  9.414   1.00 0.00 ? 31 ARG A HH11 5  
ATOM 4612  H HH12 . ARG A 1 31 ? 2.173   -9.712  10.629  1.00 0.00 ? 31 ARG A HH12 5  
ATOM 4613  H HH21 . ARG A 1 31 ? -1.012  -8.968  9.395   1.00 0.00 ? 31 ARG A HH21 5  
ATOM 4614  H HH22 . ARG A 1 31 ? -0.116  -9.805  10.616  1.00 0.00 ? 31 ARG A HH22 5  
ATOM 4615  N N    . VAL A 1 32 ? 1.209   -3.502  5.619   1.00 0.00 ? 32 VAL A N    5  
ATOM 4616  C CA   . VAL A 1 32 ? 0.307   -2.467  5.128   1.00 0.00 ? 32 VAL A CA   5  
ATOM 4617  C C    . VAL A 1 32 ? -1.121  -2.990  5.018   1.00 0.00 ? 32 VAL A C    5  
ATOM 4618  O O    . VAL A 1 32 ? -1.353  -4.093  4.524   1.00 0.00 ? 32 VAL A O    5  
ATOM 4619  C CB   . VAL A 1 32 ? 0.755   -1.938  3.752   1.00 0.00 ? 32 VAL A CB   5  
ATOM 4620  C CG1  . VAL A 1 32 ? 0.061   -0.623  3.433   1.00 0.00 ? 32 VAL A CG1  5  
ATOM 4621  C CG2  . VAL A 1 32 ? 2.267   -1.776  3.711   1.00 0.00 ? 32 VAL A CG2  5  
ATOM 4622  H H    . VAL A 1 32 ? 1.127   -4.413  5.268   1.00 0.00 ? 32 VAL A H    5  
ATOM 4623  H HA   . VAL A 1 32 ? 0.327   -1.646  5.830   1.00 0.00 ? 32 VAL A HA   5  
ATOM 4624  H HB   . VAL A 1 32 ? 0.471   -2.661  3.001   1.00 0.00 ? 32 VAL A HB   5  
ATOM 4625  H HG11 . VAL A 1 32 ? -1.009  -0.755  3.503   1.00 0.00 ? 32 VAL A HG11 5  
ATOM 4626  H HG12 . VAL A 1 32 ? 0.378   0.132   4.137   1.00 0.00 ? 32 VAL A HG12 5  
ATOM 4627  H HG13 . VAL A 1 32 ? 0.319   -0.314  2.431   1.00 0.00 ? 32 VAL A HG13 5  
ATOM 4628  H HG21 . VAL A 1 32 ? 2.558   -1.363  2.757   1.00 0.00 ? 32 VAL A HG21 5  
ATOM 4629  H HG22 . VAL A 1 32 ? 2.580   -1.109  4.502   1.00 0.00 ? 32 VAL A HG22 5  
ATOM 4630  H HG23 . VAL A 1 32 ? 2.737   -2.739  3.846   1.00 0.00 ? 32 VAL A HG23 5  
ATOM 4631  N N    . ASP A 1 33 ? -2.075  -2.190  5.483   1.00 0.00 ? 33 ASP A N    5  
ATOM 4632  C CA   . ASP A 1 33 ? -3.482  -2.571  5.436   1.00 0.00 ? 33 ASP A CA   5  
ATOM 4633  C C    . ASP A 1 33 ? -4.149  -2.033  4.173   1.00 0.00 ? 33 ASP A C    5  
ATOM 4634  O O    . ASP A 1 33 ? -4.304  -0.823  4.008   1.00 0.00 ? 33 ASP A O    5  
ATOM 4635  C CB   . ASP A 1 33 ? -4.214  -2.053  6.674   1.00 0.00 ? 33 ASP A CB   5  
ATOM 4636  C CG   . ASP A 1 33 ? -3.531  -2.463  7.964   1.00 0.00 ? 33 ASP A CG   5  
ATOM 4637  O OD1  . ASP A 1 33 ? -3.007  -3.594  8.024   1.00 0.00 ? 33 ASP A OD1  5  
ATOM 4638  O OD2  . ASP A 1 33 ? -3.522  -1.652  8.915   1.00 0.00 ? 33 ASP A OD2  5  
ATOM 4639  H H    . ASP A 1 33 ? -1.827  -1.322  5.865   1.00 0.00 ? 33 ASP A H    5  
ATOM 4640  H HA   . ASP A 1 33 ? -3.533  -3.649  5.423   1.00 0.00 ? 33 ASP A HA   5  
ATOM 4641  H HB2  . ASP A 1 33 ? -4.253  -0.973  6.637   1.00 0.00 ? 33 ASP A HB2  5  
ATOM 4642  H HB3  . ASP A 1 33 ? -5.221  -2.445  6.680   1.00 0.00 ? 33 ASP A HB3  5  
ATOM 4643  N N    . VAL A 1 34 ? -4.540  -2.940  3.284   1.00 0.00 ? 34 VAL A N    5  
ATOM 4644  C CA   . VAL A 1 34 ? -5.190  -2.558  2.036   1.00 0.00 ? 34 VAL A CA   5  
ATOM 4645  C C    . VAL A 1 34 ? -6.682  -2.870  2.076   1.00 0.00 ? 34 VAL A C    5  
ATOM 4646  O O    . VAL A 1 34 ? -7.083  -3.996  2.366   1.00 0.00 ? 34 VAL A O    5  
ATOM 4647  C CB   . VAL A 1 34 ? -4.557  -3.277  0.830   1.00 0.00 ? 34 VAL A CB   5  
ATOM 4648  C CG1  . VAL A 1 34 ? -5.483  -3.213  -0.375  1.00 0.00 ? 34 VAL A CG1  5  
ATOM 4649  C CG2  . VAL A 1 34 ? -3.200  -2.675  0.503   1.00 0.00 ? 34 VAL A CG2  5  
ATOM 4650  H H    . VAL A 1 34 ? -4.389  -3.890  3.472   1.00 0.00 ? 34 VAL A H    5  
ATOM 4651  H HA   . VAL A 1 34 ? -5.058  -1.494  1.904   1.00 0.00 ? 34 VAL A HA   5  
ATOM 4652  H HB   . VAL A 1 34 ? -4.414  -4.316  1.091   1.00 0.00 ? 34 VAL A HB   5  
ATOM 4653  H HG11 . VAL A 1 34 ? -6.261  -3.956  -0.271  1.00 0.00 ? 34 VAL A HG11 5  
ATOM 4654  H HG12 . VAL A 1 34 ? -5.927  -2.231  -0.437  1.00 0.00 ? 34 VAL A HG12 5  
ATOM 4655  H HG13 . VAL A 1 34 ? -4.917  -3.410  -1.274  1.00 0.00 ? 34 VAL A HG13 5  
ATOM 4656  H HG21 . VAL A 1 34 ? -3.306  -1.611  0.352   1.00 0.00 ? 34 VAL A HG21 5  
ATOM 4657  H HG22 . VAL A 1 34 ? -2.518  -2.856  1.322   1.00 0.00 ? 34 VAL A HG22 5  
ATOM 4658  H HG23 . VAL A 1 34 ? -2.811  -3.129  -0.396  1.00 0.00 ? 34 VAL A HG23 5  
ATOM 4659  N N    . MET A 1 35 ? -7.499  -1.864  1.780   1.00 0.00 ? 35 MET A N    5  
ATOM 4660  C CA   . MET A 1 35 ? -8.947  -2.032  1.780   1.00 0.00 ? 35 MET A CA   5  
ATOM 4661  C C    . MET A 1 35 ? -9.504  -1.952  0.362   1.00 0.00 ? 35 MET A C    5  
ATOM 4662  O O    . MET A 1 35 ? -10.211 -2.853  -0.088  1.00 0.00 ? 35 MET A O    5  
ATOM 4663  C CB   . MET A 1 35 ? -9.606  -0.968  2.660   1.00 0.00 ? 35 MET A CB   5  
ATOM 4664  C CG   . MET A 1 35 ? -9.307  -1.134  4.141   1.00 0.00 ? 35 MET A CG   5  
ATOM 4665  S SD   . MET A 1 35 ? -9.970  0.214   5.139   1.00 0.00 ? 35 MET A SD   5  
ATOM 4666  C CE   . MET A 1 35 ? -8.545  0.625   6.142   1.00 0.00 ? 35 MET A CE   5  
ATOM 4667  H H    . MET A 1 35 ? -7.120  -0.989  1.556   1.00 0.00 ? 35 MET A H    5  
ATOM 4668  H HA   . MET A 1 35 ? -9.168  -3.008  2.186   1.00 0.00 ? 35 MET A HA   5  
ATOM 4669  H HB2  . MET A 1 35 ? -9.255  0.005   2.351   1.00 0.00 ? 35 MET A HB2  5  
ATOM 4670  H HB3  . MET A 1 35 ? -10.676 -1.016  2.524   1.00 0.00 ? 35 MET A HB3  5  
ATOM 4671  H HG2  . MET A 1 35 ? -9.742  -2.062  4.481   1.00 0.00 ? 35 MET A HG2  5  
ATOM 4672  H HG3  . MET A 1 35 ? -8.236  -1.170  4.276   1.00 0.00 ? 35 MET A HG3  5  
ATOM 4673  H HE1  . MET A 1 35 ? -8.817  0.589   7.187   1.00 0.00 ? 35 MET A HE1  5  
ATOM 4674  H HE2  . MET A 1 35 ? -7.753  -0.084  5.951   1.00 0.00 ? 35 MET A HE2  5  
ATOM 4675  H HE3  . MET A 1 35 ? -8.205  1.620   5.893   1.00 0.00 ? 35 MET A HE3  5  
ATOM 4676  N N    . GLN A 1 36 ? -9.180  -0.868  -0.335  1.00 0.00 ? 36 GLN A N    5  
ATOM 4677  C CA   . GLN A 1 36 ? -9.649  -0.670  -1.702  1.00 0.00 ? 36 GLN A CA   5  
ATOM 4678  C C    . GLN A 1 36 ? -8.506  -0.830  -2.698  1.00 0.00 ? 36 GLN A C    5  
ATOM 4679  O O    . GLN A 1 36 ? -7.350  -0.551  -2.380  1.00 0.00 ? 36 GLN A O    5  
ATOM 4680  C CB   . GLN A 1 36 ? -10.282 0.714   -1.851  1.00 0.00 ? 36 GLN A CB   5  
ATOM 4681  C CG   . GLN A 1 36 ? -10.921 0.947   -3.211  1.00 0.00 ? 36 GLN A CG   5  
ATOM 4682  C CD   . GLN A 1 36 ? -11.579 2.308   -3.321  1.00 0.00 ? 36 GLN A CD   5  
ATOM 4683  O OE1  . GLN A 1 36 ? -12.771 2.459   -3.047  1.00 0.00 ? 36 GLN A OE1  5  
ATOM 4684  N NE2  . GLN A 1 36 ? -10.806 3.310   -3.723  1.00 0.00 ? 36 GLN A NE2  5  
ATOM 4685  H H    . GLN A 1 36 ? -8.613  -0.185  0.079   1.00 0.00 ? 36 GLN A H    5  
ATOM 4686  H HA   . GLN A 1 36 ? -10.396 -1.422  -1.907  1.00 0.00 ? 36 GLN A HA   5  
ATOM 4687  H HB2  . GLN A 1 36 ? -11.043 0.832   -1.095  1.00 0.00 ? 36 GLN A HB2  5  
ATOM 4688  H HB3  . GLN A 1 36 ? -9.519  1.464   -1.703  1.00 0.00 ? 36 GLN A HB3  5  
ATOM 4689  H HG2  . GLN A 1 36 ? -10.157 0.872   -3.971  1.00 0.00 ? 36 GLN A HG2  5  
ATOM 4690  H HG3  . GLN A 1 36 ? -11.669 0.187   -3.378  1.00 0.00 ? 36 GLN A HG3  5  
ATOM 4691  H HE21 . GLN A 1 36 ? -9.866  3.116   -3.925  1.00 0.00 ? 36 GLN A HE21 5  
ATOM 4692  H HE22 . GLN A 1 36 ? -11.206 4.200   -3.804  1.00 0.00 ? 36 GLN A HE22 5  
ATOM 4693  N N    . GLN A 1 37 ? -8.837  -1.281  -3.904  1.00 0.00 ? 37 GLN A N    5  
ATOM 4694  C CA   . GLN A 1 37 ? -7.836  -1.478  -4.946  1.00 0.00 ? 37 GLN A CA   5  
ATOM 4695  C C    . GLN A 1 37 ? -8.188  -0.680  -6.197  1.00 0.00 ? 37 GLN A C    5  
ATOM 4696  O O    . GLN A 1 37 ? -9.363  -0.466  -6.499  1.00 0.00 ? 37 GLN A O    5  
ATOM 4697  C CB   . GLN A 1 37 ? -7.716  -2.964  -5.292  1.00 0.00 ? 37 GLN A CB   5  
ATOM 4698  C CG   . GLN A 1 37 ? -7.659  -3.869  -4.072  1.00 0.00 ? 37 GLN A CG   5  
ATOM 4699  C CD   . GLN A 1 37 ? -7.068  -5.231  -4.383  1.00 0.00 ? 37 GLN A CD   5  
ATOM 4700  O OE1  . GLN A 1 37 ? -7.217  -5.746  -5.492  1.00 0.00 ? 37 GLN A OE1  5  
ATOM 4701  N NE2  . GLN A 1 37 ? -6.393  -5.821  -3.404  1.00 0.00 ? 37 GLN A NE2  5  
ATOM 4702  H H    . GLN A 1 37 ? -9.775  -1.486  -4.097  1.00 0.00 ? 37 GLN A H    5  
ATOM 4703  H HA   . GLN A 1 37 ? -6.888  -1.129  -4.566  1.00 0.00 ? 37 GLN A HA   5  
ATOM 4704  H HB2  . GLN A 1 37 ? -8.568  -3.252  -5.889  1.00 0.00 ? 37 GLN A HB2  5  
ATOM 4705  H HB3  . GLN A 1 37 ? -6.815  -3.115  -5.868  1.00 0.00 ? 37 GLN A HB3  5  
ATOM 4706  H HG2  . GLN A 1 37 ? -7.051  -3.395  -3.316  1.00 0.00 ? 37 GLN A HG2  5  
ATOM 4707  H HG3  . GLN A 1 37 ? -8.661  -4.006  -3.694  1.00 0.00 ? 37 GLN A HG3  5  
ATOM 4708  H HE21 . GLN A 1 37 ? -6.317  -5.352  -2.547  1.00 0.00 ? 37 GLN A HE21 5  
ATOM 4709  H HE22 . GLN A 1 37 ? -6.002  -6.702  -3.577  1.00 0.00 ? 37 GLN A HE22 5  
ATOM 4710  N N    . CYS A 1 38 ? -7.164  -0.242  -6.921  1.00 0.00 ? 38 CYS A N    5  
ATOM 4711  C CA   . CYS A 1 38 ? -7.366  0.535   -8.139  1.00 0.00 ? 38 CYS A CA   5  
ATOM 4712  C C    . CYS A 1 38 ? -7.209  -0.344  -9.376  1.00 0.00 ? 38 CYS A C    5  
ATOM 4713  O O    . CYS A 1 38 ? -6.706  -1.465  -9.293  1.00 0.00 ? 38 CYS A O    5  
ATOM 4714  C CB   . CYS A 1 38 ? -6.375  1.699   -8.196  1.00 0.00 ? 38 CYS A CB   5  
ATOM 4715  S SG   . CYS A 1 38 ? -6.659  2.972   -6.945  1.00 0.00 ? 38 CYS A SG   5  
ATOM 4716  H H    . CYS A 1 38 ? -6.251  -0.444  -6.629  1.00 0.00 ? 38 CYS A H    5  
ATOM 4717  H HA   . CYS A 1 38 ? -8.370  0.929   -8.117  1.00 0.00 ? 38 CYS A HA   5  
ATOM 4718  H HB2  . CYS A 1 38 ? -5.374  1.317   -8.055  1.00 0.00 ? 38 CYS A HB2  5  
ATOM 4719  H HB3  . CYS A 1 38 ? -6.440  2.169   -9.166  1.00 0.00 ? 38 CYS A HB3  5  
ATOM 4720  H HG   . CYS A 1 38 ? -7.950  2.972   -6.647  1.00 0.00 ? 38 CYS A HG   5  
ATOM 4721  N N    . ASP A 1 39 ? -7.644  0.172   -10.520 1.00 0.00 ? 39 ASP A N    5  
ATOM 4722  C CA   . ASP A 1 39 ? -7.553  -0.566  -11.775 1.00 0.00 ? 39 ASP A CA   5  
ATOM 4723  C C    . ASP A 1 39 ? -6.151  -0.459  -12.367 1.00 0.00 ? 39 ASP A C    5  
ATOM 4724  O O    . ASP A 1 39 ? -5.475  -1.467  -12.574 1.00 0.00 ? 39 ASP A O    5  
ATOM 4725  C CB   . ASP A 1 39 ? -8.584  -0.043  -12.775 1.00 0.00 ? 39 ASP A CB   5  
ATOM 4726  C CG   . ASP A 1 39 ? -9.932  0.220   -12.132 1.00 0.00 ? 39 ASP A CG   5  
ATOM 4727  O OD1  . ASP A 1 39 ? -10.022 1.146   -11.300 1.00 0.00 ? 39 ASP A OD1  5  
ATOM 4728  O OD2  . ASP A 1 39 ? -10.897 -0.501  -12.462 1.00 0.00 ? 39 ASP A OD2  5  
ATOM 4729  H H    . ASP A 1 39 ? -8.035  1.070   -10.521 1.00 0.00 ? 39 ASP A H    5  
ATOM 4730  H HA   . ASP A 1 39 ? -7.762  -1.604  -11.565 1.00 0.00 ? 39 ASP A HA   5  
ATOM 4731  H HB2  . ASP A 1 39 ? -8.225  0.882   -13.203 1.00 0.00 ? 39 ASP A HB2  5  
ATOM 4732  H HB3  . ASP A 1 39 ? -8.716  -0.772  -13.561 1.00 0.00 ? 39 ASP A HB3  5  
ATOM 4733  N N    . ASP A 1 40 ? -5.722  0.768   -12.639 1.00 0.00 ? 40 ASP A N    5  
ATOM 4734  C CA   . ASP A 1 40 ? -4.401  1.008   -13.209 1.00 0.00 ? 40 ASP A CA   5  
ATOM 4735  C C    . ASP A 1 40 ? -3.366  0.071   -12.593 1.00 0.00 ? 40 ASP A C    5  
ATOM 4736  O O    . ASP A 1 40 ? -2.535  -0.501  -13.297 1.00 0.00 ? 40 ASP A O    5  
ATOM 4737  C CB   . ASP A 1 40 ? -3.984  2.463   -12.990 1.00 0.00 ? 40 ASP A CB   5  
ATOM 4738  C CG   . ASP A 1 40 ? -3.585  2.741   -11.554 1.00 0.00 ? 40 ASP A CG   5  
ATOM 4739  O OD1  . ASP A 1 40 ? -4.256  2.219   -10.639 1.00 0.00 ? 40 ASP A OD1  5  
ATOM 4740  O OD2  . ASP A 1 40 ? -2.601  3.481   -11.345 1.00 0.00 ? 40 ASP A OD2  5  
ATOM 4741  H H    . ASP A 1 40 ? -6.307  1.532   -12.452 1.00 0.00 ? 40 ASP A H    5  
ATOM 4742  H HA   . ASP A 1 40 ? -4.457  0.815   -14.269 1.00 0.00 ? 40 ASP A HA   5  
ATOM 4743  H HB2  . ASP A 1 40 ? -3.142  2.689   -13.628 1.00 0.00 ? 40 ASP A HB2  5  
ATOM 4744  H HB3  . ASP A 1 40 ? -4.809  3.110   -13.248 1.00 0.00 ? 40 ASP A HB3  5  
ATOM 4745  N N    . GLY A 1 41 ? -3.423  -0.080  -11.273 1.00 0.00 ? 41 GLY A N    5  
ATOM 4746  C CA   . GLY A 1 41 ? -2.484  -0.947  -10.585 1.00 0.00 ? 41 GLY A CA   5  
ATOM 4747  C C    . GLY A 1 41 ? -1.994  -0.351  -9.280  1.00 0.00 ? 41 GLY A C    5  
ATOM 4748  O O    . GLY A 1 41 ? -0.832  -0.521  -8.911  1.00 0.00 ? 41 GLY A O    5  
ATOM 4749  H H    . GLY A 1 41 ? -4.107  0.401   -10.763 1.00 0.00 ? 41 GLY A H    5  
ATOM 4750  H HA2  . GLY A 1 41 ? -2.968  -1.891  -10.379 1.00 0.00 ? 41 GLY A HA2  5  
ATOM 4751  H HA3  . GLY A 1 41 ? -1.635  -1.122  -11.229 1.00 0.00 ? 41 GLY A HA3  5  
ATOM 4752  N N    . TRP A 1 42 ? -2.880  0.350   -8.582  1.00 0.00 ? 42 TRP A N    5  
ATOM 4753  C CA   . TRP A 1 42 ? -2.529  0.975   -7.312  1.00 0.00 ? 42 TRP A CA   5  
ATOM 4754  C C    . TRP A 1 42 ? -3.411  0.448   -6.185  1.00 0.00 ? 42 TRP A C    5  
ATOM 4755  O O    . TRP A 1 42 ? -4.490  -0.093  -6.428  1.00 0.00 ? 42 TRP A O    5  
ATOM 4756  C CB   . TRP A 1 42 ? -2.665  2.495   -7.413  1.00 0.00 ? 42 TRP A CB   5  
ATOM 4757  C CG   . TRP A 1 42 ? -1.460  3.160   -8.007  1.00 0.00 ? 42 TRP A CG   5  
ATOM 4758  C CD1  . TRP A 1 42 ? -0.920  2.928   -9.240  1.00 0.00 ? 42 TRP A CD1  5  
ATOM 4759  C CD2  . TRP A 1 42 ? -0.646  4.165   -7.393  1.00 0.00 ? 42 TRP A CD2  5  
ATOM 4760  N NE1  . TRP A 1 42 ? 0.181   3.728   -9.429  1.00 0.00 ? 42 TRP A NE1  5  
ATOM 4761  C CE2  . TRP A 1 42 ? 0.370   4.496   -8.311  1.00 0.00 ? 42 TRP A CE2  5  
ATOM 4762  C CE3  . TRP A 1 42 ? -0.677  4.818   -6.158  1.00 0.00 ? 42 TRP A CE3  5  
ATOM 4763  C CZ2  . TRP A 1 42 ? 1.344   5.451   -8.030  1.00 0.00 ? 42 TRP A CZ2  5  
ATOM 4764  C CZ3  . TRP A 1 42 ? 0.291   5.764   -5.880  1.00 0.00 ? 42 TRP A CZ3  5  
ATOM 4765  C CH2  . TRP A 1 42 ? 1.290   6.074   -6.813  1.00 0.00 ? 42 TRP A CH2  5  
ATOM 4766  H H    . TRP A 1 42 ? -3.791  0.450   -8.929  1.00 0.00 ? 42 TRP A H    5  
ATOM 4767  H HA   . TRP A 1 42 ? -1.501  0.728   -7.094  1.00 0.00 ? 42 TRP A HA   5  
ATOM 4768  H HB2  . TRP A 1 42 ? -3.516  2.734   -8.032  1.00 0.00 ? 42 TRP A HB2  5  
ATOM 4769  H HB3  . TRP A 1 42 ? -2.818  2.902   -6.424  1.00 0.00 ? 42 TRP A HB3  5  
ATOM 4770  H HD1  . TRP A 1 42 ? -1.311  2.216   -9.951  1.00 0.00 ? 42 TRP A HD1  5  
ATOM 4771  H HE1  . TRP A 1 42 ? 0.739   3.746   -10.235 1.00 0.00 ? 42 TRP A HE1  5  
ATOM 4772  H HE3  . TRP A 1 42 ? -1.439  4.593   -5.426  1.00 0.00 ? 42 TRP A HE3  5  
ATOM 4773  H HZ2  . TRP A 1 42 ? 2.120   5.701   -8.738  1.00 0.00 ? 42 TRP A HZ2  5  
ATOM 4774  H HZ3  . TRP A 1 42 ? 0.283   6.279   -4.931  1.00 0.00 ? 42 TRP A HZ3  5  
ATOM 4775  H HH2  . TRP A 1 42 ? 2.025   6.820   -6.554  1.00 0.00 ? 42 TRP A HH2  5  
ATOM 4776  N N    . PHE A 1 43 ? -2.945  0.609   -4.951  1.00 0.00 ? 43 PHE A N    5  
ATOM 4777  C CA   . PHE A 1 43 ? -3.691  0.148   -3.785  1.00 0.00 ? 43 PHE A CA   5  
ATOM 4778  C C    . PHE A 1 43 ? -3.992  1.307   -2.839  1.00 0.00 ? 43 PHE A C    5  
ATOM 4779  O O    . PHE A 1 43 ? -3.191  2.230   -2.696  1.00 0.00 ? 43 PHE A O    5  
ATOM 4780  C CB   . PHE A 1 43 ? -2.905  -0.938  -3.047  1.00 0.00 ? 43 PHE A CB   5  
ATOM 4781  C CG   . PHE A 1 43 ? -2.876  -2.254  -3.770  1.00 0.00 ? 43 PHE A CG   5  
ATOM 4782  C CD1  . PHE A 1 43 ? -4.034  -2.786  -4.314  1.00 0.00 ? 43 PHE A CD1  5  
ATOM 4783  C CD2  . PHE A 1 43 ? -1.691  -2.960  -3.904  1.00 0.00 ? 43 PHE A CD2  5  
ATOM 4784  C CE1  . PHE A 1 43 ? -4.011  -3.996  -4.981  1.00 0.00 ? 43 PHE A CE1  5  
ATOM 4785  C CE2  . PHE A 1 43 ? -1.662  -4.171  -4.569  1.00 0.00 ? 43 PHE A CE2  5  
ATOM 4786  C CZ   . PHE A 1 43 ? -2.823  -4.690  -5.107  1.00 0.00 ? 43 PHE A CZ   5  
ATOM 4787  H H    . PHE A 1 43 ? -2.077  1.047   -4.820  1.00 0.00 ? 43 PHE A H    5  
ATOM 4788  H HA   . PHE A 1 43 ? -4.623  -0.269  -4.134  1.00 0.00 ? 43 PHE A HA   5  
ATOM 4789  H HB2  . PHE A 1 43 ? -1.885  -0.608  -2.917  1.00 0.00 ? 43 PHE A HB2  5  
ATOM 4790  H HB3  . PHE A 1 43 ? -3.353  -1.099  -2.078  1.00 0.00 ? 43 PHE A HB3  5  
ATOM 4791  H HD1  . PHE A 1 43 ? -4.964  -2.243  -4.216  1.00 0.00 ? 43 PHE A HD1  5  
ATOM 4792  H HD2  . PHE A 1 43 ? -0.783  -2.555  -3.483  1.00 0.00 ? 43 PHE A HD2  5  
ATOM 4793  H HE1  . PHE A 1 43 ? -4.921  -4.400  -5.400  1.00 0.00 ? 43 PHE A HE1  5  
ATOM 4794  H HE2  . PHE A 1 43 ? -0.732  -4.711  -4.667  1.00 0.00 ? 43 PHE A HE2  5  
ATOM 4795  H HZ   . PHE A 1 43 ? -2.803  -5.636  -5.628  1.00 0.00 ? 43 PHE A HZ   5  
ATOM 4796  N N    . VAL A 1 44 ? -5.154  1.251   -2.196  1.00 0.00 ? 44 VAL A N    5  
ATOM 4797  C CA   . VAL A 1 44 ? -5.562  2.294   -1.263  1.00 0.00 ? 44 VAL A CA   5  
ATOM 4798  C C    . VAL A 1 44 ? -5.927  1.706   0.095   1.00 0.00 ? 44 VAL A C    5  
ATOM 4799  O O    . VAL A 1 44 ? -6.831  0.879   0.202   1.00 0.00 ? 44 VAL A O    5  
ATOM 4800  C CB   . VAL A 1 44 ? -6.764  3.092   -1.804  1.00 0.00 ? 44 VAL A CB   5  
ATOM 4801  C CG1  . VAL A 1 44 ? -7.132  4.217   -0.849  1.00 0.00 ? 44 VAL A CG1  5  
ATOM 4802  C CG2  . VAL A 1 44 ? -6.461  3.637   -3.192  1.00 0.00 ? 44 VAL A CG2  5  
ATOM 4803  H H    . VAL A 1 44 ? -5.751  0.489   -2.352  1.00 0.00 ? 44 VAL A H    5  
ATOM 4804  H HA   . VAL A 1 44 ? -4.732  2.975   -1.139  1.00 0.00 ? 44 VAL A HA   5  
ATOM 4805  H HB   . VAL A 1 44 ? -7.609  2.423   -1.880  1.00 0.00 ? 44 VAL A HB   5  
ATOM 4806  H HG11 . VAL A 1 44 ? -7.988  4.751   -1.235  1.00 0.00 ? 44 VAL A HG11 5  
ATOM 4807  H HG12 . VAL A 1 44 ? -7.371  3.803   0.120   1.00 0.00 ? 44 VAL A HG12 5  
ATOM 4808  H HG13 . VAL A 1 44 ? -6.297  4.896   -0.755  1.00 0.00 ? 44 VAL A HG13 5  
ATOM 4809  H HG21 . VAL A 1 44 ? -5.421  3.464   -3.426  1.00 0.00 ? 44 VAL A HG21 5  
ATOM 4810  H HG22 . VAL A 1 44 ? -7.082  3.135   -3.920  1.00 0.00 ? 44 VAL A HG22 5  
ATOM 4811  H HG23 . VAL A 1 44 ? -6.664  4.697   -3.215  1.00 0.00 ? 44 VAL A HG23 5  
ATOM 4812  N N    . GLY A 1 45 ? -5.215  2.138   1.131   1.00 0.00 ? 45 GLY A N    5  
ATOM 4813  C CA   . GLY A 1 45 ? -5.478  1.643   2.470   1.00 0.00 ? 45 GLY A CA   5  
ATOM 4814  C C    . GLY A 1 45 ? -4.829  2.496   3.542   1.00 0.00 ? 45 GLY A C    5  
ATOM 4815  O O    . GLY A 1 45 ? -4.790  3.722   3.431   1.00 0.00 ? 45 GLY A O    5  
ATOM 4816  H H    . GLY A 1 45 ? -4.505  2.798   0.986   1.00 0.00 ? 45 GLY A H    5  
ATOM 4817  H HA2  . GLY A 1 45 ? -6.546  1.630   2.634   1.00 0.00 ? 45 GLY A HA2  5  
ATOM 4818  H HA3  . GLY A 1 45 ? -5.099  0.635   2.550   1.00 0.00 ? 45 GLY A HA3  5  
ATOM 4819  N N    . VAL A 1 46 ? -4.318  1.847   4.583   1.00 0.00 ? 46 VAL A N    5  
ATOM 4820  C CA   . VAL A 1 46 ? -3.667  2.554   5.680   1.00 0.00 ? 46 VAL A CA   5  
ATOM 4821  C C    . VAL A 1 46 ? -2.295  1.960   5.979   1.00 0.00 ? 46 VAL A C    5  
ATOM 4822  O O    . VAL A 1 46 ? -2.055  0.776   5.744   1.00 0.00 ? 46 VAL A O    5  
ATOM 4823  C CB   . VAL A 1 46 ? -4.522  2.513   6.960   1.00 0.00 ? 46 VAL A CB   5  
ATOM 4824  C CG1  . VAL A 1 46 ? -3.738  3.058   8.144   1.00 0.00 ? 46 VAL A CG1  5  
ATOM 4825  C CG2  . VAL A 1 46 ? -5.814  3.292   6.762   1.00 0.00 ? 46 VAL A CG2  5  
ATOM 4826  H H    . VAL A 1 46 ? -4.379  0.870   4.614   1.00 0.00 ? 46 VAL A H    5  
ATOM 4827  H HA   . VAL A 1 46 ? -3.545  3.586   5.386   1.00 0.00 ? 46 VAL A HA   5  
ATOM 4828  H HB   . VAL A 1 46 ? -4.775  1.484   7.167   1.00 0.00 ? 46 VAL A HB   5  
ATOM 4829  H HG11 . VAL A 1 46 ? -3.148  3.905   7.825   1.00 0.00 ? 46 VAL A HG11 5  
ATOM 4830  H HG12 . VAL A 1 46 ? -4.424  3.367   8.919   1.00 0.00 ? 46 VAL A HG12 5  
ATOM 4831  H HG13 . VAL A 1 46 ? -3.084  2.288   8.527   1.00 0.00 ? 46 VAL A HG13 5  
ATOM 4832  H HG21 . VAL A 1 46 ? -6.486  2.720   6.140   1.00 0.00 ? 46 VAL A HG21 5  
ATOM 4833  H HG22 . VAL A 1 46 ? -6.277  3.472   7.721   1.00 0.00 ? 46 VAL A HG22 5  
ATOM 4834  H HG23 . VAL A 1 46 ? -5.596  4.236   6.285   1.00 0.00 ? 46 VAL A HG23 5  
ATOM 4835  N N    . SER A 1 47 ? -1.398  2.790   6.501   1.00 0.00 ? 47 SER A N    5  
ATOM 4836  C CA   . SER A 1 47 ? -0.048  2.348   6.830   1.00 0.00 ? 47 SER A CA   5  
ATOM 4837  C C    . SER A 1 47 ? -0.004  1.728   8.223   1.00 0.00 ? 47 SER A C    5  
ATOM 4838  O O    . SER A 1 47 ? -0.994  1.746   8.954   1.00 0.00 ? 47 SER A O    5  
ATOM 4839  C CB   . SER A 1 47 ? 0.930   3.522   6.750   1.00 0.00 ? 47 SER A CB   5  
ATOM 4840  O OG   . SER A 1 47 ? 2.258   3.098   7.003   1.00 0.00 ? 47 SER A OG   5  
ATOM 4841  H H    . SER A 1 47 ? -1.649  3.723   6.665   1.00 0.00 ? 47 SER A H    5  
ATOM 4842  H HA   . SER A 1 47 ? 0.242   1.600   6.107   1.00 0.00 ? 47 SER A HA   5  
ATOM 4843  H HB2  . SER A 1 47 ? 0.886   3.957   5.763   1.00 0.00 ? 47 SER A HB2  5  
ATOM 4844  H HB3  . SER A 1 47 ? 0.656   4.266   7.484   1.00 0.00 ? 47 SER A HB3  5  
ATOM 4845  H HG   . SER A 1 47 ? 2.839   3.862   7.029   1.00 0.00 ? 47 SER A HG   5  
ATOM 4846  N N    . ARG A 1 48 ? 1.153   1.181   8.585   1.00 0.00 ? 48 ARG A N    5  
ATOM 4847  C CA   . ARG A 1 48 ? 1.327   0.555   9.889   1.00 0.00 ? 48 ARG A CA   5  
ATOM 4848  C C    . ARG A 1 48 ? 2.317   1.342   10.743  1.00 0.00 ? 48 ARG A C    5  
ATOM 4849  O O    . ARG A 1 48 ? 2.605   0.970   11.880  1.00 0.00 ? 48 ARG A O    5  
ATOM 4850  C CB   . ARG A 1 48 ? 1.811   -0.887  9.726   1.00 0.00 ? 48 ARG A CB   5  
ATOM 4851  C CG   . ARG A 1 48 ? 0.770   -1.814  9.120   1.00 0.00 ? 48 ARG A CG   5  
ATOM 4852  C CD   . ARG A 1 48 ? -0.364  -2.091  10.095  1.00 0.00 ? 48 ARG A CD   5  
ATOM 4853  N NE   . ARG A 1 48 ? 0.081   -2.874  11.245  1.00 0.00 ? 48 ARG A NE   5  
ATOM 4854  C CZ   . ARG A 1 48 ? 0.251   -4.191  11.215  1.00 0.00 ? 48 ARG A CZ   5  
ATOM 4855  N NH1  . ARG A 1 48 ? 0.015   -4.868  10.100  1.00 0.00 ? 48 ARG A NH1  5  
ATOM 4856  N NH2  . ARG A 1 48 ? 0.658   -4.833  12.303  1.00 0.00 ? 48 ARG A NH2  5  
ATOM 4857  H H    . ARG A 1 48 ? 1.906   1.198   7.958   1.00 0.00 ? 48 ARG A H    5  
ATOM 4858  H HA   . ARG A 1 48 ? 0.368   0.549   10.385  1.00 0.00 ? 48 ARG A HA   5  
ATOM 4859  H HB2  . ARG A 1 48 ? 2.681   -0.892  9.086   1.00 0.00 ? 48 ARG A HB2  5  
ATOM 4860  H HB3  . ARG A 1 48 ? 2.085   -1.274  10.696  1.00 0.00 ? 48 ARG A HB3  5  
ATOM 4861  H HG2  . ARG A 1 48 ? 0.363   -1.352  8.233   1.00 0.00 ? 48 ARG A HG2  5  
ATOM 4862  H HG3  . ARG A 1 48 ? 1.243   -2.748  8.858   1.00 0.00 ? 48 ARG A HG3  5  
ATOM 4863  H HD2  . ARG A 1 48 ? -0.758  -1.148  10.444  1.00 0.00 ? 48 ARG A HD2  5  
ATOM 4864  H HD3  . ARG A 1 48 ? -1.140  -2.635  9.578   1.00 0.00 ? 48 ARG A HD3  5  
ATOM 4865  H HE   . ARG A 1 48 ? 0.261   -2.393  12.079  1.00 0.00 ? 48 ARG A HE   5  
ATOM 4866  H HH11 . ARG A 1 48 ? -0.291  -4.387  9.279   1.00 0.00 ? 48 ARG A HH11 5  
ATOM 4867  H HH12 . ARG A 1 48 ? 0.145   -5.860  10.081  1.00 0.00 ? 48 ARG A HH12 5  
ATOM 4868  H HH21 . ARG A 1 48 ? 0.837   -4.325  13.145  1.00 0.00 ? 48 ARG A HH21 5  
ATOM 4869  H HH22 . ARG A 1 48 ? 0.785   -5.824  12.280  1.00 0.00 ? 48 ARG A HH22 5  
ATOM 4870  N N    . ARG A 1 49 ? 2.836   2.431   10.184  1.00 0.00 ? 49 ARG A N    5  
ATOM 4871  C CA   . ARG A 1 49 ? 3.796   3.269   10.893  1.00 0.00 ? 49 ARG A CA   5  
ATOM 4872  C C    . ARG A 1 49 ? 3.225   4.664   11.133  1.00 0.00 ? 49 ARG A C    5  
ATOM 4873  O O    . ARG A 1 49 ? 3.417   5.250   12.199  1.00 0.00 ? 49 ARG A O    5  
ATOM 4874  C CB   . ARG A 1 49 ? 5.100   3.370   10.101  1.00 0.00 ? 49 ARG A CB   5  
ATOM 4875  C CG   . ARG A 1 49 ? 6.168   4.205   10.788  1.00 0.00 ? 49 ARG A CG   5  
ATOM 4876  C CD   . ARG A 1 49 ? 7.566   3.732   10.424  1.00 0.00 ? 49 ARG A CD   5  
ATOM 4877  N NE   . ARG A 1 49 ? 8.601   4.594   10.989  1.00 0.00 ? 49 ARG A NE   5  
ATOM 4878  C CZ   . ARG A 1 49 ? 9.902   4.379   10.834  1.00 0.00 ? 49 ARG A CZ   5  
ATOM 4879  N NH1  . ARG A 1 49 ? 10.326  3.336   10.134  1.00 0.00 ? 49 ARG A NH1  5  
ATOM 4880  N NH2  . ARG A 1 49 ? 10.783  5.209   11.379  1.00 0.00 ? 49 ARG A NH2  5  
ATOM 4881  H H    . ARG A 1 49 ? 2.568   2.676   9.274   1.00 0.00 ? 49 ARG A H    5  
ATOM 4882  H HA   . ARG A 1 49 ? 3.999   2.807   11.847  1.00 0.00 ? 49 ARG A HA   5  
ATOM 4883  H HB2  . ARG A 1 49 ? 5.494   2.375   9.950   1.00 0.00 ? 49 ARG A HB2  5  
ATOM 4884  H HB3  . ARG A 1 49 ? 4.890   3.814   9.140   1.00 0.00 ? 49 ARG A HB3  5  
ATOM 4885  H HG2  . ARG A 1 49 ? 6.058   5.235   10.483  1.00 0.00 ? 49 ARG A HG2  5  
ATOM 4886  H HG3  . ARG A 1 49 ? 6.038   4.128   11.858  1.00 0.00 ? 49 ARG A HG3  5  
ATOM 4887  H HD2  . ARG A 1 49 ? 7.702   2.729   10.800  1.00 0.00 ? 49 ARG A HD2  5  
ATOM 4888  H HD3  . ARG A 1 49 ? 7.661   3.728   9.348   1.00 0.00 ? 49 ARG A HD3  5  
ATOM 4889  H HE   . ARG A 1 49 ? 8.309   5.371   11.510  1.00 0.00 ? 49 ARG A HE   5  
ATOM 4890  H HH11 . ARG A 1 49 ? 9.665   2.709   9.721   1.00 0.00 ? 49 ARG A HH11 5  
ATOM 4891  H HH12 . ARG A 1 49 ? 11.307  3.177   10.018  1.00 0.00 ? 49 ARG A HH12 5  
ATOM 4892  H HH21 . ARG A 1 49 ? 10.467  5.996   11.907  1.00 0.00 ? 49 ARG A HH21 5  
ATOM 4893  H HH22 . ARG A 1 49 ? 11.762  5.046   11.262  1.00 0.00 ? 49 ARG A HH22 5  
ATOM 4894  N N    . THR A 1 50 ? 2.524   5.191   10.135  1.00 0.00 ? 50 THR A N    5  
ATOM 4895  C CA   . THR A 1 50 ? 1.927   6.517   10.236  1.00 0.00 ? 50 THR A CA   5  
ATOM 4896  C C    . THR A 1 50 ? 0.418   6.428   10.427  1.00 0.00 ? 50 THR A C    5  
ATOM 4897  O O    . THR A 1 50 ? -0.255  7.442   10.607  1.00 0.00 ? 50 THR A O    5  
ATOM 4898  C CB   . THR A 1 50 ? 2.226   7.365   8.985   1.00 0.00 ? 50 THR A CB   5  
ATOM 4899  O OG1  . THR A 1 50 ? 1.861   6.642   7.805   1.00 0.00 ? 50 THR A OG1  5  
ATOM 4900  C CG2  . THR A 1 50 ? 3.700   7.736   8.923   1.00 0.00 ? 50 THR A CG2  5  
ATOM 4901  H H    . THR A 1 50 ? 2.406   4.675   9.310   1.00 0.00 ? 50 THR A H    5  
ATOM 4902  H HA   . THR A 1 50 ? 2.360   7.013   11.093  1.00 0.00 ? 50 THR A HA   5  
ATOM 4903  H HB   . THR A 1 50 ? 1.643   8.273   9.037   1.00 0.00 ? 50 THR A HB   5  
ATOM 4904  H HG1  . THR A 1 50 ? 1.354   7.213   7.223   1.00 0.00 ? 50 THR A HG1  5  
ATOM 4905  H HG21 . THR A 1 50 ? 3.908   8.228   7.984   1.00 0.00 ? 50 THR A HG21 5  
ATOM 4906  H HG22 . THR A 1 50 ? 4.300   6.842   9.003   1.00 0.00 ? 50 THR A HG22 5  
ATOM 4907  H HG23 . THR A 1 50 ? 3.938   8.403   9.738   1.00 0.00 ? 50 THR A HG23 5  
ATOM 4908  N N    . GLN A 1 51 ? -0.108  5.208   10.385  1.00 0.00 ? 51 GLN A N    5  
ATOM 4909  C CA   . GLN A 1 51 ? -1.540  4.987   10.554  1.00 0.00 ? 51 GLN A CA   5  
ATOM 4910  C C    . GLN A 1 51 ? -2.345  6.014   9.764   1.00 0.00 ? 51 GLN A C    5  
ATOM 4911  O O    . GLN A 1 51 ? -3.409  6.454   10.200  1.00 0.00 ? 51 GLN A O    5  
ATOM 4912  C CB   . GLN A 1 51 ? -1.917  5.055   12.034  1.00 0.00 ? 51 GLN A CB   5  
ATOM 4913  C CG   . GLN A 1 51 ? -1.533  6.367   12.701  1.00 0.00 ? 51 GLN A CG   5  
ATOM 4914  C CD   . GLN A 1 51 ? -1.994  6.446   14.142  1.00 0.00 ? 51 GLN A CD   5  
ATOM 4915  O OE1  . GLN A 1 51 ? -1.534  5.686   14.996  1.00 0.00 ? 51 GLN A OE1  5  
ATOM 4916  N NE2  . GLN A 1 51 ? -2.907  7.368   14.422  1.00 0.00 ? 51 GLN A NE2  5  
ATOM 4917  H H    . GLN A 1 51 ? 0.480   4.439   10.238  1.00 0.00 ? 51 GLN A H    5  
ATOM 4918  H HA   . GLN A 1 51 ? -1.770  4.002   10.178  1.00 0.00 ? 51 GLN A HA   5  
ATOM 4919  H HB2  . GLN A 1 51 ? -2.985  4.928   12.128  1.00 0.00 ? 51 GLN A HB2  5  
ATOM 4920  H HB3  . GLN A 1 51 ? -1.420  4.252   12.557  1.00 0.00 ? 51 GLN A HB3  5  
ATOM 4921  H HG2  . GLN A 1 51 ? -0.458  6.466   12.677  1.00 0.00 ? 51 GLN A HG2  5  
ATOM 4922  H HG3  . GLN A 1 51 ? -1.980  7.180   12.149  1.00 0.00 ? 51 GLN A HG3  5  
ATOM 4923  H HE21 . GLN A 1 51 ? -3.229  7.937   13.691  1.00 0.00 ? 51 GLN A HE21 5  
ATOM 4924  H HE22 . GLN A 1 51 ? -3.224  7.441   15.346  1.00 0.00 ? 51 GLN A HE22 5  
ATOM 4925  N N    . LYS A 1 52 ? -1.831  6.392   8.598   1.00 0.00 ? 52 LYS A N    5  
ATOM 4926  C CA   . LYS A 1 52 ? -2.502  7.366   7.746   1.00 0.00 ? 52 LYS A CA   5  
ATOM 4927  C C    . LYS A 1 52 ? -3.232  6.674   6.599   1.00 0.00 ? 52 LYS A C    5  
ATOM 4928  O O    . LYS A 1 52 ? -2.979  5.506   6.304   1.00 0.00 ? 52 LYS A O    5  
ATOM 4929  C CB   . LYS A 1 52 ? -1.489  8.369   7.188   1.00 0.00 ? 52 LYS A CB   5  
ATOM 4930  C CG   . LYS A 1 52 ? -1.031  9.400   8.205   1.00 0.00 ? 52 LYS A CG   5  
ATOM 4931  C CD   . LYS A 1 52 ? -0.580  10.686  7.531   1.00 0.00 ? 52 LYS A CD   5  
ATOM 4932  C CE   . LYS A 1 52 ? -0.007  11.671  8.538   1.00 0.00 ? 52 LYS A CE   5  
ATOM 4933  N NZ   . LYS A 1 52 ? 0.868   12.684  7.886   1.00 0.00 ? 52 LYS A NZ   5  
ATOM 4934  H H    . LYS A 1 52 ? -0.979  6.005   8.304   1.00 0.00 ? 52 LYS A H    5  
ATOM 4935  H HA   . LYS A 1 52 ? -3.224  7.894   8.350   1.00 0.00 ? 52 LYS A HA   5  
ATOM 4936  H HB2  . LYS A 1 52 ? -0.622  7.830   6.838   1.00 0.00 ? 52 LYS A HB2  5  
ATOM 4937  H HB3  . LYS A 1 52 ? -1.939  8.891   6.355   1.00 0.00 ? 52 LYS A HB3  5  
ATOM 4938  H HG2  . LYS A 1 52 ? -1.851  9.625   8.871   1.00 0.00 ? 52 LYS A HG2  5  
ATOM 4939  H HG3  . LYS A 1 52 ? -0.206  8.992   8.771   1.00 0.00 ? 52 LYS A HG3  5  
ATOM 4940  H HD2  . LYS A 1 52 ? 0.180   10.452  6.801   1.00 0.00 ? 52 LYS A HD2  5  
ATOM 4941  H HD3  . LYS A 1 52 ? -1.428  11.140  7.039   1.00 0.00 ? 52 LYS A HD3  5  
ATOM 4942  H HE2  . LYS A 1 52 ? -0.822  12.176  9.032   1.00 0.00 ? 52 LYS A HE2  5  
ATOM 4943  H HE3  . LYS A 1 52 ? 0.572   11.124  9.268   1.00 0.00 ? 52 LYS A HE3  5  
ATOM 4944  H HZ1  . LYS A 1 52 ? 0.368   13.128  7.089   1.00 0.00 ? 52 LYS A HZ1  5  
ATOM 4945  H HZ2  . LYS A 1 52 ? 1.734   12.232  7.528   1.00 0.00 ? 52 LYS A HZ2  5  
ATOM 4946  H HZ3  . LYS A 1 52 ? 1.132   13.422  8.570   1.00 0.00 ? 52 LYS A HZ3  5  
ATOM 4947  N N    . PHE A 1 53 ? -4.138  7.403   5.955   1.00 0.00 ? 53 PHE A N    5  
ATOM 4948  C CA   . PHE A 1 53 ? -4.905  6.859   4.841   1.00 0.00 ? 53 PHE A CA   5  
ATOM 4949  C C    . PHE A 1 53 ? -4.585  7.602   3.547   1.00 0.00 ? 53 PHE A C    5  
ATOM 4950  O O    . PHE A 1 53 ? -4.654  8.829   3.489   1.00 0.00 ? 53 PHE A O    5  
ATOM 4951  C CB   . PHE A 1 53 ? -6.404  6.946   5.135   1.00 0.00 ? 53 PHE A CB   5  
ATOM 4952  C CG   . PHE A 1 53 ? -7.260  6.307   4.078   1.00 0.00 ? 53 PHE A CG   5  
ATOM 4953  C CD1  . PHE A 1 53 ? -7.377  4.929   4.003   1.00 0.00 ? 53 PHE A CD1  5  
ATOM 4954  C CD2  . PHE A 1 53 ? -7.946  7.085   3.160   1.00 0.00 ? 53 PHE A CD2  5  
ATOM 4955  C CE1  . PHE A 1 53 ? -8.164  4.338   3.032   1.00 0.00 ? 53 PHE A CE1  5  
ATOM 4956  C CE2  . PHE A 1 53 ? -8.735  6.500   2.188   1.00 0.00 ? 53 PHE A CE2  5  
ATOM 4957  C CZ   . PHE A 1 53 ? -8.843  5.125   2.123   1.00 0.00 ? 53 PHE A CZ   5  
ATOM 4958  H H    . PHE A 1 53 ? -4.295  8.329   6.238   1.00 0.00 ? 53 PHE A H    5  
ATOM 4959  H HA   . PHE A 1 53 ? -4.629  5.822   4.724   1.00 0.00 ? 53 PHE A HA   5  
ATOM 4960  H HB2  . PHE A 1 53 ? -6.609  6.450   6.071   1.00 0.00 ? 53 PHE A HB2  5  
ATOM 4961  H HB3  . PHE A 1 53 ? -6.689  7.984   5.212   1.00 0.00 ? 53 PHE A HB3  5  
ATOM 4962  H HD1  . PHE A 1 53 ? -6.846  4.312   4.714   1.00 0.00 ? 53 PHE A HD1  5  
ATOM 4963  H HD2  . PHE A 1 53 ? -7.862  8.161   3.209   1.00 0.00 ? 53 PHE A HD2  5  
ATOM 4964  H HE1  . PHE A 1 53 ? -8.247  3.262   2.985   1.00 0.00 ? 53 PHE A HE1  5  
ATOM 4965  H HE2  . PHE A 1 53 ? -9.265  7.118   1.478   1.00 0.00 ? 53 PHE A HE2  5  
ATOM 4966  H HZ   . PHE A 1 53 ? -9.459  4.665   1.364   1.00 0.00 ? 53 PHE A HZ   5  
ATOM 4967  N N    . GLY A 1 54 ? -4.234  6.848   2.509   1.00 0.00 ? 54 GLY A N    5  
ATOM 4968  C CA   . GLY A 1 54 ? -3.908  7.451   1.230   1.00 0.00 ? 54 GLY A CA   5  
ATOM 4969  C C    . GLY A 1 54 ? -3.815  6.430   0.114   1.00 0.00 ? 54 GLY A C    5  
ATOM 4970  O O    . GLY A 1 54 ? -4.367  5.334   0.217   1.00 0.00 ? 54 GLY A O    5  
ATOM 4971  H H    . GLY A 1 54 ? -4.196  5.874   2.613   1.00 0.00 ? 54 GLY A H    5  
ATOM 4972  H HA2  . GLY A 1 54 ? -4.671  8.174   0.981   1.00 0.00 ? 54 GLY A HA2  5  
ATOM 4973  H HA3  . GLY A 1 54 ? -2.959  7.960   1.317   1.00 0.00 ? 54 GLY A HA3  5  
ATOM 4974  N N    . THR A 1 55 ? -3.116  6.789   -0.958  1.00 0.00 ? 55 THR A N    5  
ATOM 4975  C CA   . THR A 1 55 ? -2.955  5.897   -2.099  1.00 0.00 ? 55 THR A CA   5  
ATOM 4976  C C    . THR A 1 55 ? -1.482  5.696   -2.437  1.00 0.00 ? 55 THR A C    5  
ATOM 4977  O O    . THR A 1 55 ? -0.701  6.648   -2.443  1.00 0.00 ? 55 THR A O    5  
ATOM 4978  C CB   . THR A 1 55 ? -3.686  6.438   -3.342  1.00 0.00 ? 55 THR A CB   5  
ATOM 4979  O OG1  . THR A 1 55 ? -3.347  5.652   -4.490  1.00 0.00 ? 55 THR A OG1  5  
ATOM 4980  C CG2  . THR A 1 55 ? -3.322  7.894   -3.593  1.00 0.00 ? 55 THR A CG2  5  
ATOM 4981  H H    . THR A 1 55 ? -2.699  7.675   -0.980  1.00 0.00 ? 55 THR A H    5  
ATOM 4982  H HA   . THR A 1 55 ? -3.388  4.942   -1.840  1.00 0.00 ? 55 THR A HA   5  
ATOM 4983  H HB   . THR A 1 55 ? -4.751  6.372   -3.172  1.00 0.00 ? 55 THR A HB   5  
ATOM 4984  H HG1  . THR A 1 55 ? -3.148  4.753   -4.216  1.00 0.00 ? 55 THR A HG1  5  
ATOM 4985  H HG21 . THR A 1 55 ? -3.905  8.527   -2.940  1.00 0.00 ? 55 THR A HG21 5  
ATOM 4986  H HG22 . THR A 1 55 ? -3.532  8.145   -4.622  1.00 0.00 ? 55 THR A HG22 5  
ATOM 4987  H HG23 . THR A 1 55 ? -2.272  8.041   -3.393  1.00 0.00 ? 55 THR A HG23 5  
ATOM 4988  N N    . PHE A 1 56 ? -1.108  4.452   -2.718  1.00 0.00 ? 56 PHE A N    5  
ATOM 4989  C CA   . PHE A 1 56 ? 0.272   4.127   -3.056  1.00 0.00 ? 56 PHE A CA   5  
ATOM 4990  C C    . PHE A 1 56 ? 0.328   3.056   -4.143  1.00 0.00 ? 56 PHE A C    5  
ATOM 4991  O O    . PHE A 1 56 ? -0.609  2.282   -4.335  1.00 0.00 ? 56 PHE A O    5  
ATOM 4992  C CB   . PHE A 1 56 ? 1.025   3.647   -1.813  1.00 0.00 ? 56 PHE A CB   5  
ATOM 4993  C CG   . PHE A 1 56 ? 0.231   2.701   -0.959  1.00 0.00 ? 56 PHE A CG   5  
ATOM 4994  C CD1  . PHE A 1 56 ? -0.743  3.176   -0.097  1.00 0.00 ? 56 PHE A CD1  5  
ATOM 4995  C CD2  . PHE A 1 56 ? 0.460   1.335   -1.019  1.00 0.00 ? 56 PHE A CD2  5  
ATOM 4996  C CE1  . PHE A 1 56 ? -1.476  2.308   0.690   1.00 0.00 ? 56 PHE A CE1  5  
ATOM 4997  C CE2  . PHE A 1 56 ? -0.270  0.462   -0.235  1.00 0.00 ? 56 PHE A CE2  5  
ATOM 4998  C CZ   . PHE A 1 56 ? -1.238  0.949   0.622   1.00 0.00 ? 56 PHE A CZ   5  
ATOM 4999  H H    . PHE A 1 56 ? -1.777  3.736   -2.696  1.00 0.00 ? 56 PHE A H    5  
ATOM 5000  H HA   . PHE A 1 56 ? 0.742   5.024   -3.428  1.00 0.00 ? 56 PHE A HA   5  
ATOM 5001  H HB2  . PHE A 1 56 ? 1.927   3.139   -2.121  1.00 0.00 ? 56 PHE A HB2  5  
ATOM 5002  H HB3  . PHE A 1 56 ? 1.287   4.502   -1.208  1.00 0.00 ? 56 PHE A HB3  5  
ATOM 5003  H HD1  . PHE A 1 56 ? -0.930  4.240   -0.042  1.00 0.00 ? 56 PHE A HD1  5  
ATOM 5004  H HD2  . PHE A 1 56 ? 1.217   0.953   -1.687  1.00 0.00 ? 56 PHE A HD2  5  
ATOM 5005  H HE1  . PHE A 1 56 ? -2.232  2.692   1.359   1.00 0.00 ? 56 PHE A HE1  5  
ATOM 5006  H HE2  . PHE A 1 56 ? -0.082  -0.600  -0.290  1.00 0.00 ? 56 PHE A HE2  5  
ATOM 5007  H HZ   . PHE A 1 56 ? -1.810  0.269   1.235   1.00 0.00 ? 56 PHE A HZ   5  
ATOM 5008  N N    . PRO A 1 57 ? 1.453   3.012   -4.871  1.00 0.00 ? 57 PRO A N    5  
ATOM 5009  C CA   . PRO A 1 57 ? 1.660   2.042   -5.951  1.00 0.00 ? 57 PRO A CA   5  
ATOM 5010  C C    . PRO A 1 57 ? 1.825   0.619   -5.428  1.00 0.00 ? 57 PRO A C    5  
ATOM 5011  O O    . PRO A 1 57 ? 2.830   0.292   -4.797  1.00 0.00 ? 57 PRO A O    5  
ATOM 5012  C CB   . PRO A 1 57 ? 2.952   2.521   -6.616  1.00 0.00 ? 57 PRO A CB   5  
ATOM 5013  C CG   . PRO A 1 57 ? 3.674   3.266   -5.548  1.00 0.00 ? 57 PRO A CG   5  
ATOM 5014  C CD   . PRO A 1 57 ? 2.611   3.905   -4.697  1.00 0.00 ? 57 PRO A CD   5  
ATOM 5015  H HA   . PRO A 1 57 ? 0.852   2.069   -6.668  1.00 0.00 ? 57 PRO A HA   5  
ATOM 5016  H HB2  . PRO A 1 57 ? 3.521   1.668   -6.958  1.00 0.00 ? 57 PRO A HB2  5  
ATOM 5017  H HB3  . PRO A 1 57 ? 2.715   3.161   -7.453  1.00 0.00 ? 57 PRO A HB3  5  
ATOM 5018  H HG2  . PRO A 1 57 ? 4.266   2.583   -4.959  1.00 0.00 ? 57 PRO A HG2  5  
ATOM 5019  H HG3  . PRO A 1 57 ? 4.304   4.024   -5.991  1.00 0.00 ? 57 PRO A HG3  5  
ATOM 5020  H HD2  . PRO A 1 57 ? 2.923   3.935   -3.664  1.00 0.00 ? 57 PRO A HD2  5  
ATOM 5021  H HD3  . PRO A 1 57 ? 2.388   4.899   -5.055  1.00 0.00 ? 57 PRO A HD3  5  
ATOM 5022  N N    . GLY A 1 58 ? 0.833   -0.225  -5.695  1.00 0.00 ? 58 GLY A N    5  
ATOM 5023  C CA   . GLY A 1 58 ? 0.889   -1.603  -5.244  1.00 0.00 ? 58 GLY A CA   5  
ATOM 5024  C C    . GLY A 1 58 ? 2.147   -2.313  -5.704  1.00 0.00 ? 58 GLY A C    5  
ATOM 5025  O O    . GLY A 1 58 ? 2.509   -3.359  -5.168  1.00 0.00 ? 58 GLY A O    5  
ATOM 5026  H H    . GLY A 1 58 ? 0.056   0.092   -6.202  1.00 0.00 ? 58 GLY A H    5  
ATOM 5027  H HA2  . GLY A 1 58 ? 0.854   -1.619  -4.165  1.00 0.00 ? 58 GLY A HA2  5  
ATOM 5028  H HA3  . GLY A 1 58 ? 0.030   -2.131  -5.630  1.00 0.00 ? 58 GLY A HA3  5  
ATOM 5029  N N    . ASN A 1 59 ? 2.814   -1.743  -6.702  1.00 0.00 ? 59 ASN A N    5  
ATOM 5030  C CA   . ASN A 1 59 ? 4.038   -2.329  -7.237  1.00 0.00 ? 59 ASN A CA   5  
ATOM 5031  C C    . ASN A 1 59 ? 5.128   -2.379  -6.170  1.00 0.00 ? 59 ASN A C    5  
ATOM 5032  O O    . ASN A 1 59 ? 6.125   -3.086  -6.319  1.00 0.00 ? 59 ASN A O    5  
ATOM 5033  C CB   . ASN A 1 59 ? 4.527   -1.528  -8.445  1.00 0.00 ? 59 ASN A CB   5  
ATOM 5034  C CG   . ASN A 1 59 ? 3.409   -1.210  -9.419  1.00 0.00 ? 59 ASN A CG   5  
ATOM 5035  O OD1  . ASN A 1 59 ? 3.081   -2.017  -10.289 1.00 0.00 ? 59 ASN A OD1  5  
ATOM 5036  N ND2  . ASN A 1 59 ? 2.819   -0.030  -9.276  1.00 0.00 ? 59 ASN A ND2  5  
ATOM 5037  H H    . ASN A 1 59 ? 2.476   -0.909  -7.089  1.00 0.00 ? 59 ASN A H    5  
ATOM 5038  H HA   . ASN A 1 59 ? 3.813   -3.337  -7.552  1.00 0.00 ? 59 ASN A HA   5  
ATOM 5039  H HB2  . ASN A 1 59 ? 4.955   -0.597  -8.102  1.00 0.00 ? 59 ASN A HB2  5  
ATOM 5040  H HB3  . ASN A 1 59 ? 5.283   -2.097  -8.965  1.00 0.00 ? 59 ASN A HB3  5  
ATOM 5041  H HD21 . ASN A 1 59 ? 3.133   0.562   -8.561  1.00 0.00 ? 59 ASN A HD21 5  
ATOM 5042  H HD22 . ASN A 1 59 ? 2.092   0.201   -9.892  1.00 0.00 ? 59 ASN A HD22 5  
ATOM 5043  N N    . TYR A 1 60 ? 4.930   -1.625  -5.095  1.00 0.00 ? 60 TYR A N    5  
ATOM 5044  C CA   . TYR A 1 60 ? 5.897   -1.582  -4.004  1.00 0.00 ? 60 TYR A CA   5  
ATOM 5045  C C    . TYR A 1 60 ? 5.502   -2.545  -2.888  1.00 0.00 ? 60 TYR A C    5  
ATOM 5046  O O    . TYR A 1 60 ? 6.352   -3.029  -2.140  1.00 0.00 ? 60 TYR A O    5  
ATOM 5047  C CB   . TYR A 1 60 ? 6.008   -0.160  -3.450  1.00 0.00 ? 60 TYR A CB   5  
ATOM 5048  C CG   . TYR A 1 60 ? 6.933   0.730   -4.249  1.00 0.00 ? 60 TYR A CG   5  
ATOM 5049  C CD1  . TYR A 1 60 ? 6.564   1.199   -5.504  1.00 0.00 ? 60 TYR A CD1  5  
ATOM 5050  C CD2  . TYR A 1 60 ? 8.175   1.101   -3.750  1.00 0.00 ? 60 TYR A CD2  5  
ATOM 5051  C CE1  . TYR A 1 60 ? 7.405   2.012   -6.238  1.00 0.00 ? 60 TYR A CE1  5  
ATOM 5052  C CE2  . TYR A 1 60 ? 9.022   1.915   -4.477  1.00 0.00 ? 60 TYR A CE2  5  
ATOM 5053  C CZ   . TYR A 1 60 ? 8.633   2.368   -5.720  1.00 0.00 ? 60 TYR A CZ   5  
ATOM 5054  O OH   . TYR A 1 60 ? 9.475   3.178   -6.447  1.00 0.00 ? 60 TYR A OH   5  
ATOM 5055  H H    . TYR A 1 60 ? 4.116   -1.084  -5.033  1.00 0.00 ? 60 TYR A H    5  
ATOM 5056  H HA   . TYR A 1 60 ? 6.857   -1.880  -4.399  1.00 0.00 ? 60 TYR A HA   5  
ATOM 5057  H HB2  . TYR A 1 60 ? 5.030   0.295   -3.447  1.00 0.00 ? 60 TYR A HB2  5  
ATOM 5058  H HB3  . TYR A 1 60 ? 6.383   -0.204  -2.437  1.00 0.00 ? 60 TYR A HB3  5  
ATOM 5059  H HD1  . TYR A 1 60 ? 5.601   0.919   -5.907  1.00 0.00 ? 60 TYR A HD1  5  
ATOM 5060  H HD2  . TYR A 1 60 ? 8.477   0.745   -2.776  1.00 0.00 ? 60 TYR A HD2  5  
ATOM 5061  H HE1  . TYR A 1 60 ? 7.101   2.367   -7.212  1.00 0.00 ? 60 TYR A HE1  5  
ATOM 5062  H HE2  . TYR A 1 60 ? 9.984   2.194   -4.071  1.00 0.00 ? 60 TYR A HE2  5  
ATOM 5063  H HH   . TYR A 1 60 ? 10.135  2.638   -6.889  1.00 0.00 ? 60 TYR A HH   5  
ATOM 5064  N N    . VAL A 1 61 ? 4.206   -2.819  -2.782  1.00 0.00 ? 61 VAL A N    5  
ATOM 5065  C CA   . VAL A 1 61 ? 3.697   -3.725  -1.760  1.00 0.00 ? 61 VAL A CA   5  
ATOM 5066  C C    . VAL A 1 61 ? 3.213   -5.033  -2.376  1.00 0.00 ? 61 VAL A C    5  
ATOM 5067  O O    . VAL A 1 61 ? 3.131   -5.162  -3.597  1.00 0.00 ? 61 VAL A O    5  
ATOM 5068  C CB   . VAL A 1 61 ? 2.541   -3.085  -0.967  1.00 0.00 ? 61 VAL A CB   5  
ATOM 5069  C CG1  . VAL A 1 61 ? 2.949   -1.719  -0.437  1.00 0.00 ? 61 VAL A CG1  5  
ATOM 5070  C CG2  . VAL A 1 61 ? 1.296   -2.980  -1.834  1.00 0.00 ? 61 VAL A CG2  5  
ATOM 5071  H H    . VAL A 1 61 ? 3.577   -2.402  -3.407  1.00 0.00 ? 61 VAL A H    5  
ATOM 5072  H HA   . VAL A 1 61 ? 4.502   -3.939  -1.072  1.00 0.00 ? 61 VAL A HA   5  
ATOM 5073  H HB   . VAL A 1 61 ? 2.315   -3.721  -0.124  1.00 0.00 ? 61 VAL A HB   5  
ATOM 5074  H HG11 . VAL A 1 61 ? 3.584   -1.844  0.428   1.00 0.00 ? 61 VAL A HG11 5  
ATOM 5075  H HG12 . VAL A 1 61 ? 3.486   -1.180  -1.204  1.00 0.00 ? 61 VAL A HG12 5  
ATOM 5076  H HG13 . VAL A 1 61 ? 2.066   -1.164  -0.157  1.00 0.00 ? 61 VAL A HG13 5  
ATOM 5077  H HG21 . VAL A 1 61 ? 0.462   -3.434  -1.321  1.00 0.00 ? 61 VAL A HG21 5  
ATOM 5078  H HG22 . VAL A 1 61 ? 1.077   -1.939  -2.026  1.00 0.00 ? 61 VAL A HG22 5  
ATOM 5079  H HG23 . VAL A 1 61 ? 1.464   -3.490  -2.771  1.00 0.00 ? 61 VAL A HG23 5  
ATOM 5080  N N    . ALA A 1 62 ? 2.894   -6.000  -1.523  1.00 0.00 ? 62 ALA A N    5  
ATOM 5081  C CA   . ALA A 1 62 ? 2.416   -7.298  -1.983  1.00 0.00 ? 62 ALA A CA   5  
ATOM 5082  C C    . ALA A 1 62 ? 1.536   -7.964  -0.931  1.00 0.00 ? 62 ALA A C    5  
ATOM 5083  O O    . ALA A 1 62 ? 1.669   -7.721  0.269   1.00 0.00 ? 62 ALA A O    5  
ATOM 5084  C CB   . ALA A 1 62 ? 3.590   -8.198  -2.337  1.00 0.00 ? 62 ALA A CB   5  
ATOM 5085  H H    . ALA A 1 62 ? 2.981   -5.837  -0.561  1.00 0.00 ? 62 ALA A H    5  
ATOM 5086  H HA   . ALA A 1 62 ? 1.832   -7.140  -2.879  1.00 0.00 ? 62 ALA A HA   5  
ATOM 5087  H HB1  . ALA A 1 62 ? 3.526   -8.480  -3.378  1.00 0.00 ? 62 ALA A HB1  5  
ATOM 5088  H HB2  . ALA A 1 62 ? 4.515   -7.668  -2.165  1.00 0.00 ? 62 ALA A HB2  5  
ATOM 5089  H HB3  . ALA A 1 62 ? 3.563   -9.085  -1.722  1.00 0.00 ? 62 ALA A HB3  5  
ATOM 5090  N N    . PRO A 1 63 ? 0.613   -8.823  -1.388  1.00 0.00 ? 63 PRO A N    5  
ATOM 5091  C CA   . PRO A 1 63 ? -0.308  -9.541  -0.502  1.00 0.00 ? 63 PRO A CA   5  
ATOM 5092  C C    . PRO A 1 63 ? 0.402   -10.598 0.339   1.00 0.00 ? 63 PRO A C    5  
ATOM 5093  O O    . PRO A 1 63 ? 0.691   -11.694 -0.140  1.00 0.00 ? 63 PRO A O    5  
ATOM 5094  C CB   . PRO A 1 63 ? -1.291  -10.201 -1.471  1.00 0.00 ? 63 PRO A CB   5  
ATOM 5095  C CG   . PRO A 1 63 ? -0.531  -10.342 -2.745  1.00 0.00 ? 63 PRO A CG   5  
ATOM 5096  C CD   . PRO A 1 63 ? 0.397   -9.161  -2.805  1.00 0.00 ? 63 PRO A CD   5  
ATOM 5097  H HA   . PRO A 1 63 ? -0.841  -8.864  0.149   1.00 0.00 ? 63 PRO A HA   5  
ATOM 5098  H HB2  . PRO A 1 63 ? -1.594  -11.163 -1.082  1.00 0.00 ? 63 PRO A HB2  5  
ATOM 5099  H HB3  . PRO A 1 63 ? -2.158  -9.569  -1.597  1.00 0.00 ? 63 PRO A HB3  5  
ATOM 5100  H HG2  . PRO A 1 63 ? 0.033   -11.262 -2.736  1.00 0.00 ? 63 PRO A HG2  5  
ATOM 5101  H HG3  . PRO A 1 63 ? -1.213  -10.325 -3.582  1.00 0.00 ? 63 PRO A HG3  5  
ATOM 5102  H HD2  . PRO A 1 63 ? 1.327   -9.435  -3.282  1.00 0.00 ? 63 PRO A HD2  5  
ATOM 5103  H HD3  . PRO A 1 63 ? -0.069  -8.340  -3.329  1.00 0.00 ? 63 PRO A HD3  5  
ATOM 5104  N N    . VAL A 1 64 ? 0.679   -10.261 1.594   1.00 0.00 ? 64 VAL A N    5  
ATOM 5105  C CA   . VAL A 1 64 ? 1.353   -11.181 2.502   1.00 0.00 ? 64 VAL A CA   5  
ATOM 5106  C C    . VAL A 1 64 ? 0.490   -12.406 2.784   1.00 0.00 ? 64 VAL A C    5  
ATOM 5107  O O    . VAL A 1 64 ? 1.003   -13.510 2.966   1.00 0.00 ? 64 VAL A O    5  
ATOM 5108  C CB   . VAL A 1 64 ? 1.706   -10.496 3.836   1.00 0.00 ? 64 VAL A CB   5  
ATOM 5109  C CG1  . VAL A 1 64 ? 0.576   -9.581  4.281   1.00 0.00 ? 64 VAL A CG1  5  
ATOM 5110  C CG2  . VAL A 1 64 ? 2.013   -11.536 4.903   1.00 0.00 ? 64 VAL A CG2  5  
ATOM 5111  H H    . VAL A 1 64 ? 0.423   -9.372  1.918   1.00 0.00 ? 64 VAL A H    5  
ATOM 5112  H HA   . VAL A 1 64 ? 2.272   -11.500 2.031   1.00 0.00 ? 64 VAL A HA   5  
ATOM 5113  H HB   . VAL A 1 64 ? 2.589   -9.894  3.685   1.00 0.00 ? 64 VAL A HB   5  
ATOM 5114  H HG11 . VAL A 1 64 ? -0.326  -9.835  3.744   1.00 0.00 ? 64 VAL A HG11 5  
ATOM 5115  H HG12 . VAL A 1 64 ? 0.410   -9.702  5.342   1.00 0.00 ? 64 VAL A HG12 5  
ATOM 5116  H HG13 . VAL A 1 64 ? 0.841   -8.555  4.073   1.00 0.00 ? 64 VAL A HG13 5  
ATOM 5117  H HG21 . VAL A 1 64 ? 1.144   -12.159 5.058   1.00 0.00 ? 64 VAL A HG21 5  
ATOM 5118  H HG22 . VAL A 1 64 ? 2.842   -12.149 4.581   1.00 0.00 ? 64 VAL A HG22 5  
ATOM 5119  H HG23 . VAL A 1 64 ? 2.270   -11.040 5.826   1.00 0.00 ? 64 VAL A HG23 5  
ATOM 5120  N N    . SER A 1 65 ? -0.823  -12.202 2.818   1.00 0.00 ? 65 SER A N    5  
ATOM 5121  C CA   . SER A 1 65 ? -1.758  -13.290 3.082   1.00 0.00 ? 65 SER A CA   5  
ATOM 5122  C C    . SER A 1 65 ? -1.338  -14.558 2.344   1.00 0.00 ? 65 SER A C    5  
ATOM 5123  O O    . SER A 1 65 ? -1.521  -15.668 2.841   1.00 0.00 ? 65 SER A O    5  
ATOM 5124  C CB   . SER A 1 65 ? -3.173  -12.886 2.662   1.00 0.00 ? 65 SER A CB   5  
ATOM 5125  O OG   . SER A 1 65 ? -3.864  -12.265 3.731   1.00 0.00 ? 65 SER A OG   5  
ATOM 5126  H H    . SER A 1 65 ? -1.170  -11.299 2.665   1.00 0.00 ? 65 SER A H    5  
ATOM 5127  H HA   . SER A 1 65 ? -1.749  -13.485 4.143   1.00 0.00 ? 65 SER A HA   5  
ATOM 5128  H HB2  . SER A 1 65 ? -3.117  -12.195 1.835   1.00 0.00 ? 65 SER A HB2  5  
ATOM 5129  H HB3  . SER A 1 65 ? -3.720  -13.767 2.358   1.00 0.00 ? 65 SER A HB3  5  
ATOM 5130  H HG   . SER A 1 65 ? -3.815  -12.822 4.511   1.00 0.00 ? 65 SER A HG   5  
ATOM 5131  N N    . GLY A 1 66 ? -0.774  -14.383 1.153   1.00 0.00 ? 66 GLY A N    5  
ATOM 5132  C CA   . GLY A 1 66 ? -0.337  -15.520 0.365   1.00 0.00 ? 66 GLY A CA   5  
ATOM 5133  C C    . GLY A 1 66 ? -1.256  -15.801 -0.807  1.00 0.00 ? 66 GLY A C    5  
ATOM 5134  O O    . GLY A 1 66 ? -2.240  -15.097 -1.035  1.00 0.00 ? 66 GLY A O    5  
ATOM 5135  H H    . GLY A 1 66 ? -0.653  -13.474 0.806   1.00 0.00 ? 66 GLY A H    5  
ATOM 5136  H HA2  . GLY A 1 66 ? 0.657   -15.325 -0.009  1.00 0.00 ? 66 GLY A HA2  5  
ATOM 5137  H HA3  . GLY A 1 66 ? -0.307  -16.393 1.000   1.00 0.00 ? 66 GLY A HA3  5  
ATOM 5138  N N    . PRO A 1 67 ? -0.935  -16.852 -1.577  1.00 0.00 ? 67 PRO A N    5  
ATOM 5139  C CA   . PRO A 1 67 ? -1.726  -17.247 -2.746  1.00 0.00 ? 67 PRO A CA   5  
ATOM 5140  C C    . PRO A 1 67 ? -3.086  -17.820 -2.360  1.00 0.00 ? 67 PRO A C    5  
ATOM 5141  O O    . PRO A 1 67 ? -3.288  -18.249 -1.224  1.00 0.00 ? 67 PRO A O    5  
ATOM 5142  C CB   . PRO A 1 67 ? -0.863  -18.321 -3.413  1.00 0.00 ? 67 PRO A CB   5  
ATOM 5143  C CG   . PRO A 1 67 ? -0.032  -18.878 -2.308  1.00 0.00 ? 67 PRO A CG   5  
ATOM 5144  C CD   . PRO A 1 67 ? 0.224   -17.735 -1.366  1.00 0.00 ? 67 PRO A CD   5  
ATOM 5145  H HA   . PRO A 1 67 ? -1.866  -16.421 -3.428  1.00 0.00 ? 67 PRO A HA   5  
ATOM 5146  H HB2  . PRO A 1 67 ? -1.499  -19.078 -3.850  1.00 0.00 ? 67 PRO A HB2  5  
ATOM 5147  H HB3  . PRO A 1 67 ? -0.250  -17.871 -4.179  1.00 0.00 ? 67 PRO A HB3  5  
ATOM 5148  H HG2  . PRO A 1 67 ? -0.572  -19.666 -1.804  1.00 0.00 ? 67 PRO A HG2  5  
ATOM 5149  H HG3  . PRO A 1 67 ? 0.900   -19.253 -2.704  1.00 0.00 ? 67 PRO A HG3  5  
ATOM 5150  H HD2  . PRO A 1 67 ? 0.259   -18.087 -0.345  1.00 0.00 ? 67 PRO A HD2  5  
ATOM 5151  H HD3  . PRO A 1 67 ? 1.144   -17.231 -1.624  1.00 0.00 ? 67 PRO A HD3  5  
ATOM 5152  N N    . SER A 1 68 ? -4.013  -17.825 -3.312  1.00 0.00 ? 68 SER A N    5  
ATOM 5153  C CA   . SER A 1 68 ? -5.355  -18.343 -3.069  1.00 0.00 ? 68 SER A CA   5  
ATOM 5154  C C    . SER A 1 68 ? -5.758  -19.336 -4.155  1.00 0.00 ? 68 SER A C    5  
ATOM 5155  O O    . SER A 1 68 ? -6.299  -20.403 -3.865  1.00 0.00 ? 68 SER A O    5  
ATOM 5156  C CB   . SER A 1 68 ? -6.365  -17.195 -3.012  1.00 0.00 ? 68 SER A CB   5  
ATOM 5157  O OG   . SER A 1 68 ? -6.065  -16.304 -1.951  1.00 0.00 ? 68 SER A OG   5  
ATOM 5158  H H    . SER A 1 68 ? -3.791  -17.469 -4.198  1.00 0.00 ? 68 SER A H    5  
ATOM 5159  H HA   . SER A 1 68 ? -5.346  -18.851 -2.117  1.00 0.00 ? 68 SER A HA   5  
ATOM 5160  H HB2  . SER A 1 68 ? -6.338  -16.649 -3.942  1.00 0.00 ? 68 SER A HB2  5  
ATOM 5161  H HB3  . SER A 1 68 ? -7.355  -17.598 -2.859  1.00 0.00 ? 68 SER A HB3  5  
ATOM 5162  H HG   . SER A 1 68 ? -6.643  -16.487 -1.206  1.00 0.00 ? 68 SER A HG   5  
ATOM 5163  N N    . SER A 1 69 ? -5.490  -18.977 -5.406  1.00 0.00 ? 69 SER A N    5  
ATOM 5164  C CA   . SER A 1 69 ? -5.827  -19.834 -6.536  1.00 0.00 ? 69 SER A CA   5  
ATOM 5165  C C    . SER A 1 69 ? -4.784  -19.710 -7.643  1.00 0.00 ? 69 SER A C    5  
ATOM 5166  O O    . SER A 1 69 ? -4.106  -18.690 -7.760  1.00 0.00 ? 69 SER A O    5  
ATOM 5167  C CB   . SER A 1 69 ? -7.211  -19.474 -7.081  1.00 0.00 ? 69 SER A CB   5  
ATOM 5168  O OG   . SER A 1 69 ? -7.273  -18.107 -7.451  1.00 0.00 ? 69 SER A OG   5  
ATOM 5169  H H    . SER A 1 69 ? -5.057  -18.113 -5.573  1.00 0.00 ? 69 SER A H    5  
ATOM 5170  H HA   . SER A 1 69 ? -5.843  -20.855 -6.185  1.00 0.00 ? 69 SER A HA   5  
ATOM 5171  H HB2  . SER A 1 69 ? -7.422  -20.079 -7.950  1.00 0.00 ? 69 SER A HB2  5  
ATOM 5172  H HB3  . SER A 1 69 ? -7.955  -19.663 -6.321  1.00 0.00 ? 69 SER A HB3  5  
ATOM 5173  H HG   . SER A 1 69 ? -6.511  -17.886 -7.991  1.00 0.00 ? 69 SER A HG   5  
ATOM 5174  N N    . GLY A 1 70 ? -4.662  -20.757 -8.453  1.00 0.00 ? 70 GLY A N    5  
ATOM 5175  C CA   . GLY A 1 70 ? -3.700  -20.747 -9.540  1.00 0.00 ? 70 GLY A CA   5  
ATOM 5176  C C    . GLY A 1 70 ? -2.805  -21.969 -9.533  1.00 0.00 ? 70 GLY A C    5  
ATOM 5177  O O    . GLY A 1 70 ? -3.064  -22.933 -8.812  1.00 0.00 ? 70 GLY A O    5  
ATOM 5178  H H    . GLY A 1 70 ? -5.230  -21.544 -8.312  1.00 0.00 ? 70 GLY A H    5  
ATOM 5179  H HA2  . GLY A 1 70 ? -4.234  -20.709 -10.478 1.00 0.00 ? 70 GLY A HA2  5  
ATOM 5180  H HA3  . GLY A 1 70 ? -3.085  -19.863 -9.451  1.00 0.00 ? 70 GLY A HA3  5  
ATOM 5181  N N    . GLY A 1 1  ? -18.327 -12.186 14.699  1.00 0.00 ? 1  GLY A N    6  
ATOM 5182  C CA   . GLY A 1 1  ? -19.206 -11.054 14.928  1.00 0.00 ? 1  GLY A CA   6  
ATOM 5183  C C    . GLY A 1 1  ? -19.488 -10.273 13.660  1.00 0.00 ? 1  GLY A C    6  
ATOM 5184  O O    . GLY A 1 1  ? -19.557 -10.846 12.572  1.00 0.00 ? 1  GLY A O    6  
ATOM 5185  H H1   . GLY A 1 1  ? -17.569 -12.099 14.084  1.00 0.00 ? 1  GLY A H1   6  
ATOM 5186  H HA2  . GLY A 1 1  ? -20.140 -11.413 15.332  1.00 0.00 ? 1  GLY A HA2  6  
ATOM 5187  H HA3  . GLY A 1 1  ? -18.744 -10.394 15.648  1.00 0.00 ? 1  GLY A HA3  6  
ATOM 5188  N N    . SER A 1 2  ? -19.653 -8.962  13.798  1.00 0.00 ? 2  SER A N    6  
ATOM 5189  C CA   . SER A 1 2  ? -19.935 -8.102  12.655  1.00 0.00 ? 2  SER A CA   6  
ATOM 5190  C C    . SER A 1 2  ? -18.735 -7.215  12.333  1.00 0.00 ? 2  SER A C    6  
ATOM 5191  O O    . SER A 1 2  ? -18.266 -7.176  11.196  1.00 0.00 ? 2  SER A O    6  
ATOM 5192  C CB   . SER A 1 2  ? -21.164 -7.235  12.933  1.00 0.00 ? 2  SER A CB   6  
ATOM 5193  O OG   . SER A 1 2  ? -22.345 -8.018  12.958  1.00 0.00 ? 2  SER A OG   6  
ATOM 5194  H H    . SER A 1 2  ? -19.586 -8.564  14.692  1.00 0.00 ? 2  SER A H    6  
ATOM 5195  H HA   . SER A 1 2  ? -20.137 -8.736  11.805  1.00 0.00 ? 2  SER A HA   6  
ATOM 5196  H HB2  . SER A 1 2  ? -21.049 -6.748  13.889  1.00 0.00 ? 2  SER A HB2  6  
ATOM 5197  H HB3  . SER A 1 2  ? -21.258 -6.488  12.157  1.00 0.00 ? 2  SER A HB3  6  
ATOM 5198  H HG   . SER A 1 2  ? -22.367 -8.590  12.188  1.00 0.00 ? 2  SER A HG   6  
ATOM 5199  N N    . SER A 1 3  ? -18.245 -6.504  13.344  1.00 0.00 ? 3  SER A N    6  
ATOM 5200  C CA   . SER A 1 3  ? -17.103 -5.615  13.169  1.00 0.00 ? 3  SER A CA   6  
ATOM 5201  C C    . SER A 1 3  ? -15.801 -6.408  13.104  1.00 0.00 ? 3  SER A C    6  
ATOM 5202  O O    . SER A 1 3  ? -15.800 -7.632  13.226  1.00 0.00 ? 3  SER A O    6  
ATOM 5203  C CB   . SER A 1 3  ? -17.039 -4.601  14.314  1.00 0.00 ? 3  SER A CB   6  
ATOM 5204  O OG   . SER A 1 3  ? -16.734 -5.238  15.542  1.00 0.00 ? 3  SER A OG   6  
ATOM 5205  H H    . SER A 1 3  ? -18.663 -6.579  14.227  1.00 0.00 ? 3  SER A H    6  
ATOM 5206  H HA   . SER A 1 3  ? -17.235 -5.085  12.238  1.00 0.00 ? 3  SER A HA   6  
ATOM 5207  H HB2  . SER A 1 3  ? -16.274 -3.870  14.101  1.00 0.00 ? 3  SER A HB2  6  
ATOM 5208  H HB3  . SER A 1 3  ? -17.995 -4.106  14.406  1.00 0.00 ? 3  SER A HB3  6  
ATOM 5209  H HG   . SER A 1 3  ? -16.350 -4.599  16.147  1.00 0.00 ? 3  SER A HG   6  
ATOM 5210  N N    . GLY A 1 4  ? -14.693 -5.700  12.912  1.00 0.00 ? 4  GLY A N    6  
ATOM 5211  C CA   . GLY A 1 4  ? -13.399 -6.353  12.833  1.00 0.00 ? 4  GLY A CA   6  
ATOM 5212  C C    . GLY A 1 4  ? -12.340 -5.469  12.205  1.00 0.00 ? 4  GLY A C    6  
ATOM 5213  O O    . GLY A 1 4  ? -12.430 -4.242  12.266  1.00 0.00 ? 4  GLY A O    6  
ATOM 5214  H H    . GLY A 1 4  ? -14.754 -4.725  12.821  1.00 0.00 ? 4  GLY A H    6  
ATOM 5215  H HA2  . GLY A 1 4  ? -13.083 -6.622  13.830  1.00 0.00 ? 4  GLY A HA2  6  
ATOM 5216  H HA3  . GLY A 1 4  ? -13.498 -7.252  12.242  1.00 0.00 ? 4  GLY A HA3  6  
ATOM 5217  N N    . SER A 1 5  ? -11.333 -6.092  11.602  1.00 0.00 ? 5  SER A N    6  
ATOM 5218  C CA   . SER A 1 5  ? -10.249 -5.353  10.965  1.00 0.00 ? 5  SER A CA   6  
ATOM 5219  C C    . SER A 1 5  ? -10.420 -5.336  9.449   1.00 0.00 ? 5  SER A C    6  
ATOM 5220  O O    . SER A 1 5  ? -9.931  -6.221  8.748   1.00 0.00 ? 5  SER A O    6  
ATOM 5221  C CB   . SER A 1 5  ? -8.898  -5.972  11.330  1.00 0.00 ? 5  SER A CB   6  
ATOM 5222  O OG   . SER A 1 5  ? -8.712  -5.999  12.734  1.00 0.00 ? 5  SER A OG   6  
ATOM 5223  H H    . SER A 1 5  ? -11.317 -7.072  11.587  1.00 0.00 ? 5  SER A H    6  
ATOM 5224  H HA   . SER A 1 5  ? -10.280 -4.337  11.331  1.00 0.00 ? 5  SER A HA   6  
ATOM 5225  H HB2  . SER A 1 5  ? -8.855  -6.983  10.954  1.00 0.00 ? 5  SER A HB2  6  
ATOM 5226  H HB3  . SER A 1 5  ? -8.106  -5.389  10.884  1.00 0.00 ? 5  SER A HB3  6  
ATOM 5227  H HG   . SER A 1 5  ? -8.805  -5.111  13.087  1.00 0.00 ? 5  SER A HG   6  
ATOM 5228  N N    . SER A 1 6  ? -11.119 -4.321  8.951   1.00 0.00 ? 6  SER A N    6  
ATOM 5229  C CA   . SER A 1 6  ? -11.360 -4.189  7.518   1.00 0.00 ? 6  SER A CA   6  
ATOM 5230  C C    . SER A 1 6  ? -10.074 -3.825  6.783   1.00 0.00 ? 6  SER A C    6  
ATOM 5231  O O    . SER A 1 6  ? -9.446  -2.808  7.073   1.00 0.00 ? 6  SER A O    6  
ATOM 5232  C CB   . SER A 1 6  ? -12.430 -3.128  7.255   1.00 0.00 ? 6  SER A CB   6  
ATOM 5233  O OG   . SER A 1 6  ? -13.689 -3.535  7.762   1.00 0.00 ? 6  SER A OG   6  
ATOM 5234  H H    . SER A 1 6  ? -11.484 -3.647  9.561   1.00 0.00 ? 6  SER A H    6  
ATOM 5235  H HA   . SER A 1 6  ? -11.713 -5.142  7.153   1.00 0.00 ? 6  SER A HA   6  
ATOM 5236  H HB2  . SER A 1 6  ? -12.143 -2.205  7.736   1.00 0.00 ? 6  SER A HB2  6  
ATOM 5237  H HB3  . SER A 1 6  ? -12.518 -2.966  6.190   1.00 0.00 ? 6  SER A HB3  6  
ATOM 5238  H HG   . SER A 1 6  ? -14.323 -2.823  7.654   1.00 0.00 ? 6  SER A HG   6  
ATOM 5239  N N    . GLY A 1 7  ? -9.688  -4.666  5.827   1.00 0.00 ? 7  GLY A N    6  
ATOM 5240  C CA   . GLY A 1 7  ? -8.479  -4.416  5.064   1.00 0.00 ? 7  GLY A CA   6  
ATOM 5241  C C    . GLY A 1 7  ? -7.586  -5.638  4.978   1.00 0.00 ? 7  GLY A C    6  
ATOM 5242  O O    . GLY A 1 7  ? -7.362  -6.325  5.975   1.00 0.00 ? 7  GLY A O    6  
ATOM 5243  H H    . GLY A 1 7  ? -10.229 -5.461  5.639   1.00 0.00 ? 7  GLY A H    6  
ATOM 5244  H HA2  . GLY A 1 7  ? -8.753  -4.112  4.065   1.00 0.00 ? 7  GLY A HA2  6  
ATOM 5245  H HA3  . GLY A 1 7  ? -7.929  -3.615  5.535   1.00 0.00 ? 7  GLY A HA3  6  
ATOM 5246  N N    . THR A 1 8  ? -7.073  -5.911  3.782   1.00 0.00 ? 8  THR A N    6  
ATOM 5247  C CA   . THR A 1 8  ? -6.201  -7.060  3.568   1.00 0.00 ? 8  THR A CA   6  
ATOM 5248  C C    . THR A 1 8  ? -4.765  -6.741  3.966   1.00 0.00 ? 8  THR A C    6  
ATOM 5249  O O    . THR A 1 8  ? -4.245  -5.659  3.692   1.00 0.00 ? 8  THR A O    6  
ATOM 5250  C CB   . THR A 1 8  ? -6.225  -7.517  2.098   1.00 0.00 ? 8  THR A CB   6  
ATOM 5251  O OG1  . THR A 1 8  ? -7.556  -7.891  1.723   1.00 0.00 ? 8  THR A OG1  6  
ATOM 5252  C CG2  . THR A 1 8  ? -5.283  -8.691  1.881   1.00 0.00 ? 8  THR A CG2  6  
ATOM 5253  H H    . THR A 1 8  ? -7.288  -5.326  3.026   1.00 0.00 ? 8  THR A H    6  
ATOM 5254  H HA   . THR A 1 8  ? -6.563  -7.872  4.182   1.00 0.00 ? 8  THR A HA   6  
ATOM 5255  H HB   . THR A 1 8  ? -5.902  -6.695  1.476   1.00 0.00 ? 8  THR A HB   6  
ATOM 5256  H HG1  . THR A 1 8  ? -7.963  -8.387  2.438   1.00 0.00 ? 8  THR A HG1  6  
ATOM 5257  H HG21 . THR A 1 8  ? -5.749  -9.598  2.239   1.00 0.00 ? 8  THR A HG21 6  
ATOM 5258  H HG22 . THR A 1 8  ? -4.364  -8.520  2.422   1.00 0.00 ? 8  THR A HG22 6  
ATOM 5259  H HG23 . THR A 1 8  ? -5.068  -8.790  0.828   1.00 0.00 ? 8  THR A HG23 6  
ATOM 5260  N N    . PRO A 1 9  ? -4.106  -7.704  4.628   1.00 0.00 ? 9  PRO A N    6  
ATOM 5261  C CA   . PRO A 1 9  ? -2.719  -7.549  5.076   1.00 0.00 ? 9  PRO A CA   6  
ATOM 5262  C C    . PRO A 1 9  ? -1.732  -7.536  3.914   1.00 0.00 ? 9  PRO A C    6  
ATOM 5263  O O    . PRO A 1 9  ? -1.764  -8.412  3.050   1.00 0.00 ? 9  PRO A O    6  
ATOM 5264  C CB   . PRO A 1 9  ? -2.491  -8.781  5.957   1.00 0.00 ? 9  PRO A CB   6  
ATOM 5265  C CG   . PRO A 1 9  ? -3.461  -9.792  5.451   1.00 0.00 ? 9  PRO A CG   6  
ATOM 5266  C CD   . PRO A 1 9  ? -4.664  -9.018  4.988   1.00 0.00 ? 9  PRO A CD   6  
ATOM 5267  H HA   . PRO A 1 9  ? -2.590  -6.654  5.666   1.00 0.00 ? 9  PRO A HA   6  
ATOM 5268  H HB2  . PRO A 1 9  ? -1.471  -9.120  5.848   1.00 0.00 ? 9  PRO A HB2  6  
ATOM 5269  H HB3  . PRO A 1 9  ? -2.685  -8.530  6.989   1.00 0.00 ? 9  PRO A HB3  6  
ATOM 5270  H HG2  . PRO A 1 9  ? -3.026  -10.338 4.627   1.00 0.00 ? 9  PRO A HG2  6  
ATOM 5271  H HG3  . PRO A 1 9  ? -3.734  -10.469 6.247   1.00 0.00 ? 9  PRO A HG3  6  
ATOM 5272  H HD2  . PRO A 1 9  ? -5.112  -9.495  4.129   1.00 0.00 ? 9  PRO A HD2  6  
ATOM 5273  H HD3  . PRO A 1 9  ? -5.383  -8.925  5.788   1.00 0.00 ? 9  PRO A HD3  6  
ATOM 5274  N N    . TYR A 1 10 ? -0.856  -6.538  3.900   1.00 0.00 ? 10 TYR A N    6  
ATOM 5275  C CA   . TYR A 1 10 ? 0.140   -6.410  2.842   1.00 0.00 ? 10 TYR A CA   6  
ATOM 5276  C C    . TYR A 1 10 ? 1.511   -6.075  3.422   1.00 0.00 ? 10 TYR A C    6  
ATOM 5277  O O    . TYR A 1 10 ? 1.650   -5.849  4.624   1.00 0.00 ? 10 TYR A O    6  
ATOM 5278  C CB   . TYR A 1 10 ? -0.282  -5.330  1.844   1.00 0.00 ? 10 TYR A CB   6  
ATOM 5279  C CG   . TYR A 1 10 ? -1.170  -5.845  0.734   1.00 0.00 ? 10 TYR A CG   6  
ATOM 5280  C CD1  . TYR A 1 10 ? -2.471  -6.256  0.994   1.00 0.00 ? 10 TYR A CD1  6  
ATOM 5281  C CD2  . TYR A 1 10 ? -0.708  -5.920  -0.574  1.00 0.00 ? 10 TYR A CD2  6  
ATOM 5282  C CE1  . TYR A 1 10 ? -3.287  -6.728  -0.016  1.00 0.00 ? 10 TYR A CE1  6  
ATOM 5283  C CE2  . TYR A 1 10 ? -1.517  -6.389  -1.591  1.00 0.00 ? 10 TYR A CE2  6  
ATOM 5284  C CZ   . TYR A 1 10 ? -2.805  -6.792  -1.307  1.00 0.00 ? 10 TYR A CZ   6  
ATOM 5285  O OH   . TYR A 1 10 ? -3.614  -7.261  -2.317  1.00 0.00 ? 10 TYR A OH   6  
ATOM 5286  H H    . TYR A 1 10 ? -0.880  -5.870  4.616   1.00 0.00 ? 10 TYR A H    6  
ATOM 5287  H HA   . TYR A 1 10 ? 0.201   -7.358  2.327   1.00 0.00 ? 10 TYR A HA   6  
ATOM 5288  H HB2  . TYR A 1 10 ? -0.821  -4.556  2.368   1.00 0.00 ? 10 TYR A HB2  6  
ATOM 5289  H HB3  . TYR A 1 10 ? 0.602   -4.903  1.391   1.00 0.00 ? 10 TYR A HB3  6  
ATOM 5290  H HD1  . TYR A 1 10 ? -2.846  -6.205  2.006   1.00 0.00 ? 10 TYR A HD1  6  
ATOM 5291  H HD2  . TYR A 1 10 ? 0.302   -5.604  -0.793  1.00 0.00 ? 10 TYR A HD2  6  
ATOM 5292  H HE1  . TYR A 1 10 ? -4.296  -7.044  0.205   1.00 0.00 ? 10 TYR A HE1  6  
ATOM 5293  H HE2  . TYR A 1 10 ? -1.140  -6.440  -2.602  1.00 0.00 ? 10 TYR A HE2  6  
ATOM 5294  H HH   . TYR A 1 10 ? -4.158  -6.544  -2.651  1.00 0.00 ? 10 TYR A HH   6  
ATOM 5295  N N    . ARG A 1 11 ? 2.520   -6.044  2.558   1.00 0.00 ? 11 ARG A N    6  
ATOM 5296  C CA   . ARG A 1 11 ? 3.881   -5.738  2.982   1.00 0.00 ? 11 ARG A CA   6  
ATOM 5297  C C    . ARG A 1 11 ? 4.626   -4.960  1.901   1.00 0.00 ? 11 ARG A C    6  
ATOM 5298  O O    . ARG A 1 11 ? 4.573   -5.311  0.723   1.00 0.00 ? 11 ARG A O    6  
ATOM 5299  C CB   . ARG A 1 11 ? 4.637   -7.026  3.312   1.00 0.00 ? 11 ARG A CB   6  
ATOM 5300  C CG   . ARG A 1 11 ? 6.142   -6.838  3.419   1.00 0.00 ? 11 ARG A CG   6  
ATOM 5301  C CD   . ARG A 1 11 ? 6.863   -8.173  3.522   1.00 0.00 ? 11 ARG A CD   6  
ATOM 5302  N NE   . ARG A 1 11 ? 6.805   -8.925  2.272   1.00 0.00 ? 11 ARG A NE   6  
ATOM 5303  C CZ   . ARG A 1 11 ? 7.187   -10.192 2.158   1.00 0.00 ? 11 ARG A CZ   6  
ATOM 5304  N NH1  . ARG A 1 11 ? 7.652   -10.846 3.214   1.00 0.00 ? 11 ARG A NH1  6  
ATOM 5305  N NH2  . ARG A 1 11 ? 7.104   -10.809 0.986   1.00 0.00 ? 11 ARG A NH2  6  
ATOM 5306  H H    . ARG A 1 11 ? 2.346   -6.233  1.612   1.00 0.00 ? 11 ARG A H    6  
ATOM 5307  H HA   . ARG A 1 11 ? 3.821   -5.128  3.871   1.00 0.00 ? 11 ARG A HA   6  
ATOM 5308  H HB2  . ARG A 1 11 ? 4.277   -7.410  4.255   1.00 0.00 ? 11 ARG A HB2  6  
ATOM 5309  H HB3  . ARG A 1 11 ? 4.441   -7.752  2.538   1.00 0.00 ? 11 ARG A HB3  6  
ATOM 5310  H HG2  . ARG A 1 11 ? 6.494   -6.319  2.540   1.00 0.00 ? 11 ARG A HG2  6  
ATOM 5311  H HG3  . ARG A 1 11 ? 6.360   -6.251  4.298   1.00 0.00 ? 11 ARG A HG3  6  
ATOM 5312  H HD2  . ARG A 1 11 ? 7.897   -7.989  3.772   1.00 0.00 ? 11 ARG A HD2  6  
ATOM 5313  H HD3  . ARG A 1 11 ? 6.402   -8.757  4.305   1.00 0.00 ? 11 ARG A HD3  6  
ATOM 5314  H HE   . ARG A 1 11 ? 6.465   -8.462  1.479   1.00 0.00 ? 11 ARG A HE   6  
ATOM 5315  H HH11 . ARG A 1 11 ? 7.715   -10.384 4.098   1.00 0.00 ? 11 ARG A HH11 6  
ATOM 5316  H HH12 . ARG A 1 11 ? 7.938   -11.800 3.126   1.00 0.00 ? 11 ARG A HH12 6  
ATOM 5317  H HH21 . ARG A 1 11 ? 6.753   -10.320 0.188   1.00 0.00 ? 11 ARG A HH21 6  
ATOM 5318  H HH22 . ARG A 1 11 ? 7.391   -11.762 0.901   1.00 0.00 ? 11 ARG A HH22 6  
ATOM 5319  N N    . ALA A 1 12 ? 5.318   -3.902  2.311   1.00 0.00 ? 12 ALA A N    6  
ATOM 5320  C CA   . ALA A 1 12 ? 6.074   -3.076  1.378   1.00 0.00 ? 12 ALA A CA   6  
ATOM 5321  C C    . ALA A 1 12 ? 7.428   -3.702  1.064   1.00 0.00 ? 12 ALA A C    6  
ATOM 5322  O O    . ALA A 1 12 ? 8.354   -3.640  1.873   1.00 0.00 ? 12 ALA A O    6  
ATOM 5323  C CB   . ALA A 1 12 ? 6.256   -1.675  1.943   1.00 0.00 ? 12 ALA A CB   6  
ATOM 5324  H H    . ALA A 1 12 ? 5.321   -3.673  3.264   1.00 0.00 ? 12 ALA A H    6  
ATOM 5325  H HA   . ALA A 1 12 ? 5.504   -2.998  0.464   1.00 0.00 ? 12 ALA A HA   6  
ATOM 5326  H HB1  . ALA A 1 12 ? 5.342   -1.360  2.423   1.00 0.00 ? 12 ALA A HB1  6  
ATOM 5327  H HB2  . ALA A 1 12 ? 7.060   -1.680  2.664   1.00 0.00 ? 12 ALA A HB2  6  
ATOM 5328  H HB3  . ALA A 1 12 ? 6.496   -0.993  1.141   1.00 0.00 ? 12 ALA A HB3  6  
ATOM 5329  N N    . MET A 1 13 ? 7.537   -4.306  -0.115  1.00 0.00 ? 13 MET A N    6  
ATOM 5330  C CA   . MET A 1 13 ? 8.779   -4.944  -0.535  1.00 0.00 ? 13 MET A CA   6  
ATOM 5331  C C    . MET A 1 13 ? 9.925   -3.937  -0.561  1.00 0.00 ? 13 MET A C    6  
ATOM 5332  O O    . MET A 1 13 ? 11.088  -4.301  -0.384  1.00 0.00 ? 13 MET A O    6  
ATOM 5333  C CB   . MET A 1 13 ? 8.610   -5.577  -1.917  1.00 0.00 ? 13 MET A CB   6  
ATOM 5334  C CG   . MET A 1 13 ? 7.428   -6.528  -2.009  1.00 0.00 ? 13 MET A CG   6  
ATOM 5335  S SD   . MET A 1 13 ? 7.621   -7.753  -3.319  1.00 0.00 ? 13 MET A SD   6  
ATOM 5336  C CE   . MET A 1 13 ? 6.980   -6.848  -4.725  1.00 0.00 ? 13 MET A CE   6  
ATOM 5337  H H    . MET A 1 13 ? 6.764   -4.323  -0.717  1.00 0.00 ? 13 MET A H    6  
ATOM 5338  H HA   . MET A 1 13 ? 9.012   -5.718  0.180   1.00 0.00 ? 13 MET A HA   6  
ATOM 5339  H HB2  . MET A 1 13 ? 8.471   -4.793  -2.645  1.00 0.00 ? 13 MET A HB2  6  
ATOM 5340  H HB3  . MET A 1 13 ? 9.506   -6.128  -2.160  1.00 0.00 ? 13 MET A HB3  6  
ATOM 5341  H HG2  . MET A 1 13 ? 7.323   -7.045  -1.066  1.00 0.00 ? 13 MET A HG2  6  
ATOM 5342  H HG3  . MET A 1 13 ? 6.535   -5.952  -2.202  1.00 0.00 ? 13 MET A HG3  6  
ATOM 5343  H HE1  . MET A 1 13 ? 6.953   -7.496  -5.589  1.00 0.00 ? 13 MET A HE1  6  
ATOM 5344  H HE2  . MET A 1 13 ? 5.982   -6.500  -4.505  1.00 0.00 ? 13 MET A HE2  6  
ATOM 5345  H HE3  . MET A 1 13 ? 7.620   -6.002  -4.930  1.00 0.00 ? 13 MET A HE3  6  
ATOM 5346  N N    . TYR A 1 14 ? 9.589   -2.671  -0.784  1.00 0.00 ? 14 TYR A N    6  
ATOM 5347  C CA   . TYR A 1 14 ? 10.591  -1.613  -0.837  1.00 0.00 ? 14 TYR A CA   6  
ATOM 5348  C C    . TYR A 1 14 ? 10.036  -0.310  -0.269  1.00 0.00 ? 14 TYR A C    6  
ATOM 5349  O O    . TYR A 1 14 ? 8.822   -0.123  -0.188  1.00 0.00 ? 14 TYR A O    6  
ATOM 5350  C CB   . TYR A 1 14 ? 11.060  -1.396  -2.276  1.00 0.00 ? 14 TYR A CB   6  
ATOM 5351  C CG   . TYR A 1 14 ? 11.004  -2.646  -3.126  1.00 0.00 ? 14 TYR A CG   6  
ATOM 5352  C CD1  . TYR A 1 14 ? 12.001  -3.611  -3.042  1.00 0.00 ? 14 TYR A CD1  6  
ATOM 5353  C CD2  . TYR A 1 14 ? 9.957   -2.861  -4.012  1.00 0.00 ? 14 TYR A CD2  6  
ATOM 5354  C CE1  . TYR A 1 14 ? 11.955  -4.754  -3.816  1.00 0.00 ? 14 TYR A CE1  6  
ATOM 5355  C CE2  . TYR A 1 14 ? 9.902   -4.002  -4.789  1.00 0.00 ? 14 TYR A CE2  6  
ATOM 5356  C CZ   . TYR A 1 14 ? 10.903  -4.945  -4.688  1.00 0.00 ? 14 TYR A CZ   6  
ATOM 5357  O OH   . TYR A 1 14 ? 10.853  -6.082  -5.462  1.00 0.00 ? 14 TYR A OH   6  
ATOM 5358  H H    . TYR A 1 14 ? 8.646   -2.443  -0.919  1.00 0.00 ? 14 TYR A H    6  
ATOM 5359  H HA   . TYR A 1 14 ? 11.433  -1.923  -0.237  1.00 0.00 ? 14 TYR A HA   6  
ATOM 5360  H HB2  . TYR A 1 14 ? 10.434  -0.651  -2.743  1.00 0.00 ? 14 TYR A HB2  6  
ATOM 5361  H HB3  . TYR A 1 14 ? 12.082  -1.047  -2.266  1.00 0.00 ? 14 TYR A HB3  6  
ATOM 5362  H HD1  . TYR A 1 14 ? 12.823  -3.458  -2.358  1.00 0.00 ? 14 TYR A HD1  6  
ATOM 5363  H HD2  . TYR A 1 14 ? 9.174   -2.120  -4.090  1.00 0.00 ? 14 TYR A HD2  6  
ATOM 5364  H HE1  . TYR A 1 14 ? 12.739  -5.493  -3.737  1.00 0.00 ? 14 TYR A HE1  6  
ATOM 5365  H HE2  . TYR A 1 14 ? 9.079   -4.152  -5.473  1.00 0.00 ? 14 TYR A HE2  6  
ATOM 5366  H HH   . TYR A 1 14 ? 9.952   -6.413  -5.486  1.00 0.00 ? 14 TYR A HH   6  
ATOM 5367  N N    . GLN A 1 15 ? 10.935  0.588   0.121   1.00 0.00 ? 15 GLN A N    6  
ATOM 5368  C CA   . GLN A 1 15 ? 10.536  1.874   0.680   1.00 0.00 ? 15 GLN A CA   6  
ATOM 5369  C C    . GLN A 1 15 ? 10.075  2.827   -0.418  1.00 0.00 ? 15 GLN A C    6  
ATOM 5370  O O    . GLN A 1 15 ? 10.645  2.855   -1.509  1.00 0.00 ? 15 GLN A O    6  
ATOM 5371  C CB   . GLN A 1 15 ? 11.697  2.498   1.458   1.00 0.00 ? 15 GLN A CB   6  
ATOM 5372  C CG   . GLN A 1 15 ? 11.360  3.844   2.078   1.00 0.00 ? 15 GLN A CG   6  
ATOM 5373  C CD   . GLN A 1 15 ? 12.542  4.470   2.792   1.00 0.00 ? 15 GLN A CD   6  
ATOM 5374  O OE1  . GLN A 1 15 ? 13.327  3.778   3.441   1.00 0.00 ? 15 GLN A OE1  6  
ATOM 5375  N NE2  . GLN A 1 15 ? 12.675  5.786   2.676   1.00 0.00 ? 15 GLN A NE2  6  
ATOM 5376  H H    . GLN A 1 15 ? 11.888  0.381   0.030   1.00 0.00 ? 15 GLN A H    6  
ATOM 5377  H HA   . GLN A 1 15 ? 9.714   1.700   1.357   1.00 0.00 ? 15 GLN A HA   6  
ATOM 5378  H HB2  . GLN A 1 15 ? 11.987  1.824   2.250   1.00 0.00 ? 15 GLN A HB2  6  
ATOM 5379  H HB3  . GLN A 1 15 ? 12.532  2.634   0.787   1.00 0.00 ? 15 GLN A HB3  6  
ATOM 5380  H HG2  . GLN A 1 15 ? 11.035  4.515   1.296   1.00 0.00 ? 15 GLN A HG2  6  
ATOM 5381  H HG3  . GLN A 1 15 ? 10.559  3.708   2.789   1.00 0.00 ? 15 GLN A HG3  6  
ATOM 5382  H HE21 . GLN A 1 15 ? 12.010  6.273   2.143   1.00 0.00 ? 15 GLN A HE21 6  
ATOM 5383  H HE22 . GLN A 1 15 ? 13.429  6.217   3.127   1.00 0.00 ? 15 GLN A HE22 6  
ATOM 5384  N N    . TYR A 1 16 ? 9.039   3.604   -0.123  1.00 0.00 ? 16 TYR A N    6  
ATOM 5385  C CA   . TYR A 1 16 ? 8.499   4.556   -1.086  1.00 0.00 ? 16 TYR A CA   6  
ATOM 5386  C C    . TYR A 1 16 ? 8.700   5.990   -0.607  1.00 0.00 ? 16 TYR A C    6  
ATOM 5387  O O    . TYR A 1 16 ? 8.852   6.241   0.589   1.00 0.00 ? 16 TYR A O    6  
ATOM 5388  C CB   . TYR A 1 16 ? 7.011   4.288   -1.320  1.00 0.00 ? 16 TYR A CB   6  
ATOM 5389  C CG   . TYR A 1 16 ? 6.363   5.265   -2.276  1.00 0.00 ? 16 TYR A CG   6  
ATOM 5390  C CD1  . TYR A 1 16 ? 6.708   5.283   -3.621  1.00 0.00 ? 16 TYR A CD1  6  
ATOM 5391  C CD2  . TYR A 1 16 ? 5.405   6.169   -1.833  1.00 0.00 ? 16 TYR A CD2  6  
ATOM 5392  C CE1  . TYR A 1 16 ? 6.119   6.173   -4.498  1.00 0.00 ? 16 TYR A CE1  6  
ATOM 5393  C CE2  . TYR A 1 16 ? 4.810   7.062   -2.702  1.00 0.00 ? 16 TYR A CE2  6  
ATOM 5394  C CZ   . TYR A 1 16 ? 5.170   7.061   -4.034  1.00 0.00 ? 16 TYR A CZ   6  
ATOM 5395  O OH   . TYR A 1 16 ? 4.580   7.949   -4.904  1.00 0.00 ? 16 TYR A OH   6  
ATOM 5396  H H    . TYR A 1 16 ? 8.626   3.535   0.763   1.00 0.00 ? 16 TYR A H    6  
ATOM 5397  H HA   . TYR A 1 16 ? 9.029   4.422   -2.018  1.00 0.00 ? 16 TYR A HA   6  
ATOM 5398  H HB2  . TYR A 1 16 ? 6.890   3.297   -1.727  1.00 0.00 ? 16 TYR A HB2  6  
ATOM 5399  H HB3  . TYR A 1 16 ? 6.488   4.351   -0.377  1.00 0.00 ? 16 TYR A HB3  6  
ATOM 5400  H HD1  . TYR A 1 16 ? 7.451   4.586   -3.982  1.00 0.00 ? 16 TYR A HD1  6  
ATOM 5401  H HD2  . TYR A 1 16 ? 5.124   6.167   -0.789  1.00 0.00 ? 16 TYR A HD2  6  
ATOM 5402  H HE1  . TYR A 1 16 ? 6.401   6.172   -5.540  1.00 0.00 ? 16 TYR A HE1  6  
ATOM 5403  H HE2  . TYR A 1 16 ? 4.067   7.757   -2.339  1.00 0.00 ? 16 TYR A HE2  6  
ATOM 5404  H HH   . TYR A 1 16 ? 5.198   8.166   -5.606  1.00 0.00 ? 16 TYR A HH   6  
ATOM 5405  N N    . ARG A 1 17 ? 8.699   6.928   -1.549  1.00 0.00 ? 17 ARG A N    6  
ATOM 5406  C CA   . ARG A 1 17 ? 8.882   8.337   -1.224  1.00 0.00 ? 17 ARG A CA   6  
ATOM 5407  C C    . ARG A 1 17 ? 7.770   9.185   -1.836  1.00 0.00 ? 17 ARG A C    6  
ATOM 5408  O O    . ARG A 1 17 ? 7.880   9.683   -2.956  1.00 0.00 ? 17 ARG A O    6  
ATOM 5409  C CB   . ARG A 1 17 ? 10.243  8.825   -1.724  1.00 0.00 ? 17 ARG A CB   6  
ATOM 5410  C CG   . ARG A 1 17 ? 11.419  8.219   -0.976  1.00 0.00 ? 17 ARG A CG   6  
ATOM 5411  C CD   . ARG A 1 17 ? 12.699  9.003   -1.221  1.00 0.00 ? 17 ARG A CD   6  
ATOM 5412  N NE   . ARG A 1 17 ? 13.109  8.956   -2.622  1.00 0.00 ? 17 ARG A NE   6  
ATOM 5413  C CZ   . ARG A 1 17 ? 14.260  9.447   -3.068  1.00 0.00 ? 17 ARG A CZ   6  
ATOM 5414  N NH1  . ARG A 1 17 ? 15.111  10.018  -2.226  1.00 0.00 ? 17 ARG A NH1  6  
ATOM 5415  N NH2  . ARG A 1 17 ? 14.563  9.366   -4.357  1.00 0.00 ? 17 ARG A NH2  6  
ATOM 5416  H H    . ARG A 1 17 ? 8.573   6.665   -2.485  1.00 0.00 ? 17 ARG A H    6  
ATOM 5417  H HA   . ARG A 1 17 ? 8.845   8.438   -0.150  1.00 0.00 ? 17 ARG A HA   6  
ATOM 5418  H HB2  . ARG A 1 17 ? 10.341  8.573   -2.769  1.00 0.00 ? 17 ARG A HB2  6  
ATOM 5419  H HB3  . ARG A 1 17 ? 10.289  9.898   -1.614  1.00 0.00 ? 17 ARG A HB3  6  
ATOM 5420  H HG2  . ARG A 1 17 ? 11.203  8.226   0.083   1.00 0.00 ? 17 ARG A HG2  6  
ATOM 5421  H HG3  . ARG A 1 17 ? 11.560  7.202   -1.310  1.00 0.00 ? 17 ARG A HG3  6  
ATOM 5422  H HD2  . ARG A 1 17 ? 12.535  10.032  -0.939  1.00 0.00 ? 17 ARG A HD2  6  
ATOM 5423  H HD3  . ARG A 1 17 ? 13.485  8.583   -0.611  1.00 0.00 ? 17 ARG A HD3  6  
ATOM 5424  H HE   . ARG A 1 17 ? 12.496  8.538   -3.261  1.00 0.00 ? 17 ARG A HE   6  
ATOM 5425  H HH11 . ARG A 1 17 ? 14.886  10.080  -1.254  1.00 0.00 ? 17 ARG A HH11 6  
ATOM 5426  H HH12 . ARG A 1 17 ? 15.977  10.386  -2.564  1.00 0.00 ? 17 ARG A HH12 6  
ATOM 5427  H HH21 . ARG A 1 17 ? 13.924  8.936   -4.994  1.00 0.00 ? 17 ARG A HH21 6  
ATOM 5428  H HH22 . ARG A 1 17 ? 15.429  9.736   -4.691  1.00 0.00 ? 17 ARG A HH22 6  
ATOM 5429  N N    . PRO A 1 18 ? 6.672   9.353   -1.084  1.00 0.00 ? 18 PRO A N    6  
ATOM 5430  C CA   . PRO A 1 18 ? 5.519   10.140  -1.531  1.00 0.00 ? 18 PRO A CA   6  
ATOM 5431  C C    . PRO A 1 18 ? 5.824   11.632  -1.593  1.00 0.00 ? 18 PRO A C    6  
ATOM 5432  O O    . PRO A 1 18 ? 6.233   12.232  -0.599  1.00 0.00 ? 18 PRO A O    6  
ATOM 5433  C CB   . PRO A 1 18 ? 4.459   9.854   -0.464  1.00 0.00 ? 18 PRO A CB   6  
ATOM 5434  C CG   . PRO A 1 18 ? 5.236   9.490   0.754   1.00 0.00 ? 18 PRO A CG   6  
ATOM 5435  C CD   . PRO A 1 18 ? 6.472   8.788   0.262   1.00 0.00 ? 18 PRO A CD   6  
ATOM 5436  H HA   . PRO A 1 18 ? 5.161   9.806   -2.494  1.00 0.00 ? 18 PRO A HA   6  
ATOM 5437  H HB2  . PRO A 1 18 ? 3.861   10.740  -0.301  1.00 0.00 ? 18 PRO A HB2  6  
ATOM 5438  H HB3  . PRO A 1 18 ? 3.828   9.041   -0.787  1.00 0.00 ? 18 PRO A HB3  6  
ATOM 5439  H HG2  . PRO A 1 18 ? 5.504   10.382  1.299   1.00 0.00 ? 18 PRO A HG2  6  
ATOM 5440  H HG3  . PRO A 1 18 ? 4.653   8.828   1.376   1.00 0.00 ? 18 PRO A HG3  6  
ATOM 5441  H HD2  . PRO A 1 18 ? 7.313   9.011   0.902   1.00 0.00 ? 18 PRO A HD2  6  
ATOM 5442  H HD3  . PRO A 1 18 ? 6.306   7.722   0.211   1.00 0.00 ? 18 PRO A HD3  6  
ATOM 5443  N N    . GLN A 1 19 ? 5.623   12.225  -2.765  1.00 0.00 ? 19 GLN A N    6  
ATOM 5444  C CA   . GLN A 1 19 ? 5.878   13.648  -2.955  1.00 0.00 ? 19 GLN A CA   6  
ATOM 5445  C C    . GLN A 1 19 ? 4.911   14.489  -2.128  1.00 0.00 ? 19 GLN A C    6  
ATOM 5446  O O    . GLN A 1 19 ? 5.255   15.578  -1.671  1.00 0.00 ? 19 GLN A O    6  
ATOM 5447  C CB   . GLN A 1 19 ? 5.755   14.016  -4.435  1.00 0.00 ? 19 GLN A CB   6  
ATOM 5448  C CG   . GLN A 1 19 ? 7.020   13.750  -5.235  1.00 0.00 ? 19 GLN A CG   6  
ATOM 5449  C CD   . GLN A 1 19 ? 6.734   13.413  -6.685  1.00 0.00 ? 19 GLN A CD   6  
ATOM 5450  O OE1  . GLN A 1 19 ? 6.338   14.277  -7.468  1.00 0.00 ? 19 GLN A OE1  6  
ATOM 5451  N NE2  . GLN A 1 19 ? 6.933   12.152  -7.051  1.00 0.00 ? 19 GLN A NE2  6  
ATOM 5452  H H    . GLN A 1 19 ? 5.296   11.693  -3.520  1.00 0.00 ? 19 GLN A H    6  
ATOM 5453  H HA   . GLN A 1 19 ? 6.885   13.851  -2.625  1.00 0.00 ? 19 GLN A HA   6  
ATOM 5454  H HB2  . GLN A 1 19 ? 4.951   13.443  -4.871  1.00 0.00 ? 19 GLN A HB2  6  
ATOM 5455  H HB3  . GLN A 1 19 ? 5.521   15.068  -4.513  1.00 0.00 ? 19 GLN A HB3  6  
ATOM 5456  H HG2  . GLN A 1 19 ? 7.644   14.631  -5.202  1.00 0.00 ? 19 GLN A HG2  6  
ATOM 5457  H HG3  . GLN A 1 19 ? 7.547   12.921  -4.785  1.00 0.00 ? 19 GLN A HG3  6  
ATOM 5458  H HE21 . GLN A 1 19 ? 7.248   11.518  -6.372  1.00 0.00 ? 19 GLN A HE21 6  
ATOM 5459  H HE22 . GLN A 1 19 ? 6.755   11.907  -7.982  1.00 0.00 ? 19 GLN A HE22 6  
ATOM 5460  N N    . ASN A 1 20 ? 3.699   13.976  -1.940  1.00 0.00 ? 20 ASN A N    6  
ATOM 5461  C CA   . ASN A 1 20 ? 2.682   14.681  -1.169  1.00 0.00 ? 20 ASN A CA   6  
ATOM 5462  C C    . ASN A 1 20 ? 2.146   13.801  -0.043  1.00 0.00 ? 20 ASN A C    6  
ATOM 5463  O O    . ASN A 1 20 ? 2.533   12.640  0.087   1.00 0.00 ? 20 ASN A O    6  
ATOM 5464  C CB   . ASN A 1 20 ? 1.534   15.119  -2.080  1.00 0.00 ? 20 ASN A CB   6  
ATOM 5465  C CG   . ASN A 1 20 ? 2.006   15.471  -3.477  1.00 0.00 ? 20 ASN A CG   6  
ATOM 5466  O OD1  . ASN A 1 20 ? 2.570   16.542  -3.702  1.00 0.00 ? 20 ASN A OD1  6  
ATOM 5467  N ND2  . ASN A 1 20 ? 1.777   14.569  -4.424  1.00 0.00 ? 20 ASN A ND2  6  
ATOM 5468  H H    . ASN A 1 20 ? 3.484   13.103  -2.330  1.00 0.00 ? 20 ASN A H    6  
ATOM 5469  H HA   . ASN A 1 20 ? 3.142   15.557  -0.737  1.00 0.00 ? 20 ASN A HA   6  
ATOM 5470  H HB2  . ASN A 1 20 ? 0.816   14.315  -2.155  1.00 0.00 ? 20 ASN A HB2  6  
ATOM 5471  H HB3  . ASN A 1 20 ? 1.053   15.986  -1.652  1.00 0.00 ? 20 ASN A HB3  6  
ATOM 5472  H HD21 . ASN A 1 20 ? 1.322   13.738  -4.172  1.00 0.00 ? 20 ASN A HD21 6  
ATOM 5473  H HD22 . ASN A 1 20 ? 2.073   14.770  -5.336  1.00 0.00 ? 20 ASN A HD22 6  
ATOM 5474  N N    . GLU A 1 21 ? 1.254   14.363  0.767   1.00 0.00 ? 21 GLU A N    6  
ATOM 5475  C CA   . GLU A 1 21 ? 0.666   13.629  1.881   1.00 0.00 ? 21 GLU A CA   6  
ATOM 5476  C C    . GLU A 1 21 ? -0.385  12.640  1.386   1.00 0.00 ? 21 GLU A C    6  
ATOM 5477  O O    . GLU A 1 21 ? -0.544  11.554  1.945   1.00 0.00 ? 21 GLU A O    6  
ATOM 5478  C CB   . GLU A 1 21 ? 0.037   14.599  2.884   1.00 0.00 ? 21 GLU A CB   6  
ATOM 5479  C CG   . GLU A 1 21 ? 1.017   15.121  3.921   1.00 0.00 ? 21 GLU A CG   6  
ATOM 5480  C CD   . GLU A 1 21 ? 0.325   15.652  5.162   1.00 0.00 ? 21 GLU A CD   6  
ATOM 5481  O OE1  . GLU A 1 21 ? -0.088  16.830  5.152   1.00 0.00 ? 21 GLU A OE1  6  
ATOM 5482  O OE2  . GLU A 1 21 ? 0.197   14.890  6.142   1.00 0.00 ? 21 GLU A OE2  6  
ATOM 5483  H H    . GLU A 1 21 ? 0.986   15.293  0.611   1.00 0.00 ? 21 GLU A H    6  
ATOM 5484  H HA   . GLU A 1 21 ? 1.456   13.081  2.371   1.00 0.00 ? 21 GLU A HA   6  
ATOM 5485  H HB2  . GLU A 1 21 ? -0.369  15.442  2.345   1.00 0.00 ? 21 GLU A HB2  6  
ATOM 5486  H HB3  . GLU A 1 21 ? -0.765  14.093  3.400   1.00 0.00 ? 21 GLU A HB3  6  
ATOM 5487  H HG2  . GLU A 1 21 ? 1.677   14.318  4.212   1.00 0.00 ? 21 GLU A HG2  6  
ATOM 5488  H HG3  . GLU A 1 21 ? 1.596   15.920  3.481   1.00 0.00 ? 21 GLU A HG3  6  
ATOM 5489  N N    . ASP A 1 22 ? -1.101  13.023  0.334   1.00 0.00 ? 22 ASP A N    6  
ATOM 5490  C CA   . ASP A 1 22 ? -2.137  12.170  -0.237  1.00 0.00 ? 22 ASP A CA   6  
ATOM 5491  C C    . ASP A 1 22 ? -1.646  10.732  -0.367  1.00 0.00 ? 22 ASP A C    6  
ATOM 5492  O O    . ASP A 1 22 ? -2.348  9.791   0.002   1.00 0.00 ? 22 ASP A O    6  
ATOM 5493  C CB   . ASP A 1 22 ? -2.567  12.701  -1.605  1.00 0.00 ? 22 ASP A CB   6  
ATOM 5494  C CG   . ASP A 1 22 ? -3.928  12.182  -2.026  1.00 0.00 ? 22 ASP A CG   6  
ATOM 5495  O OD1  . ASP A 1 22 ? -3.982  11.115  -2.671  1.00 0.00 ? 22 ASP A OD1  6  
ATOM 5496  O OD2  . ASP A 1 22 ? -4.939  12.844  -1.710  1.00 0.00 ? 22 ASP A OD2  6  
ATOM 5497  H H    . ASP A 1 22 ? -0.928  13.900  -0.068  1.00 0.00 ? 22 ASP A H    6  
ATOM 5498  H HA   . ASP A 1 22 ? -2.986  12.188  0.429   1.00 0.00 ? 22 ASP A HA   6  
ATOM 5499  H HB2  . ASP A 1 22 ? -2.610  13.780  -1.568  1.00 0.00 ? 22 ASP A HB2  6  
ATOM 5500  H HB3  . ASP A 1 22 ? -1.841  12.399  -2.346  1.00 0.00 ? 22 ASP A HB3  6  
ATOM 5501  N N    . GLU A 1 23 ? -0.437  10.570  -0.895  1.00 0.00 ? 23 GLU A N    6  
ATOM 5502  C CA   . GLU A 1 23 ? 0.146   9.245   -1.076  1.00 0.00 ? 23 GLU A CA   6  
ATOM 5503  C C    . GLU A 1 23 ? 0.705   8.713   0.241   1.00 0.00 ? 23 GLU A C    6  
ATOM 5504  O O    . GLU A 1 23 ? 1.306   9.455   1.018   1.00 0.00 ? 23 GLU A O    6  
ATOM 5505  C CB   . GLU A 1 23 ? 1.253   9.291   -2.131  1.00 0.00 ? 23 GLU A CB   6  
ATOM 5506  C CG   . GLU A 1 23 ? 0.806   9.882   -3.457  1.00 0.00 ? 23 GLU A CG   6  
ATOM 5507  C CD   . GLU A 1 23 ? 1.756   9.553   -4.593  1.00 0.00 ? 23 GLU A CD   6  
ATOM 5508  O OE1  . GLU A 1 23 ? 2.177   8.382   -4.694  1.00 0.00 ? 23 GLU A OE1  6  
ATOM 5509  O OE2  . GLU A 1 23 ? 2.078   10.468  -5.380  1.00 0.00 ? 23 GLU A OE2  6  
ATOM 5510  H H    . GLU A 1 23 ? 0.075   11.359  -1.170  1.00 0.00 ? 23 GLU A H    6  
ATOM 5511  H HA   . GLU A 1 23 ? -0.635  8.583   -1.416  1.00 0.00 ? 23 GLU A HA   6  
ATOM 5512  H HB2  . GLU A 1 23 ? 2.071   9.886   -1.752  1.00 0.00 ? 23 GLU A HB2  6  
ATOM 5513  H HB3  . GLU A 1 23 ? 1.604   8.285   -2.309  1.00 0.00 ? 23 GLU A HB3  6  
ATOM 5514  H HG2  . GLU A 1 23 ? -0.170  9.490   -3.701  1.00 0.00 ? 23 GLU A HG2  6  
ATOM 5515  H HG3  . GLU A 1 23 ? 0.747   10.955  -3.357  1.00 0.00 ? 23 GLU A HG3  6  
ATOM 5516  N N    . LEU A 1 24 ? 0.501   7.423   0.484   1.00 0.00 ? 24 LEU A N    6  
ATOM 5517  C CA   . LEU A 1 24 ? 0.983   6.789   1.707   1.00 0.00 ? 24 LEU A CA   6  
ATOM 5518  C C    . LEU A 1 24 ? 2.421   6.308   1.540   1.00 0.00 ? 24 LEU A C    6  
ATOM 5519  O O    . LEU A 1 24 ? 2.774   5.721   0.518   1.00 0.00 ? 24 LEU A O    6  
ATOM 5520  C CB   . LEU A 1 24 ? 0.080   5.614   2.086   1.00 0.00 ? 24 LEU A CB   6  
ATOM 5521  C CG   . LEU A 1 24 ? 0.100   5.200   3.557   1.00 0.00 ? 24 LEU A CG   6  
ATOM 5522  C CD1  . LEU A 1 24 ? -0.534  6.277   4.423   1.00 0.00 ? 24 LEU A CD1  6  
ATOM 5523  C CD2  . LEU A 1 24 ? -0.615  3.870   3.747   1.00 0.00 ? 24 LEU A CD2  6  
ATOM 5524  H H    . LEU A 1 24 ? 0.015   6.883   -0.173  1.00 0.00 ? 24 LEU A H    6  
ATOM 5525  H HA   . LEU A 1 24 ? 0.952   7.526   2.496   1.00 0.00 ? 24 LEU A HA   6  
ATOM 5526  H HB2  . LEU A 1 24 ? -0.934  5.880   1.831   1.00 0.00 ? 24 LEU A HB2  6  
ATOM 5527  H HB3  . LEU A 1 24 ? 0.385   4.761   1.496   1.00 0.00 ? 24 LEU A HB3  6  
ATOM 5528  H HG   . LEU A 1 24 ? 1.126   5.077   3.876   1.00 0.00 ? 24 LEU A HG   6  
ATOM 5529  H HD11 . LEU A 1 24 ? 0.101   7.149   4.436   1.00 0.00 ? 24 LEU A HD11 6  
ATOM 5530  H HD12 . LEU A 1 24 ? -0.655  5.904   5.430   1.00 0.00 ? 24 LEU A HD12 6  
ATOM 5531  H HD13 . LEU A 1 24 ? -1.501  6.540   4.019   1.00 0.00 ? 24 LEU A HD13 6  
ATOM 5532  H HD21 . LEU A 1 24 ? -1.012  3.537   2.799   1.00 0.00 ? 24 LEU A HD21 6  
ATOM 5533  H HD22 . LEU A 1 24 ? -1.425  3.994   4.452   1.00 0.00 ? 24 LEU A HD22 6  
ATOM 5534  H HD23 . LEU A 1 24 ? 0.082   3.137   4.124   1.00 0.00 ? 24 LEU A HD23 6  
ATOM 5535  N N    . GLU A 1 25 ? 3.245   6.561   2.552   1.00 0.00 ? 25 GLU A N    6  
ATOM 5536  C CA   . GLU A 1 25 ? 4.644   6.151   2.517   1.00 0.00 ? 25 GLU A CA   6  
ATOM 5537  C C    . GLU A 1 25 ? 4.795   4.691   2.935   1.00 0.00 ? 25 GLU A C    6  
ATOM 5538  O O    . GLU A 1 25 ? 3.969   4.157   3.676   1.00 0.00 ? 25 GLU A O    6  
ATOM 5539  C CB   . GLU A 1 25 ? 5.483   7.044   3.434   1.00 0.00 ? 25 GLU A CB   6  
ATOM 5540  C CG   . GLU A 1 25 ? 6.969   7.018   3.117   1.00 0.00 ? 25 GLU A CG   6  
ATOM 5541  C CD   . GLU A 1 25 ? 7.681   5.843   3.759   1.00 0.00 ? 25 GLU A CD   6  
ATOM 5542  O OE1  . GLU A 1 25 ? 7.151   5.299   4.751   1.00 0.00 ? 25 GLU A OE1  6  
ATOM 5543  O OE2  . GLU A 1 25 ? 8.768   5.469   3.271   1.00 0.00 ? 25 GLU A OE2  6  
ATOM 5544  H H    . GLU A 1 25 ? 2.904   7.033   3.340   1.00 0.00 ? 25 GLU A H    6  
ATOM 5545  H HA   . GLU A 1 25 ? 4.997   6.261   1.503   1.00 0.00 ? 25 GLU A HA   6  
ATOM 5546  H HB2  . GLU A 1 25 ? 5.134   8.062   3.342   1.00 0.00 ? 25 GLU A HB2  6  
ATOM 5547  H HB3  . GLU A 1 25 ? 5.348   6.718   4.455   1.00 0.00 ? 25 GLU A HB3  6  
ATOM 5548  H HG2  . GLU A 1 25 ? 7.094   6.953   2.046   1.00 0.00 ? 25 GLU A HG2  6  
ATOM 5549  H HG3  . GLU A 1 25 ? 7.417   7.932   3.476   1.00 0.00 ? 25 GLU A HG3  6  
ATOM 5550  N N    . LEU A 1 26 ? 5.854   4.051   2.453   1.00 0.00 ? 26 LEU A N    6  
ATOM 5551  C CA   . LEU A 1 26 ? 6.114   2.652   2.775   1.00 0.00 ? 26 LEU A CA   6  
ATOM 5552  C C    . LEU A 1 26 ? 7.590   2.431   3.093   1.00 0.00 ? 26 LEU A C    6  
ATOM 5553  O O    . LEU A 1 26 ? 8.462   3.089   2.525   1.00 0.00 ? 26 LEU A O    6  
ATOM 5554  C CB   . LEU A 1 26 ? 5.691   1.753   1.612   1.00 0.00 ? 26 LEU A CB   6  
ATOM 5555  C CG   . LEU A 1 26 ? 4.245   1.905   1.138   1.00 0.00 ? 26 LEU A CG   6  
ATOM 5556  C CD1  . LEU A 1 26 ? 4.035   1.170   -0.177  1.00 0.00 ? 26 LEU A CD1  6  
ATOM 5557  C CD2  . LEU A 1 26 ? 3.280   1.392   2.197   1.00 0.00 ? 26 LEU A CD2  6  
ATOM 5558  H H    . LEU A 1 26 ? 6.477   4.529   1.867   1.00 0.00 ? 26 LEU A H    6  
ATOM 5559  H HA   . LEU A 1 26 ? 5.529   2.398   3.646   1.00 0.00 ? 26 LEU A HA   6  
ATOM 5560  H HB2  . LEU A 1 26 ? 6.337   1.970   0.775   1.00 0.00 ? 26 LEU A HB2  6  
ATOM 5561  H HB3  . LEU A 1 26 ? 5.834   0.727   1.919   1.00 0.00 ? 26 LEU A HB3  6  
ATOM 5562  H HG   . LEU A 1 26 ? 4.035   2.952   0.972   1.00 0.00 ? 26 LEU A HG   6  
ATOM 5563  H HD11 . LEU A 1 26 ? 4.511   0.203   -0.129  1.00 0.00 ? 26 LEU A HD11 6  
ATOM 5564  H HD12 . LEU A 1 26 ? 4.467   1.745   -0.983  1.00 0.00 ? 26 LEU A HD12 6  
ATOM 5565  H HD13 . LEU A 1 26 ? 2.976   1.043   -0.353  1.00 0.00 ? 26 LEU A HD13 6  
ATOM 5566  H HD21 . LEU A 1 26 ? 3.291   2.060   3.046   1.00 0.00 ? 26 LEU A HD21 6  
ATOM 5567  H HD22 . LEU A 1 26 ? 3.584   0.404   2.513   1.00 0.00 ? 26 LEU A HD22 6  
ATOM 5568  H HD23 . LEU A 1 26 ? 2.283   1.349   1.785   1.00 0.00 ? 26 LEU A HD23 6  
ATOM 5569  N N    . ARG A 1 27 ? 7.861   1.500   4.001   1.00 0.00 ? 27 ARG A N    6  
ATOM 5570  C CA   . ARG A 1 27 ? 9.231   1.192   4.393   1.00 0.00 ? 27 ARG A CA   6  
ATOM 5571  C C    . ARG A 1 27 ? 9.536   -0.289  4.186   1.00 0.00 ? 27 ARG A C    6  
ATOM 5572  O O    . ARG A 1 27 ? 8.773   -1.155  4.613   1.00 0.00 ? 27 ARG A O    6  
ATOM 5573  C CB   . ARG A 1 27 ? 9.463   1.571   5.857   1.00 0.00 ? 27 ARG A CB   6  
ATOM 5574  C CG   . ARG A 1 27 ? 10.908  1.920   6.174   1.00 0.00 ? 27 ARG A CG   6  
ATOM 5575  C CD   . ARG A 1 27 ? 11.131  2.063   7.672   1.00 0.00 ? 27 ARG A CD   6  
ATOM 5576  N NE   . ARG A 1 27 ? 11.472  0.789   8.298   1.00 0.00 ? 27 ARG A NE   6  
ATOM 5577  C CZ   . ARG A 1 27 ? 12.661  0.208   8.183   1.00 0.00 ? 27 ARG A CZ   6  
ATOM 5578  N NH1  . ARG A 1 27 ? 13.618  0.785   7.469   1.00 0.00 ? 27 ARG A NH1  6  
ATOM 5579  N NH2  . ARG A 1 27 ? 12.896  -0.952  8.783   1.00 0.00 ? 27 ARG A NH2  6  
ATOM 5580  H H    . ARG A 1 27 ? 7.123   1.009   4.418   1.00 0.00 ? 27 ARG A H    6  
ATOM 5581  H HA   . ARG A 1 27 ? 9.894   1.774   3.770   1.00 0.00 ? 27 ARG A HA   6  
ATOM 5582  H HB2  . ARG A 1 27 ? 8.849   2.426   6.097   1.00 0.00 ? 27 ARG A HB2  6  
ATOM 5583  H HB3  . ARG A 1 27 ? 9.170   0.741   6.482   1.00 0.00 ? 27 ARG A HB3  6  
ATOM 5584  H HG2  . ARG A 1 27 ? 11.549  1.135   5.800   1.00 0.00 ? 27 ARG A HG2  6  
ATOM 5585  H HG3  . ARG A 1 27 ? 11.158  2.852   5.691   1.00 0.00 ? 27 ARG A HG3  6  
ATOM 5586  H HD2  . ARG A 1 27 ? 11.937  2.762   7.837   1.00 0.00 ? 27 ARG A HD2  6  
ATOM 5587  H HD3  . ARG A 1 27 ? 10.226  2.444   8.121   1.00 0.00 ? 27 ARG A HD3  6  
ATOM 5588  H HE   . ARG A 1 27 ? 10.780  0.345   8.831   1.00 0.00 ? 27 ARG A HE   6  
ATOM 5589  H HH11 . ARG A 1 27 ? 13.444  1.660   7.017   1.00 0.00 ? 27 ARG A HH11 6  
ATOM 5590  H HH12 . ARG A 1 27 ? 14.513  0.347   7.385   1.00 0.00 ? 27 ARG A HH12 6  
ATOM 5591  H HH21 . ARG A 1 27 ? 12.177  -1.389  9.323   1.00 0.00 ? 27 ARG A HH21 6  
ATOM 5592  H HH22 . ARG A 1 27 ? 13.791  -1.387  8.696   1.00 0.00 ? 27 ARG A HH22 6  
ATOM 5593  N N    . GLU A 1 28 ? 10.656  -0.571  3.526   1.00 0.00 ? 28 GLU A N    6  
ATOM 5594  C CA   . GLU A 1 28 ? 11.059  -1.947  3.262   1.00 0.00 ? 28 GLU A CA   6  
ATOM 5595  C C    . GLU A 1 28 ? 10.885  -2.814  4.505   1.00 0.00 ? 28 GLU A C    6  
ATOM 5596  O O    . GLU A 1 28 ? 11.642  -2.697  5.468   1.00 0.00 ? 28 GLU A O    6  
ATOM 5597  C CB   . GLU A 1 28 ? 12.516  -1.993  2.794   1.00 0.00 ? 28 GLU A CB   6  
ATOM 5598  C CG   . GLU A 1 28 ? 12.933  -3.344  2.238   1.00 0.00 ? 28 GLU A CG   6  
ATOM 5599  C CD   . GLU A 1 28 ? 14.440  -3.509  2.175   1.00 0.00 ? 28 GLU A CD   6  
ATOM 5600  O OE1  . GLU A 1 28 ? 15.040  -3.087  1.164   1.00 0.00 ? 28 GLU A OE1  6  
ATOM 5601  O OE2  . GLU A 1 28 ? 15.018  -4.058  3.136   1.00 0.00 ? 28 GLU A OE2  6  
ATOM 5602  H H    . GLU A 1 28 ? 11.222  0.163   3.210   1.00 0.00 ? 28 GLU A H    6  
ATOM 5603  H HA   . GLU A 1 28 ? 10.427  -2.333  2.477   1.00 0.00 ? 28 GLU A HA   6  
ATOM 5604  H HB2  . GLU A 1 28 ? 12.658  -1.250  2.023   1.00 0.00 ? 28 GLU A HB2  6  
ATOM 5605  H HB3  . GLU A 1 28 ? 13.157  -1.758  3.631   1.00 0.00 ? 28 GLU A HB3  6  
ATOM 5606  H HG2  . GLU A 1 28 ? 12.528  -4.120  2.870   1.00 0.00 ? 28 GLU A HG2  6  
ATOM 5607  H HG3  . GLU A 1 28 ? 12.533  -3.448  1.241   1.00 0.00 ? 28 GLU A HG3  6  
ATOM 5608  N N    . GLY A 1 29 ? 9.880   -3.684  4.477   1.00 0.00 ? 29 GLY A N    6  
ATOM 5609  C CA   . GLY A 1 29 ? 9.623   -4.557  5.607   1.00 0.00 ? 29 GLY A CA   6  
ATOM 5610  C C    . GLY A 1 29 ? 8.561   -4.005  6.537   1.00 0.00 ? 29 GLY A C    6  
ATOM 5611  O O    . GLY A 1 29 ? 8.663   -4.140  7.756   1.00 0.00 ? 29 GLY A O    6  
ATOM 5612  H H    . GLY A 1 29 ? 9.308   -3.733  3.682   1.00 0.00 ? 29 GLY A H    6  
ATOM 5613  H HA2  . GLY A 1 29 ? 9.299   -5.519  5.238   1.00 0.00 ? 29 GLY A HA2  6  
ATOM 5614  H HA3  . GLY A 1 29 ? 10.540  -4.686  6.163   1.00 0.00 ? 29 GLY A HA3  6  
ATOM 5615  N N    . ASP A 1 30 ? 7.539   -3.381  5.961   1.00 0.00 ? 30 ASP A N    6  
ATOM 5616  C CA   . ASP A 1 30 ? 6.454   -2.805  6.747   1.00 0.00 ? 30 ASP A CA   6  
ATOM 5617  C C    . ASP A 1 30 ? 5.110   -3.394  6.330   1.00 0.00 ? 30 ASP A C    6  
ATOM 5618  O O    . ASP A 1 30 ? 4.886   -3.683  5.154   1.00 0.00 ? 30 ASP A O    6  
ATOM 5619  C CB   . ASP A 1 30 ? 6.430   -1.284  6.586   1.00 0.00 ? 30 ASP A CB   6  
ATOM 5620  C CG   . ASP A 1 30 ? 7.364   -0.585  7.555   1.00 0.00 ? 30 ASP A CG   6  
ATOM 5621  O OD1  . ASP A 1 30 ? 8.501   -1.067  7.736   1.00 0.00 ? 30 ASP A OD1  6  
ATOM 5622  O OD2  . ASP A 1 30 ? 6.956   0.445   8.131   1.00 0.00 ? 30 ASP A OD2  6  
ATOM 5623  H H    . ASP A 1 30 ? 7.515   -3.305  4.984   1.00 0.00 ? 30 ASP A H    6  
ATOM 5624  H HA   . ASP A 1 30 ? 6.632   -3.045  7.784   1.00 0.00 ? 30 ASP A HA   6  
ATOM 5625  H HB2  . ASP A 1 30 ? 6.730   -1.030  5.580   1.00 0.00 ? 30 ASP A HB2  6  
ATOM 5626  H HB3  . ASP A 1 30 ? 5.426   -0.926  6.759   1.00 0.00 ? 30 ASP A HB3  6  
ATOM 5627  N N    . ARG A 1 31 ? 4.220   -3.570  7.301   1.00 0.00 ? 31 ARG A N    6  
ATOM 5628  C CA   . ARG A 1 31 ? 2.899   -4.127  7.036   1.00 0.00 ? 31 ARG A CA   6  
ATOM 5629  C C    . ARG A 1 31 ? 1.936   -3.041  6.566   1.00 0.00 ? 31 ARG A C    6  
ATOM 5630  O O    . ARG A 1 31 ? 2.020   -1.892  7.000   1.00 0.00 ? 31 ARG A O    6  
ATOM 5631  C CB   . ARG A 1 31 ? 2.347   -4.806  8.290   1.00 0.00 ? 31 ARG A CB   6  
ATOM 5632  C CG   . ARG A 1 31 ? 3.122   -6.047  8.703   1.00 0.00 ? 31 ARG A CG   6  
ATOM 5633  C CD   . ARG A 1 31 ? 2.828   -7.220  7.781   1.00 0.00 ? 31 ARG A CD   6  
ATOM 5634  N NE   . ARG A 1 31 ? 1.648   -7.968  8.206   1.00 0.00 ? 31 ARG A NE   6  
ATOM 5635  C CZ   . ARG A 1 31 ? 1.607   -8.714  9.304   1.00 0.00 ? 31 ARG A CZ   6  
ATOM 5636  N NH1  . ARG A 1 31 ? 2.675   -8.810  10.084  1.00 0.00 ? 31 ARG A NH1  6  
ATOM 5637  N NH2  . ARG A 1 31 ? 0.496   -9.365  9.624   1.00 0.00 ? 31 ARG A NH2  6  
ATOM 5638  H H    . ARG A 1 31 ? 4.458   -3.321  8.219   1.00 0.00 ? 31 ARG A H    6  
ATOM 5639  H HA   . ARG A 1 31 ? 3.001   -4.864  6.253   1.00 0.00 ? 31 ARG A HA   6  
ATOM 5640  H HB2  . ARG A 1 31 ? 2.375   -4.102  9.109   1.00 0.00 ? 31 ARG A HB2  6  
ATOM 5641  H HB3  . ARG A 1 31 ? 1.322   -5.093  8.108   1.00 0.00 ? 31 ARG A HB3  6  
ATOM 5642  H HG2  . ARG A 1 31 ? 4.179   -5.829  8.664   1.00 0.00 ? 31 ARG A HG2  6  
ATOM 5643  H HG3  . ARG A 1 31 ? 2.844   -6.314  9.711   1.00 0.00 ? 31 ARG A HG3  6  
ATOM 5644  H HD2  . ARG A 1 31 ? 2.664   -6.843  6.782   1.00 0.00 ? 31 ARG A HD2  6  
ATOM 5645  H HD3  . ARG A 1 31 ? 3.682   -7.881  7.779   1.00 0.00 ? 31 ARG A HD3  6  
ATOM 5646  H HE   . ARG A 1 31 ? 0.848   -7.910  7.643   1.00 0.00 ? 31 ARG A HE   6  
ATOM 5647  H HH11 . ARG A 1 31 ? 3.513   -8.320  9.846   1.00 0.00 ? 31 ARG A HH11 6  
ATOM 5648  H HH12 . ARG A 1 31 ? 2.641   -9.371  10.911  1.00 0.00 ? 31 ARG A HH12 6  
ATOM 5649  H HH21 . ARG A 1 31 ? -0.311  -9.294  9.038   1.00 0.00 ? 31 ARG A HH21 6  
ATOM 5650  H HH22 . ARG A 1 31 ? 0.466   -9.926  10.451  1.00 0.00 ? 31 ARG A HH22 6  
ATOM 5651  N N    . VAL A 1 32 ? 1.021   -3.413  5.676   1.00 0.00 ? 32 VAL A N    6  
ATOM 5652  C CA   . VAL A 1 32 ? 0.041   -2.471  5.147   1.00 0.00 ? 32 VAL A CA   6  
ATOM 5653  C C    . VAL A 1 32 ? -1.367  -3.052  5.209   1.00 0.00 ? 32 VAL A C    6  
ATOM 5654  O O    . VAL A 1 32 ? -1.552  -4.267  5.142   1.00 0.00 ? 32 VAL A O    6  
ATOM 5655  C CB   . VAL A 1 32 ? 0.363   -2.085  3.691   1.00 0.00 ? 32 VAL A CB   6  
ATOM 5656  C CG1  . VAL A 1 32 ? -0.502  -0.916  3.246   1.00 0.00 ? 32 VAL A CG1  6  
ATOM 5657  C CG2  . VAL A 1 32 ? 1.840   -1.753  3.542   1.00 0.00 ? 32 VAL A CG2  6  
ATOM 5658  H H    . VAL A 1 32 ? 1.004   -4.343  5.368   1.00 0.00 ? 32 VAL A H    6  
ATOM 5659  H HA   . VAL A 1 32 ? 0.078   -1.577  5.752   1.00 0.00 ? 32 VAL A HA   6  
ATOM 5660  H HB   . VAL A 1 32 ? 0.140   -2.931  3.058   1.00 0.00 ? 32 VAL A HB   6  
ATOM 5661  H HG11 . VAL A 1 32 ? 0.078   -0.259  2.615   1.00 0.00 ? 32 VAL A HG11 6  
ATOM 5662  H HG12 . VAL A 1 32 ? -1.354  -1.287  2.694   1.00 0.00 ? 32 VAL A HG12 6  
ATOM 5663  H HG13 . VAL A 1 32 ? -0.845  -0.371  4.113   1.00 0.00 ? 32 VAL A HG13 6  
ATOM 5664  H HG21 . VAL A 1 32 ? 2.334   -1.877  4.495   1.00 0.00 ? 32 VAL A HG21 6  
ATOM 5665  H HG22 . VAL A 1 32 ? 2.287   -2.417  2.817   1.00 0.00 ? 32 VAL A HG22 6  
ATOM 5666  H HG23 . VAL A 1 32 ? 1.948   -0.732  3.210   1.00 0.00 ? 32 VAL A HG23 6  
ATOM 5667  N N    . ASP A 1 33 ? -2.357  -2.175  5.335   1.00 0.00 ? 33 ASP A N    6  
ATOM 5668  C CA   . ASP A 1 33 ? -3.750  -2.600  5.404   1.00 0.00 ? 33 ASP A CA   6  
ATOM 5669  C C    . ASP A 1 33 ? -4.533  -2.092  4.197   1.00 0.00 ? 33 ASP A C    6  
ATOM 5670  O O    . ASP A 1 33 ? -5.170  -1.040  4.254   1.00 0.00 ? 33 ASP A O    6  
ATOM 5671  C CB   . ASP A 1 33 ? -4.397  -2.095  6.695   1.00 0.00 ? 33 ASP A CB   6  
ATOM 5672  C CG   . ASP A 1 33 ? -5.494  -3.016  7.191   1.00 0.00 ? 33 ASP A CG   6  
ATOM 5673  O OD1  . ASP A 1 33 ? -5.167  -4.108  7.702   1.00 0.00 ? 33 ASP A OD1  6  
ATOM 5674  O OD2  . ASP A 1 33 ? -6.680  -2.644  7.069   1.00 0.00 ? 33 ASP A OD2  6  
ATOM 5675  H H    . ASP A 1 33 ? -2.146  -1.219  5.383   1.00 0.00 ? 33 ASP A H    6  
ATOM 5676  H HA   . ASP A 1 33 ? -3.769  -3.679  5.401   1.00 0.00 ? 33 ASP A HA   6  
ATOM 5677  H HB2  . ASP A 1 33 ? -3.641  -2.021  7.463   1.00 0.00 ? 33 ASP A HB2  6  
ATOM 5678  H HB3  . ASP A 1 33 ? -4.822  -1.119  6.519   1.00 0.00 ? 33 ASP A HB3  6  
ATOM 5679  N N    . VAL A 1 34 ? -4.480  -2.846  3.103   1.00 0.00 ? 34 VAL A N    6  
ATOM 5680  C CA   . VAL A 1 34 ? -5.184  -2.473  1.882   1.00 0.00 ? 34 VAL A CA   6  
ATOM 5681  C C    . VAL A 1 34 ? -6.694  -2.571  2.067   1.00 0.00 ? 34 VAL A C    6  
ATOM 5682  O O    . VAL A 1 34 ? -7.203  -3.565  2.586   1.00 0.00 ? 34 VAL A O    6  
ATOM 5683  C CB   . VAL A 1 34 ? -4.763  -3.364  0.698   1.00 0.00 ? 34 VAL A CB   6  
ATOM 5684  C CG1  . VAL A 1 34 ? -5.777  -3.263  -0.432  1.00 0.00 ? 34 VAL A CG1  6  
ATOM 5685  C CG2  . VAL A 1 34 ? -3.373  -2.982  0.213   1.00 0.00 ? 34 VAL A CG2  6  
ATOM 5686  H H    . VAL A 1 34 ? -3.955  -3.674  3.119   1.00 0.00 ? 34 VAL A H    6  
ATOM 5687  H HA   . VAL A 1 34 ? -4.925  -1.451  1.647   1.00 0.00 ? 34 VAL A HA   6  
ATOM 5688  H HB   . VAL A 1 34 ? -4.735  -4.389  1.036   1.00 0.00 ? 34 VAL A HB   6  
ATOM 5689  H HG11 . VAL A 1 34 ? -6.244  -2.289  -0.411  1.00 0.00 ? 34 VAL A HG11 6  
ATOM 5690  H HG12 . VAL A 1 34 ? -5.276  -3.403  -1.379  1.00 0.00 ? 34 VAL A HG12 6  
ATOM 5691  H HG13 . VAL A 1 34 ? -6.531  -4.026  -0.307  1.00 0.00 ? 34 VAL A HG13 6  
ATOM 5692  H HG21 . VAL A 1 34 ? -3.203  -1.933  0.399   1.00 0.00 ? 34 VAL A HG21 6  
ATOM 5693  H HG22 . VAL A 1 34 ? -2.634  -3.566  0.743   1.00 0.00 ? 34 VAL A HG22 6  
ATOM 5694  H HG23 . VAL A 1 34 ? -3.294  -3.178  -0.846  1.00 0.00 ? 34 VAL A HG23 6  
ATOM 5695  N N    . MET A 1 35 ? -7.406  -1.535  1.637   1.00 0.00 ? 35 MET A N    6  
ATOM 5696  C CA   . MET A 1 35 ? -8.859  -1.505  1.753   1.00 0.00 ? 35 MET A CA   6  
ATOM 5697  C C    . MET A 1 35 ? -9.516  -1.598  0.380   1.00 0.00 ? 35 MET A C    6  
ATOM 5698  O O    . MET A 1 35 ? -10.422 -2.404  0.169   1.00 0.00 ? 35 MET A O    6  
ATOM 5699  C CB   . MET A 1 35 ? -9.310  -0.226  2.462   1.00 0.00 ? 35 MET A CB   6  
ATOM 5700  C CG   . MET A 1 35 ? -8.408  0.178   3.617   1.00 0.00 ? 35 MET A CG   6  
ATOM 5701  S SD   . MET A 1 35 ? -8.900  -0.576  5.179   1.00 0.00 ? 35 MET A SD   6  
ATOM 5702  C CE   . MET A 1 35 ? -7.783  0.241   6.316   1.00 0.00 ? 35 MET A CE   6  
ATOM 5703  H H    . MET A 1 35 ? -6.944  -0.771  1.231   1.00 0.00 ? 35 MET A H    6  
ATOM 5704  H HA   . MET A 1 35 ? -9.162  -2.358  2.342   1.00 0.00 ? 35 MET A HA   6  
ATOM 5705  H HB2  . MET A 1 35 ? -9.325  0.582   1.745   1.00 0.00 ? 35 MET A HB2  6  
ATOM 5706  H HB3  . MET A 1 35 ? -10.307 -0.374  2.847   1.00 0.00 ? 35 MET A HB3  6  
ATOM 5707  H HG2  . MET A 1 35 ? -7.397  -0.125  3.390   1.00 0.00 ? 35 MET A HG2  6  
ATOM 5708  H HG3  . MET A 1 35 ? -8.444  1.252   3.724   1.00 0.00 ? 35 MET A HG3  6  
ATOM 5709  H HE1  . MET A 1 35 ? -8.348  0.667   7.132   1.00 0.00 ? 35 MET A HE1  6  
ATOM 5710  H HE2  . MET A 1 35 ? -7.076  -0.477  6.704   1.00 0.00 ? 35 MET A HE2  6  
ATOM 5711  H HE3  . MET A 1 35 ? -7.252  1.026   5.797   1.00 0.00 ? 35 MET A HE3  6  
ATOM 5712  N N    . GLN A 1 36 ? -9.054  -0.768  -0.550  1.00 0.00 ? 36 GLN A N    6  
ATOM 5713  C CA   . GLN A 1 36 ? -9.599  -0.757  -1.902  1.00 0.00 ? 36 GLN A CA   6  
ATOM 5714  C C    . GLN A 1 36 ? -8.516  -1.076  -2.928  1.00 0.00 ? 36 GLN A C    6  
ATOM 5715  O O    . GLN A 1 36 ? -7.328  -1.079  -2.608  1.00 0.00 ? 36 GLN A O    6  
ATOM 5716  C CB   . GLN A 1 36 ? -10.225 0.604   -2.211  1.00 0.00 ? 36 GLN A CB   6  
ATOM 5717  C CG   . GLN A 1 36 ? -10.873 0.678   -3.585  1.00 0.00 ? 36 GLN A CG   6  
ATOM 5718  C CD   . GLN A 1 36 ? -11.605 1.985   -3.815  1.00 0.00 ? 36 GLN A CD   6  
ATOM 5719  O OE1  . GLN A 1 36 ? -11.144 3.050   -3.403  1.00 0.00 ? 36 GLN A OE1  6  
ATOM 5720  N NE2  . GLN A 1 36 ? -12.754 1.912   -4.477  1.00 0.00 ? 36 GLN A NE2  6  
ATOM 5721  H H    . GLN A 1 36 ? -8.331  -0.149  -0.321  1.00 0.00 ? 36 GLN A H    6  
ATOM 5722  H HA   . GLN A 1 36 ? -10.364 -1.516  -1.958  1.00 0.00 ? 36 GLN A HA   6  
ATOM 5723  H HB2  . GLN A 1 36 ? -10.980 0.816   -1.469  1.00 0.00 ? 36 GLN A HB2  6  
ATOM 5724  H HB3  . GLN A 1 36 ? -9.457  1.361   -2.159  1.00 0.00 ? 36 GLN A HB3  6  
ATOM 5725  H HG2  . GLN A 1 36 ? -10.104 0.577   -4.337  1.00 0.00 ? 36 GLN A HG2  6  
ATOM 5726  H HG3  . GLN A 1 36 ? -11.578 -0.135  -3.680  1.00 0.00 ? 36 GLN A HG3  6  
ATOM 5727  H HE21 . GLN A 1 36 ? -13.060 1.029   -4.775  1.00 0.00 ? 36 GLN A HE21 6  
ATOM 5728  H HE22 . GLN A 1 36 ? -13.248 2.741   -4.640  1.00 0.00 ? 36 GLN A HE22 6  
ATOM 5729  N N    . GLN A 1 37 ? -8.936  -1.344  -4.160  1.00 0.00 ? 37 GLN A N    6  
ATOM 5730  C CA   . GLN A 1 37 ? -8.001  -1.665  -5.232  1.00 0.00 ? 37 GLN A CA   6  
ATOM 5731  C C    . GLN A 1 37 ? -8.392  -0.959  -6.526  1.00 0.00 ? 37 GLN A C    6  
ATOM 5732  O O    . GLN A 1 37 ? -9.531  -1.064  -6.982  1.00 0.00 ? 37 GLN A O    6  
ATOM 5733  C CB   . GLN A 1 37 ? -7.951  -3.178  -5.458  1.00 0.00 ? 37 GLN A CB   6  
ATOM 5734  C CG   . GLN A 1 37 ? -7.814  -3.980  -4.174  1.00 0.00 ? 37 GLN A CG   6  
ATOM 5735  C CD   . GLN A 1 37 ? -7.642  -5.465  -4.429  1.00 0.00 ? 37 GLN A CD   6  
ATOM 5736  O OE1  . GLN A 1 37 ? -6.795  -5.876  -5.221  1.00 0.00 ? 37 GLN A OE1  6  
ATOM 5737  N NE2  . GLN A 1 37 ? -8.449  -6.278  -3.757  1.00 0.00 ? 37 GLN A NE2  6  
ATOM 5738  H H    . GLN A 1 37 ? -9.896  -1.326  -4.353  1.00 0.00 ? 37 GLN A H    6  
ATOM 5739  H HA   . GLN A 1 37 ? -7.022  -1.323  -4.932  1.00 0.00 ? 37 GLN A HA   6  
ATOM 5740  H HB2  . GLN A 1 37 ? -8.859  -3.486  -5.954  1.00 0.00 ? 37 GLN A HB2  6  
ATOM 5741  H HB3  . GLN A 1 37 ? -7.107  -3.407  -6.092  1.00 0.00 ? 37 GLN A HB3  6  
ATOM 5742  H HG2  . GLN A 1 37 ? -6.951  -3.622  -3.631  1.00 0.00 ? 37 GLN A HG2  6  
ATOM 5743  H HG3  . GLN A 1 37 ? -8.701  -3.832  -3.576  1.00 0.00 ? 37 GLN A HG3  6  
ATOM 5744  H HE21 . GLN A 1 37 ? -9.102  -5.879  -3.143  1.00 0.00 ? 37 GLN A HE21 6  
ATOM 5745  H HE22 . GLN A 1 37 ? -8.361  -7.242  -3.903  1.00 0.00 ? 37 GLN A HE22 6  
ATOM 5746  N N    . CYS A 1 38 ? -7.441  -0.240  -7.112  1.00 0.00 ? 38 CYS A N    6  
ATOM 5747  C CA   . CYS A 1 38 ? -7.687  0.485   -8.354  1.00 0.00 ? 38 CYS A CA   6  
ATOM 5748  C C    . CYS A 1 38 ? -7.436  -0.408  -9.564  1.00 0.00 ? 38 CYS A C    6  
ATOM 5749  O O    . CYS A 1 38 ? -6.578  -1.290  -9.530  1.00 0.00 ? 38 CYS A O    6  
ATOM 5750  C CB   . CYS A 1 38 ? -6.798  1.727   -8.428  1.00 0.00 ? 38 CYS A CB   6  
ATOM 5751  S SG   . CYS A 1 38 ? -7.475  3.060   -9.444  1.00 0.00 ? 38 CYS A SG   6  
ATOM 5752  H H    . CYS A 1 38 ? -6.553  -0.195  -6.701  1.00 0.00 ? 38 CYS A H    6  
ATOM 5753  H HA   . CYS A 1 38 ? -8.722  0.793   -8.357  1.00 0.00 ? 38 CYS A HA   6  
ATOM 5754  H HB2  . CYS A 1 38 ? -6.652  2.117   -7.431  1.00 0.00 ? 38 CYS A HB2  6  
ATOM 5755  H HB3  . CYS A 1 38 ? -5.840  1.450   -8.842  1.00 0.00 ? 38 CYS A HB3  6  
ATOM 5756  H HG   . CYS A 1 38 ? -6.474  3.613   -10.113 1.00 0.00 ? 38 CYS A HG   6  
ATOM 5757  N N    . ASP A 1 39 ? -8.192  -0.175  -10.631 1.00 0.00 ? 39 ASP A N    6  
ATOM 5758  C CA   . ASP A 1 39 ? -8.052  -0.959  -11.853 1.00 0.00 ? 39 ASP A CA   6  
ATOM 5759  C C    . ASP A 1 39 ? -6.838  -0.502  -12.656 1.00 0.00 ? 39 ASP A C    6  
ATOM 5760  O O    . ASP A 1 39 ? -6.548  -1.043  -13.724 1.00 0.00 ? 39 ASP A O    6  
ATOM 5761  C CB   . ASP A 1 39 ? -9.316  -0.844  -12.706 1.00 0.00 ? 39 ASP A CB   6  
ATOM 5762  C CG   . ASP A 1 39 ? -10.583 -0.924  -11.877 1.00 0.00 ? 39 ASP A CG   6  
ATOM 5763  O OD1  . ASP A 1 39 ? -11.050 -2.052  -11.614 1.00 0.00 ? 39 ASP A OD1  6  
ATOM 5764  O OD2  . ASP A 1 39 ? -11.106 0.142   -11.490 1.00 0.00 ? 39 ASP A OD2  6  
ATOM 5765  H H    . ASP A 1 39 ? -8.859  0.542   -10.597 1.00 0.00 ? 39 ASP A H    6  
ATOM 5766  H HA   . ASP A 1 39 ? -7.912  -1.991  -11.571 1.00 0.00 ? 39 ASP A HA   6  
ATOM 5767  H HB2  . ASP A 1 39 ? -9.307  0.103   -13.225 1.00 0.00 ? 39 ASP A HB2  6  
ATOM 5768  H HB3  . ASP A 1 39 ? -9.329  -1.646  -13.429 1.00 0.00 ? 39 ASP A HB3  6  
ATOM 5769  N N    . ASP A 1 40 ? -6.134  0.498   -12.137 1.00 0.00 ? 40 ASP A N    6  
ATOM 5770  C CA   . ASP A 1 40 ? -4.952  1.029   -12.806 1.00 0.00 ? 40 ASP A CA   6  
ATOM 5771  C C    . ASP A 1 40 ? -3.705  0.243   -12.411 1.00 0.00 ? 40 ASP A C    6  
ATOM 5772  O O    . ASP A 1 40 ? -2.772  0.102   -13.200 1.00 0.00 ? 40 ASP A O    6  
ATOM 5773  C CB   . ASP A 1 40 ? -4.767  2.508   -12.464 1.00 0.00 ? 40 ASP A CB   6  
ATOM 5774  C CG   . ASP A 1 40 ? -5.889  3.372   -13.007 1.00 0.00 ? 40 ASP A CG   6  
ATOM 5775  O OD1  . ASP A 1 40 ? -7.046  2.902   -13.020 1.00 0.00 ? 40 ASP A OD1  6  
ATOM 5776  O OD2  . ASP A 1 40 ? -5.610  4.518   -13.419 1.00 0.00 ? 40 ASP A OD2  6  
ATOM 5777  H H    . ASP A 1 40 ? -6.416  0.888   -11.283 1.00 0.00 ? 40 ASP A H    6  
ATOM 5778  H HA   . ASP A 1 40 ? -5.101  0.931   -13.871 1.00 0.00 ? 40 ASP A HA   6  
ATOM 5779  H HB2  . ASP A 1 40 ? -4.738  2.622   -11.390 1.00 0.00 ? 40 ASP A HB2  6  
ATOM 5780  H HB3  . ASP A 1 40 ? -3.835  2.854   -12.885 1.00 0.00 ? 40 ASP A HB3  6  
ATOM 5781  N N    . GLY A 1 41 ? -3.697  -0.265  -11.182 1.00 0.00 ? 41 GLY A N    6  
ATOM 5782  C CA   . GLY A 1 41 ? -2.560  -1.029  -10.703 1.00 0.00 ? 41 GLY A CA   6  
ATOM 5783  C C    . GLY A 1 41 ? -2.025  -0.507  -9.384  1.00 0.00 ? 41 GLY A C    6  
ATOM 5784  O O    . GLY A 1 41 ? -0.890  -0.799  -9.008  1.00 0.00 ? 41 GLY A O    6  
ATOM 5785  H H    . GLY A 1 41 ? -4.470  -0.121  -10.596 1.00 0.00 ? 41 GLY A H    6  
ATOM 5786  H HA2  . GLY A 1 41 ? -2.860  -2.059  -10.576 1.00 0.00 ? 41 GLY A HA2  6  
ATOM 5787  H HA3  . GLY A 1 41 ? -1.773  -0.982  -11.441 1.00 0.00 ? 41 GLY A HA3  6  
ATOM 5788  N N    . TRP A 1 42 ? -2.843  0.268   -8.681  1.00 0.00 ? 42 TRP A N    6  
ATOM 5789  C CA   . TRP A 1 42 ? -2.445  0.833   -7.397  1.00 0.00 ? 42 TRP A CA   6  
ATOM 5790  C C    . TRP A 1 42 ? -3.275  0.244   -6.262  1.00 0.00 ? 42 TRP A C    6  
ATOM 5791  O O    . TRP A 1 42 ? -4.283  -0.421  -6.498  1.00 0.00 ? 42 TRP A O    6  
ATOM 5792  C CB   . TRP A 1 42 ? -2.595  2.355   -7.418  1.00 0.00 ? 42 TRP A CB   6  
ATOM 5793  C CG   . TRP A 1 42 ? -1.391  3.063   -7.962  1.00 0.00 ? 42 TRP A CG   6  
ATOM 5794  C CD1  . TRP A 1 42 ? -0.793  2.852   -9.172  1.00 0.00 ? 42 TRP A CD1  6  
ATOM 5795  C CD2  . TRP A 1 42 ? -0.638  4.094   -7.315  1.00 0.00 ? 42 TRP A CD2  6  
ATOM 5796  N NE1  . TRP A 1 42 ? 0.286   3.691   -9.315  1.00 0.00 ? 42 TRP A NE1  6  
ATOM 5797  C CE2  . TRP A 1 42 ? 0.402   4.463   -8.190  1.00 0.00 ? 42 TRP A CE2  6  
ATOM 5798  C CE3  . TRP A 1 42 ? -0.742  4.744   -6.082  1.00 0.00 ? 42 TRP A CE3  6  
ATOM 5799  C CZ2  . TRP A 1 42 ? 1.330   5.450   -7.869  1.00 0.00 ? 42 TRP A CZ2  6  
ATOM 5800  C CZ3  . TRP A 1 42 ? 0.179   5.723   -5.764  1.00 0.00 ? 42 TRP A CZ3  6  
ATOM 5801  C CH2  . TRP A 1 42 ? 1.204   6.069   -6.655  1.00 0.00 ? 42 TRP A CH2  6  
ATOM 5802  H H    . TRP A 1 42 ? -3.737  0.464   -9.034  1.00 0.00 ? 42 TRP A H    6  
ATOM 5803  H HA   . TRP A 1 42 ? -1.406  0.585   -7.235  1.00 0.00 ? 42 TRP A HA   6  
ATOM 5804  H HB2  . TRP A 1 42 ? -3.442  2.619   -8.033  1.00 0.00 ? 42 TRP A HB2  6  
ATOM 5805  H HB3  . TRP A 1 42 ? -2.763  2.707   -6.411  1.00 0.00 ? 42 TRP A HB3  6  
ATOM 5806  H HD1  . TRP A 1 42 ? -1.129  2.128   -9.898  1.00 0.00 ? 42 TRP A HD1  6  
ATOM 5807  H HE1  . TRP A 1 42 ? 0.876   3.729   -10.097 1.00 0.00 ? 42 TRP A HE1  6  
ATOM 5808  H HE3  . TRP A 1 42 ? -1.525  4.491   -5.382  1.00 0.00 ? 42 TRP A HE3  6  
ATOM 5809  H HZ2  . TRP A 1 42 ? 2.125   5.729   -8.545  1.00 0.00 ? 42 TRP A HZ2  6  
ATOM 5810  H HZ3  . TRP A 1 42 ? 0.115   6.235   -4.816  1.00 0.00 ? 42 TRP A HZ3  6  
ATOM 5811  H HH2  . TRP A 1 42 ? 1.902   6.840   -6.366  1.00 0.00 ? 42 TRP A HH2  6  
ATOM 5812  N N    . PHE A 1 43 ? -2.844  0.493   -5.029  1.00 0.00 ? 43 PHE A N    6  
ATOM 5813  C CA   . PHE A 1 43 ? -3.548  -0.014  -3.857  1.00 0.00 ? 43 PHE A CA   6  
ATOM 5814  C C    . PHE A 1 43 ? -3.767  1.095   -2.833  1.00 0.00 ? 43 PHE A C    6  
ATOM 5815  O O    . PHE A 1 43 ? -2.840  1.824   -2.482  1.00 0.00 ? 43 PHE A O    6  
ATOM 5816  C CB   . PHE A 1 43 ? -2.762  -1.163  -3.221  1.00 0.00 ? 43 PHE A CB   6  
ATOM 5817  C CG   . PHE A 1 43 ? -2.810  -2.435  -4.018  1.00 0.00 ? 43 PHE A CG   6  
ATOM 5818  C CD1  . PHE A 1 43 ? -4.009  -2.902  -4.532  1.00 0.00 ? 43 PHE A CD1  6  
ATOM 5819  C CD2  . PHE A 1 43 ? -1.656  -3.166  -4.253  1.00 0.00 ? 43 PHE A CD2  6  
ATOM 5820  C CE1  . PHE A 1 43 ? -4.057  -4.072  -5.266  1.00 0.00 ? 43 PHE A CE1  6  
ATOM 5821  C CE2  . PHE A 1 43 ? -1.698  -4.336  -4.986  1.00 0.00 ? 43 PHE A CE2  6  
ATOM 5822  C CZ   . PHE A 1 43 ? -2.900  -4.791  -5.492  1.00 0.00 ? 43 PHE A CZ   6  
ATOM 5823  H H    . PHE A 1 43 ? -2.033  1.030   -4.905  1.00 0.00 ? 43 PHE A H    6  
ATOM 5824  H HA   . PHE A 1 43 ? -4.508  -0.383  -4.182  1.00 0.00 ? 43 PHE A HA   6  
ATOM 5825  H HB2  . PHE A 1 43 ? -1.727  -0.872  -3.125  1.00 0.00 ? 43 PHE A HB2  6  
ATOM 5826  H HB3  . PHE A 1 43 ? -3.167  -1.368  -2.242  1.00 0.00 ? 43 PHE A HB3  6  
ATOM 5827  H HD1  . PHE A 1 43 ? -4.916  -2.340  -4.355  1.00 0.00 ? 43 PHE A HD1  6  
ATOM 5828  H HD2  . PHE A 1 43 ? -0.715  -2.812  -3.857  1.00 0.00 ? 43 PHE A HD2  6  
ATOM 5829  H HE1  . PHE A 1 43 ? -4.999  -4.424  -5.660  1.00 0.00 ? 43 PHE A HE1  6  
ATOM 5830  H HE2  . PHE A 1 43 ? -0.791  -4.897  -5.161  1.00 0.00 ? 43 PHE A HE2  6  
ATOM 5831  H HZ   . PHE A 1 43 ? -2.935  -5.705  -6.066  1.00 0.00 ? 43 PHE A HZ   6  
ATOM 5832  N N    . VAL A 1 44 ? -5.002  1.216   -2.356  1.00 0.00 ? 44 VAL A N    6  
ATOM 5833  C CA   . VAL A 1 44 ? -5.345  2.235   -1.371  1.00 0.00 ? 44 VAL A CA   6  
ATOM 5834  C C    . VAL A 1 44 ? -5.680  1.607   -0.023  1.00 0.00 ? 44 VAL A C    6  
ATOM 5835  O O    . VAL A 1 44 ? -6.587  0.782   0.081   1.00 0.00 ? 44 VAL A O    6  
ATOM 5836  C CB   . VAL A 1 44 ? -6.540  3.088   -1.839  1.00 0.00 ? 44 VAL A CB   6  
ATOM 5837  C CG1  . VAL A 1 44 ? -6.890  4.135   -0.792  1.00 0.00 ? 44 VAL A CG1  6  
ATOM 5838  C CG2  . VAL A 1 44 ? -6.236  3.741   -3.178  1.00 0.00 ? 44 VAL A CG2  6  
ATOM 5839  H H    . VAL A 1 44 ? -5.699  0.605   -2.673  1.00 0.00 ? 44 VAL A H    6  
ATOM 5840  H HA   . VAL A 1 44 ? -4.490  2.885   -1.252  1.00 0.00 ? 44 VAL A HA   6  
ATOM 5841  H HB   . VAL A 1 44 ? -7.393  2.438   -1.964  1.00 0.00 ? 44 VAL A HB   6  
ATOM 5842  H HG11 . VAL A 1 44 ? -7.771  3.822   -0.251  1.00 0.00 ? 44 VAL A HG11 6  
ATOM 5843  H HG12 . VAL A 1 44 ? -6.065  4.248   -0.105  1.00 0.00 ? 44 VAL A HG12 6  
ATOM 5844  H HG13 . VAL A 1 44 ? -7.085  5.079   -1.280  1.00 0.00 ? 44 VAL A HG13 6  
ATOM 5845  H HG21 . VAL A 1 44 ? -6.637  3.132   -3.974  1.00 0.00 ? 44 VAL A HG21 6  
ATOM 5846  H HG22 . VAL A 1 44 ? -6.689  4.722   -3.212  1.00 0.00 ? 44 VAL A HG22 6  
ATOM 5847  H HG23 . VAL A 1 44 ? -5.167  3.835   -3.299  1.00 0.00 ? 44 VAL A HG23 6  
ATOM 5848  N N    . GLY A 1 45 ? -4.940  2.002   1.008   1.00 0.00 ? 45 GLY A N    6  
ATOM 5849  C CA   . GLY A 1 45 ? -5.174  1.468   2.337   1.00 0.00 ? 45 GLY A CA   6  
ATOM 5850  C C    . GLY A 1 45 ? -4.573  2.336   3.425   1.00 0.00 ? 45 GLY A C    6  
ATOM 5851  O O    . GLY A 1 45 ? -4.476  3.554   3.276   1.00 0.00 ? 45 GLY A O    6  
ATOM 5852  H H    . GLY A 1 45 ? -4.230  2.663   0.866   1.00 0.00 ? 45 GLY A H    6  
ATOM 5853  H HA2  . GLY A 1 45 ? -6.239  1.391   2.500   1.00 0.00 ? 45 GLY A HA2  6  
ATOM 5854  H HA3  . GLY A 1 45 ? -4.738  0.482   2.398   1.00 0.00 ? 45 GLY A HA3  6  
ATOM 5855  N N    . VAL A 1 46 ? -4.169  1.708   4.525   1.00 0.00 ? 46 VAL A N    6  
ATOM 5856  C CA   . VAL A 1 46 ? -3.575  2.430   5.643   1.00 0.00 ? 46 VAL A CA   6  
ATOM 5857  C C    . VAL A 1 46 ? -2.255  1.797   6.068   1.00 0.00 ? 46 VAL A C    6  
ATOM 5858  O O    . VAL A 1 46 ? -2.114  0.574   6.071   1.00 0.00 ? 46 VAL A O    6  
ATOM 5859  C CB   . VAL A 1 46 ? -4.525  2.470   6.855   1.00 0.00 ? 46 VAL A CB   6  
ATOM 5860  C CG1  . VAL A 1 46 ? -3.779  2.912   8.104   1.00 0.00 ? 46 VAL A CG1  6  
ATOM 5861  C CG2  . VAL A 1 46 ? -5.706  3.388   6.575   1.00 0.00 ? 46 VAL A CG2  6  
ATOM 5862  H H    . VAL A 1 46 ? -4.273  0.735   4.586   1.00 0.00 ? 46 VAL A H    6  
ATOM 5863  H HA   . VAL A 1 46 ? -3.390  3.446   5.324   1.00 0.00 ? 46 VAL A HA   6  
ATOM 5864  H HB   . VAL A 1 46 ? -4.904  1.472   7.022   1.00 0.00 ? 46 VAL A HB   6  
ATOM 5865  H HG11 . VAL A 1 46 ? -2.988  3.593   7.829   1.00 0.00 ? 46 VAL A HG11 6  
ATOM 5866  H HG12 . VAL A 1 46 ? -4.465  3.408   8.776   1.00 0.00 ? 46 VAL A HG12 6  
ATOM 5867  H HG13 . VAL A 1 46 ? -3.356  2.048   8.595   1.00 0.00 ? 46 VAL A HG13 6  
ATOM 5868  H HG21 . VAL A 1 46 ? -5.677  3.706   5.544   1.00 0.00 ? 46 VAL A HG21 6  
ATOM 5869  H HG22 . VAL A 1 46 ? -6.628  2.856   6.762   1.00 0.00 ? 46 VAL A HG22 6  
ATOM 5870  H HG23 . VAL A 1 46 ? -5.652  4.251   7.221   1.00 0.00 ? 46 VAL A HG23 6  
ATOM 5871  N N    . SER A 1 47 ? -1.289  2.638   6.425   1.00 0.00 ? 47 SER A N    6  
ATOM 5872  C CA   . SER A 1 47 ? 0.022   2.160   6.849   1.00 0.00 ? 47 SER A CA   6  
ATOM 5873  C C    . SER A 1 47 ? -0.025  1.643   8.283   1.00 0.00 ? 47 SER A C    6  
ATOM 5874  O O    . SER A 1 47 ? -0.837  2.095   9.091   1.00 0.00 ? 47 SER A O    6  
ATOM 5875  C CB   . SER A 1 47 ? 1.058   3.280   6.732   1.00 0.00 ? 47 SER A CB   6  
ATOM 5876  O OG   . SER A 1 47 ? 2.362   2.752   6.562   1.00 0.00 ? 47 SER A OG   6  
ATOM 5877  H H    . SER A 1 47 ? -1.463  3.602   6.401   1.00 0.00 ? 47 SER A H    6  
ATOM 5878  H HA   . SER A 1 47 ? 0.306   1.349   6.195   1.00 0.00 ? 47 SER A HA   6  
ATOM 5879  H HB2  . SER A 1 47 ? 0.820   3.900   5.881   1.00 0.00 ? 47 SER A HB2  6  
ATOM 5880  H HB3  . SER A 1 47 ? 1.039   3.880   7.631   1.00 0.00 ? 47 SER A HB3  6  
ATOM 5881  H HG   . SER A 1 47 ? 2.522   2.587   5.630   1.00 0.00 ? 47 SER A HG   6  
ATOM 5882  N N    . ARG A 1 48 ? 0.851   0.693   8.592   1.00 0.00 ? 48 ARG A N    6  
ATOM 5883  C CA   . ARG A 1 48 ? 0.910   0.113   9.929   1.00 0.00 ? 48 ARG A CA   6  
ATOM 5884  C C    . ARG A 1 48 ? 2.092   0.673   10.713  1.00 0.00 ? 48 ARG A C    6  
ATOM 5885  O O    . ARG A 1 48 ? 2.585   0.042   11.648  1.00 0.00 ? 48 ARG A O    6  
ATOM 5886  C CB   . ARG A 1 48 ? 1.017   -1.410  9.842   1.00 0.00 ? 48 ARG A CB   6  
ATOM 5887  C CG   . ARG A 1 48 ? -0.234  -2.079  9.296   1.00 0.00 ? 48 ARG A CG   6  
ATOM 5888  C CD   . ARG A 1 48 ? -1.310  -2.204  10.363  1.00 0.00 ? 48 ARG A CD   6  
ATOM 5889  N NE   . ARG A 1 48 ? -0.804  -2.837  11.578  1.00 0.00 ? 48 ARG A NE   6  
ATOM 5890  C CZ   . ARG A 1 48 ? -1.490  -2.899  12.714  1.00 0.00 ? 48 ARG A CZ   6  
ATOM 5891  N NH1  . ARG A 1 48 ? -2.703  -2.370  12.790  1.00 0.00 ? 48 ARG A NH1  6  
ATOM 5892  N NH2  . ARG A 1 48 ? -0.962  -3.491  13.778  1.00 0.00 ? 48 ARG A NH2  6  
ATOM 5893  H H    . ARG A 1 48 ? 1.473   0.374   7.905   1.00 0.00 ? 48 ARG A H    6  
ATOM 5894  H HA   . ARG A 1 48 ? -0.003  0.372   10.443  1.00 0.00 ? 48 ARG A HA   6  
ATOM 5895  H HB2  . ARG A 1 48 ? 1.846   -1.665  9.197   1.00 0.00 ? 48 ARG A HB2  6  
ATOM 5896  H HB3  . ARG A 1 48 ? 1.207   -1.802  10.830  1.00 0.00 ? 48 ARG A HB3  6  
ATOM 5897  H HG2  . ARG A 1 48 ? -0.620  -1.487  8.479   1.00 0.00 ? 48 ARG A HG2  6  
ATOM 5898  H HG3  . ARG A 1 48 ? 0.024   -3.065  8.938   1.00 0.00 ? 48 ARG A HG3  6  
ATOM 5899  H HD2  . ARG A 1 48 ? -1.673  -1.217  10.607  1.00 0.00 ? 48 ARG A HD2  6  
ATOM 5900  H HD3  . ARG A 1 48 ? -2.120  -2.799  9.969   1.00 0.00 ? 48 ARG A HD3  6  
ATOM 5901  H HE   . ARG A 1 48 ? 0.091   -3.234  11.545  1.00 0.00 ? 48 ARG A HE   6  
ATOM 5902  H HH11 . ARG A 1 48 ? -3.104  -1.924  11.990  1.00 0.00 ? 48 ARG A HH11 6  
ATOM 5903  H HH12 . ARG A 1 48 ? -3.218  -2.419  13.646  1.00 0.00 ? 48 ARG A HH12 6  
ATOM 5904  H HH21 . ARG A 1 48 ? -0.047  -3.891  13.725  1.00 0.00 ? 48 ARG A HH21 6  
ATOM 5905  H HH22 . ARG A 1 48 ? -1.478  -3.537  14.632  1.00 0.00 ? 48 ARG A HH22 6  
ATOM 5906  N N    . ARG A 1 49 ? 2.543   1.862   10.326  1.00 0.00 ? 49 ARG A N    6  
ATOM 5907  C CA   . ARG A 1 49 ? 3.669   2.506   10.992  1.00 0.00 ? 49 ARG A CA   6  
ATOM 5908  C C    . ARG A 1 49 ? 3.327   3.945   11.367  1.00 0.00 ? 49 ARG A C    6  
ATOM 5909  O O    . ARG A 1 49 ? 3.719   4.432   12.428  1.00 0.00 ? 49 ARG A O    6  
ATOM 5910  C CB   . ARG A 1 49 ? 4.904   2.483   10.089  1.00 0.00 ? 49 ARG A CB   6  
ATOM 5911  C CG   . ARG A 1 49 ? 6.087   3.252   10.656  1.00 0.00 ? 49 ARG A CG   6  
ATOM 5912  C CD   . ARG A 1 49 ? 7.384   2.870   9.960   1.00 0.00 ? 49 ARG A CD   6  
ATOM 5913  N NE   . ARG A 1 49 ? 8.016   1.709   10.579  1.00 0.00 ? 49 ARG A NE   6  
ATOM 5914  C CZ   . ARG A 1 49 ? 8.535   1.719   11.802  1.00 0.00 ? 49 ARG A CZ   6  
ATOM 5915  N NH1  . ARG A 1 49 ? 8.496   2.824   12.533  1.00 0.00 ? 49 ARG A NH1  6  
ATOM 5916  N NH2  . ARG A 1 49 ? 9.094   0.621   12.296  1.00 0.00 ? 49 ARG A NH2  6  
ATOM 5917  H H    . ARG A 1 49 ? 2.109   2.316   9.574   1.00 0.00 ? 49 ARG A H    6  
ATOM 5918  H HA   . ARG A 1 49 ? 3.882   1.952   11.893  1.00 0.00 ? 49 ARG A HA   6  
ATOM 5919  H HB2  . ARG A 1 49 ? 5.208   1.457   9.940   1.00 0.00 ? 49 ARG A HB2  6  
ATOM 5920  H HB3  . ARG A 1 49 ? 4.645   2.916   9.135   1.00 0.00 ? 49 ARG A HB3  6  
ATOM 5921  H HG2  . ARG A 1 49 ? 5.916   4.309   10.519  1.00 0.00 ? 49 ARG A HG2  6  
ATOM 5922  H HG3  . ARG A 1 49 ? 6.175   3.032   11.709  1.00 0.00 ? 49 ARG A HG3  6  
ATOM 5923  H HD2  . ARG A 1 49 ? 7.169   2.643   8.926   1.00 0.00 ? 49 ARG A HD2  6  
ATOM 5924  H HD3  . ARG A 1 49 ? 8.063   3.708   10.010  1.00 0.00 ? 49 ARG A HD3  6  
ATOM 5925  H HE   . ARG A 1 49 ? 8.056   0.881   10.056  1.00 0.00 ? 49 ARG A HE   6  
ATOM 5926  H HH11 . ARG A 1 49 ? 8.075   3.652   12.163  1.00 0.00 ? 49 ARG A HH11 6  
ATOM 5927  H HH12 . ARG A 1 49 ? 8.886   2.829   13.454  1.00 0.00 ? 49 ARG A HH12 6  
ATOM 5928  H HH21 . ARG A 1 49 ? 9.125   -0.214  11.748  1.00 0.00 ? 49 ARG A HH21 6  
ATOM 5929  H HH22 . ARG A 1 49 ? 9.484   0.630   13.216  1.00 0.00 ? 49 ARG A HH22 6  
ATOM 5930  N N    . THR A 1 50 ? 2.594   4.623   10.489  1.00 0.00 ? 50 THR A N    6  
ATOM 5931  C CA   . THR A 1 50 ? 2.201   6.006   10.727  1.00 0.00 ? 50 THR A CA   6  
ATOM 5932  C C    . THR A 1 50 ? 0.690   6.128   10.885  1.00 0.00 ? 50 THR A C    6  
ATOM 5933  O O    . THR A 1 50 ? 0.168   7.219   11.116  1.00 0.00 ? 50 THR A O    6  
ATOM 5934  C CB   . THR A 1 50 ? 2.662   6.926   9.581   1.00 0.00 ? 50 THR A CB   6  
ATOM 5935  O OG1  . THR A 1 50 ? 2.228   6.397   8.323   1.00 0.00 ? 50 THR A OG1  6  
ATOM 5936  C CG2  . THR A 1 50 ? 4.176   7.072   9.580   1.00 0.00 ? 50 THR A CG2  6  
ATOM 5937  H H    . THR A 1 50 ? 2.312   4.180   9.661   1.00 0.00 ? 50 THR A H    6  
ATOM 5938  H HA   . THR A 1 50 ? 2.677   6.335   11.639  1.00 0.00 ? 50 THR A HA   6  
ATOM 5939  H HB   . THR A 1 50 ? 2.221   7.902   9.724   1.00 0.00 ? 50 THR A HB   6  
ATOM 5940  H HG1  . THR A 1 50 ? 1.279   6.253   8.347   1.00 0.00 ? 50 THR A HG1  6  
ATOM 5941  H HG21 . THR A 1 50 ? 4.498   7.496   10.520  1.00 0.00 ? 50 THR A HG21 6  
ATOM 5942  H HG22 . THR A 1 50 ? 4.475   7.721   8.771   1.00 0.00 ? 50 THR A HG22 6  
ATOM 5943  H HG23 . THR A 1 50 ? 4.631   6.101   9.450   1.00 0.00 ? 50 THR A HG23 6  
ATOM 5944  N N    . GLN A 1 51 ? -0.007  5.003   10.760  1.00 0.00 ? 51 GLN A N    6  
ATOM 5945  C CA   . GLN A 1 51 ? -1.459  4.986   10.889  1.00 0.00 ? 51 GLN A CA   6  
ATOM 5946  C C    . GLN A 1 51 ? -2.098  6.038   9.988   1.00 0.00 ? 51 GLN A C    6  
ATOM 5947  O O    . GLN A 1 51 ? -3.143  6.601   10.317  1.00 0.00 ? 51 GLN A O    6  
ATOM 5948  C CB   . GLN A 1 51 ? -1.866  5.229   12.343  1.00 0.00 ? 51 GLN A CB   6  
ATOM 5949  C CG   . GLN A 1 51 ? -1.244  4.245   13.321  1.00 0.00 ? 51 GLN A CG   6  
ATOM 5950  C CD   . GLN A 1 51 ? -1.897  4.289   14.688  1.00 0.00 ? 51 GLN A CD   6  
ATOM 5951  O OE1  . GLN A 1 51 ? -1.637  5.192   15.484  1.00 0.00 ? 51 GLN A OE1  6  
ATOM 5952  N NE2  . GLN A 1 51 ? -2.750  3.311   14.969  1.00 0.00 ? 51 GLN A NE2  6  
ATOM 5953  H H    . GLN A 1 51 ? 0.466   4.166   10.576  1.00 0.00 ? 51 GLN A H    6  
ATOM 5954  H HA   . GLN A 1 51 ? -1.808  4.011   10.585  1.00 0.00 ? 51 GLN A HA   6  
ATOM 5955  H HB2  . GLN A 1 51 ? -1.564  6.226   12.628  1.00 0.00 ? 51 GLN A HB2  6  
ATOM 5956  H HB3  . GLN A 1 51 ? -2.940  5.150   12.422  1.00 0.00 ? 51 GLN A HB3  6  
ATOM 5957  H HG2  . GLN A 1 51 ? -1.347  3.246   12.922  1.00 0.00 ? 51 GLN A HG2  6  
ATOM 5958  H HG3  . GLN A 1 51 ? -0.196  4.481   13.431  1.00 0.00 ? 51 GLN A HG3  6  
ATOM 5959  H HE21 . GLN A 1 51 ? -2.907  2.624   14.287  1.00 0.00 ? 51 GLN A HE21 6  
ATOM 5960  H HE22 . GLN A 1 51 ? -3.186  3.314   15.846  1.00 0.00 ? 51 GLN A HE22 6  
ATOM 5961  N N    . LYS A 1 52 ? -1.464  6.300   8.850   1.00 0.00 ? 52 LYS A N    6  
ATOM 5962  C CA   . LYS A 1 52 ? -1.970  7.283   7.900   1.00 0.00 ? 52 LYS A CA   6  
ATOM 5963  C C    . LYS A 1 52 ? -2.741  6.604   6.772   1.00 0.00 ? 52 LYS A C    6  
ATOM 5964  O O    . LYS A 1 52 ? -2.550  5.418   6.504   1.00 0.00 ? 52 LYS A O    6  
ATOM 5965  C CB   . LYS A 1 52 ? -0.816  8.104   7.321   1.00 0.00 ? 52 LYS A CB   6  
ATOM 5966  C CG   . LYS A 1 52 ? -0.196  9.069   8.317   1.00 0.00 ? 52 LYS A CG   6  
ATOM 5967  C CD   . LYS A 1 52 ? -1.044  10.319  8.483   1.00 0.00 ? 52 LYS A CD   6  
ATOM 5968  C CE   . LYS A 1 52 ? -0.878  10.924  9.869   1.00 0.00 ? 52 LYS A CE   6  
ATOM 5969  N NZ   . LYS A 1 52 ? 0.285   11.853  9.933   1.00 0.00 ? 52 LYS A NZ   6  
ATOM 5970  H H    . LYS A 1 52 ? -0.635  5.818   8.644   1.00 0.00 ? 52 LYS A H    6  
ATOM 5971  H HA   . LYS A 1 52 ? -2.639  7.943   8.431   1.00 0.00 ? 52 LYS A HA   6  
ATOM 5972  H HB2  . LYS A 1 52 ? -0.045  7.428   6.979   1.00 0.00 ? 52 LYS A HB2  6  
ATOM 5973  H HB3  . LYS A 1 52 ? -1.182  8.674   6.479   1.00 0.00 ? 52 LYS A HB3  6  
ATOM 5974  H HG2  . LYS A 1 52 ? -0.107  8.577   9.274   1.00 0.00 ? 52 LYS A HG2  6  
ATOM 5975  H HG3  . LYS A 1 52 ? 0.785   9.355   7.964   1.00 0.00 ? 52 LYS A HG3  6  
ATOM 5976  H HD2  . LYS A 1 52 ? -0.743  11.048  7.746   1.00 0.00 ? 52 LYS A HD2  6  
ATOM 5977  H HD3  . LYS A 1 52 ? -2.083  10.061  8.335   1.00 0.00 ? 52 LYS A HD3  6  
ATOM 5978  H HE2  . LYS A 1 52 ? -1.776  11.468  10.120  1.00 0.00 ? 52 LYS A HE2  6  
ATOM 5979  H HE3  . LYS A 1 52 ? -0.730  10.126  10.581  1.00 0.00 ? 52 LYS A HE3  6  
ATOM 5980  H HZ1  . LYS A 1 52 ? 1.056   11.422  10.481  1.00 0.00 ? 52 LYS A HZ1  6  
ATOM 5981  H HZ2  . LYS A 1 52 ? 0.005   12.744  10.390  1.00 0.00 ? 52 LYS A HZ2  6  
ATOM 5982  H HZ3  . LYS A 1 52 ? 0.629   12.061  8.974   1.00 0.00 ? 52 LYS A HZ3  6  
ATOM 5983  N N    . PHE A 1 53 ? -3.610  7.364   6.115   1.00 0.00 ? 53 PHE A N    6  
ATOM 5984  C CA   . PHE A 1 53 ? -4.409  6.835   5.015   1.00 0.00 ? 53 PHE A CA   6  
ATOM 5985  C C    . PHE A 1 53 ? -4.081  7.554   3.710   1.00 0.00 ? 53 PHE A C    6  
ATOM 5986  O O    . PHE A 1 53 ? -3.918  8.773   3.684   1.00 0.00 ? 53 PHE A O    6  
ATOM 5987  C CB   . PHE A 1 53 ? -5.901  6.975   5.327   1.00 0.00 ? 53 PHE A CB   6  
ATOM 5988  C CG   . PHE A 1 53 ? -6.787  6.256   4.352   1.00 0.00 ? 53 PHE A CG   6  
ATOM 5989  C CD1  . PHE A 1 53 ? -6.838  6.646   3.023   1.00 0.00 ? 53 PHE A CD1  6  
ATOM 5990  C CD2  . PHE A 1 53 ? -7.570  5.189   4.762   1.00 0.00 ? 53 PHE A CD2  6  
ATOM 5991  C CE1  . PHE A 1 53 ? -7.653  5.987   2.123   1.00 0.00 ? 53 PHE A CE1  6  
ATOM 5992  C CE2  . PHE A 1 53 ? -8.388  4.526   3.867   1.00 0.00 ? 53 PHE A CE2  6  
ATOM 5993  C CZ   . PHE A 1 53 ? -8.428  4.924   2.545   1.00 0.00 ? 53 PHE A CZ   6  
ATOM 5994  H H    . PHE A 1 53 ? -3.718  8.303   6.376   1.00 0.00 ? 53 PHE A H    6  
ATOM 5995  H HA   . PHE A 1 53 ? -4.170  5.789   4.906   1.00 0.00 ? 53 PHE A HA   6  
ATOM 5996  H HB2  . PHE A 1 53 ? -6.095  6.573   6.310   1.00 0.00 ? 53 PHE A HB2  6  
ATOM 5997  H HB3  . PHE A 1 53 ? -6.167  8.021   5.312   1.00 0.00 ? 53 PHE A HB3  6  
ATOM 5998  H HD1  . PHE A 1 53 ? -6.231  7.476   2.691   1.00 0.00 ? 53 PHE A HD1  6  
ATOM 5999  H HD2  . PHE A 1 53 ? -7.539  4.877   5.797   1.00 0.00 ? 53 PHE A HD2  6  
ATOM 6000  H HE1  . PHE A 1 53 ? -7.683  6.300   1.090   1.00 0.00 ? 53 PHE A HE1  6  
ATOM 6001  H HE2  . PHE A 1 53 ? -8.993  3.696   4.201   1.00 0.00 ? 53 PHE A HE2  6  
ATOM 6002  H HZ   . PHE A 1 53 ? -9.067  4.408   1.844   1.00 0.00 ? 53 PHE A HZ   6  
ATOM 6003  N N    . GLY A 1 54 ? -3.987  6.788   2.627   1.00 0.00 ? 54 GLY A N    6  
ATOM 6004  C CA   . GLY A 1 54 ? -3.678  7.368   1.333   1.00 0.00 ? 54 GLY A CA   6  
ATOM 6005  C C    . GLY A 1 54 ? -3.576  6.324   0.239   1.00 0.00 ? 54 GLY A C    6  
ATOM 6006  O O    . GLY A 1 54 ? -4.069  5.205   0.389   1.00 0.00 ? 54 GLY A O    6  
ATOM 6007  H H    . GLY A 1 54 ? -4.127  5.821   2.708   1.00 0.00 ? 54 GLY A H    6  
ATOM 6008  H HA2  . GLY A 1 54 ? -4.454  8.073   1.073   1.00 0.00 ? 54 GLY A HA2  6  
ATOM 6009  H HA3  . GLY A 1 54 ? -2.737  7.893   1.402   1.00 0.00 ? 54 GLY A HA3  6  
ATOM 6010  N N    . THR A 1 55 ? -2.935  6.688   -0.867  1.00 0.00 ? 55 THR A N    6  
ATOM 6011  C CA   . THR A 1 55 ? -2.773  5.776   -1.992  1.00 0.00 ? 55 THR A CA   6  
ATOM 6012  C C    . THR A 1 55 ? -1.299  5.576   -2.329  1.00 0.00 ? 55 THR A C    6  
ATOM 6013  O O    . THR A 1 55 ? -0.511  6.522   -2.298  1.00 0.00 ? 55 THR A O    6  
ATOM 6014  C CB   . THR A 1 55 ? -3.509  6.290   -3.243  1.00 0.00 ? 55 THR A CB   6  
ATOM 6015  O OG1  . THR A 1 55 ? -3.343  5.365   -4.324  1.00 0.00 ? 55 THR A OG1  6  
ATOM 6016  C CG2  . THR A 1 55 ? -2.985  7.658   -3.655  1.00 0.00 ? 55 THR A CG2  6  
ATOM 6017  H H    . THR A 1 55 ? -2.564  7.593   -0.927  1.00 0.00 ? 55 THR A H    6  
ATOM 6018  H HA   . THR A 1 55 ? -3.201  4.824   -1.714  1.00 0.00 ? 55 THR A HA   6  
ATOM 6019  H HB   . THR A 1 55 ? -4.561  6.378   -3.013  1.00 0.00 ? 55 THR A HB   6  
ATOM 6020  H HG1  . THR A 1 55 ? -3.780  5.707   -5.108  1.00 0.00 ? 55 THR A HG1  6  
ATOM 6021  H HG21 . THR A 1 55 ? -3.805  8.265   -4.012  1.00 0.00 ? 55 THR A HG21 6  
ATOM 6022  H HG22 . THR A 1 55 ? -2.254  7.542   -4.441  1.00 0.00 ? 55 THR A HG22 6  
ATOM 6023  H HG23 . THR A 1 55 ? -2.526  8.138   -2.805  1.00 0.00 ? 55 THR A HG23 6  
ATOM 6024  N N    . PHE A 1 56 ? -0.934  4.340   -2.652  1.00 0.00 ? 56 PHE A N    6  
ATOM 6025  C CA   . PHE A 1 56 ? 0.446   4.016   -2.995  1.00 0.00 ? 56 PHE A CA   6  
ATOM 6026  C C    . PHE A 1 56 ? 0.500   2.980   -4.114  1.00 0.00 ? 56 PHE A C    6  
ATOM 6027  O O    . PHE A 1 56 ? -0.440  2.215   -4.331  1.00 0.00 ? 56 PHE A O    6  
ATOM 6028  C CB   . PHE A 1 56 ? 1.191   3.495   -1.765  1.00 0.00 ? 56 PHE A CB   6  
ATOM 6029  C CG   . PHE A 1 56 ? 0.396   2.511   -0.955  1.00 0.00 ? 56 PHE A CG   6  
ATOM 6030  C CD1  . PHE A 1 56 ? -0.576  2.949   -0.069  1.00 0.00 ? 56 PHE A CD1  6  
ATOM 6031  C CD2  . PHE A 1 56 ? 0.620   1.150   -1.079  1.00 0.00 ? 56 PHE A CD2  6  
ATOM 6032  C CE1  . PHE A 1 56 ? -1.310  2.046   0.678   1.00 0.00 ? 56 PHE A CE1  6  
ATOM 6033  C CE2  . PHE A 1 56 ? -0.112  0.243   -0.336  1.00 0.00 ? 56 PHE A CE2  6  
ATOM 6034  C CZ   . PHE A 1 56 ? -1.077  0.692   0.545   1.00 0.00 ? 56 PHE A CZ   6  
ATOM 6035  H H    . PHE A 1 56 ? -1.608  3.629   -2.659  1.00 0.00 ? 56 PHE A H    6  
ATOM 6036  H HA   . PHE A 1 56 ? 0.923   4.922   -3.337  1.00 0.00 ? 56 PHE A HA   6  
ATOM 6037  H HB2  . PHE A 1 56 ? 2.098   3.004   -2.084  1.00 0.00 ? 56 PHE A HB2  6  
ATOM 6038  H HB3  . PHE A 1 56 ? 1.442   4.327   -1.126  1.00 0.00 ? 56 PHE A HB3  6  
ATOM 6039  H HD1  . PHE A 1 56 ? -0.759  4.009   0.036   1.00 0.00 ? 56 PHE A HD1  6  
ATOM 6040  H HD2  . PHE A 1 56 ? 1.374   0.797   -1.766  1.00 0.00 ? 56 PHE A HD2  6  
ATOM 6041  H HE1  . PHE A 1 56 ? -2.063  2.401   1.365   1.00 0.00 ? 56 PHE A HE1  6  
ATOM 6042  H HE2  . PHE A 1 56 ? 0.073   -0.816  -0.441  1.00 0.00 ? 56 PHE A HE2  6  
ATOM 6043  H HZ   . PHE A 1 56 ? -1.649  -0.015  1.127   1.00 0.00 ? 56 PHE A HZ   6  
ATOM 6044  N N    . PRO A 1 57 ? 1.626   2.953   -4.842  1.00 0.00 ? 57 PRO A N    6  
ATOM 6045  C CA   . PRO A 1 57 ? 1.830   2.016   -5.950  1.00 0.00 ? 57 PRO A CA   6  
ATOM 6046  C C    . PRO A 1 57 ? 1.990   0.577   -5.471  1.00 0.00 ? 57 PRO A C    6  
ATOM 6047  O O    . PRO A 1 57 ? 2.974   0.237   -4.816  1.00 0.00 ? 57 PRO A O    6  
ATOM 6048  C CB   . PRO A 1 57 ? 3.125   2.510   -6.600  1.00 0.00 ? 57 PRO A CB   6  
ATOM 6049  C CG   . PRO A 1 57 ? 3.848   3.220   -5.508  1.00 0.00 ? 57 PRO A CG   6  
ATOM 6050  C CD   . PRO A 1 57 ? 2.787   3.836   -4.639  1.00 0.00 ? 57 PRO A CD   6  
ATOM 6051  H HA   . PRO A 1 57 ? 1.023   2.067   -6.667  1.00 0.00 ? 57 PRO A HA   6  
ATOM 6052  H HB2  . PRO A 1 57 ? 3.691   1.666   -6.967  1.00 0.00 ? 57 PRO A HB2  6  
ATOM 6053  H HB3  . PRO A 1 57 ? 2.891   3.176   -7.416  1.00 0.00 ? 57 PRO A HB3  6  
ATOM 6054  H HG2  . PRO A 1 57 ? 4.437   2.516   -4.939  1.00 0.00 ? 57 PRO A HG2  6  
ATOM 6055  H HG3  . PRO A 1 57 ? 4.481   3.988   -5.927  1.00 0.00 ? 57 PRO A HG3  6  
ATOM 6056  H HD2  . PRO A 1 57 ? 3.097   3.834   -3.605  1.00 0.00 ? 57 PRO A HD2  6  
ATOM 6057  H HD3  . PRO A 1 57 ? 2.567   4.842   -4.967  1.00 0.00 ? 57 PRO A HD3  6  
ATOM 6058  N N    . GLY A 1 58 ? 1.015   -0.264  -5.802  1.00 0.00 ? 58 GLY A N    6  
ATOM 6059  C CA   . GLY A 1 58 ? 1.067   -1.657  -5.397  1.00 0.00 ? 58 GLY A CA   6  
ATOM 6060  C C    . GLY A 1 58 ? 2.343   -2.343  -5.844  1.00 0.00 ? 58 GLY A C    6  
ATOM 6061  O O    . GLY A 1 58 ? 2.723   -3.378  -5.299  1.00 0.00 ? 58 GLY A O    6  
ATOM 6062  H H    . GLY A 1 58 ? 0.254   0.063   -6.325  1.00 0.00 ? 58 GLY A H    6  
ATOM 6063  H HA2  . GLY A 1 58 ? 1.001   -1.710  -4.320  1.00 0.00 ? 58 GLY A HA2  6  
ATOM 6064  H HA3  . GLY A 1 58 ? 0.223   -2.177  -5.825  1.00 0.00 ? 58 GLY A HA3  6  
ATOM 6065  N N    . ASN A 1 59 ? 3.004   -1.766  -6.842  1.00 0.00 ? 59 ASN A N    6  
ATOM 6066  C CA   . ASN A 1 59 ? 4.244   -2.331  -7.365  1.00 0.00 ? 59 ASN A CA   6  
ATOM 6067  C C    . ASN A 1 59 ? 5.329   -2.347  -6.292  1.00 0.00 ? 59 ASN A C    6  
ATOM 6068  O O    . ASN A 1 59 ? 6.366   -2.990  -6.454  1.00 0.00 ? 59 ASN A O    6  
ATOM 6069  C CB   . ASN A 1 59 ? 4.721   -1.530  -8.578  1.00 0.00 ? 59 ASN A CB   6  
ATOM 6070  C CG   . ASN A 1 59 ? 3.598   -1.231  -9.552  1.00 0.00 ? 59 ASN A CG   6  
ATOM 6071  O OD1  . ASN A 1 59 ? 3.423   -1.932  -10.549 1.00 0.00 ? 59 ASN A OD1  6  
ATOM 6072  N ND2  . ASN A 1 59 ? 2.831   -0.185  -9.268  1.00 0.00 ? 59 ASN A ND2  6  
ATOM 6073  H H    . ASN A 1 59 ? 2.651   -0.942  -7.237  1.00 0.00 ? 59 ASN A H    6  
ATOM 6074  H HA   . ASN A 1 59 ? 4.042   -3.346  -7.672  1.00 0.00 ? 59 ASN A HA   6  
ATOM 6075  H HB2  . ASN A 1 59 ? 5.138   -0.592  -8.240  1.00 0.00 ? 59 ASN A HB2  6  
ATOM 6076  H HB3  . ASN A 1 59 ? 5.483   -2.092  -9.096  1.00 0.00 ? 59 ASN A HB3  6  
ATOM 6077  H HD21 . ASN A 1 59 ? 3.030   0.329   -8.457  1.00 0.00 ? 59 ASN A HD21 6  
ATOM 6078  H HD22 . ASN A 1 59 ? 2.098   0.031   -9.880  1.00 0.00 ? 59 ASN A HD22 6  
ATOM 6079  N N    . TYR A 1 60 ? 5.081   -1.637  -5.198  1.00 0.00 ? 60 TYR A N    6  
ATOM 6080  C CA   . TYR A 1 60 ? 6.038   -1.568  -4.099  1.00 0.00 ? 60 TYR A CA   6  
ATOM 6081  C C    . TYR A 1 60 ? 5.633   -2.504  -2.965  1.00 0.00 ? 60 TYR A C    6  
ATOM 6082  O O    . TYR A 1 60 ? 6.461   -2.898  -2.143  1.00 0.00 ? 60 TYR A O    6  
ATOM 6083  C CB   . TYR A 1 60 ? 6.144   -0.134  -3.577  1.00 0.00 ? 60 TYR A CB   6  
ATOM 6084  C CG   . TYR A 1 60 ? 6.993   0.766   -4.447  1.00 0.00 ? 60 TYR A CG   6  
ATOM 6085  C CD1  . TYR A 1 60 ? 6.546   1.180   -5.696  1.00 0.00 ? 60 TYR A CD1  6  
ATOM 6086  C CD2  . TYR A 1 60 ? 8.242   1.200   -4.021  1.00 0.00 ? 60 TYR A CD2  6  
ATOM 6087  C CE1  . TYR A 1 60 ? 7.318   2.001   -6.495  1.00 0.00 ? 60 TYR A CE1  6  
ATOM 6088  C CE2  . TYR A 1 60 ? 9.020   2.022   -4.813  1.00 0.00 ? 60 TYR A CE2  6  
ATOM 6089  C CZ   . TYR A 1 60 ? 8.554   2.420   -6.049  1.00 0.00 ? 60 TYR A CZ   6  
ATOM 6090  O OH   . TYR A 1 60 ? 9.327   3.238   -6.840  1.00 0.00 ? 60 TYR A OH   6  
ATOM 6091  H H    . TYR A 1 60 ? 4.236   -1.145  -5.127  1.00 0.00 ? 60 TYR A H    6  
ATOM 6092  H HA   . TYR A 1 60 ? 7.001   -1.875  -4.478  1.00 0.00 ? 60 TYR A HA   6  
ATOM 6093  H HB2  . TYR A 1 60 ? 5.156   0.297   -3.522  1.00 0.00 ? 60 TYR A HB2  6  
ATOM 6094  H HB3  . TYR A 1 60 ? 6.581   -0.149  -2.590  1.00 0.00 ? 60 TYR A HB3  6  
ATOM 6095  H HD1  . TYR A 1 60 ? 5.577   0.851   -6.043  1.00 0.00 ? 60 TYR A HD1  6  
ATOM 6096  H HD2  . TYR A 1 60 ? 8.604   0.886   -3.053  1.00 0.00 ? 60 TYR A HD2  6  
ATOM 6097  H HE1  . TYR A 1 60 ? 6.954   2.313   -7.462  1.00 0.00 ? 60 TYR A HE1  6  
ATOM 6098  H HE2  . TYR A 1 60 ? 9.989   2.350   -4.464  1.00 0.00 ? 60 TYR A HE2  6  
ATOM 6099  H HH   . TYR A 1 60 ? 9.363   2.880   -7.731  1.00 0.00 ? 60 TYR A HH   6  
ATOM 6100  N N    . VAL A 1 61 ? 4.352   -2.859  -2.927  1.00 0.00 ? 61 VAL A N    6  
ATOM 6101  C CA   . VAL A 1 61 ? 3.836   -3.751  -1.896  1.00 0.00 ? 61 VAL A CA   6  
ATOM 6102  C C    . VAL A 1 61 ? 3.360   -5.069  -2.498  1.00 0.00 ? 61 VAL A C    6  
ATOM 6103  O O    . VAL A 1 61 ? 3.354   -5.240  -3.716  1.00 0.00 ? 61 VAL A O    6  
ATOM 6104  C CB   . VAL A 1 61 ? 2.672   -3.102  -1.124  1.00 0.00 ? 61 VAL A CB   6  
ATOM 6105  C CG1  . VAL A 1 61 ? 3.080   -1.737  -0.591  1.00 0.00 ? 61 VAL A CG1  6  
ATOM 6106  C CG2  . VAL A 1 61 ? 1.441   -2.991  -2.011  1.00 0.00 ? 61 VAL A CG2  6  
ATOM 6107  H H    . VAL A 1 61 ? 3.740   -2.513  -3.610  1.00 0.00 ? 61 VAL A H    6  
ATOM 6108  H HA   . VAL A 1 61 ? 4.636   -3.953  -1.198  1.00 0.00 ? 61 VAL A HA   6  
ATOM 6109  H HB   . VAL A 1 61 ? 2.428   -3.734  -0.283  1.00 0.00 ? 61 VAL A HB   6  
ATOM 6110  H HG11 . VAL A 1 61 ? 3.751   -1.864  0.246   1.00 0.00 ? 61 VAL A HG11 6  
ATOM 6111  H HG12 . VAL A 1 61 ? 3.578   -1.180  -1.371  1.00 0.00 ? 61 VAL A HG12 6  
ATOM 6112  H HG13 . VAL A 1 61 ? 2.201   -1.199  -0.268  1.00 0.00 ? 61 VAL A HG13 6  
ATOM 6113  H HG21 . VAL A 1 61 ? 0.591   -3.420  -1.501  1.00 0.00 ? 61 VAL A HG21 6  
ATOM 6114  H HG22 . VAL A 1 61 ? 1.244   -1.951  -2.225  1.00 0.00 ? 61 VAL A HG22 6  
ATOM 6115  H HG23 . VAL A 1 61 ? 1.613   -3.522  -2.935  1.00 0.00 ? 61 VAL A HG23 6  
ATOM 6116  N N    . ALA A 1 62 ? 2.962   -5.997  -1.634  1.00 0.00 ? 62 ALA A N    6  
ATOM 6117  C CA   . ALA A 1 62 ? 2.481   -7.299  -2.080  1.00 0.00 ? 62 ALA A CA   6  
ATOM 6118  C C    . ALA A 1 62 ? 1.558   -7.929  -1.042  1.00 0.00 ? 62 ALA A C    6  
ATOM 6119  O O    . ALA A 1 62 ? 1.730   -7.753  0.164   1.00 0.00 ? 62 ALA A O    6  
ATOM 6120  C CB   . ALA A 1 62 ? 3.655   -8.222  -2.375  1.00 0.00 ? 62 ALA A CB   6  
ATOM 6121  H H    . ALA A 1 62 ? 2.990   -5.801  -0.675  1.00 0.00 ? 62 ALA A H    6  
ATOM 6122  H HA   . ALA A 1 62 ? 1.929   -7.155  -2.998  1.00 0.00 ? 62 ALA A HA   6  
ATOM 6123  H HB1  . ALA A 1 62 ? 3.316   -9.052  -2.978  1.00 0.00 ? 62 ALA A HB1  6  
ATOM 6124  H HB2  . ALA A 1 62 ? 4.417   -7.675  -2.909  1.00 0.00 ? 62 ALA A HB2  6  
ATOM 6125  H HB3  . ALA A 1 62 ? 4.062   -8.594  -1.446  1.00 0.00 ? 62 ALA A HB3  6  
ATOM 6126  N N    . PRO A 1 63 ? 0.555   -8.680  -1.519  1.00 0.00 ? 63 PRO A N    6  
ATOM 6127  C CA   . PRO A 1 63 ? -0.415  -9.350  -0.649  1.00 0.00 ? 63 PRO A CA   6  
ATOM 6128  C C    . PRO A 1 63 ? 0.207   -10.503 0.132   1.00 0.00 ? 63 PRO A C    6  
ATOM 6129  O O    . PRO A 1 63 ? 0.376   -11.603 -0.394  1.00 0.00 ? 63 PRO A O    6  
ATOM 6130  C CB   . PRO A 1 63 ? -1.468  -9.875  -1.628  1.00 0.00 ? 63 PRO A CB   6  
ATOM 6131  C CG   . PRO A 1 63 ? -0.741  -10.026 -2.920  1.00 0.00 ? 63 PRO A CG   6  
ATOM 6132  C CD   . PRO A 1 63 ? 0.290   -8.933  -2.946  1.00 0.00 ? 63 PRO A CD   6  
ATOM 6133  H HA   . PRO A 1 63 ? -0.876  -8.657  0.040   1.00 0.00 ? 63 PRO A HA   6  
ATOM 6134  H HB2  . PRO A 1 63 ? -1.851  -10.822 -1.276  1.00 0.00 ? 63 PRO A HB2  6  
ATOM 6135  H HB3  . PRO A 1 63 ? -2.275  -9.162  -1.711  1.00 0.00 ? 63 PRO A HB3  6  
ATOM 6136  H HG2  . PRO A 1 63 ? -0.264  -10.993 -2.961  1.00 0.00 ? 63 PRO A HG2  6  
ATOM 6137  H HG3  . PRO A 1 63 ? -1.430  -9.911  -3.744  1.00 0.00 ? 63 PRO A HG3  6  
ATOM 6138  H HD2  . PRO A 1 63 ? 1.184   -9.269  -3.450  1.00 0.00 ? 63 PRO A HD2  6  
ATOM 6139  H HD3  . PRO A 1 63 ? -0.107  -8.050  -3.426  1.00 0.00 ? 63 PRO A HD3  6  
ATOM 6140  N N    . VAL A 1 64 ? 0.545   -10.245 1.391   1.00 0.00 ? 64 VAL A N    6  
ATOM 6141  C CA   . VAL A 1 64 ? 1.147   -11.261 2.246   1.00 0.00 ? 64 VAL A CA   6  
ATOM 6142  C C    . VAL A 1 64 ? 0.112   -12.290 2.689   1.00 0.00 ? 64 VAL A C    6  
ATOM 6143  O O    . VAL A 1 64 ? 0.459   -13.391 3.115   1.00 0.00 ? 64 VAL A O    6  
ATOM 6144  C CB   . VAL A 1 64 ? 1.797   -10.634 3.493   1.00 0.00 ? 64 VAL A CB   6  
ATOM 6145  C CG1  . VAL A 1 64 ? 0.898   -9.556  4.079   1.00 0.00 ? 64 VAL A CG1  6  
ATOM 6146  C CG2  . VAL A 1 64 ? 2.105   -11.704 4.529   1.00 0.00 ? 64 VAL A CG2  6  
ATOM 6147  H H    . VAL A 1 64 ? 0.385   -9.349  1.755   1.00 0.00 ? 64 VAL A H    6  
ATOM 6148  H HA   . VAL A 1 64 ? 1.917   -11.762 1.677   1.00 0.00 ? 64 VAL A HA   6  
ATOM 6149  H HB   . VAL A 1 64 ? 2.727   -10.172 3.195   1.00 0.00 ? 64 VAL A HB   6  
ATOM 6150  H HG11 . VAL A 1 64 ? 1.203   -8.590  3.704   1.00 0.00 ? 64 VAL A HG11 6  
ATOM 6151  H HG12 . VAL A 1 64 ? -0.126  -9.747  3.794   1.00 0.00 ? 64 VAL A HG12 6  
ATOM 6152  H HG13 . VAL A 1 64 ? 0.980   -9.565  5.156   1.00 0.00 ? 64 VAL A HG13 6  
ATOM 6153  H HG21 . VAL A 1 64 ? 2.508   -12.576 4.035   1.00 0.00 ? 64 VAL A HG21 6  
ATOM 6154  H HG22 . VAL A 1 64 ? 2.828   -11.324 5.236   1.00 0.00 ? 64 VAL A HG22 6  
ATOM 6155  H HG23 . VAL A 1 64 ? 1.198   -11.972 5.051   1.00 0.00 ? 64 VAL A HG23 6  
ATOM 6156  N N    . SER A 1 65 ? -1.161  -11.923 2.584   1.00 0.00 ? 65 SER A N    6  
ATOM 6157  C CA   . SER A 1 65 ? -2.248  -12.812 2.977   1.00 0.00 ? 65 SER A CA   6  
ATOM 6158  C C    . SER A 1 65 ? -2.019  -14.221 2.438   1.00 0.00 ? 65 SER A C    6  
ATOM 6159  O O    . SER A 1 65 ? -2.313  -15.210 3.109   1.00 0.00 ? 65 SER A O    6  
ATOM 6160  C CB   . SER A 1 65 ? -3.586  -12.271 2.470   1.00 0.00 ? 65 SER A CB   6  
ATOM 6161  O OG   . SER A 1 65 ? -4.549  -13.307 2.368   1.00 0.00 ? 65 SER A OG   6  
ATOM 6162  H H    . SER A 1 65 ? -1.375  -11.031 2.236   1.00 0.00 ? 65 SER A H    6  
ATOM 6163  H HA   . SER A 1 65 ? -2.271  -12.851 4.056   1.00 0.00 ? 65 SER A HA   6  
ATOM 6164  H HB2  . SER A 1 65 ? -3.952  -11.523 3.156   1.00 0.00 ? 65 SER A HB2  6  
ATOM 6165  H HB3  . SER A 1 65 ? -3.446  -11.829 1.494   1.00 0.00 ? 65 SER A HB3  6  
ATOM 6166  H HG   . SER A 1 65 ? -4.849  -13.552 3.246   1.00 0.00 ? 65 SER A HG   6  
ATOM 6167  N N    . GLY A 1 66 ? -1.491  -14.304 1.221   1.00 0.00 ? 66 GLY A N    6  
ATOM 6168  C CA   . GLY A 1 66 ? -1.230  -15.595 0.611   1.00 0.00 ? 66 GLY A CA   6  
ATOM 6169  C C    . GLY A 1 66 ? -2.220  -15.927 -0.488  1.00 0.00 ? 66 GLY A C    6  
ATOM 6170  O O    . GLY A 1 66 ? -2.857  -15.046 -1.066  1.00 0.00 ? 66 GLY A O    6  
ATOM 6171  H H    . GLY A 1 66 ? -1.276  -13.481 0.732   1.00 0.00 ? 66 GLY A H    6  
ATOM 6172  H HA2  . GLY A 1 66 ? -0.234  -15.590 0.195   1.00 0.00 ? 66 GLY A HA2  6  
ATOM 6173  H HA3  . GLY A 1 66 ? -1.287  -16.358 1.373   1.00 0.00 ? 66 GLY A HA3  6  
ATOM 6174  N N    . PRO A 1 67 ? -2.358  -17.226 -0.793  1.00 0.00 ? 67 PRO A N    6  
ATOM 6175  C CA   . PRO A 1 67 ? -3.274  -17.702 -1.833  1.00 0.00 ? 67 PRO A CA   6  
ATOM 6176  C C    . PRO A 1 67 ? -4.737  -17.539 -1.435  1.00 0.00 ? 67 PRO A C    6  
ATOM 6177  O O    . PRO A 1 67 ? -5.209  -18.178 -0.495  1.00 0.00 ? 67 PRO A O    6  
ATOM 6178  C CB   . PRO A 1 67 ? -2.919  -19.185 -1.968  1.00 0.00 ? 67 PRO A CB   6  
ATOM 6179  C CG   . PRO A 1 67 ? -2.340  -19.557 -0.647  1.00 0.00 ? 67 PRO A CG   6  
ATOM 6180  C CD   . PRO A 1 67 ? -1.630  -18.330 -0.145  1.00 0.00 ? 67 PRO A CD   6  
ATOM 6181  H HA   . PRO A 1 67 ? -3.101  -17.201 -2.774  1.00 0.00 ? 67 PRO A HA   6  
ATOM 6182  H HB2  . PRO A 1 67 ? -3.812  -19.754 -2.183  1.00 0.00 ? 67 PRO A HB2  6  
ATOM 6183  H HB3  . PRO A 1 67 ? -2.201  -19.315 -2.764  1.00 0.00 ? 67 PRO A HB3  6  
ATOM 6184  H HG2  . PRO A 1 67 ? -3.129  -19.838 0.034   1.00 0.00 ? 67 PRO A HG2  6  
ATOM 6185  H HG3  . PRO A 1 67 ? -1.640  -20.370 -0.769  1.00 0.00 ? 67 PRO A HG3  6  
ATOM 6186  H HD2  . PRO A 1 67 ? -1.705  -18.263 0.930   1.00 0.00 ? 67 PRO A HD2  6  
ATOM 6187  H HD3  . PRO A 1 67 ? -0.594  -18.341 -0.452  1.00 0.00 ? 67 PRO A HD3  6  
ATOM 6188  N N    . SER A 1 68 ? -5.450  -16.681 -2.158  1.00 0.00 ? 68 SER A N    6  
ATOM 6189  C CA   . SER A 1 68 ? -6.860  -16.432 -1.877  1.00 0.00 ? 68 SER A CA   6  
ATOM 6190  C C    . SER A 1 68 ? -7.699  -17.671 -2.174  1.00 0.00 ? 68 SER A C    6  
ATOM 6191  O O    . SER A 1 68 ? -7.276  -18.559 -2.914  1.00 0.00 ? 68 SER A O    6  
ATOM 6192  C CB   . SER A 1 68 ? -7.365  -15.250 -2.706  1.00 0.00 ? 68 SER A CB   6  
ATOM 6193  O OG   . SER A 1 68 ? -8.703  -14.926 -2.370  1.00 0.00 ? 68 SER A OG   6  
ATOM 6194  H H    . SER A 1 68 ? -5.017  -16.202 -2.895  1.00 0.00 ? 68 SER A H    6  
ATOM 6195  H HA   . SER A 1 68 ? -6.952  -16.191 -0.829  1.00 0.00 ? 68 SER A HA   6  
ATOM 6196  H HB2  . SER A 1 68 ? -6.741  -14.389 -2.519  1.00 0.00 ? 68 SER A HB2  6  
ATOM 6197  H HB3  . SER A 1 68 ? -7.322  -15.504 -3.755  1.00 0.00 ? 68 SER A HB3  6  
ATOM 6198  H HG   . SER A 1 68 ? -9.045  -14.285 -2.998  1.00 0.00 ? 68 SER A HG   6  
ATOM 6199  N N    . SER A 1 69 ? -8.892  -17.723 -1.589  1.00 0.00 ? 69 SER A N    6  
ATOM 6200  C CA   . SER A 1 69 ? -9.791  -18.855 -1.786  1.00 0.00 ? 69 SER A CA   6  
ATOM 6201  C C    . SER A 1 69 ? -10.747 -18.593 -2.946  1.00 0.00 ? 69 SER A C    6  
ATOM 6202  O O    . SER A 1 69 ? -11.002 -19.474 -3.766  1.00 0.00 ? 69 SER A O    6  
ATOM 6203  C CB   . SER A 1 69 ? -10.585 -19.131 -0.508  1.00 0.00 ? 69 SER A CB   6  
ATOM 6204  O OG   . SER A 1 69 ? -11.536 -20.162 -0.711  1.00 0.00 ? 69 SER A OG   6  
ATOM 6205  H H    . SER A 1 69 ? -9.173  -16.984 -1.010  1.00 0.00 ? 69 SER A H    6  
ATOM 6206  H HA   . SER A 1 69 ? -9.189  -19.720 -2.020  1.00 0.00 ? 69 SER A HA   6  
ATOM 6207  H HB2  . SER A 1 69 ? -9.907  -19.432 0.276   1.00 0.00 ? 69 SER A HB2  6  
ATOM 6208  H HB3  . SER A 1 69 ? -11.105 -18.232 -0.209  1.00 0.00 ? 69 SER A HB3  6  
ATOM 6209  H HG   . SER A 1 69 ? -12.389 -19.882 -0.372  1.00 0.00 ? 69 SER A HG   6  
ATOM 6210  N N    . GLY A 1 70 ? -11.274 -17.374 -3.007  1.00 0.00 ? 70 GLY A N    6  
ATOM 6211  C CA   . GLY A 1 70 ? -12.197 -17.016 -4.068  1.00 0.00 ? 70 GLY A CA   6  
ATOM 6212  C C    . GLY A 1 70 ? -12.689 -15.587 -3.953  1.00 0.00 ? 70 GLY A C    6  
ATOM 6213  O O    . GLY A 1 70 ? -13.301 -15.057 -4.880  1.00 0.00 ? 70 GLY A O    6  
ATOM 6214  H H    . GLY A 1 70 ? -11.035 -16.711 -2.325  1.00 0.00 ? 70 GLY A H    6  
ATOM 6215  H HA2  . GLY A 1 70 ? -11.699 -17.139 -5.019  1.00 0.00 ? 70 GLY A HA2  6  
ATOM 6216  H HA3  . GLY A 1 70 ? -13.047 -17.681 -4.030  1.00 0.00 ? 70 GLY A HA3  6  
ATOM 6217  N N    . GLY A 1 1  ? -16.857 -8.808  17.754  1.00 0.00 ? 1  GLY A N    7  
ATOM 6218  C CA   . GLY A 1 1  ? -17.492 -8.319  16.544  1.00 0.00 ? 1  GLY A CA   7  
ATOM 6219  C C    . GLY A 1 1  ? -16.658 -8.579  15.305  1.00 0.00 ? 1  GLY A C    7  
ATOM 6220  O O    . GLY A 1 1  ? -16.039 -9.635  15.176  1.00 0.00 ? 1  GLY A O    7  
ATOM 6221  H H1   . GLY A 1 1  ? -16.601 -8.178  18.459  1.00 0.00 ? 1  GLY A H1   7  
ATOM 6222  H HA2  . GLY A 1 1  ? -18.449 -8.807  16.430  1.00 0.00 ? 1  GLY A HA2  7  
ATOM 6223  H HA3  . GLY A 1 1  ? -17.652 -7.255  16.640  1.00 0.00 ? 1  GLY A HA3  7  
ATOM 6224  N N    . SER A 1 2  ? -16.643 -7.614  14.391  1.00 0.00 ? 2  SER A N    7  
ATOM 6225  C CA   . SER A 1 2  ? -15.883 -7.746  13.153  1.00 0.00 ? 2  SER A CA   7  
ATOM 6226  C C    . SER A 1 2  ? -14.487 -8.297  13.429  1.00 0.00 ? 2  SER A C    7  
ATOM 6227  O O    . SER A 1 2  ? -13.580 -7.557  13.809  1.00 0.00 ? 2  SER A O    7  
ATOM 6228  C CB   . SER A 1 2  ? -15.779 -6.393  12.447  1.00 0.00 ? 2  SER A CB   7  
ATOM 6229  O OG   . SER A 1 2  ? -15.064 -6.507  11.229  1.00 0.00 ? 2  SER A OG   7  
ATOM 6230  H H    . SER A 1 2  ? -17.157 -6.796  14.552  1.00 0.00 ? 2  SER A H    7  
ATOM 6231  H HA   . SER A 1 2  ? -16.410 -8.438  12.513  1.00 0.00 ? 2  SER A HA   7  
ATOM 6232  H HB2  . SER A 1 2  ? -16.771 -6.024  12.235  1.00 0.00 ? 2  SER A HB2  7  
ATOM 6233  H HB3  . SER A 1 2  ? -15.264 -5.694  13.089  1.00 0.00 ? 2  SER A HB3  7  
ATOM 6234  H HG   . SER A 1 2  ? -14.451 -7.244  11.285  1.00 0.00 ? 2  SER A HG   7  
ATOM 6235  N N    . SER A 1 3  ? -14.324 -9.602  13.235  1.00 0.00 ? 3  SER A N    7  
ATOM 6236  C CA   . SER A 1 3  ? -13.040 -10.254 13.466  1.00 0.00 ? 3  SER A CA   7  
ATOM 6237  C C    . SER A 1 3  ? -11.956 -9.650  12.578  1.00 0.00 ? 3  SER A C    7  
ATOM 6238  O O    . SER A 1 3  ? -12.238 -9.136  11.497  1.00 0.00 ? 3  SER A O    7  
ATOM 6239  C CB   . SER A 1 3  ? -13.153 -11.757 13.201  1.00 0.00 ? 3  SER A CB   7  
ATOM 6240  O OG   . SER A 1 3  ? -13.547 -12.453 14.370  1.00 0.00 ? 3  SER A OG   7  
ATOM 6241  H H    . SER A 1 3  ? -15.086 -10.139 12.931  1.00 0.00 ? 3  SER A H    7  
ATOM 6242  H HA   . SER A 1 3  ? -12.771 -10.099 14.500  1.00 0.00 ? 3  SER A HA   7  
ATOM 6243  H HB2  . SER A 1 3  ? -13.887 -11.929 12.429  1.00 0.00 ? 3  SER A HB2  7  
ATOM 6244  H HB3  . SER A 1 3  ? -12.194 -12.135 12.877  1.00 0.00 ? 3  SER A HB3  7  
ATOM 6245  H HG   . SER A 1 3  ? -14.045 -11.863 14.941  1.00 0.00 ? 3  SER A HG   7  
ATOM 6246  N N    . GLY A 1 4  ? -10.713 -9.715  13.046  1.00 0.00 ? 4  GLY A N    7  
ATOM 6247  C CA   . GLY A 1 4  ? -9.605  -9.171  12.284  1.00 0.00 ? 4  GLY A CA   7  
ATOM 6248  C C    . GLY A 1 4  ? -9.715  -7.671  12.090  1.00 0.00 ? 4  GLY A C    7  
ATOM 6249  O O    . GLY A 1 4  ? -10.220 -6.962  12.960  1.00 0.00 ? 4  GLY A O    7  
ATOM 6250  H H    . GLY A 1 4  ? -10.547 -10.136 13.915  1.00 0.00 ? 4  GLY A H    7  
ATOM 6251  H HA2  . GLY A 1 4  ? -8.683  -9.389  12.803  1.00 0.00 ? 4  GLY A HA2  7  
ATOM 6252  H HA3  . GLY A 1 4  ? -9.582  -9.646  11.314  1.00 0.00 ? 4  GLY A HA3  7  
ATOM 6253  N N    . SER A 1 5  ? -9.240  -7.187  10.947  1.00 0.00 ? 5  SER A N    7  
ATOM 6254  C CA   . SER A 1 5  ? -9.282  -5.761  10.644  1.00 0.00 ? 5  SER A CA   7  
ATOM 6255  C C    . SER A 1 5  ? -9.775  -5.523  9.220   1.00 0.00 ? 5  SER A C    7  
ATOM 6256  O O    . SER A 1 5  ? -9.513  -6.319  8.319   1.00 0.00 ? 5  SER A O    7  
ATOM 6257  C CB   . SER A 1 5  ? -7.898  -5.138  10.828  1.00 0.00 ? 5  SER A CB   7  
ATOM 6258  O OG   . SER A 1 5  ? -7.655  -4.826  12.189  1.00 0.00 ? 5  SER A OG   7  
ATOM 6259  H H    . SER A 1 5  ? -8.849  -7.804  10.293  1.00 0.00 ? 5  SER A H    7  
ATOM 6260  H HA   . SER A 1 5  ? -9.971  -5.297  11.334  1.00 0.00 ? 5  SER A HA   7  
ATOM 6261  H HB2  . SER A 1 5  ? -7.145  -5.834  10.491  1.00 0.00 ? 5  SER A HB2  7  
ATOM 6262  H HB3  . SER A 1 5  ? -7.835  -4.230  10.246  1.00 0.00 ? 5  SER A HB3  7  
ATOM 6263  H HG   . SER A 1 5  ? -7.258  -3.954  12.252  1.00 0.00 ? 5  SER A HG   7  
ATOM 6264  N N    . SER A 1 6  ? -10.492 -4.420  9.025   1.00 0.00 ? 6  SER A N    7  
ATOM 6265  C CA   . SER A 1 6  ? -11.025 -4.077  7.713   1.00 0.00 ? 6  SER A CA   7  
ATOM 6266  C C    . SER A 1 6  ? -9.897  -3.804  6.722   1.00 0.00 ? 6  SER A C    7  
ATOM 6267  O O    . SER A 1 6  ? -9.263  -2.751  6.761   1.00 0.00 ? 6  SER A O    7  
ATOM 6268  C CB   . SER A 1 6  ? -11.938 -2.853  7.813   1.00 0.00 ? 6  SER A CB   7  
ATOM 6269  O OG   . SER A 1 6  ? -13.130 -3.163  8.514   1.00 0.00 ? 6  SER A OG   7  
ATOM 6270  H H    . SER A 1 6  ? -10.667 -3.825  9.784   1.00 0.00 ? 6  SER A H    7  
ATOM 6271  H HA   . SER A 1 6  ? -11.603 -4.918  7.360   1.00 0.00 ? 6  SER A HA   7  
ATOM 6272  H HB2  . SER A 1 6  ? -11.421 -2.064  8.337   1.00 0.00 ? 6  SER A HB2  7  
ATOM 6273  H HB3  . SER A 1 6  ? -12.196 -2.517  6.819   1.00 0.00 ? 6  SER A HB3  7  
ATOM 6274  H HG   . SER A 1 6  ? -13.686 -2.381  8.561   1.00 0.00 ? 6  SER A HG   7  
ATOM 6275  N N    . GLY A 1 7  ? -9.654  -4.763  5.833   1.00 0.00 ? 7  GLY A N    7  
ATOM 6276  C CA   . GLY A 1 7  ? -8.603  -4.608  4.845   1.00 0.00 ? 7  GLY A CA   7  
ATOM 6277  C C    . GLY A 1 7  ? -7.650  -5.787  4.823   1.00 0.00 ? 7  GLY A C    7  
ATOM 6278  O O    . GLY A 1 7  ? -7.374  -6.392  5.859   1.00 0.00 ? 7  GLY A O    7  
ATOM 6279  H H    . GLY A 1 7  ? -10.192 -5.582  5.849   1.00 0.00 ? 7  GLY A H    7  
ATOM 6280  H HA2  . GLY A 1 7  ? -9.054  -4.505  3.869   1.00 0.00 ? 7  GLY A HA2  7  
ATOM 6281  H HA3  . GLY A 1 7  ? -8.043  -3.712  5.068   1.00 0.00 ? 7  GLY A HA3  7  
ATOM 6282  N N    . THR A 1 8  ? -7.145  -6.116  3.637   1.00 0.00 ? 8  THR A N    7  
ATOM 6283  C CA   . THR A 1 8  ? -6.219  -7.231  3.484   1.00 0.00 ? 8  THR A CA   7  
ATOM 6284  C C    . THR A 1 8  ? -4.794  -6.814  3.826   1.00 0.00 ? 8  THR A C    7  
ATOM 6285  O O    . THR A 1 8  ? -4.337  -5.726  3.472   1.00 0.00 ? 8  THR A O    7  
ATOM 6286  C CB   . THR A 1 8  ? -6.248  -7.791  2.049   1.00 0.00 ? 8  THR A CB   7  
ATOM 6287  O OG1  . THR A 1 8  ? -7.555  -8.288  1.743   1.00 0.00 ? 8  THR A OG1  7  
ATOM 6288  C CG2  . THR A 1 8  ? -5.225  -8.905  1.883   1.00 0.00 ? 8  THR A CG2  7  
ATOM 6289  H H    . THR A 1 8  ? -7.403  -5.595  2.848   1.00 0.00 ? 8  THR A H    7  
ATOM 6290  H HA   . THR A 1 8  ? -6.527  -8.015  4.160   1.00 0.00 ? 8  THR A HA   7  
ATOM 6291  H HB   . THR A 1 8  ? -6.004  -6.993  1.363   1.00 0.00 ? 8  THR A HB   7  
ATOM 6292  H HG1  . THR A 1 8  ? -7.960  -7.731  1.073   1.00 0.00 ? 8  THR A HG1  7  
ATOM 6293  H HG21 . THR A 1 8  ? -5.658  -9.842  2.201   1.00 0.00 ? 8  THR A HG21 7  
ATOM 6294  H HG22 . THR A 1 8  ? -4.355  -8.687  2.484   1.00 0.00 ? 8  THR A HG22 7  
ATOM 6295  H HG23 . THR A 1 8  ? -4.937  -8.976  0.845   1.00 0.00 ? 8  THR A HG23 7  
ATOM 6296  N N    . PRO A 1 9  ? -4.071  -7.697  4.531   1.00 0.00 ? 9  PRO A N    7  
ATOM 6297  C CA   . PRO A 1 9  ? -2.685  -7.442  4.936   1.00 0.00 ? 9  PRO A CA   7  
ATOM 6298  C C    . PRO A 1 9  ? -1.724  -7.453  3.752   1.00 0.00 ? 9  PRO A C    7  
ATOM 6299  O O    . PRO A 1 9  ? -1.848  -8.278  2.847   1.00 0.00 ? 9  PRO A O    7  
ATOM 6300  C CB   . PRO A 1 9  ? -2.375  -8.600  5.887   1.00 0.00 ? 9  PRO A CB   7  
ATOM 6301  C CG   . PRO A 1 9  ? -3.299  -9.692  5.469   1.00 0.00 ? 9  PRO A CG   7  
ATOM 6302  C CD   . PRO A 1 9  ? -4.551  -9.012  4.987   1.00 0.00 ? 9  PRO A CD   7  
ATOM 6303  H HA   . PRO A 1 9  ? -2.592  -6.505  5.465   1.00 0.00 ? 9  PRO A HA   7  
ATOM 6304  H HB2  . PRO A 1 9  ? -1.340  -8.893  5.775   1.00 0.00 ? 9  PRO A HB2  7  
ATOM 6305  H HB3  . PRO A 1 9  ? -2.560  -8.294  6.905   1.00 0.00 ? 9  PRO A HB3  7  
ATOM 6306  H HG2  . PRO A 1 9  ? -2.853  -10.265 4.672   1.00 0.00 ? 9  PRO A HG2  7  
ATOM 6307  H HG3  . PRO A 1 9  ? -3.520  -10.328 6.313   1.00 0.00 ? 9  PRO A HG3  7  
ATOM 6308  H HD2  . PRO A 1 9  ? -4.991  -9.566  4.171   1.00 0.00 ? 9  PRO A HD2  7  
ATOM 6309  H HD3  . PRO A 1 9  ? -5.257  -8.904  5.797   1.00 0.00 ? 9  PRO A HD3  7  
ATOM 6310  N N    . TYR A 1 10 ? -0.767  -6.532  3.764   1.00 0.00 ? 10 TYR A N    7  
ATOM 6311  C CA   . TYR A 1 10 ? 0.214   -6.434  2.690   1.00 0.00 ? 10 TYR A CA   7  
ATOM 6312  C C    . TYR A 1 10 ? 1.607   -6.158  3.248   1.00 0.00 ? 10 TYR A C    7  
ATOM 6313  O O    . TYR A 1 10 ? 1.786   -6.014  4.457   1.00 0.00 ? 10 TYR A O    7  
ATOM 6314  C CB   . TYR A 1 10 ? -0.182  -5.330  1.708   1.00 0.00 ? 10 TYR A CB   7  
ATOM 6315  C CG   . TYR A 1 10 ? -1.061  -5.813  0.576   1.00 0.00 ? 10 TYR A CG   7  
ATOM 6316  C CD1  . TYR A 1 10 ? -2.366  -6.227  0.812   1.00 0.00 ? 10 TYR A CD1  7  
ATOM 6317  C CD2  . TYR A 1 10 ? -0.586  -5.856  -0.729  1.00 0.00 ? 10 TYR A CD2  7  
ATOM 6318  C CE1  . TYR A 1 10 ? -3.173  -6.670  -0.218  1.00 0.00 ? 10 TYR A CE1  7  
ATOM 6319  C CE2  . TYR A 1 10 ? -1.386  -6.296  -1.766  1.00 0.00 ? 10 TYR A CE2  7  
ATOM 6320  C CZ   . TYR A 1 10 ? -2.678  -6.702  -1.506  1.00 0.00 ? 10 TYR A CZ   7  
ATOM 6321  O OH   . TYR A 1 10 ? -3.478  -7.142  -2.536  1.00 0.00 ? 10 TYR A OH   7  
ATOM 6322  H H    . TYR A 1 10 ? -0.720  -5.901  4.513   1.00 0.00 ? 10 TYR A H    7  
ATOM 6323  H HA   . TYR A 1 10 ? 0.228   -7.379  2.167   1.00 0.00 ? 10 TYR A HA   7  
ATOM 6324  H HB2  . TYR A 1 10 ? -0.721  -4.561  2.240   1.00 0.00 ? 10 TYR A HB2  7  
ATOM 6325  H HB3  . TYR A 1 10 ? 0.711   -4.905  1.276   1.00 0.00 ? 10 TYR A HB3  7  
ATOM 6326  H HD1  . TYR A 1 10 ? -2.751  -6.201  1.822   1.00 0.00 ? 10 TYR A HD1  7  
ATOM 6327  H HD2  . TYR A 1 10 ? 0.427   -5.538  -0.929  1.00 0.00 ? 10 TYR A HD2  7  
ATOM 6328  H HE1  . TYR A 1 10 ? -4.185  -6.988  -0.015  1.00 0.00 ? 10 TYR A HE1  7  
ATOM 6329  H HE2  . TYR A 1 10 ? -0.999  -6.322  -2.774  1.00 0.00 ? 10 TYR A HE2  7  
ATOM 6330  H HH   . TYR A 1 10 ? -2.926  -7.445  -3.261  1.00 0.00 ? 10 TYR A HH   7  
ATOM 6331  N N    . ARG A 1 11 ? 2.590   -6.087  2.356   1.00 0.00 ? 11 ARG A N    7  
ATOM 6332  C CA   . ARG A 1 11 ? 3.968   -5.829  2.758   1.00 0.00 ? 11 ARG A CA   7  
ATOM 6333  C C    . ARG A 1 11 ? 4.696   -5.001  1.703   1.00 0.00 ? 11 ARG A C    7  
ATOM 6334  O O    . ARG A 1 11 ? 4.687   -5.340  0.520   1.00 0.00 ? 11 ARG A O    7  
ATOM 6335  C CB   . ARG A 1 11 ? 4.709   -7.147  2.989   1.00 0.00 ? 11 ARG A CB   7  
ATOM 6336  C CG   . ARG A 1 11 ? 6.219   -6.991  3.062   1.00 0.00 ? 11 ARG A CG   7  
ATOM 6337  C CD   . ARG A 1 11 ? 6.885   -8.255  3.585   1.00 0.00 ? 11 ARG A CD   7  
ATOM 6338  N NE   . ARG A 1 11 ? 6.971   -9.292  2.560   1.00 0.00 ? 11 ARG A NE   7  
ATOM 6339  C CZ   . ARG A 1 11 ? 7.661   -10.417 2.710   1.00 0.00 ? 11 ARG A CZ   7  
ATOM 6340  N NH1  . ARG A 1 11 ? 8.320   -10.650 3.836   1.00 0.00 ? 11 ARG A NH1  7  
ATOM 6341  N NH2  . ARG A 1 11 ? 7.692   -11.313 1.731   1.00 0.00 ? 11 ARG A NH2  7  
ATOM 6342  H H    . ARG A 1 11 ? 2.385   -6.211  1.406   1.00 0.00 ? 11 ARG A H    7  
ATOM 6343  H HA   . ARG A 1 11 ? 3.945   -5.272  3.683   1.00 0.00 ? 11 ARG A HA   7  
ATOM 6344  H HB2  . ARG A 1 11 ? 4.369   -7.580  3.918   1.00 0.00 ? 11 ARG A HB2  7  
ATOM 6345  H HB3  . ARG A 1 11 ? 4.477   -7.823  2.180   1.00 0.00 ? 11 ARG A HB3  7  
ATOM 6346  H HG2  . ARG A 1 11 ? 6.599   -6.781  2.073   1.00 0.00 ? 11 ARG A HG2  7  
ATOM 6347  H HG3  . ARG A 1 11 ? 6.456   -6.171  3.722   1.00 0.00 ? 11 ARG A HG3  7  
ATOM 6348  H HD2  . ARG A 1 11 ? 7.882   -8.009  3.919   1.00 0.00 ? 11 ARG A HD2  7  
ATOM 6349  H HD3  . ARG A 1 11 ? 6.309   -8.631  4.417   1.00 0.00 ? 11 ARG A HD3  7  
ATOM 6350  H HE   . ARG A 1 11 ? 6.492   -9.140  1.719   1.00 0.00 ? 11 ARG A HE   7  
ATOM 6351  H HH11 . ARG A 1 11 ? 8.297   -9.977  4.576   1.00 0.00 ? 11 ARG A HH11 7  
ATOM 6352  H HH12 . ARG A 1 11 ? 8.837   -11.499 3.947   1.00 0.00 ? 11 ARG A HH12 7  
ATOM 6353  H HH21 . ARG A 1 11 ? 7.196   -11.141 0.880   1.00 0.00 ? 11 ARG A HH21 7  
ATOM 6354  H HH22 . ARG A 1 11 ? 8.211   -12.160 1.845   1.00 0.00 ? 11 ARG A HH22 7  
ATOM 6355  N N    . ALA A 1 12 ? 5.325   -3.915  2.140   1.00 0.00 ? 12 ALA A N    7  
ATOM 6356  C CA   . ALA A 1 12 ? 6.058   -3.040  1.234   1.00 0.00 ? 12 ALA A CA   7  
ATOM 6357  C C    . ALA A 1 12 ? 7.376   -3.677  0.804   1.00 0.00 ? 12 ALA A C    7  
ATOM 6358  O O    . ALA A 1 12 ? 8.347   -3.688  1.560   1.00 0.00 ? 12 ALA A O    7  
ATOM 6359  C CB   . ALA A 1 12 ? 6.311   -1.692  1.892   1.00 0.00 ? 12 ALA A CB   7  
ATOM 6360  H H    . ALA A 1 12 ? 5.295   -3.698  3.095   1.00 0.00 ? 12 ALA A H    7  
ATOM 6361  H HA   . ALA A 1 12 ? 5.446   -2.877  0.359   1.00 0.00 ? 12 ALA A HA   7  
ATOM 6362  H HB1  . ALA A 1 12 ? 6.455   -1.832  2.954   1.00 0.00 ? 12 ALA A HB1  7  
ATOM 6363  H HB2  . ALA A 1 12 ? 7.196   -1.243  1.465   1.00 0.00 ? 12 ALA A HB2  7  
ATOM 6364  H HB3  . ALA A 1 12 ? 5.463   -1.046  1.725   1.00 0.00 ? 12 ALA A HB3  7  
ATOM 6365  N N    . MET A 1 13 ? 7.402   -4.206  -0.415  1.00 0.00 ? 13 MET A N    7  
ATOM 6366  C CA   . MET A 1 13 ? 8.601   -4.844  -0.945  1.00 0.00 ? 13 MET A CA   7  
ATOM 6367  C C    . MET A 1 13 ? 9.755   -3.849  -1.027  1.00 0.00 ? 13 MET A C    7  
ATOM 6368  O O    . MET A 1 13 ? 10.923  -4.232  -0.958  1.00 0.00 ? 13 MET A O    7  
ATOM 6369  C CB   . MET A 1 13 ? 8.322   -5.433  -2.329  1.00 0.00 ? 13 MET A CB   7  
ATOM 6370  C CG   . MET A 1 13 ? 7.128   -6.374  -2.359  1.00 0.00 ? 13 MET A CG   7  
ATOM 6371  S SD   . MET A 1 13 ? 7.246   -7.604  -3.672  1.00 0.00 ? 13 MET A SD   7  
ATOM 6372  C CE   . MET A 1 13 ? 6.518   -6.709  -5.042  1.00 0.00 ? 13 MET A CE   7  
ATOM 6373  H H    . MET A 1 13 ? 6.596   -4.166  -0.971  1.00 0.00 ? 13 MET A H    7  
ATOM 6374  H HA   . MET A 1 13 ? 8.876   -5.642  -0.273  1.00 0.00 ? 13 MET A HA   7  
ATOM 6375  H HB2  . MET A 1 13 ? 8.134   -4.625  -3.020  1.00 0.00 ? 13 MET A HB2  7  
ATOM 6376  H HB3  . MET A 1 13 ? 9.192   -5.981  -2.657  1.00 0.00 ? 13 MET A HB3  7  
ATOM 6377  H HG2  . MET A 1 13 ? 7.065   -6.886  -1.411  1.00 0.00 ? 13 MET A HG2  7  
ATOM 6378  H HG3  . MET A 1 13 ? 6.232   -5.790  -2.511  1.00 0.00 ? 13 MET A HG3  7  
ATOM 6379  H HE1  . MET A 1 13 ? 6.598   -7.300  -5.942  1.00 0.00 ? 13 MET A HE1  7  
ATOM 6380  H HE2  . MET A 1 13 ? 5.477   -6.514  -4.831  1.00 0.00 ? 13 MET A HE2  7  
ATOM 6381  H HE3  . MET A 1 13 ? 7.040   -5.773  -5.178  1.00 0.00 ? 13 MET A HE3  7  
ATOM 6382  N N    . TYR A 1 14 ? 9.420   -2.572  -1.174  1.00 0.00 ? 14 TYR A N    7  
ATOM 6383  C CA   . TYR A 1 14 ? 10.429  -1.524  -1.267  1.00 0.00 ? 14 TYR A CA   7  
ATOM 6384  C C    . TYR A 1 14 ? 9.919   -0.222  -0.656  1.00 0.00 ? 14 TYR A C    7  
ATOM 6385  O O    . TYR A 1 14 ? 8.729   0.082   -0.722  1.00 0.00 ? 14 TYR A O    7  
ATOM 6386  C CB   . TYR A 1 14 ? 10.823  -1.295  -2.727  1.00 0.00 ? 14 TYR A CB   7  
ATOM 6387  C CG   . TYR A 1 14 ? 10.719  -2.537  -3.584  1.00 0.00 ? 14 TYR A CG   7  
ATOM 6388  C CD1  . TYR A 1 14 ? 11.775  -3.437  -3.667  1.00 0.00 ? 14 TYR A CD1  7  
ATOM 6389  C CD2  . TYR A 1 14 ? 9.567   -2.809  -4.311  1.00 0.00 ? 14 TYR A CD2  7  
ATOM 6390  C CE1  . TYR A 1 14 ? 11.685  -4.572  -4.449  1.00 0.00 ? 14 TYR A CE1  7  
ATOM 6391  C CE2  . TYR A 1 14 ? 9.469   -3.943  -5.095  1.00 0.00 ? 14 TYR A CE2  7  
ATOM 6392  C CZ   . TYR A 1 14 ? 10.530  -4.821  -5.160  1.00 0.00 ? 14 TYR A CZ   7  
ATOM 6393  O OH   . TYR A 1 14 ? 10.436  -5.950  -5.941  1.00 0.00 ? 14 TYR A OH   7  
ATOM 6394  H H    . TYR A 1 14 ? 8.472   -2.329  -1.222  1.00 0.00 ? 14 TYR A H    7  
ATOM 6395  H HA   . TYR A 1 14 ? 11.299  -1.850  -0.717  1.00 0.00 ? 14 TYR A HA   7  
ATOM 6396  H HB2  . TYR A 1 14 ? 10.176  -0.544  -3.154  1.00 0.00 ? 14 TYR A HB2  7  
ATOM 6397  H HB3  . TYR A 1 14 ? 11.845  -0.948  -2.767  1.00 0.00 ? 14 TYR A HB3  7  
ATOM 6398  H HD1  . TYR A 1 14 ? 12.678  -3.239  -3.109  1.00 0.00 ? 14 TYR A HD1  7  
ATOM 6399  H HD2  . TYR A 1 14 ? 8.738   -2.119  -4.258  1.00 0.00 ? 14 TYR A HD2  7  
ATOM 6400  H HE1  . TYR A 1 14 ? 12.516  -5.260  -4.501  1.00 0.00 ? 14 TYR A HE1  7  
ATOM 6401  H HE2  . TYR A 1 14 ? 8.564   -4.137  -5.652  1.00 0.00 ? 14 TYR A HE2  7  
ATOM 6402  H HH   . TYR A 1 14 ? 11.001  -6.637  -5.579  1.00 0.00 ? 14 TYR A HH   7  
ATOM 6403  N N    . GLN A 1 15 ? 10.831  0.542   -0.063  1.00 0.00 ? 15 GLN A N    7  
ATOM 6404  C CA   . GLN A 1 15 ? 10.475  1.812   0.560   1.00 0.00 ? 15 GLN A CA   7  
ATOM 6405  C C    . GLN A 1 15 ? 9.949   2.799   -0.478  1.00 0.00 ? 15 GLN A C    7  
ATOM 6406  O O    . GLN A 1 15 ? 10.380  2.790   -1.631  1.00 0.00 ? 15 GLN A O    7  
ATOM 6407  C CB   . GLN A 1 15 ? 11.685  2.407   1.281   1.00 0.00 ? 15 GLN A CB   7  
ATOM 6408  C CG   . GLN A 1 15 ? 11.400  3.745   1.944   1.00 0.00 ? 15 GLN A CG   7  
ATOM 6409  C CD   . GLN A 1 15 ? 12.637  4.363   2.566   1.00 0.00 ? 15 GLN A CD   7  
ATOM 6410  O OE1  . GLN A 1 15 ? 13.284  3.759   3.422   1.00 0.00 ? 15 GLN A OE1  7  
ATOM 6411  N NE2  . GLN A 1 15 ? 12.973  5.574   2.137   1.00 0.00 ? 15 GLN A NE2  7  
ATOM 6412  H H    . GLN A 1 15 ? 11.764  0.246   -0.044  1.00 0.00 ? 15 GLN A H    7  
ATOM 6413  H HA   . GLN A 1 15 ? 9.696   1.619   1.282   1.00 0.00 ? 15 GLN A HA   7  
ATOM 6414  H HB2  . GLN A 1 15 ? 12.013  1.715   2.041   1.00 0.00 ? 15 GLN A HB2  7  
ATOM 6415  H HB3  . GLN A 1 15 ? 12.482  2.548   0.565   1.00 0.00 ? 15 GLN A HB3  7  
ATOM 6416  H HG2  . GLN A 1 15 ? 11.011  4.426   1.202   1.00 0.00 ? 15 GLN A HG2  7  
ATOM 6417  H HG3  . GLN A 1 15 ? 10.661  3.598   2.718   1.00 0.00 ? 15 GLN A HG3  7  
ATOM 6418  H HE21 . GLN A 1 15 ? 12.410  5.995   1.453   1.00 0.00 ? 15 GLN A HE21 7  
ATOM 6419  H HE22 . GLN A 1 15 ? 13.767  5.998   2.522   1.00 0.00 ? 15 GLN A HE22 7  
ATOM 6420  N N    . TYR A 1 16 ? 9.017   3.648   -0.060  1.00 0.00 ? 16 TYR A N    7  
ATOM 6421  C CA   . TYR A 1 16 ? 8.431   4.639   -0.954  1.00 0.00 ? 16 TYR A CA   7  
ATOM 6422  C C    . TYR A 1 16 ? 8.640   6.051   -0.414  1.00 0.00 ? 16 TYR A C    7  
ATOM 6423  O O    . TYR A 1 16 ? 8.709   6.260   0.798   1.00 0.00 ? 16 TYR A O    7  
ATOM 6424  C CB   . TYR A 1 16 ? 6.937   4.368   -1.140  1.00 0.00 ? 16 TYR A CB   7  
ATOM 6425  C CG   . TYR A 1 16 ? 6.262   5.328   -2.094  1.00 0.00 ? 16 TYR A CG   7  
ATOM 6426  C CD1  . TYR A 1 16 ? 6.455   5.225   -3.466  1.00 0.00 ? 16 TYR A CD1  7  
ATOM 6427  C CD2  . TYR A 1 16 ? 5.430   6.336   -1.624  1.00 0.00 ? 16 TYR A CD2  7  
ATOM 6428  C CE1  . TYR A 1 16 ? 5.841   6.100   -4.342  1.00 0.00 ? 16 TYR A CE1  7  
ATOM 6429  C CE2  . TYR A 1 16 ? 4.811   7.215   -2.491  1.00 0.00 ? 16 TYR A CE2  7  
ATOM 6430  C CZ   . TYR A 1 16 ? 5.020   7.093   -3.849  1.00 0.00 ? 16 TYR A CZ   7  
ATOM 6431  O OH   . TYR A 1 16 ? 4.405   7.966   -4.718  1.00 0.00 ? 16 TYR A OH   7  
ATOM 6432  H H    . TYR A 1 16 ? 8.714   3.606   0.871   1.00 0.00 ? 16 TYR A H    7  
ATOM 6433  H HA   . TYR A 1 16 ? 8.924   4.556   -1.911  1.00 0.00 ? 16 TYR A HA   7  
ATOM 6434  H HB2  . TYR A 1 16 ? 6.804   3.370   -1.526  1.00 0.00 ? 16 TYR A HB2  7  
ATOM 6435  H HB3  . TYR A 1 16 ? 6.441   4.448   -0.184  1.00 0.00 ? 16 TYR A HB3  7  
ATOM 6436  H HD1  . TYR A 1 16 ? 7.099   4.446   -3.848  1.00 0.00 ? 16 TYR A HD1  7  
ATOM 6437  H HD2  . TYR A 1 16 ? 5.268   6.429   -0.559  1.00 0.00 ? 16 TYR A HD2  7  
ATOM 6438  H HE1  . TYR A 1 16 ? 6.004   6.005   -5.405  1.00 0.00 ? 16 TYR A HE1  7  
ATOM 6439  H HE2  . TYR A 1 16 ? 4.168   7.993   -2.107  1.00 0.00 ? 16 TYR A HE2  7  
ATOM 6440  H HH   . TYR A 1 16 ? 4.869   7.959   -5.559  1.00 0.00 ? 16 TYR A HH   7  
ATOM 6441  N N    . ARG A 1 17 ? 8.739   7.016   -1.322  1.00 0.00 ? 17 ARG A N    7  
ATOM 6442  C CA   . ARG A 1 17 ? 8.940   8.408   -0.938  1.00 0.00 ? 17 ARG A CA   7  
ATOM 6443  C C    . ARG A 1 17 ? 7.846   9.297   -1.523  1.00 0.00 ? 17 ARG A C    7  
ATOM 6444  O O    . ARG A 1 17 ? 7.969   9.829   -2.627  1.00 0.00 ? 17 ARG A O    7  
ATOM 6445  C CB   . ARG A 1 17 ? 10.313  8.895   -1.406  1.00 0.00 ? 17 ARG A CB   7  
ATOM 6446  C CG   . ARG A 1 17 ? 11.469  8.317   -0.607  1.00 0.00 ? 17 ARG A CG   7  
ATOM 6447  C CD   . ARG A 1 17 ? 12.768  9.054   -0.894  1.00 0.00 ? 17 ARG A CD   7  
ATOM 6448  N NE   . ARG A 1 17 ? 13.338  8.675   -2.185  1.00 0.00 ? 17 ARG A NE   7  
ATOM 6449  C CZ   . ARG A 1 17 ? 14.087  7.594   -2.368  1.00 0.00 ? 17 ARG A CZ   7  
ATOM 6450  N NH1  . ARG A 1 17 ? 14.355  6.788   -1.350  1.00 0.00 ? 17 ARG A NH1  7  
ATOM 6451  N NH2  . ARG A 1 17 ? 14.569  7.316   -3.573  1.00 0.00 ? 17 ARG A NH2  7  
ATOM 6452  H H    . ARG A 1 17 ? 8.675   6.787   -2.272  1.00 0.00 ? 17 ARG A H    7  
ATOM 6453  H HA   . ARG A 1 17 ? 8.896   8.465   0.139   1.00 0.00 ? 17 ARG A HA   7  
ATOM 6454  H HB2  . ARG A 1 17 ? 10.446  8.618   -2.442  1.00 0.00 ? 17 ARG A HB2  7  
ATOM 6455  H HB3  . ARG A 1 17 ? 10.347  9.970   -1.323  1.00 0.00 ? 17 ARG A HB3  7  
ATOM 6456  H HG2  . ARG A 1 17 ? 11.245  8.403   0.446   1.00 0.00 ? 17 ARG A HG2  7  
ATOM 6457  H HG3  . ARG A 1 17 ? 11.590  7.276   -0.867  1.00 0.00 ? 17 ARG A HG3  7  
ATOM 6458  H HD2  . ARG A 1 17 ? 12.572  10.116  -0.896  1.00 0.00 ? 17 ARG A HD2  7  
ATOM 6459  H HD3  . ARG A 1 17 ? 13.478  8.821   -0.115  1.00 0.00 ? 17 ARG A HD3  7  
ATOM 6460  H HE   . ARG A 1 17 ? 13.152  9.257   -2.951  1.00 0.00 ? 17 ARG A HE   7  
ATOM 6461  H HH11 . ARG A 1 17 ? 13.992  6.994   -0.442  1.00 0.00 ? 17 ARG A HH11 7  
ATOM 6462  H HH12 . ARG A 1 17 ? 14.918  5.974   -1.491  1.00 0.00 ? 17 ARG A HH12 7  
ATOM 6463  H HH21 . ARG A 1 17 ? 14.369  7.921   -4.343  1.00 0.00 ? 17 ARG A HH21 7  
ATOM 6464  H HH22 . ARG A 1 17 ? 15.133  6.503   -3.710  1.00 0.00 ? 17 ARG A HH22 7  
ATOM 6465  N N    . PRO A 1 18 ? 6.751   9.462   -0.768  1.00 0.00 ? 18 PRO A N    7  
ATOM 6466  C CA   . PRO A 1 18 ? 5.614   10.286  -1.191  1.00 0.00 ? 18 PRO A CA   7  
ATOM 6467  C C    . PRO A 1 18 ? 5.949   11.773  -1.203  1.00 0.00 ? 18 PRO A C    7  
ATOM 6468  O O    . PRO A 1 18 ? 6.330   12.341  -0.179  1.00 0.00 ? 18 PRO A O    7  
ATOM 6469  C CB   . PRO A 1 18 ? 4.547   9.987   -0.135  1.00 0.00 ? 18 PRO A CB   7  
ATOM 6470  C CG   . PRO A 1 18 ? 5.314   9.567   1.071   1.00 0.00 ? 18 PRO A CG   7  
ATOM 6471  C CD   . PRO A 1 18 ? 6.537   8.858   0.558   1.00 0.00 ? 18 PRO A CD   7  
ATOM 6472  H HA   . PRO A 1 18 ? 5.252   9.992   -2.165  1.00 0.00 ? 18 PRO A HA   7  
ATOM 6473  H HB2  . PRO A 1 18 ? 3.966   10.878  0.056   1.00 0.00 ? 18 PRO A HB2  7  
ATOM 6474  H HB3  . PRO A 1 18 ? 3.900   9.197   -0.486  1.00 0.00 ? 18 PRO A HB3  7  
ATOM 6475  H HG2  . PRO A 1 18 ? 5.598   10.435  1.646   1.00 0.00 ? 18 PRO A HG2  7  
ATOM 6476  H HG3  . PRO A 1 18 ? 4.716   8.897   1.671   1.00 0.00 ? 18 PRO A HG3  7  
ATOM 6477  H HD2  . PRO A 1 18 ? 7.380   9.042   1.207   1.00 0.00 ? 18 PRO A HD2  7  
ATOM 6478  H HD3  . PRO A 1 18 ? 6.349   7.797   0.472   1.00 0.00 ? 18 PRO A HD3  7  
ATOM 6479  N N    . GLN A 1 19 ? 5.805   12.398  -2.367  1.00 0.00 ? 19 GLN A N    7  
ATOM 6480  C CA   . GLN A 1 19 ? 6.093   13.820  -2.511  1.00 0.00 ? 19 GLN A CA   7  
ATOM 6481  C C    . GLN A 1 19 ? 5.104   14.660  -1.710  1.00 0.00 ? 19 GLN A C    7  
ATOM 6482  O O    . GLN A 1 19 ? 5.415   15.776  -1.296  1.00 0.00 ? 19 GLN A O    7  
ATOM 6483  C CB   . GLN A 1 19 ? 6.046   14.225  -3.986  1.00 0.00 ? 19 GLN A CB   7  
ATOM 6484  C CG   . GLN A 1 19 ? 7.302   13.856  -4.758  1.00 0.00 ? 19 GLN A CG   7  
ATOM 6485  C CD   . GLN A 1 19 ? 7.349   14.489  -6.134  1.00 0.00 ? 19 GLN A CD   7  
ATOM 6486  O OE1  . GLN A 1 19 ? 7.565   15.694  -6.269  1.00 0.00 ? 19 GLN A OE1  7  
ATOM 6487  N NE2  . GLN A 1 19 ? 7.146   13.679  -7.166  1.00 0.00 ? 19 GLN A NE2  7  
ATOM 6488  H H    . GLN A 1 19 ? 5.498   11.891  -3.147  1.00 0.00 ? 19 GLN A H    7  
ATOM 6489  H HA   . GLN A 1 19 ? 7.087   13.997  -2.130  1.00 0.00 ? 19 GLN A HA   7  
ATOM 6490  H HB2  . GLN A 1 19 ? 5.205   13.737  -4.454  1.00 0.00 ? 19 GLN A HB2  7  
ATOM 6491  H HB3  . GLN A 1 19 ? 5.912   15.295  -4.049  1.00 0.00 ? 19 GLN A HB3  7  
ATOM 6492  H HG2  . GLN A 1 19 ? 8.164   14.186  -4.198  1.00 0.00 ? 19 GLN A HG2  7  
ATOM 6493  H HG3  . GLN A 1 19 ? 7.338   12.782  -4.870  1.00 0.00 ? 19 GLN A HG3  7  
ATOM 6494  H HE21 . GLN A 1 19 ? 6.978   12.730  -6.984  1.00 0.00 ? 19 GLN A HE21 7  
ATOM 6495  H HE22 . GLN A 1 19 ? 7.169   14.062  -8.067  1.00 0.00 ? 19 GLN A HE22 7  
ATOM 6496  N N    . ASN A 1 20 ? 3.910   14.115  -1.495  1.00 0.00 ? 20 ASN A N    7  
ATOM 6497  C CA   . ASN A 1 20 ? 2.875   14.815  -0.744  1.00 0.00 ? 20 ASN A CA   7  
ATOM 6498  C C    . ASN A 1 20 ? 2.291   13.918  0.343   1.00 0.00 ? 20 ASN A C    7  
ATOM 6499  O O    . ASN A 1 20 ? 2.640   12.742  0.445   1.00 0.00 ? 20 ASN A O    7  
ATOM 6500  C CB   . ASN A 1 20 ? 1.763   15.286  -1.684  1.00 0.00 ? 20 ASN A CB   7  
ATOM 6501  C CG   . ASN A 1 20 ? 2.275   15.587  -3.079  1.00 0.00 ? 20 ASN A CG   7  
ATOM 6502  O OD1  . ASN A 1 20 ? 2.838   16.653  -3.329  1.00 0.00 ? 20 ASN A OD1  7  
ATOM 6503  N ND2  . ASN A 1 20 ? 2.081   14.646  -3.996  1.00 0.00 ? 20 ASN A ND2  7  
ATOM 6504  H H    . ASN A 1 20 ? 3.721   13.222  -1.850  1.00 0.00 ? 20 ASN A H    7  
ATOM 6505  H HA   . ASN A 1 20 ? 3.328   15.677  -0.278  1.00 0.00 ? 20 ASN A HA   7  
ATOM 6506  H HB2  . ASN A 1 20 ? 1.011   14.514  -1.756  1.00 0.00 ? 20 ASN A HB2  7  
ATOM 6507  H HB3  . ASN A 1 20 ? 1.316   16.182  -1.283  1.00 0.00 ? 20 ASN A HB3  7  
ATOM 6508  H HD21 . ASN A 1 20 ? 1.626   13.822  -3.725  1.00 0.00 ? 20 ASN A HD21 7  
ATOM 6509  H HD22 . ASN A 1 20 ? 2.403   14.814  -4.906  1.00 0.00 ? 20 ASN A HD22 7  
ATOM 6510  N N    . GLU A 1 21 ? 1.399   14.481  1.153   1.00 0.00 ? 21 GLU A N    7  
ATOM 6511  C CA   . GLU A 1 21 ? 0.767   13.731  2.232   1.00 0.00 ? 21 GLU A CA   7  
ATOM 6512  C C    . GLU A 1 21 ? -0.269  12.755  1.682   1.00 0.00 ? 21 GLU A C    7  
ATOM 6513  O O    . GLU A 1 21 ? -0.446  11.658  2.212   1.00 0.00 ? 21 GLU A O    7  
ATOM 6514  C CB   . GLU A 1 21 ? 0.107   14.687  3.228   1.00 0.00 ? 21 GLU A CB   7  
ATOM 6515  C CG   . GLU A 1 21 ? 1.099   15.493  4.048   1.00 0.00 ? 21 GLU A CG   7  
ATOM 6516  C CD   . GLU A 1 21 ? 0.428   16.553  4.900   1.00 0.00 ? 21 GLU A CD   7  
ATOM 6517  O OE1  . GLU A 1 21 ? -0.185  16.190  5.926   1.00 0.00 ? 21 GLU A OE1  7  
ATOM 6518  O OE2  . GLU A 1 21 ? 0.516   17.745  4.541   1.00 0.00 ? 21 GLU A OE2  7  
ATOM 6519  H H    . GLU A 1 21 ? 1.162   15.423  1.021   1.00 0.00 ? 21 GLU A H    7  
ATOM 6520  H HA   . GLU A 1 21 ? 1.537   13.171  2.741   1.00 0.00 ? 21 GLU A HA   7  
ATOM 6521  H HB2  . GLU A 1 21 ? -0.523  15.375  2.684   1.00 0.00 ? 21 GLU A HB2  7  
ATOM 6522  H HB3  . GLU A 1 21 ? -0.506  14.112  3.906   1.00 0.00 ? 21 GLU A HB3  7  
ATOM 6523  H HG2  . GLU A 1 21 ? 1.640   14.821  4.698   1.00 0.00 ? 21 GLU A HG2  7  
ATOM 6524  H HG3  . GLU A 1 21 ? 1.793   15.978  3.377   1.00 0.00 ? 21 GLU A HG3  7  
ATOM 6525  N N    . ASP A 1 22 ? -0.951  13.164  0.618   1.00 0.00 ? 22 ASP A N    7  
ATOM 6526  C CA   . ASP A 1 22 ? -1.970  12.327  -0.004  1.00 0.00 ? 22 ASP A CA   7  
ATOM 6527  C C    . ASP A 1 22 ? -1.487  10.885  -0.128  1.00 0.00 ? 22 ASP A C    7  
ATOM 6528  O O    . ASP A 1 22 ? -2.186  9.951   0.265   1.00 0.00 ? 22 ASP A O    7  
ATOM 6529  C CB   . ASP A 1 22 ? -2.338  12.874  -1.384  1.00 0.00 ? 22 ASP A CB   7  
ATOM 6530  C CG   . ASP A 1 22 ? -2.657  14.356  -1.353  1.00 0.00 ? 22 ASP A CG   7  
ATOM 6531  O OD1  . ASP A 1 22 ? -1.724  15.168  -1.526  1.00 0.00 ? 22 ASP A OD1  7  
ATOM 6532  O OD2  . ASP A 1 22 ? -3.840  14.703  -1.156  1.00 0.00 ? 22 ASP A OD2  7  
ATOM 6533  H H    . ASP A 1 22 ? -0.765  14.050  0.242   1.00 0.00 ? 22 ASP A H    7  
ATOM 6534  H HA   . ASP A 1 22 ? -2.846  12.347  0.626   1.00 0.00 ? 22 ASP A HA   7  
ATOM 6535  H HB2  . ASP A 1 22 ? -1.508  12.718  -2.059  1.00 0.00 ? 22 ASP A HB2  7  
ATOM 6536  H HB3  . ASP A 1 22 ? -3.203  12.345  -1.756  1.00 0.00 ? 22 ASP A HB3  7  
ATOM 6537  N N    . GLU A 1 23 ? -0.289  10.712  -0.677  1.00 0.00 ? 23 GLU A N    7  
ATOM 6538  C CA   . GLU A 1 23 ? 0.285   9.383   -0.854  1.00 0.00 ? 23 GLU A CA   7  
ATOM 6539  C C    . GLU A 1 23 ? 0.755   8.812   0.481   1.00 0.00 ? 23 GLU A C    7  
ATOM 6540  O O    . GLU A 1 23 ? 1.201   9.548   1.362   1.00 0.00 ? 23 GLU A O    7  
ATOM 6541  C CB   . GLU A 1 23 ? 1.455   9.436   -1.839  1.00 0.00 ? 23 GLU A CB   7  
ATOM 6542  C CG   . GLU A 1 23 ? 1.121   10.138  -3.144  1.00 0.00 ? 23 GLU A CG   7  
ATOM 6543  C CD   . GLU A 1 23 ? 2.253   10.069  -4.150  1.00 0.00 ? 23 GLU A CD   7  
ATOM 6544  O OE1  . GLU A 1 23 ? 3.396   10.410  -3.781  1.00 0.00 ? 23 GLU A OE1  7  
ATOM 6545  O OE2  . GLU A 1 23 ? 1.996   9.674   -5.307  1.00 0.00 ? 23 GLU A OE2  7  
ATOM 6546  H H    . GLU A 1 23 ? 0.220   11.496  -0.971  1.00 0.00 ? 23 GLU A H    7  
ATOM 6547  H HA   . GLU A 1 23 ? -0.483  8.741   -1.256  1.00 0.00 ? 23 GLU A HA   7  
ATOM 6548  H HB2  . GLU A 1 23 ? 2.278   9.957   -1.374  1.00 0.00 ? 23 GLU A HB2  7  
ATOM 6549  H HB3  . GLU A 1 23 ? 1.763   8.426   -2.066  1.00 0.00 ? 23 GLU A HB3  7  
ATOM 6550  H HG2  . GLU A 1 23 ? 0.247   9.672   -3.576  1.00 0.00 ? 23 GLU A HG2  7  
ATOM 6551  H HG3  . GLU A 1 23 ? 0.907   11.176  -2.935  1.00 0.00 ? 23 GLU A HG3  7  
ATOM 6552  N N    . LEU A 1 24 ? 0.650   7.495   0.623   1.00 0.00 ? 24 LEU A N    7  
ATOM 6553  C CA   . LEU A 1 24 ? 1.064   6.823   1.850   1.00 0.00 ? 24 LEU A CA   7  
ATOM 6554  C C    . LEU A 1 24 ? 2.501   6.325   1.741   1.00 0.00 ? 24 LEU A C    7  
ATOM 6555  O O    . LEU A 1 24 ? 2.841   5.579   0.823   1.00 0.00 ? 24 LEU A O    7  
ATOM 6556  C CB   . LEU A 1 24 ? 0.127   5.652   2.154   1.00 0.00 ? 24 LEU A CB   7  
ATOM 6557  C CG   . LEU A 1 24 ? 0.050   5.217   3.617   1.00 0.00 ? 24 LEU A CG   7  
ATOM 6558  C CD1  . LEU A 1 24 ? -0.230  6.412   4.516   1.00 0.00 ? 24 LEU A CD1  7  
ATOM 6559  C CD2  . LEU A 1 24 ? -1.018  4.148   3.800   1.00 0.00 ? 24 LEU A CD2  7  
ATOM 6560  H H    . LEU A 1 24 ? 0.287   6.961   -0.113  1.00 0.00 ? 24 LEU A H    7  
ATOM 6561  H HA   . LEU A 1 24 ? 1.004   7.539   2.656   1.00 0.00 ? 24 LEU A HA   7  
ATOM 6562  H HB2  . LEU A 1 24 ? -0.866  5.933   1.839   1.00 0.00 ? 24 LEU A HB2  7  
ATOM 6563  H HB3  . LEU A 1 24 ? 0.461   4.804   1.572   1.00 0.00 ? 24 LEU A HB3  7  
ATOM 6564  H HG   . LEU A 1 24 ? 1.001   4.794   3.912   1.00 0.00 ? 24 LEU A HG   7  
ATOM 6565  H HD11 . LEU A 1 24 ? -0.602  6.066   5.468   1.00 0.00 ? 24 LEU A HD11 7  
ATOM 6566  H HD12 . LEU A 1 24 ? -0.969  7.047   4.049   1.00 0.00 ? 24 LEU A HD12 7  
ATOM 6567  H HD13 . LEU A 1 24 ? 0.682   6.971   4.665   1.00 0.00 ? 24 LEU A HD13 7  
ATOM 6568  H HD21 . LEU A 1 24 ? -1.825  4.545   4.399   1.00 0.00 ? 24 LEU A HD21 7  
ATOM 6569  H HD22 . LEU A 1 24 ? -0.588  3.291   4.298   1.00 0.00 ? 24 LEU A HD22 7  
ATOM 6570  H HD23 . LEU A 1 24 ? -1.399  3.851   2.834   1.00 0.00 ? 24 LEU A HD23 7  
ATOM 6571  N N    . GLU A 1 25 ? 3.340   6.741   2.684   1.00 0.00 ? 25 GLU A N    7  
ATOM 6572  C CA   . GLU A 1 25 ? 4.740   6.335   2.694   1.00 0.00 ? 25 GLU A CA   7  
ATOM 6573  C C    . GLU A 1 25 ? 4.879   4.867   3.087   1.00 0.00 ? 25 GLU A C    7  
ATOM 6574  O O    . GLU A 1 25 ? 4.066   4.336   3.845   1.00 0.00 ? 25 GLU A O    7  
ATOM 6575  C CB   . GLU A 1 25 ? 5.542   7.211   3.659   1.00 0.00 ? 25 GLU A CB   7  
ATOM 6576  C CG   . GLU A 1 25 ? 7.046   7.038   3.532   1.00 0.00 ? 25 GLU A CG   7  
ATOM 6577  C CD   . GLU A 1 25 ? 7.582   5.927   4.413   1.00 0.00 ? 25 GLU A CD   7  
ATOM 6578  O OE1  . GLU A 1 25 ? 6.862   5.509   5.344   1.00 0.00 ? 25 GLU A OE1  7  
ATOM 6579  O OE2  . GLU A 1 25 ? 8.721   5.475   4.172   1.00 0.00 ? 25 GLU A OE2  7  
ATOM 6580  H H    . GLU A 1 25 ? 3.009   7.335   3.390   1.00 0.00 ? 25 GLU A H    7  
ATOM 6581  H HA   . GLU A 1 25 ? 5.130   6.466   1.696   1.00 0.00 ? 25 GLU A HA   7  
ATOM 6582  H HB2  . GLU A 1 25 ? 5.301   8.247   3.471   1.00 0.00 ? 25 GLU A HB2  7  
ATOM 6583  H HB3  . GLU A 1 25 ? 5.257   6.963   4.671   1.00 0.00 ? 25 GLU A HB3  7  
ATOM 6584  H HG2  . GLU A 1 25 ? 7.283   6.808   2.504   1.00 0.00 ? 25 GLU A HG2  7  
ATOM 6585  H HG3  . GLU A 1 25 ? 7.527   7.964   3.812   1.00 0.00 ? 25 GLU A HG3  7  
ATOM 6586  N N    . LEU A 1 26 ? 5.913   4.216   2.566   1.00 0.00 ? 26 LEU A N    7  
ATOM 6587  C CA   . LEU A 1 26 ? 6.159   2.809   2.861   1.00 0.00 ? 26 LEU A CA   7  
ATOM 6588  C C    . LEU A 1 26 ? 7.628   2.571   3.194   1.00 0.00 ? 26 LEU A C    7  
ATOM 6589  O O    . LEU A 1 26 ? 8.479   3.424   2.938   1.00 0.00 ? 26 LEU A O    7  
ATOM 6590  C CB   . LEU A 1 26 ? 5.747   1.939   1.672   1.00 0.00 ? 26 LEU A CB   7  
ATOM 6591  C CG   . LEU A 1 26 ? 4.286   2.050   1.233   1.00 0.00 ? 26 LEU A CG   7  
ATOM 6592  C CD1  . LEU A 1 26 ? 4.111   1.513   -0.179  1.00 0.00 ? 26 LEU A CD1  7  
ATOM 6593  C CD2  . LEU A 1 26 ? 3.379   1.308   2.204   1.00 0.00 ? 26 LEU A CD2  7  
ATOM 6594  H H    . LEU A 1 26 ? 6.526   4.692   1.968   1.00 0.00 ? 26 LEU A H    7  
ATOM 6595  H HA   . LEU A 1 26 ? 5.560   2.541   3.718   1.00 0.00 ? 26 LEU A HA   7  
ATOM 6596  H HB2  . LEU A 1 26 ? 6.366   2.212   0.832   1.00 0.00 ? 26 LEU A HB2  7  
ATOM 6597  H HB3  . LEU A 1 26 ? 5.936   0.908   1.937   1.00 0.00 ? 26 LEU A HB3  7  
ATOM 6598  H HG   . LEU A 1 26 ? 3.996   3.092   1.232   1.00 0.00 ? 26 LEU A HG   7  
ATOM 6599  H HD11 . LEU A 1 26 ? 3.167   1.852   -0.578  1.00 0.00 ? 26 LEU A HD11 7  
ATOM 6600  H HD12 . LEU A 1 26 ? 4.127   0.434   -0.158  1.00 0.00 ? 26 LEU A HD12 7  
ATOM 6601  H HD13 . LEU A 1 26 ? 4.916   1.873   -0.803  1.00 0.00 ? 26 LEU A HD13 7  
ATOM 6602  H HD21 . LEU A 1 26 ? 2.749   2.017   2.721   1.00 0.00 ? 26 LEU A HD21 7  
ATOM 6603  H HD22 . LEU A 1 26 ? 3.983   0.773   2.923   1.00 0.00 ? 26 LEU A HD22 7  
ATOM 6604  H HD23 . LEU A 1 26 ? 2.764   0.609   1.659   1.00 0.00 ? 26 LEU A HD23 7  
ATOM 6605  N N    . ARG A 1 27 ? 7.920   1.407   3.765   1.00 0.00 ? 27 ARG A N    7  
ATOM 6606  C CA   . ARG A 1 27 ? 9.286   1.057   4.133   1.00 0.00 ? 27 ARG A CA   7  
ATOM 6607  C C    . ARG A 1 27 ? 9.559   -0.421  3.867   1.00 0.00 ? 27 ARG A C    7  
ATOM 6608  O O    . ARG A 1 27 ? 8.744   -1.281  4.200   1.00 0.00 ? 27 ARG A O    7  
ATOM 6609  C CB   . ARG A 1 27 ? 9.538   1.376   5.607   1.00 0.00 ? 27 ARG A CB   7  
ATOM 6610  C CG   . ARG A 1 27 ? 10.889  0.895   6.112   1.00 0.00 ? 27 ARG A CG   7  
ATOM 6611  C CD   . ARG A 1 27 ? 11.968  1.946   5.903   1.00 0.00 ? 27 ARG A CD   7  
ATOM 6612  N NE   . ARG A 1 27 ? 13.026  1.850   6.905   1.00 0.00 ? 27 ARG A NE   7  
ATOM 6613  C CZ   . ARG A 1 27 ? 12.872  2.212   8.174   1.00 0.00 ? 27 ARG A CZ   7  
ATOM 6614  N NH1  . ARG A 1 27 ? 11.708  2.690   8.594   1.00 0.00 ? 27 ARG A NH1  7  
ATOM 6615  N NH2  . ARG A 1 27 ? 13.882  2.094   9.026   1.00 0.00 ? 27 ARG A NH2  7  
ATOM 6616  H H    . ARG A 1 27 ? 7.198   0.769   3.944   1.00 0.00 ? 27 ARG A H    7  
ATOM 6617  H HA   . ARG A 1 27 ? 9.955   1.649   3.526   1.00 0.00 ? 27 ARG A HA   7  
ATOM 6618  H HB2  . ARG A 1 27 ? 9.487   2.446   5.746   1.00 0.00 ? 27 ARG A HB2  7  
ATOM 6619  H HB3  . ARG A 1 27 ? 8.768   0.908   6.201   1.00 0.00 ? 27 ARG A HB3  7  
ATOM 6620  H HG2  . ARG A 1 27 ? 10.812  0.679   7.168   1.00 0.00 ? 27 ARG A HG2  7  
ATOM 6621  H HG3  . ARG A 1 27 ? 11.163  -0.002  5.578   1.00 0.00 ? 27 ARG A HG3  7  
ATOM 6622  H HD2  . ARG A 1 27 ? 12.400  1.809   4.923   1.00 0.00 ? 27 ARG A HD2  7  
ATOM 6623  H HD3  . ARG A 1 27 ? 11.515  2.924   5.963   1.00 0.00 ? 27 ARG A HD3  7  
ATOM 6624  H HE   . ARG A 1 27 ? 13.894  1.500   6.617   1.00 0.00 ? 27 ARG A HE   7  
ATOM 6625  H HH11 . ARG A 1 27 ? 10.945  2.778   7.954   1.00 0.00 ? 27 ARG A HH11 7  
ATOM 6626  H HH12 . ARG A 1 27 ? 11.594  2.960   9.550   1.00 0.00 ? 27 ARG A HH12 7  
ATOM 6627  H HH21 . ARG A 1 27 ? 14.760  1.734   8.714   1.00 0.00 ? 27 ARG A HH21 7  
ATOM 6628  H HH22 . ARG A 1 27 ? 13.765  2.367   9.981   1.00 0.00 ? 27 ARG A HH22 7  
ATOM 6629  N N    . GLU A 1 28 ? 10.710  -0.707  3.266   1.00 0.00 ? 28 GLU A N    7  
ATOM 6630  C CA   . GLU A 1 28 ? 11.088  -2.080  2.955   1.00 0.00 ? 28 GLU A CA   7  
ATOM 6631  C C    . GLU A 1 28 ? 11.040  -2.954  4.206   1.00 0.00 ? 28 GLU A C    7  
ATOM 6632  O O    . GLU A 1 28 ? 11.847  -2.793  5.120   1.00 0.00 ? 28 GLU A O    7  
ATOM 6633  C CB   . GLU A 1 28 ? 12.491  -2.121  2.345   1.00 0.00 ? 28 GLU A CB   7  
ATOM 6634  C CG   . GLU A 1 28 ? 12.959  -3.521  1.990   1.00 0.00 ? 28 GLU A CG   7  
ATOM 6635  C CD   . GLU A 1 28 ? 14.471  -3.640  1.958   1.00 0.00 ? 28 GLU A CD   7  
ATOM 6636  O OE1  . GLU A 1 28 ? 15.090  -3.079  1.030   1.00 0.00 ? 28 GLU A OE1  7  
ATOM 6637  O OE2  . GLU A 1 28 ? 15.034  -4.295  2.860   1.00 0.00 ? 28 GLU A OE2  7  
ATOM 6638  H H    . GLU A 1 28 ? 11.318  0.023   3.026   1.00 0.00 ? 28 GLU A H    7  
ATOM 6639  H HA   . GLU A 1 28 ? 10.381  -2.464  2.235   1.00 0.00 ? 28 GLU A HA   7  
ATOM 6640  H HB2  . GLU A 1 28 ? 12.497  -1.522  1.447   1.00 0.00 ? 28 GLU A HB2  7  
ATOM 6641  H HB3  . GLU A 1 28 ? 13.189  -1.699  3.053   1.00 0.00 ? 28 GLU A HB3  7  
ATOM 6642  H HG2  . GLU A 1 28 ? 12.575  -4.213  2.724   1.00 0.00 ? 28 GLU A HG2  7  
ATOM 6643  H HG3  . GLU A 1 28 ? 12.572  -3.780  1.015   1.00 0.00 ? 28 GLU A HG3  7  
ATOM 6644  N N    . GLY A 1 29 ? 10.085  -3.879  4.237   1.00 0.00 ? 29 GLY A N    7  
ATOM 6645  C CA   . GLY A 1 29 ? 9.948   -4.764  5.379   1.00 0.00 ? 29 GLY A CA   7  
ATOM 6646  C C    . GLY A 1 29 ? 8.899   -4.283  6.363   1.00 0.00 ? 29 GLY A C    7  
ATOM 6647  O O    . GLY A 1 29 ? 9.081   -4.391  7.576   1.00 0.00 ? 29 GLY A O    7  
ATOM 6648  H H    . GLY A 1 29 ? 9.469   -3.961  3.479   1.00 0.00 ? 29 GLY A H    7  
ATOM 6649  H HA2  . GLY A 1 29 ? 9.673   -5.747  5.028   1.00 0.00 ? 29 GLY A HA2  7  
ATOM 6650  H HA3  . GLY A 1 29 ? 10.899  -4.827  5.887   1.00 0.00 ? 29 GLY A HA3  7  
ATOM 6651  N N    . ASP A 1 30 ? 7.801   -3.751  5.840   1.00 0.00 ? 30 ASP A N    7  
ATOM 6652  C CA   . ASP A 1 30 ? 6.719   -3.251  6.680   1.00 0.00 ? 30 ASP A CA   7  
ATOM 6653  C C    . ASP A 1 30 ? 5.368   -3.758  6.186   1.00 0.00 ? 30 ASP A C    7  
ATOM 6654  O O    . ASP A 1 30 ? 5.190   -4.021  4.996   1.00 0.00 ? 30 ASP A O    7  
ATOM 6655  C CB   . ASP A 1 30 ? 6.727   -1.722  6.703   1.00 0.00 ? 30 ASP A CB   7  
ATOM 6656  C CG   . ASP A 1 30 ? 7.693   -1.163  7.728   1.00 0.00 ? 30 ASP A CG   7  
ATOM 6657  O OD1  . ASP A 1 30 ? 8.912   -1.391  7.582   1.00 0.00 ? 30 ASP A OD1  7  
ATOM 6658  O OD2  . ASP A 1 30 ? 7.231   -0.496  8.678   1.00 0.00 ? 30 ASP A OD2  7  
ATOM 6659  H H    . ASP A 1 30 ? 7.715   -3.693  4.865   1.00 0.00 ? 30 ASP A H    7  
ATOM 6660  H HA   . ASP A 1 30 ? 6.881   -3.617  7.683   1.00 0.00 ? 30 ASP A HA   7  
ATOM 6661  H HB2  . ASP A 1 30 ? 7.014   -1.355  5.728   1.00 0.00 ? 30 ASP A HB2  7  
ATOM 6662  H HB3  . ASP A 1 30 ? 5.734   -1.366  6.938   1.00 0.00 ? 30 ASP A HB3  7  
ATOM 6663  N N    . ARG A 1 31 ? 4.419   -3.892  7.106   1.00 0.00 ? 31 ARG A N    7  
ATOM 6664  C CA   . ARG A 1 31 ? 3.084   -4.370  6.764   1.00 0.00 ? 31 ARG A CA   7  
ATOM 6665  C C    . ARG A 1 31 ? 2.184   -3.212  6.342   1.00 0.00 ? 31 ARG A C    7  
ATOM 6666  O O    . ARG A 1 31 ? 2.304   -2.100  6.855   1.00 0.00 ? 31 ARG A O    7  
ATOM 6667  C CB   . ARG A 1 31 ? 2.463   -5.106  7.952   1.00 0.00 ? 31 ARG A CB   7  
ATOM 6668  C CG   . ARG A 1 31 ? 3.174   -6.402  8.306   1.00 0.00 ? 31 ARG A CG   7  
ATOM 6669  C CD   . ARG A 1 31 ? 2.849   -7.505  7.311   1.00 0.00 ? 31 ARG A CD   7  
ATOM 6670  N NE   . ARG A 1 31 ? 3.689   -8.684  7.507   1.00 0.00 ? 31 ARG A NE   7  
ATOM 6671  C CZ   . ARG A 1 31 ? 4.985   -8.718  7.217   1.00 0.00 ? 31 ARG A CZ   7  
ATOM 6672  N NH1  . ARG A 1 31 ? 5.586   -7.645  6.723   1.00 0.00 ? 31 ARG A NH1  7  
ATOM 6673  N NH2  . ARG A 1 31 ? 5.683   -9.828  7.423   1.00 0.00 ? 31 ARG A NH2  7  
ATOM 6674  H H    . ARG A 1 31 ? 4.621   -3.666  8.038   1.00 0.00 ? 31 ARG A H    7  
ATOM 6675  H HA   . ARG A 1 31 ? 3.180   -5.056  5.936   1.00 0.00 ? 31 ARG A HA   7  
ATOM 6676  H HB2  . ARG A 1 31 ? 2.490   -4.459  8.816   1.00 0.00 ? 31 ARG A HB2  7  
ATOM 6677  H HB3  . ARG A 1 31 ? 1.434   -5.338  7.718   1.00 0.00 ? 31 ARG A HB3  7  
ATOM 6678  H HG2  . ARG A 1 31 ? 4.240   -6.230  8.299   1.00 0.00 ? 31 ARG A HG2  7  
ATOM 6679  H HG3  . ARG A 1 31 ? 2.864   -6.714  9.292   1.00 0.00 ? 31 ARG A HG3  7  
ATOM 6680  H HD2  . ARG A 1 31 ? 1.814   -7.789  7.434   1.00 0.00 ? 31 ARG A HD2  7  
ATOM 6681  H HD3  . ARG A 1 31 ? 3.002   -7.127  6.311   1.00 0.00 ? 31 ARG A HD3  7  
ATOM 6682  H HE   . ARG A 1 31 ? 3.266   -9.488  7.871   1.00 0.00 ? 31 ARG A HE   7  
ATOM 6683  H HH11 . ARG A 1 31 ? 5.063   -6.807  6.568   1.00 0.00 ? 31 ARG A HH11 7  
ATOM 6684  H HH12 . ARG A 1 31 ? 6.563   -7.673  6.507   1.00 0.00 ? 31 ARG A HH12 7  
ATOM 6685  H HH21 . ARG A 1 31 ? 5.234   -10.639 7.796   1.00 0.00 ? 31 ARG A HH21 7  
ATOM 6686  H HH22 . ARG A 1 31 ? 6.658   -9.853  7.205   1.00 0.00 ? 31 ARG A HH22 7  
ATOM 6687  N N    . VAL A 1 32 ? 1.283   -3.482  5.402   1.00 0.00 ? 32 VAL A N    7  
ATOM 6688  C CA   . VAL A 1 32 ? 0.363   -2.463  4.911   1.00 0.00 ? 32 VAL A CA   7  
ATOM 6689  C C    . VAL A 1 32 ? -1.060  -3.005  4.823   1.00 0.00 ? 32 VAL A C    7  
ATOM 6690  O O    . VAL A 1 32 ? -1.286  -4.105  4.318   1.00 0.00 ? 32 VAL A O    7  
ATOM 6691  C CB   . VAL A 1 32 ? 0.789   -1.942  3.526   1.00 0.00 ? 32 VAL A CB   7  
ATOM 6692  C CG1  . VAL A 1 32 ? -0.020  -0.712  3.146   1.00 0.00 ? 32 VAL A CG1  7  
ATOM 6693  C CG2  . VAL A 1 32 ? 2.279   -1.638  3.507   1.00 0.00 ? 32 VAL A CG2  7  
ATOM 6694  H H    . VAL A 1 32 ? 1.236   -4.387  5.031   1.00 0.00 ? 32 VAL A H    7  
ATOM 6695  H HA   . VAL A 1 32 ? 0.380   -1.635  5.605   1.00 0.00 ? 32 VAL A HA   7  
ATOM 6696  H HB   . VAL A 1 32 ? 0.592   -2.714  2.797   1.00 0.00 ? 32 VAL A HB   7  
ATOM 6697  H HG11 . VAL A 1 32 ? 0.479   0.174   3.513   1.00 0.00 ? 32 VAL A HG11 7  
ATOM 6698  H HG12 . VAL A 1 32 ? -0.109  -0.657  2.071   1.00 0.00 ? 32 VAL A HG12 7  
ATOM 6699  H HG13 . VAL A 1 32 ? -1.004  -0.778  3.587   1.00 0.00 ? 32 VAL A HG13 7  
ATOM 6700  H HG21 . VAL A 1 32 ? 2.696   -1.939  2.558   1.00 0.00 ? 32 VAL A HG21 7  
ATOM 6701  H HG22 . VAL A 1 32 ? 2.432   -0.577  3.647   1.00 0.00 ? 32 VAL A HG22 7  
ATOM 6702  H HG23 . VAL A 1 32 ? 2.768   -2.179  4.304   1.00 0.00 ? 32 VAL A HG23 7  
ATOM 6703  N N    . ASP A 1 33 ? -2.015  -2.226  5.316   1.00 0.00 ? 33 ASP A N    7  
ATOM 6704  C CA   . ASP A 1 33 ? -3.417  -2.626  5.292   1.00 0.00 ? 33 ASP A CA   7  
ATOM 6705  C C    . ASP A 1 33 ? -4.124  -2.057  4.065   1.00 0.00 ? 33 ASP A C    7  
ATOM 6706  O O    . ASP A 1 33 ? -4.419  -0.864  4.004   1.00 0.00 ? 33 ASP A O    7  
ATOM 6707  C CB   . ASP A 1 33 ? -4.125  -2.161  6.565   1.00 0.00 ? 33 ASP A CB   7  
ATOM 6708  C CG   . ASP A 1 33 ? -3.652  -2.908  7.796   1.00 0.00 ? 33 ASP A CG   7  
ATOM 6709  O OD1  . ASP A 1 33 ? -2.650  -3.647  7.694   1.00 0.00 ? 33 ASP A OD1  7  
ATOM 6710  O OD2  . ASP A 1 33 ? -4.282  -2.752  8.863   1.00 0.00 ? 33 ASP A OD2  7  
ATOM 6711  H H    . ASP A 1 33 ? -1.772  -1.360  5.706   1.00 0.00 ? 33 ASP A H    7  
ATOM 6712  H HA   . ASP A 1 33 ? -3.454  -3.704  5.244   1.00 0.00 ? 33 ASP A HA   7  
ATOM 6713  H HB2  . ASP A 1 33 ? -3.935  -1.108  6.711   1.00 0.00 ? 33 ASP A HB2  7  
ATOM 6714  H HB3  . ASP A 1 33 ? -5.188  -2.319  6.456   1.00 0.00 ? 33 ASP A HB3  7  
ATOM 6715  N N    . VAL A 1 34 ? -4.391  -2.919  3.089   1.00 0.00 ? 34 VAL A N    7  
ATOM 6716  C CA   . VAL A 1 34 ? -5.062  -2.502  1.864   1.00 0.00 ? 34 VAL A CA   7  
ATOM 6717  C C    . VAL A 1 34 ? -6.548  -2.843  1.908   1.00 0.00 ? 34 VAL A C    7  
ATOM 6718  O O    . VAL A 1 34 ? -6.925  -3.985  2.167   1.00 0.00 ? 34 VAL A O    7  
ATOM 6719  C CB   . VAL A 1 34 ? -4.431  -3.165  0.625   1.00 0.00 ? 34 VAL A CB   7  
ATOM 6720  C CG1  . VAL A 1 34 ? -5.348  -3.025  -0.581  1.00 0.00 ? 34 VAL A CG1  7  
ATOM 6721  C CG2  . VAL A 1 34 ? -3.064  -2.563  0.337   1.00 0.00 ? 34 VAL A CG2  7  
ATOM 6722  H H    . VAL A 1 34 ? -4.131  -3.858  3.196   1.00 0.00 ? 34 VAL A H    7  
ATOM 6723  H HA   . VAL A 1 34 ? -4.951  -1.432  1.769   1.00 0.00 ? 34 VAL A HA   7  
ATOM 6724  H HB   . VAL A 1 34 ? -4.302  -4.217  0.831   1.00 0.00 ? 34 VAL A HB   7  
ATOM 6725  H HG11 . VAL A 1 34 ? -4.843  -3.393  -1.462  1.00 0.00 ? 34 VAL A HG11 7  
ATOM 6726  H HG12 . VAL A 1 34 ? -6.250  -3.597  -0.416  1.00 0.00 ? 34 VAL A HG12 7  
ATOM 6727  H HG13 . VAL A 1 34 ? -5.602  -1.985  -0.721  1.00 0.00 ? 34 VAL A HG13 7  
ATOM 6728  H HG21 . VAL A 1 34 ? -3.111  -1.491  0.456   1.00 0.00 ? 34 VAL A HG21 7  
ATOM 6729  H HG22 . VAL A 1 34 ? -2.339  -2.970  1.028   1.00 0.00 ? 34 VAL A HG22 7  
ATOM 6730  H HG23 . VAL A 1 34 ? -2.771  -2.802  -0.674  1.00 0.00 ? 34 VAL A HG23 7  
ATOM 6731  N N    . MET A 1 35 ? -7.386  -1.844  1.652   1.00 0.00 ? 35 MET A N    7  
ATOM 6732  C CA   . MET A 1 35 ? -8.831  -2.039  1.661   1.00 0.00 ? 35 MET A CA   7  
ATOM 6733  C C    . MET A 1 35 ? -9.389  -2.032  0.241   1.00 0.00 ? 35 MET A C    7  
ATOM 6734  O O    . MET A 1 35 ? -10.098 -2.955  -0.160  1.00 0.00 ? 35 MET A O    7  
ATOM 6735  C CB   . MET A 1 35 ? -9.509  -0.949  2.493   1.00 0.00 ? 35 MET A CB   7  
ATOM 6736  C CG   . MET A 1 35 ? -9.198  -1.036  3.978   1.00 0.00 ? 35 MET A CG   7  
ATOM 6737  S SD   . MET A 1 35 ? -9.854  0.362   4.909   1.00 0.00 ? 35 MET A SD   7  
ATOM 6738  C CE   . MET A 1 35 ? -8.375  0.943   5.736   1.00 0.00 ? 35 MET A CE   7  
ATOM 6739  H H    . MET A 1 35 ? -7.025  -0.955  1.452   1.00 0.00 ? 35 MET A H    7  
ATOM 6740  H HA   . MET A 1 35 ? -9.033  -3.000  2.110   1.00 0.00 ? 35 MET A HA   7  
ATOM 6741  H HB2  . MET A 1 35 ? -9.183  0.016   2.135   1.00 0.00 ? 35 MET A HB2  7  
ATOM 6742  H HB3  . MET A 1 35 ? -10.579 -1.028  2.367   1.00 0.00 ? 35 MET A HB3  7  
ATOM 6743  H HG2  . MET A 1 35 ? -9.629  -1.945  4.371   1.00 0.00 ? 35 MET A HG2  7  
ATOM 6744  H HG3  . MET A 1 35 ? -8.125  -1.064  4.106   1.00 0.00 ? 35 MET A HG3  7  
ATOM 6745  H HE1  . MET A 1 35 ? -7.595  0.203   5.639   1.00 0.00 ? 35 MET A HE1  7  
ATOM 6746  H HE2  . MET A 1 35 ? -8.052  1.869   5.285   1.00 0.00 ? 35 MET A HE2  7  
ATOM 6747  H HE3  . MET A 1 35 ? -8.589  1.106   6.782   1.00 0.00 ? 35 MET A HE3  7  
ATOM 6748  N N    . GLN A 1 36 ? -9.066  -0.986  -0.512  1.00 0.00 ? 36 GLN A N    7  
ATOM 6749  C CA   . GLN A 1 36 ? -9.536  -0.861  -1.886  1.00 0.00 ? 36 GLN A CA   7  
ATOM 6750  C C    . GLN A 1 36 ? -8.398  -1.092  -2.875  1.00 0.00 ? 36 GLN A C    7  
ATOM 6751  O O    . GLN A 1 36 ? -7.228  -0.911  -2.541  1.00 0.00 ? 36 GLN A O    7  
ATOM 6752  C CB   . GLN A 1 36 ? -10.151 0.522   -2.113  1.00 0.00 ? 36 GLN A CB   7  
ATOM 6753  C CG   . GLN A 1 36 ? -10.709 0.717   -3.513  1.00 0.00 ? 36 GLN A CG   7  
ATOM 6754  C CD   . GLN A 1 36 ? -11.065 2.162   -3.803  1.00 0.00 ? 36 GLN A CD   7  
ATOM 6755  O OE1  . GLN A 1 36 ? -10.190 2.988   -4.068  1.00 0.00 ? 36 GLN A OE1  7  
ATOM 6756  N NE2  . GLN A 1 36 ? -12.354 2.476   -3.754  1.00 0.00 ? 36 GLN A NE2  7  
ATOM 6757  H H    . GLN A 1 36 ? -8.498  -0.283  -0.135  1.00 0.00 ? 36 GLN A H    7  
ATOM 6758  H HA   . GLN A 1 36 ? -10.294 -1.612  -2.047  1.00 0.00 ? 36 GLN A HA   7  
ATOM 6759  H HB2  . GLN A 1 36 ? -10.953 0.666   -1.405  1.00 0.00 ? 36 GLN A HB2  7  
ATOM 6760  H HB3  . GLN A 1 36 ? -9.393  1.272   -1.943  1.00 0.00 ? 36 GLN A HB3  7  
ATOM 6761  H HG2  . GLN A 1 36 ? -9.969  0.395   -4.230  1.00 0.00 ? 36 GLN A HG2  7  
ATOM 6762  H HG3  . GLN A 1 36 ? -11.599 0.114   -3.619  1.00 0.00 ? 36 GLN A HG3  7  
ATOM 6763  H HE21 . GLN A 1 36 ? -12.995 1.767   -3.536  1.00 0.00 ? 36 GLN A HE21 7  
ATOM 6764  H HE22 . GLN A 1 36 ? -12.612 3.403   -3.937  1.00 0.00 ? 36 GLN A HE22 7  
ATOM 6765  N N    . GLN A 1 37 ? -8.751  -1.494  -4.092  1.00 0.00 ? 37 GLN A N    7  
ATOM 6766  C CA   . GLN A 1 37 ? -7.758  -1.751  -5.128  1.00 0.00 ? 37 GLN A CA   7  
ATOM 6767  C C    . GLN A 1 37 ? -8.120  -1.027  -6.421  1.00 0.00 ? 37 GLN A C    7  
ATOM 6768  O O    . GLN A 1 37 ? -9.276  -1.033  -6.844  1.00 0.00 ? 37 GLN A O    7  
ATOM 6769  C CB   . GLN A 1 37 ? -7.639  -3.254  -5.388  1.00 0.00 ? 37 GLN A CB   7  
ATOM 6770  C CG   . GLN A 1 37 ? -7.662  -4.094  -4.122  1.00 0.00 ? 37 GLN A CG   7  
ATOM 6771  C CD   . GLN A 1 37 ? -7.114  -5.491  -4.338  1.00 0.00 ? 37 GLN A CD   7  
ATOM 6772  O OE1  . GLN A 1 37 ? -6.813  -5.885  -5.465  1.00 0.00 ? 37 GLN A OE1  7  
ATOM 6773  N NE2  . GLN A 1 37 ? -6.981  -6.249  -3.255  1.00 0.00 ? 37 GLN A NE2  7  
ATOM 6774  H H    . GLN A 1 37 ? -9.700  -1.620  -4.297  1.00 0.00 ? 37 GLN A H    7  
ATOM 6775  H HA   . GLN A 1 37 ? -6.808  -1.380  -4.776  1.00 0.00 ? 37 GLN A HA   7  
ATOM 6776  H HB2  . GLN A 1 37 ? -8.461  -3.565  -6.016  1.00 0.00 ? 37 GLN A HB2  7  
ATOM 6777  H HB3  . GLN A 1 37 ? -6.710  -3.446  -5.904  1.00 0.00 ? 37 GLN A HB3  7  
ATOM 6778  H HG2  . GLN A 1 37 ? -7.065  -3.603  -3.368  1.00 0.00 ? 37 GLN A HG2  7  
ATOM 6779  H HG3  . GLN A 1 37 ? -8.683  -4.173  -3.776  1.00 0.00 ? 37 GLN A HG3  7  
ATOM 6780  H HE21 . GLN A 1 37 ? -7.242  -5.869  -2.390  1.00 0.00 ? 37 GLN A HE21 7  
ATOM 6781  H HE22 . GLN A 1 37 ? -6.629  -7.156  -3.366  1.00 0.00 ? 37 GLN A HE22 7  
ATOM 6782  N N    . CYS A 1 38 ? -7.125  -0.404  -7.042  1.00 0.00 ? 38 CYS A N    7  
ATOM 6783  C CA   . CYS A 1 38 ? -7.338  0.326   -8.287  1.00 0.00 ? 38 CYS A CA   7  
ATOM 6784  C C    . CYS A 1 38 ? -7.154  -0.589  -9.493  1.00 0.00 ? 38 CYS A C    7  
ATOM 6785  O O    . CYS A 1 38 ? -6.513  -1.635  -9.399  1.00 0.00 ? 38 CYS A O    7  
ATOM 6786  C CB   . CYS A 1 38 ? -6.376  1.511   -8.378  1.00 0.00 ? 38 CYS A CB   7  
ATOM 6787  S SG   . CYS A 1 38 ? -6.558  2.495   -9.884  1.00 0.00 ? 38 CYS A SG   7  
ATOM 6788  H H    . CYS A 1 38 ? -6.225  -0.435  -6.656  1.00 0.00 ? 38 CYS A H    7  
ATOM 6789  H HA   . CYS A 1 38 ? -8.352  0.697   -8.283  1.00 0.00 ? 38 CYS A HA   7  
ATOM 6790  H HB2  . CYS A 1 38 ? -6.543  2.167   -7.537  1.00 0.00 ? 38 CYS A HB2  7  
ATOM 6791  H HB3  . CYS A 1 38 ? -5.361  1.144   -8.345  1.00 0.00 ? 38 CYS A HB3  7  
ATOM 6792  H HG   . CYS A 1 38 ? -7.768  3.032   -9.878  1.00 0.00 ? 38 CYS A HG   7  
ATOM 6793  N N    . ASP A 1 39 ? -7.723  -0.188  -10.625 1.00 0.00 ? 39 ASP A N    7  
ATOM 6794  C CA   . ASP A 1 39 ? -7.622  -0.972  -11.850 1.00 0.00 ? 39 ASP A CA   7  
ATOM 6795  C C    . ASP A 1 39 ? -6.265  -0.769  -12.515 1.00 0.00 ? 39 ASP A C    7  
ATOM 6796  O O    . ASP A 1 39 ? -5.694  -1.702  -13.082 1.00 0.00 ? 39 ASP A O    7  
ATOM 6797  C CB   . ASP A 1 39 ? -8.741  -0.589  -12.819 1.00 0.00 ? 39 ASP A CB   7  
ATOM 6798  C CG   . ASP A 1 39 ? -8.797  -1.501  -14.030 1.00 0.00 ? 39 ASP A CG   7  
ATOM 6799  O OD1  . ASP A 1 39 ? -7.891  -1.408  -14.885 1.00 0.00 ? 39 ASP A OD1  7  
ATOM 6800  O OD2  . ASP A 1 39 ? -9.745  -2.308  -14.121 1.00 0.00 ? 39 ASP A OD2  7  
ATOM 6801  H H    . ASP A 1 39 ? -8.222  0.656   -10.637 1.00 0.00 ? 39 ASP A H    7  
ATOM 6802  H HA   . ASP A 1 39 ? -7.728  -2.014  -11.587 1.00 0.00 ? 39 ASP A HA   7  
ATOM 6803  H HB2  . ASP A 1 39 ? -9.690  -0.647  -12.305 1.00 0.00 ? 39 ASP A HB2  7  
ATOM 6804  H HB3  . ASP A 1 39 ? -8.583  0.423   -13.160 1.00 0.00 ? 39 ASP A HB3  7  
ATOM 6805  N N    . ASP A 1 40 ? -5.753  0.455   -12.443 1.00 0.00 ? 40 ASP A N    7  
ATOM 6806  C CA   . ASP A 1 40 ? -4.463  0.781   -13.038 1.00 0.00 ? 40 ASP A CA   7  
ATOM 6807  C C    . ASP A 1 40 ? -3.358  -0.092  -12.451 1.00 0.00 ? 40 ASP A C    7  
ATOM 6808  O O    . ASP A 1 40 ? -2.400  -0.444  -13.138 1.00 0.00 ? 40 ASP A O    7  
ATOM 6809  C CB   . ASP A 1 40 ? -4.134  2.258   -12.818 1.00 0.00 ? 40 ASP A CB   7  
ATOM 6810  C CG   . ASP A 1 40 ? -3.277  2.832   -13.929 1.00 0.00 ? 40 ASP A CG   7  
ATOM 6811  O OD1  . ASP A 1 40 ? -2.040  2.670   -13.868 1.00 0.00 ? 40 ASP A OD1  7  
ATOM 6812  O OD2  . ASP A 1 40 ? -3.843  3.443   -14.859 1.00 0.00 ? 40 ASP A OD2  7  
ATOM 6813  H H    . ASP A 1 40 ? -6.256  1.156   -11.977 1.00 0.00 ? 40 ASP A H    7  
ATOM 6814  H HA   . ASP A 1 40 ? -4.529  0.590   -14.099 1.00 0.00 ? 40 ASP A HA   7  
ATOM 6815  H HB2  . ASP A 1 40 ? -5.055  2.822   -12.772 1.00 0.00 ? 40 ASP A HB2  7  
ATOM 6816  H HB3  . ASP A 1 40 ? -3.603  2.367   -11.884 1.00 0.00 ? 40 ASP A HB3  7  
ATOM 6817  N N    . GLY A 1 41 ? -3.498  -0.437  -11.175 1.00 0.00 ? 41 GLY A N    7  
ATOM 6818  C CA   . GLY A 1 41 ? -2.504  -1.264  -10.516 1.00 0.00 ? 41 GLY A CA   7  
ATOM 6819  C C    . GLY A 1 41 ? -2.035  -0.671  -9.202  1.00 0.00 ? 41 GLY A C    7  
ATOM 6820  O O    . GLY A 1 41 ? -0.926  -0.953  -8.748  1.00 0.00 ? 41 GLY A O    7  
ATOM 6821  H H    . GLY A 1 41 ? -4.283  -0.127  -10.676 1.00 0.00 ? 41 GLY A H    7  
ATOM 6822  H HA2  . GLY A 1 41 ? -2.930  -2.238  -10.328 1.00 0.00 ? 41 GLY A HA2  7  
ATOM 6823  H HA3  . GLY A 1 41 ? -1.653  -1.374  -11.172 1.00 0.00 ? 41 GLY A HA3  7  
ATOM 6824  N N    . TRP A 1 42 ? -2.879  0.152   -8.592  1.00 0.00 ? 42 TRP A N    7  
ATOM 6825  C CA   . TRP A 1 42 ? -2.544  0.787   -7.322  1.00 0.00 ? 42 TRP A CA   7  
ATOM 6826  C C    . TRP A 1 42 ? -3.393  0.222   -6.189  1.00 0.00 ? 42 TRP A C    7  
ATOM 6827  O O    . TRP A 1 42 ? -4.401  -0.444  -6.428  1.00 0.00 ? 42 TRP A O    7  
ATOM 6828  C CB   . TRP A 1 42 ? -2.741  2.301   -7.418  1.00 0.00 ? 42 TRP A CB   7  
ATOM 6829  C CG   . TRP A 1 42 ? -1.554  3.020   -7.985  1.00 0.00 ? 42 TRP A CG   7  
ATOM 6830  C CD1  . TRP A 1 42 ? -0.982  2.819   -9.208  1.00 0.00 ? 42 TRP A CD1  7  
ATOM 6831  C CD2  . TRP A 1 42 ? -0.793  4.052   -7.348  1.00 0.00 ? 42 TRP A CD2  7  
ATOM 6832  N NE1  . TRP A 1 42 ? 0.089   3.665   -9.371  1.00 0.00 ? 42 TRP A NE1  7  
ATOM 6833  C CE2  . TRP A 1 42 ? 0.225   4.433   -8.244  1.00 0.00 ? 42 TRP A CE2  7  
ATOM 6834  C CE3  . TRP A 1 42 ? -0.874  4.694   -6.110  1.00 0.00 ? 42 TRP A CE3  7  
ATOM 6835  C CZ2  . TRP A 1 42 ? 1.153   5.424   -7.939  1.00 0.00 ? 42 TRP A CZ2  7  
ATOM 6836  C CZ3  . TRP A 1 42 ? 0.048   5.678   -5.808  1.00 0.00 ? 42 TRP A CZ3  7  
ATOM 6837  C CH2  . TRP A 1 42 ? 1.050   6.036   -6.719  1.00 0.00 ? 42 TRP A CH2  7  
ATOM 6838  H H    . TRP A 1 42 ? -3.749  0.337   -9.004  1.00 0.00 ? 42 TRP A H    7  
ATOM 6839  H HA   . TRP A 1 42 ? -1.504  0.581   -7.114  1.00 0.00 ? 42 TRP A HA   7  
ATOM 6840  H HB2  . TRP A 1 42 ? -3.589  2.508   -8.053  1.00 0.00 ? 42 TRP A HB2  7  
ATOM 6841  H HB3  . TRP A 1 42 ? -2.930  2.695   -6.430  1.00 0.00 ? 42 TRP A HB3  7  
ATOM 6842  H HD1  . TRP A 1 42 ? -1.329  2.097   -9.931  1.00 0.00 ? 42 TRP A HD1  7  
ATOM 6843  H HE1  . TRP A 1 42 ? 0.661   3.712   -10.166 1.00 0.00 ? 42 TRP A HE1  7  
ATOM 6844  H HE3  . TRP A 1 42 ? -1.640  4.433   -5.394  1.00 0.00 ? 42 TRP A HE3  7  
ATOM 6845  H HZ2  . TRP A 1 42 ? 1.931   5.712   -8.631  1.00 0.00 ? 42 TRP A HZ2  7  
ATOM 6846  H HZ3  . TRP A 1 42 ? 0.001   6.185   -4.855  1.00 0.00 ? 42 TRP A HZ3  7  
ATOM 6847  H HH2  . TRP A 1 42 ? 1.749   6.809   -6.441  1.00 0.00 ? 42 TRP A HH2  7  
ATOM 6848  N N    . PHE A 1 43 ? -2.981  0.492   -4.955  1.00 0.00 ? 43 PHE A N    7  
ATOM 6849  C CA   . PHE A 1 43 ? -3.705  0.010   -3.785  1.00 0.00 ? 43 PHE A CA   7  
ATOM 6850  C C    . PHE A 1 43 ? -3.966  1.146   -2.800  1.00 0.00 ? 43 PHE A C    7  
ATOM 6851  O O    . PHE A 1 43 ? -3.063  1.913   -2.466  1.00 0.00 ? 43 PHE A O    7  
ATOM 6852  C CB   . PHE A 1 43 ? -2.917  -1.106  -3.096  1.00 0.00 ? 43 PHE A CB   7  
ATOM 6853  C CG   . PHE A 1 43 ? -2.934  -2.405  -3.849  1.00 0.00 ? 43 PHE A CG   7  
ATOM 6854  C CD1  . PHE A 1 43 ? -4.121  -2.914  -4.352  1.00 0.00 ? 43 PHE A CD1  7  
ATOM 6855  C CD2  . PHE A 1 43 ? -1.764  -3.118  -4.054  1.00 0.00 ? 43 PHE A CD2  7  
ATOM 6856  C CE1  . PHE A 1 43 ? -4.140  -4.110  -5.046  1.00 0.00 ? 43 PHE A CE1  7  
ATOM 6857  C CE2  . PHE A 1 43 ? -1.777  -4.313  -4.748  1.00 0.00 ? 43 PHE A CE2  7  
ATOM 6858  C CZ   . PHE A 1 43 ? -2.966  -4.810  -5.243  1.00 0.00 ? 43 PHE A CZ   7  
ATOM 6859  H H    . PHE A 1 43 ? -2.170  1.029   -4.828  1.00 0.00 ? 43 PHE A H    7  
ATOM 6860  H HA   . PHE A 1 43 ? -4.652  -0.384  -4.121  1.00 0.00 ? 43 PHE A HA   7  
ATOM 6861  H HB2  . PHE A 1 43 ? -1.888  -0.798  -2.990  1.00 0.00 ? 43 PHE A HB2  7  
ATOM 6862  H HB3  . PHE A 1 43 ? -3.338  -1.283  -2.117  1.00 0.00 ? 43 PHE A HB3  7  
ATOM 6863  H HD1  . PHE A 1 43 ? -5.040  -2.367  -4.197  1.00 0.00 ? 43 PHE A HD1  7  
ATOM 6864  H HD2  . PHE A 1 43 ? -0.833  -2.731  -3.667  1.00 0.00 ? 43 PHE A HD2  7  
ATOM 6865  H HE1  . PHE A 1 43 ? -5.072  -4.495  -5.431  1.00 0.00 ? 43 PHE A HE1  7  
ATOM 6866  H HE2  . PHE A 1 43 ? -0.858  -4.859  -4.901  1.00 0.00 ? 43 PHE A HE2  7  
ATOM 6867  H HZ   . PHE A 1 43 ? -2.979  -5.744  -5.786  1.00 0.00 ? 43 PHE A HZ   7  
ATOM 6868  N N    . VAL A 1 44 ? -5.209  1.248   -2.339  1.00 0.00 ? 44 VAL A N    7  
ATOM 6869  C CA   . VAL A 1 44 ? -5.591  2.289   -1.393  1.00 0.00 ? 44 VAL A CA   7  
ATOM 6870  C C    . VAL A 1 44 ? -5.933  1.695   -0.031  1.00 0.00 ? 44 VAL A C    7  
ATOM 6871  O O    . VAL A 1 44 ? -6.848  0.883   0.092   1.00 0.00 ? 44 VAL A O    7  
ATOM 6872  C CB   . VAL A 1 44 ? -6.797  3.099   -1.905  1.00 0.00 ? 44 VAL A CB   7  
ATOM 6873  C CG1  . VAL A 1 44 ? -7.176  4.182   -0.906  1.00 0.00 ? 44 VAL A CG1  7  
ATOM 6874  C CG2  . VAL A 1 44 ? -6.492  3.702   -3.268  1.00 0.00 ? 44 VAL A CG2  7  
ATOM 6875  H H    . VAL A 1 44 ? -5.885  0.607   -2.642  1.00 0.00 ? 44 VAL A H    7  
ATOM 6876  H HA   . VAL A 1 44 ? -4.753  2.962   -1.281  1.00 0.00 ? 44 VAL A HA   7  
ATOM 6877  H HB   . VAL A 1 44 ? -7.636  2.428   -2.011  1.00 0.00 ? 44 VAL A HB   7  
ATOM 6878  H HG11 . VAL A 1 44 ? -7.930  3.801   -0.233  1.00 0.00 ? 44 VAL A HG11 7  
ATOM 6879  H HG12 . VAL A 1 44 ? -6.302  4.475   -0.343  1.00 0.00 ? 44 VAL A HG12 7  
ATOM 6880  H HG13 . VAL A 1 44 ? -7.567  5.038   -1.436  1.00 0.00 ? 44 VAL A HG13 7  
ATOM 6881  H HG21 . VAL A 1 44 ? -5.448  3.555   -3.501  1.00 0.00 ? 44 VAL A HG21 7  
ATOM 6882  H HG22 . VAL A 1 44 ? -7.100  3.219   -4.020  1.00 0.00 ? 44 VAL A HG22 7  
ATOM 6883  H HG23 . VAL A 1 44 ? -6.713  4.759   -3.252  1.00 0.00 ? 44 VAL A HG23 7  
ATOM 6884  N N    . GLY A 1 45 ? -5.190  2.108   0.992   1.00 0.00 ? 45 GLY A N    7  
ATOM 6885  C CA   . GLY A 1 45 ? -5.430  1.607   2.333   1.00 0.00 ? 45 GLY A CA   7  
ATOM 6886  C C    . GLY A 1 45 ? -4.800  2.480   3.400   1.00 0.00 ? 45 GLY A C    7  
ATOM 6887  O O    . GLY A 1 45 ? -4.785  3.705   3.280   1.00 0.00 ? 45 GLY A O    7  
ATOM 6888  H H    . GLY A 1 45 ? -4.473  2.758   0.835   1.00 0.00 ? 45 GLY A H    7  
ATOM 6889  H HA2  . GLY A 1 45 ? -6.496  1.561   2.503   1.00 0.00 ? 45 GLY A HA2  7  
ATOM 6890  H HA3  . GLY A 1 45 ? -5.020  0.611   2.411   1.00 0.00 ? 45 GLY A HA3  7  
ATOM 6891  N N    . VAL A 1 46 ? -4.280  1.849   4.447   1.00 0.00 ? 46 VAL A N    7  
ATOM 6892  C CA   . VAL A 1 46 ? -3.646  2.576   5.541   1.00 0.00 ? 46 VAL A CA   7  
ATOM 6893  C C    . VAL A 1 46 ? -2.278  1.990   5.870   1.00 0.00 ? 46 VAL A C    7  
ATOM 6894  O O    . VAL A 1 46 ? -2.013  0.818   5.604   1.00 0.00 ? 46 VAL A O    7  
ATOM 6895  C CB   . VAL A 1 46 ? -4.520  2.557   6.809   1.00 0.00 ? 46 VAL A CB   7  
ATOM 6896  C CG1  . VAL A 1 46 ? -3.725  3.041   8.012   1.00 0.00 ? 46 VAL A CG1  7  
ATOM 6897  C CG2  . VAL A 1 46 ? -5.768  3.402   6.608   1.00 0.00 ? 46 VAL A CG2  7  
ATOM 6898  H H    . VAL A 1 46 ? -4.323  0.871   4.486   1.00 0.00 ? 46 VAL A H    7  
ATOM 6899  H HA   . VAL A 1 46 ? -3.522  3.604   5.230   1.00 0.00 ? 46 VAL A HA   7  
ATOM 6900  H HB   . VAL A 1 46 ? -4.826  1.538   6.995   1.00 0.00 ? 46 VAL A HB   7  
ATOM 6901  H HG11 . VAL A 1 46 ? -3.348  4.035   7.818   1.00 0.00 ? 46 VAL A HG11 7  
ATOM 6902  H HG12 . VAL A 1 46 ? -4.366  3.062   8.882   1.00 0.00 ? 46 VAL A HG12 7  
ATOM 6903  H HG13 . VAL A 1 46 ? -2.897  2.371   8.190   1.00 0.00 ? 46 VAL A HG13 7  
ATOM 6904  H HG21 . VAL A 1 46 ? -5.495  4.345   6.157   1.00 0.00 ? 46 VAL A HG21 7  
ATOM 6905  H HG22 . VAL A 1 46 ? -6.457  2.879   5.960   1.00 0.00 ? 46 VAL A HG22 7  
ATOM 6906  H HG23 . VAL A 1 46 ? -6.239  3.582   7.563   1.00 0.00 ? 46 VAL A HG23 7  
ATOM 6907  N N    . SER A 1 47 ? -1.412  2.814   6.451   1.00 0.00 ? 47 SER A N    7  
ATOM 6908  C CA   . SER A 1 47 ? -0.068  2.379   6.815   1.00 0.00 ? 47 SER A CA   7  
ATOM 6909  C C    . SER A 1 47 ? -0.045  1.816   8.233   1.00 0.00 ? 47 SER A C    7  
ATOM 6910  O O    . SER A 1 47 ? -0.807  2.250   9.097   1.00 0.00 ? 47 SER A O    7  
ATOM 6911  C CB   . SER A 1 47 ? 0.917   3.544   6.700   1.00 0.00 ? 47 SER A CB   7  
ATOM 6912  O OG   . SER A 1 47 ? 2.241   3.075   6.512   1.00 0.00 ? 47 SER A OG   7  
ATOM 6913  H H    . SER A 1 47 ? -1.682  3.738   6.638   1.00 0.00 ? 47 SER A H    7  
ATOM 6914  H HA   . SER A 1 47 ? 0.226   1.601   6.126   1.00 0.00 ? 47 SER A HA   7  
ATOM 6915  H HB2  . SER A 1 47 ? 0.644   4.161   5.858   1.00 0.00 ? 47 SER A HB2  7  
ATOM 6916  H HB3  . SER A 1 47 ? 0.881   4.133   7.605   1.00 0.00 ? 47 SER A HB3  7  
ATOM 6917  H HG   . SER A 1 47 ? 2.273   2.508   5.738   1.00 0.00 ? 47 SER A HG   7  
ATOM 6918  N N    . ARG A 1 48 ? 0.835   0.847   8.464   1.00 0.00 ? 48 ARG A N    7  
ATOM 6919  C CA   . ARG A 1 48 ? 0.958   0.223   9.775   1.00 0.00 ? 48 ARG A CA   7  
ATOM 6920  C C    . ARG A 1 48 ? 2.082   0.869   10.581  1.00 0.00 ? 48 ARG A C    7  
ATOM 6921  O O    . ARG A 1 48 ? 2.517   0.331   11.600  1.00 0.00 ? 48 ARG A O    7  
ATOM 6922  C CB   . ARG A 1 48 ? 1.219   -1.277  9.628   1.00 0.00 ? 48 ARG A CB   7  
ATOM 6923  C CG   . ARG A 1 48 ? 0.019   -2.055  9.112   1.00 0.00 ? 48 ARG A CG   7  
ATOM 6924  C CD   . ARG A 1 48 ? -0.987  -2.325  10.220  1.00 0.00 ? 48 ARG A CD   7  
ATOM 6925  N NE   . ARG A 1 48 ? -0.365  -2.946  11.386  1.00 0.00 ? 48 ARG A NE   7  
ATOM 6926  C CZ   . ARG A 1 48 ? -0.870  -2.875  12.613  1.00 0.00 ? 48 ARG A CZ   7  
ATOM 6927  N NH1  . ARG A 1 48 ? -1.998  -2.215  12.832  1.00 0.00 ? 48 ARG A NH1  7  
ATOM 6928  N NH2  . ARG A 1 48 ? -0.245  -3.467  13.623  1.00 0.00 ? 48 ARG A NH2  7  
ATOM 6929  H H    . ARG A 1 48 ? 1.416   0.544   7.734   1.00 0.00 ? 48 ARG A H    7  
ATOM 6930  H HA   . ARG A 1 48 ? 0.026   0.368   10.300  1.00 0.00 ? 48 ARG A HA   7  
ATOM 6931  H HB2  . ARG A 1 48 ? 2.038   -1.422  8.939   1.00 0.00 ? 48 ARG A HB2  7  
ATOM 6932  H HB3  . ARG A 1 48 ? 1.494   -1.678  10.591  1.00 0.00 ? 48 ARG A HB3  7  
ATOM 6933  H HG2  . ARG A 1 48 ? -0.463  -1.482  8.334   1.00 0.00 ? 48 ARG A HG2  7  
ATOM 6934  H HG3  . ARG A 1 48 ? 0.360   -2.998  8.710   1.00 0.00 ? 48 ARG A HG3  7  
ATOM 6935  H HD2  . ARG A 1 48 ? -1.434  -1.388  10.518  1.00 0.00 ? 48 ARG A HD2  7  
ATOM 6936  H HD3  . ARG A 1 48 ? -1.754  -2.983  9.838   1.00 0.00 ? 48 ARG A HD3  7  
ATOM 6937  H HE   . ARG A 1 48 ? 0.469   -3.439  11.246  1.00 0.00 ? 48 ARG A HE   7  
ATOM 6938  H HH11 . ARG A 1 48 ? -2.471  -1.769  12.073  1.00 0.00 ? 48 ARG A HH11 7  
ATOM 6939  H HH12 . ARG A 1 48 ? -2.376  -2.164  13.757  1.00 0.00 ? 48 ARG A HH12 7  
ATOM 6940  H HH21 . ARG A 1 48 ? 0.606   -3.966  13.462  1.00 0.00 ? 48 ARG A HH21 7  
ATOM 6941  H HH22 . ARG A 1 48 ? -0.625  -3.413  14.546  1.00 0.00 ? 48 ARG A HH22 7  
ATOM 6942  N N    . ARG A 1 49 ? 2.548   2.024   10.118  1.00 0.00 ? 49 ARG A N    7  
ATOM 6943  C CA   . ARG A 1 49 ? 3.622   2.741   10.794  1.00 0.00 ? 49 ARG A CA   7  
ATOM 6944  C C    . ARG A 1 49 ? 3.199   4.171   11.121  1.00 0.00 ? 49 ARG A C    7  
ATOM 6945  O O    . ARG A 1 49 ? 3.499   4.688   12.198  1.00 0.00 ? 49 ARG A O    7  
ATOM 6946  C CB   . ARG A 1 49 ? 4.880   2.757   9.924   1.00 0.00 ? 49 ARG A CB   7  
ATOM 6947  C CG   . ARG A 1 49 ? 6.029   3.547   10.529  1.00 0.00 ? 49 ARG A CG   7  
ATOM 6948  C CD   . ARG A 1 49 ? 6.896   2.674   11.422  1.00 0.00 ? 49 ARG A CD   7  
ATOM 6949  N NE   . ARG A 1 49 ? 7.912   1.951   10.661  1.00 0.00 ? 49 ARG A NE   7  
ATOM 6950  C CZ   . ARG A 1 49 ? 8.678   0.998   11.178  1.00 0.00 ? 49 ARG A CZ   7  
ATOM 6951  N NH1  . ARG A 1 49 ? 8.545   0.653   12.451  1.00 0.00 ? 49 ARG A NH1  7  
ATOM 6952  N NH2  . ARG A 1 49 ? 9.580   0.386   10.421  1.00 0.00 ? 49 ARG A NH2  7  
ATOM 6953  H H    . ARG A 1 49 ? 2.160   2.402   9.301   1.00 0.00 ? 49 ARG A H    7  
ATOM 6954  H HA   . ARG A 1 49 ? 3.838   2.223   11.716  1.00 0.00 ? 49 ARG A HA   7  
ATOM 6955  H HB2  . ARG A 1 49 ? 5.212   1.740   9.773   1.00 0.00 ? 49 ARG A HB2  7  
ATOM 6956  H HB3  . ARG A 1 49 ? 4.636   3.194   8.967   1.00 0.00 ? 49 ARG A HB3  7  
ATOM 6957  H HG2  . ARG A 1 49 ? 6.639   3.945   9.732   1.00 0.00 ? 49 ARG A HG2  7  
ATOM 6958  H HG3  . ARG A 1 49 ? 5.625   4.358   11.116  1.00 0.00 ? 49 ARG A HG3  7  
ATOM 6959  H HD2  . ARG A 1 49 ? 7.386   3.301   12.151  1.00 0.00 ? 49 ARG A HD2  7  
ATOM 6960  H HD3  . ARG A 1 49 ? 6.264   1.960   11.929  1.00 0.00 ? 49 ARG A HD3  7  
ATOM 6961  H HE   . ARG A 1 49 ? 8.027   2.190   9.718   1.00 0.00 ? 49 ARG A HE   7  
ATOM 6962  H HH11 . ARG A 1 49 ? 7.865   1.111   13.024  1.00 0.00 ? 49 ARG A HH11 7  
ATOM 6963  H HH12 . ARG A 1 49 ? 9.122   -0.066  12.838  1.00 0.00 ? 49 ARG A HH12 7  
ATOM 6964  H HH21 . ARG A 1 49 ? 9.684   0.643   9.461   1.00 0.00 ? 49 ARG A HH21 7  
ATOM 6965  H HH22 . ARG A 1 49 ? 10.157  -0.331  10.811  1.00 0.00 ? 49 ARG A HH22 7  
ATOM 6966  N N    . THR A 1 50 ? 2.500   4.805   10.184  1.00 0.00 ? 50 THR A N    7  
ATOM 6967  C CA   . THR A 1 50 ? 2.037   6.174   10.372  1.00 0.00 ? 50 THR A CA   7  
ATOM 6968  C C    . THR A 1 50 ? 0.547   6.212   10.691  1.00 0.00 ? 50 THR A C    7  
ATOM 6969  O O    . THR A 1 50 ? 0.021   7.241   11.114  1.00 0.00 ? 50 THR A O    7  
ATOM 6970  C CB   . THR A 1 50 ? 2.305   7.034   9.122   1.00 0.00 ? 50 THR A CB   7  
ATOM 6971  O OG1  . THR A 1 50 ? 1.803   6.372   7.955   1.00 0.00 ? 50 THR A OG1  7  
ATOM 6972  C CG2  . THR A 1 50 ? 3.794   7.301   8.958   1.00 0.00 ? 50 THR A CG2  7  
ATOM 6973  H H    . THR A 1 50 ? 2.292   4.340   9.347   1.00 0.00 ? 50 THR A H    7  
ATOM 6974  H HA   . THR A 1 50 ? 2.584   6.601   11.200  1.00 0.00 ? 50 THR A HA   7  
ATOM 6975  H HB   . THR A 1 50 ? 1.795   7.979   9.238   1.00 0.00 ? 50 THR A HB   7  
ATOM 6976  H HG1  . THR A 1 50 ? 0.849   6.478   7.913   1.00 0.00 ? 50 THR A HG1  7  
ATOM 6977  H HG21 . THR A 1 50 ? 4.312   6.367   8.800   1.00 0.00 ? 50 THR A HG21 7  
ATOM 6978  H HG22 . THR A 1 50 ? 4.174   7.778   9.849   1.00 0.00 ? 50 THR A HG22 7  
ATOM 6979  H HG23 . THR A 1 50 ? 3.951   7.948   8.108   1.00 0.00 ? 50 THR A HG23 7  
ATOM 6980  N N    . GLN A 1 51 ? -0.126  5.085   10.487  1.00 0.00 ? 51 GLN A N    7  
ATOM 6981  C CA   . GLN A 1 51 ? -1.556  4.990   10.754  1.00 0.00 ? 51 GLN A CA   7  
ATOM 6982  C C    . GLN A 1 51 ? -2.326  6.052   9.976   1.00 0.00 ? 51 GLN A C    7  
ATOM 6983  O O    . GLN A 1 51 ? -3.317  6.598   10.462  1.00 0.00 ? 51 GLN A O    7  
ATOM 6984  C CB   . GLN A 1 51 ? -1.828  5.141   12.251  1.00 0.00 ? 51 GLN A CB   7  
ATOM 6985  C CG   . GLN A 1 51 ? -1.039  4.170   13.114  1.00 0.00 ? 51 GLN A CG   7  
ATOM 6986  C CD   . GLN A 1 51 ? -1.585  4.064   14.524  1.00 0.00 ? 51 GLN A CD   7  
ATOM 6987  O OE1  . GLN A 1 51 ? -2.799  4.034   14.731  1.00 0.00 ? 51 GLN A OE1  7  
ATOM 6988  N NE2  . GLN A 1 51 ? -0.690  4.008   15.503  1.00 0.00 ? 51 GLN A NE2  7  
ATOM 6989  H H    . GLN A 1 51 ? 0.350   4.298   10.149  1.00 0.00 ? 51 GLN A H    7  
ATOM 6990  H HA   . GLN A 1 51 ? -1.890  4.015   10.433  1.00 0.00 ? 51 GLN A HA   7  
ATOM 6991  H HB2  . GLN A 1 51 ? -1.572  6.146   12.552  1.00 0.00 ? 51 GLN A HB2  7  
ATOM 6992  H HB3  . GLN A 1 51 ? -2.880  4.977   12.433  1.00 0.00 ? 51 GLN A HB3  7  
ATOM 6993  H HG2  . GLN A 1 51 ? -1.075  3.192   12.657  1.00 0.00 ? 51 GLN A HG2  7  
ATOM 6994  H HG3  . GLN A 1 51 ? -0.014  4.505   13.165  1.00 0.00 ? 51 GLN A HG3  7  
ATOM 6995  H HE21 . GLN A 1 51 ? 0.260   4.038   15.264  1.00 0.00 ? 51 GLN A HE21 7  
ATOM 6996  H HE22 . GLN A 1 51 ? -1.016  3.941   16.424  1.00 0.00 ? 51 GLN A HE22 7  
ATOM 6997  N N    . LYS A 1 52 ? -1.864  6.342   8.764   1.00 0.00 ? 52 LYS A N    7  
ATOM 6998  C CA   . LYS A 1 52 ? -2.509  7.338   7.917   1.00 0.00 ? 52 LYS A CA   7  
ATOM 6999  C C    . LYS A 1 52 ? -3.126  6.686   6.683   1.00 0.00 ? 52 LYS A C    7  
ATOM 7000  O O    . LYS A 1 52 ? -2.761  5.571   6.310   1.00 0.00 ? 52 LYS A O    7  
ATOM 7001  C CB   . LYS A 1 52 ? -1.499  8.406   7.491   1.00 0.00 ? 52 LYS A CB   7  
ATOM 7002  C CG   . LYS A 1 52 ? -1.076  9.328   8.621   1.00 0.00 ? 52 LYS A CG   7  
ATOM 7003  C CD   . LYS A 1 52 ? -0.513  10.636  8.093   1.00 0.00 ? 52 LYS A CD   7  
ATOM 7004  C CE   . LYS A 1 52 ? 0.426   11.286  9.098   1.00 0.00 ? 52 LYS A CE   7  
ATOM 7005  N NZ   . LYS A 1 52 ? -0.301  11.765  10.306  1.00 0.00 ? 52 LYS A NZ   7  
ATOM 7006  H H    . LYS A 1 52 ? -1.070  5.873   8.431   1.00 0.00 ? 52 LYS A H    7  
ATOM 7007  H HA   . LYS A 1 52 ? -3.294  7.805   8.492   1.00 0.00 ? 52 LYS A HA   7  
ATOM 7008  H HB2  . LYS A 1 52 ? -0.618  7.917   7.103   1.00 0.00 ? 52 LYS A HB2  7  
ATOM 7009  H HB3  . LYS A 1 52 ? -1.939  9.008   6.709   1.00 0.00 ? 52 LYS A HB3  7  
ATOM 7010  H HG2  . LYS A 1 52 ? -1.934  9.542   9.240   1.00 0.00 ? 52 LYS A HG2  7  
ATOM 7011  H HG3  . LYS A 1 52 ? -0.318  8.833   9.212   1.00 0.00 ? 52 LYS A HG3  7  
ATOM 7012  H HD2  . LYS A 1 52 ? 0.034   10.441  7.182   1.00 0.00 ? 52 LYS A HD2  7  
ATOM 7013  H HD3  . LYS A 1 52 ? -1.330  11.313  7.887   1.00 0.00 ? 52 LYS A HD3  7  
ATOM 7014  H HE2  . LYS A 1 52 ? 1.167   10.562  9.399   1.00 0.00 ? 52 LYS A HE2  7  
ATOM 7015  H HE3  . LYS A 1 52 ? 0.913   12.125  8.625   1.00 0.00 ? 52 LYS A HE3  7  
ATOM 7016  H HZ1  . LYS A 1 52 ? -1.109  11.141  10.508  1.00 0.00 ? 52 LYS A HZ1  7  
ATOM 7017  H HZ2  . LYS A 1 52 ? -0.655  12.730  10.151  1.00 0.00 ? 52 LYS A HZ2  7  
ATOM 7018  H HZ3  . LYS A 1 52 ? 0.335   11.768  11.129  1.00 0.00 ? 52 LYS A HZ3  7  
ATOM 7019  N N    . PHE A 1 53 ? -4.061  7.389   6.053   1.00 0.00 ? 53 PHE A N    7  
ATOM 7020  C CA   . PHE A 1 53 ? -4.728  6.878   4.861   1.00 0.00 ? 53 PHE A CA   7  
ATOM 7021  C C    . PHE A 1 53 ? -4.208  7.574   3.607   1.00 0.00 ? 53 PHE A C    7  
ATOM 7022  O O    . PHE A 1 53 ? -3.745  8.712   3.662   1.00 0.00 ? 53 PHE A O    7  
ATOM 7023  C CB   . PHE A 1 53 ? -6.242  7.072   4.975   1.00 0.00 ? 53 PHE A CB   7  
ATOM 7024  C CG   . PHE A 1 53 ? -7.004  6.551   3.790   1.00 0.00 ? 53 PHE A CG   7  
ATOM 7025  C CD1  . PHE A 1 53 ? -7.259  5.196   3.654   1.00 0.00 ? 53 PHE A CD1  7  
ATOM 7026  C CD2  . PHE A 1 53 ? -7.464  7.417   2.811   1.00 0.00 ? 53 PHE A CD2  7  
ATOM 7027  C CE1  . PHE A 1 53 ? -7.960  4.714   2.565   1.00 0.00 ? 53 PHE A CE1  7  
ATOM 7028  C CE2  . PHE A 1 53 ? -8.166  6.941   1.720   1.00 0.00 ? 53 PHE A CE2  7  
ATOM 7029  C CZ   . PHE A 1 53 ? -8.414  5.587   1.596   1.00 0.00 ? 53 PHE A CZ   7  
ATOM 7030  H H    . PHE A 1 53 ? -4.310  8.272   6.399   1.00 0.00 ? 53 PHE A H    7  
ATOM 7031  H HA   . PHE A 1 53 ? -4.514  5.823   4.788   1.00 0.00 ? 53 PHE A HA   7  
ATOM 7032  H HB2  . PHE A 1 53 ? -6.599  6.554   5.852   1.00 0.00 ? 53 PHE A HB2  7  
ATOM 7033  H HB3  . PHE A 1 53 ? -6.456  8.126   5.072   1.00 0.00 ? 53 PHE A HB3  7  
ATOM 7034  H HD1  . PHE A 1 53 ? -6.904  4.512   4.412   1.00 0.00 ? 53 PHE A HD1  7  
ATOM 7035  H HD2  . PHE A 1 53 ? -7.271  8.476   2.906   1.00 0.00 ? 53 PHE A HD2  7  
ATOM 7036  H HE1  . PHE A 1 53 ? -8.152  3.655   2.472   1.00 0.00 ? 53 PHE A HE1  7  
ATOM 7037  H HE2  . PHE A 1 53 ? -8.520  7.626   0.964   1.00 0.00 ? 53 PHE A HE2  7  
ATOM 7038  H HZ   . PHE A 1 53 ? -8.962  5.213   0.745   1.00 0.00 ? 53 PHE A HZ   7  
ATOM 7039  N N    . GLY A 1 54 ? -4.288  6.879   2.476   1.00 0.00 ? 54 GLY A N    7  
ATOM 7040  C CA   . GLY A 1 54 ? -3.821  7.445   1.223   1.00 0.00 ? 54 GLY A CA   7  
ATOM 7041  C C    . GLY A 1 54 ? -3.719  6.409   0.121   1.00 0.00 ? 54 GLY A C    7  
ATOM 7042  O O    . GLY A 1 54 ? -4.224  5.294   0.257   1.00 0.00 ? 54 GLY A O    7  
ATOM 7043  H H    . GLY A 1 54 ? -4.666  5.975   2.492   1.00 0.00 ? 54 GLY A H    7  
ATOM 7044  H HA2  . GLY A 1 54 ? -4.506  8.219   0.913   1.00 0.00 ? 54 GLY A HA2  7  
ATOM 7045  H HA3  . GLY A 1 54 ? -2.846  7.883   1.381   1.00 0.00 ? 54 GLY A HA3  7  
ATOM 7046  N N    . THR A 1 55 ? -3.065  6.777   -0.976  1.00 0.00 ? 55 THR A N    7  
ATOM 7047  C CA   . THR A 1 55 ? -2.901  5.872   -2.107  1.00 0.00 ? 55 THR A CA   7  
ATOM 7048  C C    . THR A 1 55 ? -1.427  5.672   -2.442  1.00 0.00 ? 55 THR A C    7  
ATOM 7049  O O    . THR A 1 55 ? -0.646  6.624   -2.442  1.00 0.00 ? 55 THR A O    7  
ATOM 7050  C CB   . THR A 1 55 ? -3.633  6.397   -3.357  1.00 0.00 ? 55 THR A CB   7  
ATOM 7051  O OG1  . THR A 1 55 ? -3.406  5.517   -4.463  1.00 0.00 ? 55 THR A OG1  7  
ATOM 7052  C CG2  . THR A 1 55 ? -3.161  7.799   -3.712  1.00 0.00 ? 55 THR A CG2  7  
ATOM 7053  H H    . THR A 1 55 ? -2.685  7.678   -1.025  1.00 0.00 ? 55 THR A H    7  
ATOM 7054  H HA   . THR A 1 55 ? -3.332  4.919   -1.837  1.00 0.00 ? 55 THR A HA   7  
ATOM 7055  H HB   . THR A 1 55 ? -4.693  6.433   -3.146  1.00 0.00 ? 55 THR A HB   7  
ATOM 7056  H HG1  . THR A 1 55 ? -3.852  5.860   -5.242  1.00 0.00 ? 55 THR A HG1  7  
ATOM 7057  H HG21 . THR A 1 55 ? -2.353  7.737   -4.426  1.00 0.00 ? 55 THR A HG21 7  
ATOM 7058  H HG22 . THR A 1 55 ? -2.815  8.299   -2.819  1.00 0.00 ? 55 THR A HG22 7  
ATOM 7059  H HG23 . THR A 1 55 ? -3.979  8.356   -4.142  1.00 0.00 ? 55 THR A HG23 7  
ATOM 7060  N N    . PHE A 1 56 ? -1.054  4.430   -2.728  1.00 0.00 ? 56 PHE A N    7  
ATOM 7061  C CA   . PHE A 1 56 ? 0.327   4.105   -3.065  1.00 0.00 ? 56 PHE A CA   7  
ATOM 7062  C C    . PHE A 1 56 ? 0.385   3.043   -4.159  1.00 0.00 ? 56 PHE A C    7  
ATOM 7063  O O    . PHE A 1 56 ? -0.556  2.275   -4.364  1.00 0.00 ? 56 PHE A O    7  
ATOM 7064  C CB   . PHE A 1 56 ? 1.076   3.616   -1.823  1.00 0.00 ? 56 PHE A CB   7  
ATOM 7065  C CG   . PHE A 1 56 ? 0.265   2.693   -0.959  1.00 0.00 ? 56 PHE A CG   7  
ATOM 7066  C CD1  . PHE A 1 56 ? -0.736  3.190   -0.140  1.00 0.00 ? 56 PHE A CD1  7  
ATOM 7067  C CD2  . PHE A 1 56 ? 0.504   1.328   -0.966  1.00 0.00 ? 56 PHE A CD2  7  
ATOM 7068  C CE1  . PHE A 1 56 ? -1.484  2.343   0.656   1.00 0.00 ? 56 PHE A CE1  7  
ATOM 7069  C CE2  . PHE A 1 56 ? -0.241  0.476   -0.172  1.00 0.00 ? 56 PHE A CE2  7  
ATOM 7070  C CZ   . PHE A 1 56 ? -1.236  0.985   0.640   1.00 0.00 ? 56 PHE A CZ   7  
ATOM 7071  H H    . PHE A 1 56 ? -1.723  3.714   -2.711  1.00 0.00 ? 56 PHE A H    7  
ATOM 7072  H HA   . PHE A 1 56 ? 0.799   5.005   -3.428  1.00 0.00 ? 56 PHE A HA   7  
ATOM 7073  H HB2  . PHE A 1 56 ? 1.964   3.085   -2.133  1.00 0.00 ? 56 PHE A HB2  7  
ATOM 7074  H HB3  . PHE A 1 56 ? 1.361   4.468   -1.225  1.00 0.00 ? 56 PHE A HB3  7  
ATOM 7075  H HD1  . PHE A 1 56 ? -0.931  4.253   -0.127  1.00 0.00 ? 56 PHE A HD1  7  
ATOM 7076  H HD2  . PHE A 1 56 ? 1.282   0.929   -1.600  1.00 0.00 ? 56 PHE A HD2  7  
ATOM 7077  H HE1  . PHE A 1 56 ? -2.261  2.744   1.290   1.00 0.00 ? 56 PHE A HE1  7  
ATOM 7078  H HE2  . PHE A 1 56 ? -0.045  -0.585  -0.186  1.00 0.00 ? 56 PHE A HE2  7  
ATOM 7079  H HZ   . PHE A 1 56 ? -1.819  0.322   1.261   1.00 0.00 ? 56 PHE A HZ   7  
ATOM 7080  N N    . PRO A 1 57 ? 1.516   2.996   -4.879  1.00 0.00 ? 57 PRO A N    7  
ATOM 7081  C CA   . PRO A 1 57 ? 1.724   2.033   -5.964  1.00 0.00 ? 57 PRO A CA   7  
ATOM 7082  C C    . PRO A 1 57 ? 1.877   0.605   -5.450  1.00 0.00 ? 57 PRO A C    7  
ATOM 7083  O O    . PRO A 1 57 ? 2.927   0.232   -4.929  1.00 0.00 ? 57 PRO A O    7  
ATOM 7084  C CB   . PRO A 1 57 ? 3.025   2.509   -6.615  1.00 0.00 ? 57 PRO A CB   7  
ATOM 7085  C CG   . PRO A 1 57 ? 3.744   3.242   -5.535  1.00 0.00 ? 57 PRO A CG   7  
ATOM 7086  C CD   . PRO A 1 57 ? 2.678   3.880   -4.688  1.00 0.00 ? 57 PRO A CD   7  
ATOM 7087  H HA   . PRO A 1 57 ? 0.923   2.071   -6.687  1.00 0.00 ? 57 PRO A HA   7  
ATOM 7088  H HB2  . PRO A 1 57 ? 3.592   1.655   -6.959  1.00 0.00 ? 57 PRO A HB2  7  
ATOM 7089  H HB3  . PRO A 1 57 ? 2.799   3.157   -7.449  1.00 0.00 ? 57 PRO A HB3  7  
ATOM 7090  H HG2  . PRO A 1 57 ? 4.326   2.550   -4.947  1.00 0.00 ? 57 PRO A HG2  7  
ATOM 7091  H HG3  . PRO A 1 57 ? 4.382   3.998   -5.968  1.00 0.00 ? 57 PRO A HG3  7  
ATOM 7092  H HD2  . PRO A 1 57 ? 2.981   3.901   -3.652  1.00 0.00 ? 57 PRO A HD2  7  
ATOM 7093  H HD3  . PRO A 1 57 ? 2.464   4.879   -5.041  1.00 0.00 ? 57 PRO A HD3  7  
ATOM 7094  N N    . GLY A 1 58 ? 0.822   -0.189  -5.602  1.00 0.00 ? 58 GLY A N    7  
ATOM 7095  C CA   . GLY A 1 58 ? 0.860   -1.568  -5.149  1.00 0.00 ? 58 GLY A CA   7  
ATOM 7096  C C    . GLY A 1 58 ? 2.112   -2.292  -5.601  1.00 0.00 ? 58 GLY A C    7  
ATOM 7097  O O    . GLY A 1 58 ? 2.657   -3.119  -4.871  1.00 0.00 ? 58 GLY A O    7  
ATOM 7098  H H    . GLY A 1 58 ? 0.011   0.163   -6.026  1.00 0.00 ? 58 GLY A H    7  
ATOM 7099  H HA2  . GLY A 1 58 ? 0.818   -1.582  -4.070  1.00 0.00 ? 58 GLY A HA2  7  
ATOM 7100  H HA3  . GLY A 1 58 ? -0.003  -2.087  -5.540  1.00 0.00 ? 58 GLY A HA3  7  
ATOM 7101  N N    . ASN A 1 59 ? 2.569   -1.983  -6.810  1.00 0.00 ? 59 ASN A N    7  
ATOM 7102  C CA   . ASN A 1 59 ? 3.764   -2.613  -7.360  1.00 0.00 ? 59 ASN A CA   7  
ATOM 7103  C C    . ASN A 1 59 ? 4.884   -2.651  -6.325  1.00 0.00 ? 59 ASN A C    7  
ATOM 7104  O O    . ASN A 1 59 ? 5.785   -3.487  -6.400  1.00 0.00 ? 59 ASN A O    7  
ATOM 7105  C CB   . ASN A 1 59 ? 4.233   -1.862  -8.608  1.00 0.00 ? 59 ASN A CB   7  
ATOM 7106  C CG   . ASN A 1 59 ? 3.085   -1.221  -9.363  1.00 0.00 ? 59 ASN A CG   7  
ATOM 7107  O OD1  . ASN A 1 59 ? 3.133   -0.038  -9.700  1.00 0.00 ? 59 ASN A OD1  7  
ATOM 7108  N ND2  . ASN A 1 59 ? 2.044   -2.001  -9.631  1.00 0.00 ? 59 ASN A ND2  7  
ATOM 7109  H H    . ASN A 1 59 ? 2.091   -1.316  -7.346  1.00 0.00 ? 59 ASN A H    7  
ATOM 7110  H HA   . ASN A 1 59 ? 3.509   -3.625  -7.635  1.00 0.00 ? 59 ASN A HA   7  
ATOM 7111  H HB2  . ASN A 1 59 ? 4.925   -1.086  -8.315  1.00 0.00 ? 59 ASN A HB2  7  
ATOM 7112  H HB3  . ASN A 1 59 ? 4.734   -2.553  -9.270  1.00 0.00 ? 59 ASN A HB3  7  
ATOM 7113  H HD21 . ASN A 1 59 ? 2.075   -2.933  -9.332  1.00 0.00 ? 59 ASN A HD21 7  
ATOM 7114  H HD22 . ASN A 1 59 ? 1.289   -1.611  -10.119 1.00 0.00 ? 59 ASN A HD22 7  
ATOM 7115  N N    . TYR A 1 60 ? 4.820   -1.741  -5.359  1.00 0.00 ? 60 TYR A N    7  
ATOM 7116  C CA   . TYR A 1 60 ? 5.830   -1.670  -4.309  1.00 0.00 ? 60 TYR A CA   7  
ATOM 7117  C C    . TYR A 1 60 ? 5.527   -2.665  -3.193  1.00 0.00 ? 60 TYR A C    7  
ATOM 7118  O O    . TYR A 1 60 ? 6.437   -3.236  -2.592  1.00 0.00 ? 60 TYR A O    7  
ATOM 7119  C CB   . TYR A 1 60 ? 5.901   -0.252  -3.738  1.00 0.00 ? 60 TYR A CB   7  
ATOM 7120  C CG   . TYR A 1 60 ? 6.887   0.641   -4.457  1.00 0.00 ? 60 TYR A CG   7  
ATOM 7121  C CD1  . TYR A 1 60 ? 6.606   1.140   -5.723  1.00 0.00 ? 60 TYR A CD1  7  
ATOM 7122  C CD2  . TYR A 1 60 ? 8.098   0.986   -3.871  1.00 0.00 ? 60 TYR A CD2  7  
ATOM 7123  C CE1  . TYR A 1 60 ? 7.504   1.957   -6.384  1.00 0.00 ? 60 TYR A CE1  7  
ATOM 7124  C CE2  . TYR A 1 60 ? 9.001   1.802   -4.524  1.00 0.00 ? 60 TYR A CE2  7  
ATOM 7125  C CZ   . TYR A 1 60 ? 8.699   2.285   -5.780  1.00 0.00 ? 60 TYR A CZ   7  
ATOM 7126  O OH   . TYR A 1 60 ? 9.597   3.098   -6.434  1.00 0.00 ? 60 TYR A OH   7  
ATOM 7127  H H    . TYR A 1 60 ? 4.078   -1.102  -5.352  1.00 0.00 ? 60 TYR A H    7  
ATOM 7128  H HA   . TYR A 1 60 ? 6.784   -1.918  -4.749  1.00 0.00 ? 60 TYR A HA   7  
ATOM 7129  H HB2  . TYR A 1 60 ? 4.927   0.206   -3.807  1.00 0.00 ? 60 TYR A HB2  7  
ATOM 7130  H HB3  . TYR A 1 60 ? 6.196   -0.305  -2.700  1.00 0.00 ? 60 TYR A HB3  7  
ATOM 7131  H HD1  . TYR A 1 60 ? 5.669   0.881   -6.193  1.00 0.00 ? 60 TYR A HD1  7  
ATOM 7132  H HD2  . TYR A 1 60 ? 8.332   0.605   -2.887  1.00 0.00 ? 60 TYR A HD2  7  
ATOM 7133  H HE1  . TYR A 1 60 ? 7.268   2.335   -7.368  1.00 0.00 ? 60 TYR A HE1  7  
ATOM 7134  H HE2  . TYR A 1 60 ? 9.938   2.059   -4.051  1.00 0.00 ? 60 TYR A HE2  7  
ATOM 7135  H HH   . TYR A 1 60 ? 9.642   3.947   -5.989  1.00 0.00 ? 60 TYR A HH   7  
ATOM 7136  N N    . VAL A 1 61 ? 4.242   -2.868  -2.923  1.00 0.00 ? 61 VAL A N    7  
ATOM 7137  C CA   . VAL A 1 61 ? 3.817   -3.796  -1.881  1.00 0.00 ? 61 VAL A CA   7  
ATOM 7138  C C    . VAL A 1 61 ? 3.247   -5.075  -2.484  1.00 0.00 ? 61 VAL A C    7  
ATOM 7139  O O    . VAL A 1 61 ? 3.087   -5.183  -3.699  1.00 0.00 ? 61 VAL A O    7  
ATOM 7140  C CB   . VAL A 1 61 ? 2.759   -3.159  -0.960  1.00 0.00 ? 61 VAL A CB   7  
ATOM 7141  C CG1  . VAL A 1 61 ? 3.290   -1.872  -0.348  1.00 0.00 ? 61 VAL A CG1  7  
ATOM 7142  C CG2  . VAL A 1 61 ? 1.470   -2.903  -1.727  1.00 0.00 ? 61 VAL A CG2  7  
ATOM 7143  H H    . VAL A 1 61 ? 3.563   -2.383  -3.437  1.00 0.00 ? 61 VAL A H    7  
ATOM 7144  H HA   . VAL A 1 61 ? 4.681   -4.045  -1.283  1.00 0.00 ? 61 VAL A HA   7  
ATOM 7145  H HB   . VAL A 1 61 ? 2.545   -3.851  -0.160  1.00 0.00 ? 61 VAL A HB   7  
ATOM 7146  H HG11 . VAL A 1 61 ? 3.630   -2.067  0.659   1.00 0.00 ? 61 VAL A HG11 7  
ATOM 7147  H HG12 . VAL A 1 61 ? 4.112   -1.502  -0.942  1.00 0.00 ? 61 VAL A HG12 7  
ATOM 7148  H HG13 . VAL A 1 61 ? 2.501   -1.134  -0.323  1.00 0.00 ? 61 VAL A HG13 7  
ATOM 7149  H HG21 . VAL A 1 61 ? 1.344   -3.664  -2.482  1.00 0.00 ? 61 VAL A HG21 7  
ATOM 7150  H HG22 . VAL A 1 61 ? 0.633   -2.930  -1.045  1.00 0.00 ? 61 VAL A HG22 7  
ATOM 7151  H HG23 . VAL A 1 61 ? 1.519   -1.932  -2.199  1.00 0.00 ? 61 VAL A HG23 7  
ATOM 7152  N N    . ALA A 1 62 ? 2.941   -6.042  -1.625  1.00 0.00 ? 62 ALA A N    7  
ATOM 7153  C CA   . ALA A 1 62 ? 2.385   -7.313  -2.072  1.00 0.00 ? 62 ALA A CA   7  
ATOM 7154  C C    . ALA A 1 62 ? 1.471   -7.916  -1.011  1.00 0.00 ? 62 ALA A C    7  
ATOM 7155  O O    . ALA A 1 62 ? 1.618   -7.666  0.186   1.00 0.00 ? 62 ALA A O    7  
ATOM 7156  C CB   . ALA A 1 62 ? 3.504   -8.284  -2.420  1.00 0.00 ? 62 ALA A CB   7  
ATOM 7157  H H    . ALA A 1 62 ? 3.091   -5.896  -0.668  1.00 0.00 ? 62 ALA A H    7  
ATOM 7158  H HA   . ALA A 1 62 ? 1.809   -7.130  -2.967  1.00 0.00 ? 62 ALA A HA   7  
ATOM 7159  H HB1  . ALA A 1 62 ? 4.383   -7.729  -2.714  1.00 0.00 ? 62 ALA A HB1  7  
ATOM 7160  H HB2  . ALA A 1 62 ? 3.733   -8.893  -1.558  1.00 0.00 ? 62 ALA A HB2  7  
ATOM 7161  H HB3  . ALA A 1 62 ? 3.189   -8.918  -3.235  1.00 0.00 ? 62 ALA A HB3  7  
ATOM 7162  N N    . PRO A 1 63 ? 0.501   -8.729  -1.457  1.00 0.00 ? 63 PRO A N    7  
ATOM 7163  C CA   . PRO A 1 63 ? -0.457  -9.383  -0.561  1.00 0.00 ? 63 PRO A CA   7  
ATOM 7164  C C    . PRO A 1 63 ? 0.194   -10.467 0.292   1.00 0.00 ? 63 PRO A C    7  
ATOM 7165  O O    . PRO A 1 63 ? 0.557   -11.531 -0.209  1.00 0.00 ? 63 PRO A O    7  
ATOM 7166  C CB   . PRO A 1 63 ? -1.476  -10.000 -1.523  1.00 0.00 ? 63 PRO A CB   7  
ATOM 7167  C CG   . PRO A 1 63 ? -0.726  -10.198 -2.794  1.00 0.00 ? 63 PRO A CG   7  
ATOM 7168  C CD   . PRO A 1 63 ? 0.266   -9.071  -2.870  1.00 0.00 ? 63 PRO A CD   7  
ATOM 7169  H HA   . PRO A 1 63 ? -0.952  -8.670  0.081   1.00 0.00 ? 63 PRO A HA   7  
ATOM 7170  H HB2  . PRO A 1 63 ? -1.831  -10.939 -1.121  1.00 0.00 ? 63 PRO A HB2  7  
ATOM 7171  H HB3  . PRO A 1 63 ? -2.307  -9.323  -1.656  1.00 0.00 ? 63 PRO A HB3  7  
ATOM 7172  H HG2  . PRO A 1 63 ? -0.214  -11.148 -2.774  1.00 0.00 ? 63 PRO A HG2  7  
ATOM 7173  H HG3  . PRO A 1 63 ? -1.406  -10.155 -3.632  1.00 0.00 ? 63 PRO A HG3  7  
ATOM 7174  H HD2  . PRO A 1 63 ? 1.179   -9.403  -3.343  1.00 0.00 ? 63 PRO A HD2  7  
ATOM 7175  H HD3  . PRO A 1 63 ? -0.155  -8.233  -3.404  1.00 0.00 ? 63 PRO A HD3  7  
ATOM 7176  N N    . VAL A 1 64 ? 0.337   -10.189 1.584   1.00 0.00 ? 64 VAL A N    7  
ATOM 7177  C CA   . VAL A 1 64 ? 0.943   -11.141 2.507   1.00 0.00 ? 64 VAL A CA   7  
ATOM 7178  C C    . VAL A 1 64 ? -0.087  -12.143 3.019   1.00 0.00 ? 64 VAL A C    7  
ATOM 7179  O O    . VAL A 1 64 ? 0.258   -13.257 3.411   1.00 0.00 ? 64 VAL A O    7  
ATOM 7180  C CB   . VAL A 1 64 ? 1.587   -10.425 3.709   1.00 0.00 ? 64 VAL A CB   7  
ATOM 7181  C CG1  . VAL A 1 64 ? 0.641   -9.379  4.278   1.00 0.00 ? 64 VAL A CG1  7  
ATOM 7182  C CG2  . VAL A 1 64 ? 1.986   -11.432 4.778   1.00 0.00 ? 64 VAL A CG2  7  
ATOM 7183  H H    . VAL A 1 64 ? 0.028   -9.324  1.924   1.00 0.00 ? 64 VAL A H    7  
ATOM 7184  H HA   . VAL A 1 64 ? 1.718   -11.676 1.976   1.00 0.00 ? 64 VAL A HA   7  
ATOM 7185  H HB   . VAL A 1 64 ? 2.480   -9.923  3.367   1.00 0.00 ? 64 VAL A HB   7  
ATOM 7186  H HG11 . VAL A 1 64 ? 0.610   -9.469  5.354   1.00 0.00 ? 64 VAL A HG11 7  
ATOM 7187  H HG12 . VAL A 1 64 ? 0.989   -8.393  4.007   1.00 0.00 ? 64 VAL A HG12 7  
ATOM 7188  H HG13 . VAL A 1 64 ? -0.350  -9.534  3.876   1.00 0.00 ? 64 VAL A HG13 7  
ATOM 7189  H HG21 . VAL A 1 64 ? 2.606   -12.198 4.336   1.00 0.00 ? 64 VAL A HG21 7  
ATOM 7190  H HG22 . VAL A 1 64 ? 2.538   -10.929 5.559   1.00 0.00 ? 64 VAL A HG22 7  
ATOM 7191  H HG23 . VAL A 1 64 ? 1.099   -11.883 5.197   1.00 0.00 ? 64 VAL A HG23 7  
ATOM 7192  N N    . SER A 1 65 ? -1.353  -11.737 3.011   1.00 0.00 ? 65 SER A N    7  
ATOM 7193  C CA   . SER A 1 65 ? -2.434  -12.598 3.477   1.00 0.00 ? 65 SER A CA   7  
ATOM 7194  C C    . SER A 1 65 ? -2.250  -14.024 2.968   1.00 0.00 ? 65 SER A C    7  
ATOM 7195  O O    . SER A 1 65 ? -2.745  -14.978 3.568   1.00 0.00 ? 65 SER A O    7  
ATOM 7196  C CB   . SER A 1 65 ? -3.785  -12.049 3.016   1.00 0.00 ? 65 SER A CB   7  
ATOM 7197  O OG   . SER A 1 65 ? -4.114  -12.524 1.721   1.00 0.00 ? 65 SER A OG   7  
ATOM 7198  H H    . SER A 1 65 ? -1.564  -10.837 2.686   1.00 0.00 ? 65 SER A H    7  
ATOM 7199  H HA   . SER A 1 65 ? -2.408  -12.607 4.556   1.00 0.00 ? 65 SER A HA   7  
ATOM 7200  H HB2  . SER A 1 65 ? -4.553  -12.363 3.706   1.00 0.00 ? 65 SER A HB2  7  
ATOM 7201  H HB3  . SER A 1 65 ? -3.743  -10.970 2.990   1.00 0.00 ? 65 SER A HB3  7  
ATOM 7202  H HG   . SER A 1 65 ? -3.319  -12.565 1.184   1.00 0.00 ? 65 SER A HG   7  
ATOM 7203  N N    . GLY A 1 66 ? -1.535  -14.162 1.856   1.00 0.00 ? 66 GLY A N    7  
ATOM 7204  C CA   . GLY A 1 66 ? -1.298  -15.474 1.283   1.00 0.00 ? 66 GLY A CA   7  
ATOM 7205  C C    . GLY A 1 66 ? -2.563  -16.104 0.734   1.00 0.00 ? 66 GLY A C    7  
ATOM 7206  O O    . GLY A 1 66 ? -3.661  -15.897 1.252   1.00 0.00 ? 66 GLY A O    7  
ATOM 7207  H H    . GLY A 1 66 ? -1.165  -13.366 1.420   1.00 0.00 ? 66 GLY A H    7  
ATOM 7208  H HA2  . GLY A 1 66 ? -0.578  -15.382 0.484   1.00 0.00 ? 66 GLY A HA2  7  
ATOM 7209  H HA3  . GLY A 1 66 ? -0.892  -16.120 2.048   1.00 0.00 ? 66 GLY A HA3  7  
ATOM 7210  N N    . PRO A 1 67 ? -2.418  -16.892 -0.342  1.00 0.00 ? 67 PRO A N    7  
ATOM 7211  C CA   . PRO A 1 67 ? -3.547  -17.568 -0.986  1.00 0.00 ? 67 PRO A CA   7  
ATOM 7212  C C    . PRO A 1 67 ? -4.122  -18.687 -0.123  1.00 0.00 ? 67 PRO A C    7  
ATOM 7213  O O    . PRO A 1 67 ? -3.609  -18.975 0.958   1.00 0.00 ? 67 PRO A O    7  
ATOM 7214  C CB   . PRO A 1 67 ? -2.934  -18.142 -2.266  1.00 0.00 ? 67 PRO A CB   7  
ATOM 7215  C CG   . PRO A 1 67 ? -1.486  -18.303 -1.953  1.00 0.00 ? 67 PRO A CG   7  
ATOM 7216  C CD   . PRO A 1 67 ? -1.139  -17.183 -1.012  1.00 0.00 ? 67 PRO A CD   7  
ATOM 7217  H HA   . PRO A 1 67 ? -4.333  -16.873 -1.241  1.00 0.00 ? 67 PRO A HA   7  
ATOM 7218  H HB2  . PRO A 1 67 ? -3.397  -19.091 -2.496  1.00 0.00 ? 67 PRO A HB2  7  
ATOM 7219  H HB3  . PRO A 1 67 ? -3.087  -17.453 -3.083  1.00 0.00 ? 67 PRO A HB3  7  
ATOM 7220  H HG2  . PRO A 1 67 ? -1.317  -19.257 -1.479  1.00 0.00 ? 67 PRO A HG2  7  
ATOM 7221  H HG3  . PRO A 1 67 ? -0.905  -18.223 -2.860  1.00 0.00 ? 67 PRO A HG3  7  
ATOM 7222  H HD2  . PRO A 1 67 ? -0.395  -17.506 -0.299  1.00 0.00 ? 67 PRO A HD2  7  
ATOM 7223  H HD3  . PRO A 1 67 ? -0.788  -16.322 -1.562  1.00 0.00 ? 67 PRO A HD3  7  
ATOM 7224  N N    . SER A 1 68 ? -5.188  -19.314 -0.608  1.00 0.00 ? 68 SER A N    7  
ATOM 7225  C CA   . SER A 1 68 ? -5.834  -20.399 0.121   1.00 0.00 ? 68 SER A CA   7  
ATOM 7226  C C    . SER A 1 68 ? -5.168  -21.736 -0.191  1.00 0.00 ? 68 SER A C    7  
ATOM 7227  O O    . SER A 1 68 ? -5.600  -22.464 -1.084  1.00 0.00 ? 68 SER A O    7  
ATOM 7228  C CB   . SER A 1 68 ? -7.322  -20.464 -0.231  1.00 0.00 ? 68 SER A CB   7  
ATOM 7229  O OG   . SER A 1 68 ? -8.045  -21.199 0.741   1.00 0.00 ? 68 SER A OG   7  
ATOM 7230  H H    . SER A 1 68 ? -5.551  -19.038 -1.476  1.00 0.00 ? 68 SER A H    7  
ATOM 7231  H HA   . SER A 1 68 ? -5.731  -20.197 1.176   1.00 0.00 ? 68 SER A HA   7  
ATOM 7232  H HB2  . SER A 1 68 ? -7.722  -19.463 -0.279  1.00 0.00 ? 68 SER A HB2  7  
ATOM 7233  H HB3  . SER A 1 68 ? -7.441  -20.945 -1.191  1.00 0.00 ? 68 SER A HB3  7  
ATOM 7234  H HG   . SER A 1 68 ? -7.582  -22.018 0.933   1.00 0.00 ? 68 SER A HG   7  
ATOM 7235  N N    . SER A 1 69 ? -4.112  -22.051 0.552   1.00 0.00 ? 69 SER A N    7  
ATOM 7236  C CA   . SER A 1 69 ? -3.382  -23.298 0.354   1.00 0.00 ? 69 SER A CA   7  
ATOM 7237  C C    . SER A 1 69 ? -3.831  -24.356 1.357   1.00 0.00 ? 69 SER A C    7  
ATOM 7238  O O    . SER A 1 69 ? -3.330  -24.415 2.479   1.00 0.00 ? 69 SER A O    7  
ATOM 7239  C CB   . SER A 1 69 ? -1.877  -23.059 0.487   1.00 0.00 ? 69 SER A CB   7  
ATOM 7240  O OG   . SER A 1 69 ? -1.147  -24.245 0.227   1.00 0.00 ? 69 SER A OG   7  
ATOM 7241  H H    . SER A 1 69 ? -3.815  -21.429 1.249   1.00 0.00 ? 69 SER A H    7  
ATOM 7242  H HA   . SER A 1 69 ? -3.595  -23.651 -0.644  1.00 0.00 ? 69 SER A HA   7  
ATOM 7243  H HB2  . SER A 1 69 ? -1.571  -22.301 -0.219  1.00 0.00 ? 69 SER A HB2  7  
ATOM 7244  H HB3  . SER A 1 69 ? -1.655  -22.726 1.490   1.00 0.00 ? 69 SER A HB3  7  
ATOM 7245  H HG   . SER A 1 69 ? -1.385  -24.915 0.873   1.00 0.00 ? 69 SER A HG   7  
ATOM 7246  N N    . GLY A 1 70 ? -4.780  -25.190 0.943   1.00 0.00 ? 70 GLY A N    7  
ATOM 7247  C CA   . GLY A 1 70 ? -5.281  -26.235 1.816   1.00 0.00 ? 70 GLY A CA   7  
ATOM 7248  C C    . GLY A 1 70 ? -5.830  -27.420 1.046   1.00 0.00 ? 70 GLY A C    7  
ATOM 7249  O O    . GLY A 1 70 ? -6.376  -28.352 1.636   1.00 0.00 ? 70 GLY A O    7  
ATOM 7250  H H    . GLY A 1 70 ? -5.142  -25.095 0.037   1.00 0.00 ? 70 GLY A H    7  
ATOM 7251  H HA2  . GLY A 1 70 ? -4.478  -26.573 2.453   1.00 0.00 ? 70 GLY A HA2  7  
ATOM 7252  H HA3  . GLY A 1 70 ? -6.068  -25.826 2.433   1.00 0.00 ? 70 GLY A HA3  7  
ATOM 7253  N N    . GLY A 1 1  ? -20.532 -14.494 12.870  1.00 0.00 ? 1  GLY A N    8  
ATOM 7254  C CA   . GLY A 1 1  ? -21.096 -13.559 11.915  1.00 0.00 ? 1  GLY A CA   8  
ATOM 7255  C C    . GLY A 1 1  ? -20.789 -12.116 12.265  1.00 0.00 ? 1  GLY A C    8  
ATOM 7256  O O    . GLY A 1 1  ? -21.698 -11.323 12.512  1.00 0.00 ? 1  GLY A O    8  
ATOM 7257  H H1   . GLY A 1 1  ? -21.098 -15.189 13.266  1.00 0.00 ? 1  GLY A H1   8  
ATOM 7258  H HA2  . GLY A 1 1  ? -20.695 -13.775 10.936  1.00 0.00 ? 1  GLY A HA2  8  
ATOM 7259  H HA3  . GLY A 1 1  ? -22.168 -13.691 11.890  1.00 0.00 ? 1  GLY A HA3  8  
ATOM 7260  N N    . SER A 1 2  ? -19.505 -11.775 12.287  1.00 0.00 ? 2  SER A N    8  
ATOM 7261  C CA   . SER A 1 2  ? -19.080 -10.419 12.615  1.00 0.00 ? 2  SER A CA   8  
ATOM 7262  C C    . SER A 1 2  ? -17.719 -10.112 11.997  1.00 0.00 ? 2  SER A C    8  
ATOM 7263  O O    . SER A 1 2  ? -16.787 -10.910 12.094  1.00 0.00 ? 2  SER A O    8  
ATOM 7264  C CB   . SER A 1 2  ? -19.018 -10.234 14.132  1.00 0.00 ? 2  SER A CB   8  
ATOM 7265  O OG   . SER A 1 2  ? -18.083 -11.124 14.716  1.00 0.00 ? 2  SER A OG   8  
ATOM 7266  H H    . SER A 1 2  ? -18.827 -12.452 12.081  1.00 0.00 ? 2  SER A H    8  
ATOM 7267  H HA   . SER A 1 2  ? -19.810 -9.735  12.207  1.00 0.00 ? 2  SER A HA   8  
ATOM 7268  H HB2  . SER A 1 2  ? -18.720 -9.221  14.357  1.00 0.00 ? 2  SER A HB2  8  
ATOM 7269  H HB3  . SER A 1 2  ? -19.993 -10.425 14.556  1.00 0.00 ? 2  SER A HB3  8  
ATOM 7270  H HG   . SER A 1 2  ? -17.955 -11.879 14.138  1.00 0.00 ? 2  SER A HG   8  
ATOM 7271  N N    . SER A 1 3  ? -17.614 -8.949  11.361  1.00 0.00 ? 3  SER A N    8  
ATOM 7272  C CA   . SER A 1 3  ? -16.369 -8.537  10.724  1.00 0.00 ? 3  SER A CA   8  
ATOM 7273  C C    . SER A 1 3  ? -15.574 -7.606  11.635  1.00 0.00 ? 3  SER A C    8  
ATOM 7274  O O    . SER A 1 3  ? -15.814 -6.400  11.671  1.00 0.00 ? 3  SER A O    8  
ATOM 7275  C CB   . SER A 1 3  ? -16.659 -7.841  9.393   1.00 0.00 ? 3  SER A CB   8  
ATOM 7276  O OG   . SER A 1 3  ? -15.503 -7.188  8.896   1.00 0.00 ? 3  SER A OG   8  
ATOM 7277  H H    . SER A 1 3  ? -18.393 -8.356  11.318  1.00 0.00 ? 3  SER A H    8  
ATOM 7278  H HA   . SER A 1 3  ? -15.783 -9.424  10.536  1.00 0.00 ? 3  SER A HA   8  
ATOM 7279  H HB2  . SER A 1 3  ? -16.983 -8.573  8.670   1.00 0.00 ? 3  SER A HB2  8  
ATOM 7280  H HB3  . SER A 1 3  ? -17.438 -7.107  9.536   1.00 0.00 ? 3  SER A HB3  8  
ATOM 7281  H HG   . SER A 1 3  ? -15.546 -7.146  7.938   1.00 0.00 ? 3  SER A HG   8  
ATOM 7282  N N    . GLY A 1 4  ? -14.625 -8.177  12.371  1.00 0.00 ? 4  GLY A N    8  
ATOM 7283  C CA   . GLY A 1 4  ? -13.809 -7.385  13.273  1.00 0.00 ? 4  GLY A CA   8  
ATOM 7284  C C    . GLY A 1 4  ? -13.128 -6.226  12.573  1.00 0.00 ? 4  GLY A C    8  
ATOM 7285  O O    . GLY A 1 4  ? -13.720 -5.159  12.406  1.00 0.00 ? 4  GLY A O    8  
ATOM 7286  H H    . GLY A 1 4  ? -14.478 -9.144  12.301  1.00 0.00 ? 4  GLY A H    8  
ATOM 7287  H HA2  . GLY A 1 4  ? -14.436 -6.998  14.062  1.00 0.00 ? 4  GLY A HA2  8  
ATOM 7288  H HA3  . GLY A 1 4  ? -13.053 -8.022  13.708  1.00 0.00 ? 4  GLY A HA3  8  
ATOM 7289  N N    . SER A 1 5  ? -11.881 -6.434  12.163  1.00 0.00 ? 5  SER A N    8  
ATOM 7290  C CA   . SER A 1 5  ? -11.117 -5.396  11.481  1.00 0.00 ? 5  SER A CA   8  
ATOM 7291  C C    . SER A 1 5  ? -11.456 -5.359  9.994   1.00 0.00 ? 5  SER A C    8  
ATOM 7292  O O    . SER A 1 5  ? -12.244 -6.169  9.506   1.00 0.00 ? 5  SER A O    8  
ATOM 7293  C CB   . SER A 1 5  ? -9.617  -5.631  11.668  1.00 0.00 ? 5  SER A CB   8  
ATOM 7294  O OG   . SER A 1 5  ? -9.254  -5.549  13.035  1.00 0.00 ? 5  SER A OG   8  
ATOM 7295  H H    . SER A 1 5  ? -11.464 -7.307  12.326  1.00 0.00 ? 5  SER A H    8  
ATOM 7296  H HA   . SER A 1 5  ? -11.381 -4.446  11.923  1.00 0.00 ? 5  SER A HA   8  
ATOM 7297  H HB2  . SER A 1 5  ? -9.360  -6.612  11.298  1.00 0.00 ? 5  SER A HB2  8  
ATOM 7298  H HB3  . SER A 1 5  ? -9.067  -4.883  11.116  1.00 0.00 ? 5  SER A HB3  8  
ATOM 7299  H HG   . SER A 1 5  ? -8.593  -6.217  13.232  1.00 0.00 ? 5  SER A HG   8  
ATOM 7300  N N    . SER A 1 6  ? -10.856 -4.413  9.280   1.00 0.00 ? 6  SER A N    8  
ATOM 7301  C CA   . SER A 1 6  ? -11.096 -4.267  7.849   1.00 0.00 ? 6  SER A CA   8  
ATOM 7302  C C    . SER A 1 6  ? -9.805  -3.919  7.114   1.00 0.00 ? 6  SER A C    8  
ATOM 7303  O O    . SER A 1 6  ? -9.066  -3.025  7.523   1.00 0.00 ? 6  SER A O    8  
ATOM 7304  C CB   . SER A 1 6  ? -12.148 -3.186  7.595   1.00 0.00 ? 6  SER A CB   8  
ATOM 7305  O OG   . SER A 1 6  ? -13.409 -3.568  8.117   1.00 0.00 ? 6  SER A OG   8  
ATOM 7306  H H    . SER A 1 6  ? -10.238 -3.797  9.727   1.00 0.00 ? 6  SER A H    8  
ATOM 7307  H HA   . SER A 1 6  ? -11.465 -5.211  7.477   1.00 0.00 ? 6  SER A HA   8  
ATOM 7308  H HB2  . SER A 1 6  ? -11.839 -2.268  8.071   1.00 0.00 ? 6  SER A HB2  8  
ATOM 7309  H HB3  . SER A 1 6  ? -12.245 -3.025  6.531   1.00 0.00 ? 6  SER A HB3  8  
ATOM 7310  H HG   . SER A 1 6  ? -13.923 -3.997  7.429   1.00 0.00 ? 6  SER A HG   8  
ATOM 7311  N N    . GLY A 1 7  ? -9.541  -4.635  6.025   1.00 0.00 ? 7  GLY A N    8  
ATOM 7312  C CA   . GLY A 1 7  ? -8.339  -4.388  5.249   1.00 0.00 ? 7  GLY A CA   8  
ATOM 7313  C C    . GLY A 1 7  ? -7.463  -5.620  5.130   1.00 0.00 ? 7  GLY A C    8  
ATOM 7314  O O    . GLY A 1 7  ? -7.201  -6.304  6.120   1.00 0.00 ? 7  GLY A O    8  
ATOM 7315  H H    . GLY A 1 7  ? -10.166 -5.336  5.746   1.00 0.00 ? 7  GLY A H    8  
ATOM 7316  H HA2  . GLY A 1 7  ? -8.623  -4.064  4.259   1.00 0.00 ? 7  GLY A HA2  8  
ATOM 7317  H HA3  . GLY A 1 7  ? -7.772  -3.602  5.726   1.00 0.00 ? 7  GLY A HA3  8  
ATOM 7318  N N    . THR A 1 8  ? -7.009  -5.906  3.913   1.00 0.00 ? 8  THR A N    8  
ATOM 7319  C CA   . THR A 1 8  ? -6.160  -7.064  3.667   1.00 0.00 ? 8  THR A CA   8  
ATOM 7320  C C    . THR A 1 8  ? -4.712  -6.775  4.044   1.00 0.00 ? 8  THR A C    8  
ATOM 7321  O O    . THR A 1 8  ? -4.176  -5.702  3.767   1.00 0.00 ? 8  THR A O    8  
ATOM 7322  C CB   . THR A 1 8  ? -6.218  -7.499  2.190   1.00 0.00 ? 8  THR A CB   8  
ATOM 7323  O OG1  . THR A 1 8  ? -7.572  -7.772  1.812   1.00 0.00 ? 8  THR A OG1  8  
ATOM 7324  C CG2  . THR A 1 8  ? -5.361  -8.734  1.956   1.00 0.00 ? 8  THR A CG2  8  
ATOM 7325  H H    . THR A 1 8  ? -7.253  -5.322  3.164   1.00 0.00 ? 8  THR A H    8  
ATOM 7326  H HA   . THR A 1 8  ? -6.525  -7.880  4.275   1.00 0.00 ? 8  THR A HA   8  
ATOM 7327  H HB   . THR A 1 8  ? -5.837  -6.694  1.579   1.00 0.00 ? 8  THR A HB   8  
ATOM 7328  H HG1  . THR A 1 8  ? -8.061  -8.086  2.577   1.00 0.00 ? 8  THR A HG1  8  
ATOM 7329  H HG21 . THR A 1 8  ? -5.196  -8.862  0.897   1.00 0.00 ? 8  THR A HG21 8  
ATOM 7330  H HG22 . THR A 1 8  ? -5.868  -9.603  2.349   1.00 0.00 ? 8  THR A HG22 8  
ATOM 7331  H HG23 . THR A 1 8  ? -4.412  -8.614  2.457   1.00 0.00 ? 8  THR A HG23 8  
ATOM 7332  N N    . PRO A 1 9  ? -4.061  -7.753  4.691   1.00 0.00 ? 9  PRO A N    8  
ATOM 7333  C CA   . PRO A 1 9  ? -2.665  -7.627  5.118   1.00 0.00 ? 9  PRO A CA   8  
ATOM 7334  C C    . PRO A 1 9  ? -1.696  -7.627  3.941   1.00 0.00 ? 9  PRO A C    8  
ATOM 7335  O O    . PRO A 1 9  ? -1.737  -8.516  3.090   1.00 0.00 ? 9  PRO A O    8  
ATOM 7336  C CB   . PRO A 1 9  ? -2.447  -8.866  5.990   1.00 0.00 ? 9  PRO A CB   8  
ATOM 7337  C CG   . PRO A 1 9  ? -3.443  -9.857  5.494   1.00 0.00 ? 9  PRO A CG   8  
ATOM 7338  C CD   . PRO A 1 9  ? -4.638  -9.058  5.054   1.00 0.00 ? 9  PRO A CD   8  
ATOM 7339  H HA   . PRO A 1 9  ? -2.510  -6.737  5.710   1.00 0.00 ? 9  PRO A HA   8  
ATOM 7340  H HB2  . PRO A 1 9  ? -1.435  -9.225  5.864   1.00 0.00 ? 9  PRO A HB2  8  
ATOM 7341  H HB3  . PRO A 1 9  ? -2.620  -8.617  7.026   1.00 0.00 ? 9  PRO A HB3  8  
ATOM 7342  H HG2  . PRO A 1 9  ? -3.031  -10.407 4.661   1.00 0.00 ? 9  PRO A HG2  8  
ATOM 7343  H HG3  . PRO A 1 9  ? -3.717  -10.532 6.292   1.00 0.00 ? 9  PRO A HG3  8  
ATOM 7344  H HD2  . PRO A 1 9  ? -5.109  -9.523  4.200   1.00 0.00 ? 9  PRO A HD2  8  
ATOM 7345  H HD3  . PRO A 1 9  ? -5.343  -8.955  5.866   1.00 0.00 ? 9  PRO A HD3  8  
ATOM 7346  N N    . TYR A 1 10 ? -0.825  -6.625  3.898   1.00 0.00 ? 10 TYR A N    8  
ATOM 7347  C CA   . TYR A 1 10 ? 0.154   -6.508  2.823   1.00 0.00 ? 10 TYR A CA   8  
ATOM 7348  C C    . TYR A 1 10 ? 1.532   -6.160  3.377   1.00 0.00 ? 10 TYR A C    8  
ATOM 7349  O O    . TYR A 1 10 ? 1.694   -5.941  4.577   1.00 0.00 ? 10 TYR A O    8  
ATOM 7350  C CB   . TYR A 1 10 ? -0.287  -5.445  1.817   1.00 0.00 ? 10 TYR A CB   8  
ATOM 7351  C CG   . TYR A 1 10 ? -1.186  -5.980  0.725   1.00 0.00 ? 10 TYR A CG   8  
ATOM 7352  C CD1  . TYR A 1 10 ? -2.489  -6.376  1.002   1.00 0.00 ? 10 TYR A CD1  8  
ATOM 7353  C CD2  . TYR A 1 10 ? -0.732  -6.091  -0.584  1.00 0.00 ? 10 TYR A CD2  8  
ATOM 7354  C CE1  . TYR A 1 10 ? -3.313  -6.866  0.008   1.00 0.00 ? 10 TYR A CE1  8  
ATOM 7355  C CE2  . TYR A 1 10 ? -1.550  -6.578  -1.584  1.00 0.00 ? 10 TYR A CE2  8  
ATOM 7356  C CZ   . TYR A 1 10 ? -2.840  -6.965  -1.284  1.00 0.00 ? 10 TYR A CZ   8  
ATOM 7357  O OH   . TYR A 1 10 ? -3.657  -7.452  -2.277  1.00 0.00 ? 10 TYR A OH   8  
ATOM 7358  H H    . TYR A 1 10 ? -0.841  -5.946  4.605   1.00 0.00 ? 10 TYR A H    8  
ATOM 7359  H HA   . TYR A 1 10 ? 0.211   -7.463  2.321   1.00 0.00 ? 10 TYR A HA   8  
ATOM 7360  H HB2  . TYR A 1 10 ? -0.825  -4.668  2.337   1.00 0.00 ? 10 TYR A HB2  8  
ATOM 7361  H HB3  . TYR A 1 10 ? 0.587   -5.018  1.347   1.00 0.00 ? 10 TYR A HB3  8  
ATOM 7362  H HD1  . TYR A 1 10 ? -2.857  -6.297  2.015   1.00 0.00 ? 10 TYR A HD1  8  
ATOM 7363  H HD2  . TYR A 1 10 ? 0.278   -5.787  -0.816  1.00 0.00 ? 10 TYR A HD2  8  
ATOM 7364  H HE1  . TYR A 1 10 ? -4.323  -7.168  0.243   1.00 0.00 ? 10 TYR A HE1  8  
ATOM 7365  H HE2  . TYR A 1 10 ? -1.180  -6.656  -2.596  1.00 0.00 ? 10 TYR A HE2  8  
ATOM 7366  H HH   . TYR A 1 10 ? -4.537  -7.081  -2.179  1.00 0.00 ? 10 TYR A HH   8  
ATOM 7367  N N    . ARG A 1 11 ? 2.523   -6.111  2.492   1.00 0.00 ? 11 ARG A N    8  
ATOM 7368  C CA   . ARG A 1 11 ? 3.888   -5.790  2.891   1.00 0.00 ? 11 ARG A CA   8  
ATOM 7369  C C    . ARG A 1 11 ? 4.598   -4.990  1.803   1.00 0.00 ? 11 ARG A C    8  
ATOM 7370  O O    . ARG A 1 11 ? 4.507   -5.315  0.619   1.00 0.00 ? 11 ARG A O    8  
ATOM 7371  C CB   . ARG A 1 11 ? 4.669   -7.071  3.189   1.00 0.00 ? 11 ARG A CB   8  
ATOM 7372  C CG   . ARG A 1 11 ? 6.170   -6.858  3.297   1.00 0.00 ? 11 ARG A CG   8  
ATOM 7373  C CD   . ARG A 1 11 ? 6.889   -8.142  3.681   1.00 0.00 ? 11 ARG A CD   8  
ATOM 7374  N NE   . ARG A 1 11 ? 8.255   -8.179  3.167   1.00 0.00 ? 11 ARG A NE   8  
ATOM 7375  C CZ   . ARG A 1 11 ? 8.939   -9.302  2.978   1.00 0.00 ? 11 ARG A CZ   8  
ATOM 7376  N NH1  . ARG A 1 11 ? 8.387   -10.474 3.259   1.00 0.00 ? 11 ARG A NH1  8  
ATOM 7377  N NH2  . ARG A 1 11 ? 10.179  -9.254  2.506   1.00 0.00 ? 11 ARG A NH2  8  
ATOM 7378  H H    . ARG A 1 11 ? 2.331   -6.295  1.549   1.00 0.00 ? 11 ARG A H    8  
ATOM 7379  H HA   . ARG A 1 11 ? 3.840   -5.191  3.788   1.00 0.00 ? 11 ARG A HA   8  
ATOM 7380  H HB2  . ARG A 1 11 ? 4.318   -7.484  4.123   1.00 0.00 ? 11 ARG A HB2  8  
ATOM 7381  H HB3  . ARG A 1 11 ? 4.485   -7.783  2.398   1.00 0.00 ? 11 ARG A HB3  8  
ATOM 7382  H HG2  . ARG A 1 11 ? 6.546   -6.520  2.343   1.00 0.00 ? 11 ARG A HG2  8  
ATOM 7383  H HG3  . ARG A 1 11 ? 6.364   -6.108  4.049   1.00 0.00 ? 11 ARG A HG3  8  
ATOM 7384  H HD2  . ARG A 1 11 ? 6.918   -8.214  4.758   1.00 0.00 ? 11 ARG A HD2  8  
ATOM 7385  H HD3  . ARG A 1 11 ? 6.340   -8.980  3.279   1.00 0.00 ? 11 ARG A HD3  8  
ATOM 7386  H HE   . ARG A 1 11 ? 8.683   -7.324  2.953   1.00 0.00 ? 11 ARG A HE   8  
ATOM 7387  H HH11 . ARG A 1 11 ? 7.453   -10.513 3.613   1.00 0.00 ? 11 ARG A HH11 8  
ATOM 7388  H HH12 . ARG A 1 11 ? 8.903   -11.318 3.114   1.00 0.00 ? 11 ARG A HH12 8  
ATOM 7389  H HH21 . ARG A 1 11 ? 10.599  -8.372  2.293   1.00 0.00 ? 11 ARG A HH21 8  
ATOM 7390  H HH22 . ARG A 1 11 ? 10.693  -10.099 2.364   1.00 0.00 ? 11 ARG A HH22 8  
ATOM 7391  N N    . ALA A 1 12 ? 5.305   -3.942  2.212   1.00 0.00 ? 12 ALA A N    8  
ATOM 7392  C CA   . ALA A 1 12 ? 6.032   -3.096  1.273   1.00 0.00 ? 12 ALA A CA   8  
ATOM 7393  C C    . ALA A 1 12 ? 7.369   -3.722  0.893   1.00 0.00 ? 12 ALA A C    8  
ATOM 7394  O O    . ALA A 1 12 ? 8.327   -3.678  1.664   1.00 0.00 ? 12 ALA A O    8  
ATOM 7395  C CB   . ALA A 1 12 ? 6.245   -1.711  1.866   1.00 0.00 ? 12 ALA A CB   8  
ATOM 7396  H H    . ALA A 1 12 ? 5.339   -3.733  3.169   1.00 0.00 ? 12 ALA A H    8  
ATOM 7397  H HA   . ALA A 1 12 ? 5.428   -2.991  0.383   1.00 0.00 ? 12 ALA A HA   8  
ATOM 7398  H HB1  . ALA A 1 12 ? 7.039   -1.752  2.597   1.00 0.00 ? 12 ALA A HB1  8  
ATOM 7399  H HB2  . ALA A 1 12 ? 6.513   -1.021  1.080   1.00 0.00 ? 12 ALA A HB2  8  
ATOM 7400  H HB3  . ALA A 1 12 ? 5.334   -1.380  2.342   1.00 0.00 ? 12 ALA A HB3  8  
ATOM 7401  N N    . MET A 1 13 ? 7.426   -4.305  -0.300  1.00 0.00 ? 13 MET A N    8  
ATOM 7402  C CA   . MET A 1 13 ? 8.647   -4.940  -0.783  1.00 0.00 ? 13 MET A CA   8  
ATOM 7403  C C    . MET A 1 13 ? 9.770   -3.917  -0.930  1.00 0.00 ? 13 MET A C    8  
ATOM 7404  O O    . MET A 1 13 ? 10.949  -4.271  -0.928  1.00 0.00 ? 13 MET A O    8  
ATOM 7405  C CB   . MET A 1 13 ? 8.393   -5.631  -2.123  1.00 0.00 ? 13 MET A CB   8  
ATOM 7406  C CG   . MET A 1 13 ? 7.173   -6.538  -2.117  1.00 0.00 ? 13 MET A CG   8  
ATOM 7407  S SD   . MET A 1 13 ? 7.260   -7.828  -3.374  1.00 0.00 ? 13 MET A SD   8  
ATOM 7408  C CE   . MET A 1 13 ? 6.603   -6.960  -4.796  1.00 0.00 ? 13 MET A CE   8  
ATOM 7409  H H    . MET A 1 13 ? 6.629   -4.308  -0.871  1.00 0.00 ? 13 MET A H    8  
ATOM 7410  H HA   . MET A 1 13 ? 8.944   -5.681  -0.056  1.00 0.00 ? 13 MET A HA   8  
ATOM 7411  H HB2  . MET A 1 13 ? 8.250   -4.877  -2.883  1.00 0.00 ? 13 MET A HB2  8  
ATOM 7412  H HB3  . MET A 1 13 ? 9.256   -6.228  -2.377  1.00 0.00 ? 13 MET A HB3  8  
ATOM 7413  H HG2  . MET A 1 13 ? 7.093   -7.006  -1.147  1.00 0.00 ? 13 MET A HG2  8  
ATOM 7414  H HG3  . MET A 1 13 ? 6.294   -5.937  -2.297  1.00 0.00 ? 13 MET A HG3  8  
ATOM 7415  H HE1  . MET A 1 13 ? 6.302   -7.675  -5.548  1.00 0.00 ? 13 MET A HE1  8  
ATOM 7416  H HE2  . MET A 1 13 ? 5.749   -6.371  -4.496  1.00 0.00 ? 13 MET A HE2  8  
ATOM 7417  H HE3  . MET A 1 13 ? 7.364   -6.309  -5.203  1.00 0.00 ? 13 MET A HE3  8  
ATOM 7418  N N    . TYR A 1 14 ? 9.396   -2.649  -1.058  1.00 0.00 ? 14 TYR A N    8  
ATOM 7419  C CA   . TYR A 1 14 ? 10.371  -1.576  -1.209  1.00 0.00 ? 14 TYR A CA   8  
ATOM 7420  C C    . TYR A 1 14 ? 9.850   -0.277  -0.603  1.00 0.00 ? 14 TYR A C    8  
ATOM 7421  O O    . TYR A 1 14 ? 8.672   0.055   -0.738  1.00 0.00 ? 14 TYR A O    8  
ATOM 7422  C CB   . TYR A 1 14 ? 10.703  -1.365  -2.688  1.00 0.00 ? 14 TYR A CB   8  
ATOM 7423  C CG   . TYR A 1 14 ? 10.714  -2.644  -3.494  1.00 0.00 ? 14 TYR A CG   8  
ATOM 7424  C CD1  . TYR A 1 14 ? 11.693  -3.609  -3.289  1.00 0.00 ? 14 TYR A CD1  8  
ATOM 7425  C CD2  . TYR A 1 14 ? 9.748   -2.886  -4.462  1.00 0.00 ? 14 TYR A CD2  8  
ATOM 7426  C CE1  . TYR A 1 14 ? 11.707  -4.779  -4.024  1.00 0.00 ? 14 TYR A CE1  8  
ATOM 7427  C CE2  . TYR A 1 14 ? 9.754   -4.054  -5.201  1.00 0.00 ? 14 TYR A CE2  8  
ATOM 7428  C CZ   . TYR A 1 14 ? 10.736  -4.996  -4.978  1.00 0.00 ? 14 TYR A CZ   8  
ATOM 7429  O OH   . TYR A 1 14 ? 10.746  -6.160  -5.713  1.00 0.00 ? 14 TYR A OH   8  
ATOM 7430  H H    . TYR A 1 14 ? 8.441   -2.429  -1.053  1.00 0.00 ? 14 TYR A H    8  
ATOM 7431  H HA   . TYR A 1 14 ? 11.270  -1.869  -0.687  1.00 0.00 ? 14 TYR A HA   8  
ATOM 7432  H HB2  . TYR A 1 14 ? 9.970   -0.705  -3.124  1.00 0.00 ? 14 TYR A HB2  8  
ATOM 7433  H HB3  . TYR A 1 14 ? 11.681  -0.913  -2.769  1.00 0.00 ? 14 TYR A HB3  8  
ATOM 7434  H HD1  . TYR A 1 14 ? 12.453  -3.435  -2.541  1.00 0.00 ? 14 TYR A HD1  8  
ATOM 7435  H HD2  . TYR A 1 14 ? 8.980   -2.145  -4.634  1.00 0.00 ? 14 TYR A HD2  8  
ATOM 7436  H HE1  . TYR A 1 14 ? 12.476  -5.517  -3.850  1.00 0.00 ? 14 TYR A HE1  8  
ATOM 7437  H HE2  . TYR A 1 14 ? 8.993   -4.224  -5.948  1.00 0.00 ? 14 TYR A HE2  8  
ATOM 7438  H HH   . TYR A 1 14 ? 11.471  -6.134  -6.342  1.00 0.00 ? 14 TYR A HH   8  
ATOM 7439  N N    . GLN A 1 15 ? 10.736  0.454   0.065   1.00 0.00 ? 15 GLN A N    8  
ATOM 7440  C CA   . GLN A 1 15 ? 10.367  1.718   0.692   1.00 0.00 ? 15 GLN A CA   8  
ATOM 7441  C C    . GLN A 1 15 ? 9.839   2.706   -0.343  1.00 0.00 ? 15 GLN A C    8  
ATOM 7442  O O    . GLN A 1 15 ? 10.320  2.749   -1.476  1.00 0.00 ? 15 GLN A O    8  
ATOM 7443  C CB   . GLN A 1 15 ? 11.568  2.319   1.423   1.00 0.00 ? 15 GLN A CB   8  
ATOM 7444  C CG   . GLN A 1 15 ? 11.234  3.574   2.213   1.00 0.00 ? 15 GLN A CG   8  
ATOM 7445  C CD   . GLN A 1 15 ? 11.382  4.839   1.390   1.00 0.00 ? 15 GLN A CD   8  
ATOM 7446  O OE1  . GLN A 1 15 ? 11.518  4.785   0.167   1.00 0.00 ? 15 GLN A OE1  8  
ATOM 7447  N NE2  . GLN A 1 15 ? 11.356  5.986   2.057   1.00 0.00 ? 15 GLN A NE2  8  
ATOM 7448  H H    . GLN A 1 15 ? 11.660  0.137   0.137   1.00 0.00 ? 15 GLN A H    8  
ATOM 7449  H HA   . GLN A 1 15 ? 9.585   1.515   1.409   1.00 0.00 ? 15 GLN A HA   8  
ATOM 7450  H HB2  . GLN A 1 15 ? 11.963  1.584   2.107   1.00 0.00 ? 15 GLN A HB2  8  
ATOM 7451  H HB3  . GLN A 1 15 ? 12.328  2.569   0.697   1.00 0.00 ? 15 GLN A HB3  8  
ATOM 7452  H HG2  . GLN A 1 15 ? 10.213  3.506   2.558   1.00 0.00 ? 15 GLN A HG2  8  
ATOM 7453  H HG3  . GLN A 1 15 ? 11.896  3.636   3.063   1.00 0.00 ? 15 GLN A HG3  8  
ATOM 7454  H HE21 . GLN A 1 15 ? 11.246  5.953   3.031   1.00 0.00 ? 15 GLN A HE21 8  
ATOM 7455  H HE22 . GLN A 1 15 ? 11.451  6.819   1.550   1.00 0.00 ? 15 GLN A HE22 8  
ATOM 7456  N N    . TYR A 1 16 ? 8.849   3.498   0.053   1.00 0.00 ? 16 TYR A N    8  
ATOM 7457  C CA   . TYR A 1 16 ? 8.254   4.484   -0.842  1.00 0.00 ? 16 TYR A CA   8  
ATOM 7458  C C    . TYR A 1 16 ? 8.508   5.901   -0.337  1.00 0.00 ? 16 TYR A C    8  
ATOM 7459  O O    . TYR A 1 16 ? 8.787   6.110   0.844   1.00 0.00 ? 16 TYR A O    8  
ATOM 7460  C CB   . TYR A 1 16 ? 6.750   4.240   -0.976  1.00 0.00 ? 16 TYR A CB   8  
ATOM 7461  C CG   . TYR A 1 16 ? 6.071   5.170   -1.956  1.00 0.00 ? 16 TYR A CG   8  
ATOM 7462  C CD1  . TYR A 1 16 ? 6.306   5.063   -3.321  1.00 0.00 ? 16 TYR A CD1  8  
ATOM 7463  C CD2  . TYR A 1 16 ? 5.195   6.154   -1.517  1.00 0.00 ? 16 TYR A CD2  8  
ATOM 7464  C CE1  . TYR A 1 16 ? 5.688   5.911   -4.220  1.00 0.00 ? 16 TYR A CE1  8  
ATOM 7465  C CE2  . TYR A 1 16 ? 4.571   7.005   -2.408  1.00 0.00 ? 16 TYR A CE2  8  
ATOM 7466  C CZ   . TYR A 1 16 ? 4.822   6.880   -3.759  1.00 0.00 ? 16 TYR A CZ   8  
ATOM 7467  O OH   . TYR A 1 16 ? 4.203   7.726   -4.651  1.00 0.00 ? 16 TYR A OH   8  
ATOM 7468  H H    . TYR A 1 16 ? 8.508   3.416   0.968   1.00 0.00 ? 16 TYR A H    8  
ATOM 7469  H HA   . TYR A 1 16 ? 8.715   4.371   -1.812  1.00 0.00 ? 16 TYR A HA   8  
ATOM 7470  H HB2  . TYR A 1 16 ? 6.585   3.228   -1.311  1.00 0.00 ? 16 TYR A HB2  8  
ATOM 7471  H HB3  . TYR A 1 16 ? 6.283   4.376   -0.011  1.00 0.00 ? 16 TYR A HB3  8  
ATOM 7472  H HD1  . TYR A 1 16 ? 6.985   4.303   -3.679  1.00 0.00 ? 16 TYR A HD1  8  
ATOM 7473  H HD2  . TYR A 1 16 ? 5.000   6.249   -0.458  1.00 0.00 ? 16 TYR A HD2  8  
ATOM 7474  H HE1  . TYR A 1 16 ? 5.884   5.813   -5.278  1.00 0.00 ? 16 TYR A HE1  8  
ATOM 7475  H HE2  . TYR A 1 16 ? 3.893   7.764   -2.048  1.00 0.00 ? 16 TYR A HE2  8  
ATOM 7476  H HH   . TYR A 1 16 ? 4.143   8.605   -4.269  1.00 0.00 ? 16 TYR A HH   8  
ATOM 7477  N N    . ARG A 1 17 ? 8.410   6.870   -1.240  1.00 0.00 ? 17 ARG A N    8  
ATOM 7478  C CA   . ARG A 1 17 ? 8.629   8.268   -0.888  1.00 0.00 ? 17 ARG A CA   8  
ATOM 7479  C C    . ARG A 1 17 ? 7.514   9.150   -1.442  1.00 0.00 ? 17 ARG A C    8  
ATOM 7480  O O    . ARG A 1 17 ? 7.603   9.684   -2.548  1.00 0.00 ? 17 ARG A O    8  
ATOM 7481  C CB   . ARG A 1 17 ? 9.982   8.744   -1.419  1.00 0.00 ? 17 ARG A CB   8  
ATOM 7482  C CG   . ARG A 1 17 ? 11.164  8.262   -0.594  1.00 0.00 ? 17 ARG A CG   8  
ATOM 7483  C CD   . ARG A 1 17 ? 12.380  9.155   -0.788  1.00 0.00 ? 17 ARG A CD   8  
ATOM 7484  N NE   . ARG A 1 17 ? 13.629  8.441   -0.538  1.00 0.00 ? 17 ARG A NE   8  
ATOM 7485  C CZ   . ARG A 1 17 ? 14.113  8.211   0.678   1.00 0.00 ? 17 ARG A CZ   8  
ATOM 7486  N NH1  . ARG A 1 17 ? 13.456  8.635   1.748   1.00 0.00 ? 17 ARG A NH1  8  
ATOM 7487  N NH2  . ARG A 1 17 ? 15.257  7.554   0.824   1.00 0.00 ? 17 ARG A NH2  8  
ATOM 7488  H H    . ARG A 1 17 ? 8.185   6.641   -2.166  1.00 0.00 ? 17 ARG A H    8  
ATOM 7489  H HA   . ARG A 1 17 ? 8.629   8.343   0.189   1.00 0.00 ? 17 ARG A HA   8  
ATOM 7490  H HB2  . ARG A 1 17 ? 10.106  8.383   -2.430  1.00 0.00 ? 17 ARG A HB2  8  
ATOM 7491  H HB3  . ARG A 1 17 ? 9.993   9.823   -1.427  1.00 0.00 ? 17 ARG A HB3  8  
ATOM 7492  H HG2  . ARG A 1 17 ? 10.889  8.268   0.450   1.00 0.00 ? 17 ARG A HG2  8  
ATOM 7493  H HG3  . ARG A 1 17 ? 11.415  7.256   -0.896  1.00 0.00 ? 17 ARG A HG3  8  
ATOM 7494  H HD2  . ARG A 1 17 ? 12.383  9.521   -1.803  1.00 0.00 ? 17 ARG A HD2  8  
ATOM 7495  H HD3  . ARG A 1 17 ? 12.309  9.989   -0.105  1.00 0.00 ? 17 ARG A HD3  8  
ATOM 7496  H HE   . ARG A 1 17 ? 14.131  8.119   -1.315  1.00 0.00 ? 17 ARG A HE   8  
ATOM 7497  H HH11 . ARG A 1 17 ? 12.593  9.130   1.641   1.00 0.00 ? 17 ARG A HH11 8  
ATOM 7498  H HH12 . ARG A 1 17 ? 13.822  8.459   2.662   1.00 0.00 ? 17 ARG A HH12 8  
ATOM 7499  H HH21 . ARG A 1 17 ? 15.755  7.232   0.020   1.00 0.00 ? 17 ARG A HH21 8  
ATOM 7500  H HH22 . ARG A 1 17 ? 15.620  7.381   1.739   1.00 0.00 ? 17 ARG A HH22 8  
ATOM 7501  N N    . PRO A 1 18 ? 6.437   9.306   -0.658  1.00 0.00 ? 18 PRO A N    8  
ATOM 7502  C CA   . PRO A 1 18 ? 5.284   10.123  -1.049  1.00 0.00 ? 18 PRO A CA   8  
ATOM 7503  C C    . PRO A 1 18 ? 5.608   11.612  -1.069  1.00 0.00 ? 18 PRO A C    8  
ATOM 7504  O O    . PRO A 1 18 ? 5.980   12.189  -0.047  1.00 0.00 ? 18 PRO A O    8  
ATOM 7505  C CB   . PRO A 1 18 ? 4.248   9.815   0.034   1.00 0.00 ? 18 PRO A CB   8  
ATOM 7506  C CG   . PRO A 1 18 ? 5.050   9.399   1.219   1.00 0.00 ? 18 PRO A CG   8  
ATOM 7507  C CD   . PRO A 1 18 ? 6.263   8.699   0.673   1.00 0.00 ? 18 PRO A CD   8  
ATOM 7508  H HA   . PRO A 1 18 ? 4.898   9.827   -2.014  1.00 0.00 ? 18 PRO A HA   8  
ATOM 7509  H HB2  . PRO A 1 18 ? 3.666   10.702  0.241   1.00 0.00 ? 18 PRO A HB2  8  
ATOM 7510  H HB3  . PRO A 1 18 ? 3.597   9.021   -0.300  1.00 0.00 ? 18 PRO A HB3  8  
ATOM 7511  H HG2  . PRO A 1 18 ? 5.343   10.269  1.787   1.00 0.00 ? 18 PRO A HG2  8  
ATOM 7512  H HG3  . PRO A 1 18 ? 4.473   8.724   1.834   1.00 0.00 ? 18 PRO A HG3  8  
ATOM 7513  H HD2  . PRO A 1 18 ? 7.122   8.889   1.299   1.00 0.00 ? 18 PRO A HD2  8  
ATOM 7514  H HD3  . PRO A 1 18 ? 6.081   7.638   0.590   1.00 0.00 ? 18 PRO A HD3  8  
ATOM 7515  N N    . GLN A 1 19 ? 5.465   12.229  -2.237  1.00 0.00 ? 19 GLN A N    8  
ATOM 7516  C CA   . GLN A 1 19 ? 5.743   13.653  -2.388  1.00 0.00 ? 19 GLN A CA   8  
ATOM 7517  C C    . GLN A 1 19 ? 4.809   14.485  -1.516  1.00 0.00 ? 19 GLN A C    8  
ATOM 7518  O O    . GLN A 1 19 ? 5.203   15.519  -0.979  1.00 0.00 ? 19 GLN A O    8  
ATOM 7519  C CB   . GLN A 1 19 ? 5.600   14.069  -3.853  1.00 0.00 ? 19 GLN A CB   8  
ATOM 7520  C CG   . GLN A 1 19 ? 4.167   14.028  -4.359  1.00 0.00 ? 19 GLN A CG   8  
ATOM 7521  C CD   . GLN A 1 19 ? 4.026   14.595  -5.758  1.00 0.00 ? 19 GLN A CD   8  
ATOM 7522  O OE1  . GLN A 1 19 ? 3.991   15.812  -5.947  1.00 0.00 ? 19 GLN A OE1  8  
ATOM 7523  N NE2  . GLN A 1 19 ? 3.944   13.715  -6.749  1.00 0.00 ? 19 GLN A NE2  8  
ATOM 7524  H H    . GLN A 1 19 ? 5.166   11.716  -3.015  1.00 0.00 ? 19 GLN A H    8  
ATOM 7525  H HA   . GLN A 1 19 ? 6.760   13.827  -2.072  1.00 0.00 ? 19 GLN A HA   8  
ATOM 7526  H HB2  . GLN A 1 19 ? 5.970   15.077  -3.966  1.00 0.00 ? 19 GLN A HB2  8  
ATOM 7527  H HB3  . GLN A 1 19 ? 6.193   13.405  -4.463  1.00 0.00 ? 19 GLN A HB3  8  
ATOM 7528  H HG2  . GLN A 1 19 ? 3.831   13.002  -4.369  1.00 0.00 ? 19 GLN A HG2  8  
ATOM 7529  H HG3  . GLN A 1 19 ? 3.545   14.603  -3.689  1.00 0.00 ? 19 GLN A HG3  8  
ATOM 7530  H HE21 . GLN A 1 19 ? 3.978   12.761  -6.524  1.00 0.00 ? 19 GLN A HE21 8  
ATOM 7531  H HE22 . GLN A 1 19 ? 3.852   14.054  -7.663  1.00 0.00 ? 19 GLN A HE22 8  
ATOM 7532  N N    . ASN A 1 20 ? 3.569   14.027  -1.381  1.00 0.00 ? 20 ASN A N    8  
ATOM 7533  C CA   . ASN A 1 20 ? 2.577   14.731  -0.575  1.00 0.00 ? 20 ASN A CA   8  
ATOM 7534  C C    . ASN A 1 20 ? 1.808   13.758  0.313   1.00 0.00 ? 20 ASN A C    8  
ATOM 7535  O O    . ASN A 1 20 ? 1.637   12.590  -0.034  1.00 0.00 ? 20 ASN A O    8  
ATOM 7536  C CB   . ASN A 1 20 ? 1.605   15.494  -1.477  1.00 0.00 ? 20 ASN A CB   8  
ATOM 7537  C CG   . ASN A 1 20 ? 1.317   14.757  -2.771  1.00 0.00 ? 20 ASN A CG   8  
ATOM 7538  O OD1  . ASN A 1 20 ? 1.373   15.338  -3.855  1.00 0.00 ? 20 ASN A OD1  8  
ATOM 7539  N ND2  . ASN A 1 20 ? 1.005   13.471  -2.662  1.00 0.00 ? 20 ASN A ND2  8  
ATOM 7540  H H    . ASN A 1 20 ? 3.313   13.197  -1.835  1.00 0.00 ? 20 ASN A H    8  
ATOM 7541  H HA   . ASN A 1 20 ? 3.101   15.436  0.052   1.00 0.00 ? 20 ASN A HA   8  
ATOM 7542  H HB2  . ASN A 1 20 ? 0.672   15.636  -0.951  1.00 0.00 ? 20 ASN A HB2  8  
ATOM 7543  H HB3  . ASN A 1 20 ? 2.027   16.457  -1.719  1.00 0.00 ? 20 ASN A HB3  8  
ATOM 7544  H HD21 . ASN A 1 20 ? 0.979   13.074  -1.766  1.00 0.00 ? 20 ASN A HD21 8  
ATOM 7545  H HD22 . ASN A 1 20 ? 0.815   12.970  -3.482  1.00 0.00 ? 20 ASN A HD22 8  
ATOM 7546  N N    . GLU A 1 21 ? 1.347   14.249  1.459   1.00 0.00 ? 21 GLU A N    8  
ATOM 7547  C CA   . GLU A 1 21 ? 0.597   13.422  2.396   1.00 0.00 ? 21 GLU A CA   8  
ATOM 7548  C C    . GLU A 1 21 ? -0.380  12.511  1.658   1.00 0.00 ? 21 GLU A C    8  
ATOM 7549  O O    . GLU A 1 21 ? -0.571  11.354  2.032   1.00 0.00 ? 21 GLU A O    8  
ATOM 7550  C CB   . GLU A 1 21 ? -0.163  14.302  3.392   1.00 0.00 ? 21 GLU A CB   8  
ATOM 7551  C CG   . GLU A 1 21 ? 0.711   14.855  4.505   1.00 0.00 ? 21 GLU A CG   8  
ATOM 7552  C CD   . GLU A 1 21 ? -0.084  15.622  5.544   1.00 0.00 ? 21 GLU A CD   8  
ATOM 7553  O OE1  . GLU A 1 21 ? -0.986  16.391  5.152   1.00 0.00 ? 21 GLU A OE1  8  
ATOM 7554  O OE2  . GLU A 1 21 ? 0.196   15.452  6.749   1.00 0.00 ? 21 GLU A OE2  8  
ATOM 7555  H H    . GLU A 1 21 ? 1.517   15.189  1.679   1.00 0.00 ? 21 GLU A H    8  
ATOM 7556  H HA   . GLU A 1 21 ? 1.302   12.810  2.937   1.00 0.00 ? 21 GLU A HA   8  
ATOM 7557  H HB2  . GLU A 1 21 ? -0.601  15.133  2.859   1.00 0.00 ? 21 GLU A HB2  8  
ATOM 7558  H HB3  . GLU A 1 21 ? -0.952  13.717  3.840   1.00 0.00 ? 21 GLU A HB3  8  
ATOM 7559  H HG2  . GLU A 1 21 ? 1.214   14.033  4.993   1.00 0.00 ? 21 GLU A HG2  8  
ATOM 7560  H HG3  . GLU A 1 21 ? 1.445   15.519  4.073   1.00 0.00 ? 21 GLU A HG3  8  
ATOM 7561  N N    . ASP A 1 22 ? -0.995  13.043  0.607   1.00 0.00 ? 22 ASP A N    8  
ATOM 7562  C CA   . ASP A 1 22 ? -1.952  12.279  -0.186  1.00 0.00 ? 22 ASP A CA   8  
ATOM 7563  C C    . ASP A 1 22 ? -1.504  10.827  -0.327  1.00 0.00 ? 22 ASP A C    8  
ATOM 7564  O O    . ASP A 1 22 ? -2.269  9.903   -0.050  1.00 0.00 ? 22 ASP A O    8  
ATOM 7565  C CB   . ASP A 1 22 ? -2.120  12.910  -1.568  1.00 0.00 ? 22 ASP A CB   8  
ATOM 7566  C CG   . ASP A 1 22 ? -2.419  14.395  -1.494  1.00 0.00 ? 22 ASP A CG   8  
ATOM 7567  O OD1  . ASP A 1 22 ? -1.491  15.173  -1.187  1.00 0.00 ? 22 ASP A OD1  8  
ATOM 7568  O OD2  . ASP A 1 22 ? -3.580  14.779  -1.745  1.00 0.00 ? 22 ASP A OD2  8  
ATOM 7569  H H    . ASP A 1 22 ? -0.801  13.971  0.358   1.00 0.00 ? 22 ASP A H    8  
ATOM 7570  H HA   . ASP A 1 22 ? -2.901  12.301  0.328   1.00 0.00 ? 22 ASP A HA   8  
ATOM 7571  H HB2  . ASP A 1 22 ? -1.210  12.773  -2.133  1.00 0.00 ? 22 ASP A HB2  8  
ATOM 7572  H HB3  . ASP A 1 22 ? -2.935  12.423  -2.083  1.00 0.00 ? 22 ASP A HB3  8  
ATOM 7573  N N    . GLU A 1 23 ? -0.262  10.636  -0.760  1.00 0.00 ? 23 GLU A N    8  
ATOM 7574  C CA   . GLU A 1 23 ? 0.285   9.296   -0.939  1.00 0.00 ? 23 GLU A CA   8  
ATOM 7575  C C    . GLU A 1 23 ? 0.804   8.738   0.383   1.00 0.00 ? 23 GLU A C    8  
ATOM 7576  O O    . GLU A 1 23 ? 1.428   9.453   1.169   1.00 0.00 ? 23 GLU A O    8  
ATOM 7577  C CB   . GLU A 1 23 ? 1.412   9.316   -1.974  1.00 0.00 ? 23 GLU A CB   8  
ATOM 7578  C CG   . GLU A 1 23 ? 1.034   10.009  -3.272  1.00 0.00 ? 23 GLU A CG   8  
ATOM 7579  C CD   . GLU A 1 23 ? 2.202   10.125  -4.233  1.00 0.00 ? 23 GLU A CD   8  
ATOM 7580  O OE1  . GLU A 1 23 ? 3.276   10.597  -3.805  1.00 0.00 ? 23 GLU A OE1  8  
ATOM 7581  O OE2  . GLU A 1 23 ? 2.041   9.746   -5.412  1.00 0.00 ? 23 GLU A OE2  8  
ATOM 7582  H H    . GLU A 1 23 ? 0.298   11.413  -0.964  1.00 0.00 ? 23 GLU A H    8  
ATOM 7583  H HA   . GLU A 1 23 ? -0.509  8.659   -1.298  1.00 0.00 ? 23 GLU A HA   8  
ATOM 7584  H HB2  . GLU A 1 23 ? 2.264   9.828   -1.551  1.00 0.00 ? 23 GLU A HB2  8  
ATOM 7585  H HB3  . GLU A 1 23 ? 1.692   8.298   -2.202  1.00 0.00 ? 23 GLU A HB3  8  
ATOM 7586  H HG2  . GLU A 1 23 ? 0.249   9.444   -3.752  1.00 0.00 ? 23 GLU A HG2  8  
ATOM 7587  H HG3  . GLU A 1 23 ? 0.674   11.002  -3.044  1.00 0.00 ? 23 GLU A HG3  8  
ATOM 7588  N N    . LEU A 1 24 ? 0.541   7.459   0.622   1.00 0.00 ? 24 LEU A N    8  
ATOM 7589  C CA   . LEU A 1 24 ? 0.980   6.804   1.850   1.00 0.00 ? 24 LEU A CA   8  
ATOM 7590  C C    . LEU A 1 24 ? 2.439   6.372   1.744   1.00 0.00 ? 24 LEU A C    8  
ATOM 7591  O O    . LEU A 1 24 ? 2.875   5.875   0.707   1.00 0.00 ? 24 LEU A O    8  
ATOM 7592  C CB   . LEU A 1 24 ? 0.098   5.590   2.147   1.00 0.00 ? 24 LEU A CB   8  
ATOM 7593  C CG   . LEU A 1 24 ? 0.106   5.093   3.593   1.00 0.00 ? 24 LEU A CG   8  
ATOM 7594  C CD1  . LEU A 1 24 ? -0.371  6.187   4.537   1.00 0.00 ? 24 LEU A CD1  8  
ATOM 7595  C CD2  . LEU A 1 24 ? -0.760  3.849   3.735   1.00 0.00 ? 24 LEU A CD2  8  
ATOM 7596  H H    . LEU A 1 24 ? 0.040   6.941   -0.041  1.00 0.00 ? 24 LEU A H    8  
ATOM 7597  H HA   . LEU A 1 24 ? 0.885   7.515   2.657   1.00 0.00 ? 24 LEU A HA   8  
ATOM 7598  H HB2  . LEU A 1 24 ? -0.919  5.850   1.893   1.00 0.00 ? 24 LEU A HB2  8  
ATOM 7599  H HB3  . LEU A 1 24 ? 0.429   4.778   1.515   1.00 0.00 ? 24 LEU A HB3  8  
ATOM 7600  H HG   . LEU A 1 24 ? 1.117   4.831   3.872   1.00 0.00 ? 24 LEU A HG   8  
ATOM 7601  H HD11 . LEU A 1 24 ? 0.402   6.932   4.644   1.00 0.00 ? 24 LEU A HD11 8  
ATOM 7602  H HD12 . LEU A 1 24 ? -0.594  5.757   5.502   1.00 0.00 ? 24 LEU A HD12 8  
ATOM 7603  H HD13 . LEU A 1 24 ? -1.262  6.646   4.133   1.00 0.00 ? 24 LEU A HD13 8  
ATOM 7604  H HD21 . LEU A 1 24 ? -1.507  4.016   4.496   1.00 0.00 ? 24 LEU A HD21 8  
ATOM 7605  H HD22 . LEU A 1 24 ? -0.140  3.010   4.016   1.00 0.00 ? 24 LEU A HD22 8  
ATOM 7606  H HD23 . LEU A 1 24 ? -1.245  3.640   2.793   1.00 0.00 ? 24 LEU A HD23 8  
ATOM 7607  N N    . GLU A 1 25 ? 3.187   6.564   2.826   1.00 0.00 ? 25 GLU A N    8  
ATOM 7608  C CA   . GLU A 1 25 ? 4.597   6.193   2.855   1.00 0.00 ? 25 GLU A CA   8  
ATOM 7609  C C    . GLU A 1 25 ? 4.766   4.728   3.248   1.00 0.00 ? 25 GLU A C    8  
ATOM 7610  O O    . GLU A 1 25 ? 4.075   4.228   4.136   1.00 0.00 ? 25 GLU A O    8  
ATOM 7611  C CB   . GLU A 1 25 ? 5.363   7.086   3.833   1.00 0.00 ? 25 GLU A CB   8  
ATOM 7612  C CG   . GLU A 1 25 ? 6.871   7.026   3.659   1.00 0.00 ? 25 GLU A CG   8  
ATOM 7613  C CD   . GLU A 1 25 ? 7.615   7.753   4.763   1.00 0.00 ? 25 GLU A CD   8  
ATOM 7614  O OE1  . GLU A 1 25 ? 7.444   8.984   4.881   1.00 0.00 ? 25 GLU A OE1  8  
ATOM 7615  O OE2  . GLU A 1 25 ? 8.367   7.091   5.508   1.00 0.00 ? 25 GLU A OE2  8  
ATOM 7616  H H    . GLU A 1 25 ? 2.782   6.965   3.623   1.00 0.00 ? 25 GLU A H    8  
ATOM 7617  H HA   . GLU A 1 25 ? 4.998   6.335   1.863   1.00 0.00 ? 25 GLU A HA   8  
ATOM 7618  H HB2  . GLU A 1 25 ? 5.045   8.109   3.692   1.00 0.00 ? 25 GLU A HB2  8  
ATOM 7619  H HB3  . GLU A 1 25 ? 5.126   6.781   4.841   1.00 0.00 ? 25 GLU A HB3  8  
ATOM 7620  H HG2  . GLU A 1 25 ? 7.180   5.991   3.659   1.00 0.00 ? 25 GLU A HG2  8  
ATOM 7621  H HG3  . GLU A 1 25 ? 7.130   7.478   2.713   1.00 0.00 ? 25 GLU A HG3  8  
ATOM 7622  N N    . LEU A 1 26 ? 5.690   4.045   2.580   1.00 0.00 ? 26 LEU A N    8  
ATOM 7623  C CA   . LEU A 1 26 ? 5.950   2.637   2.858   1.00 0.00 ? 26 LEU A CA   8  
ATOM 7624  C C    . LEU A 1 26 ? 7.379   2.435   3.353   1.00 0.00 ? 26 LEU A C    8  
ATOM 7625  O O    . LEU A 1 26 ? 8.164   3.382   3.417   1.00 0.00 ? 26 LEU A O    8  
ATOM 7626  C CB   . LEU A 1 26 ? 5.710   1.796   1.603   1.00 0.00 ? 26 LEU A CB   8  
ATOM 7627  C CG   . LEU A 1 26 ? 4.307   1.878   0.999   1.00 0.00 ? 26 LEU A CG   8  
ATOM 7628  C CD1  . LEU A 1 26 ? 4.288   1.262   -0.391  1.00 0.00 ? 26 LEU A CD1  8  
ATOM 7629  C CD2  . LEU A 1 26 ? 3.296   1.189   1.904   1.00 0.00 ? 26 LEU A CD2  8  
ATOM 7630  H H    . LEU A 1 26 ? 6.209   4.498   1.883   1.00 0.00 ? 26 LEU A H    8  
ATOM 7631  H HA   . LEU A 1 26 ? 5.266   2.320   3.631   1.00 0.00 ? 26 LEU A HA   8  
ATOM 7632  H HB2  . LEU A 1 26 ? 6.413   2.117   0.850   1.00 0.00 ? 26 LEU A HB2  8  
ATOM 7633  H HB3  . LEU A 1 26 ? 5.902   0.763   1.856   1.00 0.00 ? 26 LEU A HB3  8  
ATOM 7634  H HG   . LEU A 1 26 ? 4.022   2.917   0.907   1.00 0.00 ? 26 LEU A HG   8  
ATOM 7635  H HD11 . LEU A 1 26 ? 3.267   1.165   -0.728  1.00 0.00 ? 26 LEU A HD11 8  
ATOM 7636  H HD12 . LEU A 1 26 ? 4.750   0.286   -0.359  1.00 0.00 ? 26 LEU A HD12 8  
ATOM 7637  H HD13 . LEU A 1 26 ? 4.834   1.896   -1.074  1.00 0.00 ? 26 LEU A HD13 8  
ATOM 7638  H HD21 . LEU A 1 26 ? 2.868   0.343   1.387   1.00 0.00 ? 26 LEU A HD21 8  
ATOM 7639  H HD22 . LEU A 1 26 ? 2.512   1.886   2.163   1.00 0.00 ? 26 LEU A HD22 8  
ATOM 7640  H HD23 . LEU A 1 26 ? 3.789   0.851   2.803   1.00 0.00 ? 26 LEU A HD23 8  
ATOM 7641  N N    . ARG A 1 27 ? 7.710   1.196   3.700   1.00 0.00 ? 27 ARG A N    8  
ATOM 7642  C CA   . ARG A 1 27 ? 9.045   0.870   4.188   1.00 0.00 ? 27 ARG A CA   8  
ATOM 7643  C C    . ARG A 1 27 ? 9.378   -0.595  3.921   1.00 0.00 ? 27 ARG A C    8  
ATOM 7644  O O    . ARG A 1 27 ? 8.581   -1.486  4.215   1.00 0.00 ? 27 ARG A O    8  
ATOM 7645  C CB   . ARG A 1 27 ? 9.149   1.163   5.685   1.00 0.00 ? 27 ARG A CB   8  
ATOM 7646  C CG   . ARG A 1 27 ? 10.461  0.711   6.305   1.00 0.00 ? 27 ARG A CG   8  
ATOM 7647  C CD   . ARG A 1 27 ? 11.546  1.763   6.141   1.00 0.00 ? 27 ARG A CD   8  
ATOM 7648  N NE   . ARG A 1 27 ? 12.684  1.519   7.024   1.00 0.00 ? 27 ARG A NE   8  
ATOM 7649  C CZ   . ARG A 1 27 ? 13.672  2.387   7.207   1.00 0.00 ? 27 ARG A CZ   8  
ATOM 7650  N NH1  . ARG A 1 27 ? 13.663  3.551   6.572   1.00 0.00 ? 27 ARG A NH1  8  
ATOM 7651  N NH2  . ARG A 1 27 ? 14.673  2.092   8.027   1.00 0.00 ? 27 ARG A NH2  8  
ATOM 7652  H H    . ARG A 1 27 ? 7.041   0.484   3.626   1.00 0.00 ? 27 ARG A H    8  
ATOM 7653  H HA   . ARG A 1 27 ? 9.752   1.490   3.658   1.00 0.00 ? 27 ARG A HA   8  
ATOM 7654  H HB2  . ARG A 1 27 ? 9.052   2.228   5.840   1.00 0.00 ? 27 ARG A HB2  8  
ATOM 7655  H HB3  . ARG A 1 27 ? 8.342   0.658   6.195   1.00 0.00 ? 27 ARG A HB3  8  
ATOM 7656  H HG2  . ARG A 1 27 ? 10.308  0.528   7.358   1.00 0.00 ? 27 ARG A HG2  8  
ATOM 7657  H HG3  . ARG A 1 27 ? 10.780  -0.201  5.822   1.00 0.00 ? 27 ARG A HG3  8  
ATOM 7658  H HD2  . ARG A 1 27 ? 11.889  1.752   5.117   1.00 0.00 ? 27 ARG A HD2  8  
ATOM 7659  H HD3  . ARG A 1 27 ? 11.127  2.732   6.370   1.00 0.00 ? 27 ARG A HD3  8  
ATOM 7660  H HE   . ARG A 1 27 ? 12.711  0.665   7.503   1.00 0.00 ? 27 ARG A HE   8  
ATOM 7661  H HH11 . ARG A 1 27 ? 12.909  3.776   5.955   1.00 0.00 ? 27 ARG A HH11 8  
ATOM 7662  H HH12 . ARG A 1 27 ? 14.407  4.203   6.713   1.00 0.00 ? 27 ARG A HH12 8  
ATOM 7663  H HH21 . ARG A 1 27 ? 14.683  1.216   8.508   1.00 0.00 ? 27 ARG A HH21 8  
ATOM 7664  H HH22 . ARG A 1 27 ? 15.416  2.746   8.164   1.00 0.00 ? 27 ARG A HH22 8  
ATOM 7665  N N    . GLU A 1 28 ? 10.560  -0.836  3.362   1.00 0.00 ? 28 GLU A N    8  
ATOM 7666  C CA   . GLU A 1 28 ? 10.997  -2.192  3.054   1.00 0.00 ? 28 GLU A CA   8  
ATOM 7667  C C    . GLU A 1 28 ? 10.862  -3.097  4.276   1.00 0.00 ? 28 GLU A C    8  
ATOM 7668  O O    . GLU A 1 28 ? 11.652  -3.014  5.214   1.00 0.00 ? 28 GLU A O    8  
ATOM 7669  C CB   . GLU A 1 28 ? 12.448  -2.187  2.568   1.00 0.00 ? 28 GLU A CB   8  
ATOM 7670  C CG   . GLU A 1 28 ? 12.955  -3.557  2.150   1.00 0.00 ? 28 GLU A CG   8  
ATOM 7671  C CD   . GLU A 1 28 ? 14.467  -3.662  2.209   1.00 0.00 ? 28 GLU A CD   8  
ATOM 7672  O OE1  . GLU A 1 28 ? 15.024  -3.603  3.325   1.00 0.00 ? 28 GLU A OE1  8  
ATOM 7673  O OE2  . GLU A 1 28 ? 15.093  -3.803  1.137   1.00 0.00 ? 28 GLU A OE2  8  
ATOM 7674  H H    . GLU A 1 28 ? 11.151  -0.083  3.151   1.00 0.00 ? 28 GLU A H    8  
ATOM 7675  H HA   . GLU A 1 28 ? 10.365  -2.574  2.267   1.00 0.00 ? 28 GLU A HA   8  
ATOM 7676  H HB2  . GLU A 1 28 ? 12.529  -1.521  1.721   1.00 0.00 ? 28 GLU A HB2  8  
ATOM 7677  H HB3  . GLU A 1 28 ? 13.080  -1.820  3.364   1.00 0.00 ? 28 GLU A HB3  8  
ATOM 7678  H HG2  . GLU A 1 28 ? 12.533  -4.300  2.810   1.00 0.00 ? 28 GLU A HG2  8  
ATOM 7679  H HG3  . GLU A 1 28 ? 12.634  -3.752  1.138   1.00 0.00 ? 28 GLU A HG3  8  
ATOM 7680  N N    . GLY A 1 29 ? 9.852   -3.963  4.255   1.00 0.00 ? 29 GLY A N    8  
ATOM 7681  C CA   . GLY A 1 29 ? 9.631   -4.870  5.365   1.00 0.00 ? 29 GLY A CA   8  
ATOM 7682  C C    . GLY A 1 29 ? 8.607   -4.342  6.350   1.00 0.00 ? 29 GLY A C    8  
ATOM 7683  O O    . GLY A 1 29 ? 8.726   -4.559  7.556   1.00 0.00 ? 29 GLY A O    8  
ATOM 7684  H H    . GLY A 1 29 ? 9.254   -3.985  3.479   1.00 0.00 ? 29 GLY A H    8  
ATOM 7685  H HA2  . GLY A 1 29 ? 9.287   -5.818  4.978   1.00 0.00 ? 29 GLY A HA2  8  
ATOM 7686  H HA3  . GLY A 1 29 ? 10.566  -5.022  5.883   1.00 0.00 ? 29 GLY A HA3  8  
ATOM 7687  N N    . ASP A 1 30 ? 7.599   -3.646  5.837   1.00 0.00 ? 30 ASP A N    8  
ATOM 7688  C CA   . ASP A 1 30 ? 6.550   -3.084  6.680   1.00 0.00 ? 30 ASP A CA   8  
ATOM 7689  C C    . ASP A 1 30 ? 5.176   -3.579  6.240   1.00 0.00 ? 30 ASP A C    8  
ATOM 7690  O O    . ASP A 1 30 ? 4.907   -3.713  5.046   1.00 0.00 ? 30 ASP A O    8  
ATOM 7691  C CB   . ASP A 1 30 ? 6.594   -1.556  6.636   1.00 0.00 ? 30 ASP A CB   8  
ATOM 7692  C CG   . ASP A 1 30 ? 7.515   -0.972  7.689   1.00 0.00 ? 30 ASP A CG   8  
ATOM 7693  O OD1  . ASP A 1 30 ? 8.689   -1.395  7.750   1.00 0.00 ? 30 ASP A OD1  8  
ATOM 7694  O OD2  . ASP A 1 30 ? 7.063   -0.093  8.451   1.00 0.00 ? 30 ASP A OD2  8  
ATOM 7695  H H    . ASP A 1 30 ? 7.559   -3.507  4.867   1.00 0.00 ? 30 ASP A H    8  
ATOM 7696  H HA   . ASP A 1 30 ? 6.728   -3.411  7.693   1.00 0.00 ? 30 ASP A HA   8  
ATOM 7697  H HB2  . ASP A 1 30 ? 6.944   -1.240  5.663   1.00 0.00 ? 30 ASP A HB2  8  
ATOM 7698  H HB3  . ASP A 1 30 ? 5.599   -1.169  6.799   1.00 0.00 ? 30 ASP A HB3  8  
ATOM 7699  N N    . ARG A 1 31 ? 4.310   -3.849  7.211   1.00 0.00 ? 31 ARG A N    8  
ATOM 7700  C CA   . ARG A 1 31 ? 2.965   -4.331  6.924   1.00 0.00 ? 31 ARG A CA   8  
ATOM 7701  C C    . ARG A 1 31 ? 2.055   -3.183  6.499   1.00 0.00 ? 31 ARG A C    8  
ATOM 7702  O O    . ARG A 1 31 ? 2.188   -2.059  6.984   1.00 0.00 ? 31 ARG A O    8  
ATOM 7703  C CB   . ARG A 1 31 ? 2.379   -5.033  8.150   1.00 0.00 ? 31 ARG A CB   8  
ATOM 7704  C CG   . ARG A 1 31 ? 2.673   -6.523  8.198   1.00 0.00 ? 31 ARG A CG   8  
ATOM 7705  C CD   . ARG A 1 31 ? 4.135   -6.812  7.892   1.00 0.00 ? 31 ARG A CD   8  
ATOM 7706  N NE   . ARG A 1 31 ? 5.008   -6.457  9.007   1.00 0.00 ? 31 ARG A NE   8  
ATOM 7707  C CZ   . ARG A 1 31 ? 6.220   -6.972  9.184   1.00 0.00 ? 31 ARG A CZ   8  
ATOM 7708  N NH1  . ARG A 1 31 ? 6.699   -7.859  8.323   1.00 0.00 ? 31 ARG A NH1  8  
ATOM 7709  N NH2  . ARG A 1 31 ? 6.955   -6.598  10.223  1.00 0.00 ? 31 ARG A NH2  8  
ATOM 7710  H H    . ARG A 1 31 ? 4.583   -3.722  8.144   1.00 0.00 ? 31 ARG A H    8  
ATOM 7711  H HA   . ARG A 1 31 ? 3.033   -5.040  6.113   1.00 0.00 ? 31 ARG A HA   8  
ATOM 7712  H HB2  . ARG A 1 31 ? 2.788   -4.579  9.041   1.00 0.00 ? 31 ARG A HB2  8  
ATOM 7713  H HB3  . ARG A 1 31 ? 1.307   -4.900  8.149   1.00 0.00 ? 31 ARG A HB3  8  
ATOM 7714  H HG2  . ARG A 1 31 ? 2.444   -6.895  9.186   1.00 0.00 ? 31 ARG A HG2  8  
ATOM 7715  H HG3  . ARG A 1 31 ? 2.055   -7.026  7.470   1.00 0.00 ? 31 ARG A HG3  8  
ATOM 7716  H HD2  . ARG A 1 31 ? 4.243   -7.866  7.684   1.00 0.00 ? 31 ARG A HD2  8  
ATOM 7717  H HD3  . ARG A 1 31 ? 4.426   -6.242  7.023   1.00 0.00 ? 31 ARG A HD3  8  
ATOM 7718  H HE   . ARG A 1 31 ? 4.674   -5.803  9.655   1.00 0.00 ? 31 ARG A HE   8  
ATOM 7719  H HH11 . ARG A 1 31 ? 6.148   -8.141  7.539   1.00 0.00 ? 31 ARG A HH11 8  
ATOM 7720  H HH12 . ARG A 1 31 ? 7.613   -8.244  8.458   1.00 0.00 ? 31 ARG A HH12 8  
ATOM 7721  H HH21 . ARG A 1 31 ? 6.597   -5.929  10.874  1.00 0.00 ? 31 ARG A HH21 8  
ATOM 7722  H HH22 . ARG A 1 31 ? 7.867   -6.986  10.356  1.00 0.00 ? 31 ARG A HH22 8  
ATOM 7723  N N    . VAL A 1 32 ? 1.131   -3.472  5.588   1.00 0.00 ? 32 VAL A N    8  
ATOM 7724  C CA   . VAL A 1 32 ? 0.198   -2.464  5.098   1.00 0.00 ? 32 VAL A CA   8  
ATOM 7725  C C    . VAL A 1 32 ? -1.235  -2.982  5.124   1.00 0.00 ? 32 VAL A C    8  
ATOM 7726  O O    . VAL A 1 32 ? -1.475  -4.182  4.989   1.00 0.00 ? 32 VAL A O    8  
ATOM 7727  C CB   . VAL A 1 32 ? 0.548   -2.027  3.663   1.00 0.00 ? 32 VAL A CB   8  
ATOM 7728  C CG1  . VAL A 1 32 ? -0.276  -0.814  3.258   1.00 0.00 ? 32 VAL A CG1  8  
ATOM 7729  C CG2  . VAL A 1 32 ? 2.036   -1.736  3.543   1.00 0.00 ? 32 VAL A CG2  8  
ATOM 7730  H H    . VAL A 1 32 ? 1.074   -4.386  5.239   1.00 0.00 ? 32 VAL A H    8  
ATOM 7731  H HA   . VAL A 1 32 ? 0.271   -1.601  5.742   1.00 0.00 ? 32 VAL A HA   8  
ATOM 7732  H HB   . VAL A 1 32 ? 0.307   -2.839  2.992   1.00 0.00 ? 32 VAL A HB   8  
ATOM 7733  H HG11 . VAL A 1 32 ? -0.346  -0.133  4.093   1.00 0.00 ? 32 VAL A HG11 8  
ATOM 7734  H HG12 . VAL A 1 32 ? 0.200   -0.318  2.425   1.00 0.00 ? 32 VAL A HG12 8  
ATOM 7735  H HG13 . VAL A 1 32 ? -1.267  -1.133  2.970   1.00 0.00 ? 32 VAL A HG13 8  
ATOM 7736  H HG21 . VAL A 1 32 ? 2.580   -2.349  4.246   1.00 0.00 ? 32 VAL A HG21 8  
ATOM 7737  H HG22 . VAL A 1 32 ? 2.368   -1.959  2.539   1.00 0.00 ? 32 VAL A HG22 8  
ATOM 7738  H HG23 . VAL A 1 32 ? 2.218   -0.693  3.758   1.00 0.00 ? 32 VAL A HG23 8  
ATOM 7739  N N    . ASP A 1 33 ? -2.185  -2.070  5.300   1.00 0.00 ? 33 ASP A N    8  
ATOM 7740  C CA   . ASP A 1 33 ? -3.596  -2.434  5.343   1.00 0.00 ? 33 ASP A CA   8  
ATOM 7741  C C    . ASP A 1 33 ? -4.330  -1.910  4.113   1.00 0.00 ? 33 ASP A C    8  
ATOM 7742  O O    . ASP A 1 33 ? -4.794  -0.770  4.093   1.00 0.00 ? 33 ASP A O    8  
ATOM 7743  C CB   . ASP A 1 33 ? -4.248  -1.886  6.613   1.00 0.00 ? 33 ASP A CB   8  
ATOM 7744  C CG   . ASP A 1 33 ? -5.406  -2.743  7.085   1.00 0.00 ? 33 ASP A CG   8  
ATOM 7745  O OD1  . ASP A 1 33 ? -5.170  -3.915  7.447   1.00 0.00 ? 33 ASP A OD1  8  
ATOM 7746  O OD2  . ASP A 1 33 ? -6.550  -2.241  7.094   1.00 0.00 ? 33 ASP A OD2  8  
ATOM 7747  H H    . ASP A 1 33 ? -1.930  -1.129  5.402   1.00 0.00 ? 33 ASP A H    8  
ATOM 7748  H HA   . ASP A 1 33 ? -3.661  -3.512  5.352   1.00 0.00 ? 33 ASP A HA   8  
ATOM 7749  H HB2  . ASP A 1 33 ? -3.509  -1.847  7.401   1.00 0.00 ? 33 ASP A HB2  8  
ATOM 7750  H HB3  . ASP A 1 33 ? -4.615  -0.889  6.420   1.00 0.00 ? 33 ASP A HB3  8  
ATOM 7751  N N    . VAL A 1 34 ? -4.431  -2.749  3.087   1.00 0.00 ? 34 VAL A N    8  
ATOM 7752  C CA   . VAL A 1 34 ? -5.109  -2.370  1.853   1.00 0.00 ? 34 VAL A CA   8  
ATOM 7753  C C    . VAL A 1 34 ? -6.620  -2.519  1.987   1.00 0.00 ? 34 VAL A C    8  
ATOM 7754  O O    . VAL A 1 34 ? -7.113  -3.540  2.466   1.00 0.00 ? 34 VAL A O    8  
ATOM 7755  C CB   . VAL A 1 34 ? -4.624  -3.220  0.663   1.00 0.00 ? 34 VAL A CB   8  
ATOM 7756  C CG1  . VAL A 1 34 ? -5.583  -3.091  -0.511  1.00 0.00 ? 34 VAL A CG1  8  
ATOM 7757  C CG2  . VAL A 1 34 ? -3.215  -2.816  0.258   1.00 0.00 ? 34 VAL A CG2  8  
ATOM 7758  H H    . VAL A 1 34 ? -4.041  -3.645  3.162   1.00 0.00 ? 34 VAL A H    8  
ATOM 7759  H HA   . VAL A 1 34 ? -4.875  -1.336  1.647   1.00 0.00 ? 34 VAL A HA   8  
ATOM 7760  H HB   . VAL A 1 34 ? -4.605  -4.256  0.971   1.00 0.00 ? 34 VAL A HB   8  
ATOM 7761  H HG11 . VAL A 1 34 ? -6.273  -2.281  -0.324  1.00 0.00 ? 34 VAL A HG11 8  
ATOM 7762  H HG12 . VAL A 1 34 ? -5.023  -2.888  -1.413  1.00 0.00 ? 34 VAL A HG12 8  
ATOM 7763  H HG13 . VAL A 1 34 ? -6.134  -4.012  -0.629  1.00 0.00 ? 34 VAL A HG13 8  
ATOM 7764  H HG21 . VAL A 1 34 ? -3.058  -1.775  0.496   1.00 0.00 ? 34 VAL A HG21 8  
ATOM 7765  H HG22 . VAL A 1 34 ? -2.498  -3.420  0.796   1.00 0.00 ? 34 VAL A HG22 8  
ATOM 7766  H HG23 . VAL A 1 34 ? -3.087  -2.967  -0.803  1.00 0.00 ? 34 VAL A HG23 8  
ATOM 7767  N N    . MET A 1 35 ? -7.350  -1.493  1.562   1.00 0.00 ? 35 MET A N    8  
ATOM 7768  C CA   . MET A 1 35 ? -8.806  -1.510  1.634   1.00 0.00 ? 35 MET A CA   8  
ATOM 7769  C C    . MET A 1 35 ? -9.419  -1.567  0.238   1.00 0.00 ? 35 MET A C    8  
ATOM 7770  O O    . MET A 1 35 ? -10.240 -2.435  -0.053  1.00 0.00 ? 35 MET A O    8  
ATOM 7771  C CB   . MET A 1 35 ? -9.316  -0.274  2.378   1.00 0.00 ? 35 MET A CB   8  
ATOM 7772  C CG   . MET A 1 35 ? -9.156  -0.364  3.887   1.00 0.00 ? 35 MET A CG   8  
ATOM 7773  S SD   . MET A 1 35 ? -9.762  1.106   4.738   1.00 0.00 ? 35 MET A SD   8  
ATOM 7774  C CE   . MET A 1 35 ? -8.590  1.223   6.087   1.00 0.00 ? 35 MET A CE   8  
ATOM 7775  H H    . MET A 1 35 ? -6.899  -0.706  1.191   1.00 0.00 ? 35 MET A H    8  
ATOM 7776  H HA   . MET A 1 35 ? -9.100  -2.394  2.180   1.00 0.00 ? 35 MET A HA   8  
ATOM 7777  H HB2  . MET A 1 35 ? -8.771  0.591   2.030   1.00 0.00 ? 35 MET A HB2  8  
ATOM 7778  H HB3  . MET A 1 35 ? -10.365 -0.142  2.156   1.00 0.00 ? 35 MET A HB3  8  
ATOM 7779  H HG2  . MET A 1 35 ? -9.707  -1.221  4.244   1.00 0.00 ? 35 MET A HG2  8  
ATOM 7780  H HG3  . MET A 1 35 ? -8.108  -0.490  4.116   1.00 0.00 ? 35 MET A HG3  8  
ATOM 7781  H HE1  . MET A 1 35 ? -8.846  0.503   6.850   1.00 0.00 ? 35 MET A HE1  8  
ATOM 7782  H HE2  . MET A 1 35 ? -7.595  1.019   5.719   1.00 0.00 ? 35 MET A HE2  8  
ATOM 7783  H HE3  . MET A 1 35 ? -8.622  2.218   6.507   1.00 0.00 ? 35 MET A HE3  8  
ATOM 7784  N N    . GLN A 1 36 ? -9.014  -0.636  -0.619  1.00 0.00 ? 36 GLN A N    8  
ATOM 7785  C CA   . GLN A 1 36 ? -9.524  -0.580  -1.984  1.00 0.00 ? 36 GLN A CA   8  
ATOM 7786  C C    . GLN A 1 36 ? -8.422  -0.890  -2.991  1.00 0.00 ? 36 GLN A C    8  
ATOM 7787  O O    . GLN A 1 36 ? -7.247  -0.623  -2.739  1.00 0.00 ? 36 GLN A O    8  
ATOM 7788  C CB   . GLN A 1 36 ? -10.122 0.798   -2.272  1.00 0.00 ? 36 GLN A CB   8  
ATOM 7789  C CG   . GLN A 1 36 ? -10.402 1.044   -3.745  1.00 0.00 ? 36 GLN A CG   8  
ATOM 7790  C CD   . GLN A 1 36 ? -10.589 2.514   -4.067  1.00 0.00 ? 36 GLN A CD   8  
ATOM 7791  O OE1  . GLN A 1 36 ? -10.559 3.364   -3.177  1.00 0.00 ? 36 GLN A OE1  8  
ATOM 7792  N NE2  . GLN A 1 36 ? -10.783 2.821   -5.344  1.00 0.00 ? 36 GLN A NE2  8  
ATOM 7793  H H    . GLN A 1 36 ? -8.357  0.030   -0.327  1.00 0.00 ? 36 GLN A H    8  
ATOM 7794  H HA   . GLN A 1 36 ? -10.300 -1.325  -2.078  1.00 0.00 ? 36 GLN A HA   8  
ATOM 7795  H HB2  . GLN A 1 36 ? -11.051 0.895   -1.730  1.00 0.00 ? 36 GLN A HB2  8  
ATOM 7796  H HB3  . GLN A 1 36 ? -9.433  1.555   -1.927  1.00 0.00 ? 36 GLN A HB3  8  
ATOM 7797  H HG2  . GLN A 1 36 ? -9.571  0.668   -4.324  1.00 0.00 ? 36 GLN A HG2  8  
ATOM 7798  H HG3  . GLN A 1 36 ? -11.301 0.513   -4.021  1.00 0.00 ? 36 GLN A HG3  8  
ATOM 7799  H HE21 . GLN A 1 36 ? -10.795 2.091   -5.998  1.00 0.00 ? 36 GLN A HE21 8  
ATOM 7800  H HE22 . GLN A 1 36 ? -10.907 3.763   -5.580  1.00 0.00 ? 36 GLN A HE22 8  
ATOM 7801  N N    . GLN A 1 37 ? -8.809  -1.454  -4.130  1.00 0.00 ? 37 GLN A N    8  
ATOM 7802  C CA   . GLN A 1 37 ? -7.852  -1.801  -5.174  1.00 0.00 ? 37 GLN A CA   8  
ATOM 7803  C C    . GLN A 1 37 ? -8.205  -1.111  -6.487  1.00 0.00 ? 37 GLN A C    8  
ATOM 7804  O O    . GLN A 1 37 ? -9.327  -1.231  -6.981  1.00 0.00 ? 37 GLN A O    8  
ATOM 7805  C CB   . GLN A 1 37 ? -7.812  -3.317  -5.376  1.00 0.00 ? 37 GLN A CB   8  
ATOM 7806  C CG   . GLN A 1 37 ? -7.700  -4.100  -4.078  1.00 0.00 ? 37 GLN A CG   8  
ATOM 7807  C CD   . GLN A 1 37 ? -7.257  -5.533  -4.297  1.00 0.00 ? 37 GLN A CD   8  
ATOM 7808  O OE1  . GLN A 1 37 ? -6.600  -5.847  -5.290  1.00 0.00 ? 37 GLN A OE1  8  
ATOM 7809  N NE2  . GLN A 1 37 ? -7.615  -6.413  -3.369  1.00 0.00 ? 37 GLN A NE2  8  
ATOM 7810  H H    . GLN A 1 37 ? -9.760  -1.642  -4.272  1.00 0.00 ? 37 GLN A H    8  
ATOM 7811  H HA   . GLN A 1 37 ? -6.877  -1.464  -4.856  1.00 0.00 ? 37 GLN A HA   8  
ATOM 7812  H HB2  . GLN A 1 37 ? -8.715  -3.625  -5.881  1.00 0.00 ? 37 GLN A HB2  8  
ATOM 7813  H HB3  . GLN A 1 37 ? -6.961  -3.563  -5.994  1.00 0.00 ? 37 GLN A HB3  8  
ATOM 7814  H HG2  . GLN A 1 37 ? -6.980  -3.612  -3.438  1.00 0.00 ? 37 GLN A HG2  8  
ATOM 7815  H HG3  . GLN A 1 37 ? -8.665  -4.107  -3.593  1.00 0.00 ? 37 GLN A HG3  8  
ATOM 7816  H HE21 . GLN A 1 37 ? -8.139  -6.091  -2.605  1.00 0.00 ? 37 GLN A HE21 8  
ATOM 7817  H HE22 . GLN A 1 37 ? -7.342  -7.346  -3.486  1.00 0.00 ? 37 GLN A HE22 8  
ATOM 7818  N N    . CYS A 1 38 ? -7.242  -0.388  -7.048  1.00 0.00 ? 38 CYS A N    8  
ATOM 7819  C CA   . CYS A 1 38 ? -7.452  0.323   -8.304  1.00 0.00 ? 38 CYS A CA   8  
ATOM 7820  C C    . CYS A 1 38 ? -7.200  -0.594  -9.496  1.00 0.00 ? 38 CYS A C    8  
ATOM 7821  O O    . CYS A 1 38 ? -6.434  -1.554  -9.404  1.00 0.00 ? 38 CYS A O    8  
ATOM 7822  C CB   . CYS A 1 38 ? -6.535  1.544   -8.382  1.00 0.00 ? 38 CYS A CB   8  
ATOM 7823  S SG   . CYS A 1 38 ? -6.943  2.690   -9.721  1.00 0.00 ? 38 CYS A SG   8  
ATOM 7824  H H    . CYS A 1 38 ? -6.369  -0.330  -6.607  1.00 0.00 ? 38 CYS A H    8  
ATOM 7825  H HA   . CYS A 1 38 ? -8.479  0.652   -8.330  1.00 0.00 ? 38 CYS A HA   8  
ATOM 7826  H HB2  . CYS A 1 38 ? -6.596  2.091   -7.453  1.00 0.00 ? 38 CYS A HB2  8  
ATOM 7827  H HB3  . CYS A 1 38 ? -5.518  1.213   -8.530  1.00 0.00 ? 38 CYS A HB3  8  
ATOM 7828  H HG   . CYS A 1 38 ? -5.919  3.514   -9.879  1.00 0.00 ? 38 CYS A HG   8  
ATOM 7829  N N    . ASP A 1 39 ? -7.851  -0.294  -10.615 1.00 0.00 ? 39 ASP A N    8  
ATOM 7830  C CA   . ASP A 1 39 ? -7.698  -1.091  -11.826 1.00 0.00 ? 39 ASP A CA   8  
ATOM 7831  C C    . ASP A 1 39 ? -6.391  -0.756  -12.536 1.00 0.00 ? 39 ASP A C    8  
ATOM 7832  O O    . ASP A 1 39 ? -5.784  -1.614  -13.178 1.00 0.00 ? 39 ASP A O    8  
ATOM 7833  C CB   . ASP A 1 39 ? -8.880  -0.857  -12.769 1.00 0.00 ? 39 ASP A CB   8  
ATOM 7834  C CG   . ASP A 1 39 ? -8.578  -1.283  -14.192 1.00 0.00 ? 39 ASP A CG   8  
ATOM 7835  O OD1  . ASP A 1 39 ? -8.299  -2.481  -14.405 1.00 0.00 ? 39 ASP A OD1  8  
ATOM 7836  O OD2  . ASP A 1 39 ? -8.621  -0.419  -15.092 1.00 0.00 ? 39 ASP A OD2  8  
ATOM 7837  H H    . ASP A 1 39 ? -8.448  0.484   -10.626 1.00 0.00 ? 39 ASP A H    8  
ATOM 7838  H HA   . ASP A 1 39 ? -7.681  -2.132  -11.538 1.00 0.00 ? 39 ASP A HA   8  
ATOM 7839  H HB2  . ASP A 1 39 ? -9.731  -1.422  -12.416 1.00 0.00 ? 39 ASP A HB2  8  
ATOM 7840  H HB3  . ASP A 1 39 ? -9.127  0.194   -12.771 1.00 0.00 ? 39 ASP A HB3  8  
ATOM 7841  N N    . ASP A 1 40 ? -5.963  0.496   -12.418 1.00 0.00 ? 40 ASP A N    8  
ATOM 7842  C CA   . ASP A 1 40 ? -4.728  0.945   -13.049 1.00 0.00 ? 40 ASP A CA   8  
ATOM 7843  C C    . ASP A 1 40 ? -3.538  0.128   -12.556 1.00 0.00 ? 40 ASP A C    8  
ATOM 7844  O O    . ASP A 1 40 ? -2.583  -0.107  -13.295 1.00 0.00 ? 40 ASP A O    8  
ATOM 7845  C CB   . ASP A 1 40 ? -4.496  2.430   -12.766 1.00 0.00 ? 40 ASP A CB   8  
ATOM 7846  C CG   . ASP A 1 40 ? -5.524  3.316   -13.441 1.00 0.00 ? 40 ASP A CG   8  
ATOM 7847  O OD1  . ASP A 1 40 ? -6.716  3.218   -13.085 1.00 0.00 ? 40 ASP A OD1  8  
ATOM 7848  O OD2  . ASP A 1 40 ? -5.136  4.107   -14.327 1.00 0.00 ? 40 ASP A OD2  8  
ATOM 7849  H H    . ASP A 1 40 ? -6.492  1.134   -11.894 1.00 0.00 ? 40 ASP A H    8  
ATOM 7850  H HA   . ASP A 1 40 ? -4.829  0.803   -14.115 1.00 0.00 ? 40 ASP A HA   8  
ATOM 7851  H HB2  . ASP A 1 40 ? -4.547  2.599   -11.700 1.00 0.00 ? 40 ASP A HB2  8  
ATOM 7852  H HB3  . ASP A 1 40 ? -3.515  2.709   -13.123 1.00 0.00 ? 40 ASP A HB3  8  
ATOM 7853  N N    . GLY A 1 41 ? -3.601  -0.301  -11.299 1.00 0.00 ? 41 GLY A N    8  
ATOM 7854  C CA   . GLY A 1 41 ? -2.523  -1.086  -10.727 1.00 0.00 ? 41 GLY A CA   8  
ATOM 7855  C C    . GLY A 1 41 ? -2.007  -0.502  -9.427  1.00 0.00 ? 41 GLY A C    8  
ATOM 7856  O O    . GLY A 1 41 ? -0.849  -0.708  -9.063  1.00 0.00 ? 41 GLY A O    8  
ATOM 7857  H H    . GLY A 1 41 ? -4.387  -0.083  -10.755 1.00 0.00 ? 41 GLY A H    8  
ATOM 7858  H HA2  . GLY A 1 41 ? -2.879  -2.088  -10.544 1.00 0.00 ? 41 GLY A HA2  8  
ATOM 7859  H HA3  . GLY A 1 41 ? -1.709  -1.129  -11.437 1.00 0.00 ? 41 GLY A HA3  8  
ATOM 7860  N N    . TRP A 1 42 ? -2.867  0.228   -8.726  1.00 0.00 ? 42 TRP A N    8  
ATOM 7861  C CA   . TRP A 1 42 ? -2.491  0.845   -7.459  1.00 0.00 ? 42 TRP A CA   8  
ATOM 7862  C C    . TRP A 1 42 ? -3.394  0.363   -6.330  1.00 0.00 ? 42 TRP A C    8  
ATOM 7863  O O    . TRP A 1 42 ? -4.502  -0.116  -6.570  1.00 0.00 ? 42 TRP A O    8  
ATOM 7864  C CB   . TRP A 1 42 ? -2.561  2.369   -7.570  1.00 0.00 ? 42 TRP A CB   8  
ATOM 7865  C CG   . TRP A 1 42 ? -1.310  2.983   -8.123  1.00 0.00 ? 42 TRP A CG   8  
ATOM 7866  C CD1  . TRP A 1 42 ? -0.674  2.643   -9.283  1.00 0.00 ? 42 TRP A CD1  8  
ATOM 7867  C CD2  . TRP A 1 42 ? -0.544  4.041   -7.538  1.00 0.00 ? 42 TRP A CD2  8  
ATOM 7868  N NE1  . TRP A 1 42 ? 0.441   3.427   -9.454  1.00 0.00 ? 42 TRP A NE1  8  
ATOM 7869  C CE2  . TRP A 1 42 ? 0.543   4.293   -8.398  1.00 0.00 ? 42 TRP A CE2  8  
ATOM 7870  C CE3  . TRP A 1 42 ? -0.671  4.802   -6.373  1.00 0.00 ? 42 TRP A CE3  8  
ATOM 7871  C CZ2  . TRP A 1 42 ? 1.495   5.272   -8.127  1.00 0.00 ? 42 TRP A CZ2  8  
ATOM 7872  C CZ3  . TRP A 1 42 ? 0.275   5.773   -6.105  1.00 0.00 ? 42 TRP A CZ3  8  
ATOM 7873  C CH2  . TRP A 1 42 ? 1.346   6.001   -6.979  1.00 0.00 ? 42 TRP A CH2  8  
ATOM 7874  H H    . TRP A 1 42 ? -3.776  0.356   -9.069  1.00 0.00 ? 42 TRP A H    8  
ATOM 7875  H HA   . TRP A 1 42 ? -1.473  0.556   -7.240  1.00 0.00 ? 42 TRP A HA   8  
ATOM 7876  H HB2  . TRP A 1 42 ? -3.380  2.639   -8.219  1.00 0.00 ? 42 TRP A HB2  8  
ATOM 7877  H HB3  . TRP A 1 42 ? -2.732  2.786   -6.588  1.00 0.00 ? 42 TRP A HB3  8  
ATOM 7878  H HD1  . TRP A 1 42 ? -1.010  1.869   -9.956  1.00 0.00 ? 42 TRP A HD1  8  
ATOM 7879  H HE1  . TRP A 1 42 ? 1.062   3.375   -10.211 1.00 0.00 ? 42 TRP A HE1  8  
ATOM 7880  H HE3  . TRP A 1 42 ? -1.489  4.640   -5.687  1.00 0.00 ? 42 TRP A HE3  8  
ATOM 7881  H HZ2  . TRP A 1 42 ? 2.326   5.461   -8.790  1.00 0.00 ? 42 TRP A HZ2  8  
ATOM 7882  H HZ3  . TRP A 1 42 ? 0.194   6.370   -5.208  1.00 0.00 ? 42 TRP A HZ3  8  
ATOM 7883  H HH2  . TRP A 1 42 ? 2.062   6.770   -6.729  1.00 0.00 ? 42 TRP A HH2  8  
ATOM 7884  N N    . PHE A 1 43 ? -2.913  0.492   -5.097  1.00 0.00 ? 43 PHE A N    8  
ATOM 7885  C CA   . PHE A 1 43 ? -3.678  0.069   -3.930  1.00 0.00 ? 43 PHE A CA   8  
ATOM 7886  C C    . PHE A 1 43 ? -3.899  1.235   -2.972  1.00 0.00 ? 43 PHE A C    8  
ATOM 7887  O O    . PHE A 1 43 ? -3.019  2.075   -2.786  1.00 0.00 ? 43 PHE A O    8  
ATOM 7888  C CB   . PHE A 1 43 ? -2.956  -1.070  -3.207  1.00 0.00 ? 43 PHE A CB   8  
ATOM 7889  C CG   . PHE A 1 43 ? -2.916  -2.350  -3.993  1.00 0.00 ? 43 PHE A CG   8  
ATOM 7890  C CD1  . PHE A 1 43 ? -4.047  -2.810  -4.649  1.00 0.00 ? 43 PHE A CD1  8  
ATOM 7891  C CD2  . PHE A 1 43 ? -1.749  -3.092  -4.076  1.00 0.00 ? 43 PHE A CD2  8  
ATOM 7892  C CE1  . PHE A 1 43 ? -4.013  -3.987  -5.374  1.00 0.00 ? 43 PHE A CE1  8  
ATOM 7893  C CE2  . PHE A 1 43 ? -1.710  -4.269  -4.799  1.00 0.00 ? 43 PHE A CE2  8  
ATOM 7894  C CZ   . PHE A 1 43 ? -2.844  -4.718  -5.448  1.00 0.00 ? 43 PHE A CZ   8  
ATOM 7895  H H    . PHE A 1 43 ? -2.022  0.881   -4.970  1.00 0.00 ? 43 PHE A H    8  
ATOM 7896  H HA   . PHE A 1 43 ? -4.637  -0.286  -4.274  1.00 0.00 ? 43 PHE A HA   8  
ATOM 7897  H HB2  . PHE A 1 43 ? -1.938  -0.773  -3.008  1.00 0.00 ? 43 PHE A HB2  8  
ATOM 7898  H HB3  . PHE A 1 43 ? -3.459  -1.269  -2.273  1.00 0.00 ? 43 PHE A HB3  8  
ATOM 7899  H HD1  . PHE A 1 43 ? -4.963  -2.239  -4.592  1.00 0.00 ? 43 PHE A HD1  8  
ATOM 7900  H HD2  . PHE A 1 43 ? -0.862  -2.743  -3.568  1.00 0.00 ? 43 PHE A HD2  8  
ATOM 7901  H HE1  . PHE A 1 43 ? -4.902  -4.335  -5.880  1.00 0.00 ? 43 PHE A HE1  8  
ATOM 7902  H HE2  . PHE A 1 43 ? -0.794  -4.838  -4.855  1.00 0.00 ? 43 PHE A HE2  8  
ATOM 7903  H HZ   . PHE A 1 43 ? -2.815  -5.637  -6.014  1.00 0.00 ? 43 PHE A HZ   8  
ATOM 7904  N N    . VAL A 1 44 ? -5.082  1.280   -2.367  1.00 0.00 ? 44 VAL A N    8  
ATOM 7905  C CA   . VAL A 1 44 ? -5.420  2.343   -1.427  1.00 0.00 ? 44 VAL A CA   8  
ATOM 7906  C C    . VAL A 1 44 ? -5.800  1.772   -0.066  1.00 0.00 ? 44 VAL A C    8  
ATOM 7907  O O    . VAL A 1 44 ? -6.733  0.979   0.048   1.00 0.00 ? 44 VAL A O    8  
ATOM 7908  C CB   . VAL A 1 44 ? -6.581  3.207   -1.952  1.00 0.00 ? 44 VAL A CB   8  
ATOM 7909  C CG1  . VAL A 1 44 ? -7.010  4.220   -0.901  1.00 0.00 ? 44 VAL A CG1  8  
ATOM 7910  C CG2  . VAL A 1 44 ? -6.185  3.904   -3.245  1.00 0.00 ? 44 VAL A CG2  8  
ATOM 7911  H H    . VAL A 1 44 ? -5.742  0.582   -2.556  1.00 0.00 ? 44 VAL A H    8  
ATOM 7912  H HA   . VAL A 1 44 ? -4.551  2.976   -1.312  1.00 0.00 ? 44 VAL A HA   8  
ATOM 7913  H HB   . VAL A 1 44 ? -7.420  2.559   -2.159  1.00 0.00 ? 44 VAL A HB   8  
ATOM 7914  H HG11 . VAL A 1 44 ? -6.135  4.635   -0.423  1.00 0.00 ? 44 VAL A HG11 8  
ATOM 7915  H HG12 . VAL A 1 44 ? -7.574  5.012   -1.372  1.00 0.00 ? 44 VAL A HG12 8  
ATOM 7916  H HG13 . VAL A 1 44 ? -7.626  3.731   -0.161  1.00 0.00 ? 44 VAL A HG13 8  
ATOM 7917  H HG21 . VAL A 1 44 ? -6.702  3.444   -4.074  1.00 0.00 ? 44 VAL A HG21 8  
ATOM 7918  H HG22 . VAL A 1 44 ? -6.454  4.949   -3.188  1.00 0.00 ? 44 VAL A HG22 8  
ATOM 7919  H HG23 . VAL A 1 44 ? -5.119  3.815   -3.390  1.00 0.00 ? 44 VAL A HG23 8  
ATOM 7920  N N    . GLY A 1 45 ? -5.069  2.183   0.967   1.00 0.00 ? 45 GLY A N    8  
ATOM 7921  C CA   . GLY A 1 45 ? -5.345  1.702   2.308   1.00 0.00 ? 45 GLY A CA   8  
ATOM 7922  C C    . GLY A 1 45 ? -4.684  2.551   3.376   1.00 0.00 ? 45 GLY A C    8  
ATOM 7923  O O    . GLY A 1 45 ? -4.533  3.762   3.212   1.00 0.00 ? 45 GLY A O    8  
ATOM 7924  H H    . GLY A 1 45 ? -4.337  2.817   0.817   1.00 0.00 ? 45 GLY A H    8  
ATOM 7925  H HA2  . GLY A 1 45 ? -6.413  1.709   2.468   1.00 0.00 ? 45 GLY A HA2  8  
ATOM 7926  H HA3  . GLY A 1 45 ? -4.984  0.688   2.396   1.00 0.00 ? 45 GLY A HA3  8  
ATOM 7927  N N    . VAL A 1 46 ? -4.288  1.916   4.474   1.00 0.00 ? 46 VAL A N    8  
ATOM 7928  C CA   . VAL A 1 46 ? -3.639  2.620   5.573   1.00 0.00 ? 46 VAL A CA   8  
ATOM 7929  C C    . VAL A 1 46 ? -2.297  1.985   5.917   1.00 0.00 ? 46 VAL A C    8  
ATOM 7930  O O    . VAL A 1 46 ? -2.097  0.786   5.721   1.00 0.00 ? 46 VAL A O    8  
ATOM 7931  C CB   . VAL A 1 46 ? -4.526  2.634   6.833   1.00 0.00 ? 46 VAL A CB   8  
ATOM 7932  C CG1  . VAL A 1 46 ? -3.723  3.073   8.047   1.00 0.00 ? 46 VAL A CG1  8  
ATOM 7933  C CG2  . VAL A 1 46 ? -5.732  3.538   6.625   1.00 0.00 ? 46 VAL A CG2  8  
ATOM 7934  H H    . VAL A 1 46 ? -4.435  0.949   4.547   1.00 0.00 ? 46 VAL A H    8  
ATOM 7935  H HA   . VAL A 1 46 ? -3.475  3.642   5.264   1.00 0.00 ? 46 VAL A HA   8  
ATOM 7936  H HB   . VAL A 1 46 ? -4.882  1.629   7.008   1.00 0.00 ? 46 VAL A HB   8  
ATOM 7937  H HG11 . VAL A 1 46 ? -3.103  2.255   8.384   1.00 0.00 ? 46 VAL A HG11 8  
ATOM 7938  H HG12 . VAL A 1 46 ? -3.098  3.913   7.781   1.00 0.00 ? 46 VAL A HG12 8  
ATOM 7939  H HG13 . VAL A 1 46 ? -4.398  3.362   8.839   1.00 0.00 ? 46 VAL A HG13 8  
ATOM 7940  H HG21 . VAL A 1 46 ? -6.491  3.297   7.355   1.00 0.00 ? 46 VAL A HG21 8  
ATOM 7941  H HG22 . VAL A 1 46 ? -5.434  4.569   6.742   1.00 0.00 ? 46 VAL A HG22 8  
ATOM 7942  H HG23 . VAL A 1 46 ? -6.127  3.388   5.631   1.00 0.00 ? 46 VAL A HG23 8  
ATOM 7943  N N    . SER A 1 47 ? -1.379  2.797   6.432   1.00 0.00 ? 47 SER A N    8  
ATOM 7944  C CA   . SER A 1 47 ? -0.053  2.315   6.800   1.00 0.00 ? 47 SER A CA   8  
ATOM 7945  C C    . SER A 1 47 ? -0.045  1.786   8.232   1.00 0.00 ? 47 SER A C    8  
ATOM 7946  O O    . SER A 1 47 ? -1.004  1.977   8.980   1.00 0.00 ? 47 SER A O    8  
ATOM 7947  C CB   . SER A 1 47 ? 0.979   3.435   6.653   1.00 0.00 ? 47 SER A CB   8  
ATOM 7948  O OG   . SER A 1 47 ? 2.299   2.928   6.747   1.00 0.00 ? 47 SER A OG   8  
ATOM 7949  H H    . SER A 1 47 ? -1.598  3.743   6.564   1.00 0.00 ? 47 SER A H    8  
ATOM 7950  H HA   . SER A 1 47 ? 0.205   1.509   6.130   1.00 0.00 ? 47 SER A HA   8  
ATOM 7951  H HB2  . SER A 1 47 ? 0.857   3.910   5.691   1.00 0.00 ? 47 SER A HB2  8  
ATOM 7952  H HB3  . SER A 1 47 ? 0.830   4.164   7.436   1.00 0.00 ? 47 SER A HB3  8  
ATOM 7953  H HG   . SER A 1 47 ? 2.912   3.555   6.355   1.00 0.00 ? 47 SER A HG   8  
ATOM 7954  N N    . ARG A 1 48 ? 1.044   1.122   8.605   1.00 0.00 ? 48 ARG A N    8  
ATOM 7955  C CA   . ARG A 1 48 ? 1.177   0.564   9.945   1.00 0.00 ? 48 ARG A CA   8  
ATOM 7956  C C    . ARG A 1 48 ? 2.260   1.295   10.733  1.00 0.00 ? 48 ARG A C    8  
ATOM 7957  O O    . ARG A 1 48 ? 2.510   0.985   11.898  1.00 0.00 ? 48 ARG A O    8  
ATOM 7958  C CB   . ARG A 1 48 ? 1.505   -0.928  9.869   1.00 0.00 ? 48 ARG A CB   8  
ATOM 7959  C CG   . ARG A 1 48 ? 0.341   -1.784  9.398   1.00 0.00 ? 48 ARG A CG   8  
ATOM 7960  C CD   . ARG A 1 48 ? -0.727  -1.913  10.472  1.00 0.00 ? 48 ARG A CD   8  
ATOM 7961  N NE   . ARG A 1 48 ? -0.266  -2.701  11.612  1.00 0.00 ? 48 ARG A NE   8  
ATOM 7962  C CZ   . ARG A 1 48 ? -1.063  -3.113  12.591  1.00 0.00 ? 48 ARG A CZ   8  
ATOM 7963  N NH1  . ARG A 1 48 ? -2.355  -2.814  12.570  1.00 0.00 ? 48 ARG A NH1  8  
ATOM 7964  N NH2  . ARG A 1 48 ? -0.568  -3.826  13.595  1.00 0.00 ? 48 ARG A NH2  8  
ATOM 7965  H H    . ARG A 1 48 ? 1.775   1.003   7.963   1.00 0.00 ? 48 ARG A H    8  
ATOM 7966  H HA   . ARG A 1 48 ? 0.232   0.691   10.452  1.00 0.00 ? 48 ARG A HA   8  
ATOM 7967  H HB2  . ARG A 1 48 ? 2.328   -1.070  9.184   1.00 0.00 ? 48 ARG A HB2  8  
ATOM 7968  H HB3  . ARG A 1 48 ? 1.800   -1.269  10.850  1.00 0.00 ? 48 ARG A HB3  8  
ATOM 7969  H HG2  . ARG A 1 48 ? -0.098  -1.329  8.522   1.00 0.00 ? 48 ARG A HG2  8  
ATOM 7970  H HG3  . ARG A 1 48 ? 0.709   -2.769  9.148   1.00 0.00 ? 48 ARG A HG3  8  
ATOM 7971  H HD2  . ARG A 1 48 ? -0.995  -0.924  10.815  1.00 0.00 ? 48 ARG A HD2  8  
ATOM 7972  H HD3  . ARG A 1 48 ? -1.595  -2.391  10.043  1.00 0.00 ? 48 ARG A HD3  8  
ATOM 7973  H HE   . ARG A 1 48 ? 0.685   -2.933  11.648  1.00 0.00 ? 48 ARG A HE   8  
ATOM 7974  H HH11 . ARG A 1 48 ? -2.730  -2.277  11.814  1.00 0.00 ? 48 ARG A HH11 8  
ATOM 7975  H HH12 . ARG A 1 48 ? -2.953  -3.127  13.308  1.00 0.00 ? 48 ARG A HH12 8  
ATOM 7976  H HH21 . ARG A 1 48 ? 0.405   -4.054  13.614  1.00 0.00 ? 48 ARG A HH21 8  
ATOM 7977  H HH22 . ARG A 1 48 ? -1.169  -4.136  14.331  1.00 0.00 ? 48 ARG A HH22 8  
ATOM 7978  N N    . ARG A 1 49 ? 2.900   2.266   10.089  1.00 0.00 ? 49 ARG A N    8  
ATOM 7979  C CA   . ARG A 1 49 ? 3.957   3.039   10.728  1.00 0.00 ? 49 ARG A CA   8  
ATOM 7980  C C    . ARG A 1 49 ? 3.479   4.452   11.050  1.00 0.00 ? 49 ARG A C    8  
ATOM 7981  O O    . ARG A 1 49 ? 3.726   4.971   12.139  1.00 0.00 ? 49 ARG A O    8  
ATOM 7982  C CB   . ARG A 1 49 ? 5.191   3.100   9.826   1.00 0.00 ? 49 ARG A CB   8  
ATOM 7983  C CG   . ARG A 1 49 ? 6.411   3.703   10.502  1.00 0.00 ? 49 ARG A CG   8  
ATOM 7984  C CD   . ARG A 1 49 ? 7.122   2.684   11.380  1.00 0.00 ? 49 ARG A CD   8  
ATOM 7985  N NE   . ARG A 1 49 ? 8.022   3.320   12.338  1.00 0.00 ? 49 ARG A NE   8  
ATOM 7986  C CZ   . ARG A 1 49 ? 7.603   3.995   13.403  1.00 0.00 ? 49 ARG A CZ   8  
ATOM 7987  N NH1  . ARG A 1 49 ? 6.305   4.120   13.644  1.00 0.00 ? 49 ARG A NH1  8  
ATOM 7988  N NH2  . ARG A 1 49 ? 8.483   4.546   14.230  1.00 0.00 ? 49 ARG A NH2  8  
ATOM 7989  H H    . ARG A 1 49 ? 2.656   2.466   9.161   1.00 0.00 ? 49 ARG A H    8  
ATOM 7990  H HA   . ARG A 1 49 ? 4.220   2.543   11.650  1.00 0.00 ? 49 ARG A HA   8  
ATOM 7991  H HB2  . ARG A 1 49 ? 5.441   2.098   9.509   1.00 0.00 ? 49 ARG A HB2  8  
ATOM 7992  H HB3  . ARG A 1 49 ? 4.957   3.696   8.957   1.00 0.00 ? 49 ARG A HB3  8  
ATOM 7993  H HG2  . ARG A 1 49 ? 7.098   4.049   9.744   1.00 0.00 ? 49 ARG A HG2  8  
ATOM 7994  H HG3  . ARG A 1 49 ? 6.097   4.535   11.114  1.00 0.00 ? 49 ARG A HG3  8  
ATOM 7995  H HD2  . ARG A 1 49 ? 6.381   2.114   11.920  1.00 0.00 ? 49 ARG A HD2  8  
ATOM 7996  H HD3  . ARG A 1 49 ? 7.695   2.022   10.747  1.00 0.00 ? 49 ARG A HD3  8  
ATOM 7997  H HE   . ARG A 1 49 ? 8.985   3.240   12.179  1.00 0.00 ? 49 ARG A HE   8  
ATOM 7998  H HH11 . ARG A 1 49 ? 5.640   3.706   13.024  1.00 0.00 ? 49 ARG A HH11 8  
ATOM 7999  H HH12 . ARG A 1 49 ? 5.992   4.628   14.447  1.00 0.00 ? 49 ARG A HH12 8  
ATOM 8000  H HH21 . ARG A 1 49 ? 9.462   4.453   14.051  1.00 0.00 ? 49 ARG A HH21 8  
ATOM 8001  H HH22 . ARG A 1 49 ? 8.166   5.054   15.030  1.00 0.00 ? 49 ARG A HH22 8  
ATOM 8002  N N    . THR A 1 50 ? 2.793   5.071   10.094  1.00 0.00 ? 50 THR A N    8  
ATOM 8003  C CA   . THR A 1 50 ? 2.281   6.424   10.274  1.00 0.00 ? 50 THR A CA   8  
ATOM 8004  C C    . THR A 1 50 ? 0.769   6.419   10.465  1.00 0.00 ? 50 THR A C    8  
ATOM 8005  O O    . THR A 1 50 ? 0.159   7.465   10.684  1.00 0.00 ? 50 THR A O    8  
ATOM 8006  C CB   . THR A 1 50 ? 2.632   7.321   9.073   1.00 0.00 ? 50 THR A CB   8  
ATOM 8007  O OG1  . THR A 1 50 ? 2.097   6.760   7.869   1.00 0.00 ? 50 THR A OG1  8  
ATOM 8008  C CG2  . THR A 1 50 ? 4.139   7.481   8.938   1.00 0.00 ? 50 THR A CG2  8  
ATOM 8009  H H    . THR A 1 50 ? 2.628   4.605   9.248   1.00 0.00 ? 50 THR A H    8  
ATOM 8010  H HA   . THR A 1 50 ? 2.745   6.841   11.156  1.00 0.00 ? 50 THR A HA   8  
ATOM 8011  H HB   . THR A 1 50 ? 2.195   8.297   9.231   1.00 0.00 ? 50 THR A HB   8  
ATOM 8012  H HG1  . THR A 1 50 ? 2.134   7.414   7.166   1.00 0.00 ? 50 THR A HG1  8  
ATOM 8013  H HG21 . THR A 1 50 ? 4.366   8.001   8.019   1.00 0.00 ? 50 THR A HG21 8  
ATOM 8014  H HG22 . THR A 1 50 ? 4.604   6.506   8.924   1.00 0.00 ? 50 THR A HG22 8  
ATOM 8015  H HG23 . THR A 1 50 ? 4.517   8.048   9.775   1.00 0.00 ? 50 THR A HG23 8  
ATOM 8016  N N    . GLN A 1 51 ? 0.170   5.235   10.383  1.00 0.00 ? 51 GLN A N    8  
ATOM 8017  C CA   . GLN A 1 51 ? -1.272  5.095   10.547  1.00 0.00 ? 51 GLN A CA   8  
ATOM 8018  C C    . GLN A 1 51 ? -2.017  6.148   9.733   1.00 0.00 ? 51 GLN A C    8  
ATOM 8019  O O    . GLN A 1 51 ? -3.019  6.703   10.185  1.00 0.00 ? 51 GLN A O    8  
ATOM 8020  C CB   . GLN A 1 51 ? -1.652  5.213   12.024  1.00 0.00 ? 51 GLN A CB   8  
ATOM 8021  C CG   . GLN A 1 51 ? -1.170  4.045   12.871  1.00 0.00 ? 51 GLN A CG   8  
ATOM 8022  C CD   . GLN A 1 51 ? -1.879  3.962   14.208  1.00 0.00 ? 51 GLN A CD   8  
ATOM 8023  O OE1  . GLN A 1 51 ? -2.955  3.374   14.318  1.00 0.00 ? 51 GLN A OE1  8  
ATOM 8024  N NE2  . GLN A 1 51 ? -1.278  4.554   15.234  1.00 0.00 ? 51 GLN A NE2  8  
ATOM 8025  H H    . GLN A 1 51 ? 0.711   4.437   10.206  1.00 0.00 ? 51 GLN A H    8  
ATOM 8026  H HA   . GLN A 1 51 ? -1.553  4.117   10.189  1.00 0.00 ? 51 GLN A HA   8  
ATOM 8027  H HB2  . GLN A 1 51 ? -1.223  6.120   12.423  1.00 0.00 ? 51 GLN A HB2  8  
ATOM 8028  H HB3  . GLN A 1 51 ? -2.727  5.267   12.104  1.00 0.00 ? 51 GLN A HB3  8  
ATOM 8029  H HG2  . GLN A 1 51 ? -1.348  3.127   12.330  1.00 0.00 ? 51 GLN A HG2  8  
ATOM 8030  H HG3  . GLN A 1 51 ? -0.111  4.158   13.047  1.00 0.00 ? 51 GLN A HG3  8  
ATOM 8031  H HE21 . GLN A 1 51 ? -0.423  5.005   15.072  1.00 0.00 ? 51 GLN A HE21 8  
ATOM 8032  H HE22 . GLN A 1 51 ? -1.715  4.517   16.110  1.00 0.00 ? 51 GLN A HE22 8  
ATOM 8033  N N    . LYS A 1 52 ? -1.521  6.419   8.531   1.00 0.00 ? 52 LYS A N    8  
ATOM 8034  C CA   . LYS A 1 52 ? -2.140  7.405   7.652   1.00 0.00 ? 52 LYS A CA   8  
ATOM 8035  C C    . LYS A 1 52 ? -2.943  6.723   6.550   1.00 0.00 ? 52 LYS A C    8  
ATOM 8036  O O    . LYS A 1 52 ? -2.788  5.526   6.304   1.00 0.00 ? 52 LYS A O    8  
ATOM 8037  C CB   . LYS A 1 52 ? -1.071  8.309   7.034   1.00 0.00 ? 52 LYS A CB   8  
ATOM 8038  C CG   . LYS A 1 52 ? -0.537  9.361   7.990   1.00 0.00 ? 52 LYS A CG   8  
ATOM 8039  C CD   . LYS A 1 52 ? -0.054  10.596  7.247   1.00 0.00 ? 52 LYS A CD   8  
ATOM 8040  C CE   . LYS A 1 52 ? 0.864   11.444  8.114   1.00 0.00 ? 52 LYS A CE   8  
ATOM 8041  N NZ   . LYS A 1 52 ? 1.694   12.374  7.299   1.00 0.00 ? 52 LYS A NZ   8  
ATOM 8042  H H    . LYS A 1 52 ? -0.720  5.943   8.226   1.00 0.00 ? 52 LYS A H    8  
ATOM 8043  H HA   . LYS A 1 52 ? -2.808  8.008   8.248   1.00 0.00 ? 52 LYS A HA   8  
ATOM 8044  H HB2  . LYS A 1 52 ? -0.244  7.697   6.707   1.00 0.00 ? 52 LYS A HB2  8  
ATOM 8045  H HB3  . LYS A 1 52 ? -1.495  8.813   6.177   1.00 0.00 ? 52 LYS A HB3  8  
ATOM 8046  H HG2  . LYS A 1 52 ? -1.325  9.650   8.670   1.00 0.00 ? 52 LYS A HG2  8  
ATOM 8047  H HG3  . LYS A 1 52 ? 0.288   8.942   8.548   1.00 0.00 ? 52 LYS A HG3  8  
ATOM 8048  H HD2  . LYS A 1 52 ? 0.488   10.286  6.366   1.00 0.00 ? 52 LYS A HD2  8  
ATOM 8049  H HD3  . LYS A 1 52 ? -0.910  11.189  6.957   1.00 0.00 ? 52 LYS A HD3  8  
ATOM 8050  H HE2  . LYS A 1 52 ? 0.260   12.020  8.798   1.00 0.00 ? 52 LYS A HE2  8  
ATOM 8051  H HE3  . LYS A 1 52 ? 1.516   10.789  8.674   1.00 0.00 ? 52 LYS A HE3  8  
ATOM 8052  H HZ1  . LYS A 1 52 ? 2.524   12.683  7.845   1.00 0.00 ? 52 LYS A HZ1  8  
ATOM 8053  H HZ2  . LYS A 1 52 ? 1.137   13.211  7.034   1.00 0.00 ? 52 LYS A HZ2  8  
ATOM 8054  H HZ3  . LYS A 1 52 ? 2.019   11.898  6.434   1.00 0.00 ? 52 LYS A HZ3  8  
ATOM 8055  N N    . PHE A 1 53 ? -3.802  7.491   5.888   1.00 0.00 ? 53 PHE A N    8  
ATOM 8056  C CA   . PHE A 1 53 ? -4.630  6.961   4.811   1.00 0.00 ? 53 PHE A CA   8  
ATOM 8057  C C    . PHE A 1 53 ? -4.330  7.671   3.494   1.00 0.00 ? 53 PHE A C    8  
ATOM 8058  O O    . PHE A 1 53 ? -4.401  8.896   3.406   1.00 0.00 ? 53 PHE A O    8  
ATOM 8059  C CB   . PHE A 1 53 ? -6.112  7.110   5.157   1.00 0.00 ? 53 PHE A CB   8  
ATOM 8060  C CG   . PHE A 1 53 ? -7.033  6.567   4.102   1.00 0.00 ? 53 PHE A CG   8  
ATOM 8061  C CD1  . PHE A 1 53 ? -7.254  7.269   2.928   1.00 0.00 ? 53 PHE A CD1  8  
ATOM 8062  C CD2  . PHE A 1 53 ? -7.676  5.353   4.283   1.00 0.00 ? 53 PHE A CD2  8  
ATOM 8063  C CE1  . PHE A 1 53 ? -8.101  6.772   1.956   1.00 0.00 ? 53 PHE A CE1  8  
ATOM 8064  C CE2  . PHE A 1 53 ? -8.524  4.850   3.315   1.00 0.00 ? 53 PHE A CE2  8  
ATOM 8065  C CZ   . PHE A 1 53 ? -8.736  5.560   2.149   1.00 0.00 ? 53 PHE A CZ   8  
ATOM 8066  H H    . PHE A 1 53 ? -3.881  8.438   6.130   1.00 0.00 ? 53 PHE A H    8  
ATOM 8067  H HA   . PHE A 1 53 ? -4.398  5.913   4.701   1.00 0.00 ? 53 PHE A HA   8  
ATOM 8068  H HB2  . PHE A 1 53 ? -6.315  6.583   6.077   1.00 0.00 ? 53 PHE A HB2  8  
ATOM 8069  H HB3  . PHE A 1 53 ? -6.340  8.157   5.290   1.00 0.00 ? 53 PHE A HB3  8  
ATOM 8070  H HD1  . PHE A 1 53 ? -6.758  8.216   2.776   1.00 0.00 ? 53 PHE A HD1  8  
ATOM 8071  H HD2  . PHE A 1 53 ? -7.511  4.797   5.195   1.00 0.00 ? 53 PHE A HD2  8  
ATOM 8072  H HE1  . PHE A 1 53 ? -8.265  7.328   1.046   1.00 0.00 ? 53 PHE A HE1  8  
ATOM 8073  H HE2  . PHE A 1 53 ? -9.018  3.903   3.469   1.00 0.00 ? 53 PHE A HE2  8  
ATOM 8074  H HZ   . PHE A 1 53 ? -9.398  5.169   1.391   1.00 0.00 ? 53 PHE A HZ   8  
ATOM 8075  N N    . GLY A 1 54 ? -3.992  6.891   2.471   1.00 0.00 ? 54 GLY A N    8  
ATOM 8076  C CA   . GLY A 1 54 ? -3.685  7.462   1.173   1.00 0.00 ? 54 GLY A CA   8  
ATOM 8077  C C    . GLY A 1 54 ? -3.592  6.411   0.085   1.00 0.00 ? 54 GLY A C    8  
ATOM 8078  O O    . GLY A 1 54 ? -4.125  5.310   0.226   1.00 0.00 ? 54 GLY A O    8  
ATOM 8079  H H    . GLY A 1 54 ? -3.951  5.920   2.599   1.00 0.00 ? 54 GLY A H    8  
ATOM 8080  H HA2  . GLY A 1 54 ? -4.458  8.169   0.910   1.00 0.00 ? 54 GLY A HA2  8  
ATOM 8081  H HA3  . GLY A 1 54 ? -2.741  7.983   1.235   1.00 0.00 ? 54 GLY A HA3  8  
ATOM 8082  N N    . THR A 1 55 ? -2.913  6.750   -1.007  1.00 0.00 ? 55 THR A N    8  
ATOM 8083  C CA   . THR A 1 55 ? -2.753  5.828   -2.125  1.00 0.00 ? 55 THR A CA   8  
ATOM 8084  C C    . THR A 1 55 ? -1.280  5.584   -2.430  1.00 0.00 ? 55 THR A C    8  
ATOM 8085  O O    . THR A 1 55 ? -0.467  6.508   -2.395  1.00 0.00 ? 55 THR A O    8  
ATOM 8086  C CB   . THR A 1 55 ? -3.448  6.359   -3.393  1.00 0.00 ? 55 THR A CB   8  
ATOM 8087  O OG1  . THR A 1 55 ? -3.273  5.432   -4.471  1.00 0.00 ? 55 THR A OG1  8  
ATOM 8088  C CG2  . THR A 1 55 ? -2.888  7.717   -3.789  1.00 0.00 ? 55 THR A CG2  8  
ATOM 8089  H H    . THR A 1 55 ? -2.510  7.642   -1.061  1.00 0.00 ? 55 THR A H    8  
ATOM 8090  H HA   . THR A 1 55 ? -3.215  4.890   -1.852  1.00 0.00 ? 55 THR A HA   8  
ATOM 8091  H HB   . THR A 1 55 ? -4.504  6.466   -3.189  1.00 0.00 ? 55 THR A HB   8  
ATOM 8092  H HG1  . THR A 1 55 ? -3.344  5.898   -5.308  1.00 0.00 ? 55 THR A HG1  8  
ATOM 8093  H HG21 . THR A 1 55 ? -2.164  7.591   -4.580  1.00 0.00 ? 55 THR A HG21 8  
ATOM 8094  H HG22 . THR A 1 55 ? -2.412  8.173   -2.934  1.00 0.00 ? 55 THR A HG22 8  
ATOM 8095  H HG23 . THR A 1 55 ? -3.692  8.350   -4.134  1.00 0.00 ? 55 THR A HG23 8  
ATOM 8096  N N    . PHE A 1 56 ? -0.942  4.334   -2.731  1.00 0.00 ? 56 PHE A N    8  
ATOM 8097  C CA   . PHE A 1 56 ? 0.435   3.969   -3.043  1.00 0.00 ? 56 PHE A CA   8  
ATOM 8098  C C    . PHE A 1 56 ? 0.483   2.949   -4.177  1.00 0.00 ? 56 PHE A C    8  
ATOM 8099  O O    . PHE A 1 56 ? -0.479  2.225   -4.437  1.00 0.00 ? 56 PHE A O    8  
ATOM 8100  C CB   . PHE A 1 56 ? 1.128   3.402   -1.802  1.00 0.00 ? 56 PHE A CB   8  
ATOM 8101  C CG   . PHE A 1 56 ? 0.265   2.460   -1.011  1.00 0.00 ? 56 PHE A CG   8  
ATOM 8102  C CD1  . PHE A 1 56 ? -0.642  2.945   -0.083  1.00 0.00 ? 56 PHE A CD1  8  
ATOM 8103  C CD2  . PHE A 1 56 ? 0.362   1.090   -1.196  1.00 0.00 ? 56 PHE A CD2  8  
ATOM 8104  C CE1  . PHE A 1 56 ? -1.438  2.081   0.646   1.00 0.00 ? 56 PHE A CE1  8  
ATOM 8105  C CE2  . PHE A 1 56 ? -0.431  0.222   -0.470  1.00 0.00 ? 56 PHE A CE2  8  
ATOM 8106  C CZ   . PHE A 1 56 ? -1.331  0.718   0.453   1.00 0.00 ? 56 PHE A CZ   8  
ATOM 8107  H H    . PHE A 1 56 ? -1.635  3.641   -2.743  1.00 0.00 ? 56 PHE A H    8  
ATOM 8108  H HA   . PHE A 1 56 ? 0.951   4.863   -3.356  1.00 0.00 ? 56 PHE A HA   8  
ATOM 8109  H HB2  . PHE A 1 56 ? 2.012   2.863   -2.107  1.00 0.00 ? 56 PHE A HB2  8  
ATOM 8110  H HB3  . PHE A 1 56 ? 1.412   4.217   -1.154  1.00 0.00 ? 56 PHE A HB3  8  
ATOM 8111  H HD1  . PHE A 1 56 ? -0.726  4.012   0.069   1.00 0.00 ? 56 PHE A HD1  8  
ATOM 8112  H HD2  . PHE A 1 56 ? 1.066   0.701   -1.916  1.00 0.00 ? 56 PHE A HD2  8  
ATOM 8113  H HE1  . PHE A 1 56 ? -2.141  2.473   1.367   1.00 0.00 ? 56 PHE A HE1  8  
ATOM 8114  H HE2  . PHE A 1 56 ? -0.346  -0.844  -0.623  1.00 0.00 ? 56 PHE A HE2  8  
ATOM 8115  H HZ   . PHE A 1 56 ? -1.952  0.041   1.021   1.00 0.00 ? 56 PHE A HZ   8  
ATOM 8116  N N    . PRO A 1 57 ? 1.630   2.889   -4.870  1.00 0.00 ? 57 PRO A N    8  
ATOM 8117  C CA   . PRO A 1 57 ? 1.832   1.962   -5.987  1.00 0.00 ? 57 PRO A CA   8  
ATOM 8118  C C    . PRO A 1 57 ? 1.920   0.511   -5.528  1.00 0.00 ? 57 PRO A C    8  
ATOM 8119  O O    . PRO A 1 57 ? 2.864   0.123   -4.841  1.00 0.00 ? 57 PRO A O    8  
ATOM 8120  C CB   . PRO A 1 57 ? 3.166   2.415   -6.587  1.00 0.00 ? 57 PRO A CB   8  
ATOM 8121  C CG   . PRO A 1 57 ? 3.882   3.078   -5.461  1.00 0.00 ? 57 PRO A CG   8  
ATOM 8122  C CD   . PRO A 1 57 ? 2.818   3.722   -4.615  1.00 0.00 ? 57 PRO A CD   8  
ATOM 8123  H HA   . PRO A 1 57 ? 1.052   2.058   -6.728  1.00 0.00 ? 57 PRO A HA   8  
ATOM 8124  H HB2  . PRO A 1 57 ? 3.711   1.555   -6.950  1.00 0.00 ? 57 PRO A HB2  8  
ATOM 8125  H HB3  . PRO A 1 57 ? 2.985   3.103   -7.398  1.00 0.00 ? 57 PRO A HB3  8  
ATOM 8126  H HG2  . PRO A 1 57 ? 4.423   2.342   -4.886  1.00 0.00 ? 57 PRO A HG2  8  
ATOM 8127  H HG3  . PRO A 1 57 ? 4.558   3.827   -5.846  1.00 0.00 ? 57 PRO A HG3  8  
ATOM 8128  H HD2  . PRO A 1 57 ? 3.094   3.690   -3.572  1.00 0.00 ? 57 PRO A HD2  8  
ATOM 8129  H HD3  . PRO A 1 57 ? 2.649   4.740   -4.932  1.00 0.00 ? 57 PRO A HD3  8  
ATOM 8130  N N    . GLY A 1 58 ? 0.930   -0.288  -5.913  1.00 0.00 ? 58 GLY A N    8  
ATOM 8131  C CA   . GLY A 1 58 ? 0.915   -1.688  -5.531  1.00 0.00 ? 58 GLY A CA   8  
ATOM 8132  C C    . GLY A 1 58 ? 2.176   -2.417  -5.952  1.00 0.00 ? 58 GLY A C    8  
ATOM 8133  O O    . GLY A 1 58 ? 2.507   -3.466  -5.401  1.00 0.00 ? 58 GLY A O    8  
ATOM 8134  H H    . GLY A 1 58 ? 0.203   0.076   -6.460  1.00 0.00 ? 58 GLY A H    8  
ATOM 8135  H HA2  . GLY A 1 58 ? 0.812   -1.757  -4.459  1.00 0.00 ? 58 GLY A HA2  8  
ATOM 8136  H HA3  . GLY A 1 58 ? 0.065   -2.167  -5.995  1.00 0.00 ? 58 GLY A HA3  8  
ATOM 8137  N N    . ASN A 1 59 ? 2.880   -1.860  -6.931  1.00 0.00 ? 59 ASN A N    8  
ATOM 8138  C CA   . ASN A 1 59 ? 4.111   -2.466  -7.427  1.00 0.00 ? 59 ASN A CA   8  
ATOM 8139  C C    . ASN A 1 59 ? 5.212   -2.400  -6.373  1.00 0.00 ? 59 ASN A C    8  
ATOM 8140  O O    . ASN A 1 59 ? 6.308   -2.925  -6.571  1.00 0.00 ? 59 ASN A O    8  
ATOM 8141  C CB   . ASN A 1 59 ? 4.571   -1.762  -8.705  1.00 0.00 ? 59 ASN A CB   8  
ATOM 8142  C CG   . ASN A 1 59 ? 4.196   -0.293  -8.724  1.00 0.00 ? 59 ASN A CG   8  
ATOM 8143  O OD1  . ASN A 1 59 ? 5.018   0.573   -8.424  1.00 0.00 ? 59 ASN A OD1  8  
ATOM 8144  N ND2  . ASN A 1 59 ? 2.949   -0.005  -9.078  1.00 0.00 ? 59 ASN A ND2  8  
ATOM 8145  H H    . ASN A 1 59 ? 2.565   -1.023  -7.331  1.00 0.00 ? 59 ASN A H    8  
ATOM 8146  H HA   . ASN A 1 59 ? 3.904   -3.501  -7.651  1.00 0.00 ? 59 ASN A HA   8  
ATOM 8147  H HB2  . ASN A 1 59 ? 5.646   -1.840  -8.785  1.00 0.00 ? 59 ASN A HB2  8  
ATOM 8148  H HB3  . ASN A 1 59 ? 4.115   -2.242  -9.558  1.00 0.00 ? 59 ASN A HB3  8  
ATOM 8149  H HD21 . ASN A 1 59 ? 2.349   -0.747  -9.304  1.00 0.00 ? 59 ASN A HD21 8  
ATOM 8150  H HD22 . ASN A 1 59 ? 2.680   0.937   -9.099  1.00 0.00 ? 59 ASN A HD22 8  
ATOM 8151  N N    . TYR A 1 60 ? 4.913   -1.753  -5.252  1.00 0.00 ? 60 TYR A N    8  
ATOM 8152  C CA   . TYR A 1 60 ? 5.877   -1.618  -4.167  1.00 0.00 ? 60 TYR A CA   8  
ATOM 8153  C C    . TYR A 1 60 ? 5.545   -2.568  -3.020  1.00 0.00 ? 60 TYR A C    8  
ATOM 8154  O O    . TYR A 1 60 ? 6.422   -2.967  -2.255  1.00 0.00 ? 60 TYR A O    8  
ATOM 8155  C CB   . TYR A 1 60 ? 5.904   -0.176  -3.658  1.00 0.00 ? 60 TYR A CB   8  
ATOM 8156  C CG   . TYR A 1 60 ? 6.747   0.750   -4.505  1.00 0.00 ? 60 TYR A CG   8  
ATOM 8157  C CD1  . TYR A 1 60 ? 6.435   0.978   -5.840  1.00 0.00 ? 60 TYR A CD1  8  
ATOM 8158  C CD2  . TYR A 1 60 ? 7.855   1.396   -3.972  1.00 0.00 ? 60 TYR A CD2  8  
ATOM 8159  C CE1  . TYR A 1 60 ? 7.202   1.823   -6.619  1.00 0.00 ? 60 TYR A CE1  8  
ATOM 8160  C CE2  . TYR A 1 60 ? 8.627   2.244   -4.743  1.00 0.00 ? 60 TYR A CE2  8  
ATOM 8161  C CZ   . TYR A 1 60 ? 8.297   2.454   -6.066  1.00 0.00 ? 60 TYR A CZ   8  
ATOM 8162  O OH   . TYR A 1 60 ? 9.064   3.296   -6.837  1.00 0.00 ? 60 TYR A OH   8  
ATOM 8163  H H    . TYR A 1 60 ? 4.023   -1.356  -5.152  1.00 0.00 ? 60 TYR A H    8  
ATOM 8164  H HA   . TYR A 1 60 ? 6.853   -1.870  -4.557  1.00 0.00 ? 60 TYR A HA   8  
ATOM 8165  H HB2  . TYR A 1 60 ? 4.897   0.213   -3.644  1.00 0.00 ? 60 TYR A HB2  8  
ATOM 8166  H HB3  . TYR A 1 60 ? 6.304   -0.163  -2.654  1.00 0.00 ? 60 TYR A HB3  8  
ATOM 8167  H HD1  . TYR A 1 60 ? 5.577   0.483   -6.271  1.00 0.00 ? 60 TYR A HD1  8  
ATOM 8168  H HD2  . TYR A 1 60 ? 8.111   1.229   -2.936  1.00 0.00 ? 60 TYR A HD2  8  
ATOM 8169  H HE1  . TYR A 1 60 ? 6.944   1.988   -7.655  1.00 0.00 ? 60 TYR A HE1  8  
ATOM 8170  H HE2  . TYR A 1 60 ? 9.485   2.737   -4.310  1.00 0.00 ? 60 TYR A HE2  8  
ATOM 8171  H HH   . TYR A 1 60 ? 9.650   2.776   -7.393  1.00 0.00 ? 60 TYR A HH   8  
ATOM 8172  N N    . VAL A 1 61 ? 4.270   -2.927  -2.909  1.00 0.00 ? 61 VAL A N    8  
ATOM 8173  C CA   . VAL A 1 61 ? 3.819   -3.831  -1.858  1.00 0.00 ? 61 VAL A CA   8  
ATOM 8174  C C    . VAL A 1 61 ? 3.413   -5.183  -2.433  1.00 0.00 ? 61 VAL A C    8  
ATOM 8175  O O    . VAL A 1 61 ? 3.469   -5.396  -3.644  1.00 0.00 ? 61 VAL A O    8  
ATOM 8176  C CB   . VAL A 1 61 ? 2.629   -3.239  -1.080  1.00 0.00 ? 61 VAL A CB   8  
ATOM 8177  C CG1  . VAL A 1 61 ? 3.020   -1.920  -0.430  1.00 0.00 ? 61 VAL A CG1  8  
ATOM 8178  C CG2  . VAL A 1 61 ? 1.430   -3.055  -1.998  1.00 0.00 ? 61 VAL A CG2  8  
ATOM 8179  H H    . VAL A 1 61 ? 3.616   -2.575  -3.550  1.00 0.00 ? 61 VAL A H    8  
ATOM 8180  H HA   . VAL A 1 61 ? 4.638   -3.975  -1.168  1.00 0.00 ? 61 VAL A HA   8  
ATOM 8181  H HB   . VAL A 1 61 ? 2.355   -3.932  -0.298  1.00 0.00 ? 61 VAL A HB   8  
ATOM 8182  H HG11 . VAL A 1 61 ? 3.431   -2.110  0.551   1.00 0.00 ? 61 VAL A HG11 8  
ATOM 8183  H HG12 . VAL A 1 61 ? 3.758   -1.422  -1.040  1.00 0.00 ? 61 VAL A HG12 8  
ATOM 8184  H HG13 . VAL A 1 61 ? 2.146   -1.292  -0.337  1.00 0.00 ? 61 VAL A HG13 8  
ATOM 8185  H HG21 . VAL A 1 61 ? 0.526   -3.300  -1.461  1.00 0.00 ? 61 VAL A HG21 8  
ATOM 8186  H HG22 . VAL A 1 61 ? 1.385   -2.029  -2.331  1.00 0.00 ? 61 VAL A HG22 8  
ATOM 8187  H HG23 . VAL A 1 61 ? 1.529   -3.707  -2.853  1.00 0.00 ? 61 VAL A HG23 8  
ATOM 8188  N N    . ALA A 1 62 ? 3.003   -6.094  -1.557  1.00 0.00 ? 62 ALA A N    8  
ATOM 8189  C CA   . ALA A 1 62 ? 2.585   -7.426  -1.978  1.00 0.00 ? 62 ALA A CA   8  
ATOM 8190  C C    . ALA A 1 62 ? 1.640   -8.052  -0.958  1.00 0.00 ? 62 ALA A C    8  
ATOM 8191  O O    . ALA A 1 62 ? 1.755   -7.833  0.248   1.00 0.00 ? 62 ALA A O    8  
ATOM 8192  C CB   . ALA A 1 62 ? 3.799   -8.317  -2.192  1.00 0.00 ? 62 ALA A CB   8  
ATOM 8193  H H    . ALA A 1 62 ? 2.980   -5.865  -0.604  1.00 0.00 ? 62 ALA A H    8  
ATOM 8194  H HA   . ALA A 1 62 ? 2.068   -7.330  -2.922  1.00 0.00 ? 62 ALA A HA   8  
ATOM 8195  H HB1  . ALA A 1 62 ? 3.518   -9.168  -2.796  1.00 0.00 ? 62 ALA A HB1  8  
ATOM 8196  H HB2  . ALA A 1 62 ? 4.572   -7.757  -2.696  1.00 0.00 ? 62 ALA A HB2  8  
ATOM 8197  H HB3  . ALA A 1 62 ? 4.167   -8.660  -1.236  1.00 0.00 ? 62 ALA A HB3  8  
ATOM 8198  N N    . PRO A 1 63 ? 0.681   -8.850  -1.451  1.00 0.00 ? 63 PRO A N    8  
ATOM 8199  C CA   . PRO A 1 63 ? -0.303  -9.525  -0.599  1.00 0.00 ? 63 PRO A CA   8  
ATOM 8200  C C    . PRO A 1 63 ? 0.322   -10.631 0.244   1.00 0.00 ? 63 PRO A C    8  
ATOM 8201  O O    . PRO A 1 63 ? 0.553   -11.739 -0.240  1.00 0.00 ? 63 PRO A O    8  
ATOM 8202  C CB   . PRO A 1 63 ? -1.297  -10.114 -1.603  1.00 0.00 ? 63 PRO A CB   8  
ATOM 8203  C CG   . PRO A 1 63 ? -0.512  -10.282 -2.858  1.00 0.00 ? 63 PRO A CG   8  
ATOM 8204  C CD   . PRO A 1 63 ? 0.484   -9.157  -2.877  1.00 0.00 ? 63 PRO A CD   8  
ATOM 8205  H HA   . PRO A 1 63 ? -0.813  -8.826  0.048   1.00 0.00 ? 63 PRO A HA   8  
ATOM 8206  H HB2  . PRO A 1 63 ? -1.664  -11.062 -1.235  1.00 0.00 ? 63 PRO A HB2  8  
ATOM 8207  H HB3  . PRO A 1 63 ? -2.121  -9.431  -1.741  1.00 0.00 ? 63 PRO A HB3  8  
ATOM 8208  H HG2  . PRO A 1 63 ? -0.003  -11.234 -2.848  1.00 0.00 ? 63 PRO A HG2  8  
ATOM 8209  H HG3  . PRO A 1 63 ? -1.169  -10.215 -3.712  1.00 0.00 ? 63 PRO A HG3  8  
ATOM 8210  H HD2  . PRO A 1 63 ? 1.409   -9.479  -3.334  1.00 0.00 ? 63 PRO A HD2  8  
ATOM 8211  H HD3  . PRO A 1 63 ? 0.080   -8.303  -3.402  1.00 0.00 ? 63 PRO A HD3  8  
ATOM 8212  N N    . VAL A 1 64 ? 0.592   -10.324 1.509   1.00 0.00 ? 64 VAL A N    8  
ATOM 8213  C CA   . VAL A 1 64 ? 1.189   -11.294 2.420   1.00 0.00 ? 64 VAL A CA   8  
ATOM 8214  C C    . VAL A 1 64 ? 0.160   -12.319 2.882   1.00 0.00 ? 64 VAL A C    8  
ATOM 8215  O O    . VAL A 1 64 ? 0.513   -13.417 3.314   1.00 0.00 ? 64 VAL A O    8  
ATOM 8216  C CB   . VAL A 1 64 ? 1.798   -10.602 3.655   1.00 0.00 ? 64 VAL A CB   8  
ATOM 8217  C CG1  . VAL A 1 64 ? 0.861   -9.526  4.181   1.00 0.00 ? 64 VAL A CG1  8  
ATOM 8218  C CG2  . VAL A 1 64 ? 2.110   -11.625 4.737   1.00 0.00 ? 64 VAL A CG2  8  
ATOM 8219  H H    . VAL A 1 64 ? 0.385   -9.424  1.837   1.00 0.00 ? 64 VAL A H    8  
ATOM 8220  H HA   . VAL A 1 64 ? 1.981   -11.805 1.893   1.00 0.00 ? 64 VAL A HA   8  
ATOM 8221  H HB   . VAL A 1 64 ? 2.723   -10.130 3.358   1.00 0.00 ? 64 VAL A HB   8  
ATOM 8222  H HG11 . VAL A 1 64 ? 0.973   -9.444  5.252   1.00 0.00 ? 64 VAL A HG11 8  
ATOM 8223  H HG12 . VAL A 1 64 ? 1.104   -8.580  3.719   1.00 0.00 ? 64 VAL A HG12 8  
ATOM 8224  H HG13 . VAL A 1 64 ? -0.159  -9.790  3.945   1.00 0.00 ? 64 VAL A HG13 8  
ATOM 8225  H HG21 . VAL A 1 64 ? 2.844   -11.216 5.416   1.00 0.00 ? 64 VAL A HG21 8  
ATOM 8226  H HG22 . VAL A 1 64 ? 1.207   -11.860 5.282   1.00 0.00 ? 64 VAL A HG22 8  
ATOM 8227  H HG23 . VAL A 1 64 ? 2.500   -12.523 4.283   1.00 0.00 ? 64 VAL A HG23 8  
ATOM 8228  N N    . SER A 1 65 ? -1.115  -11.955 2.787   1.00 0.00 ? 65 SER A N    8  
ATOM 8229  C CA   . SER A 1 65 ? -2.196  -12.843 3.198   1.00 0.00 ? 65 SER A CA   8  
ATOM 8230  C C    . SER A 1 65 ? -1.979  -14.252 2.655   1.00 0.00 ? 65 SER A C    8  
ATOM 8231  O O    . SER A 1 65 ? -2.332  -15.239 3.298   1.00 0.00 ? 65 SER A O    8  
ATOM 8232  C CB   . SER A 1 65 ? -3.542  -12.299 2.714   1.00 0.00 ? 65 SER A CB   8  
ATOM 8233  O OG   . SER A 1 65 ? -4.614  -12.860 3.452   1.00 0.00 ? 65 SER A OG   8  
ATOM 8234  H H    . SER A 1 65 ? -1.333  -11.067 2.434   1.00 0.00 ? 65 SER A H    8  
ATOM 8235  H HA   . SER A 1 65 ? -2.201  -12.882 4.277   1.00 0.00 ? 65 SER A HA   8  
ATOM 8236  H HB2  . SER A 1 65 ? -3.559  -11.227 2.836   1.00 0.00 ? 65 SER A HB2  8  
ATOM 8237  H HB3  . SER A 1 65 ? -3.672  -12.546 1.670   1.00 0.00 ? 65 SER A HB3  8  
ATOM 8238  H HG   . SER A 1 65 ? -4.355  -13.722 3.788   1.00 0.00 ? 65 SER A HG   8  
ATOM 8239  N N    . GLY A 1 66 ? -1.393  -14.336 1.464   1.00 0.00 ? 66 GLY A N    8  
ATOM 8240  C CA   . GLY A 1 66 ? -1.138  -15.628 0.852   1.00 0.00 ? 66 GLY A CA   8  
ATOM 8241  C C    . GLY A 1 66 ? -2.074  -15.916 -0.305  1.00 0.00 ? 66 GLY A C    8  
ATOM 8242  O O    . GLY A 1 66 ? -3.094  -16.588 -0.154  1.00 0.00 ? 66 GLY A O    8  
ATOM 8243  H H    . GLY A 1 66 ? -1.133  -13.515 0.996   1.00 0.00 ? 66 GLY A H    8  
ATOM 8244  H HA2  . GLY A 1 66 ? -0.120  -15.649 0.493   1.00 0.00 ? 66 GLY A HA2  8  
ATOM 8245  H HA3  . GLY A 1 66 ? -1.262  -16.397 1.600   1.00 0.00 ? 66 GLY A HA3  8  
ATOM 8246  N N    . PRO A 1 67 ? -1.728  -15.399 -1.493  1.00 0.00 ? 67 PRO A N    8  
ATOM 8247  C CA   . PRO A 1 67 ? -2.532  -15.590 -2.704  1.00 0.00 ? 67 PRO A CA   8  
ATOM 8248  C C    . PRO A 1 67 ? -2.488  -17.029 -3.207  1.00 0.00 ? 67 PRO A C    8  
ATOM 8249  O O    . PRO A 1 67 ? -1.495  -17.462 -3.793  1.00 0.00 ? 67 PRO A O    8  
ATOM 8250  C CB   . PRO A 1 67 ? -1.876  -14.649 -3.718  1.00 0.00 ? 67 PRO A CB   8  
ATOM 8251  C CG   . PRO A 1 67 ? -0.470  -14.505 -3.247  1.00 0.00 ? 67 PRO A CG   8  
ATOM 8252  C CD   . PRO A 1 67 ? -0.526  -14.587 -1.747  1.00 0.00 ? 67 PRO A CD   8  
ATOM 8253  H HA   . PRO A 1 67 ? -3.559  -15.296 -2.549  1.00 0.00 ? 67 PRO A HA   8  
ATOM 8254  H HB2  . PRO A 1 67 ? -1.921  -15.090 -4.704  1.00 0.00 ? 67 PRO A HB2  8  
ATOM 8255  H HB3  . PRO A 1 67 ? -2.391  -13.700 -3.718  1.00 0.00 ? 67 PRO A HB3  8  
ATOM 8256  H HG2  . PRO A 1 67 ? 0.134   -15.306 -3.644  1.00 0.00 ? 67 PRO A HG2  8  
ATOM 8257  H HG3  . PRO A 1 67 ? -0.077  -13.548 -3.555  1.00 0.00 ? 67 PRO A HG3  8  
ATOM 8258  H HD2  . PRO A 1 67 ? 0.358   -15.076 -1.363  1.00 0.00 ? 67 PRO A HD2  8  
ATOM 8259  H HD3  . PRO A 1 67 ? -0.629  -13.601 -1.318  1.00 0.00 ? 67 PRO A HD3  8  
ATOM 8260  N N    . SER A 1 68 ? -3.570  -17.765 -2.976  1.00 0.00 ? 68 SER A N    8  
ATOM 8261  C CA   . SER A 1 68 ? -3.653  -19.157 -3.404  1.00 0.00 ? 68 SER A CA   8  
ATOM 8262  C C    . SER A 1 68 ? -3.502  -19.270 -4.917  1.00 0.00 ? 68 SER A C    8  
ATOM 8263  O O    . SER A 1 68 ? -3.767  -18.319 -5.652  1.00 0.00 ? 68 SER A O    8  
ATOM 8264  C CB   . SER A 1 68 ? -4.985  -19.769 -2.965  1.00 0.00 ? 68 SER A CB   8  
ATOM 8265  O OG   . SER A 1 68 ? -6.071  -19.175 -3.657  1.00 0.00 ? 68 SER A OG   8  
ATOM 8266  H H    . SER A 1 68 ? -4.330  -17.363 -2.505  1.00 0.00 ? 68 SER A H    8  
ATOM 8267  H HA   . SER A 1 68 ? -2.846  -19.698 -2.932  1.00 0.00 ? 68 SER A HA   8  
ATOM 8268  H HB2  . SER A 1 68 ? -4.978  -20.828 -3.173  1.00 0.00 ? 68 SER A HB2  8  
ATOM 8269  H HB3  . SER A 1 68 ? -5.119  -19.610 -1.905  1.00 0.00 ? 68 SER A HB3  8  
ATOM 8270  H HG   . SER A 1 68 ? -5.826  -18.291 -3.938  1.00 0.00 ? 68 SER A HG   8  
ATOM 8271  N N    . SER A 1 69 ? -3.075  -20.442 -5.377  1.00 0.00 ? 69 SER A N    8  
ATOM 8272  C CA   . SER A 1 69 ? -2.885  -20.680 -6.803  1.00 0.00 ? 69 SER A CA   8  
ATOM 8273  C C    . SER A 1 69 ? -3.807  -21.792 -7.296  1.00 0.00 ? 69 SER A C    8  
ATOM 8274  O O    . SER A 1 69 ? -3.696  -22.940 -6.870  1.00 0.00 ? 69 SER A O    8  
ATOM 8275  C CB   . SER A 1 69 ? -1.427  -21.046 -7.091  1.00 0.00 ? 69 SER A CB   8  
ATOM 8276  O OG   . SER A 1 69 ? -0.563  -19.959 -6.810  1.00 0.00 ? 69 SER A OG   8  
ATOM 8277  H H    . SER A 1 69 ? -2.881  -21.163 -4.742  1.00 0.00 ? 69 SER A H    8  
ATOM 8278  H HA   . SER A 1 69 ? -3.128  -19.768 -7.327  1.00 0.00 ? 69 SER A HA   8  
ATOM 8279  H HB2  . SER A 1 69 ? -1.142  -21.886 -6.475  1.00 0.00 ? 69 SER A HB2  8  
ATOM 8280  H HB3  . SER A 1 69 ? -1.325  -21.313 -8.133  1.00 0.00 ? 69 SER A HB3  8  
ATOM 8281  H HG   . SER A 1 69 ? 0.197   -20.273 -6.315  1.00 0.00 ? 69 SER A HG   8  
ATOM 8282  N N    . GLY A 1 70 ? -4.718  -21.439 -8.198  1.00 0.00 ? 70 GLY A N    8  
ATOM 8283  C CA   . GLY A 1 70 ? -5.647  -22.417 -8.735  1.00 0.00 ? 70 GLY A CA   8  
ATOM 8284  C C    . GLY A 1 70 ? -4.958  -23.462 -9.591  1.00 0.00 ? 70 GLY A C    8  
ATOM 8285  O O    . GLY A 1 70 ? -5.061  -23.435 -10.817 1.00 0.00 ? 70 GLY A O    8  
ATOM 8286  H H    . GLY A 1 70 ? -4.760  -20.508 -8.502  1.00 0.00 ? 70 GLY A H    8  
ATOM 8287  H HA2  . GLY A 1 70 ? -6.147  -22.910 -7.915  1.00 0.00 ? 70 GLY A HA2  8  
ATOM 8288  H HA3  . GLY A 1 70 ? -6.383  -21.904 -9.337  1.00 0.00 ? 70 GLY A HA3  8  
ATOM 8289  N N    . GLY A 1 1  ? -7.593  -7.844  20.589  1.00 0.00 ? 1  GLY A N    9  
ATOM 8290  C CA   . GLY A 1 1  ? -7.287  -8.242  19.228  1.00 0.00 ? 1  GLY A CA   9  
ATOM 8291  C C    . GLY A 1 1  ? -8.113  -7.488  18.204  1.00 0.00 ? 1  GLY A C    9  
ATOM 8292  O O    . GLY A 1 1  ? -8.578  -6.379  18.466  1.00 0.00 ? 1  GLY A O    9  
ATOM 8293  H H1   . GLY A 1 1  ? -7.281  -6.978  20.927  1.00 0.00 ? 1  GLY A H1   9  
ATOM 8294  H HA2  . GLY A 1 1  ? -6.241  -8.057  19.037  1.00 0.00 ? 1  GLY A HA2  9  
ATOM 8295  H HA3  . GLY A 1 1  ? -7.481  -9.299  19.122  1.00 0.00 ? 1  GLY A HA3  9  
ATOM 8296  N N    . SER A 1 2  ? -8.295  -8.091  17.034  1.00 0.00 ? 2  SER A N    9  
ATOM 8297  C CA   . SER A 1 2  ? -9.066  -7.467  15.964  1.00 0.00 ? 2  SER A CA   9  
ATOM 8298  C C    . SER A 1 2  ? -10.165 -8.403  15.470  1.00 0.00 ? 2  SER A C    9  
ATOM 8299  O O    . SER A 1 2  ? -9.959  -9.185  14.542  1.00 0.00 ? 2  SER A O    9  
ATOM 8300  C CB   . SER A 1 2  ? -8.148  -7.081  14.803  1.00 0.00 ? 2  SER A CB   9  
ATOM 8301  O OG   . SER A 1 2  ? -7.165  -6.149  15.218  1.00 0.00 ? 2  SER A OG   9  
ATOM 8302  H H    . SER A 1 2  ? -7.899  -8.975  16.885  1.00 0.00 ? 2  SER A H    9  
ATOM 8303  H HA   . SER A 1 2  ? -9.523  -6.573  16.363  1.00 0.00 ? 2  SER A HA   9  
ATOM 8304  H HB2  . SER A 1 2  ? -7.653  -7.965  14.430  1.00 0.00 ? 2  SER A HB2  9  
ATOM 8305  H HB3  . SER A 1 2  ? -8.738  -6.638  14.014  1.00 0.00 ? 2  SER A HB3  9  
ATOM 8306  H HG   . SER A 1 2  ? -7.578  -5.296  15.373  1.00 0.00 ? 2  SER A HG   9  
ATOM 8307  N N    . SER A 1 3  ? -11.334 -8.316  16.097  1.00 0.00 ? 3  SER A N    9  
ATOM 8308  C CA   . SER A 1 3  ? -12.466 -9.157  15.724  1.00 0.00 ? 3  SER A CA   9  
ATOM 8309  C C    . SER A 1 3  ? -13.199 -8.578  14.518  1.00 0.00 ? 3  SER A C    9  
ATOM 8310  O O    . SER A 1 3  ? -13.890 -7.565  14.624  1.00 0.00 ? 3  SER A O    9  
ATOM 8311  C CB   . SER A 1 3  ? -13.432 -9.300  16.902  1.00 0.00 ? 3  SER A CB   9  
ATOM 8312  O OG   . SER A 1 3  ? -12.810 -9.953  17.995  1.00 0.00 ? 3  SER A OG   9  
ATOM 8313  H H    . SER A 1 3  ? -11.437 -7.672  16.829  1.00 0.00 ? 3  SER A H    9  
ATOM 8314  H HA   . SER A 1 3  ? -12.082 -10.132 15.463  1.00 0.00 ? 3  SER A HA   9  
ATOM 8315  H HB2  . SER A 1 3  ? -13.755 -8.320  17.220  1.00 0.00 ? 3  SER A HB2  9  
ATOM 8316  H HB3  . SER A 1 3  ? -14.289 -9.879  16.592  1.00 0.00 ? 3  SER A HB3  9  
ATOM 8317  H HG   . SER A 1 3  ? -11.916 -9.618  18.102  1.00 0.00 ? 3  SER A HG   9  
ATOM 8318  N N    . GLY A 1 4  ? -13.042 -9.229  13.369  1.00 0.00 ? 4  GLY A N    9  
ATOM 8319  C CA   . GLY A 1 4  ? -13.694 -8.765  12.158  1.00 0.00 ? 4  GLY A CA   9  
ATOM 8320  C C    . GLY A 1 4  ? -13.222 -7.388  11.737  1.00 0.00 ? 4  GLY A C    9  
ATOM 8321  O O    . GLY A 1 4  ? -13.101 -6.485  12.565  1.00 0.00 ? 4  GLY A O    9  
ATOM 8322  H H    . GLY A 1 4  ? -12.479 -10.031 13.344  1.00 0.00 ? 4  GLY A H    9  
ATOM 8323  H HA2  . GLY A 1 4  ? -13.489 -9.464  11.362  1.00 0.00 ? 4  GLY A HA2  9  
ATOM 8324  H HA3  . GLY A 1 4  ? -14.760 -8.731  12.328  1.00 0.00 ? 4  GLY A HA3  9  
ATOM 8325  N N    . SER A 1 5  ? -12.952 -7.226  10.445  1.00 0.00 ? 5  SER A N    9  
ATOM 8326  C CA   . SER A 1 5  ? -12.485 -5.950  9.916   1.00 0.00 ? 5  SER A CA   9  
ATOM 8327  C C    . SER A 1 5  ? -12.562 -5.933  8.392   1.00 0.00 ? 5  SER A C    9  
ATOM 8328  O O    . SER A 1 5  ? -12.740 -6.973  7.757   1.00 0.00 ? 5  SER A O    9  
ATOM 8329  C CB   . SER A 1 5  ? -11.048 -5.682  10.368  1.00 0.00 ? 5  SER A CB   9  
ATOM 8330  O OG   . SER A 1 5  ? -10.194 -6.756  10.017  1.00 0.00 ? 5  SER A OG   9  
ATOM 8331  H H    . SER A 1 5  ? -13.068 -7.984  9.834   1.00 0.00 ? 5  SER A H    9  
ATOM 8332  H HA   . SER A 1 5  ? -13.127 -5.174  10.305  1.00 0.00 ? 5  SER A HA   9  
ATOM 8333  H HB2  . SER A 1 5  ? -10.687 -4.781  9.895   1.00 0.00 ? 5  SER A HB2  9  
ATOM 8334  H HB3  . SER A 1 5  ? -11.029 -5.558  11.441  1.00 0.00 ? 5  SER A HB3  9  
ATOM 8335  H HG   . SER A 1 5  ? -10.542 -7.202  9.241   1.00 0.00 ? 5  SER A HG   9  
ATOM 8336  N N    . SER A 1 6  ? -12.427 -4.745  7.812   1.00 0.00 ? 6  SER A N    9  
ATOM 8337  C CA   . SER A 1 6  ? -12.484 -4.591  6.363   1.00 0.00 ? 6  SER A CA   9  
ATOM 8338  C C    . SER A 1 6  ? -11.146 -4.104  5.815   1.00 0.00 ? 6  SER A C    9  
ATOM 8339  O O    . SER A 1 6  ? -10.932 -2.905  5.643   1.00 0.00 ? 6  SER A O    9  
ATOM 8340  C CB   . SER A 1 6  ? -13.593 -3.609  5.978   1.00 0.00 ? 6  SER A CB   9  
ATOM 8341  O OG   . SER A 1 6  ? -13.985 -3.788  4.628   1.00 0.00 ? 6  SER A OG   9  
ATOM 8342  H H    . SER A 1 6  ? -12.287 -3.953  8.373   1.00 0.00 ? 6  SER A H    9  
ATOM 8343  H HA   . SER A 1 6  ? -12.706 -5.557  5.935   1.00 0.00 ? 6  SER A HA   9  
ATOM 8344  H HB2  . SER A 1 6  ? -14.450 -3.771  6.613   1.00 0.00 ? 6  SER A HB2  9  
ATOM 8345  H HB3  . SER A 1 6  ? -13.235 -2.598  6.105   1.00 0.00 ? 6  SER A HB3  9  
ATOM 8346  H HG   . SER A 1 6  ? -14.942 -3.846  4.577   1.00 0.00 ? 6  SER A HG   9  
ATOM 8347  N N    . GLY A 1 7  ? -10.248 -5.046  5.542   1.00 0.00 ? 7  GLY A N    9  
ATOM 8348  C CA   . GLY A 1 7  ? -8.942  -4.696  5.016   1.00 0.00 ? 7  GLY A CA   9  
ATOM 8349  C C    . GLY A 1 7  ? -7.988  -5.874  5.000   1.00 0.00 ? 7  GLY A C    9  
ATOM 8350  O O    . GLY A 1 7  ? -7.822  -6.563  6.007   1.00 0.00 ? 7  GLY A O    9  
ATOM 8351  H H    . GLY A 1 7  ? -10.474 -5.987  5.700   1.00 0.00 ? 7  GLY A H    9  
ATOM 8352  H HA2  . GLY A 1 7  ? -9.059  -4.326  4.009   1.00 0.00 ? 7  GLY A HA2  9  
ATOM 8353  H HA3  . GLY A 1 7  ? -8.518  -3.914  5.629   1.00 0.00 ? 7  GLY A HA3  9  
ATOM 8354  N N    . THR A 1 8  ? -7.360  -6.108  3.852   1.00 0.00 ? 8  THR A N    9  
ATOM 8355  C CA   . THR A 1 8  ? -6.420  -7.213  3.707   1.00 0.00 ? 8  THR A CA   9  
ATOM 8356  C C    . THR A 1 8  ? -4.997  -6.769  4.024   1.00 0.00 ? 8  THR A C    9  
ATOM 8357  O O    . THR A 1 8  ? -4.550  -5.696  3.619   1.00 0.00 ? 8  THR A O    9  
ATOM 8358  C CB   . THR A 1 8  ? -6.458  -7.799  2.283   1.00 0.00 ? 8  THR A CB   9  
ATOM 8359  O OG1  . THR A 1 8  ? -7.803  -8.135  1.927   1.00 0.00 ? 8  THR A OG1  9  
ATOM 8360  C CG2  . THR A 1 8  ? -5.577  -9.036  2.183   1.00 0.00 ? 8  THR A CG2  9  
ATOM 8361  H H    . THR A 1 8  ? -7.534  -5.524  3.085   1.00 0.00 ? 8  THR A H    9  
ATOM 8362  H HA   . THR A 1 8  ? -6.708  -7.989  4.401   1.00 0.00 ? 8  THR A HA   9  
ATOM 8363  H HB   . THR A 1 8  ? -6.086  -7.054  1.593   1.00 0.00 ? 8  THR A HB   9  
ATOM 8364  H HG1  . THR A 1 8  ? -8.047  -8.966  2.344   1.00 0.00 ? 8  THR A HG1  9  
ATOM 8365  H HG21 . THR A 1 8  ? -5.463  -9.314  1.146   1.00 0.00 ? 8  THR A HG21 9  
ATOM 8366  H HG22 . THR A 1 8  ? -6.035  -9.848  2.726   1.00 0.00 ? 8  THR A HG22 9  
ATOM 8367  H HG23 . THR A 1 8  ? -4.607  -8.821  2.606   1.00 0.00 ? 8  THR A HG23 9  
ATOM 8368  N N    . PRO A 1 9  ? -4.264  -7.613  4.765   1.00 0.00 ? 9  PRO A N    9  
ATOM 8369  C CA   . PRO A 1 9  ? -2.879  -7.330  5.152   1.00 0.00 ? 9  PRO A CA   9  
ATOM 8370  C C    . PRO A 1 9  ? -1.923  -7.387  3.966   1.00 0.00 ? 9  PRO A C    9  
ATOM 8371  O O    . PRO A 1 9  ? -2.111  -8.178  3.042   1.00 0.00 ? 9  PRO A O    9  
ATOM 8372  C CB   . PRO A 1 9  ? -2.556  -8.441  6.154   1.00 0.00 ? 9  PRO A CB   9  
ATOM 8373  C CG   . PRO A 1 9  ? -3.473  -9.557  5.790   1.00 0.00 ? 9  PRO A CG   9  
ATOM 8374  C CD   . PRO A 1 9  ? -4.732  -8.910  5.283   1.00 0.00 ? 9  PRO A CD   9  
ATOM 8375  H HA   . PRO A 1 9  ? -2.792  -6.369  5.638   1.00 0.00 ? 9  PRO A HA   9  
ATOM 8376  H HB2  . PRO A 1 9  ? -1.519  -8.731  6.052   1.00 0.00 ? 9  PRO A HB2  9  
ATOM 8377  H HB3  . PRO A 1 9  ? -2.740  -8.090  7.158   1.00 0.00 ? 9  PRO A HB3  9  
ATOM 8378  H HG2  . PRO A 1 9  ? -3.025  -10.164 5.018   1.00 0.00 ? 9  PRO A HG2  9  
ATOM 8379  H HG3  . PRO A 1 9  ? -3.685  -10.156 6.663   1.00 0.00 ? 9  PRO A HG3  9  
ATOM 8380  H HD2  . PRO A 1 9  ? -5.170  -9.505  4.495   1.00 0.00 ? 9  PRO A HD2  9  
ATOM 8381  H HD3  . PRO A 1 9  ? -5.436  -8.771  6.090   1.00 0.00 ? 9  PRO A HD3  9  
ATOM 8382  N N    . TYR A 1 10 ? -0.896  -6.544  3.999   1.00 0.00 ? 10 TYR A N    9  
ATOM 8383  C CA   . TYR A 1 10 ? 0.089   -6.497  2.925   1.00 0.00 ? 10 TYR A CA   9  
ATOM 8384  C C    . TYR A 1 10 ? 1.483   -6.216  3.476   1.00 0.00 ? 10 TYR A C    9  
ATOM 8385  O O    . TYR A 1 10 ? 1.662   -6.041  4.682   1.00 0.00 ? 10 TYR A O    9  
ATOM 8386  C CB   . TYR A 1 10 ? -0.292  -5.427  1.900   1.00 0.00 ? 10 TYR A CB   9  
ATOM 8387  C CG   . TYR A 1 10 ? -1.173  -5.943  0.785   1.00 0.00 ? 10 TYR A CG   9  
ATOM 8388  C CD1  . TYR A 1 10 ? -2.469  -6.374  1.040   1.00 0.00 ? 10 TYR A CD1  9  
ATOM 8389  C CD2  . TYR A 1 10 ? -0.709  -6.000  -0.523  1.00 0.00 ? 10 TYR A CD2  9  
ATOM 8390  C CE1  . TYR A 1 10 ? -3.277  -6.847  0.024   1.00 0.00 ? 10 TYR A CE1  9  
ATOM 8391  C CE2  . TYR A 1 10 ? -1.510  -6.470  -1.546  1.00 0.00 ? 10 TYR A CE2  9  
ATOM 8392  C CZ   . TYR A 1 10 ? -2.794  -6.892  -1.267  1.00 0.00 ? 10 TYR A CZ   9  
ATOM 8393  O OH   . TYR A 1 10 ? -3.595  -7.362  -2.283  1.00 0.00 ? 10 TYR A OH   9  
ATOM 8394  H H    . TYR A 1 10 ? -0.800  -5.937  4.762   1.00 0.00 ? 10 TYR A H    9  
ATOM 8395  H HA   . TYR A 1 10 ? 0.095   -7.461  2.438   1.00 0.00 ? 10 TYR A HA   9  
ATOM 8396  H HB2  . TYR A 1 10 ? -0.824  -4.632  2.401   1.00 0.00 ? 10 TYR A HB2  9  
ATOM 8397  H HB3  . TYR A 1 10 ? 0.607   -5.028  1.456   1.00 0.00 ? 10 TYR A HB3  9  
ATOM 8398  H HD1  . TYR A 1 10 ? -2.845  -6.337  2.052   1.00 0.00 ? 10 TYR A HD1  9  
ATOM 8399  H HD2  . TYR A 1 10 ? 0.297   -5.669  -0.738  1.00 0.00 ? 10 TYR A HD2  9  
ATOM 8400  H HE1  . TYR A 1 10 ? -4.282  -7.177  0.241   1.00 0.00 ? 10 TYR A HE1  9  
ATOM 8401  H HE2  . TYR A 1 10 ? -1.132  -6.506  -2.556  1.00 0.00 ? 10 TYR A HE2  9  
ATOM 8402  H HH   . TYR A 1 10 ? -4.471  -6.978  -2.203  1.00 0.00 ? 10 TYR A HH   9  
ATOM 8403  N N    . ARG A 1 11 ? 2.467   -6.172  2.584   1.00 0.00 ? 11 ARG A N    9  
ATOM 8404  C CA   . ARG A 1 11 ? 3.846   -5.912  2.980   1.00 0.00 ? 11 ARG A CA   9  
ATOM 8405  C C    . ARG A 1 11 ? 4.568   -5.080  1.924   1.00 0.00 ? 11 ARG A C    9  
ATOM 8406  O O    . ARG A 1 11 ? 4.526   -5.396  0.735   1.00 0.00 ? 11 ARG A O    9  
ATOM 8407  C CB   . ARG A 1 11 ? 4.592   -7.229  3.204   1.00 0.00 ? 11 ARG A CB   9  
ATOM 8408  C CG   . ARG A 1 11 ? 6.099   -7.064  3.314   1.00 0.00 ? 11 ARG A CG   9  
ATOM 8409  C CD   . ARG A 1 11 ? 6.714   -8.141  4.195   1.00 0.00 ? 11 ARG A CD   9  
ATOM 8410  N NE   . ARG A 1 11 ? 8.102   -8.417  3.833   1.00 0.00 ? 11 ARG A NE   9  
ATOM 8411  C CZ   . ARG A 1 11 ? 8.724   -9.555  4.121   1.00 0.00 ? 11 ARG A CZ   9  
ATOM 8412  N NH1  . ARG A 1 11 ? 8.085   -10.517 4.773   1.00 0.00 ? 11 ARG A NH1  9  
ATOM 8413  N NH2  . ARG A 1 11 ? 9.988   -9.732  3.758   1.00 0.00 ? 11 ARG A NH2  9  
ATOM 8414  H H    . ARG A 1 11 ? 2.262   -6.319  1.637   1.00 0.00 ? 11 ARG A H    9  
ATOM 8415  H HA   . ARG A 1 11 ? 3.827   -5.358  3.907   1.00 0.00 ? 11 ARG A HA   9  
ATOM 8416  H HB2  . ARG A 1 11 ? 4.234   -7.681  4.117   1.00 0.00 ? 11 ARG A HB2  9  
ATOM 8417  H HB3  . ARG A 1 11 ? 4.383   -7.892  2.378   1.00 0.00 ? 11 ARG A HB3  9  
ATOM 8418  H HG2  . ARG A 1 11 ? 6.532   -7.132  2.327   1.00 0.00 ? 11 ARG A HG2  9  
ATOM 8419  H HG3  . ARG A 1 11 ? 6.316   -6.096  3.739   1.00 0.00 ? 11 ARG A HG3  9  
ATOM 8420  H HD2  . ARG A 1 11 ? 6.679   -7.810  5.222   1.00 0.00 ? 11 ARG A HD2  9  
ATOM 8421  H HD3  . ARG A 1 11 ? 6.136   -9.047  4.089   1.00 0.00 ? 11 ARG A HD3  9  
ATOM 8422  H HE   . ARG A 1 11 ? 8.592   -7.720  3.351   1.00 0.00 ? 11 ARG A HE   9  
ATOM 8423  H HH11 . ARG A 1 11 ? 7.132   -10.387 5.047   1.00 0.00 ? 11 ARG A HH11 9  
ATOM 8424  H HH12 . ARG A 1 11 ? 8.556   -11.373 4.988   1.00 0.00 ? 11 ARG A HH12 9  
ATOM 8425  H HH21 . ARG A 1 11 ? 10.473  -9.009  3.267   1.00 0.00 ? 11 ARG A HH21 9  
ATOM 8426  H HH22 . ARG A 1 11 ? 10.455  -10.588 3.976   1.00 0.00 ? 11 ARG A HH22 9  
ATOM 8427  N N    . ALA A 1 12 ? 5.228   -4.015  2.367   1.00 0.00 ? 12 ALA A N    9  
ATOM 8428  C CA   . ALA A 1 12 ? 5.959   -3.138  1.460   1.00 0.00 ? 12 ALA A CA   9  
ATOM 8429  C C    . ALA A 1 12 ? 7.314   -3.734  1.095   1.00 0.00 ? 12 ALA A C    9  
ATOM 8430  O O    . ALA A 1 12 ? 8.277   -3.622  1.853   1.00 0.00 ? 12 ALA A O    9  
ATOM 8431  C CB   . ALA A 1 12 ? 6.136   -1.762  2.085   1.00 0.00 ? 12 ALA A CB   9  
ATOM 8432  H H    . ALA A 1 12 ? 5.224   -3.814  3.326   1.00 0.00 ? 12 ALA A H    9  
ATOM 8433  H HA   . ALA A 1 12 ? 5.372   -3.025  0.560   1.00 0.00 ? 12 ALA A HA   9  
ATOM 8434  H HB1  . ALA A 1 12 ? 6.366   -1.044  1.311   1.00 0.00 ? 12 ALA A HB1  9  
ATOM 8435  H HB2  . ALA A 1 12 ? 5.224   -1.474  2.585   1.00 0.00 ? 12 ALA A HB2  9  
ATOM 8436  H HB3  . ALA A 1 12 ? 6.945   -1.793  2.800   1.00 0.00 ? 12 ALA A HB3  9  
ATOM 8437  N N    . MET A 1 13 ? 7.382   -4.368  -0.071  1.00 0.00 ? 13 MET A N    9  
ATOM 8438  C CA   . MET A 1 13 ? 8.620   -4.982  -0.537  1.00 0.00 ? 13 MET A CA   9  
ATOM 8439  C C    . MET A 1 13 ? 9.740   -3.949  -0.622  1.00 0.00 ? 13 MET A C    9  
ATOM 8440  O O    . MET A 1 13 ? 10.919  -4.287  -0.516  1.00 0.00 ? 13 MET A O    9  
ATOM 8441  C CB   . MET A 1 13 ? 8.408   -5.636  -1.903  1.00 0.00 ? 13 MET A CB   9  
ATOM 8442  C CG   . MET A 1 13 ? 7.218   -6.580  -1.947  1.00 0.00 ? 13 MET A CG   9  
ATOM 8443  S SD   . MET A 1 13 ? 7.365   -7.824  -3.244  1.00 0.00 ? 13 MET A SD   9  
ATOM 8444  C CE   . MET A 1 13 ? 6.538   -6.998  -4.601  1.00 0.00 ? 13 MET A CE   9  
ATOM 8445  H H    . MET A 1 13 ? 6.580   -4.425  -0.633  1.00 0.00 ? 13 MET A H    9  
ATOM 8446  H HA   . MET A 1 13 ? 8.902   -5.742  0.176   1.00 0.00 ? 13 MET A HA   9  
ATOM 8447  H HB2  . MET A 1 13 ? 8.254   -4.861  -2.640  1.00 0.00 ? 13 MET A HB2  9  
ATOM 8448  H HB3  . MET A 1 13 ? 9.294   -6.196  -2.162  1.00 0.00 ? 13 MET A HB3  9  
ATOM 8449  H HG2  . MET A 1 13 ? 7.137   -7.082  -0.995  1.00 0.00 ? 13 MET A HG2  9  
ATOM 8450  H HG3  . MET A 1 13 ? 6.323   -6.000  -2.123  1.00 0.00 ? 13 MET A HG3  9  
ATOM 8451  H HE1  . MET A 1 13 ? 6.679   -7.568  -5.508  1.00 0.00 ? 13 MET A HE1  9  
ATOM 8452  H HE2  . MET A 1 13 ? 5.483   -6.919  -4.385  1.00 0.00 ? 13 MET A HE2  9  
ATOM 8453  H HE3  . MET A 1 13 ? 6.956   -6.010  -4.728  1.00 0.00 ? 13 MET A HE3  9  
ATOM 8454  N N    . TYR A 1 14 ? 9.363   -2.690  -0.815  1.00 0.00 ? 14 TYR A N    9  
ATOM 8455  C CA   . TYR A 1 14 ? 10.335  -1.608  -0.918  1.00 0.00 ? 14 TYR A CA   9  
ATOM 8456  C C    . TYR A 1 14 ? 9.778   -0.316  -0.328  1.00 0.00 ? 14 TYR A C    9  
ATOM 8457  O O    . TYR A 1 14 ? 8.569   -0.086  -0.342  1.00 0.00 ? 14 TYR A O    9  
ATOM 8458  C CB   . TYR A 1 14 ? 10.730  -1.386  -2.379  1.00 0.00 ? 14 TYR A CB   9  
ATOM 8459  C CG   . TYR A 1 14 ? 10.711  -2.649  -3.210  1.00 0.00 ? 14 TYR A CG   9  
ATOM 8460  C CD1  . TYR A 1 14 ? 11.680  -3.631  -3.039  1.00 0.00 ? 14 TYR A CD1  9  
ATOM 8461  C CD2  . TYR A 1 14 ? 9.726   -2.860  -4.166  1.00 0.00 ? 14 TYR A CD2  9  
ATOM 8462  C CE1  . TYR A 1 14 ? 11.667  -4.786  -3.797  1.00 0.00 ? 14 TYR A CE1  9  
ATOM 8463  C CE2  . TYR A 1 14 ? 9.705   -4.013  -4.927  1.00 0.00 ? 14 TYR A CE2  9  
ATOM 8464  C CZ   . TYR A 1 14 ? 10.677  -4.973  -4.739  1.00 0.00 ? 14 TYR A CZ   9  
ATOM 8465  O OH   . TYR A 1 14 ? 10.660  -6.122  -5.496  1.00 0.00 ? 14 TYR A OH   9  
ATOM 8466  H H    . TYR A 1 14 ? 8.408   -2.482  -0.892  1.00 0.00 ? 14 TYR A H    9  
ATOM 8467  H HA   . TYR A 1 14 ? 11.213  -1.897  -0.358  1.00 0.00 ? 14 TYR A HA   9  
ATOM 8468  H HB2  . TYR A 1 14 ? 10.044  -0.684  -2.827  1.00 0.00 ? 14 TYR A HB2  9  
ATOM 8469  H HB3  . TYR A 1 14 ? 11.730  -0.979  -2.416  1.00 0.00 ? 14 TYR A HB3  9  
ATOM 8470  H HD1  . TYR A 1 14 ? 12.454  -3.482  -2.300  1.00 0.00 ? 14 TYR A HD1  9  
ATOM 8471  H HD2  . TYR A 1 14 ? 8.966   -2.106  -4.311  1.00 0.00 ? 14 TYR A HD2  9  
ATOM 8472  H HE1  . TYR A 1 14 ? 12.428  -5.538  -3.649  1.00 0.00 ? 14 TYR A HE1  9  
ATOM 8473  H HE2  . TYR A 1 14 ? 8.930   -4.159  -5.665  1.00 0.00 ? 14 TYR A HE2  9  
ATOM 8474  H HH   . TYR A 1 14 ? 11.535  -6.278  -5.859  1.00 0.00 ? 14 TYR A HH   9  
ATOM 8475  N N    . GLN A 1 15 ? 10.669  0.523   0.190   1.00 0.00 ? 15 GLN A N    9  
ATOM 8476  C CA   . GLN A 1 15 ? 10.267  1.792   0.786   1.00 0.00 ? 15 GLN A CA   9  
ATOM 8477  C C    . GLN A 1 15 ? 9.823   2.780   -0.288  1.00 0.00 ? 15 GLN A C    9  
ATOM 8478  O O    . GLN A 1 15 ? 10.351  2.783   -1.400  1.00 0.00 ? 15 GLN A O    9  
ATOM 8479  C CB   . GLN A 1 15 ? 11.419  2.386   1.598   1.00 0.00 ? 15 GLN A CB   9  
ATOM 8480  C CG   . GLN A 1 15 ? 11.067  3.695   2.286   1.00 0.00 ? 15 GLN A CG   9  
ATOM 8481  C CD   . GLN A 1 15 ? 12.289  4.435   2.793   1.00 0.00 ? 15 GLN A CD   9  
ATOM 8482  O OE1  . GLN A 1 15 ? 13.419  3.976   2.630   1.00 0.00 ? 15 GLN A OE1  9  
ATOM 8483  N NE2  . GLN A 1 15 ? 12.067  5.589   3.412   1.00 0.00 ? 15 GLN A NE2  9  
ATOM 8484  H H    . GLN A 1 15 ? 11.619  0.283   0.172   1.00 0.00 ? 15 GLN A H    9  
ATOM 8485  H HA   . GLN A 1 15 ? 9.435   1.599   1.446   1.00 0.00 ? 15 GLN A HA   9  
ATOM 8486  H HB2  . GLN A 1 15 ? 11.716  1.675   2.354   1.00 0.00 ? 15 GLN A HB2  9  
ATOM 8487  H HB3  . GLN A 1 15 ? 12.254  2.566   0.937   1.00 0.00 ? 15 GLN A HB3  9  
ATOM 8488  H HG2  . GLN A 1 15 ? 10.548  4.329   1.582   1.00 0.00 ? 15 GLN A HG2  9  
ATOM 8489  H HG3  . GLN A 1 15 ? 10.418  3.483   3.123   1.00 0.00 ? 15 GLN A HG3  9  
ATOM 8490  H HE21 . GLN A 1 15 ? 11.140  5.892   3.507   1.00 0.00 ? 15 GLN A HE21 9  
ATOM 8491  H HE22 . GLN A 1 15 ? 12.839  6.088   3.751   1.00 0.00 ? 15 GLN A HE22 9  
ATOM 8492  N N    . TYR A 1 16 ? 8.849   3.617   0.053   1.00 0.00 ? 16 TYR A N    9  
ATOM 8493  C CA   . TYR A 1 16 ? 8.331   4.608   -0.883  1.00 0.00 ? 16 TYR A CA   9  
ATOM 8494  C C    . TYR A 1 16 ? 8.557   6.023   -0.358  1.00 0.00 ? 16 TYR A C    9  
ATOM 8495  O O    . TYR A 1 16 ? 8.605   6.247   0.852   1.00 0.00 ? 16 TYR A O    9  
ATOM 8496  C CB   . TYR A 1 16 ? 6.840   4.376   -1.132  1.00 0.00 ? 16 TYR A CB   9  
ATOM 8497  C CG   . TYR A 1 16 ? 6.236   5.338   -2.130  1.00 0.00 ? 16 TYR A CG   9  
ATOM 8498  C CD1  . TYR A 1 16 ? 6.488   5.208   -3.490  1.00 0.00 ? 16 TYR A CD1  9  
ATOM 8499  C CD2  . TYR A 1 16 ? 5.411   6.375   -1.712  1.00 0.00 ? 16 TYR A CD2  9  
ATOM 8500  C CE1  . TYR A 1 16 ? 5.938   6.085   -4.405  1.00 0.00 ? 16 TYR A CE1  9  
ATOM 8501  C CE2  . TYR A 1 16 ? 4.856   7.256   -2.620  1.00 0.00 ? 16 TYR A CE2  9  
ATOM 8502  C CZ   . TYR A 1 16 ? 5.123   7.107   -3.965  1.00 0.00 ? 16 TYR A CZ   9  
ATOM 8503  O OH   . TYR A 1 16 ? 4.572   7.982   -4.873  1.00 0.00 ? 16 TYR A OH   9  
ATOM 8504  H H    . TYR A 1 16 ? 8.467   3.566   0.954   1.00 0.00 ? 16 TYR A H    9  
ATOM 8505  H HA   . TYR A 1 16 ? 8.864   4.494   -1.816  1.00 0.00 ? 16 TYR A HA   9  
ATOM 8506  H HB2  . TYR A 1 16 ? 6.697   3.375   -1.508  1.00 0.00 ? 16 TYR A HB2  9  
ATOM 8507  H HB3  . TYR A 1 16 ? 6.305   4.485   -0.200  1.00 0.00 ? 16 TYR A HB3  9  
ATOM 8508  H HD1  . TYR A 1 16 ? 7.127   4.406   -3.831  1.00 0.00 ? 16 TYR A HD1  9  
ATOM 8509  H HD2  . TYR A 1 16 ? 5.204   6.489   -0.658  1.00 0.00 ? 16 TYR A HD2  9  
ATOM 8510  H HE1  . TYR A 1 16 ? 6.147   5.969   -5.458  1.00 0.00 ? 16 TYR A HE1  9  
ATOM 8511  H HE2  . TYR A 1 16 ? 4.218   8.057   -2.276  1.00 0.00 ? 16 TYR A HE2  9  
ATOM 8512  H HH   . TYR A 1 16 ? 4.668   8.881   -4.550  1.00 0.00 ? 16 TYR A HH   9  
ATOM 8513  N N    . ARG A 1 17 ? 8.693   6.973   -1.276  1.00 0.00 ? 17 ARG A N    9  
ATOM 8514  C CA   . ARG A 1 17 ? 8.913   8.366   -0.907  1.00 0.00 ? 17 ARG A CA   9  
ATOM 8515  C C    . ARG A 1 17 ? 7.844   9.267   -1.520  1.00 0.00 ? 17 ARG A C    9  
ATOM 8516  O O    . ARG A 1 17 ? 8.002   9.799   -2.619  1.00 0.00 ? 17 ARG A O    9  
ATOM 8517  C CB   . ARG A 1 17 ? 10.301  8.823   -1.361  1.00 0.00 ? 17 ARG A CB   9  
ATOM 8518  C CG   . ARG A 1 17 ? 11.437  8.198   -0.568  1.00 0.00 ? 17 ARG A CG   9  
ATOM 8519  C CD   . ARG A 1 17 ? 12.748  8.934   -0.798  1.00 0.00 ? 17 ARG A CD   9  
ATOM 8520  N NE   . ARG A 1 17 ? 13.487  8.393   -1.936  1.00 0.00 ? 17 ARG A NE   9  
ATOM 8521  C CZ   . ARG A 1 17 ? 14.525  9.003   -2.495  1.00 0.00 ? 17 ARG A CZ   9  
ATOM 8522  N NH1  . ARG A 1 17 ? 14.946  10.169  -2.024  1.00 0.00 ? 17 ARG A NH1  9  
ATOM 8523  N NH2  . ARG A 1 17 ? 15.146  8.447   -3.528  1.00 0.00 ? 17 ARG A NH2  9  
ATOM 8524  H H    . ARG A 1 17 ? 8.645   6.732   -2.225  1.00 0.00 ? 17 ARG A H    9  
ATOM 8525  H HA   . ARG A 1 17 ? 8.854   8.438   0.168   1.00 0.00 ? 17 ARG A HA   9  
ATOM 8526  H HB2  . ARG A 1 17 ? 10.431  8.561   -2.401  1.00 0.00 ? 17 ARG A HB2  9  
ATOM 8527  H HB3  . ARG A 1 17 ? 10.366  9.895   -1.257  1.00 0.00 ? 17 ARG A HB3  9  
ATOM 8528  H HG2  . ARG A 1 17 ? 11.195  8.239   0.484   1.00 0.00 ? 17 ARG A HG2  9  
ATOM 8529  H HG3  . ARG A 1 17 ? 11.553  7.169   -0.873  1.00 0.00 ? 17 ARG A HG3  9  
ATOM 8530  H HD2  . ARG A 1 17 ? 12.533  9.976   -0.984  1.00 0.00 ? 17 ARG A HD2  9  
ATOM 8531  H HD3  . ARG A 1 17 ? 13.356  8.845   0.090   1.00 0.00 ? 17 ARG A HD3  9  
ATOM 8532  H HE   . ARG A 1 17 ? 13.193  7.532   -2.300  1.00 0.00 ? 17 ARG A HE   9  
ATOM 8533  H HH11 . ARG A 1 17 ? 14.481  10.590  -1.245  1.00 0.00 ? 17 ARG A HH11 9  
ATOM 8534  H HH12 . ARG A 1 17 ? 15.729  10.626  -2.446  1.00 0.00 ? 17 ARG A HH12 9  
ATOM 8535  H HH21 . ARG A 1 17 ? 14.832  7.568   -3.885  1.00 0.00 ? 17 ARG A HH21 9  
ATOM 8536  H HH22 . ARG A 1 17 ? 15.927  8.908   -3.948  1.00 0.00 ? 17 ARG A HH22 9  
ATOM 8537  N N    . PRO A 1 18 ? 6.730   9.441   -0.794  1.00 0.00 ? 18 PRO A N    9  
ATOM 8538  C CA   . PRO A 1 18 ? 5.613   10.276  -1.246  1.00 0.00 ? 18 PRO A CA   9  
ATOM 8539  C C    . PRO A 1 18 ? 5.963   11.761  -1.246  1.00 0.00 ? 18 PRO A C    9  
ATOM 8540  O O    . PRO A 1 18 ? 6.352   12.315  -0.219  1.00 0.00 ? 18 PRO A O    9  
ATOM 8541  C CB   . PRO A 1 18 ? 4.515   9.986   -0.220  1.00 0.00 ? 18 PRO A CB   9  
ATOM 8542  C CG   . PRO A 1 18 ? 5.245   9.557   1.005   1.00 0.00 ? 18 PRO A CG   9  
ATOM 8543  C CD   . PRO A 1 18 ? 6.474   8.837   0.524   1.00 0.00 ? 18 PRO A CD   9  
ATOM 8544  H HA   . PRO A 1 18 ? 5.275   9.987   -2.230  1.00 0.00 ? 18 PRO A HA   9  
ATOM 8545  H HB2  . PRO A 1 18 ? 3.938   10.882  -0.044  1.00 0.00 ? 18 PRO A HB2  9  
ATOM 8546  H HB3  . PRO A 1 18 ? 3.870   9.203   -0.590  1.00 0.00 ? 18 PRO A HB3  9  
ATOM 8547  H HG2  . PRO A 1 18 ? 5.522   10.421  1.590   1.00 0.00 ? 18 PRO A HG2  9  
ATOM 8548  H HG3  . PRO A 1 18 ? 4.625   8.891   1.588   1.00 0.00 ? 18 PRO A HG3  9  
ATOM 8549  H HD2  . PRO A 1 18 ? 7.302   9.012   1.196   1.00 0.00 ? 18 PRO A HD2  9  
ATOM 8550  H HD3  . PRO A 1 18 ? 6.279   7.778   0.431   1.00 0.00 ? 18 PRO A HD3  9  
ATOM 8551  N N    . GLN A 1 19 ? 5.820   12.397  -2.404  1.00 0.00 ? 19 GLN A N    9  
ATOM 8552  C CA   . GLN A 1 19 ? 6.121   13.818  -2.537  1.00 0.00 ? 19 GLN A CA   9  
ATOM 8553  C C    . GLN A 1 19 ? 5.175   14.657  -1.684  1.00 0.00 ? 19 GLN A C    9  
ATOM 8554  O O    . GLN A 1 19 ? 5.529   15.746  -1.236  1.00 0.00 ? 19 GLN A O    9  
ATOM 8555  C CB   . GLN A 1 19 ? 6.023   14.247  -4.002  1.00 0.00 ? 19 GLN A CB   9  
ATOM 8556  C CG   . GLN A 1 19 ? 6.910   13.437  -4.934  1.00 0.00 ? 19 GLN A CG   9  
ATOM 8557  C CD   . GLN A 1 19 ? 6.812   13.893  -6.376  1.00 0.00 ? 19 GLN A CD   9  
ATOM 8558  O OE1  . GLN A 1 19 ? 6.404   13.132  -7.254  1.00 0.00 ? 19 GLN A OE1  9  
ATOM 8559  N NE2  . GLN A 1 19 ? 7.185   15.142  -6.629  1.00 0.00 ? 19 GLN A NE2  9  
ATOM 8560  H H    . GLN A 1 19 ? 5.506   11.900  -3.187  1.00 0.00 ? 19 GLN A H    9  
ATOM 8561  H HA   . GLN A 1 19 ? 7.132   13.975  -2.192  1.00 0.00 ? 19 GLN A HA   9  
ATOM 8562  H HB2  . GLN A 1 19 ? 5.000   14.138  -4.329  1.00 0.00 ? 19 GLN A HB2  9  
ATOM 8563  H HB3  . GLN A 1 19 ? 6.310   15.285  -4.080  1.00 0.00 ? 19 GLN A HB3  9  
ATOM 8564  H HG2  . GLN A 1 19 ? 7.936   13.536  -4.611  1.00 0.00 ? 19 GLN A HG2  9  
ATOM 8565  H HG3  . GLN A 1 19 ? 6.615   12.399  -4.879  1.00 0.00 ? 19 GLN A HG3  9  
ATOM 8566  H HE21 . GLN A 1 19 ? 7.501   15.691  -5.880  1.00 0.00 ? 19 GLN A HE21 9  
ATOM 8567  H HE22 . GLN A 1 19 ? 7.133   15.463  -7.552  1.00 0.00 ? 19 GLN A HE22 9  
ATOM 8568  N N    . ASN A 1 20 ? 3.970   14.141  -1.465  1.00 0.00 ? 20 ASN A N    9  
ATOM 8569  C CA   . ASN A 1 20 ? 2.972   14.844  -0.667  1.00 0.00 ? 20 ASN A CA   9  
ATOM 8570  C C    . ASN A 1 20 ? 2.348   13.912  0.367   1.00 0.00 ? 20 ASN A C    9  
ATOM 8571  O O    . ASN A 1 20 ? 2.666   12.724  0.418   1.00 0.00 ? 20 ASN A O    9  
ATOM 8572  C CB   . ASN A 1 20 ? 1.882   15.424  -1.571  1.00 0.00 ? 20 ASN A CB   9  
ATOM 8573  C CG   . ASN A 1 20 ? 1.497   14.478  -2.692  1.00 0.00 ? 20 ASN A CG   9  
ATOM 8574  O OD1  . ASN A 1 20 ? 0.978   13.389  -2.450  1.00 0.00 ? 20 ASN A OD1  9  
ATOM 8575  N ND2  . ASN A 1 20 ? 1.751   14.892  -3.928  1.00 0.00 ? 20 ASN A ND2  9  
ATOM 8576  H H    . ASN A 1 20 ? 3.746   13.268  -1.850  1.00 0.00 ? 20 ASN A H    9  
ATOM 8577  H HA   . ASN A 1 20 ? 3.469   15.653  -0.153  1.00 0.00 ? 20 ASN A HA   9  
ATOM 8578  H HB2  . ASN A 1 20 ? 1.001   15.626  -0.978  1.00 0.00 ? 20 ASN A HB2  9  
ATOM 8579  H HB3  . ASN A 1 20 ? 2.236   16.346  -2.007  1.00 0.00 ? 20 ASN A HB3  9  
ATOM 8580  H HD21 . ASN A 1 20 ? 2.167   15.772  -4.046  1.00 0.00 ? 20 ASN A HD21 9  
ATOM 8581  H HD22 . ASN A 1 20 ? 1.512   14.301  -4.672  1.00 0.00 ? 20 ASN A HD22 9  
ATOM 8582  N N    . GLU A 1 21 ? 1.458   14.460  1.189   1.00 0.00 ? 21 GLU A N    9  
ATOM 8583  C CA   . GLU A 1 21 ? 0.789   13.677  2.221   1.00 0.00 ? 21 GLU A CA   9  
ATOM 8584  C C    . GLU A 1 21 ? -0.268  12.761  1.611   1.00 0.00 ? 21 GLU A C    9  
ATOM 8585  O O    . GLU A 1 21 ? -0.541  11.678  2.130   1.00 0.00 ? 21 GLU A O    9  
ATOM 8586  C CB   . GLU A 1 21 ? 0.144   14.601  3.256   1.00 0.00 ? 21 GLU A CB   9  
ATOM 8587  C CG   . GLU A 1 21 ? 1.132   15.188  4.249   1.00 0.00 ? 21 GLU A CG   9  
ATOM 8588  C CD   . GLU A 1 21 ? 0.496   16.211  5.170   1.00 0.00 ? 21 GLU A CD   9  
ATOM 8589  O OE1  . GLU A 1 21 ? 0.156   17.312  4.687   1.00 0.00 ? 21 GLU A OE1  9  
ATOM 8590  O OE2  . GLU A 1 21 ? 0.340   15.913  6.372   1.00 0.00 ? 21 GLU A OE2  9  
ATOM 8591  H H    . GLU A 1 21 ? 1.246   15.412  1.098   1.00 0.00 ? 21 GLU A H    9  
ATOM 8592  H HA   . GLU A 1 21 ? 1.535   13.069  2.711   1.00 0.00 ? 21 GLU A HA   9  
ATOM 8593  H HB2  . GLU A 1 21 ? -0.343  15.415  2.739   1.00 0.00 ? 21 GLU A HB2  9  
ATOM 8594  H HB3  . GLU A 1 21 ? -0.598  14.042  3.806   1.00 0.00 ? 21 GLU A HB3  9  
ATOM 8595  H HG2  . GLU A 1 21 ? 1.536   14.387  4.851   1.00 0.00 ? 21 GLU A HG2  9  
ATOM 8596  H HG3  . GLU A 1 21 ? 1.932   15.665  3.702   1.00 0.00 ? 21 GLU A HG3  9  
ATOM 8597  N N    . ASP A 1 22 ? -0.859  13.203  0.508   1.00 0.00 ? 22 ASP A N    9  
ATOM 8598  C CA   . ASP A 1 22 ? -1.886  12.424  -0.174  1.00 0.00 ? 22 ASP A CA   9  
ATOM 8599  C C    . ASP A 1 22 ? -1.454  10.969  -0.325  1.00 0.00 ? 22 ASP A C    9  
ATOM 8600  O O    . ASP A 1 22 ? -2.206  10.052  0.002   1.00 0.00 ? 22 ASP A O    9  
ATOM 8601  C CB   . ASP A 1 22 ? -2.185  13.026  -1.549  1.00 0.00 ? 22 ASP A CB   9  
ATOM 8602  C CG   . ASP A 1 22 ? -3.190  14.159  -1.479  1.00 0.00 ? 22 ASP A CG   9  
ATOM 8603  O OD1  . ASP A 1 22 ? -4.168  14.037  -0.713  1.00 0.00 ? 22 ASP A OD1  9  
ATOM 8604  O OD2  . ASP A 1 22 ? -2.999  15.167  -2.191  1.00 0.00 ? 22 ASP A OD2  9  
ATOM 8605  H H    . ASP A 1 22 ? -0.599  14.075  0.142   1.00 0.00 ? 22 ASP A H    9  
ATOM 8606  H HA   . ASP A 1 22 ? -2.783  12.460  0.426   1.00 0.00 ? 22 ASP A HA   9  
ATOM 8607  H HB2  . ASP A 1 22 ? -1.268  13.409  -1.974  1.00 0.00 ? 22 ASP A HB2  9  
ATOM 8608  H HB3  . ASP A 1 22 ? -2.581  12.255  -2.193  1.00 0.00 ? 22 ASP A HB3  9  
ATOM 8609  N N    . GLU A 1 23 ? -0.238  10.767  -0.824  1.00 0.00 ? 23 GLU A N    9  
ATOM 8610  C CA   . GLU A 1 23 ? 0.292   9.423   -1.020  1.00 0.00 ? 23 GLU A CA   9  
ATOM 8611  C C    . GLU A 1 23 ? 0.796   8.840   0.297   1.00 0.00 ? 23 GLU A C    9  
ATOM 8612  O O    . GLU A 1 23 ? 1.367   9.550   1.125   1.00 0.00 ? 23 GLU A O    9  
ATOM 8613  C CB   . GLU A 1 23 ? 1.425   9.443   -2.049  1.00 0.00 ? 23 GLU A CB   9  
ATOM 8614  C CG   . GLU A 1 23 ? 1.071   10.179  -3.330  1.00 0.00 ? 23 GLU A CG   9  
ATOM 8615  C CD   . GLU A 1 23 ? 2.099   9.971   -4.425  1.00 0.00 ? 23 GLU A CD   9  
ATOM 8616  O OE1  . GLU A 1 23 ? 3.308   9.980   -4.113  1.00 0.00 ? 23 GLU A OE1  9  
ATOM 8617  O OE2  . GLU A 1 23 ? 1.695   9.799   -5.594  1.00 0.00 ? 23 GLU A OE2  9  
ATOM 8618  H H    . GLU A 1 23 ? 0.314   11.539  -1.067  1.00 0.00 ? 23 GLU A H    9  
ATOM 8619  H HA   . GLU A 1 23 ? -0.508  8.801   -1.392  1.00 0.00 ? 23 GLU A HA   9  
ATOM 8620  H HB2  . GLU A 1 23 ? 2.287   9.922   -1.608  1.00 0.00 ? 23 GLU A HB2  9  
ATOM 8621  H HB3  . GLU A 1 23 ? 1.682   8.425   -2.303  1.00 0.00 ? 23 GLU A HB3  9  
ATOM 8622  H HG2  . GLU A 1 23 ? 0.115   9.823   -3.682  1.00 0.00 ? 23 GLU A HG2  9  
ATOM 8623  H HG3  . GLU A 1 23 ? 1.004   11.236  -3.116  1.00 0.00 ? 23 GLU A HG3  9  
ATOM 8624  N N    . LEU A 1 24 ? 0.580   7.542   0.483   1.00 0.00 ? 24 LEU A N    9  
ATOM 8625  C CA   . LEU A 1 24 ? 1.012   6.862   1.699   1.00 0.00 ? 24 LEU A CA   9  
ATOM 8626  C C    . LEU A 1 24 ? 2.477   6.450   1.602   1.00 0.00 ? 24 LEU A C    9  
ATOM 8627  O O    . LEU A 1 24 ? 2.931   5.977   0.561   1.00 0.00 ? 24 LEU A O    9  
ATOM 8628  C CB   . LEU A 1 24 ? 0.140   5.631   1.955   1.00 0.00 ? 24 LEU A CB   9  
ATOM 8629  C CG   . LEU A 1 24 ? 0.215   5.036   3.362   1.00 0.00 ? 24 LEU A CG   9  
ATOM 8630  C CD1  . LEU A 1 24 ? -0.155  6.081   4.404   1.00 0.00 ? 24 LEU A CD1  9  
ATOM 8631  C CD2  . LEU A 1 24 ? -0.693  3.821   3.476   1.00 0.00 ? 24 LEU A CD2  9  
ATOM 8632  H H    . LEU A 1 24 ? 0.121   7.029   -0.213  1.00 0.00 ? 24 LEU A H    9  
ATOM 8633  H HA   . LEU A 1 24 ? 0.898   7.551   2.523   1.00 0.00 ? 24 LEU A HA   9  
ATOM 8634  H HB2  . LEU A 1 24 ? -0.886  5.908   1.768   1.00 0.00 ? 24 LEU A HB2  9  
ATOM 8635  H HB3  . LEU A 1 24 ? 0.438   4.864   1.254   1.00 0.00 ? 24 LEU A HB3  9  
ATOM 8636  H HG   . LEU A 1 24 ? 1.230   4.716   3.557   1.00 0.00 ? 24 LEU A HG   9  
ATOM 8637  H HD11 . LEU A 1 24 ? 0.615   6.836   4.445   1.00 0.00 ? 24 LEU A HD11 9  
ATOM 8638  H HD12 . LEU A 1 24 ? -0.248  5.608   5.370   1.00 0.00 ? 24 LEU A HD12 9  
ATOM 8639  H HD13 . LEU A 1 24 ? -1.095  6.539   4.135   1.00 0.00 ? 24 LEU A HD13 9  
ATOM 8640  H HD21 . LEU A 1 24 ? -1.035  3.534   2.493   1.00 0.00 ? 24 LEU A HD21 9  
ATOM 8641  H HD22 . LEU A 1 24 ? -1.544  4.065   4.096   1.00 0.00 ? 24 LEU A HD22 9  
ATOM 8642  H HD23 . LEU A 1 24 ? -0.146  3.003   3.921   1.00 0.00 ? 24 LEU A HD23 9  
ATOM 8643  N N    . GLU A 1 25 ? 3.211   6.631   2.696   1.00 0.00 ? 25 GLU A N    9  
ATOM 8644  C CA   . GLU A 1 25 ? 4.625   6.276   2.733   1.00 0.00 ? 25 GLU A CA   9  
ATOM 8645  C C    . GLU A 1 25 ? 4.811   4.825   3.168   1.00 0.00 ? 25 GLU A C    9  
ATOM 8646  O O    . GLU A 1 25 ? 4.196   4.371   4.133   1.00 0.00 ? 25 GLU A O    9  
ATOM 8647  C CB   . GLU A 1 25 ? 5.382   7.206   3.684   1.00 0.00 ? 25 GLU A CB   9  
ATOM 8648  C CG   . GLU A 1 25 ? 6.887   7.196   3.476   1.00 0.00 ? 25 GLU A CG   9  
ATOM 8649  C CD   . GLU A 1 25 ? 7.593   8.283   4.263   1.00 0.00 ? 25 GLU A CD   9  
ATOM 8650  O OE1  . GLU A 1 25 ? 7.856   8.069   5.465   1.00 0.00 ? 25 GLU A OE1  9  
ATOM 8651  O OE2  . GLU A 1 25 ? 7.881   9.347   3.676   1.00 0.00 ? 25 GLU A OE2  9  
ATOM 8652  H H    . GLU A 1 25 ? 2.793   7.012   3.495   1.00 0.00 ? 25 GLU A H    9  
ATOM 8653  H HA   . GLU A 1 25 ? 5.023   6.395   1.736   1.00 0.00 ? 25 GLU A HA   9  
ATOM 8654  H HB2  . GLU A 1 25 ? 5.026   8.216   3.540   1.00 0.00 ? 25 GLU A HB2  9  
ATOM 8655  H HB3  . GLU A 1 25 ? 5.179   6.904   4.700   1.00 0.00 ? 25 GLU A HB3  9  
ATOM 8656  H HG2  . GLU A 1 25 ? 7.274   6.237   3.788   1.00 0.00 ? 25 GLU A HG2  9  
ATOM 8657  H HG3  . GLU A 1 25 ? 7.094   7.341   2.425   1.00 0.00 ? 25 GLU A HG3  9  
ATOM 8658  N N    . LEU A 1 26 ? 5.663   4.103   2.448   1.00 0.00 ? 26 LEU A N    9  
ATOM 8659  C CA   . LEU A 1 26 ? 5.930   2.703   2.758   1.00 0.00 ? 26 LEU A CA   9  
ATOM 8660  C C    . LEU A 1 26 ? 7.402   2.492   3.100   1.00 0.00 ? 26 LEU A C    9  
ATOM 8661  O O    . LEU A 1 26 ? 8.255   3.303   2.740   1.00 0.00 ? 26 LEU A O    9  
ATOM 8662  C CB   . LEU A 1 26 ? 5.537   1.814   1.576   1.00 0.00 ? 26 LEU A CB   9  
ATOM 8663  C CG   . LEU A 1 26 ? 4.096   1.951   1.084   1.00 0.00 ? 26 LEU A CG   9  
ATOM 8664  C CD1  . LEU A 1 26 ? 3.950   1.364   -0.311  1.00 0.00 ? 26 LEU A CD1  9  
ATOM 8665  C CD2  . LEU A 1 26 ? 3.135   1.275   2.052   1.00 0.00 ? 26 LEU A CD2  9  
ATOM 8666  H H    . LEU A 1 26 ? 6.123   4.520   1.691   1.00 0.00 ? 26 LEU A H    9  
ATOM 8667  H HA   . LEU A 1 26 ? 5.332   2.433   3.615   1.00 0.00 ? 26 LEU A HA   9  
ATOM 8668  H HB2  . LEU A 1 26 ? 6.192   2.052   0.752   1.00 0.00 ? 26 LEU A HB2  9  
ATOM 8669  H HB3  . LEU A 1 26 ? 5.691   0.786   1.871   1.00 0.00 ? 26 LEU A HB3  9  
ATOM 8670  H HG   . LEU A 1 26 ? 3.838   3.000   1.033   1.00 0.00 ? 26 LEU A HG   9  
ATOM 8671  H HD11 . LEU A 1 26 ? 2.903   1.291   -0.563  1.00 0.00 ? 26 LEU A HD11 9  
ATOM 8672  H HD12 . LEU A 1 26 ? 4.396   0.380   -0.336  1.00 0.00 ? 26 LEU A HD12 9  
ATOM 8673  H HD13 . LEU A 1 26 ? 4.450   2.003   -1.025  1.00 0.00 ? 26 LEU A HD13 9  
ATOM 8674  H HD21 . LEU A 1 26 ? 2.448   0.651   1.500   1.00 0.00 ? 26 LEU A HD21 9  
ATOM 8675  H HD22 . LEU A 1 26 ? 2.582   2.029   2.594   1.00 0.00 ? 26 LEU A HD22 9  
ATOM 8676  H HD23 . LEU A 1 26 ? 3.694   0.668   2.748   1.00 0.00 ? 26 LEU A HD23 9  
ATOM 8677  N N    . ARG A 1 27 ? 7.692   1.397   3.795   1.00 0.00 ? 27 ARG A N    9  
ATOM 8678  C CA   . ARG A 1 27 ? 9.060   1.080   4.185   1.00 0.00 ? 27 ARG A CA   9  
ATOM 8679  C C    . ARG A 1 27 ? 9.352   -0.405  3.983   1.00 0.00 ? 27 ARG A C    9  
ATOM 8680  O O    . ARG A 1 27 ? 8.569   -1.261  4.391   1.00 0.00 ? 27 ARG A O    9  
ATOM 8681  C CB   . ARG A 1 27 ? 9.299   1.463   5.646   1.00 0.00 ? 27 ARG A CB   9  
ATOM 8682  C CG   . ARG A 1 27 ? 10.650  1.016   6.180   1.00 0.00 ? 27 ARG A CG   9  
ATOM 8683  C CD   . ARG A 1 27 ? 11.016  1.755   7.458   1.00 0.00 ? 27 ARG A CD   9  
ATOM 8684  N NE   . ARG A 1 27 ? 10.414  1.139   8.637   1.00 0.00 ? 27 ARG A NE   9  
ATOM 8685  C CZ   . ARG A 1 27 ? 10.572  1.606   9.871   1.00 0.00 ? 27 ARG A CZ   9  
ATOM 8686  N NH1  . ARG A 1 27 ? 11.308  2.687   10.085  1.00 0.00 ? 27 ARG A NH1  9  
ATOM 8687  N NH2  . ARG A 1 27 ? 9.991   0.990   10.894  1.00 0.00 ? 27 ARG A NH2  9  
ATOM 8688  H H    . ARG A 1 27 ? 6.968   0.789   4.053   1.00 0.00 ? 27 ARG A H    9  
ATOM 8689  H HA   . ARG A 1 27 ? 9.725   1.654   3.557   1.00 0.00 ? 27 ARG A HA   9  
ATOM 8690  H HB2  . ARG A 1 27 ? 9.238   2.538   5.739   1.00 0.00 ? 27 ARG A HB2  9  
ATOM 8691  H HB3  . ARG A 1 27 ? 8.529   1.014   6.254   1.00 0.00 ? 27 ARG A HB3  9  
ATOM 8692  H HG2  . ARG A 1 27 ? 10.612  -0.043  6.388   1.00 0.00 ? 27 ARG A HG2  9  
ATOM 8693  H HG3  . ARG A 1 27 ? 11.405  1.211   5.432   1.00 0.00 ? 27 ARG A HG3  9  
ATOM 8694  H HD2  . ARG A 1 27 ? 12.090  1.746   7.568   1.00 0.00 ? 27 ARG A HD2  9  
ATOM 8695  H HD3  . ARG A 1 27 ? 10.671  2.775   7.379   1.00 0.00 ? 27 ARG A HD3  9  
ATOM 8696  H HE   . ARG A 1 27 ? 9.866   0.339   8.502   1.00 0.00 ? 27 ARG A HE   9  
ATOM 8697  H HH11 . ARG A 1 27 ? 11.746  3.153   9.317   1.00 0.00 ? 27 ARG A HH11 9  
ATOM 8698  H HH12 . ARG A 1 27 ? 11.424  3.037   11.015  1.00 0.00 ? 27 ARG A HH12 9  
ATOM 8699  H HH21 . ARG A 1 27 ? 9.435   0.175   10.736  1.00 0.00 ? 27 ARG A HH21 9  
ATOM 8700  H HH22 . ARG A 1 27 ? 10.111  1.342   11.821  1.00 0.00 ? 27 ARG A HH22 9  
ATOM 8701  N N    . GLU A 1 28 ? 10.483  -0.699  3.350   1.00 0.00 ? 28 GLU A N    9  
ATOM 8702  C CA   . GLU A 1 28 ? 10.877  -2.080  3.094   1.00 0.00 ? 28 GLU A CA   9  
ATOM 8703  C C    . GLU A 1 28 ? 10.755  -2.924  4.359   1.00 0.00 ? 28 GLU A C    9  
ATOM 8704  O O    . GLU A 1 28 ? 11.445  -2.683  5.348   1.00 0.00 ? 28 GLU A O    9  
ATOM 8705  C CB   . GLU A 1 28 ? 12.312  -2.135  2.567   1.00 0.00 ? 28 GLU A CB   9  
ATOM 8706  C CG   . GLU A 1 28 ? 12.816  -3.546  2.317   1.00 0.00 ? 28 GLU A CG   9  
ATOM 8707  C CD   . GLU A 1 28 ? 14.318  -3.604  2.118   1.00 0.00 ? 28 GLU A CD   9  
ATOM 8708  O OE1  . GLU A 1 28 ? 15.042  -2.905  2.857   1.00 0.00 ? 28 GLU A OE1  9  
ATOM 8709  O OE2  . GLU A 1 28 ? 14.769  -4.348  1.222   1.00 0.00 ? 28 GLU A OE2  9  
ATOM 8710  H H    . GLU A 1 28 ? 11.066  0.028   3.049   1.00 0.00 ? 28 GLU A H    9  
ATOM 8711  H HA   . GLU A 1 28 ? 10.213  -2.480  2.343   1.00 0.00 ? 28 GLU A HA   9  
ATOM 8712  H HB2  . GLU A 1 28 ? 12.364  -1.586  1.638   1.00 0.00 ? 28 GLU A HB2  9  
ATOM 8713  H HB3  . GLU A 1 28 ? 12.965  -1.665  3.288   1.00 0.00 ? 28 GLU A HB3  9  
ATOM 8714  H HG2  . GLU A 1 28 ? 12.557  -4.162  3.165   1.00 0.00 ? 28 GLU A HG2  9  
ATOM 8715  H HG3  . GLU A 1 28 ? 12.334  -3.935  1.432   1.00 0.00 ? 28 GLU A HG3  9  
ATOM 8716  N N    . GLY A 1 29 ? 9.871   -3.917  4.318   1.00 0.00 ? 29 GLY A N    9  
ATOM 8717  C CA   . GLY A 1 29 ? 9.674   -4.782  5.466   1.00 0.00 ? 29 GLY A CA   9  
ATOM 8718  C C    . GLY A 1 29 ? 8.658   -4.224  6.444   1.00 0.00 ? 29 GLY A C    9  
ATOM 8719  O O    . GLY A 1 29 ? 8.878   -4.243  7.656   1.00 0.00 ? 29 GLY A O    9  
ATOM 8720  H H    . GLY A 1 29 ? 9.348   -4.062  3.502   1.00 0.00 ? 29 GLY A H    9  
ATOM 8721  H HA2  . GLY A 1 29 ? 9.334   -5.747  5.122   1.00 0.00 ? 29 GLY A HA2  9  
ATOM 8722  H HA3  . GLY A 1 29 ? 10.618  -4.904  5.977   1.00 0.00 ? 29 GLY A HA3  9  
ATOM 8723  N N    . ASP A 1 30 ? 7.545   -3.726  5.919   1.00 0.00 ? 30 ASP A N    9  
ATOM 8724  C CA   . ASP A 1 30 ? 6.492   -3.159  6.754   1.00 0.00 ? 30 ASP A CA   9  
ATOM 8725  C C    . ASP A 1 30 ? 5.120   -3.658  6.311   1.00 0.00 ? 30 ASP A C    9  
ATOM 8726  O O    . ASP A 1 30 ? 4.862   -3.817  5.118   1.00 0.00 ? 30 ASP A O    9  
ATOM 8727  C CB   . ASP A 1 30 ? 6.535   -1.632  6.700   1.00 0.00 ? 30 ASP A CB   9  
ATOM 8728  C CG   . ASP A 1 30 ? 7.554   -1.047  7.658   1.00 0.00 ? 30 ASP A CG   9  
ATOM 8729  O OD1  . ASP A 1 30 ? 8.762   -1.100  7.346   1.00 0.00 ? 30 ASP A OD1  9  
ATOM 8730  O OD2  . ASP A 1 30 ? 7.143   -0.534  8.720   1.00 0.00 ? 30 ASP A OD2  9  
ATOM 8731  H H    . ASP A 1 30 ? 7.428   -3.739  4.945   1.00 0.00 ? 30 ASP A H    9  
ATOM 8732  H HA   . ASP A 1 30 ? 6.667   -3.479  7.770   1.00 0.00 ? 30 ASP A HA   9  
ATOM 8733  H HB2  . ASP A 1 30 ? 6.791   -1.320  5.697   1.00 0.00 ? 30 ASP A HB2  9  
ATOM 8734  H HB3  . ASP A 1 30 ? 5.561   -1.241  6.955   1.00 0.00 ? 30 ASP A HB3  9  
ATOM 8735  N N    . ARG A 1 31 ? 4.245   -3.905  7.280   1.00 0.00 ? 31 ARG A N    9  
ATOM 8736  C CA   . ARG A 1 31 ? 2.900   -4.388  6.990   1.00 0.00 ? 31 ARG A CA   9  
ATOM 8737  C C    . ARG A 1 31 ? 1.988   -3.238  6.571   1.00 0.00 ? 31 ARG A C    9  
ATOM 8738  O O    . ARG A 1 31 ? 2.023   -2.158  7.159   1.00 0.00 ? 31 ARG A O    9  
ATOM 8739  C CB   . ARG A 1 31 ? 2.315   -5.097  8.213   1.00 0.00 ? 31 ARG A CB   9  
ATOM 8740  C CG   . ARG A 1 31 ? 2.922   -6.467  8.470   1.00 0.00 ? 31 ARG A CG   9  
ATOM 8741  C CD   . ARG A 1 31 ? 2.449   -7.487  7.446   1.00 0.00 ? 31 ARG A CD   9  
ATOM 8742  N NE   . ARG A 1 31 ? 2.994   -8.816  7.706   1.00 0.00 ? 31 ARG A NE   9  
ATOM 8743  C CZ   . ARG A 1 31 ? 2.609   -9.583  8.720   1.00 0.00 ? 31 ARG A CZ   9  
ATOM 8744  N NH1  . ARG A 1 31 ? 1.681   -9.155  9.565   1.00 0.00 ? 31 ARG A NH1  9  
ATOM 8745  N NH2  . ARG A 1 31 ? 3.152   -10.782 8.890   1.00 0.00 ? 31 ARG A NH2  9  
ATOM 8746  H H    . ARG A 1 31 ? 4.509   -3.759  8.212   1.00 0.00 ? 31 ARG A H    9  
ATOM 8747  H HA   . ARG A 1 31 ? 2.969   -5.092  6.175   1.00 0.00 ? 31 ARG A HA   9  
ATOM 8748  H HB2  . ARG A 1 31 ? 2.484   -4.484  9.086   1.00 0.00 ? 31 ARG A HB2  9  
ATOM 8749  H HB3  . ARG A 1 31 ? 1.252   -5.219  8.069   1.00 0.00 ? 31 ARG A HB3  9  
ATOM 8750  H HG2  . ARG A 1 31 ? 3.998   -6.390  8.415   1.00 0.00 ? 31 ARG A HG2  9  
ATOM 8751  H HG3  . ARG A 1 31 ? 2.633   -6.799  9.456   1.00 0.00 ? 31 ARG A HG3  9  
ATOM 8752  H HD2  . ARG A 1 31 ? 1.371   -7.537  7.479   1.00 0.00 ? 31 ARG A HD2  9  
ATOM 8753  H HD3  . ARG A 1 31 ? 2.764   -7.164  6.465   1.00 0.00 ? 31 ARG A HD3  9  
ATOM 8754  H HE   . ARG A 1 31 ? 3.681   -9.153  7.094   1.00 0.00 ? 31 ARG A HE   9  
ATOM 8755  H HH11 . ARG A 1 31 ? 1.269   -8.252  9.438   1.00 0.00 ? 31 ARG A HH11 9  
ATOM 8756  H HH12 . ARG A 1 31 ? 1.392   -9.734  10.326  1.00 0.00 ? 31 ARG A HH12 9  
ATOM 8757  H HH21 . ARG A 1 31 ? 3.851   -11.109 8.256   1.00 0.00 ? 31 ARG A HH21 9  
ATOM 8758  H HH22 . ARG A 1 31 ? 2.861   -11.358 9.654   1.00 0.00 ? 31 ARG A HH22 9  
ATOM 8759  N N    . VAL A 1 32 ? 1.172   -3.479  5.550   1.00 0.00 ? 32 VAL A N    9  
ATOM 8760  C CA   . VAL A 1 32 ? 0.250   -2.465  5.052   1.00 0.00 ? 32 VAL A CA   9  
ATOM 8761  C C    . VAL A 1 32 ? -1.180  -2.993  5.017   1.00 0.00 ? 32 VAL A C    9  
ATOM 8762  O O    . VAL A 1 32 ? -1.422  -4.136  4.631   1.00 0.00 ? 32 VAL A O    9  
ATOM 8763  C CB   . VAL A 1 32 ? 0.645   -1.992  3.641   1.00 0.00 ? 32 VAL A CB   9  
ATOM 8764  C CG1  . VAL A 1 32 ? -0.047  -0.680  3.305   1.00 0.00 ? 32 VAL A CG1  9  
ATOM 8765  C CG2  . VAL A 1 32 ? 2.156   -1.851  3.531   1.00 0.00 ? 32 VAL A CG2  9  
ATOM 8766  H H    . VAL A 1 32 ? 1.189   -4.361  5.122   1.00 0.00 ? 32 VAL A H    9  
ATOM 8767  H HA   . VAL A 1 32 ? 0.294   -1.617  5.720   1.00 0.00 ? 32 VAL A HA   9  
ATOM 8768  H HB   . VAL A 1 32 ? 0.321   -2.737  2.929   1.00 0.00 ? 32 VAL A HB   9  
ATOM 8769  H HG11 . VAL A 1 32 ? 0.537   0.144   3.689   1.00 0.00 ? 32 VAL A HG11 9  
ATOM 8770  H HG12 . VAL A 1 32 ? -0.141  -0.586  2.233   1.00 0.00 ? 32 VAL A HG12 9  
ATOM 8771  H HG13 . VAL A 1 32 ? -1.028  -0.665  3.755   1.00 0.00 ? 32 VAL A HG13 9  
ATOM 8772  H HG21 . VAL A 1 32 ? 2.401   -0.845  3.223   1.00 0.00 ? 32 VAL A HG21 9  
ATOM 8773  H HG22 . VAL A 1 32 ? 2.608   -2.053  4.491   1.00 0.00 ? 32 VAL A HG22 9  
ATOM 8774  H HG23 . VAL A 1 32 ? 2.531   -2.553  2.801   1.00 0.00 ? 32 VAL A HG23 9  
ATOM 8775  N N    . ASP A 1 33 ? -2.125  -2.151  5.422   1.00 0.00 ? 33 ASP A N    9  
ATOM 8776  C CA   . ASP A 1 33 ? -3.533  -2.531  5.436   1.00 0.00 ? 33 ASP A CA   9  
ATOM 8777  C C    . ASP A 1 33 ? -4.246  -2.018  4.189   1.00 0.00 ? 33 ASP A C    9  
ATOM 8778  O O    . ASP A 1 33 ? -4.558  -0.832  4.083   1.00 0.00 ? 33 ASP A O    9  
ATOM 8779  C CB   . ASP A 1 33 ? -4.218  -1.987  6.691   1.00 0.00 ? 33 ASP A CB   9  
ATOM 8780  C CG   . ASP A 1 33 ? -3.301  -1.991  7.899   1.00 0.00 ? 33 ASP A CG   9  
ATOM 8781  O OD1  . ASP A 1 33 ? -2.228  -1.356  7.831   1.00 0.00 ? 33 ASP A OD1  9  
ATOM 8782  O OD2  . ASP A 1 33 ? -3.658  -2.629  8.911   1.00 0.00 ? 33 ASP A OD2  9  
ATOM 8783  H H    . ASP A 1 33 ? -1.869  -1.252  5.719   1.00 0.00 ? 33 ASP A H    9  
ATOM 8784  H HA   . ASP A 1 33 ? -3.585  -3.609  5.447   1.00 0.00 ? 33 ASP A HA   9  
ATOM 8785  H HB2  . ASP A 1 33 ? -4.536  -0.972  6.508   1.00 0.00 ? 33 ASP A HB2  9  
ATOM 8786  H HB3  . ASP A 1 33 ? -5.081  -2.596  6.914   1.00 0.00 ? 33 ASP A HB3  9  
ATOM 8787  N N    . VAL A 1 34 ? -4.502  -2.920  3.247   1.00 0.00 ? 34 VAL A N    9  
ATOM 8788  C CA   . VAL A 1 34 ? -5.179  -2.559  2.007   1.00 0.00 ? 34 VAL A CA   9  
ATOM 8789  C C    . VAL A 1 34 ? -6.687  -2.741  2.131   1.00 0.00 ? 34 VAL A C    9  
ATOM 8790  O O    . VAL A 1 34 ? -7.160  -3.754  2.645   1.00 0.00 ? 34 VAL A O    9  
ATOM 8791  C CB   . VAL A 1 34 ? -4.667  -3.400  0.822   1.00 0.00 ? 34 VAL A CB   9  
ATOM 8792  C CG1  . VAL A 1 34 ? -5.641  -3.329  -0.344  1.00 0.00 ? 34 VAL A CG1  9  
ATOM 8793  C CG2  . VAL A 1 34 ? -3.282  -2.934  0.399   1.00 0.00 ? 34 VAL A CG2  9  
ATOM 8794  H H    . VAL A 1 34 ? -4.230  -3.850  3.389   1.00 0.00 ? 34 VAL A H    9  
ATOM 8795  H HA   . VAL A 1 34 ? -4.968  -1.519  1.801   1.00 0.00 ? 34 VAL A HA   9  
ATOM 8796  H HB   . VAL A 1 34 ? -4.596  -4.429  1.142   1.00 0.00 ? 34 VAL A HB   9  
ATOM 8797  H HG11 . VAL A 1 34 ? -5.091  -3.331  -1.273  1.00 0.00 ? 34 VAL A HG11 9  
ATOM 8798  H HG12 . VAL A 1 34 ? -6.302  -4.183  -0.313  1.00 0.00 ? 34 VAL A HG12 9  
ATOM 8799  H HG13 . VAL A 1 34 ? -6.222  -2.422  -0.273  1.00 0.00 ? 34 VAL A HG13 9  
ATOM 8800  H HG21 . VAL A 1 34 ? -3.267  -2.774  -0.669  1.00 0.00 ? 34 VAL A HG21 9  
ATOM 8801  H HG22 . VAL A 1 34 ? -3.041  -2.010  0.905   1.00 0.00 ? 34 VAL A HG22 9  
ATOM 8802  H HG23 . VAL A 1 34 ? -2.553  -3.687  0.660   1.00 0.00 ? 34 VAL A HG23 9  
ATOM 8803  N N    . MET A 1 35 ? -7.439  -1.754  1.655   1.00 0.00 ? 35 MET A N    9  
ATOM 8804  C CA   . MET A 1 35 ? -8.895  -1.807  1.711   1.00 0.00 ? 35 MET A CA   9  
ATOM 8805  C C    . MET A 1 35 ? -9.490  -1.905  0.310   1.00 0.00 ? 35 MET A C    9  
ATOM 8806  O O    . MET A 1 35 ? -10.248 -2.827  0.012   1.00 0.00 ? 35 MET A O    9  
ATOM 8807  C CB   . MET A 1 35 ? -9.444  -0.570  2.425   1.00 0.00 ? 35 MET A CB   9  
ATOM 8808  C CG   . MET A 1 35 ? -9.152  -0.550  3.917   1.00 0.00 ? 35 MET A CG   9  
ATOM 8809  S SD   . MET A 1 35 ? -7.390  -0.417  4.277   1.00 0.00 ? 35 MET A SD   9  
ATOM 8810  C CE   . MET A 1 35 ? -7.434  0.296   5.920   1.00 0.00 ? 35 MET A CE   9  
ATOM 8811  H H    . MET A 1 35 ? -7.004  -0.971  1.255   1.00 0.00 ? 35 MET A H    9  
ATOM 8812  H HA   . MET A 1 35 ? -9.173  -2.687  2.270   1.00 0.00 ? 35 MET A HA   9  
ATOM 8813  H HB2  . MET A 1 35 ? -9.006  0.311   1.982   1.00 0.00 ? 35 MET A HB2  9  
ATOM 8814  H HB3  . MET A 1 35 ? -10.515 -0.537  2.290   1.00 0.00 ? 35 MET A HB3  9  
ATOM 8815  H HG2  . MET A 1 35 ? -9.660  0.294   4.359   1.00 0.00 ? 35 MET A HG2  9  
ATOM 8816  H HG3  . MET A 1 35 ? -9.527  -1.463  4.355   1.00 0.00 ? 35 MET A HG3  9  
ATOM 8817  H HE1  . MET A 1 35 ? -6.616  0.991   6.033   1.00 0.00 ? 35 MET A HE1  9  
ATOM 8818  H HE2  . MET A 1 35 ? -8.370  0.815   6.062   1.00 0.00 ? 35 MET A HE2  9  
ATOM 8819  H HE3  . MET A 1 35 ? -7.342  -0.491  6.656   1.00 0.00 ? 35 MET A HE3  9  
ATOM 8820  N N    . GLN A 1 36 ? -9.140  -0.949  -0.545  1.00 0.00 ? 36 GLN A N    9  
ATOM 8821  C CA   . GLN A 1 36 ? -9.641  -0.928  -1.914  1.00 0.00 ? 36 GLN A CA   9  
ATOM 8822  C C    . GLN A 1 36 ? -8.510  -1.159  -2.911  1.00 0.00 ? 36 GLN A C    9  
ATOM 8823  O O    . GLN A 1 36 ? -7.345  -0.901  -2.612  1.00 0.00 ? 36 GLN A O    9  
ATOM 8824  C CB   . GLN A 1 36 ? -10.332 0.405   -2.207  1.00 0.00 ? 36 GLN A CB   9  
ATOM 8825  C CG   . GLN A 1 36 ? -10.885 0.506   -3.620  1.00 0.00 ? 36 GLN A CG   9  
ATOM 8826  C CD   . GLN A 1 36 ? -11.445 1.880   -3.930  1.00 0.00 ? 36 GLN A CD   9  
ATOM 8827  O OE1  . GLN A 1 36 ? -12.419 2.319   -3.317  1.00 0.00 ? 36 GLN A OE1  9  
ATOM 8828  N NE2  . GLN A 1 36 ? -10.831 2.568   -4.886  1.00 0.00 ? 36 GLN A NE2  9  
ATOM 8829  H H    . GLN A 1 36 ? -8.532  -0.241  -0.248  1.00 0.00 ? 36 GLN A H    9  
ATOM 8830  H HA   . GLN A 1 36 ? -10.361 -1.726  -2.015  1.00 0.00 ? 36 GLN A HA   9  
ATOM 8831  H HB2  . GLN A 1 36 ? -11.149 0.534   -1.513  1.00 0.00 ? 36 GLN A HB2  9  
ATOM 8832  H HB3  . GLN A 1 36 ? -9.619  1.204   -2.065  1.00 0.00 ? 36 GLN A HB3  9  
ATOM 8833  H HG2  . GLN A 1 36 ? -10.091 0.292   -4.320  1.00 0.00 ? 36 GLN A HG2  9  
ATOM 8834  H HG3  . GLN A 1 36 ? -11.673 -0.223  -3.737  1.00 0.00 ? 36 GLN A HG3  9  
ATOM 8835  H HE21 . GLN A 1 36 ? -10.061 2.155   -5.332  1.00 0.00 ? 36 GLN A HE21 9  
ATOM 8836  H HE22 . GLN A 1 36 ? -11.172 3.459   -5.107  1.00 0.00 ? 36 GLN A HE22 9  
ATOM 8837  N N    . GLN A 1 37 ? -8.863  -1.646  -4.096  1.00 0.00 ? 37 GLN A N    9  
ATOM 8838  C CA   . GLN A 1 37 ? -7.877  -1.912  -5.137  1.00 0.00 ? 37 GLN A CA   9  
ATOM 8839  C C    . GLN A 1 37 ? -8.210  -1.144  -6.412  1.00 0.00 ? 37 GLN A C    9  
ATOM 8840  O O    . GLN A 1 37 ? -9.352  -1.152  -6.873  1.00 0.00 ? 37 GLN A O    9  
ATOM 8841  C CB   . GLN A 1 37 ? -7.809  -3.411  -5.433  1.00 0.00 ? 37 GLN A CB   9  
ATOM 8842  C CG   . GLN A 1 37 ? -7.742  -4.275  -4.184  1.00 0.00 ? 37 GLN A CG   9  
ATOM 8843  C CD   . GLN A 1 37 ? -7.298  -5.695  -4.480  1.00 0.00 ? 37 GLN A CD   9  
ATOM 8844  O OE1  . GLN A 1 37 ? -6.670  -5.960  -5.506  1.00 0.00 ? 37 GLN A OE1  9  
ATOM 8845  N NE2  . GLN A 1 37 ? -7.624  -6.616  -3.581  1.00 0.00 ? 37 GLN A NE2  9  
ATOM 8846  H H    . GLN A 1 37 ? -9.808  -1.831  -4.275  1.00 0.00 ? 37 GLN A H    9  
ATOM 8847  H HA   . GLN A 1 37 ? -6.915  -1.582  -4.774  1.00 0.00 ? 37 GLN A HA   9  
ATOM 8848  H HB2  . GLN A 1 37 ? -8.685  -3.695  -5.995  1.00 0.00 ? 37 GLN A HB2  9  
ATOM 8849  H HB3  . GLN A 1 37 ? -6.929  -3.608  -6.029  1.00 0.00 ? 37 GLN A HB3  9  
ATOM 8850  H HG2  . GLN A 1 37 ? -7.040  -3.833  -3.493  1.00 0.00 ? 37 GLN A HG2  9  
ATOM 8851  H HG3  . GLN A 1 37 ? -8.721  -4.307  -3.731  1.00 0.00 ? 37 GLN A HG3  9  
ATOM 8852  H HE21 . GLN A 1 37 ? -8.126  -6.332  -2.789  1.00 0.00 ? 37 GLN A HE21 9  
ATOM 8853  H HE22 . GLN A 1 37 ? -7.351  -7.542  -3.748  1.00 0.00 ? 37 GLN A HE22 9  
ATOM 8854  N N    . CYS A 1 38 ? -7.206  -0.482  -6.977  1.00 0.00 ? 38 CYS A N    9  
ATOM 8855  C CA   . CYS A 1 38 ? -7.393  0.292   -8.199  1.00 0.00 ? 38 CYS A CA   9  
ATOM 8856  C C    . CYS A 1 38 ? -7.063  -0.546  -9.430  1.00 0.00 ? 38 CYS A C    9  
ATOM 8857  O O    . CYS A 1 38 ? -6.023  -1.203  -9.485  1.00 0.00 ? 38 CYS A O    9  
ATOM 8858  C CB   . CYS A 1 38 ? -6.518  1.546   -8.172  1.00 0.00 ? 38 CYS A CB   9  
ATOM 8859  S SG   . CYS A 1 38 ? -6.865  2.717   -9.505  1.00 0.00 ? 38 CYS A SG   9  
ATOM 8860  H H    . CYS A 1 38 ? -6.319  -0.514  -6.563  1.00 0.00 ? 38 CYS A H    9  
ATOM 8861  H HA   . CYS A 1 38 ? -8.430  0.588   -8.248  1.00 0.00 ? 38 CYS A HA   9  
ATOM 8862  H HB2  . CYS A 1 38 ? -6.670  2.062   -7.235  1.00 0.00 ? 38 CYS A HB2  9  
ATOM 8863  H HB3  . CYS A 1 38 ? -5.482  1.254   -8.250  1.00 0.00 ? 38 CYS A HB3  9  
ATOM 8864  H HG   . CYS A 1 38 ? -7.740  2.155   -10.325 1.00 0.00 ? 38 CYS A HG   9  
ATOM 8865  N N    . ASP A 1 39 ? -7.956  -0.520  -10.413 1.00 0.00 ? 39 ASP A N    9  
ATOM 8866  C CA   . ASP A 1 39 ? -7.760  -1.279  -11.643 1.00 0.00 ? 39 ASP A CA   9  
ATOM 8867  C C    . ASP A 1 39 ? -6.454  -0.881  -12.325 1.00 0.00 ? 39 ASP A C    9  
ATOM 8868  O O    . ASP A 1 39 ? -5.755  -1.723  -12.888 1.00 0.00 ? 39 ASP A O    9  
ATOM 8869  C CB   . ASP A 1 39 ? -8.935  -1.057  -12.597 1.00 0.00 ? 39 ASP A CB   9  
ATOM 8870  C CG   . ASP A 1 39 ? -8.571  -1.341  -14.041 1.00 0.00 ? 39 ASP A CG   9  
ATOM 8871  O OD1  . ASP A 1 39 ? -8.418  -2.530  -14.391 1.00 0.00 ? 39 ASP A OD1  9  
ATOM 8872  O OD2  . ASP A 1 39 ? -8.438  -0.375  -14.821 1.00 0.00 ? 39 ASP A OD2  9  
ATOM 8873  H H    . ASP A 1 39 ? -8.765  0.022   -10.310 1.00 0.00 ? 39 ASP A H    9  
ATOM 8874  H HA   . ASP A 1 39 ? -7.711  -2.325  -11.384 1.00 0.00 ? 39 ASP A HA   9  
ATOM 8875  H HB2  . ASP A 1 39 ? -9.747  -1.711  -12.314 1.00 0.00 ? 39 ASP A HB2  9  
ATOM 8876  H HB3  . ASP A 1 39 ? -9.263  -0.031  -12.522 1.00 0.00 ? 39 ASP A HB3  9  
ATOM 8877  N N    . ASP A 1 40 ? -6.133  0.407   -12.270 1.00 0.00 ? 40 ASP A N    9  
ATOM 8878  C CA   . ASP A 1 40 ? -4.911  0.917   -12.882 1.00 0.00 ? 40 ASP A CA   9  
ATOM 8879  C C    . ASP A 1 40 ? -3.700  0.102   -12.438 1.00 0.00 ? 40 ASP A C    9  
ATOM 8880  O O    . ASP A 1 40 ? -2.766  -0.112  -13.210 1.00 0.00 ? 40 ASP A O    9  
ATOM 8881  C CB   . ASP A 1 40 ? -4.711  2.389   -12.521 1.00 0.00 ? 40 ASP A CB   9  
ATOM 8882  C CG   . ASP A 1 40 ? -5.371  3.324   -13.515 1.00 0.00 ? 40 ASP A CG   9  
ATOM 8883  O OD1  . ASP A 1 40 ? -5.467  2.955   -14.704 1.00 0.00 ? 40 ASP A OD1  9  
ATOM 8884  O OD2  . ASP A 1 40 ? -5.793  4.425   -13.103 1.00 0.00 ? 40 ASP A OD2  9  
ATOM 8885  H H    . ASP A 1 40 ? -6.731  1.030   -11.806 1.00 0.00 ? 40 ASP A H    9  
ATOM 8886  H HA   . ASP A 1 40 ? -5.015  0.829   -13.953 1.00 0.00 ? 40 ASP A HA   9  
ATOM 8887  H HB2  . ASP A 1 40 ? -5.134  2.575   -11.544 1.00 0.00 ? 40 ASP A HB2  9  
ATOM 8888  H HB3  . ASP A 1 40 ? -3.653  2.607   -12.497 1.00 0.00 ? 40 ASP A HB3  9  
ATOM 8889  N N    . GLY A 1 41 ? -3.723  -0.350  -11.188 1.00 0.00 ? 41 GLY A N    9  
ATOM 8890  C CA   . GLY A 1 41 ? -2.621  -1.135  -10.663 1.00 0.00 ? 41 GLY A CA   9  
ATOM 8891  C C    . GLY A 1 41 ? -2.112  -0.606  -9.337  1.00 0.00 ? 41 GLY A C    9  
ATOM 8892  O O    . GLY A 1 41 ? -1.031  -0.982  -8.885  1.00 0.00 ? 41 GLY A O    9  
ATOM 8893  H H    . GLY A 1 41 ? -4.494  -0.149  -10.618 1.00 0.00 ? 41 GLY A H    9  
ATOM 8894  H HA2  . GLY A 1 41 ? -2.951  -2.154  -10.529 1.00 0.00 ? 41 GLY A HA2  9  
ATOM 8895  H HA3  . GLY A 1 41 ? -1.811  -1.121  -11.378 1.00 0.00 ? 41 GLY A HA3  9  
ATOM 8896  N N    . TRP A 1 42 ? -2.892  0.270   -8.714  1.00 0.00 ? 42 TRP A N    9  
ATOM 8897  C CA   . TRP A 1 42 ? -2.512  0.854   -7.432  1.00 0.00 ? 42 TRP A CA   9  
ATOM 8898  C C    . TRP A 1 42 ? -3.414  0.344   -6.313  1.00 0.00 ? 42 TRP A C    9  
ATOM 8899  O O    . TRP A 1 42 ? -4.493  -0.192  -6.568  1.00 0.00 ? 42 TRP A O    9  
ATOM 8900  C CB   . TRP A 1 42 ? -2.581  2.380   -7.503  1.00 0.00 ? 42 TRP A CB   9  
ATOM 8901  C CG   . TRP A 1 42 ? -1.333  3.007   -8.046  1.00 0.00 ? 42 TRP A CG   9  
ATOM 8902  C CD1  . TRP A 1 42 ? -0.732  2.733   -9.241  1.00 0.00 ? 42 TRP A CD1  9  
ATOM 8903  C CD2  . TRP A 1 42 ? -0.532  4.010   -7.412  1.00 0.00 ? 42 TRP A CD2  9  
ATOM 8904  N NE1  . TRP A 1 42 ? 0.395   3.507   -9.389  1.00 0.00 ? 42 TRP A NE1  9  
ATOM 8905  C CE2  . TRP A 1 42 ? 0.539   4.299   -8.281  1.00 0.00 ? 42 TRP A CE2  9  
ATOM 8906  C CE3  . TRP A 1 42 ? -0.616  4.694   -6.197  1.00 0.00 ? 42 TRP A CE3  9  
ATOM 8907  C CZ2  . TRP A 1 42 ? 1.516   5.240   -7.970  1.00 0.00 ? 42 TRP A CZ2  9  
ATOM 8908  C CZ3  . TRP A 1 42 ? 0.355   5.628   -5.889  1.00 0.00 ? 42 TRP A CZ3  9  
ATOM 8909  C CH2  . TRP A 1 42 ? 1.409   5.895   -6.773  1.00 0.00 ? 42 TRP A CH2  9  
ATOM 8910  H H    . TRP A 1 42 ? -3.743  0.531   -9.124  1.00 0.00 ? 42 TRP A H    9  
ATOM 8911  H HA   . TRP A 1 42 ? -1.495  0.558   -7.222  1.00 0.00 ? 42 TRP A HA   9  
ATOM 8912  H HB2  . TRP A 1 42 ? -3.403  2.668   -8.141  1.00 0.00 ? 42 TRP A HB2  9  
ATOM 8913  H HB3  . TRP A 1 42 ? -2.747  2.772   -6.510  1.00 0.00 ? 42 TRP A HB3  9  
ATOM 8914  H HD1  . TRP A 1 42 ? -1.098  2.012   -9.955  1.00 0.00 ? 42 TRP A HD1  9  
ATOM 8915  H HE1  . TRP A 1 42 ? 0.996   3.493   -10.163 1.00 0.00 ? 42 TRP A HE1  9  
ATOM 8916  H HE3  . TRP A 1 42 ? -1.421  4.503   -5.502  1.00 0.00 ? 42 TRP A HE3  9  
ATOM 8917  H HZ2  . TRP A 1 42 ? 2.334   5.458   -8.641  1.00 0.00 ? 42 TRP A HZ2  9  
ATOM 8918  H HZ3  . TRP A 1 42 ? 0.307   6.167   -4.954  1.00 0.00 ? 42 TRP A HZ3  9  
ATOM 8919  H HH2  . TRP A 1 42 ? 2.145   6.633   -6.492  1.00 0.00 ? 42 TRP A HH2  9  
ATOM 8920  N N    . PHE A 1 43 ? -2.965  0.513   -5.074  1.00 0.00 ? 43 PHE A N    9  
ATOM 8921  C CA   . PHE A 1 43 ? -3.732  0.068   -3.916  1.00 0.00 ? 43 PHE A CA   9  
ATOM 8922  C C    . PHE A 1 43 ? -3.980  1.224   -2.951  1.00 0.00 ? 43 PHE A C    9  
ATOM 8923  O O    . PHE A 1 43 ? -3.120  2.083   -2.759  1.00 0.00 ? 43 PHE A O    9  
ATOM 8924  C CB   . PHE A 1 43 ? -2.996  -1.063  -3.194  1.00 0.00 ? 43 PHE A CB   9  
ATOM 8925  C CG   . PHE A 1 43 ? -2.966  -2.349  -3.971  1.00 0.00 ? 43 PHE A CG   9  
ATOM 8926  C CD1  . PHE A 1 43 ? -4.112  -2.833  -4.580  1.00 0.00 ? 43 PHE A CD1  9  
ATOM 8927  C CD2  . PHE A 1 43 ? -1.791  -3.073  -4.090  1.00 0.00 ? 43 PHE A CD2  9  
ATOM 8928  C CE1  . PHE A 1 43 ? -4.087  -4.015  -5.295  1.00 0.00 ? 43 PHE A CE1  9  
ATOM 8929  C CE2  . PHE A 1 43 ? -1.760  -4.256  -4.805  1.00 0.00 ? 43 PHE A CE2  9  
ATOM 8930  C CZ   . PHE A 1 43 ? -2.909  -4.728  -5.407  1.00 0.00 ? 43 PHE A CZ   9  
ATOM 8931  H H    . PHE A 1 43 ? -2.097  0.947   -4.935  1.00 0.00 ? 43 PHE A H    9  
ATOM 8932  H HA   . PHE A 1 43 ? -4.682  -0.300  -4.270  1.00 0.00 ? 43 PHE A HA   9  
ATOM 8933  H HB2  . PHE A 1 43 ? -1.976  -0.761  -3.013  1.00 0.00 ? 43 PHE A HB2  9  
ATOM 8934  H HB3  . PHE A 1 43 ? -3.484  -1.255  -2.251  1.00 0.00 ? 43 PHE A HB3  9  
ATOM 8935  H HD1  . PHE A 1 43 ? -5.034  -2.276  -4.493  1.00 0.00 ? 43 PHE A HD1  9  
ATOM 8936  H HD2  . PHE A 1 43 ? -0.891  -2.706  -3.619  1.00 0.00 ? 43 PHE A HD2  9  
ATOM 8937  H HE1  . PHE A 1 43 ? -4.988  -4.382  -5.765  1.00 0.00 ? 43 PHE A HE1  9  
ATOM 8938  H HE2  . PHE A 1 43 ? -0.838  -4.811  -4.890  1.00 0.00 ? 43 PHE A HE2  9  
ATOM 8939  H HZ   . PHE A 1 43 ? -2.888  -5.652  -5.966  1.00 0.00 ? 43 PHE A HZ   9  
ATOM 8940  N N    . VAL A 1 44 ? -5.165  1.240   -2.348  1.00 0.00 ? 44 VAL A N    9  
ATOM 8941  C CA   . VAL A 1 44 ? -5.528  2.289   -1.403  1.00 0.00 ? 44 VAL A CA   9  
ATOM 8942  C C    . VAL A 1 44 ? -5.853  1.706   -0.032  1.00 0.00 ? 44 VAL A C    9  
ATOM 8943  O O    . VAL A 1 44 ? -6.738  0.862   0.101   1.00 0.00 ? 44 VAL A O    9  
ATOM 8944  C CB   . VAL A 1 44 ? -6.738  3.101   -1.903  1.00 0.00 ? 44 VAL A CB   9  
ATOM 8945  C CG1  . VAL A 1 44 ? -7.126  4.163   -0.886  1.00 0.00 ? 44 VAL A CG1  9  
ATOM 8946  C CG2  . VAL A 1 44 ? -6.435  3.730   -3.255  1.00 0.00 ? 44 VAL A CG2  9  
ATOM 8947  H H    . VAL A 1 44 ? -5.809  0.528   -2.542  1.00 0.00 ? 44 VAL A H    9  
ATOM 8948  H HA   . VAL A 1 44 ? -4.686  2.959   -1.309  1.00 0.00 ? 44 VAL A HA   9  
ATOM 8949  H HB   . VAL A 1 44 ? -7.573  2.426   -2.023  1.00 0.00 ? 44 VAL A HB   9  
ATOM 8950  H HG11 . VAL A 1 44 ? -8.093  4.570   -1.142  1.00 0.00 ? 44 VAL A HG11 9  
ATOM 8951  H HG12 . VAL A 1 44 ? -7.170  3.720   0.098   1.00 0.00 ? 44 VAL A HG12 9  
ATOM 8952  H HG13 . VAL A 1 44 ? -6.391  4.954   -0.893  1.00 0.00 ? 44 VAL A HG13 9  
ATOM 8953  H HG21 . VAL A 1 44 ? -6.810  4.743   -3.271  1.00 0.00 ? 44 VAL A HG21 9  
ATOM 8954  H HG22 . VAL A 1 44 ? -5.366  3.740   -3.416  1.00 0.00 ? 44 VAL A HG22 9  
ATOM 8955  H HG23 . VAL A 1 44 ? -6.911  3.156   -4.035  1.00 0.00 ? 44 VAL A HG23 9  
ATOM 8956  N N    . GLY A 1 45 ? -5.129  2.163   0.985   1.00 0.00 ? 45 GLY A N    9  
ATOM 8957  C CA   . GLY A 1 45 ? -5.355  1.676   2.334   1.00 0.00 ? 45 GLY A CA   9  
ATOM 8958  C C    . GLY A 1 45 ? -4.672  2.532   3.382   1.00 0.00 ? 45 GLY A C    9  
ATOM 8959  O O    . GLY A 1 45 ? -4.520  3.741   3.203   1.00 0.00 ? 45 GLY A O    9  
ATOM 8960  H H    . GLY A 1 45 ? -4.436  2.836   0.819   1.00 0.00 ? 45 GLY A H    9  
ATOM 8961  H HA2  . GLY A 1 45 ? -6.417  1.667   2.528   1.00 0.00 ? 45 GLY A HA2  9  
ATOM 8962  H HA3  . GLY A 1 45 ? -4.977  0.667   2.408   1.00 0.00 ? 45 GLY A HA3  9  
ATOM 8963  N N    . VAL A 1 46 ? -4.261  1.906   4.479   1.00 0.00 ? 46 VAL A N    9  
ATOM 8964  C CA   . VAL A 1 46 ? -3.591  2.618   5.561   1.00 0.00 ? 46 VAL A CA   9  
ATOM 8965  C C    . VAL A 1 46 ? -2.269  1.950   5.923   1.00 0.00 ? 46 VAL A C    9  
ATOM 8966  O O    . VAL A 1 46 ? -2.106  0.741   5.754   1.00 0.00 ? 46 VAL A O    9  
ATOM 8967  C CB   . VAL A 1 46 ? -4.478  2.693   6.818   1.00 0.00 ? 46 VAL A CB   9  
ATOM 8968  C CG1  . VAL A 1 46 ? -3.663  3.144   8.020   1.00 0.00 ? 46 VAL A CG1  9  
ATOM 8969  C CG2  . VAL A 1 46 ? -5.657  3.625   6.583   1.00 0.00 ? 46 VAL A CG2  9  
ATOM 8970  H H    . VAL A 1 46 ? -4.411  0.941   4.563   1.00 0.00 ? 46 VAL A H    9  
ATOM 8971  H HA   . VAL A 1 46 ? -3.393  3.626   5.225   1.00 0.00 ? 46 VAL A HA   9  
ATOM 8972  H HB   . VAL A 1 46 ? -4.862  1.704   7.022   1.00 0.00 ? 46 VAL A HB   9  
ATOM 8973  H HG11 . VAL A 1 46 ? -3.061  2.320   8.376   1.00 0.00 ? 46 VAL A HG11 9  
ATOM 8974  H HG12 . VAL A 1 46 ? -3.020  3.963   7.733   1.00 0.00 ? 46 VAL A HG12 9  
ATOM 8975  H HG13 . VAL A 1 46 ? -4.330  3.467   8.806   1.00 0.00 ? 46 VAL A HG13 9  
ATOM 8976  H HG21 . VAL A 1 46 ? -5.304  4.547   6.146   1.00 0.00 ? 46 VAL A HG21 9  
ATOM 8977  H HG22 . VAL A 1 46 ? -6.359  3.154   5.910   1.00 0.00 ? 46 VAL A HG22 9  
ATOM 8978  H HG23 . VAL A 1 46 ? -6.144  3.834   7.523   1.00 0.00 ? 46 VAL A HG23 9  
ATOM 8979  N N    . SER A 1 47 ? -1.329  2.744   6.424   1.00 0.00 ? 47 SER A N    9  
ATOM 8980  C CA   . SER A 1 47 ? -0.019  2.230   6.808   1.00 0.00 ? 47 SER A CA   9  
ATOM 8981  C C    . SER A 1 47 ? -0.007  1.817   8.277   1.00 0.00 ? 47 SER A C    9  
ATOM 8982  O O    . SER A 1 47 ? -0.880  2.210   9.051   1.00 0.00 ? 47 SER A O    9  
ATOM 8983  C CB   . SER A 1 47 ? 1.060   3.284   6.554   1.00 0.00 ? 47 SER A CB   9  
ATOM 8984  O OG   . SER A 1 47 ? 2.343   2.688   6.459   1.00 0.00 ? 47 SER A OG   9  
ATOM 8985  H H    . SER A 1 47 ? -1.519  3.699   6.535   1.00 0.00 ? 47 SER A H    9  
ATOM 8986  H HA   . SER A 1 47 ? 0.188   1.362   6.200   1.00 0.00 ? 47 SER A HA   9  
ATOM 8987  H HB2  . SER A 1 47 ? 0.847   3.799   5.630   1.00 0.00 ? 47 SER A HB2  9  
ATOM 8988  H HB3  . SER A 1 47 ? 1.066   3.993   7.370   1.00 0.00 ? 47 SER A HB3  9  
ATOM 8989  H HG   . SER A 1 47 ? 2.627   2.685   5.542   1.00 0.00 ? 47 SER A HG   9  
ATOM 8990  N N    . ARG A 1 48 ? 0.988   1.021   8.653   1.00 0.00 ? 48 ARG A N    9  
ATOM 8991  C CA   . ARG A 1 48 ? 1.114   0.552   10.028  1.00 0.00 ? 48 ARG A CA   9  
ATOM 8992  C C    . ARG A 1 48 ? 2.205   1.322   10.766  1.00 0.00 ? 48 ARG A C    9  
ATOM 8993  O O    . ARG A 1 48 ? 2.361   1.187   11.980  1.00 0.00 ? 48 ARG A O    9  
ATOM 8994  C CB   . ARG A 1 48 ? 1.426   -0.945  10.052  1.00 0.00 ? 48 ARG A CB   9  
ATOM 8995  C CG   . ARG A 1 48 ? 0.233   -1.822  9.708   1.00 0.00 ? 48 ARG A CG   9  
ATOM 8996  C CD   . ARG A 1 48 ? -0.822  -1.781  10.803  1.00 0.00 ? 48 ARG A CD   9  
ATOM 8997  N NE   . ARG A 1 48 ? -1.580  -3.027  10.879  1.00 0.00 ? 48 ARG A NE   9  
ATOM 8998  C CZ   . ARG A 1 48 ? -1.081  -4.163  11.355  1.00 0.00 ? 48 ARG A CZ   9  
ATOM 8999  N NH1  . ARG A 1 48 ? 0.169   -4.209  11.795  1.00 0.00 ? 48 ARG A NH1  9  
ATOM 9000  N NH2  . ARG A 1 48 ? -1.833  -5.255  11.391  1.00 0.00 ? 48 ARG A NH2  9  
ATOM 9001  H H    . ARG A 1 48 ? 1.654   0.741   7.990   1.00 0.00 ? 48 ARG A H    9  
ATOM 9002  H HA   . ARG A 1 48 ? 0.171   0.723   10.524  1.00 0.00 ? 48 ARG A HA   9  
ATOM 9003  H HB2  . ARG A 1 48 ? 2.212   -1.149  9.340   1.00 0.00 ? 48 ARG A HB2  9  
ATOM 9004  H HB3  . ARG A 1 48 ? 1.769   -1.213  11.040  1.00 0.00 ? 48 ARG A HB3  9  
ATOM 9005  H HG2  . ARG A 1 48 ? -0.207  -1.469  8.787   1.00 0.00 ? 48 ARG A HG2  9  
ATOM 9006  H HG3  . ARG A 1 48 ? 0.571   -2.839  9.582   1.00 0.00 ? 48 ARG A HG3  9  
ATOM 9007  H HD2  . ARG A 1 48 ? -0.332  -1.611  11.750  1.00 0.00 ? 48 ARG A HD2  9  
ATOM 9008  H HD3  . ARG A 1 48 ? -1.502  -0.968  10.598  1.00 0.00 ? 48 ARG A HD3  9  
ATOM 9009  H HE   . ARG A 1 48 ? -2.505  -3.016  10.559  1.00 0.00 ? 48 ARG A HE   9  
ATOM 9010  H HH11 . ARG A 1 48 ? 0.738   -3.387  11.769  1.00 0.00 ? 48 ARG A HH11 9  
ATOM 9011  H HH12 . ARG A 1 48 ? 0.542   -5.065  12.154  1.00 0.00 ? 48 ARG A HH12 9  
ATOM 9012  H HH21 . ARG A 1 48 ? -2.776  -5.224  11.061  1.00 0.00 ? 48 ARG A HH21 9  
ATOM 9013  H HH22 . ARG A 1 48 ? -1.457  -6.109  11.750  1.00 0.00 ? 48 ARG A HH22 9  
ATOM 9014  N N    . ARG A 1 49 ? 2.958   2.129   10.026  1.00 0.00 ? 49 ARG A N    9  
ATOM 9015  C CA   . ARG A 1 49 ? 4.035   2.919   10.610  1.00 0.00 ? 49 ARG A CA   9  
ATOM 9016  C C    . ARG A 1 49 ? 3.589   4.359   10.842  1.00 0.00 ? 49 ARG A C    9  
ATOM 9017  O O    . ARG A 1 49 ? 3.934   4.973   11.852  1.00 0.00 ? 49 ARG A O    9  
ATOM 9018  C CB   . ARG A 1 49 ? 5.265   2.895   9.700   1.00 0.00 ? 49 ARG A CB   9  
ATOM 9019  C CG   . ARG A 1 49 ? 6.376   3.828   10.153  1.00 0.00 ? 49 ARG A CG   9  
ATOM 9020  C CD   . ARG A 1 49 ? 7.734   3.362   9.652   1.00 0.00 ? 49 ARG A CD   9  
ATOM 9021  N NE   . ARG A 1 49 ? 8.753   4.399   9.789   1.00 0.00 ? 49 ARG A NE   9  
ATOM 9022  C CZ   . ARG A 1 49 ? 9.328   4.717   10.944  1.00 0.00 ? 49 ARG A CZ   9  
ATOM 9023  N NH1  . ARG A 1 49 ? 8.985   4.081   12.056  1.00 0.00 ? 49 ARG A NH1  9  
ATOM 9024  N NH2  . ARG A 1 49 ? 10.247  5.673   10.988  1.00 0.00 ? 49 ARG A NH2  9  
ATOM 9025  H H    . ARG A 1 49 ? 2.785   2.194   9.063   1.00 0.00 ? 49 ARG A H    9  
ATOM 9026  H HA   . ARG A 1 49 ? 4.293   2.477   11.561  1.00 0.00 ? 49 ARG A HA   9  
ATOM 9027  H HB2  . ARG A 1 49 ? 5.659   1.889   9.673   1.00 0.00 ? 49 ARG A HB2  9  
ATOM 9028  H HB3  . ARG A 1 49 ? 4.966   3.183   8.704   1.00 0.00 ? 49 ARG A HB3  9  
ATOM 9029  H HG2  . ARG A 1 49 ? 6.182   4.818   9.767   1.00 0.00 ? 49 ARG A HG2  9  
ATOM 9030  H HG3  . ARG A 1 49 ? 6.391   3.858   11.233  1.00 0.00 ? 49 ARG A HG3  9  
ATOM 9031  H HD2  . ARG A 1 49 ? 8.036   2.497   10.223  1.00 0.00 ? 49 ARG A HD2  9  
ATOM 9032  H HD3  . ARG A 1 49 ? 7.645   3.093   8.610   1.00 0.00 ? 49 ARG A HD3  9  
ATOM 9033  H HE   . ARG A 1 49 ? 9.021   4.882   8.980   1.00 0.00 ? 49 ARG A HE   9  
ATOM 9034  H HH11 . ARG A 1 49 ? 8.293   3.360   12.025  1.00 0.00 ? 49 ARG A HH11 9  
ATOM 9035  H HH12 . ARG A 1 49 ? 9.420   4.322   12.924  1.00 0.00 ? 49 ARG A HH12 9  
ATOM 9036  H HH21 . ARG A 1 49 ? 10.508  6.154   10.152  1.00 0.00 ? 49 ARG A HH21 9  
ATOM 9037  H HH22 . ARG A 1 49 ? 10.679  5.911   11.858  1.00 0.00 ? 49 ARG A HH22 9  
ATOM 9038  N N    . THR A 1 50 ? 2.819   4.894   9.899   1.00 0.00 ? 50 THR A N    9  
ATOM 9039  C CA   . THR A 1 50 ? 2.327   6.262   10.000  1.00 0.00 ? 50 THR A CA   9  
ATOM 9040  C C    . THR A 1 50 ? 0.818   6.290   10.214  1.00 0.00 ? 50 THR A C    9  
ATOM 9041  O O    . THR A 1 50 ? 0.219   7.358   10.335  1.00 0.00 ? 50 THR A O    9  
ATOM 9042  C CB   . THR A 1 50 ? 2.670   7.077   8.738   1.00 0.00 ? 50 THR A CB   9  
ATOM 9043  O OG1  . THR A 1 50 ? 2.142   6.426   7.576   1.00 0.00 ? 50 THR A OG1  9  
ATOM 9044  C CG2  . THR A 1 50 ? 4.175   7.242   8.593   1.00 0.00 ? 50 THR A CG2  9  
ATOM 9045  H H    . THR A 1 50 ? 2.578   4.355   9.118   1.00 0.00 ? 50 THR A H    9  
ATOM 9046  H HA   . THR A 1 50 ? 2.810   6.729   10.846  1.00 0.00 ? 50 THR A HA   9  
ATOM 9047  H HB   . THR A 1 50 ? 2.222   8.056   8.827   1.00 0.00 ? 50 THR A HB   9  
ATOM 9048  H HG1  . THR A 1 50 ? 2.263   6.991   6.810   1.00 0.00 ? 50 THR A HG1  9  
ATOM 9049  H HG21 . THR A 1 50 ? 4.387   7.884   7.750   1.00 0.00 ? 50 THR A HG21 9  
ATOM 9050  H HG22 . THR A 1 50 ? 4.629   6.276   8.433   1.00 0.00 ? 50 THR A HG22 9  
ATOM 9051  H HG23 . THR A 1 50 ? 4.576   7.685   9.492   1.00 0.00 ? 50 THR A HG23 9  
ATOM 9052  N N    . GLN A 1 51 ? 0.210   5.109   10.260  1.00 0.00 ? 51 GLN A N    9  
ATOM 9053  C CA   . GLN A 1 51 ? -1.230  4.998   10.459  1.00 0.00 ? 51 GLN A CA   9  
ATOM 9054  C C    . GLN A 1 51 ? -1.976  6.033   9.624   1.00 0.00 ? 51 GLN A C    9  
ATOM 9055  O O    . GLN A 1 51 ? -3.084  6.445   9.970   1.00 0.00 ? 51 GLN A O    9  
ATOM 9056  C CB   . GLN A 1 51 ? -1.576  5.174   11.939  1.00 0.00 ? 51 GLN A CB   9  
ATOM 9057  C CG   . GLN A 1 51 ? -1.388  6.597   12.443  1.00 0.00 ? 51 GLN A CG   9  
ATOM 9058  C CD   . GLN A 1 51 ? -2.121  6.856   13.744  1.00 0.00 ? 51 GLN A CD   9  
ATOM 9059  O OE1  . GLN A 1 51 ? -2.428  5.928   14.493  1.00 0.00 ? 51 GLN A OE1  9  
ATOM 9060  N NE2  . GLN A 1 51 ? -2.406  8.123   14.020  1.00 0.00 ? 51 GLN A NE2  9  
ATOM 9061  H H    . GLN A 1 51 ? 0.742   4.293   10.156  1.00 0.00 ? 51 GLN A H    9  
ATOM 9062  H HA   . GLN A 1 51 ? -1.534  4.012   10.143  1.00 0.00 ? 51 GLN A HA   9  
ATOM 9063  H HB2  . GLN A 1 51 ? -2.608  4.895   12.091  1.00 0.00 ? 51 GLN A HB2  9  
ATOM 9064  H HB3  . GLN A 1 51 ? -0.944  4.523   12.524  1.00 0.00 ? 51 GLN A HB3  9  
ATOM 9065  H HG2  . GLN A 1 51 ? -0.335  6.773   12.600  1.00 0.00 ? 51 GLN A HG2  9  
ATOM 9066  H HG3  . GLN A 1 51 ? -1.759  7.281   11.694  1.00 0.00 ? 51 GLN A HG3  9  
ATOM 9067  H HE21 . GLN A 1 51 ? -2.132  8.810   13.376  1.00 0.00 ? 51 GLN A HE21 9  
ATOM 9068  H HE22 . GLN A 1 51 ? -2.880  8.320   14.854  1.00 0.00 ? 51 GLN A HE22 9  
ATOM 9069  N N    . LYS A 1 52 ? -1.362  6.451   8.522   1.00 0.00 ? 52 LYS A N    9  
ATOM 9070  C CA   . LYS A 1 52 ? -1.968  7.437   7.635   1.00 0.00 ? 52 LYS A CA   9  
ATOM 9071  C C    . LYS A 1 52 ? -2.764  6.757   6.527   1.00 0.00 ? 52 LYS A C    9  
ATOM 9072  O O    . LYS A 1 52 ? -2.574  5.572   6.250   1.00 0.00 ? 52 LYS A O    9  
ATOM 9073  C CB   . LYS A 1 52 ? -0.889  8.335   7.025   1.00 0.00 ? 52 LYS A CB   9  
ATOM 9074  C CG   . LYS A 1 52 ? -0.490  9.498   7.917   1.00 0.00 ? 52 LYS A CG   9  
ATOM 9075  C CD   . LYS A 1 52 ? 0.101   10.642  7.110   1.00 0.00 ? 52 LYS A CD   9  
ATOM 9076  C CE   . LYS A 1 52 ? 1.071   11.468  7.941   1.00 0.00 ? 52 LYS A CE   9  
ATOM 9077  N NZ   . LYS A 1 52 ? 0.374   12.534  8.711   1.00 0.00 ? 52 LYS A NZ   9  
ATOM 9078  H H    . LYS A 1 52 ? -0.480  6.086   8.299   1.00 0.00 ? 52 LYS A H    9  
ATOM 9079  H HA   . LYS A 1 52 ? -2.639  8.045   8.224   1.00 0.00 ? 52 LYS A HA   9  
ATOM 9080  H HB2  . LYS A 1 52 ? -0.010  7.739   6.831   1.00 0.00 ? 52 LYS A HB2  9  
ATOM 9081  H HB3  . LYS A 1 52 ? -1.257  8.735   6.091   1.00 0.00 ? 52 LYS A HB3  9  
ATOM 9082  H HG2  . LYS A 1 52 ? -1.364  9.856   8.440   1.00 0.00 ? 52 LYS A HG2  9  
ATOM 9083  H HG3  . LYS A 1 52 ? 0.245   9.156   8.631   1.00 0.00 ? 52 LYS A HG3  9  
ATOM 9084  H HD2  . LYS A 1 52 ? 0.628   10.237  6.259   1.00 0.00 ? 52 LYS A HD2  9  
ATOM 9085  H HD3  . LYS A 1 52 ? -0.701  11.282  6.768   1.00 0.00 ? 52 LYS A HD3  9  
ATOM 9086  H HE2  . LYS A 1 52 ? 1.582   10.813  8.630   1.00 0.00 ? 52 LYS A HE2  9  
ATOM 9087  H HE3  . LYS A 1 52 ? 1.792   11.926  7.279   1.00 0.00 ? 52 LYS A HE3  9  
ATOM 9088  H HZ1  . LYS A 1 52 ? 0.031   13.275  8.066   1.00 0.00 ? 52 LYS A HZ1  9  
ATOM 9089  H HZ2  . LYS A 1 52 ? 1.026   12.964  9.397   1.00 0.00 ? 52 LYS A HZ2  9  
ATOM 9090  H HZ3  . LYS A 1 52 ? -0.437  12.133  9.223   1.00 0.00 ? 52 LYS A HZ3  9  
ATOM 9091  N N    . PHE A 1 53 ? -3.656  7.513   5.896   1.00 0.00 ? 53 PHE A N    9  
ATOM 9092  C CA   . PHE A 1 53 ? -4.481  6.982   4.817   1.00 0.00 ? 53 PHE A CA   9  
ATOM 9093  C C    . PHE A 1 53 ? -4.203  7.715   3.508   1.00 0.00 ? 53 PHE A C    9  
ATOM 9094  O O    . PHE A 1 53 ? -4.098  8.941   3.480   1.00 0.00 ? 53 PHE A O    9  
ATOM 9095  C CB   . PHE A 1 53 ? -5.964  7.100   5.175   1.00 0.00 ? 53 PHE A CB   9  
ATOM 9096  C CG   . PHE A 1 53 ? -6.884  6.623   4.087   1.00 0.00 ? 53 PHE A CG   9  
ATOM 9097  C CD1  . PHE A 1 53 ? -7.073  5.269   3.866   1.00 0.00 ? 53 PHE A CD1  9  
ATOM 9098  C CD2  . PHE A 1 53 ? -7.557  7.530   3.284   1.00 0.00 ? 53 PHE A CD2  9  
ATOM 9099  C CE1  . PHE A 1 53 ? -7.919  4.826   2.866   1.00 0.00 ? 53 PHE A CE1  9  
ATOM 9100  C CE2  . PHE A 1 53 ? -8.404  7.094   2.283   1.00 0.00 ? 53 PHE A CE2  9  
ATOM 9101  C CZ   . PHE A 1 53 ? -8.584  5.740   2.073   1.00 0.00 ? 53 PHE A CZ   9  
ATOM 9102  H H    . PHE A 1 53 ? -3.763  8.450   6.162   1.00 0.00 ? 53 PHE A H    9  
ATOM 9103  H HA   . PHE A 1 53 ? -4.232  5.940   4.692   1.00 0.00 ? 53 PHE A HA   9  
ATOM 9104  H HB2  . PHE A 1 53 ? -6.162  6.511   6.057   1.00 0.00 ? 53 PHE A HB2  9  
ATOM 9105  H HB3  . PHE A 1 53 ? -6.197  8.134   5.378   1.00 0.00 ? 53 PHE A HB3  9  
ATOM 9106  H HD1  . PHE A 1 53 ? -6.553  4.552   4.487   1.00 0.00 ? 53 PHE A HD1  9  
ATOM 9107  H HD2  . PHE A 1 53 ? -7.416  8.588   3.446   1.00 0.00 ? 53 PHE A HD2  9  
ATOM 9108  H HE1  . PHE A 1 53 ? -8.057  3.768   2.705   1.00 0.00 ? 53 PHE A HE1  9  
ATOM 9109  H HE2  . PHE A 1 53 ? -8.923  7.810   1.663   1.00 0.00 ? 53 PHE A HE2  9  
ATOM 9110  H HZ   . PHE A 1 53 ? -9.246  5.397   1.291   1.00 0.00 ? 53 PHE A HZ   9  
ATOM 9111  N N    . GLY A 1 54 ? -4.084  6.954   2.424   1.00 0.00 ? 54 GLY A N    9  
ATOM 9112  C CA   . GLY A 1 54 ? -3.817  7.548   1.126   1.00 0.00 ? 54 GLY A CA   9  
ATOM 9113  C C    . GLY A 1 54 ? -3.713  6.512   0.025   1.00 0.00 ? 54 GLY A C    9  
ATOM 9114  O O    . GLY A 1 54 ? -4.288  5.427   0.125   1.00 0.00 ? 54 GLY A O    9  
ATOM 9115  H H    . GLY A 1 54 ? -4.177  5.982   2.506   1.00 0.00 ? 54 GLY A H    9  
ATOM 9116  H HA2  . GLY A 1 54 ? -4.616  8.234   0.886   1.00 0.00 ? 54 GLY A HA2  9  
ATOM 9117  H HA3  . GLY A 1 54 ? -2.888  8.096   1.178   1.00 0.00 ? 54 GLY A HA3  9  
ATOM 9118  N N    . THR A 1 55 ? -2.977  6.845   -1.031  1.00 0.00 ? 55 THR A N    9  
ATOM 9119  C CA   . THR A 1 55 ? -2.801  5.936   -2.157  1.00 0.00 ? 55 THR A CA   9  
ATOM 9120  C C    . THR A 1 55 ? -1.323  5.700   -2.447  1.00 0.00 ? 55 THR A C    9  
ATOM 9121  O O    . THR A 1 55 ? -0.514  6.627   -2.395  1.00 0.00 ? 55 THR A O    9  
ATOM 9122  C CB   . THR A 1 55 ? -3.482  6.478   -3.428  1.00 0.00 ? 55 THR A CB   9  
ATOM 9123  O OG1  . THR A 1 55 ? -3.225  5.604   -4.532  1.00 0.00 ? 55 THR A OG1  9  
ATOM 9124  C CG2  . THR A 1 55 ? -2.982  7.877   -3.755  1.00 0.00 ? 55 THR A CG2  9  
ATOM 9125  H H    . THR A 1 55 ? -2.543  7.723   -1.052  1.00 0.00 ? 55 THR A H    9  
ATOM 9126  H HA   . THR A 1 55 ? -3.263  4.994   -1.900  1.00 0.00 ? 55 THR A HA   9  
ATOM 9127  H HB   . THR A 1 55 ? -4.548  6.524   -3.255  1.00 0.00 ? 55 THR A HB   9  
ATOM 9128  H HG1  . THR A 1 55 ? -4.020  5.108   -4.740  1.00 0.00 ? 55 THR A HG1  9  
ATOM 9129  H HG21 . THR A 1 55 ? -3.786  8.587   -3.627  1.00 0.00 ? 55 THR A HG21 9  
ATOM 9130  H HG22 . THR A 1 55 ? -2.635  7.906   -4.777  1.00 0.00 ? 55 THR A HG22 9  
ATOM 9131  H HG23 . THR A 1 55 ? -2.169  8.133   -3.092  1.00 0.00 ? 55 THR A HG23 9  
ATOM 9132  N N    . PHE A 1 56 ? -0.977  4.454   -2.753  1.00 0.00 ? 56 PHE A N    9  
ATOM 9133  C CA   . PHE A 1 56 ? 0.405   4.096   -3.052  1.00 0.00 ? 56 PHE A CA   9  
ATOM 9134  C C    . PHE A 1 56 ? 0.470   3.072   -4.181  1.00 0.00 ? 56 PHE A C    9  
ATOM 9135  O O    . PHE A 1 56 ? -0.488  2.347   -4.452  1.00 0.00 ? 56 PHE A O    9  
ATOM 9136  C CB   . PHE A 1 56 ? 1.091   3.539   -1.803  1.00 0.00 ? 56 PHE A CB   9  
ATOM 9137  C CG   . PHE A 1 56 ? 0.215   2.624   -0.996  1.00 0.00 ? 56 PHE A CG   9  
ATOM 9138  C CD1  . PHE A 1 56 ? -0.777  3.138   -0.176  1.00 0.00 ? 56 PHE A CD1  9  
ATOM 9139  C CD2  . PHE A 1 56 ? 0.383   1.250   -1.056  1.00 0.00 ? 56 PHE A CD2  9  
ATOM 9140  C CE1  . PHE A 1 56 ? -1.585  2.299   0.568   1.00 0.00 ? 56 PHE A CE1  9  
ATOM 9141  C CE2  . PHE A 1 56 ? -0.422  0.406   -0.315  1.00 0.00 ? 56 PHE A CE2  9  
ATOM 9142  C CZ   . PHE A 1 56 ? -1.406  0.931   0.499   1.00 0.00 ? 56 PHE A CZ   9  
ATOM 9143  H H    . PHE A 1 56 ? -1.667  3.759   -2.778  1.00 0.00 ? 56 PHE A H    9  
ATOM 9144  H HA   . PHE A 1 56 ? 0.918   4.992   -3.365  1.00 0.00 ? 56 PHE A HA   9  
ATOM 9145  H HB2  . PHE A 1 56 ? 1.967   2.982   -2.100  1.00 0.00 ? 56 PHE A HB2  9  
ATOM 9146  H HB3  . PHE A 1 56 ? 1.390   4.360   -1.169  1.00 0.00 ? 56 PHE A HB3  9  
ATOM 9147  H HD1  . PHE A 1 56 ? -0.917  4.208   -0.121  1.00 0.00 ? 56 PHE A HD1  9  
ATOM 9148  H HD2  . PHE A 1 56 ? 1.153   0.838   -1.692  1.00 0.00 ? 56 PHE A HD2  9  
ATOM 9149  H HE1  . PHE A 1 56 ? -2.353  2.713   1.204   1.00 0.00 ? 56 PHE A HE1  9  
ATOM 9150  H HE2  . PHE A 1 56 ? -0.280  -0.663  -0.371  1.00 0.00 ? 56 PHE A HE2  9  
ATOM 9151  H HZ   . PHE A 1 56 ? -2.037  0.274   1.079   1.00 0.00 ? 56 PHE A HZ   9  
ATOM 9152  N N    . PRO A 1 57 ? 1.626   3.011   -4.858  1.00 0.00 ? 57 PRO A N    9  
ATOM 9153  C CA   . PRO A 1 57 ? 1.845   2.080   -5.969  1.00 0.00 ? 57 PRO A CA   9  
ATOM 9154  C C    . PRO A 1 57 ? 1.927   0.630   -5.503  1.00 0.00 ? 57 PRO A C    9  
ATOM 9155  O O    . PRO A 1 57 ? 2.929   0.208   -4.929  1.00 0.00 ? 57 PRO A O    9  
ATOM 9156  C CB   . PRO A 1 57 ? 3.186   2.531   -6.551  1.00 0.00 ? 57 PRO A CB   9  
ATOM 9157  C CG   . PRO A 1 57 ? 3.886   3.198   -5.418  1.00 0.00 ? 57 PRO A CG   9  
ATOM 9158  C CD   . PRO A 1 57 ? 2.810   3.845   -4.590  1.00 0.00 ? 57 PRO A CD   9  
ATOM 9159  H HA   . PRO A 1 57 ? 1.075   2.172   -6.721  1.00 0.00 ? 57 PRO A HA   9  
ATOM 9160  H HB2  . PRO A 1 57 ? 3.736   1.670   -6.904  1.00 0.00 ? 57 PRO A HB2  9  
ATOM 9161  H HB3  . PRO A 1 57 ? 3.016   3.216   -7.368  1.00 0.00 ? 57 PRO A HB3  9  
ATOM 9162  H HG2  . PRO A 1 57 ? 4.420   2.465   -4.833  1.00 0.00 ? 57 PRO A HG2  9  
ATOM 9163  H HG3  . PRO A 1 57 ? 4.567   3.946   -5.797  1.00 0.00 ? 57 PRO A HG3  9  
ATOM 9164  H HD2  . PRO A 1 57 ? 3.072   3.817   -3.543  1.00 0.00 ? 57 PRO A HD2  9  
ATOM 9165  H HD3  . PRO A 1 57 ? 2.645   4.862   -4.913  1.00 0.00 ? 57 PRO A HD3  9  
ATOM 9166  N N    . GLY A 1 58 ? 0.864   -0.129  -5.755  1.00 0.00 ? 58 GLY A N    9  
ATOM 9167  C CA   . GLY A 1 58 ? 0.838   -1.524  -5.355  1.00 0.00 ? 58 GLY A CA   9  
ATOM 9168  C C    . GLY A 1 58 ? 2.056   -2.288  -5.834  1.00 0.00 ? 58 GLY A C    9  
ATOM 9169  O O    . GLY A 1 58 ? 2.336   -3.386  -5.355  1.00 0.00 ? 58 GLY A O    9  
ATOM 9170  H H    . GLY A 1 58 ? 0.093   0.261   -6.217  1.00 0.00 ? 58 GLY A H    9  
ATOM 9171  H HA2  . GLY A 1 58 ? 0.793   -1.577  -4.278  1.00 0.00 ? 58 GLY A HA2  9  
ATOM 9172  H HA3  . GLY A 1 58 ? -0.048  -1.987  -5.765  1.00 0.00 ? 58 GLY A HA3  9  
ATOM 9173  N N    . ASN A 1 59 ? 2.781   -1.707  -6.785  1.00 0.00 ? 59 ASN A N    9  
ATOM 9174  C CA   . ASN A 1 59 ? 3.974   -2.342  -7.331  1.00 0.00 ? 59 ASN A CA   9  
ATOM 9175  C C    . ASN A 1 59 ? 5.098   -2.366  -6.299  1.00 0.00 ? 59 ASN A C    9  
ATOM 9176  O O    . ASN A 1 59 ? 6.139   -2.987  -6.515  1.00 0.00 ? 59 ASN A O    9  
ATOM 9177  C CB   . ASN A 1 59 ? 4.438   -1.606  -8.590  1.00 0.00 ? 59 ASN A CB   9  
ATOM 9178  C CG   . ASN A 1 59 ? 4.259   -0.105  -8.481  1.00 0.00 ? 59 ASN A CG   9  
ATOM 9179  O OD1  . ASN A 1 59 ? 5.217   0.631   -8.242  1.00 0.00 ? 59 ASN A OD1  9  
ATOM 9180  N ND2  . ASN A 1 59 ? 3.026   0.358   -8.655  1.00 0.00 ? 59 ASN A ND2  9  
ATOM 9181  H H    . ASN A 1 59 ? 2.506   -0.831  -7.128  1.00 0.00 ? 59 ASN A H    9  
ATOM 9182  H HA   . ASN A 1 59 ? 3.719   -3.358  -7.592  1.00 0.00 ? 59 ASN A HA   9  
ATOM 9183  H HB2  . ASN A 1 59 ? 5.486   -1.813  -8.754  1.00 0.00 ? 59 ASN A HB2  9  
ATOM 9184  H HB3  . ASN A 1 59 ? 3.869   -1.959  -9.436  1.00 0.00 ? 59 ASN A HB3  9  
ATOM 9185  H HD21 . ASN A 1 59 ? 2.311   -0.287  -8.842  1.00 0.00 ? 59 ASN A HD21 9  
ATOM 9186  H HD22 . ASN A 1 59 ? 2.881   1.325   -8.591  1.00 0.00 ? 59 ASN A HD22 9  
ATOM 9187  N N    . TYR A 1 60 ? 4.879   -1.688  -5.179  1.00 0.00 ? 60 TYR A N    9  
ATOM 9188  C CA   . TYR A 1 60 ? 5.874   -1.629  -4.114  1.00 0.00 ? 60 TYR A CA   9  
ATOM 9189  C C    . TYR A 1 60 ? 5.534   -2.612  -2.997  1.00 0.00 ? 60 TYR A C    9  
ATOM 9190  O O    . TYR A 1 60 ? 6.415   -3.078  -2.275  1.00 0.00 ? 60 TYR A O    9  
ATOM 9191  C CB   . TYR A 1 60 ? 5.965   -0.211  -3.550  1.00 0.00 ? 60 TYR A CB   9  
ATOM 9192  C CG   . TYR A 1 60 ? 6.870   0.701   -4.349  1.00 0.00 ? 60 TYR A CG   9  
ATOM 9193  C CD1  . TYR A 1 60 ? 6.517   1.116   -5.627  1.00 0.00 ? 60 TYR A CD1  9  
ATOM 9194  C CD2  . TYR A 1 60 ? 8.077   1.146   -3.826  1.00 0.00 ? 60 TYR A CD2  9  
ATOM 9195  C CE1  . TYR A 1 60 ? 7.340   1.948   -6.361  1.00 0.00 ? 60 TYR A CE1  9  
ATOM 9196  C CE2  . TYR A 1 60 ? 8.906   1.980   -4.551  1.00 0.00 ? 60 TYR A CE2  9  
ATOM 9197  C CZ   . TYR A 1 60 ? 8.533   2.378   -5.818  1.00 0.00 ? 60 TYR A CZ   9  
ATOM 9198  O OH   . TYR A 1 60 ? 9.357   3.207   -6.545  1.00 0.00 ? 60 TYR A OH   9  
ATOM 9199  H H    . TYR A 1 60 ? 4.030   -1.213  -5.065  1.00 0.00 ? 60 TYR A H    9  
ATOM 9200  H HA   . TYR A 1 60 ? 6.830   -1.900  -4.538  1.00 0.00 ? 60 TYR A HA   9  
ATOM 9201  H HB2  . TYR A 1 60 ? 4.980   0.229   -3.538  1.00 0.00 ? 60 TYR A HB2  9  
ATOM 9202  H HB3  . TYR A 1 60 ? 6.347   -0.256  -2.541  1.00 0.00 ? 60 TYR A HB3  9  
ATOM 9203  H HD1  . TYR A 1 60 ? 5.581   0.778   -6.049  1.00 0.00 ? 60 TYR A HD1  9  
ATOM 9204  H HD2  . TYR A 1 60 ? 8.367   0.832   -2.833  1.00 0.00 ? 60 TYR A HD2  9  
ATOM 9205  H HE1  . TYR A 1 60 ? 7.048   2.261   -7.353  1.00 0.00 ? 60 TYR A HE1  9  
ATOM 9206  H HE2  . TYR A 1 60 ? 9.841   2.316   -4.127  1.00 0.00 ? 60 TYR A HE2  9  
ATOM 9207  H HH   . TYR A 1 60 ? 9.893   3.731   -5.945  1.00 0.00 ? 60 TYR A HH   9  
ATOM 9208  N N    . VAL A 1 61 ? 4.249   -2.922  -2.862  1.00 0.00 ? 61 VAL A N    9  
ATOM 9209  C CA   . VAL A 1 61 ? 3.790   -3.850  -1.834  1.00 0.00 ? 61 VAL A CA   9  
ATOM 9210  C C    . VAL A 1 61 ? 3.198   -5.109  -2.457  1.00 0.00 ? 61 VAL A C    9  
ATOM 9211  O O    . VAL A 1 61 ? 3.137   -5.241  -3.679  1.00 0.00 ? 61 VAL A O    9  
ATOM 9212  C CB   . VAL A 1 61 ? 2.737   -3.198  -0.919  1.00 0.00 ? 61 VAL A CB   9  
ATOM 9213  C CG1  . VAL A 1 61 ? 3.316   -1.976  -0.224  1.00 0.00 ? 61 VAL A CG1  9  
ATOM 9214  C CG2  . VAL A 1 61 ? 1.494   -2.830  -1.716  1.00 0.00 ? 61 VAL A CG2  9  
ATOM 9215  H H    . VAL A 1 61 ? 3.593   -2.518  -3.467  1.00 0.00 ? 61 VAL A H    9  
ATOM 9216  H HA   . VAL A 1 61 ? 4.642   -4.125  -1.229  1.00 0.00 ? 61 VAL A HA   9  
ATOM 9217  H HB   . VAL A 1 61 ? 2.454   -3.915  -0.162  1.00 0.00 ? 61 VAL A HB   9  
ATOM 9218  H HG11 . VAL A 1 61 ? 3.550   -2.223  0.801   1.00 0.00 ? 61 VAL A HG11 9  
ATOM 9219  H HG12 . VAL A 1 61 ? 4.215   -1.663  -0.734  1.00 0.00 ? 61 VAL A HG12 9  
ATOM 9220  H HG13 . VAL A 1 61 ? 2.592   -1.174  -0.243  1.00 0.00 ? 61 VAL A HG13 9  
ATOM 9221  H HG21 . VAL A 1 61 ? 1.397   -3.498  -2.559  1.00 0.00 ? 61 VAL A HG21 9  
ATOM 9222  H HG22 . VAL A 1 61 ? 0.622   -2.918  -1.085  1.00 0.00 ? 61 VAL A HG22 9  
ATOM 9223  H HG23 . VAL A 1 61 ? 1.581   -1.813  -2.069  1.00 0.00 ? 61 VAL A HG23 9  
ATOM 9224  N N    . ALA A 1 62 ? 2.762   -6.034  -1.607  1.00 0.00 ? 62 ALA A N    9  
ATOM 9225  C CA   . ALA A 1 62 ? 2.172   -7.282  -2.073  1.00 0.00 ? 62 ALA A CA   9  
ATOM 9226  C C    . ALA A 1 62 ? 1.369   -7.957  -0.966  1.00 0.00 ? 62 ALA A C    9  
ATOM 9227  O O    . ALA A 1 62 ? 1.586   -7.723  0.223   1.00 0.00 ? 62 ALA A O    9  
ATOM 9228  C CB   . ALA A 1 62 ? 3.256   -8.219  -2.587  1.00 0.00 ? 62 ALA A CB   9  
ATOM 9229  H H    . ALA A 1 62 ? 2.838   -5.871  -0.644  1.00 0.00 ? 62 ALA A H    9  
ATOM 9230  H HA   . ALA A 1 62 ? 1.510   -7.052  -2.895  1.00 0.00 ? 62 ALA A HA   9  
ATOM 9231  H HB1  . ALA A 1 62 ? 4.159   -8.071  -2.013  1.00 0.00 ? 62 ALA A HB1  9  
ATOM 9232  H HB2  . ALA A 1 62 ? 2.926   -9.242  -2.483  1.00 0.00 ? 62 ALA A HB2  9  
ATOM 9233  H HB3  . ALA A 1 62 ? 3.451   -8.007  -3.627  1.00 0.00 ? 62 ALA A HB3  9  
ATOM 9234  N N    . PRO A 1 63 ? 0.416   -8.813  -1.363  1.00 0.00 ? 63 PRO A N    9  
ATOM 9235  C CA   . PRO A 1 63 ? -0.439  -9.539  -0.419  1.00 0.00 ? 63 PRO A CA   9  
ATOM 9236  C C    . PRO A 1 63 ? 0.328   -10.601 0.360   1.00 0.00 ? 63 PRO A C    9  
ATOM 9237  O O    . PRO A 1 63 ? 0.700   -11.640 -0.186  1.00 0.00 ? 63 PRO A O    9  
ATOM 9238  C CB   . PRO A 1 63 ? -1.489  -10.193 -1.322  1.00 0.00 ? 63 PRO A CB   9  
ATOM 9239  C CG   . PRO A 1 63 ? -0.820  -10.323 -2.647  1.00 0.00 ? 63 PRO A CG   9  
ATOM 9240  C CD   . PRO A 1 63 ? 0.101   -9.140  -2.764  1.00 0.00 ? 63 PRO A CD   9  
ATOM 9241  H HA   . PRO A 1 63 ? -0.926  -8.867  0.273   1.00 0.00 ? 63 PRO A HA   9  
ATOM 9242  H HB2  . PRO A 1 63 ? -1.762  -11.158 -0.920  1.00 0.00 ? 63 PRO A HB2  9  
ATOM 9243  H HB3  . PRO A 1 63 ? -2.362  -9.561  -1.381  1.00 0.00 ? 63 PRO A HB3  9  
ATOM 9244  H HG2  . PRO A 1 63 ? -0.257  -11.243 -2.685  1.00 0.00 ? 63 PRO A HG2  9  
ATOM 9245  H HG3  . PRO A 1 63 ? -1.559  -10.301 -3.434  1.00 0.00 ? 63 PRO A HG3  9  
ATOM 9246  H HD2  . PRO A 1 63 ? 0.995   -9.411  -3.307  1.00 0.00 ? 63 PRO A HD2  9  
ATOM 9247  H HD3  . PRO A 1 63 ? -0.402  -8.316  -3.248  1.00 0.00 ? 63 PRO A HD3  9  
ATOM 9248  N N    . VAL A 1 64 ? 0.563   -10.334 1.641   1.00 0.00 ? 64 VAL A N    9  
ATOM 9249  C CA   . VAL A 1 64 ? 1.286   -11.268 2.497   1.00 0.00 ? 64 VAL A CA   9  
ATOM 9250  C C    . VAL A 1 64 ? 0.420   -12.472 2.849   1.00 0.00 ? 64 VAL A C    9  
ATOM 9251  O O    . VAL A 1 64 ? 0.927   -13.509 3.278   1.00 0.00 ? 64 VAL A O    9  
ATOM 9252  C CB   . VAL A 1 64 ? 1.755   -10.589 3.797   1.00 0.00 ? 64 VAL A CB   9  
ATOM 9253  C CG1  . VAL A 1 64 ? 0.702   -9.614  4.301   1.00 0.00 ? 64 VAL A CG1  9  
ATOM 9254  C CG2  . VAL A 1 64 ? 2.077   -11.632 4.856   1.00 0.00 ? 64 VAL A CG2  9  
ATOM 9255  H H    . VAL A 1 64 ? 0.242   -9.489  2.020   1.00 0.00 ? 64 VAL A H    9  
ATOM 9256  H HA   . VAL A 1 64 ? 2.158   -11.608 1.958   1.00 0.00 ? 64 VAL A HA   9  
ATOM 9257  H HB   . VAL A 1 64 ? 2.656   -10.033 3.584   1.00 0.00 ? 64 VAL A HB   9  
ATOM 9258  H HG11 . VAL A 1 64 ? -0.272  -9.922  3.950   1.00 0.00 ? 64 VAL A HG11 9  
ATOM 9259  H HG12 . VAL A 1 64 ? 0.709   -9.602  5.381   1.00 0.00 ? 64 VAL A HG12 9  
ATOM 9260  H HG13 . VAL A 1 64 ? 0.921   -8.624  3.929   1.00 0.00 ? 64 VAL A HG13 9  
ATOM 9261  H HG21 . VAL A 1 64 ? 2.677   -11.182 5.634   1.00 0.00 ? 64 VAL A HG21 9  
ATOM 9262  H HG22 . VAL A 1 64 ? 1.159   -12.009 5.283   1.00 0.00 ? 64 VAL A HG22 9  
ATOM 9263  H HG23 . VAL A 1 64 ? 2.624   -12.447 4.405   1.00 0.00 ? 64 VAL A HG23 9  
ATOM 9264  N N    . SER A 1 65 ? -0.888  -12.328 2.664   1.00 0.00 ? 65 SER A N    9  
ATOM 9265  C CA   . SER A 1 65 ? -1.826  -13.404 2.966   1.00 0.00 ? 65 SER A CA   9  
ATOM 9266  C C    . SER A 1 65 ? -1.658  -14.561 1.985   1.00 0.00 ? 65 SER A C    9  
ATOM 9267  O O    . SER A 1 65 ? -2.336  -15.582 2.091   1.00 0.00 ? 65 SER A O    9  
ATOM 9268  C CB   . SER A 1 65 ? -3.264  -12.884 2.918   1.00 0.00 ? 65 SER A CB   9  
ATOM 9269  O OG   . SER A 1 65 ? -3.678  -12.413 4.188   1.00 0.00 ? 65 SER A OG   9  
ATOM 9270  H H    . SER A 1 65 ? -1.231  -11.477 2.319   1.00 0.00 ? 65 SER A H    9  
ATOM 9271  H HA   . SER A 1 65 ? -1.613  -13.759 3.963   1.00 0.00 ? 65 SER A HA   9  
ATOM 9272  H HB2  . SER A 1 65 ? -3.327  -12.074 2.208   1.00 0.00 ? 65 SER A HB2  9  
ATOM 9273  H HB3  . SER A 1 65 ? -3.922  -13.684 2.612   1.00 0.00 ? 65 SER A HB3  9  
ATOM 9274  H HG   . SER A 1 65 ? -4.611  -12.602 4.312   1.00 0.00 ? 65 SER A HG   9  
ATOM 9275  N N    . GLY A 1 66 ? -0.749  -14.392 1.030   1.00 0.00 ? 66 GLY A N    9  
ATOM 9276  C CA   . GLY A 1 66 ? -0.508  -15.429 0.044   1.00 0.00 ? 66 GLY A CA   9  
ATOM 9277  C C    . GLY A 1 66 ? -1.750  -15.769 -0.756  1.00 0.00 ? 66 GLY A C    9  
ATOM 9278  O O    . GLY A 1 66 ? -2.472  -16.718 -0.449  1.00 0.00 ? 66 GLY A O    9  
ATOM 9279  H H    . GLY A 1 66 ? -0.238  -13.557 0.995   1.00 0.00 ? 66 GLY A H    9  
ATOM 9280  H HA2  . GLY A 1 66 ? 0.264   -15.095 -0.633  1.00 0.00 ? 66 GLY A HA2  9  
ATOM 9281  H HA3  . GLY A 1 66 ? -0.166  -16.320 0.551   1.00 0.00 ? 66 GLY A HA3  9  
ATOM 9282  N N    . PRO A 1 67 ? -2.015  -14.980 -1.808  1.00 0.00 ? 67 PRO A N    9  
ATOM 9283  C CA   . PRO A 1 67 ? -3.179  -15.181 -2.675  1.00 0.00 ? 67 PRO A CA   9  
ATOM 9284  C C    . PRO A 1 67 ? -3.057  -16.441 -3.526  1.00 0.00 ? 67 PRO A C    9  
ATOM 9285  O O    . PRO A 1 67 ? -2.501  -16.408 -4.624  1.00 0.00 ? 67 PRO A O    9  
ATOM 9286  C CB   . PRO A 1 67 ? -3.181  -13.934 -3.563  1.00 0.00 ? 67 PRO A CB   9  
ATOM 9287  C CG   . PRO A 1 67 ? -1.762  -13.481 -3.581  1.00 0.00 ? 67 PRO A CG   9  
ATOM 9288  C CD   . PRO A 1 67 ? -1.198  -13.830 -2.232  1.00 0.00 ? 67 PRO A CD   9  
ATOM 9289  H HA   . PRO A 1 67 ? -4.096  -15.221 -2.106  1.00 0.00 ? 67 PRO A HA   9  
ATOM 9290  H HB2  . PRO A 1 67 ? -3.526  -14.195 -4.554  1.00 0.00 ? 67 PRO A HB2  9  
ATOM 9291  H HB3  . PRO A 1 67 ? -3.829  -13.184 -3.135  1.00 0.00 ? 67 PRO A HB3  9  
ATOM 9292  H HG2  . PRO A 1 67 ? -1.221  -13.998 -4.359  1.00 0.00 ? 67 PRO A HG2  9  
ATOM 9293  H HG3  . PRO A 1 67 ? -1.720  -12.413 -3.740  1.00 0.00 ? 67 PRO A HG3  9  
ATOM 9294  H HD2  . PRO A 1 67 ? -0.157  -14.107 -2.318  1.00 0.00 ? 67 PRO A HD2  9  
ATOM 9295  H HD3  . PRO A 1 67 ? -1.314  -13.002 -1.548  1.00 0.00 ? 67 PRO A HD3  9  
ATOM 9296  N N    . SER A 1 68 ? -3.581  -17.549 -3.013  1.00 0.00 ? 68 SER A N    9  
ATOM 9297  C CA   . SER A 1 68 ? -3.528  -18.821 -3.725  1.00 0.00 ? 68 SER A CA   9  
ATOM 9298  C C    . SER A 1 68 ? -4.930  -19.303 -4.082  1.00 0.00 ? 68 SER A C    9  
ATOM 9299  O O    . SER A 1 68 ? -5.180  -19.747 -5.202  1.00 0.00 ? 68 SER A O    9  
ATOM 9300  C CB   . SER A 1 68 ? -2.814  -19.875 -2.876  1.00 0.00 ? 68 SER A CB   9  
ATOM 9301  O OG   . SER A 1 68 ? -3.437  -20.018 -1.612  1.00 0.00 ? 68 SER A OG   9  
ATOM 9302  H H    . SER A 1 68 ? -4.011  -17.511 -2.133  1.00 0.00 ? 68 SER A H    9  
ATOM 9303  H HA   . SER A 1 68 ? -2.970  -18.667 -4.637  1.00 0.00 ? 68 SER A HA   9  
ATOM 9304  H HB2  . SER A 1 68 ? -2.843  -20.825 -3.388  1.00 0.00 ? 68 SER A HB2  9  
ATOM 9305  H HB3  . SER A 1 68 ? -1.786  -19.577 -2.727  1.00 0.00 ? 68 SER A HB3  9  
ATOM 9306  H HG   . SER A 1 68 ? -4.054  -20.753 -1.640  1.00 0.00 ? 68 SER A HG   9  
ATOM 9307  N N    . SER A 1 69 ? -5.843  -19.211 -3.120  1.00 0.00 ? 69 SER A N    9  
ATOM 9308  C CA   . SER A 1 69 ? -7.221  -19.641 -3.330  1.00 0.00 ? 69 SER A CA   9  
ATOM 9309  C C    . SER A 1 69 ? -7.277  -21.120 -3.703  1.00 0.00 ? 69 SER A C    9  
ATOM 9310  O O    . SER A 1 69 ? -8.010  -21.516 -4.609  1.00 0.00 ? 69 SER A O    9  
ATOM 9311  C CB   . SER A 1 69 ? -7.878  -18.802 -4.427  1.00 0.00 ? 69 SER A CB   9  
ATOM 9312  O OG   . SER A 1 69 ? -9.291  -18.885 -4.356  1.00 0.00 ? 69 SER A OG   9  
ATOM 9313  H H    . SER A 1 69 ? -5.583  -18.848 -2.248  1.00 0.00 ? 69 SER A H    9  
ATOM 9314  H HA   . SER A 1 69 ? -7.758  -19.495 -2.405  1.00 0.00 ? 69 SER A HA   9  
ATOM 9315  H HB2  . SER A 1 69 ? -7.584  -17.769 -4.311  1.00 0.00 ? 69 SER A HB2  9  
ATOM 9316  H HB3  . SER A 1 69 ? -7.556  -19.161 -5.394  1.00 0.00 ? 69 SER A HB3  9  
ATOM 9317  H HG   . SER A 1 69 ? -9.543  -19.730 -3.975  1.00 0.00 ? 69 SER A HG   9  
ATOM 9318  N N    . GLY A 1 70 ? -6.497  -21.932 -2.997  1.00 0.00 ? 70 GLY A N    9  
ATOM 9319  C CA   . GLY A 1 70 ? -6.472  -23.358 -3.267  1.00 0.00 ? 70 GLY A CA   9  
ATOM 9320  C C    . GLY A 1 70 ? -5.804  -24.147 -2.159  1.00 0.00 ? 70 GLY A C    9  
ATOM 9321  O O    . GLY A 1 70 ? -4.900  -24.943 -2.413  1.00 0.00 ? 70 GLY A O    9  
ATOM 9322  H H    . GLY A 1 70 ? -5.933  -21.561 -2.286  1.00 0.00 ? 70 GLY A H    9  
ATOM 9323  H HA2  . GLY A 1 70 ? -7.487  -23.709 -3.384  1.00 0.00 ? 70 GLY A HA2  9  
ATOM 9324  H HA3  . GLY A 1 70 ? -5.935  -23.528 -4.189  1.00 0.00 ? 70 GLY A HA3  9  
ATOM 9325  N N    . GLY A 1 1  ? -15.562 -16.150 7.237   1.00 0.00 ? 1  GLY A N    10 
ATOM 9326  C CA   . GLY A 1 1  ? -14.926 -16.792 8.373   1.00 0.00 ? 1  GLY A CA   10 
ATOM 9327  C C    . GLY A 1 1  ? -13.458 -16.434 8.494   1.00 0.00 ? 1  GLY A C    10 
ATOM 9328  O O    . GLY A 1 1  ? -13.038 -15.834 9.483   1.00 0.00 ? 1  GLY A O    10 
ATOM 9329  H H1   . GLY A 1 1  ? -15.755 -16.670 6.429   1.00 0.00 ? 1  GLY A H1   10 
ATOM 9330  H HA2  . GLY A 1 1  ? -15.435 -16.489 9.275   1.00 0.00 ? 1  GLY A HA2  10 
ATOM 9331  H HA3  . GLY A 1 1  ? -15.015 -17.863 8.263   1.00 0.00 ? 1  GLY A HA3  10 
ATOM 9332  N N    . SER A 1 2  ? -12.675 -16.804 7.485   1.00 0.00 ? 2  SER A N    10 
ATOM 9333  C CA   . SER A 1 2  ? -11.244 -16.523 7.485   1.00 0.00 ? 2  SER A CA   10 
ATOM 9334  C C    . SER A 1 2  ? -10.972 -15.091 7.937   1.00 0.00 ? 2  SER A C    10 
ATOM 9335  O O    . SER A 1 2  ? -11.831 -14.218 7.821   1.00 0.00 ? 2  SER A O    10 
ATOM 9336  C CB   . SER A 1 2  ? -10.658 -16.750 6.091   1.00 0.00 ? 2  SER A CB   10 
ATOM 9337  O OG   . SER A 1 2  ? -10.382 -18.123 5.871   1.00 0.00 ? 2  SER A OG   10 
ATOM 9338  H H    . SER A 1 2  ? -13.069 -17.279 6.724   1.00 0.00 ? 2  SER A H    10 
ATOM 9339  H HA   . SER A 1 2  ? -10.773 -17.202 8.180   1.00 0.00 ? 2  SER A HA   10 
ATOM 9340  H HB2  . SER A 1 2  ? -11.364 -16.413 5.347   1.00 0.00 ? 2  SER A HB2  10 
ATOM 9341  H HB3  . SER A 1 2  ? -9.739  -16.190 5.994   1.00 0.00 ? 2  SER A HB3  10 
ATOM 9342  H HG   . SER A 1 2  ? -9.669  -18.403 6.448   1.00 0.00 ? 2  SER A HG   10 
ATOM 9343  N N    . SER A 1 3  ? -9.769  -14.858 8.452   1.00 0.00 ? 3  SER A N    10 
ATOM 9344  C CA   . SER A 1 3  ? -9.383  -13.534 8.925   1.00 0.00 ? 3  SER A CA   10 
ATOM 9345  C C    . SER A 1 3  ? -9.125  -12.592 7.752   1.00 0.00 ? 3  SER A C    10 
ATOM 9346  O O    . SER A 1 3  ? -8.363  -12.912 6.841   1.00 0.00 ? 3  SER A O    10 
ATOM 9347  C CB   . SER A 1 3  ? -8.133  -13.627 9.803   1.00 0.00 ? 3  SER A CB   10 
ATOM 9348  O OG   . SER A 1 3  ? -6.970  -13.820 9.017   1.00 0.00 ? 3  SER A OG   10 
ATOM 9349  H H    . SER A 1 3  ? -9.126  -15.596 8.518   1.00 0.00 ? 3  SER A H    10 
ATOM 9350  H HA   . SER A 1 3  ? -10.198 -13.142 9.514   1.00 0.00 ? 3  SER A HA   10 
ATOM 9351  H HB2  . SER A 1 3  ? -8.024  -12.713 10.367  1.00 0.00 ? 3  SER A HB2  10 
ATOM 9352  H HB3  . SER A 1 3  ? -8.236  -14.460 10.483  1.00 0.00 ? 3  SER A HB3  10 
ATOM 9353  H HG   . SER A 1 3  ? -6.698  -12.981 8.637   1.00 0.00 ? 3  SER A HG   10 
ATOM 9354  N N    . GLY A 1 4  ? -9.767  -11.428 7.784   1.00 0.00 ? 4  GLY A N    10 
ATOM 9355  C CA   . GLY A 1 4  ? -9.595  -10.457 6.719   1.00 0.00 ? 4  GLY A CA   10 
ATOM 9356  C C    . GLY A 1 4  ? -10.885 -10.182 5.972   1.00 0.00 ? 4  GLY A C    10 
ATOM 9357  O O    . GLY A 1 4  ? -11.187 -10.840 4.977   1.00 0.00 ? 4  GLY A O    10 
ATOM 9358  H H    . GLY A 1 4  ? -10.363 -11.228 8.536   1.00 0.00 ? 4  GLY A H    10 
ATOM 9359  H HA2  . GLY A 1 4  ? -9.233  -9.534  7.144   1.00 0.00 ? 4  GLY A HA2  10 
ATOM 9360  H HA3  . GLY A 1 4  ? -8.862  -10.833 6.020   1.00 0.00 ? 4  GLY A HA3  10 
ATOM 9361  N N    . SER A 1 5  ? -11.649 -9.207  6.454   1.00 0.00 ? 5  SER A N    10 
ATOM 9362  C CA   . SER A 1 5  ? -12.917 -8.849  5.829   1.00 0.00 ? 5  SER A CA   10 
ATOM 9363  C C    . SER A 1 5  ? -12.902 -7.396  5.362   1.00 0.00 ? 5  SER A C    10 
ATOM 9364  O O    . SER A 1 5  ? -13.194 -7.102  4.204   1.00 0.00 ? 5  SER A O    10 
ATOM 9365  C CB   . SER A 1 5  ? -14.073 -9.071  6.806   1.00 0.00 ? 5  SER A CB   10 
ATOM 9366  O OG   . SER A 1 5  ? -14.128 -10.421 7.232   1.00 0.00 ? 5  SER A OG   10 
ATOM 9367  H H    . SER A 1 5  ? -11.354 -8.718  7.251   1.00 0.00 ? 5  SER A H    10 
ATOM 9368  H HA   . SER A 1 5  ? -13.055 -9.489  4.970   1.00 0.00 ? 5  SER A HA   10 
ATOM 9369  H HB2  . SER A 1 5  ? -13.937 -8.438  7.670   1.00 0.00 ? 5  SER A HB2  10 
ATOM 9370  H HB3  . SER A 1 5  ? -15.005 -8.821  6.320   1.00 0.00 ? 5  SER A HB3  10 
ATOM 9371  H HG   . SER A 1 5  ? -13.409 -10.594 7.844   1.00 0.00 ? 5  SER A HG   10 
ATOM 9372  N N    . SER A 1 6  ? -12.560 -6.492  6.275   1.00 0.00 ? 6  SER A N    10 
ATOM 9373  C CA   . SER A 1 6  ? -12.510 -5.069  5.960   1.00 0.00 ? 6  SER A CA   10 
ATOM 9374  C C    . SER A 1 6  ? -11.296 -4.747  5.094   1.00 0.00 ? 6  SER A C    10 
ATOM 9375  O O    . SER A 1 6  ? -11.430 -4.240  3.981   1.00 0.00 ? 6  SER A O    10 
ATOM 9376  C CB   . SER A 1 6  ? -12.467 -4.242  7.246   1.00 0.00 ? 6  SER A CB   10 
ATOM 9377  O OG   . SER A 1 6  ? -13.768 -4.061  7.779   1.00 0.00 ? 6  SER A OG   10 
ATOM 9378  H H    . SER A 1 6  ? -12.338 -6.790  7.182   1.00 0.00 ? 6  SER A H    10 
ATOM 9379  H HA   . SER A 1 6  ? -13.405 -4.820  5.411   1.00 0.00 ? 6  SER A HA   10 
ATOM 9380  H HB2  . SER A 1 6  ? -11.859 -4.750  7.978   1.00 0.00 ? 6  SER A HB2  10 
ATOM 9381  H HB3  . SER A 1 6  ? -12.040 -3.273  7.033   1.00 0.00 ? 6  SER A HB3  10 
ATOM 9382  H HG   . SER A 1 6  ? -14.112 -3.208  7.501   1.00 0.00 ? 6  SER A HG   10 
ATOM 9383  N N    . GLY A 1 7  ? -10.109 -5.046  5.615   1.00 0.00 ? 7  GLY A N    10 
ATOM 9384  C CA   . GLY A 1 7  ? -8.887  -4.781  4.877   1.00 0.00 ? 7  GLY A CA   10 
ATOM 9385  C C    . GLY A 1 7  ? -7.981  -5.994  4.801   1.00 0.00 ? 7  GLY A C    10 
ATOM 9386  O O    . GLY A 1 7  ? -7.978  -6.834  5.702   1.00 0.00 ? 7  GLY A O    10 
ATOM 9387  H H    . GLY A 1 7  ? -10.063 -5.449  6.507   1.00 0.00 ? 7  GLY A H    10 
ATOM 9388  H HA2  . GLY A 1 7  ? -9.145  -4.474  3.874   1.00 0.00 ? 7  GLY A HA2  10 
ATOM 9389  H HA3  . GLY A 1 7  ? -8.354  -3.978  5.363   1.00 0.00 ? 7  GLY A HA3  10 
ATOM 9390  N N    . THR A 1 8  ? -7.211  -6.089  3.722   1.00 0.00 ? 8  THR A N    10 
ATOM 9391  C CA   . THR A 1 8  ? -6.299  -7.209  3.531   1.00 0.00 ? 8  THR A CA   10 
ATOM 9392  C C    . THR A 1 8  ? -4.868  -6.821  3.887   1.00 0.00 ? 8  THR A C    10 
ATOM 9393  O O    . THR A 1 8  ? -4.399  -5.727  3.571   1.00 0.00 ? 8  THR A O    10 
ATOM 9394  C CB   . THR A 1 8  ? -6.333  -7.719  2.078   1.00 0.00 ? 8  THR A CB   10 
ATOM 9395  O OG1  . THR A 1 8  ? -7.645  -8.195  1.756   1.00 0.00 ? 8  THR A OG1  10 
ATOM 9396  C CG2  . THR A 1 8  ? -5.319  -8.835  1.872   1.00 0.00 ? 8  THR A CG2  10 
ATOM 9397  H H    . THR A 1 8  ? -7.259  -5.388  3.039   1.00 0.00 ? 8  THR A H    10 
ATOM 9398  H HA   . THR A 1 8  ? -6.616  -8.012  4.180   1.00 0.00 ? 8  THR A HA   10 
ATOM 9399  H HB   . THR A 1 8  ? -6.083  -6.900  1.419   1.00 0.00 ? 8  THR A HB   10 
ATOM 9400  H HG1  . THR A 1 8  ? -7.855  -7.964  0.848   1.00 0.00 ? 8  THR A HG1  10 
ATOM 9401  H HG21 . THR A 1 8  ? -4.426  -8.619  2.439   1.00 0.00 ? 8  THR A HG21 10 
ATOM 9402  H HG22 . THR A 1 8  ? -5.071  -8.907  0.823   1.00 0.00 ? 8  THR A HG22 10 
ATOM 9403  H HG23 . THR A 1 8  ? -5.741  -9.770  2.208   1.00 0.00 ? 8  THR A HG23 10 
ATOM 9404  N N    . PRO A 1 9  ? -4.156  -7.736  4.561   1.00 0.00 ? 9  PRO A N    10 
ATOM 9405  C CA   . PRO A 1 9  ? -2.768  -7.512  4.974   1.00 0.00 ? 9  PRO A CA   10 
ATOM 9406  C C    . PRO A 1 9  ? -1.807  -7.493  3.791   1.00 0.00 ? 9  PRO A C    10 
ATOM 9407  O O    . PRO A 1 9  ? -1.938  -8.287  2.859   1.00 0.00 ? 9  PRO A O    10 
ATOM 9408  C CB   . PRO A 1 9  ? -2.471  -8.707  5.884   1.00 0.00 ? 9  PRO A CB   10 
ATOM 9409  C CG   . PRO A 1 9  ? -3.408  -9.772  5.429   1.00 0.00 ? 9  PRO A CG   10 
ATOM 9410  C CD   . PRO A 1 9  ? -4.652  -9.061  4.971   1.00 0.00 ? 9  PRO A CD   10 
ATOM 9411  H HA   . PRO A 1 9  ? -2.664  -6.595  5.536   1.00 0.00 ? 9  PRO A HA   10 
ATOM 9412  H HB2  . PRO A 1 9  ? -1.440  -9.008  5.763   1.00 0.00 ? 9  PRO A HB2  10 
ATOM 9413  H HB3  . PRO A 1 9  ? -2.653  -8.434  6.913   1.00 0.00 ? 9  PRO A HB3  10 
ATOM 9414  H HG2  . PRO A 1 9  ? -2.968  -10.323 4.612   1.00 0.00 ? 9  PRO A HG2  10 
ATOM 9415  H HG3  . PRO A 1 9  ? -3.637  -10.435 6.250   1.00 0.00 ? 9  PRO A HG3  10 
ATOM 9416  H HD2  . PRO A 1 9  ? -5.098  -9.581  4.136   1.00 0.00 ? 9  PRO A HD2  10 
ATOM 9417  H HD3  . PRO A 1 9  ? -5.357  -8.973  5.784   1.00 0.00 ? 9  PRO A HD3  10 
ATOM 9418  N N    . TYR A 1 10 ? -0.841  -6.582  3.834   1.00 0.00 ? 10 TYR A N    10 
ATOM 9419  C CA   . TYR A 1 10 ? 0.141   -6.458  2.763   1.00 0.00 ? 10 TYR A CA   10 
ATOM 9420  C C    . TYR A 1 10 ? 1.518   -6.112  3.324   1.00 0.00 ? 10 TYR A C    10 
ATOM 9421  O O    . TYR A 1 10 ? 1.672   -5.885  4.524   1.00 0.00 ? 10 TYR A O    10 
ATOM 9422  C CB   . TYR A 1 10 ? -0.297  -5.389  1.761   1.00 0.00 ? 10 TYR A CB   10 
ATOM 9423  C CG   . TYR A 1 10 ? -1.191  -5.918  0.663   1.00 0.00 ? 10 TYR A CG   10 
ATOM 9424  C CD1  . TYR A 1 10 ? -2.479  -6.359  0.940   1.00 0.00 ? 10 TYR A CD1  10 
ATOM 9425  C CD2  . TYR A 1 10 ? -0.747  -5.979  -0.652  1.00 0.00 ? 10 TYR A CD2  10 
ATOM 9426  C CE1  . TYR A 1 10 ? -3.299  -6.844  -0.060  1.00 0.00 ? 10 TYR A CE1  10 
ATOM 9427  C CE2  . TYR A 1 10 ? -1.560  -6.461  -1.659  1.00 0.00 ? 10 TYR A CE2  10 
ATOM 9428  C CZ   . TYR A 1 10 ? -2.835  -6.893  -1.358  1.00 0.00 ? 10 TYR A CZ   10 
ATOM 9429  O OH   . TYR A 1 10 ? -3.648  -7.376  -2.358  1.00 0.00 ? 10 TYR A OH   10 
ATOM 9430  H H    . TYR A 1 10 ? -0.788  -5.977  4.603   1.00 0.00 ? 10 TYR A H    10 
ATOM 9431  H HA   . TYR A 1 10 ? 0.201   -7.410  2.256   1.00 0.00 ? 10 TYR A HA   10 
ATOM 9432  H HB2  . TYR A 1 10 ? -0.838  -4.615  2.284   1.00 0.00 ? 10 TYR A HB2  10 
ATOM 9433  H HB3  . TYR A 1 10 ? 0.579   -4.958  1.298   1.00 0.00 ? 10 TYR A HB3  10 
ATOM 9434  H HD1  . TYR A 1 10 ? -2.839  -6.320  1.958   1.00 0.00 ? 10 TYR A HD1  10 
ATOM 9435  H HD2  . TYR A 1 10 ? 0.253   -5.640  -0.885  1.00 0.00 ? 10 TYR A HD2  10 
ATOM 9436  H HE1  . TYR A 1 10 ? -4.297  -7.182  0.175   1.00 0.00 ? 10 TYR A HE1  10 
ATOM 9437  H HE2  . TYR A 1 10 ? -1.197  -6.500  -2.676  1.00 0.00 ? 10 TYR A HE2  10 
ATOM 9438  H HH   . TYR A 1 10 ? -4.293  -6.706  -2.597  1.00 0.00 ? 10 TYR A HH   10 
ATOM 9439  N N    . ARG A 1 11 ? 2.514   -6.073  2.446   1.00 0.00 ? 11 ARG A N    10 
ATOM 9440  C CA   . ARG A 1 11 ? 3.878   -5.756  2.852   1.00 0.00 ? 11 ARG A CA   10 
ATOM 9441  C C    . ARG A 1 11 ? 4.606   -4.984  1.755   1.00 0.00 ? 11 ARG A C    10 
ATOM 9442  O O    . ARG A 1 11 ? 4.513   -5.325  0.576   1.00 0.00 ? 11 ARG A O    10 
ATOM 9443  C CB   . ARG A 1 11 ? 4.645   -7.037  3.184   1.00 0.00 ? 11 ARG A CB   10 
ATOM 9444  C CG   . ARG A 1 11 ? 6.130   -6.813  3.421   1.00 0.00 ? 11 ARG A CG   10 
ATOM 9445  C CD   . ARG A 1 11 ? 6.928   -8.088  3.197   1.00 0.00 ? 11 ARG A CD   10 
ATOM 9446  N NE   . ARG A 1 11 ? 8.294   -7.810  2.763   1.00 0.00 ? 11 ARG A NE   10 
ATOM 9447  C CZ   . ARG A 1 11 ? 9.045   -8.679  2.096   1.00 0.00 ? 11 ARG A CZ   10 
ATOM 9448  N NH1  . ARG A 1 11 ? 8.565   -9.876  1.789   1.00 0.00 ? 11 ARG A NH1  10 
ATOM 9449  N NH2  . ARG A 1 11 ? 10.280  -8.352  1.735   1.00 0.00 ? 11 ARG A NH2  10 
ATOM 9450  H H    . ARG A 1 11 ? 2.329   -6.264  1.503   1.00 0.00 ? 11 ARG A H    10 
ATOM 9451  H HA   . ARG A 1 11 ? 3.826   -5.138  3.736   1.00 0.00 ? 11 ARG A HA   10 
ATOM 9452  H HB2  . ARG A 1 11 ? 4.223   -7.475  4.077   1.00 0.00 ? 11 ARG A HB2  10 
ATOM 9453  H HB3  . ARG A 1 11 ? 4.534   -7.731  2.365   1.00 0.00 ? 11 ARG A HB3  10 
ATOM 9454  H HG2  . ARG A 1 11 ? 6.484   -6.056  2.738   1.00 0.00 ? 11 ARG A HG2  10 
ATOM 9455  H HG3  . ARG A 1 11 ? 6.277   -6.481  4.438   1.00 0.00 ? 11 ARG A HG3  10 
ATOM 9456  H HD2  . ARG A 1 11 ? 6.961   -8.644  4.122   1.00 0.00 ? 11 ARG A HD2  10 
ATOM 9457  H HD3  . ARG A 1 11 ? 6.433   -8.678  2.440   1.00 0.00 ? 11 ARG A HD3  10 
ATOM 9458  H HE   . ARG A 1 11 ? 8.669   -6.931  2.980   1.00 0.00 ? 11 ARG A HE   10 
ATOM 9459  H HH11 . ARG A 1 11 ? 7.635   -10.125 2.058   1.00 0.00 ? 11 ARG A HH11 10 
ATOM 9460  H HH12 . ARG A 1 11 ? 9.132   -10.529 1.286   1.00 0.00 ? 11 ARG A HH12 10 
ATOM 9461  H HH21 . ARG A 1 11 ? 10.645  -7.451  1.965   1.00 0.00 ? 11 ARG A HH21 10 
ATOM 9462  H HH22 . ARG A 1 11 ? 10.844  -9.007  1.234   1.00 0.00 ? 11 ARG A HH22 10 
ATOM 9463  N N    . ALA A 1 12 ? 5.330   -3.943  2.152   1.00 0.00 ? 12 ALA A N    10 
ATOM 9464  C CA   . ALA A 1 12 ? 6.075   -3.124  1.203   1.00 0.00 ? 12 ALA A CA   10 
ATOM 9465  C C    . ALA A 1 12 ? 7.404   -3.778  0.838   1.00 0.00 ? 12 ALA A C    10 
ATOM 9466  O O    . ALA A 1 12 ? 8.361   -3.732  1.610   1.00 0.00 ? 12 ALA A O    10 
ATOM 9467  C CB   . ALA A 1 12 ? 6.308   -1.734  1.775   1.00 0.00 ? 12 ALA A CB   10 
ATOM 9468  H H    . ALA A 1 12 ? 5.366   -3.721  3.105   1.00 0.00 ? 12 ALA A H    10 
ATOM 9469  H HA   . ALA A 1 12 ? 5.478   -3.023  0.308   1.00 0.00 ? 12 ALA A HA   10 
ATOM 9470  H HB1  . ALA A 1 12 ? 5.769   -1.634  2.706   1.00 0.00 ? 12 ALA A HB1  10 
ATOM 9471  H HB2  . ALA A 1 12 ? 7.364   -1.590  1.952   1.00 0.00 ? 12 ALA A HB2  10 
ATOM 9472  H HB3  . ALA A 1 12 ? 5.956   -0.993  1.074   1.00 0.00 ? 12 ALA A HB3  10 
ATOM 9473  N N    . MET A 1 13 ? 7.454   -4.387  -0.342  1.00 0.00 ? 13 MET A N    10 
ATOM 9474  C CA   . MET A 1 13 ? 8.666   -5.050  -0.808  1.00 0.00 ? 13 MET A CA   10 
ATOM 9475  C C    . MET A 1 13 ? 9.822   -4.060  -0.910  1.00 0.00 ? 13 MET A C    10 
ATOM 9476  O O    . MET A 1 13 ? 10.990  -4.447  -0.859  1.00 0.00 ? 13 MET A O    10 
ATOM 9477  C CB   . MET A 1 13 ? 8.422   -5.709  -2.167  1.00 0.00 ? 13 MET A CB   10 
ATOM 9478  C CG   . MET A 1 13 ? 7.173   -6.573  -2.208  1.00 0.00 ? 13 MET A CG   10 
ATOM 9479  S SD   . MET A 1 13 ? 7.229   -7.814  -3.515  1.00 0.00 ? 13 MET A SD   10 
ATOM 9480  C CE   . MET A 1 13 ? 6.465   -6.920  -4.865  1.00 0.00 ? 13 MET A CE   10 
ATOM 9481  H H    . MET A 1 13 ? 6.658   -4.390  -0.914  1.00 0.00 ? 13 MET A H    10 
ATOM 9482  H HA   . MET A 1 13 ? 8.924   -5.813  -0.089  1.00 0.00 ? 13 MET A HA   10 
ATOM 9483  H HB2  . MET A 1 13 ? 8.324   -4.937  -2.916  1.00 0.00 ? 13 MET A HB2  10 
ATOM 9484  H HB3  . MET A 1 13 ? 9.271   -6.330  -2.411  1.00 0.00 ? 13 MET A HB3  10 
ATOM 9485  H HG2  . MET A 1 13 ? 7.068   -7.076  -1.258  1.00 0.00 ? 13 MET A HG2  10 
ATOM 9486  H HG3  . MET A 1 13 ? 6.316   -5.936  -2.372  1.00 0.00 ? 13 MET A HG3  10 
ATOM 9487  H HE1  . MET A 1 13 ? 5.392   -7.022  -4.803  1.00 0.00 ? 13 MET A HE1  10 
ATOM 9488  H HE2  . MET A 1 13 ? 6.732   -5.875  -4.801  1.00 0.00 ? 13 MET A HE2  10 
ATOM 9489  H HE3  . MET A 1 13 ? 6.811   -7.323  -5.805  1.00 0.00 ? 13 MET A HE3  10 
ATOM 9490  N N    . TYR A 1 14 ? 9.490   -2.782  -1.056  1.00 0.00 ? 14 TYR A N    10 
ATOM 9491  C CA   . TYR A 1 14 ? 10.501  -1.737  -1.168  1.00 0.00 ? 14 TYR A CA   10 
ATOM 9492  C C    . TYR A 1 14 ? 9.990   -0.421  -0.589  1.00 0.00 ? 14 TYR A C    10 
ATOM 9493  O O    . TYR A 1 14 ? 8.823   -0.069  -0.755  1.00 0.00 ? 14 TYR A O    10 
ATOM 9494  C CB   . TYR A 1 14 ? 10.902  -1.542  -2.631  1.00 0.00 ? 14 TYR A CB   10 
ATOM 9495  C CG   . TYR A 1 14 ? 10.814  -2.805  -3.457  1.00 0.00 ? 14 TYR A CG   10 
ATOM 9496  C CD1  . TYR A 1 14 ? 11.839  -3.743  -3.438  1.00 0.00 ? 14 TYR A CD1  10 
ATOM 9497  C CD2  . TYR A 1 14 ? 9.707   -3.061  -4.257  1.00 0.00 ? 14 TYR A CD2  10 
ATOM 9498  C CE1  . TYR A 1 14 ? 11.764  -4.898  -4.192  1.00 0.00 ? 14 TYR A CE1  10 
ATOM 9499  C CE2  . TYR A 1 14 ? 9.623   -4.214  -5.012  1.00 0.00 ? 14 TYR A CE2  10 
ATOM 9500  C CZ   . TYR A 1 14 ? 10.654  -5.129  -4.977  1.00 0.00 ? 14 TYR A CZ   10 
ATOM 9501  O OH   . TYR A 1 14 ? 10.574  -6.279  -5.729  1.00 0.00 ? 14 TYR A OH   10 
ATOM 9502  H H    . TYR A 1 14 ? 8.542   -2.535  -1.090  1.00 0.00 ? 14 TYR A H    10 
ATOM 9503  H HA   . TYR A 1 14 ? 11.367  -2.053  -0.606  1.00 0.00 ? 14 TYR A HA   10 
ATOM 9504  H HB2  . TYR A 1 14 ? 10.252  -0.807  -3.080  1.00 0.00 ? 14 TYR A HB2  10 
ATOM 9505  H HB3  . TYR A 1 14 ? 11.922  -1.187  -2.673  1.00 0.00 ? 14 TYR A HB3  10 
ATOM 9506  H HD1  . TYR A 1 14 ? 12.708  -3.559  -2.823  1.00 0.00 ? 14 TYR A HD1  10 
ATOM 9507  H HD2  . TYR A 1 14 ? 8.901   -2.341  -4.282  1.00 0.00 ? 14 TYR A HD2  10 
ATOM 9508  H HE1  . TYR A 1 14 ? 12.571  -5.616  -4.164  1.00 0.00 ? 14 TYR A HE1  10 
ATOM 9509  H HE2  . TYR A 1 14 ? 8.753   -4.395  -5.627  1.00 0.00 ? 14 TYR A HE2  10 
ATOM 9510  H HH   . TYR A 1 14 ? 10.934  -6.114  -6.604  1.00 0.00 ? 14 TYR A HH   10 
ATOM 9511  N N    . GLN A 1 15 ? 10.875  0.301   0.091   1.00 0.00 ? 15 GLN A N    10 
ATOM 9512  C CA   . GLN A 1 15 ? 10.515  1.578   0.695   1.00 0.00 ? 15 GLN A CA   10 
ATOM 9513  C C    . GLN A 1 15 ? 10.044  2.569   -0.365  1.00 0.00 ? 15 GLN A C    10 
ATOM 9514  O O    . GLN A 1 15 ? 10.623  2.656   -1.448  1.00 0.00 ? 15 GLN A O    10 
ATOM 9515  C CB   . GLN A 1 15 ? 11.707  2.159   1.459   1.00 0.00 ? 15 GLN A CB   10 
ATOM 9516  C CG   . GLN A 1 15 ? 11.382  3.440   2.210   1.00 0.00 ? 15 GLN A CG   10 
ATOM 9517  C CD   . GLN A 1 15 ? 12.472  3.837   3.186   1.00 0.00 ? 15 GLN A CD   10 
ATOM 9518  O OE1  . GLN A 1 15 ? 13.278  3.006   3.605   1.00 0.00 ? 15 GLN A OE1  10 
ATOM 9519  N NE2  . GLN A 1 15 ? 12.501  5.112   3.555   1.00 0.00 ? 15 GLN A NE2  10 
ATOM 9520  H H    . GLN A 1 15 ? 11.791  -0.033  0.188   1.00 0.00 ? 15 GLN A H    10 
ATOM 9521  H HA   . GLN A 1 15 ? 9.707   1.401   1.388   1.00 0.00 ? 15 GLN A HA   10 
ATOM 9522  H HB2  . GLN A 1 15 ? 12.053  1.426   2.173   1.00 0.00 ? 15 GLN A HB2  10 
ATOM 9523  H HB3  . GLN A 1 15 ? 12.500  2.370   0.758   1.00 0.00 ? 15 GLN A HB3  10 
ATOM 9524  H HG2  . GLN A 1 15 ? 11.253  4.239   1.495   1.00 0.00 ? 15 GLN A HG2  10 
ATOM 9525  H HG3  . GLN A 1 15 ? 10.462  3.298   2.758   1.00 0.00 ? 15 GLN A HG3  10 
ATOM 9526  H HE21 . GLN A 1 15 ? 11.826  5.717   3.182   1.00 0.00 ? 15 GLN A HE21 10 
ATOM 9527  H HE22 . GLN A 1 15 ? 13.194  5.395   4.186   1.00 0.00 ? 15 GLN A HE22 10 
ATOM 9528  N N    . TYR A 1 16 ? 8.991   3.313   -0.046  1.00 0.00 ? 16 TYR A N    10 
ATOM 9529  C CA   . TYR A 1 16 ? 8.441   4.295   -0.972  1.00 0.00 ? 16 TYR A CA   10 
ATOM 9530  C C    . TYR A 1 16 ? 8.638   5.713   -0.443  1.00 0.00 ? 16 TYR A C    10 
ATOM 9531  O O    . TYR A 1 16 ? 8.797   5.922   0.759   1.00 0.00 ? 16 TYR A O    10 
ATOM 9532  C CB   . TYR A 1 16 ? 6.953   4.029   -1.206  1.00 0.00 ? 16 TYR A CB   10 
ATOM 9533  C CG   . TYR A 1 16 ? 6.301   5.019   -2.144  1.00 0.00 ? 16 TYR A CG   10 
ATOM 9534  C CD1  . TYR A 1 16 ? 6.627   5.046   -3.494  1.00 0.00 ? 16 TYR A CD1  10 
ATOM 9535  C CD2  . TYR A 1 16 ? 5.357   5.927   -1.680  1.00 0.00 ? 16 TYR A CD2  10 
ATOM 9536  C CE1  . TYR A 1 16 ? 6.035   5.950   -4.354  1.00 0.00 ? 16 TYR A CE1  10 
ATOM 9537  C CE2  . TYR A 1 16 ? 4.758   6.834   -2.533  1.00 0.00 ? 16 TYR A CE2  10 
ATOM 9538  C CZ   . TYR A 1 16 ? 5.100   6.842   -3.869  1.00 0.00 ? 16 TYR A CZ   10 
ATOM 9539  O OH   . TYR A 1 16 ? 4.506   7.742   -4.723  1.00 0.00 ? 16 TYR A OH   10 
ATOM 9540  H H    . TYR A 1 16 ? 8.573   3.198   0.833   1.00 0.00 ? 16 TYR A H    10 
ATOM 9541  H HA   . TYR A 1 16 ? 8.966   4.197   -1.911  1.00 0.00 ? 16 TYR A HA   10 
ATOM 9542  H HB2  . TYR A 1 16 ? 6.833   3.044   -1.629  1.00 0.00 ? 16 TYR A HB2  10 
ATOM 9543  H HB3  . TYR A 1 16 ? 6.433   4.075   -0.260  1.00 0.00 ? 16 TYR A HB3  10 
ATOM 9544  H HD1  . TYR A 1 16 ? 7.359   4.347   -3.871  1.00 0.00 ? 16 TYR A HD1  10 
ATOM 9545  H HD2  . TYR A 1 16 ? 5.091   5.919   -0.633  1.00 0.00 ? 16 TYR A HD2  10 
ATOM 9546  H HE1  . TYR A 1 16 ? 6.302   5.956   -5.401  1.00 0.00 ? 16 TYR A HE1  10 
ATOM 9547  H HE2  . TYR A 1 16 ? 4.026   7.532   -2.154  1.00 0.00 ? 16 TYR A HE2  10 
ATOM 9548  H HH   . TYR A 1 16 ? 3.552   7.691   -4.630  1.00 0.00 ? 16 TYR A HH   10 
ATOM 9549  N N    . ARG A 1 17 ? 8.626   6.683   -1.352  1.00 0.00 ? 17 ARG A N    10 
ATOM 9550  C CA   . ARG A 1 17 ? 8.805   8.081   -0.978  1.00 0.00 ? 17 ARG A CA   10 
ATOM 9551  C C    . ARG A 1 17 ? 7.704   8.949   -1.581  1.00 0.00 ? 17 ARG A C    10 
ATOM 9552  O O    . ARG A 1 17 ? 7.812   9.440   -2.705  1.00 0.00 ? 17 ARG A O    10 
ATOM 9553  C CB   . ARG A 1 17 ? 10.174  8.583   -1.439  1.00 0.00 ? 17 ARG A CB   10 
ATOM 9554  C CG   . ARG A 1 17 ? 11.331  8.032   -0.622  1.00 0.00 ? 17 ARG A CG   10 
ATOM 9555  C CD   . ARG A 1 17 ? 12.627  8.769   -0.923  1.00 0.00 ? 17 ARG A CD   10 
ATOM 9556  N NE   . ARG A 1 17 ? 12.939  8.768   -2.349  1.00 0.00 ? 17 ARG A NE   10 
ATOM 9557  C CZ   . ARG A 1 17 ? 14.048  9.292   -2.859  1.00 0.00 ? 17 ARG A CZ   10 
ATOM 9558  N NH1  . ARG A 1 17 ? 14.946  9.855   -2.063  1.00 0.00 ? 17 ARG A NH1  10 
ATOM 9559  N NH2  . ARG A 1 17 ? 14.261  9.252   -4.168  1.00 0.00 ? 17 ARG A NH2  10 
ATOM 9560  H H    . ARG A 1 17 ? 8.496   6.453   -2.295  1.00 0.00 ? 17 ARG A H    10 
ATOM 9561  H HA   . ARG A 1 17 ? 8.750   8.147   0.098   1.00 0.00 ? 17 ARG A HA   10 
ATOM 9562  H HB2  . ARG A 1 17 ? 10.322  8.297   -2.470  1.00 0.00 ? 17 ARG A HB2  10 
ATOM 9563  H HB3  . ARG A 1 17 ? 10.192  9.660   -1.366  1.00 0.00 ? 17 ARG A HB3  10 
ATOM 9564  H HG2  . ARG A 1 17 ? 11.103  8.141   0.428   1.00 0.00 ? 17 ARG A HG2  10 
ATOM 9565  H HG3  . ARG A 1 17 ? 11.459  6.986   -0.858  1.00 0.00 ? 17 ARG A HG3  10 
ATOM 9566  H HD2  . ARG A 1 17 ? 12.530  9.791   -0.586  1.00 0.00 ? 17 ARG A HD2  10 
ATOM 9567  H HD3  . ARG A 1 17 ? 13.431  8.289   -0.387  1.00 0.00 ? 17 ARG A HD3  10 
ATOM 9568  H HE   . ARG A 1 17 ? 12.289  8.356   -2.956  1.00 0.00 ? 17 ARG A HE   10 
ATOM 9569  H HH11 . ARG A 1 17 ? 14.789  9.886   -1.076  1.00 0.00 ? 17 ARG A HH11 10 
ATOM 9570  H HH12 . ARG A 1 17 ? 15.781  10.248  -2.449  1.00 0.00 ? 17 ARG A HH12 10 
ATOM 9571  H HH21 . ARG A 1 17 ? 13.587  8.827   -4.772  1.00 0.00 ? 17 ARG A HH21 10 
ATOM 9572  H HH22 . ARG A 1 17 ? 15.096  9.646   -4.551  1.00 0.00 ? 17 ARG A HH22 10 
ATOM 9573  N N    . PRO A 1 18 ? 6.618   9.142   -0.818  1.00 0.00 ? 18 PRO A N    10 
ATOM 9574  C CA   . PRO A 1 18 ? 5.476   9.951   -1.255  1.00 0.00 ? 18 PRO A CA   10 
ATOM 9575  C C    . PRO A 1 18 ? 5.811   11.437  -1.326  1.00 0.00 ? 18 PRO A C    10 
ATOM 9576  O O    . PRO A 1 18 ? 6.301   12.018  -0.358  1.00 0.00 ? 18 PRO A O    10 
ATOM 9577  C CB   . PRO A 1 18 ? 4.423   9.691   -0.176  1.00 0.00 ? 18 PRO A CB   10 
ATOM 9578  C CG   . PRO A 1 18 ? 5.206   9.315   1.035   1.00 0.00 ? 18 PRO A CG   10 
ATOM 9579  C CD   . PRO A 1 18 ? 6.421   8.586   0.532   1.00 0.00 ? 18 PRO A CD   10 
ATOM 9580  H HA   . PRO A 1 18 ? 5.101   9.622   -2.213  1.00 0.00 ? 18 PRO A HA   10 
ATOM 9581  H HB2  . PRO A 1 18 ? 3.845   10.589  -0.010  1.00 0.00 ? 18 PRO A HB2  10 
ATOM 9582  H HB3  . PRO A 1 18 ? 3.771   8.890   -0.489  1.00 0.00 ? 18 PRO A HB3  10 
ATOM 9583  H HG2  . PRO A 1 18 ? 5.497   10.203  1.574   1.00 0.00 ? 18 PRO A HG2  10 
ATOM 9584  H HG3  . PRO A 1 18 ? 4.616   8.667   1.666   1.00 0.00 ? 18 PRO A HG3  10 
ATOM 9585  H HD2  . PRO A 1 18 ? 7.273   8.794   1.162   1.00 0.00 ? 18 PRO A HD2  10 
ATOM 9586  H HD3  . PRO A 1 18 ? 6.232   7.524   0.487   1.00 0.00 ? 18 PRO A HD3  10 
ATOM 9587  N N    . GLN A 1 19 ? 5.545   12.045  -2.477  1.00 0.00 ? 19 GLN A N    10 
ATOM 9588  C CA   . GLN A 1 19 ? 5.819   13.463  -2.673  1.00 0.00 ? 19 GLN A CA   10 
ATOM 9589  C C    . GLN A 1 19 ? 4.945   14.318  -1.761  1.00 0.00 ? 19 GLN A C    10 
ATOM 9590  O O    . GLN A 1 19 ? 5.345   15.402  -1.339  1.00 0.00 ? 19 GLN A O    10 
ATOM 9591  C CB   . GLN A 1 19 ? 5.586   13.853  -4.134  1.00 0.00 ? 19 GLN A CB   10 
ATOM 9592  C CG   . GLN A 1 19 ? 6.637   13.305  -5.085  1.00 0.00 ? 19 GLN A CG   10 
ATOM 9593  C CD   . GLN A 1 19 ? 7.997   13.942  -4.881  1.00 0.00 ? 19 GLN A CD   10 
ATOM 9594  O OE1  . GLN A 1 19 ? 8.160   14.832  -4.045  1.00 0.00 ? 19 GLN A OE1  10 
ATOM 9595  N NE2  . GLN A 1 19 ? 8.984   13.490  -5.645  1.00 0.00 ? 19 GLN A NE2  10 
ATOM 9596  H H    . GLN A 1 19 ? 5.155   11.527  -3.212  1.00 0.00 ? 19 GLN A H    10 
ATOM 9597  H HA   . GLN A 1 19 ? 6.855   13.638  -2.425  1.00 0.00 ? 19 GLN A HA   10 
ATOM 9598  H HB2  . GLN A 1 19 ? 4.621   13.480  -4.444  1.00 0.00 ? 19 GLN A HB2  10 
ATOM 9599  H HB3  . GLN A 1 19 ? 5.588   14.930  -4.211  1.00 0.00 ? 19 GLN A HB3  10 
ATOM 9600  H HG2  . GLN A 1 19 ? 6.728   12.241  -4.926  1.00 0.00 ? 19 GLN A HG2  10 
ATOM 9601  H HG3  . GLN A 1 19 ? 6.317   13.491  -6.100  1.00 0.00 ? 19 GLN A HG3  10 
ATOM 9602  H HE21 . GLN A 1 19 ? 8.781   12.780  -6.291  1.00 0.00 ? 19 GLN A HE21 10 
ATOM 9603  H HE22 . GLN A 1 19 ? 9.874   13.884  -5.535  1.00 0.00 ? 19 GLN A HE22 10 
ATOM 9604  N N    . ASN A 1 20 ? 3.749   13.821  -1.460  1.00 0.00 ? 20 ASN A N    10 
ATOM 9605  C CA   . ASN A 1 20 ? 2.818   14.540  -0.598  1.00 0.00 ? 20 ASN A CA   10 
ATOM 9606  C C    . ASN A 1 20 ? 2.053   13.574  0.301   1.00 0.00 ? 20 ASN A C    10 
ATOM 9607  O O    . ASN A 1 20 ? 2.304   12.369  0.289   1.00 0.00 ? 20 ASN A O    10 
ATOM 9608  C CB   . ASN A 1 20 ? 1.836   15.356  -1.441  1.00 0.00 ? 20 ASN A CB   10 
ATOM 9609  C CG   . ASN A 1 20 ? 1.466   14.657  -2.736  1.00 0.00 ? 20 ASN A CG   10 
ATOM 9610  O OD1  . ASN A 1 20 ? 2.336   14.209  -3.483  1.00 0.00 ? 20 ASN A OD1  10 
ATOM 9611  N ND2  . ASN A 1 20 ? 0.170   14.561  -3.006  1.00 0.00 ? 20 ASN A ND2  10 
ATOM 9612  H H    . ASN A 1 20 ? 3.487   12.951  -1.827  1.00 0.00 ? 20 ASN A H    10 
ATOM 9613  H HA   . ASN A 1 20 ? 3.392   15.212  0.021   1.00 0.00 ? 20 ASN A HA   10 
ATOM 9614  H HB2  . ASN A 1 20 ? 0.932   15.519  -0.873  1.00 0.00 ? 20 ASN A HB2  10 
ATOM 9615  H HB3  . ASN A 1 20 ? 2.282   16.308  -1.683  1.00 0.00 ? 20 ASN A HB3  10 
ATOM 9616  H HD21 . ASN A 1 20 ? -0.467  14.940  -2.365  1.00 0.00 ? 20 ASN A HD21 10 
ATOM 9617  H HD22 . ASN A 1 20 ? -0.098  14.113  -3.836  1.00 0.00 ? 20 ASN A HD22 10 
ATOM 9618  N N    . GLU A 1 21 ? 1.118   14.111  1.079   1.00 0.00 ? 21 GLU A N    10 
ATOM 9619  C CA   . GLU A 1 21 ? 0.317   13.296  1.984   1.00 0.00 ? 21 GLU A CA   10 
ATOM 9620  C C    . GLU A 1 21 ? -0.614  12.372  1.204   1.00 0.00 ? 21 GLU A C    10 
ATOM 9621  O O    . GLU A 1 21 ? -0.748  11.192  1.528   1.00 0.00 ? 21 GLU A O    10 
ATOM 9622  C CB   . GLU A 1 21 ? -0.500  14.188  2.921   1.00 0.00 ? 21 GLU A CB   10 
ATOM 9623  C CG   . GLU A 1 21 ? -1.524  15.050  2.202   1.00 0.00 ? 21 GLU A CG   10 
ATOM 9624  C CD   . GLU A 1 21 ? -1.920  16.276  3.002   1.00 0.00 ? 21 GLU A CD   10 
ATOM 9625  O OE1  . GLU A 1 21 ? -1.132  17.244  3.034   1.00 0.00 ? 21 GLU A OE1  10 
ATOM 9626  O OE2  . GLU A 1 21 ? -3.019  16.266  3.596   1.00 0.00 ? 21 GLU A OE2  10 
ATOM 9627  H H    . GLU A 1 21 ? 0.965   15.079  1.043   1.00 0.00 ? 21 GLU A H    10 
ATOM 9628  H HA   . GLU A 1 21 ? 0.992   12.694  2.573   1.00 0.00 ? 21 GLU A HA   10 
ATOM 9629  H HB2  . GLU A 1 21 ? -1.021  13.563  3.631   1.00 0.00 ? 21 GLU A HB2  10 
ATOM 9630  H HB3  . GLU A 1 21 ? 0.175   14.840  3.456   1.00 0.00 ? 21 GLU A HB3  10 
ATOM 9631  H HG2  . GLU A 1 21 ? -1.106  15.373  1.260   1.00 0.00 ? 21 GLU A HG2  10 
ATOM 9632  H HG3  . GLU A 1 21 ? -2.408  14.457  2.017   1.00 0.00 ? 21 GLU A HG3  10 
ATOM 9633  N N    . ASP A 1 22 ? -1.254  12.917  0.176   1.00 0.00 ? 22 ASP A N    10 
ATOM 9634  C CA   . ASP A 1 22 ? -2.172  12.143  -0.651  1.00 0.00 ? 22 ASP A CA   10 
ATOM 9635  C C    . ASP A 1 22 ? -1.697  10.700  -0.785  1.00 0.00 ? 22 ASP A C    10 
ATOM 9636  O O    . ASP A 1 22 ? -2.503  9.770   -0.804  1.00 0.00 ? 22 ASP A O    10 
ATOM 9637  C CB   . ASP A 1 22 ? -2.307  12.780  -2.035  1.00 0.00 ? 22 ASP A CB   10 
ATOM 9638  C CG   . ASP A 1 22 ? -2.915  14.167  -1.977  1.00 0.00 ? 22 ASP A CG   10 
ATOM 9639  O OD1  . ASP A 1 22 ? -3.906  14.350  -1.240  1.00 0.00 ? 22 ASP A OD1  10 
ATOM 9640  O OD2  . ASP A 1 22 ? -2.400  15.070  -2.670  1.00 0.00 ? 22 ASP A OD2  10 
ATOM 9641  H H    . ASP A 1 22 ? -1.106  13.864  -0.032  1.00 0.00 ? 22 ASP A H    10 
ATOM 9642  H HA   . ASP A 1 22 ? -3.138  12.147  -0.167  1.00 0.00 ? 22 ASP A HA   10 
ATOM 9643  H HB2  . ASP A 1 22 ? -1.328  12.854  -2.486  1.00 0.00 ? 22 ASP A HB2  10 
ATOM 9644  H HB3  . ASP A 1 22 ? -2.937  12.155  -2.651  1.00 0.00 ? 22 ASP A HB3  10 
ATOM 9645  N N    . GLU A 1 23 ? -0.383  10.521  -0.879  1.00 0.00 ? 23 GLU A N    10 
ATOM 9646  C CA   . GLU A 1 23 ? 0.199   9.191   -1.014  1.00 0.00 ? 23 GLU A CA   10 
ATOM 9647  C C    . GLU A 1 23 ? 0.682   8.669   0.336   1.00 0.00 ? 23 GLU A C    10 
ATOM 9648  O O    . GLU A 1 23 ? 1.194   9.427   1.160   1.00 0.00 ? 23 GLU A O    10 
ATOM 9649  C CB   . GLU A 1 23 ? 1.361   9.217   -2.009  1.00 0.00 ? 23 GLU A CB   10 
ATOM 9650  C CG   . GLU A 1 23 ? 1.033   9.929   -3.311  1.00 0.00 ? 23 GLU A CG   10 
ATOM 9651  C CD   . GLU A 1 23 ? 2.209   9.968   -4.267  1.00 0.00 ? 23 GLU A CD   10 
ATOM 9652  O OE1  . GLU A 1 23 ? 3.292   10.434  -3.855  1.00 0.00 ? 23 GLU A OE1  10 
ATOM 9653  O OE2  . GLU A 1 23 ? 2.046   9.534   -5.426  1.00 0.00 ? 23 GLU A OE2  10 
ATOM 9654  H H    . GLU A 1 23 ? 0.209   11.302  -0.859  1.00 0.00 ? 23 GLU A H    10 
ATOM 9655  H HA   . GLU A 1 23 ? -0.568  8.530   -1.389  1.00 0.00 ? 23 GLU A HA   10 
ATOM 9656  H HB2  . GLU A 1 23 ? 2.201   9.718   -1.550  1.00 0.00 ? 23 GLU A HB2  10 
ATOM 9657  H HB3  . GLU A 1 23 ? 1.643   8.200   -2.241  1.00 0.00 ? 23 GLU A HB3  10 
ATOM 9658  H HG2  . GLU A 1 23 ? 0.215   9.413   -3.792  1.00 0.00 ? 23 GLU A HG2  10 
ATOM 9659  H HG3  . GLU A 1 23 ? 0.736   10.943  -3.086  1.00 0.00 ? 23 GLU A HG3  10 
ATOM 9660  N N    . LEU A 1 24 ? 0.515   7.369   0.555   1.00 0.00 ? 24 LEU A N    10 
ATOM 9661  C CA   . LEU A 1 24 ? 0.933   6.745   1.805   1.00 0.00 ? 24 LEU A CA   10 
ATOM 9662  C C    . LEU A 1 24 ? 2.372   6.246   1.710   1.00 0.00 ? 24 LEU A C    10 
ATOM 9663  O O    . LEU A 1 24 ? 2.760   5.630   0.719   1.00 0.00 ? 24 LEU A O    10 
ATOM 9664  C CB   . LEU A 1 24 ? 0.001   5.583   2.154   1.00 0.00 ? 24 LEU A CB   10 
ATOM 9665  C CG   . LEU A 1 24 ? 0.029   5.114   3.610   1.00 0.00 ? 24 LEU A CG   10 
ATOM 9666  C CD1  . LEU A 1 24 ? -0.333  6.257   4.545   1.00 0.00 ? 24 LEU A CD1  10 
ATOM 9667  C CD2  . LEU A 1 24 ? -0.917  3.939   3.809   1.00 0.00 ? 24 LEU A CD2  10 
ATOM 9668  H H    . LEU A 1 24 ? 0.101   6.816   -0.139  1.00 0.00 ? 24 LEU A H    10 
ATOM 9669  H HA   . LEU A 1 24 ? 0.874   7.490   2.584   1.00 0.00 ? 24 LEU A HA   10 
ATOM 9670  H HB2  . LEU A 1 24 ? -1.008  5.888   1.925   1.00 0.00 ? 24 LEU A HB2  10 
ATOM 9671  H HB3  . LEU A 1 24 ? 0.272   4.743   1.530   1.00 0.00 ? 24 LEU A HB3  10 
ATOM 9672  H HG   . LEU A 1 24 ? 1.029   4.786   3.856   1.00 0.00 ? 24 LEU A HG   10 
ATOM 9673  H HD11 . LEU A 1 24 ? 0.422   7.026   4.483   1.00 0.00 ? 24 LEU A HD11 10 
ATOM 9674  H HD12 . LEU A 1 24 ? -0.389  5.888   5.559   1.00 0.00 ? 24 LEU A HD12 10 
ATOM 9675  H HD13 . LEU A 1 24 ? -1.290  6.667   4.259   1.00 0.00 ? 24 LEU A HD13 10 
ATOM 9676  H HD21 . LEU A 1 24 ? -1.765  4.256   4.399   1.00 0.00 ? 24 LEU A HD21 10 
ATOM 9677  H HD22 . LEU A 1 24 ? -0.398  3.143   4.324   1.00 0.00 ? 24 LEU A HD22 10 
ATOM 9678  H HD23 . LEU A 1 24 ? -1.259  3.585   2.848   1.00 0.00 ? 24 LEU A HD23 10 
ATOM 9679  N N    . GLU A 1 25 ? 3.156   6.517   2.749   1.00 0.00 ? 25 GLU A N    10 
ATOM 9680  C CA   . GLU A 1 25 ? 4.551   6.094   2.783   1.00 0.00 ? 25 GLU A CA   10 
ATOM 9681  C C    . GLU A 1 25 ? 4.663   4.613   3.131   1.00 0.00 ? 25 GLU A C    10 
ATOM 9682  O O    . GLU A 1 25 ? 3.806   4.059   3.822   1.00 0.00 ? 25 GLU A O    10 
ATOM 9683  C CB   . GLU A 1 25 ? 5.336   6.928   3.797   1.00 0.00 ? 25 GLU A CB   10 
ATOM 9684  C CG   . GLU A 1 25 ? 6.817   7.040   3.478   1.00 0.00 ? 25 GLU A CG   10 
ATOM 9685  C CD   . GLU A 1 25 ? 7.486   8.190   4.206   1.00 0.00 ? 25 GLU A CD   10 
ATOM 9686  O OE1  . GLU A 1 25 ? 7.696   8.074   5.431   1.00 0.00 ? 25 GLU A OE1  10 
ATOM 9687  O OE2  . GLU A 1 25 ? 7.799   9.205   3.549   1.00 0.00 ? 25 GLU A OE2  10 
ATOM 9688  H H    . GLU A 1 25 ? 2.788   7.012   3.510   1.00 0.00 ? 25 GLU A H    10 
ATOM 9689  H HA   . GLU A 1 25 ? 4.969   6.253   1.800   1.00 0.00 ? 25 GLU A HA   10 
ATOM 9690  H HB2  . GLU A 1 25 ? 4.918   7.924   3.826   1.00 0.00 ? 25 GLU A HB2  10 
ATOM 9691  H HB3  . GLU A 1 25 ? 5.232   6.476   4.773   1.00 0.00 ? 25 GLU A HB3  10 
ATOM 9692  H HG2  . GLU A 1 25 ? 7.304   6.120   3.765   1.00 0.00 ? 25 GLU A HG2  10 
ATOM 9693  H HG3  . GLU A 1 25 ? 6.933   7.190   2.415   1.00 0.00 ? 25 GLU A HG3  10 
ATOM 9694  N N    . LEU A 1 26 ? 5.723   3.976   2.647   1.00 0.00 ? 26 LEU A N    10 
ATOM 9695  C CA   . LEU A 1 26 ? 5.948   2.558   2.907   1.00 0.00 ? 26 LEU A CA   10 
ATOM 9696  C C    . LEU A 1 26 ? 7.428   2.276   3.147   1.00 0.00 ? 26 LEU A C    10 
ATOM 9697  O O    . LEU A 1 26 ? 8.296   2.950   2.593   1.00 0.00 ? 26 LEU A O    10 
ATOM 9698  C CB   . LEU A 1 26 ? 5.442   1.718   1.733   1.00 0.00 ? 26 LEU A CB   10 
ATOM 9699  C CG   . LEU A 1 26 ? 4.054   2.076   1.200   1.00 0.00 ? 26 LEU A CG   10 
ATOM 9700  C CD1  . LEU A 1 26 ? 3.885   1.581   -0.228  1.00 0.00 ? 26 LEU A CD1  10 
ATOM 9701  C CD2  . LEU A 1 26 ? 2.972   1.496   2.099   1.00 0.00 ? 26 LEU A CD2  10 
ATOM 9702  H H    . LEU A 1 26 ? 6.371   4.469   2.104   1.00 0.00 ? 26 LEU A H    10 
ATOM 9703  H HA   . LEU A 1 26 ? 5.394   2.291   3.795   1.00 0.00 ? 26 LEU A HA   10 
ATOM 9704  H HB2  . LEU A 1 26 ? 6.145   1.826   0.921   1.00 0.00 ? 26 LEU A HB2  10 
ATOM 9705  H HB3  . LEU A 1 26 ? 5.419   0.685   2.051   1.00 0.00 ? 26 LEU A HB3  10 
ATOM 9706  H HG   . LEU A 1 26 ? 3.944   3.152   1.195   1.00 0.00 ? 26 LEU A HG   10 
ATOM 9707  H HD11 . LEU A 1 26 ? 4.158   0.538   -0.281  1.00 0.00 ? 26 LEU A HD11 10 
ATOM 9708  H HD12 . LEU A 1 26 ? 4.522   2.155   -0.885  1.00 0.00 ? 26 LEU A HD12 10 
ATOM 9709  H HD13 . LEU A 1 26 ? 2.855   1.701   -0.531  1.00 0.00 ? 26 LEU A HD13 10 
ATOM 9710  H HD21 . LEU A 1 26 ? 2.310   2.286   2.422   1.00 0.00 ? 26 LEU A HD21 10 
ATOM 9711  H HD22 . LEU A 1 26 ? 3.430   1.035   2.963   1.00 0.00 ? 26 LEU A HD22 10 
ATOM 9712  H HD23 . LEU A 1 26 ? 2.409   0.755   1.552   1.00 0.00 ? 26 LEU A HD23 10 
ATOM 9713  N N    . ARG A 1 27 ? 7.707   1.275   3.975   1.00 0.00 ? 27 ARG A N    10 
ATOM 9714  C CA   . ARG A 1 27 ? 9.082   0.903   4.288   1.00 0.00 ? 27 ARG A CA   10 
ATOM 9715  C C    . ARG A 1 27 ? 9.342   -0.560  3.943   1.00 0.00 ? 27 ARG A C    10 
ATOM 9716  O O    . ARG A 1 27 ? 8.414   -1.366  3.880   1.00 0.00 ? 27 ARG A O    10 
ATOM 9717  C CB   . ARG A 1 27 ? 9.375   1.148   5.770   1.00 0.00 ? 27 ARG A CB   10 
ATOM 9718  C CG   . ARG A 1 27 ? 10.827  1.496   6.054   1.00 0.00 ? 27 ARG A CG   10 
ATOM 9719  C CD   . ARG A 1 27 ? 10.983  2.169   7.409   1.00 0.00 ? 27 ARG A CD   10 
ATOM 9720  N NE   . ARG A 1 27 ? 10.964  1.204   8.505   1.00 0.00 ? 27 ARG A NE   10 
ATOM 9721  C CZ   . ARG A 1 27 ? 11.930  0.318   8.721   1.00 0.00 ? 27 ARG A CZ   10 
ATOM 9722  N NH1  . ARG A 1 27 ? 12.986  0.276   7.922   1.00 0.00 ? 27 ARG A NH1  10 
ATOM 9723  N NH2  . ARG A 1 27 ? 11.840  -0.528  9.740   1.00 0.00 ? 27 ARG A NH2  10 
ATOM 9724  H H    . ARG A 1 27 ? 6.972   0.775   4.386   1.00 0.00 ? 27 ARG A H    10 
ATOM 9725  H HA   . ARG A 1 27 ? 9.737   1.523   3.694   1.00 0.00 ? 27 ARG A HA   10 
ATOM 9726  H HB2  . ARG A 1 27 ? 8.758   1.965   6.116   1.00 0.00 ? 27 ARG A HB2  10 
ATOM 9727  H HB3  . ARG A 1 27 ? 9.124   0.258   6.325   1.00 0.00 ? 27 ARG A HB3  10 
ATOM 9728  H HG2  . ARG A 1 27 ? 11.412  0.588   6.046   1.00 0.00 ? 27 ARG A HG2  10 
ATOM 9729  H HG3  . ARG A 1 27 ? 11.184  2.165   5.286   1.00 0.00 ? 27 ARG A HG3  10 
ATOM 9730  H HD2  . ARG A 1 27 ? 11.923  2.699   7.426   1.00 0.00 ? 27 ARG A HD2  10 
ATOM 9731  H HD3  . ARG A 1 27 ? 10.172  2.869   7.543   1.00 0.00 ? 27 ARG A HD3  10 
ATOM 9732  H HE   . ARG A 1 27 ? 10.192  1.217   9.108   1.00 0.00 ? 27 ARG A HE   10 
ATOM 9733  H HH11 . ARG A 1 27 ? 13.057  0.912   7.154   1.00 0.00 ? 27 ARG A HH11 10 
ATOM 9734  H HH12 . ARG A 1 27 ? 13.713  -0.391  8.087   1.00 0.00 ? 27 ARG A HH12 10 
ATOM 9735  H HH21 . ARG A 1 27 ? 11.046  -0.499  10.345  1.00 0.00 ? 27 ARG A HH21 10 
ATOM 9736  H HH22 . ARG A 1 27 ? 12.568  -1.194  9.902   1.00 0.00 ? 27 ARG A HH22 10 
ATOM 9737  N N    . GLU A 1 28 ? 10.609  -0.895  3.719   1.00 0.00 ? 28 GLU A N    10 
ATOM 9738  C CA   . GLU A 1 28 ? 10.989  -2.260  3.379   1.00 0.00 ? 28 GLU A CA   10 
ATOM 9739  C C    . GLU A 1 28 ? 10.700  -3.210  4.537   1.00 0.00 ? 28 GLU A C    10 
ATOM 9740  O O    . GLU A 1 28 ? 11.344  -3.145  5.584   1.00 0.00 ? 28 GLU A O    10 
ATOM 9741  C CB   . GLU A 1 28 ? 12.473  -2.324  3.011   1.00 0.00 ? 28 GLU A CB   10 
ATOM 9742  C CG   . GLU A 1 28 ? 12.909  -3.675  2.469   1.00 0.00 ? 28 GLU A CG   10 
ATOM 9743  C CD   . GLU A 1 28 ? 14.370  -3.970  2.745   1.00 0.00 ? 28 GLU A CD   10 
ATOM 9744  O OE1  . GLU A 1 28 ? 15.224  -3.537  1.943   1.00 0.00 ? 28 GLU A OE1  10 
ATOM 9745  O OE2  . GLU A 1 28 ? 14.660  -4.635  3.762   1.00 0.00 ? 28 GLU A OE2  10 
ATOM 9746  H H    . GLU A 1 28 ? 11.303  -0.207  3.784   1.00 0.00 ? 28 GLU A H    10 
ATOM 9747  H HA   . GLU A 1 28 ? 10.403  -2.565  2.525   1.00 0.00 ? 28 GLU A HA   10 
ATOM 9748  H HB2  . GLU A 1 28 ? 12.678  -1.574  2.261   1.00 0.00 ? 28 GLU A HB2  10 
ATOM 9749  H HB3  . GLU A 1 28 ? 13.059  -2.108  3.892   1.00 0.00 ? 28 GLU A HB3  10 
ATOM 9750  H HG2  . GLU A 1 28 ? 12.308  -4.444  2.931   1.00 0.00 ? 28 GLU A HG2  10 
ATOM 9751  H HG3  . GLU A 1 28 ? 12.749  -3.688  1.401   1.00 0.00 ? 28 GLU A HG3  10 
ATOM 9752  N N    . GLY A 1 29 ? 9.725   -4.094  4.342   1.00 0.00 ? 29 GLY A N    10 
ATOM 9753  C CA   . GLY A 1 29 ? 9.366   -5.044  5.378   1.00 0.00 ? 29 GLY A CA   10 
ATOM 9754  C C    . GLY A 1 29 ? 8.347   -4.484  6.351   1.00 0.00 ? 29 GLY A C    10 
ATOM 9755  O O    . GLY A 1 29 ? 8.362   -4.816  7.536   1.00 0.00 ? 29 GLY A O    10 
ATOM 9756  H H    . GLY A 1 29 ? 9.246   -4.099  3.487   1.00 0.00 ? 29 GLY A H    10 
ATOM 9757  H HA2  . GLY A 1 29 ? 8.958   -5.929  4.914   1.00 0.00 ? 29 GLY A HA2  10 
ATOM 9758  H HA3  . GLY A 1 29 ? 10.257  -5.315  5.926   1.00 0.00 ? 29 GLY A HA3  10 
ATOM 9759  N N    . ASP A 1 30 ? 7.459   -3.633  5.849   1.00 0.00 ? 30 ASP A N    10 
ATOM 9760  C CA   . ASP A 1 30 ? 6.427   -3.025  6.682   1.00 0.00 ? 30 ASP A CA   10 
ATOM 9761  C C    . ASP A 1 30 ? 5.042   -3.520  6.278   1.00 0.00 ? 30 ASP A C    10 
ATOM 9762  O O    . ASP A 1 30 ? 4.748   -3.675  5.092   1.00 0.00 ? 30 ASP A O    10 
ATOM 9763  C CB   . ASP A 1 30 ? 6.489   -1.501  6.576   1.00 0.00 ? 30 ASP A CB   10 
ATOM 9764  C CG   . ASP A 1 30 ? 7.478   -0.892  7.551   1.00 0.00 ? 30 ASP A CG   10 
ATOM 9765  O OD1  . ASP A 1 30 ? 8.549   -1.497  7.765   1.00 0.00 ? 30 ASP A OD1  10 
ATOM 9766  O OD2  . ASP A 1 30 ? 7.181   0.190   8.099   1.00 0.00 ? 30 ASP A OD2  10 
ATOM 9767  H H    . ASP A 1 30 ? 7.498   -3.408  4.896   1.00 0.00 ? 30 ASP A H    10 
ATOM 9768  H HA   . ASP A 1 30 ? 6.615   -3.314  7.705   1.00 0.00 ? 30 ASP A HA   10 
ATOM 9769  H HB2  . ASP A 1 30 ? 6.786   -1.227  5.574   1.00 0.00 ? 30 ASP A HB2  10 
ATOM 9770  H HB3  . ASP A 1 30 ? 5.510   -1.092  6.781   1.00 0.00 ? 30 ASP A HB3  10 
ATOM 9771  N N    . ARG A 1 31 ? 4.195   -3.768  7.272   1.00 0.00 ? 31 ARG A N    10 
ATOM 9772  C CA   . ARG A 1 31 ? 2.841   -4.247  7.020   1.00 0.00 ? 31 ARG A CA   10 
ATOM 9773  C C    . ARG A 1 31 ? 1.928   -3.100  6.595   1.00 0.00 ? 31 ARG A C    10 
ATOM 9774  O O    . ARG A 1 31 ? 1.920   -2.037  7.216   1.00 0.00 ? 31 ARG A O    10 
ATOM 9775  C CB   . ARG A 1 31 ? 2.277   -4.926  8.270   1.00 0.00 ? 31 ARG A CB   10 
ATOM 9776  C CG   . ARG A 1 31 ? 2.564   -6.417  8.334   1.00 0.00 ? 31 ARG A CG   10 
ATOM 9777  C CD   . ARG A 1 31 ? 3.976   -6.734  7.867   1.00 0.00 ? 31 ARG A CD   10 
ATOM 9778  N NE   . ARG A 1 31 ? 4.333   -8.129  8.111   1.00 0.00 ? 31 ARG A NE   10 
ATOM 9779  C CZ   . ARG A 1 31 ? 5.497   -8.662  7.757   1.00 0.00 ? 31 ARG A CZ   10 
ATOM 9780  N NH1  . ARG A 1 31 ? 6.411   -7.921  7.147   1.00 0.00 ? 31 ARG A NH1  10 
ATOM 9781  N NH2  . ARG A 1 31 ? 5.748   -9.940  8.013   1.00 0.00 ? 31 ARG A NH2  10 
ATOM 9782  H H    . ARG A 1 31 ? 4.487   -3.625  8.196   1.00 0.00 ? 31 ARG A H    10 
ATOM 9783  H HA   . ARG A 1 31 ? 2.889   -4.969  6.219   1.00 0.00 ? 31 ARG A HA   10 
ATOM 9784  H HB2  . ARG A 1 31 ? 2.709   -4.461  9.144   1.00 0.00 ? 31 ARG A HB2  10 
ATOM 9785  H HB3  . ARG A 1 31 ? 1.207   -4.786  8.288   1.00 0.00 ? 31 ARG A HB3  10 
ATOM 9786  H HG2  . ARG A 1 31 ? 2.451   -6.752  9.355   1.00 0.00 ? 31 ARG A HG2  10 
ATOM 9787  H HG3  . ARG A 1 31 ? 1.860   -6.937  7.702   1.00 0.00 ? 31 ARG A HG3  10 
ATOM 9788  H HD2  . ARG A 1 31 ? 4.044   -6.535  6.808   1.00 0.00 ? 31 ARG A HD2  10 
ATOM 9789  H HD3  . ARG A 1 31 ? 4.667   -6.097  8.398   1.00 0.00 ? 31 ARG A HD3  10 
ATOM 9790  H HE   . ARG A 1 31 ? 3.672   -8.695  8.561   1.00 0.00 ? 31 ARG A HE   10 
ATOM 9791  H HH11 . ARG A 1 31 ? 6.225   -6.958  6.953   1.00 0.00 ? 31 ARG A HH11 10 
ATOM 9792  H HH12 . ARG A 1 31 ? 7.287   -8.325  6.882   1.00 0.00 ? 31 ARG A HH12 10 
ATOM 9793  H HH21 . ARG A 1 31 ? 5.062   -10.501 8.473   1.00 0.00 ? 31 ARG A HH21 10 
ATOM 9794  H HH22 . ARG A 1 31 ? 6.624   -10.340 7.746   1.00 0.00 ? 31 ARG A HH22 10 
ATOM 9795  N N    . VAL A 1 32 ? 1.161   -3.324  5.533   1.00 0.00 ? 32 VAL A N    10 
ATOM 9796  C CA   . VAL A 1 32 ? 0.244   -2.310  5.025   1.00 0.00 ? 32 VAL A CA   10 
ATOM 9797  C C    . VAL A 1 32 ? -1.181  -2.846  4.953   1.00 0.00 ? 32 VAL A C    10 
ATOM 9798  O O    . VAL A 1 32 ? -1.416  -3.950  4.461   1.00 0.00 ? 32 VAL A O    10 
ATOM 9799  C CB   . VAL A 1 32 ? 0.668   -1.819  3.628   1.00 0.00 ? 32 VAL A CB   10 
ATOM 9800  C CG1  . VAL A 1 32 ? 0.060   -0.457  3.334   1.00 0.00 ? 32 VAL A CG1  10 
ATOM 9801  C CG2  . VAL A 1 32 ? 2.185   -1.770  3.519   1.00 0.00 ? 32 VAL A CG2  10 
ATOM 9802  H H    . VAL A 1 32 ? 1.213   -4.192  5.080   1.00 0.00 ? 32 VAL A H    10 
ATOM 9803  H HA   . VAL A 1 32 ? 0.269   -1.469  5.702   1.00 0.00 ? 32 VAL A HA   10 
ATOM 9804  H HB   . VAL A 1 32 ? 0.298   -2.520  2.895   1.00 0.00 ? 32 VAL A HB   10 
ATOM 9805  H HG11 . VAL A 1 32 ? -0.994  -0.570  3.127   1.00 0.00 ? 32 VAL A HG11 10 
ATOM 9806  H HG12 . VAL A 1 32 ? 0.193   0.190   4.189   1.00 0.00 ? 32 VAL A HG12 10 
ATOM 9807  H HG13 . VAL A 1 32 ? 0.550   -0.022  2.474   1.00 0.00 ? 32 VAL A HG13 10 
ATOM 9808  H HG21 . VAL A 1 32 ? 2.519   -2.522  2.819   1.00 0.00 ? 32 VAL A HG21 10 
ATOM 9809  H HG22 . VAL A 1 32 ? 2.490   -0.794  3.170   1.00 0.00 ? 32 VAL A HG22 10 
ATOM 9810  H HG23 . VAL A 1 32 ? 2.623   -1.959  4.487   1.00 0.00 ? 32 VAL A HG23 10 
ATOM 9811  N N    . ASP A 1 33 ? -2.129  -2.056  5.444   1.00 0.00 ? 33 ASP A N    10 
ATOM 9812  C CA   . ASP A 1 33 ? -3.533  -2.450  5.434   1.00 0.00 ? 33 ASP A CA   10 
ATOM 9813  C C    . ASP A 1 33 ? -4.251  -1.870  4.219   1.00 0.00 ? 33 ASP A C    10 
ATOM 9814  O O    . ASP A 1 33 ? -4.642  -0.703  4.214   1.00 0.00 ? 33 ASP A O    10 
ATOM 9815  C CB   . ASP A 1 33 ? -4.224  -1.988  6.718   1.00 0.00 ? 33 ASP A CB   10 
ATOM 9816  C CG   . ASP A 1 33 ? -3.468  -2.405  7.965   1.00 0.00 ? 33 ASP A CG   10 
ATOM 9817  O OD1  . ASP A 1 33 ? -2.555  -1.661  8.382   1.00 0.00 ? 33 ASP A OD1  10 
ATOM 9818  O OD2  . ASP A 1 33 ? -3.789  -3.474  8.523   1.00 0.00 ? 33 ASP A OD2  10 
ATOM 9819  H H    . ASP A 1 33 ? -1.879  -1.187  5.823   1.00 0.00 ? 33 ASP A H    10 
ATOM 9820  H HA   . ASP A 1 33 ? -3.576  -3.527  5.381   1.00 0.00 ? 33 ASP A HA   10 
ATOM 9821  H HB2  . ASP A 1 33 ? -4.301  -0.910  6.711   1.00 0.00 ? 33 ASP A HB2  10 
ATOM 9822  H HB3  . ASP A 1 33 ? -5.215  -2.415  6.760   1.00 0.00 ? 33 ASP A HB3  10 
ATOM 9823  N N    . VAL A 1 34 ? -4.421  -2.694  3.190   1.00 0.00 ? 34 VAL A N    10 
ATOM 9824  C CA   . VAL A 1 34 ? -5.092  -2.264  1.969   1.00 0.00 ? 34 VAL A CA   10 
ATOM 9825  C C    . VAL A 1 34 ? -6.604  -2.418  2.089   1.00 0.00 ? 34 VAL A C    10 
ATOM 9826  O O    . VAL A 1 34 ? -7.106  -3.502  2.387   1.00 0.00 ? 34 VAL A O    10 
ATOM 9827  C CB   . VAL A 1 34 ? -4.601  -3.063  0.748   1.00 0.00 ? 34 VAL A CB   10 
ATOM 9828  C CG1  . VAL A 1 34 ? -5.576  -2.920  -0.411  1.00 0.00 ? 34 VAL A CG1  10 
ATOM 9829  C CG2  . VAL A 1 34 ? -3.207  -2.611  0.341   1.00 0.00 ? 34 VAL A CG2  10 
ATOM 9830  H H    . VAL A 1 34 ? -4.089  -3.614  3.254   1.00 0.00 ? 34 VAL A H    10 
ATOM 9831  H HA   . VAL A 1 34 ? -4.858  -1.221  1.809   1.00 0.00 ? 34 VAL A HA   10 
ATOM 9832  H HB   . VAL A 1 34 ? -4.553  -4.107  1.021   1.00 0.00 ? 34 VAL A HB   10 
ATOM 9833  H HG11 . VAL A 1 34 ? -5.031  -2.941  -1.344  1.00 0.00 ? 34 VAL A HG11 10 
ATOM 9834  H HG12 . VAL A 1 34 ? -6.285  -3.734  -0.388  1.00 0.00 ? 34 VAL A HG12 10 
ATOM 9835  H HG13 . VAL A 1 34 ? -6.103  -1.981  -0.324  1.00 0.00 ? 34 VAL A HG13 10 
ATOM 9836  H HG21 . VAL A 1 34 ? -2.900  -3.145  -0.546  1.00 0.00 ? 34 VAL A HG21 10 
ATOM 9837  H HG22 . VAL A 1 34 ? -3.217  -1.550  0.137   1.00 0.00 ? 34 VAL A HG22 10 
ATOM 9838  H HG23 . VAL A 1 34 ? -2.513  -2.816  1.143   1.00 0.00 ? 34 VAL A HG23 10 
ATOM 9839  N N    . MET A 1 35 ? -7.325  -1.326  1.855   1.00 0.00 ? 35 MET A N    10 
ATOM 9840  C CA   . MET A 1 35 ? -8.781  -1.341  1.935   1.00 0.00 ? 35 MET A CA   10 
ATOM 9841  C C    . MET A 1 35 ? -9.401  -1.442  0.545   1.00 0.00 ? 35 MET A C    10 
ATOM 9842  O O    . MET A 1 35 ? -10.097 -2.409  0.236   1.00 0.00 ? 35 MET A O    10 
ATOM 9843  C CB   . MET A 1 35 ? -9.287  -0.082  2.641   1.00 0.00 ? 35 MET A CB   10 
ATOM 9844  C CG   . MET A 1 35 ? -8.516  0.256   3.907   1.00 0.00 ? 35 MET A CG   10 
ATOM 9845  S SD   . MET A 1 35 ? -8.804  -0.931  5.234   1.00 0.00 ? 35 MET A SD   10 
ATOM 9846  C CE   . MET A 1 35 ? -7.705  -0.298  6.498   1.00 0.00 ? 35 MET A CE   10 
ATOM 9847  H H    . MET A 1 35 ? -6.868  -0.491  1.622   1.00 0.00 ? 35 MET A H    10 
ATOM 9848  H HA   . MET A 1 35 ? -9.072  -2.207  2.511   1.00 0.00 ? 35 MET A HA   10 
ATOM 9849  H HB2  . MET A 1 35 ? -9.207  0.754   1.963   1.00 0.00 ? 35 MET A HB2  10 
ATOM 9850  H HB3  . MET A 1 35 ? -10.325 -0.223  2.905   1.00 0.00 ? 35 MET A HB3  10 
ATOM 9851  H HG2  . MET A 1 35 ? -7.461  0.269   3.678   1.00 0.00 ? 35 MET A HG2  10 
ATOM 9852  H HG3  . MET A 1 35 ? -8.820  1.236   4.246   1.00 0.00 ? 35 MET A HG3  10 
ATOM 9853  H HE1  . MET A 1 35 ? -7.561  0.763   6.353   1.00 0.00 ? 35 MET A HE1  10 
ATOM 9854  H HE2  . MET A 1 35 ? -8.139  -0.471  7.472   1.00 0.00 ? 35 MET A HE2  10 
ATOM 9855  H HE3  . MET A 1 35 ? -6.752  -0.803  6.433   1.00 0.00 ? 35 MET A HE3  10 
ATOM 9856  N N    . GLN A 1 36 ? -9.145  -0.438  -0.287  1.00 0.00 ? 36 GLN A N    10 
ATOM 9857  C CA   . GLN A 1 36 ? -9.680  -0.416  -1.643  1.00 0.00 ? 36 GLN A CA   10 
ATOM 9858  C C    . GLN A 1 36 ? -8.599  -0.768  -2.660  1.00 0.00 ? 36 GLN A C    10 
ATOM 9859  O O    . GLN A 1 36 ? -7.418  -0.846  -2.323  1.00 0.00 ? 36 GLN A O    10 
ATOM 9860  C CB   . GLN A 1 36 ? -10.265 0.962   -1.960  1.00 0.00 ? 36 GLN A CB   10 
ATOM 9861  C CG   . GLN A 1 36 ? -11.041 1.007   -3.267  1.00 0.00 ? 36 GLN A CG   10 
ATOM 9862  C CD   . GLN A 1 36 ? -12.111 2.080   -3.273  1.00 0.00 ? 36 GLN A CD   10 
ATOM 9863  O OE1  . GLN A 1 36 ? -12.062 3.027   -2.488  1.00 0.00 ? 36 GLN A OE1  10 
ATOM 9864  N NE2  . GLN A 1 36 ? -13.087 1.938   -4.163  1.00 0.00 ? 36 GLN A NE2  10 
ATOM 9865  H H    . GLN A 1 36 ? -8.584  0.304   0.018   1.00 0.00 ? 36 GLN A H    10 
ATOM 9866  H HA   . GLN A 1 36 ? -10.466 -1.153  -1.702  1.00 0.00 ? 36 GLN A HA   10 
ATOM 9867  H HB2  . GLN A 1 36 ? -10.932 1.249   -1.161  1.00 0.00 ? 36 GLN A HB2  10 
ATOM 9868  H HB3  . GLN A 1 36 ? -9.459  1.677   -2.021  1.00 0.00 ? 36 GLN A HB3  10 
ATOM 9869  H HG2  . GLN A 1 36 ? -10.351 1.204   -4.074  1.00 0.00 ? 36 GLN A HG2  10 
ATOM 9870  H HG3  . GLN A 1 36 ? -11.512 0.048   -3.424  1.00 0.00 ? 36 GLN A HG3  10 
ATOM 9871  H HE21 . GLN A 1 36 ? -13.062 1.158   -4.756  1.00 0.00 ? 36 GLN A HE21 10 
ATOM 9872  H HE22 . GLN A 1 36 ? -13.792 2.617   -4.188  1.00 0.00 ? 36 GLN A HE22 10 
ATOM 9873  N N    . GLN A 1 37 ? -9.012  -0.980  -3.906  1.00 0.00 ? 37 GLN A N    10 
ATOM 9874  C CA   . GLN A 1 37 ? -8.079  -1.325  -4.971  1.00 0.00 ? 37 GLN A CA   10 
ATOM 9875  C C    . GLN A 1 37 ? -8.305  -0.448  -6.198  1.00 0.00 ? 37 GLN A C    10 
ATOM 9876  O O    . GLN A 1 37 ? -9.433  -0.046  -6.486  1.00 0.00 ? 37 GLN A O    10 
ATOM 9877  C CB   . GLN A 1 37 ? -8.226  -2.800  -5.350  1.00 0.00 ? 37 GLN A CB   10 
ATOM 9878  C CG   . GLN A 1 37 ? -8.019  -3.751  -4.182  1.00 0.00 ? 37 GLN A CG   10 
ATOM 9879  C CD   . GLN A 1 37 ? -7.697  -5.163  -4.630  1.00 0.00 ? 37 GLN A CD   10 
ATOM 9880  O OE1  . GLN A 1 37 ? -8.051  -5.573  -5.736  1.00 0.00 ? 37 GLN A OE1  10 
ATOM 9881  N NE2  . GLN A 1 37 ? -7.020  -5.917  -3.771  1.00 0.00 ? 37 GLN A NE2  10 
ATOM 9882  H H    . GLN A 1 37 ? -9.966  -0.903  -4.113  1.00 0.00 ? 37 GLN A H    10 
ATOM 9883  H HA   . GLN A 1 37 ? -7.078  -1.156  -4.603  1.00 0.00 ? 37 GLN A HA   10 
ATOM 9884  H HB2  . GLN A 1 37 ? -9.218  -2.961  -5.745  1.00 0.00 ? 37 GLN A HB2  10 
ATOM 9885  H HB3  . GLN A 1 37 ? -7.500  -3.038  -6.113  1.00 0.00 ? 37 GLN A HB3  10 
ATOM 9886  H HG2  . GLN A 1 37 ? -7.201  -3.387  -3.578  1.00 0.00 ? 37 GLN A HG2  10 
ATOM 9887  H HG3  . GLN A 1 37 ? -8.921  -3.774  -3.589  1.00 0.00 ? 37 GLN A HG3  10 
ATOM 9888  H HE21 . GLN A 1 37 ? -6.771  -5.525  -2.907  1.00 0.00 ? 37 GLN A HE21 10 
ATOM 9889  H HE22 . GLN A 1 37 ? -6.799  -6.834  -4.034  1.00 0.00 ? 37 GLN A HE22 10 
ATOM 9890  N N    . CYS A 1 38 ? -7.227  -0.156  -6.917  1.00 0.00 ? 38 CYS A N    10 
ATOM 9891  C CA   . CYS A 1 38 ? -7.307  0.675   -8.113  1.00 0.00 ? 38 CYS A CA   10 
ATOM 9892  C C    . CYS A 1 38 ? -7.403  -0.187  -9.368  1.00 0.00 ? 38 CYS A C    10 
ATOM 9893  O O    . CYS A 1 38 ? -7.148  -1.391  -9.328  1.00 0.00 ? 38 CYS A O    10 
ATOM 9894  C CB   . CYS A 1 38 ? -6.089  1.595   -8.204  1.00 0.00 ? 38 CYS A CB   10 
ATOM 9895  S SG   . CYS A 1 38 ? -6.300  3.184   -7.366  1.00 0.00 ? 38 CYS A SG   10 
ATOM 9896  H H    . CYS A 1 38 ? -6.355  -0.506  -6.637  1.00 0.00 ? 38 CYS A H    10 
ATOM 9897  H HA   . CYS A 1 38 ? -8.199  1.278   -8.037  1.00 0.00 ? 38 CYS A HA   10 
ATOM 9898  H HB2  . CYS A 1 38 ? -5.239  1.100   -7.757  1.00 0.00 ? 38 CYS A HB2  10 
ATOM 9899  H HB3  . CYS A 1 38 ? -5.875  1.795   -9.243  1.00 0.00 ? 38 CYS A HB3  10 
ATOM 9900  H HG   . CYS A 1 38 ? -7.556  3.264   -6.954  1.00 0.00 ? 38 CYS A HG   10 
ATOM 9901  N N    . ASP A 1 39 ? -7.773  0.437   -10.481 1.00 0.00 ? 39 ASP A N    10 
ATOM 9902  C CA   . ASP A 1 39 ? -7.903  -0.272  -11.748 1.00 0.00 ? 39 ASP A CA   10 
ATOM 9903  C C    . ASP A 1 39 ? -6.672  -0.054  -12.623 1.00 0.00 ? 39 ASP A C    10 
ATOM 9904  O O    . ASP A 1 39 ? -6.538  -0.661  -13.685 1.00 0.00 ? 39 ASP A O    10 
ATOM 9905  C CB   . ASP A 1 39 ? -9.159  0.190   -12.489 1.00 0.00 ? 39 ASP A CB   10 
ATOM 9906  C CG   . ASP A 1 39 ? -10.422 -0.441  -11.937 1.00 0.00 ? 39 ASP A CG   10 
ATOM 9907  O OD1  . ASP A 1 39 ? -10.406 -1.659  -11.662 1.00 0.00 ? 39 ASP A OD1  10 
ATOM 9908  O OD2  . ASP A 1 39 ? -11.427 0.284   -11.780 1.00 0.00 ? 39 ASP A OD2  10 
ATOM 9909  H H    . ASP A 1 39 ? -7.962  1.399   -10.449 1.00 0.00 ? 39 ASP A H    10 
ATOM 9910  H HA   . ASP A 1 39 ? -7.992  -1.326  -11.531 1.00 0.00 ? 39 ASP A HA   10 
ATOM 9911  H HB2  . ASP A 1 39 ? -9.247  1.263   -12.401 1.00 0.00 ? 39 ASP A HB2  10 
ATOM 9912  H HB3  . ASP A 1 39 ? -9.072  -0.075  -13.533 1.00 0.00 ? 39 ASP A HB3  10 
ATOM 9913  N N    . ASP A 1 40 ? -5.778  0.817   -12.169 1.00 0.00 ? 40 ASP A N    10 
ATOM 9914  C CA   . ASP A 1 40 ? -4.558  1.116   -12.909 1.00 0.00 ? 40 ASP A CA   10 
ATOM 9915  C C    . ASP A 1 40 ? -3.374  0.338   -12.343 1.00 0.00 ? 40 ASP A C    10 
ATOM 9916  O O    . ASP A 1 40 ? -2.251  0.454   -12.831 1.00 0.00 ? 40 ASP A O    10 
ATOM 9917  C CB   . ASP A 1 40 ? -4.265  2.616   -12.867 1.00 0.00 ? 40 ASP A CB   10 
ATOM 9918  C CG   . ASP A 1 40 ? -3.426  3.076   -14.043 1.00 0.00 ? 40 ASP A CG   10 
ATOM 9919  O OD1  . ASP A 1 40 ? -4.001  3.303   -15.128 1.00 0.00 ? 40 ASP A OD1  10 
ATOM 9920  O OD2  . ASP A 1 40 ? -2.195  3.209   -13.879 1.00 0.00 ? 40 ASP A OD2  10 
ATOM 9921  H H    . ASP A 1 40 ? -5.942  1.269   -11.314 1.00 0.00 ? 40 ASP A H    10 
ATOM 9922  H HA   . ASP A 1 40 ? -4.711  0.818   -13.935 1.00 0.00 ? 40 ASP A HA   10 
ATOM 9923  H HB2  . ASP A 1 40 ? -5.198  3.160   -12.880 1.00 0.00 ? 40 ASP A HB2  10 
ATOM 9924  H HB3  . ASP A 1 40 ? -3.732  2.847   -11.956 1.00 0.00 ? 40 ASP A HB3  10 
ATOM 9925  N N    . GLY A 1 41 ? -3.634  -0.457  -11.309 1.00 0.00 ? 41 GLY A N    10 
ATOM 9926  C CA   . GLY A 1 41 ? -2.581  -1.241  -10.693 1.00 0.00 ? 41 GLY A CA   10 
ATOM 9927  C C    . GLY A 1 41 ? -2.053  -0.607  -9.421  1.00 0.00 ? 41 GLY A C    10 
ATOM 9928  O O    . GLY A 1 41 ? -0.853  -0.647  -9.152  1.00 0.00 ? 41 GLY A O    10 
ATOM 9929  H H    . GLY A 1 41 ? -4.549  -0.510  -10.962 1.00 0.00 ? 41 GLY A H    10 
ATOM 9930  H HA2  . GLY A 1 41 ? -2.967  -2.223  -10.460 1.00 0.00 ? 41 GLY A HA2  10 
ATOM 9931  H HA3  . GLY A 1 41 ? -1.766  -1.343  -11.395 1.00 0.00 ? 41 GLY A HA3  10 
ATOM 9932  N N    . TRP A 1 42 ? -2.951  -0.019  -8.639  1.00 0.00 ? 42 TRP A N    10 
ATOM 9933  C CA   . TRP A 1 42 ? -2.569  0.628   -7.389  1.00 0.00 ? 42 TRP A CA   10 
ATOM 9934  C C    . TRP A 1 42 ? -3.383  0.081   -6.222  1.00 0.00 ? 42 TRP A C    10 
ATOM 9935  O O    . TRP A 1 42 ? -4.319  -0.695  -6.414  1.00 0.00 ? 42 TRP A O    10 
ATOM 9936  C CB   . TRP A 1 42 ? -2.760  2.142   -7.496  1.00 0.00 ? 42 TRP A CB   10 
ATOM 9937  C CG   . TRP A 1 42 ? -1.576  2.850   -8.080  1.00 0.00 ? 42 TRP A CG   10 
ATOM 9938  C CD1  . TRP A 1 42 ? -1.035  2.657   -9.319  1.00 0.00 ? 42 TRP A CD1  10 
ATOM 9939  C CD2  . TRP A 1 42 ? -0.786  3.864   -7.449  1.00 0.00 ? 42 TRP A CD2  10 
ATOM 9940  N NE1  . TRP A 1 42 ? 0.044   3.490   -9.496  1.00 0.00 ? 42 TRP A NE1  10 
ATOM 9941  C CE2  . TRP A 1 42 ? 0.217   4.240   -8.363  1.00 0.00 ? 42 TRP A CE2  10 
ATOM 9942  C CE3  . TRP A 1 42 ? -0.829  4.491   -6.201  1.00 0.00 ? 42 TRP A CE3  10 
ATOM 9943  C CZ2  . TRP A 1 42 ? 1.167   5.214   -8.066  1.00 0.00 ? 42 TRP A CZ2  10 
ATOM 9944  C CZ3  . TRP A 1 42 ? 0.114   5.457   -5.907  1.00 0.00 ? 42 TRP A CZ3  10 
ATOM 9945  C CH2  . TRP A 1 42 ? 1.101   5.812   -6.837  1.00 0.00 ? 42 TRP A CH2  10 
ATOM 9946  H H    . TRP A 1 42 ? -3.894  -0.021  -8.908  1.00 0.00 ? 42 TRP A H    10 
ATOM 9947  H HA   . TRP A 1 42 ? -1.524  0.418   -7.214  1.00 0.00 ? 42 TRP A HA   10 
ATOM 9948  H HB2  . TRP A 1 42 ? -3.614  2.347   -8.123  1.00 0.00 ? 42 TRP A HB2  10 
ATOM 9949  H HB3  . TRP A 1 42 ? -2.937  2.545   -6.509  1.00 0.00 ? 42 TRP A HB3  10 
ATOM 9950  H HD1  . TRP A 1 42 ? -1.409  1.950   -10.043 1.00 0.00 ? 42 TRP A HD1  10 
ATOM 9951  H HE1  . TRP A 1 42 ? 0.599   3.538   -10.303 1.00 0.00 ? 42 TRP A HE1  10 
ATOM 9952  H HE3  . TRP A 1 42 ? -1.582  4.231   -5.471  1.00 0.00 ? 42 TRP A HE3  10 
ATOM 9953  H HZ2  . TRP A 1 42 ? 1.933   5.499   -8.772  1.00 0.00 ? 42 TRP A HZ2  10 
ATOM 9954  H HZ3  . TRP A 1 42 ? 0.097   5.952   -4.948  1.00 0.00 ? 42 TRP A HZ3  10 
ATOM 9955  H HH2  . TRP A 1 42 ? 1.818   6.571   -6.565  1.00 0.00 ? 42 TRP A HH2  10 
ATOM 9956  N N    . PHE A 1 43 ? -3.021  0.491   -5.010  1.00 0.00 ? 43 PHE A N    10 
ATOM 9957  C CA   . PHE A 1 43 ? -3.719  0.042   -3.811  1.00 0.00 ? 43 PHE A CA   10 
ATOM 9958  C C    . PHE A 1 43 ? -3.906  1.192   -2.827  1.00 0.00 ? 43 PHE A C    10 
ATOM 9959  O O    . PHE A 1 43 ? -2.984  1.972   -2.583  1.00 0.00 ? 43 PHE A O    10 
ATOM 9960  C CB   . PHE A 1 43 ? -2.945  -1.096  -3.142  1.00 0.00 ? 43 PHE A CB   10 
ATOM 9961  C CG   . PHE A 1 43 ? -2.950  -2.372  -3.935  1.00 0.00 ? 43 PHE A CG   10 
ATOM 9962  C CD1  . PHE A 1 43 ? -4.124  -2.854  -4.489  1.00 0.00 ? 43 PHE A CD1  10 
ATOM 9963  C CD2  . PHE A 1 43 ? -1.779  -3.089  -4.126  1.00 0.00 ? 43 PHE A CD2  10 
ATOM 9964  C CE1  . PHE A 1 43 ? -4.132  -4.028  -5.219  1.00 0.00 ? 43 PHE A CE1  10 
ATOM 9965  C CE2  . PHE A 1 43 ? -1.781  -4.262  -4.856  1.00 0.00 ? 43 PHE A CE2  10 
ATOM 9966  C CZ   . PHE A 1 43 ? -2.959  -4.733  -5.402  1.00 0.00 ? 43 PHE A CZ   10 
ATOM 9967  H H    . PHE A 1 43 ? -2.267  1.111   -4.921  1.00 0.00 ? 43 PHE A H    10 
ATOM 9968  H HA   . PHE A 1 43 ? -4.690  -0.322  -4.110  1.00 0.00 ? 43 PHE A HA   10 
ATOM 9969  H HB2  . PHE A 1 43 ? -1.917  -0.793  -3.009  1.00 0.00 ? 43 PHE A HB2  10 
ATOM 9970  H HB3  . PHE A 1 43 ? -3.384  -1.302  -2.178  1.00 0.00 ? 43 PHE A HB3  10 
ATOM 9971  H HD1  . PHE A 1 43 ? -5.043  -2.303  -4.346  1.00 0.00 ? 43 PHE A HD1  10 
ATOM 9972  H HD2  . PHE A 1 43 ? -0.857  -2.723  -3.698  1.00 0.00 ? 43 PHE A HD2  10 
ATOM 9973  H HE1  . PHE A 1 43 ? -5.055  -4.393  -5.645  1.00 0.00 ? 43 PHE A HE1  10 
ATOM 9974  H HE2  . PHE A 1 43 ? -0.863  -4.812  -4.997  1.00 0.00 ? 43 PHE A HE2  10 
ATOM 9975  H HZ   . PHE A 1 43 ? -2.963  -5.650  -5.973  1.00 0.00 ? 43 PHE A HZ   10 
ATOM 9976  N N    . VAL A 1 44 ? -5.106  1.293   -2.264  1.00 0.00 ? 44 VAL A N    10 
ATOM 9977  C CA   . VAL A 1 44 ? -5.415  2.347   -1.306  1.00 0.00 ? 44 VAL A CA   10 
ATOM 9978  C C    . VAL A 1 44 ? -5.754  1.765   0.062   1.00 0.00 ? 44 VAL A C    10 
ATOM 9979  O O    . VAL A 1 44 ? -6.645  0.926   0.187   1.00 0.00 ? 44 VAL A O    10 
ATOM 9980  C CB   . VAL A 1 44 ? -6.592  3.216   -1.787  1.00 0.00 ? 44 VAL A CB   10 
ATOM 9981  C CG1  . VAL A 1 44 ? -6.783  4.414   -0.869  1.00 0.00 ? 44 VAL A CG1  10 
ATOM 9982  C CG2  . VAL A 1 44 ? -6.369  3.665   -3.224  1.00 0.00 ? 44 VAL A CG2  10 
ATOM 9983  H H    . VAL A 1 44 ? -5.799  0.641   -2.498  1.00 0.00 ? 44 VAL A H    10 
ATOM 9984  H HA   . VAL A 1 44 ? -4.543  2.979   -1.211  1.00 0.00 ? 44 VAL A HA   10 
ATOM 9985  H HB   . VAL A 1 44 ? -7.491  2.619   -1.755  1.00 0.00 ? 44 VAL A HB   10 
ATOM 9986  H HG11 . VAL A 1 44 ? -6.325  5.285   -1.315  1.00 0.00 ? 44 VAL A HG11 10 
ATOM 9987  H HG12 . VAL A 1 44 ? -7.838  4.593   -0.726  1.00 0.00 ? 44 VAL A HG12 10 
ATOM 9988  H HG13 . VAL A 1 44 ? -6.319  4.212   0.085   1.00 0.00 ? 44 VAL A HG13 10 
ATOM 9989  H HG21 . VAL A 1 44 ? -6.540  4.729   -3.298  1.00 0.00 ? 44 VAL A HG21 10 
ATOM 9990  H HG22 . VAL A 1 44 ? -5.353  3.444   -3.517  1.00 0.00 ? 44 VAL A HG22 10 
ATOM 9991  H HG23 . VAL A 1 44 ? -7.053  3.143   -3.875  1.00 0.00 ? 44 VAL A HG23 10 
ATOM 9992  N N    . GLY A 1 45 ? -5.037  2.217   1.086   1.00 0.00 ? 45 GLY A N    10 
ATOM 9993  C CA   . GLY A 1 45 ? -5.277  1.730   2.432   1.00 0.00 ? 45 GLY A CA   10 
ATOM 9994  C C    . GLY A 1 45 ? -4.611  2.591   3.487   1.00 0.00 ? 45 GLY A C    10 
ATOM 9995  O O    . GLY A 1 45 ? -4.426  3.793   3.293   1.00 0.00 ? 45 GLY A O    10 
ATOM 9996  H H    . GLY A 1 45 ? -4.339  2.887   0.927   1.00 0.00 ? 45 GLY A H    10 
ATOM 9997  H HA2  . GLY A 1 45 ? -6.341  1.715   2.613   1.00 0.00 ? 45 GLY A HA2  10 
ATOM 9998  H HA3  . GLY A 1 45 ? -4.894  0.724   2.512   1.00 0.00 ? 45 GLY A HA3  10 
ATOM 9999  N N    . VAL A 1 46 ? -4.251  1.977   4.610   1.00 0.00 ? 46 VAL A N    10 
ATOM 10000 C CA   . VAL A 1 46 ? -3.603  2.695   5.700   1.00 0.00 ? 46 VAL A CA   10 
ATOM 10001 C C    . VAL A 1 46 ? -2.261  2.064   6.053   1.00 0.00 ? 46 VAL A C    10 
ATOM 10002 O O    . VAL A 1 46 ? -2.078  0.854   5.920   1.00 0.00 ? 46 VAL A O    10 
ATOM 10003 C CB   . VAL A 1 46 ? -4.490  2.724   6.959   1.00 0.00 ? 46 VAL A CB   10 
ATOM 10004 C CG1  . VAL A 1 46 ? -3.692  3.197   8.165   1.00 0.00 ? 46 VAL A CG1  10 
ATOM 10005 C CG2  . VAL A 1 46 ? -5.706  3.611   6.733   1.00 0.00 ? 46 VAL A CG2  10 
ATOM 10006 H H    . VAL A 1 46 ? -4.425  1.017   4.706   1.00 0.00 ? 46 VAL A H    10 
ATOM 10007 H HA   . VAL A 1 46 ? -3.438  3.713   5.378   1.00 0.00 ? 46 VAL A HA   10 
ATOM 10008 H HB   . VAL A 1 46 ? -4.835  1.719   7.155   1.00 0.00 ? 46 VAL A HB   10 
ATOM 10009 H HG11 . VAL A 1 46 ? -2.999  3.966   7.858   1.00 0.00 ? 46 VAL A HG11 10 
ATOM 10010 H HG12 . VAL A 1 46 ? -4.366  3.594   8.910   1.00 0.00 ? 46 VAL A HG12 10 
ATOM 10011 H HG13 . VAL A 1 46 ? -3.144  2.365   8.581   1.00 0.00 ? 46 VAL A HG13 10 
ATOM 10012 H HG21 . VAL A 1 46 ? -5.598  4.520   7.305   1.00 0.00 ? 46 VAL A HG21 10 
ATOM 10013 H HG22 . VAL A 1 46 ? -5.784  3.854   5.683   1.00 0.00 ? 46 VAL A HG22 10 
ATOM 10014 H HG23 . VAL A 1 46 ? -6.596  3.089   7.049   1.00 0.00 ? 46 VAL A HG23 10 
ATOM 10015 N N    . SER A 1 47 ? -1.324  2.892   6.504   1.00 0.00 ? 47 SER A N    10 
ATOM 10016 C CA   . SER A 1 47 ? 0.004   2.415   6.873   1.00 0.00 ? 47 SER A CA   10 
ATOM 10017 C C    . SER A 1 47 ? 0.001   1.840   8.287   1.00 0.00 ? 47 SER A C    10 
ATOM 10018 O O    . SER A 1 47 ? -0.976  1.978   9.023   1.00 0.00 ? 47 SER A O    10 
ATOM 10019 C CB   . SER A 1 47 ? 1.023   3.552   6.775   1.00 0.00 ? 47 SER A CB   10 
ATOM 10020 O OG   . SER A 1 47 ? 2.325   3.100   7.103   1.00 0.00 ? 47 SER A OG   10 
ATOM 10021 H H    . SER A 1 47 ? -1.530  3.846   6.588   1.00 0.00 ? 47 SER A H    10 
ATOM 10022 H HA   . SER A 1 47 ? 0.281   1.635   6.180   1.00 0.00 ? 47 SER A HA   10 
ATOM 10023 H HB2  . SER A 1 47 ? 1.032   3.938   5.767   1.00 0.00 ? 47 SER A HB2  10 
ATOM 10024 H HB3  . SER A 1 47 ? 0.745   4.341   7.459   1.00 0.00 ? 47 SER A HB3  10 
ATOM 10025 H HG   . SER A 1 47 ? 2.806   3.804   7.545   1.00 0.00 ? 47 SER A HG   10 
ATOM 10026 N N    . ARG A 1 48 ? 1.103   1.196   8.658   1.00 0.00 ? 48 ARG A N    10 
ATOM 10027 C CA   . ARG A 1 48 ? 1.228   0.598   9.982   1.00 0.00 ? 48 ARG A CA   10 
ATOM 10028 C C    . ARG A 1 48 ? 2.305   1.307   10.799  1.00 0.00 ? 48 ARG A C    10 
ATOM 10029 O O    . ARG A 1 48 ? 2.671   0.858   11.885  1.00 0.00 ? 48 ARG A O    10 
ATOM 10030 C CB   . ARG A 1 48 ? 1.559   -0.890  9.864   1.00 0.00 ? 48 ARG A CB   10 
ATOM 10031 C CG   . ARG A 1 48 ? 0.371   -1.749  9.464   1.00 0.00 ? 48 ARG A CG   10 
ATOM 10032 C CD   . ARG A 1 48 ? -0.578  -1.966  10.632  1.00 0.00 ? 48 ARG A CD   10 
ATOM 10033 N NE   . ARG A 1 48 ? 0.051   -2.716  11.716  1.00 0.00 ? 48 ARG A NE   10 
ATOM 10034 C CZ   . ARG A 1 48 ? -0.486  -2.853  12.923  1.00 0.00 ? 48 ARG A CZ   10 
ATOM 10035 N NH1  . ARG A 1 48 ? -1.655  -2.294  13.200  1.00 0.00 ? 48 ARG A NH1  10 
ATOM 10036 N NH2  . ARG A 1 48 ? 0.148   -3.551  13.857  1.00 0.00 ? 48 ARG A NH2  10 
ATOM 10037 H H    . ARG A 1 48 ? 1.848   1.119   8.027   1.00 0.00 ? 48 ARG A H    10 
ATOM 10038 H HA   . ARG A 1 48 ? 0.280   0.708   10.487  1.00 0.00 ? 48 ARG A HA   10 
ATOM 10039 H HB2  . ARG A 1 48 ? 2.333   -1.017  9.121   1.00 0.00 ? 48 ARG A HB2  10 
ATOM 10040 H HB3  . ARG A 1 48 ? 1.925   -1.242  10.817  1.00 0.00 ? 48 ARG A HB3  10 
ATOM 10041 H HG2  . ARG A 1 48 ? -0.165  -1.256  8.666   1.00 0.00 ? 48 ARG A HG2  10 
ATOM 10042 H HG3  . ARG A 1 48 ? 0.731   -2.707  9.120   1.00 0.00 ? 48 ARG A HG3  10 
ATOM 10043 H HD2  . ARG A 1 48 ? -0.891  -1.004  11.008  1.00 0.00 ? 48 ARG A HD2  10 
ATOM 10044 H HD3  . ARG A 1 48 ? -1.440  -2.514  10.281  1.00 0.00 ? 48 ARG A HD3  10 
ATOM 10045 H HE   . ARG A 1 48 ? 0.916   -3.138  11.534  1.00 0.00 ? 48 ARG A HE   10 
ATOM 10046 H HH11 . ARG A 1 48 ? -2.136  -1.768  12.497  1.00 0.00 ? 48 ARG A HH11 10 
ATOM 10047 H HH12 . ARG A 1 48 ? -2.058  -2.399  14.109  1.00 0.00 ? 48 ARG A HH12 10 
ATOM 10048 H HH21 . ARG A 1 48 ? 1.030   -3.974  13.653  1.00 0.00 ? 48 ARG A HH21 10 
ATOM 10049 H HH22 . ARG A 1 48 ? -0.257  -3.653  14.766  1.00 0.00 ? 48 ARG A HH22 10 
ATOM 10050 N N    . ARG A 1 49 ? 2.809   2.416   10.267  1.00 0.00 ? 49 ARG A N    10 
ATOM 10051 C CA   . ARG A 1 49 ? 3.845   3.185   10.945  1.00 0.00 ? 49 ARG A CA   10 
ATOM 10052 C C    . ARG A 1 49 ? 3.363   4.602   11.244  1.00 0.00 ? 49 ARG A C    10 
ATOM 10053 O O    . ARG A 1 49 ? 3.632   5.149   12.314  1.00 0.00 ? 49 ARG A O    10 
ATOM 10054 C CB   . ARG A 1 49 ? 5.114   3.237   10.092  1.00 0.00 ? 49 ARG A CB   10 
ATOM 10055 C CG   . ARG A 1 49 ? 6.226   4.072   10.703  1.00 0.00 ? 49 ARG A CG   10 
ATOM 10056 C CD   . ARG A 1 49 ? 7.524   3.928   9.924   1.00 0.00 ? 49 ARG A CD   10 
ATOM 10057 N NE   . ARG A 1 49 ? 8.413   5.069   10.125  1.00 0.00 ? 49 ARG A NE   10 
ATOM 10058 C CZ   . ARG A 1 49 ? 9.102   5.276   11.242  1.00 0.00 ? 49 ARG A CZ   10 
ATOM 10059 N NH1  . ARG A 1 49 ? 9.006   4.423   12.252  1.00 0.00 ? 49 ARG A NH1  10 
ATOM 10060 N NH2  . ARG A 1 49 ? 9.891   6.338   11.349  1.00 0.00 ? 49 ARG A NH2  10 
ATOM 10061 H H    . ARG A 1 49 ? 2.477   2.724   9.398   1.00 0.00 ? 49 ARG A H    10 
ATOM 10062 H HA   . ARG A 1 49 ? 4.070   2.690   11.878  1.00 0.00 ? 49 ARG A HA   10 
ATOM 10063 H HB2  . ARG A 1 49 ? 5.483   2.231   9.956   1.00 0.00 ? 49 ARG A HB2  10 
ATOM 10064 H HB3  . ARG A 1 49 ? 4.867   3.654   9.127   1.00 0.00 ? 49 ARG A HB3  10 
ATOM 10065 H HG2  . ARG A 1 49 ? 5.929   5.111   10.696  1.00 0.00 ? 49 ARG A HG2  10 
ATOM 10066 H HG3  . ARG A 1 49 ? 6.389   3.749   11.721  1.00 0.00 ? 49 ARG A HG3  10 
ATOM 10067 H HD2  . ARG A 1 49 ? 8.027   3.030   10.252  1.00 0.00 ? 49 ARG A HD2  10 
ATOM 10068 H HD3  . ARG A 1 49 ? 7.290   3.846   8.873   1.00 0.00 ? 49 ARG A HD3  10 
ATOM 10069 H HE   . ARG A 1 49 ? 8.499   5.712   9.391   1.00 0.00 ? 49 ARG A HE   10 
ATOM 10070 H HH11 . ARG A 1 49 ? 8.413   3.622   12.174  1.00 0.00 ? 49 ARG A HH11 10 
ATOM 10071 H HH12 . ARG A 1 49 ? 9.527   4.581   13.091  1.00 0.00 ? 49 ARG A HH12 10 
ATOM 10072 H HH21 . ARG A 1 49 ? 9.966   6.983   10.589  1.00 0.00 ? 49 ARG A HH21 10 
ATOM 10073 H HH22 . ARG A 1 49 ? 10.409  6.493   12.189  1.00 0.00 ? 49 ARG A HH22 10 
ATOM 10074 N N    . THR A 1 50 ? 2.649   5.192   10.290  1.00 0.00 ? 50 THR A N    10 
ATOM 10075 C CA   . THR A 1 50 ? 2.130   6.545   10.449  1.00 0.00 ? 50 THR A CA   10 
ATOM 10076 C C    . THR A 1 50 ? 0.626   6.532   10.695  1.00 0.00 ? 50 THR A C    10 
ATOM 10077 O O    . THR A 1 50 ? 0.053   7.525   11.141  1.00 0.00 ? 50 THR A O    10 
ATOM 10078 C CB   . THR A 1 50 ? 2.430   7.411   9.211   1.00 0.00 ? 50 THR A CB   10 
ATOM 10079 O OG1  . THR A 1 50 ? 1.932   6.768   8.032   1.00 0.00 ? 50 THR A OG1  10 
ATOM 10080 C CG2  . THR A 1 50 ? 3.925   7.654   9.070   1.00 0.00 ? 50 THR A CG2  10 
ATOM 10081 H H    . THR A 1 50 ? 2.468   4.705   9.460   1.00 0.00 ? 50 THR A H    10 
ATOM 10082 H HA   . THR A 1 50 ? 2.621   6.991   11.302  1.00 0.00 ? 50 THR A HA   10 
ATOM 10083 H HB   . THR A 1 50 ? 1.934   8.364   9.329   1.00 0.00 ? 50 THR A HB   10 
ATOM 10084 H HG1  . THR A 1 50 ? 1.494   7.416   7.475   1.00 0.00 ? 50 THR A HG1  10 
ATOM 10085 H HG21 . THR A 1 50 ? 4.256   8.323   9.849   1.00 0.00 ? 50 THR A HG21 10 
ATOM 10086 H HG22 . THR A 1 50 ? 4.128   8.095   8.105   1.00 0.00 ? 50 THR A HG22 10 
ATOM 10087 H HG23 . THR A 1 50 ? 4.451   6.715   9.154   1.00 0.00 ? 50 THR A HG23 10 
ATOM 10088 N N    . GLN A 1 51 ? -0.007  5.401   10.401  1.00 0.00 ? 51 GLN A N    10 
ATOM 10089 C CA   . GLN A 1 51 ? -1.446  5.260   10.590  1.00 0.00 ? 51 GLN A CA   10 
ATOM 10090 C C    . GLN A 1 51 ? -2.210  6.237   9.702   1.00 0.00 ? 51 GLN A C    10 
ATOM 10091 O O    . GLN A 1 51 ? -3.328  6.641   10.023  1.00 0.00 ? 51 GLN A O    10 
ATOM 10092 C CB   . GLN A 1 51 ? -1.814  5.490   12.057  1.00 0.00 ? 51 GLN A CB   10 
ATOM 10093 C CG   . GLN A 1 51 ? -1.164  4.500   13.010  1.00 0.00 ? 51 GLN A CG   10 
ATOM 10094 C CD   . GLN A 1 51 ? -1.939  4.340   14.303  1.00 0.00 ? 51 GLN A CD   10 
ATOM 10095 O OE1  . GLN A 1 51 ? -3.155  4.529   14.338  1.00 0.00 ? 51 GLN A OE1  10 
ATOM 10096 N NE2  . GLN A 1 51 ? -1.238  3.989   15.374  1.00 0.00 ? 51 GLN A NE2  10 
ATOM 10097 H H    . GLN A 1 51 ? 0.505   4.644   10.048  1.00 0.00 ? 51 GLN A H    10 
ATOM 10098 H HA   . GLN A 1 51 ? -1.719  4.253   10.314  1.00 0.00 ? 51 GLN A HA   10 
ATOM 10099 H HB2  . GLN A 1 51 ? -1.506  6.485   12.340  1.00 0.00 ? 51 GLN A HB2  10 
ATOM 10100 H HB3  . GLN A 1 51 ? -2.886  5.409   12.164  1.00 0.00 ? 51 GLN A HB3  10 
ATOM 10101 H HG2  . GLN A 1 51 ? -1.104  3.538   12.523  1.00 0.00 ? 51 GLN A HG2  10 
ATOM 10102 H HG3  . GLN A 1 51 ? -0.168  4.846   13.244  1.00 0.00 ? 51 GLN A HG3  10 
ATOM 10103 H HE21 . GLN A 1 51 ? -0.272  3.857   15.271  1.00 0.00 ? 51 GLN A HE21 10 
ATOM 10104 H HE22 . GLN A 1 51 ? -1.713  3.880   16.223  1.00 0.00 ? 51 GLN A HE22 10 
ATOM 10105 N N    . LYS A 1 52 ? -1.600  6.613   8.584   1.00 0.00 ? 52 LYS A N    10 
ATOM 10106 C CA   . LYS A 1 52 ? -2.222  7.542   7.648   1.00 0.00 ? 52 LYS A CA   10 
ATOM 10107 C C    . LYS A 1 52 ? -2.961  6.791   6.546   1.00 0.00 ? 52 LYS A C    10 
ATOM 10108 O O    . LYS A 1 52 ? -2.694  5.615   6.295   1.00 0.00 ? 52 LYS A O    10 
ATOM 10109 C CB   . LYS A 1 52 ? -1.165  8.462   7.032   1.00 0.00 ? 52 LYS A CB   10 
ATOM 10110 C CG   . LYS A 1 52 ? -0.608  9.486   8.005   1.00 0.00 ? 52 LYS A CG   10 
ATOM 10111 C CD   . LYS A 1 52 ? -0.050  10.699  7.280   1.00 0.00 ? 52 LYS A CD   10 
ATOM 10112 C CE   . LYS A 1 52 ? 1.411   10.501  6.905   1.00 0.00 ? 52 LYS A CE   10 
ATOM 10113 N NZ   . LYS A 1 52 ? 2.094   11.797  6.635   1.00 0.00 ? 52 LYS A NZ   10 
ATOM 10114 H H    . LYS A 1 52 ? -0.709  6.257   8.382   1.00 0.00 ? 52 LYS A H    10 
ATOM 10115 H HA   . LYS A 1 52 ? -2.932  8.141   8.197   1.00 0.00 ? 52 LYS A HA   10 
ATOM 10116 H HB2  . LYS A 1 52 ? -0.346  7.858   6.670   1.00 0.00 ? 52 LYS A HB2  10 
ATOM 10117 H HB3  . LYS A 1 52 ? -1.607  8.991   6.199   1.00 0.00 ? 52 LYS A HB3  10 
ATOM 10118 H HG2  . LYS A 1 52 ? -1.399  9.808   8.667   1.00 0.00 ? 52 LYS A HG2  10 
ATOM 10119 H HG3  . LYS A 1 52 ? 0.182   9.028   8.583   1.00 0.00 ? 52 LYS A HG3  10 
ATOM 10120 H HD2  . LYS A 1 52 ? -0.622  10.864  6.378   1.00 0.00 ? 52 LYS A HD2  10 
ATOM 10121 H HD3  . LYS A 1 52 ? -0.134  11.563  7.924   1.00 0.00 ? 52 LYS A HD3  10 
ATOM 10122 H HE2  . LYS A 1 52 ? 1.913   10.003  7.720   1.00 0.00 ? 52 LYS A HE2  10 
ATOM 10123 H HE3  . LYS A 1 52 ? 1.461   9.885   6.020   1.00 0.00 ? 52 LYS A HE3  10 
ATOM 10124 H HZ1  . LYS A 1 52 ? 1.393   12.528  6.399   1.00 0.00 ? 52 LYS A HZ1  10 
ATOM 10125 H HZ2  . LYS A 1 52 ? 2.752   11.693  5.836   1.00 0.00 ? 52 LYS A HZ2  10 
ATOM 10126 H HZ3  . LYS A 1 52 ? 2.629   12.101  7.473   1.00 0.00 ? 52 LYS A HZ3  10 
ATOM 10127 N N    . PHE A 1 53 ? -3.892  7.477   5.889   1.00 0.00 ? 53 PHE A N    10 
ATOM 10128 C CA   . PHE A 1 53 ? -4.669  6.874   4.813   1.00 0.00 ? 53 PHE A CA   10 
ATOM 10129 C C    . PHE A 1 53 ? -4.418  7.593   3.491   1.00 0.00 ? 53 PHE A C    10 
ATOM 10130 O O    . PHE A 1 53 ? -4.589  8.807   3.390   1.00 0.00 ? 53 PHE A O    10 
ATOM 10131 C CB   . PHE A 1 53 ? -6.161  6.911   5.151   1.00 0.00 ? 53 PHE A CB   10 
ATOM 10132 C CG   . PHE A 1 53 ? -6.997  6.022   4.275   1.00 0.00 ? 53 PHE A CG   10 
ATOM 10133 C CD1  . PHE A 1 53 ? -7.060  6.236   2.907   1.00 0.00 ? 53 PHE A CD1  10 
ATOM 10134 C CD2  . PHE A 1 53 ? -7.719  4.972   4.819   1.00 0.00 ? 53 PHE A CD2  10 
ATOM 10135 C CE1  . PHE A 1 53 ? -7.828  5.420   2.099   1.00 0.00 ? 53 PHE A CE1  10 
ATOM 10136 C CE2  . PHE A 1 53 ? -8.489  4.152   4.016   1.00 0.00 ? 53 PHE A CE2  10 
ATOM 10137 C CZ   . PHE A 1 53 ? -8.543  4.376   2.654   1.00 0.00 ? 53 PHE A CZ   10 
ATOM 10138 H H    . PHE A 1 53 ? -4.059  8.411   6.135   1.00 0.00 ? 53 PHE A H    10 
ATOM 10139 H HA   . PHE A 1 53 ? -4.357  5.845   4.716   1.00 0.00 ? 53 PHE A HA   10 
ATOM 10140 H HB2  . PHE A 1 53 ? -6.300  6.593   6.173   1.00 0.00 ? 53 PHE A HB2  10 
ATOM 10141 H HB3  . PHE A 1 53 ? -6.523  7.922   5.041   1.00 0.00 ? 53 PHE A HB3  10 
ATOM 10142 H HD1  . PHE A 1 53 ? -6.501  7.051   2.472   1.00 0.00 ? 53 PHE A HD1  10 
ATOM 10143 H HD2  . PHE A 1 53 ? -7.677  4.796   5.885   1.00 0.00 ? 53 PHE A HD2  10 
ATOM 10144 H HE1  . PHE A 1 53 ? -7.868  5.597   1.035   1.00 0.00 ? 53 PHE A HE1  10 
ATOM 10145 H HE2  . PHE A 1 53 ? -9.046  3.337   4.453   1.00 0.00 ? 53 PHE A HE2  10 
ATOM 10146 H HZ   . PHE A 1 53 ? -9.144  3.737   2.025   1.00 0.00 ? 53 PHE A HZ   10 
ATOM 10147 N N    . GLY A 1 54 ? -4.009  6.833   2.480   1.00 0.00 ? 54 GLY A N    10 
ATOM 10148 C CA   . GLY A 1 54 ? -3.739  7.414   1.177   1.00 0.00 ? 54 GLY A CA   10 
ATOM 10149 C C    . GLY A 1 54 ? -3.666  6.370   0.081   1.00 0.00 ? 54 GLY A C    10 
ATOM 10150 O O    . GLY A 1 54 ? -4.235  5.284   0.206   1.00 0.00 ? 54 GLY A O    10 
ATOM 10151 H H    . GLY A 1 54 ? -3.889  5.870   2.619   1.00 0.00 ? 54 GLY A H    10 
ATOM 10152 H HA2  . GLY A 1 54 ? -4.523  8.117   0.940   1.00 0.00 ? 54 GLY A HA2  10 
ATOM 10153 H HA3  . GLY A 1 54 ? -2.797  7.941   1.219   1.00 0.00 ? 54 GLY A HA3  10 
ATOM 10154 N N    . THR A 1 55 ? -2.966  6.697   -1.001  1.00 0.00 ? 55 THR A N    10 
ATOM 10155 C CA   . THR A 1 55 ? -2.823  5.781   -2.125  1.00 0.00 ? 55 THR A CA   10 
ATOM 10156 C C    . THR A 1 55 ? -1.354  5.542   -2.457  1.00 0.00 ? 55 THR A C    10 
ATOM 10157 O O    . THR A 1 55 ? -0.543  6.468   -2.434  1.00 0.00 ? 55 THR A O    10 
ATOM 10158 C CB   . THR A 1 55 ? -3.540  6.316   -3.380  1.00 0.00 ? 55 THR A CB   10 
ATOM 10159 O OG1  . THR A 1 55 ? -3.377  5.397   -4.466  1.00 0.00 ? 55 THR A OG1  10 
ATOM 10160 C CG2  . THR A 1 55 ? -2.993  7.679   -3.776  1.00 0.00 ? 55 THR A CG2  10 
ATOM 10161 H H    . THR A 1 55 ? -2.535  7.577   -1.042  1.00 0.00 ? 55 THR A H    10 
ATOM 10162 H HA   . THR A 1 55 ? -3.278  4.841   -1.849  1.00 0.00 ? 55 THR A HA   10 
ATOM 10163 H HB   . THR A 1 55 ? -4.593  6.417   -3.158  1.00 0.00 ? 55 THR A HB   10 
ATOM 10164 H HG1  . THR A 1 55 ? -3.489  5.863   -5.298  1.00 0.00 ? 55 THR A HG1  10 
ATOM 10165 H HG21 . THR A 1 55 ? -3.622  8.111   -4.541  1.00 0.00 ? 55 THR A HG21 10 
ATOM 10166 H HG22 . THR A 1 55 ? -1.988  7.568   -4.155  1.00 0.00 ? 55 THR A HG22 10 
ATOM 10167 H HG23 . THR A 1 55 ? -2.982  8.327   -2.912  1.00 0.00 ? 55 THR A HG23 10 
ATOM 10168 N N    . PHE A 1 56 ? -1.018  4.294   -2.765  1.00 0.00 ? 56 PHE A N    10 
ATOM 10169 C CA   . PHE A 1 56 ? 0.355   3.933   -3.101  1.00 0.00 ? 56 PHE A CA   10 
ATOM 10170 C C    . PHE A 1 56 ? 0.385   2.882   -4.207  1.00 0.00 ? 56 PHE A C    10 
ATOM 10171 O O    . PHE A 1 56 ? -0.565  2.125   -4.405  1.00 0.00 ? 56 PHE A O    10 
ATOM 10172 C CB   . PHE A 1 56 ? 1.084   3.407   -1.862  1.00 0.00 ? 56 PHE A CB   10 
ATOM 10173 C CG   . PHE A 1 56 ? 0.269   2.441   -1.052  1.00 0.00 ? 56 PHE A CG   10 
ATOM 10174 C CD1  . PHE A 1 56 ? -0.651  2.899   -0.122  1.00 0.00 ? 56 PHE A CD1  10 
ATOM 10175 C CD2  . PHE A 1 56 ? 0.423   1.074   -1.219  1.00 0.00 ? 56 PHE A CD2  10 
ATOM 10176 C CE1  . PHE A 1 56 ? -1.403  2.012   0.625   1.00 0.00 ? 56 PHE A CE1  10 
ATOM 10177 C CE2  . PHE A 1 56 ? -0.326  0.182   -0.475  1.00 0.00 ? 56 PHE A CE2  10 
ATOM 10178 C CZ   . PHE A 1 56 ? -1.239  0.652   0.449   1.00 0.00 ? 56 PHE A CZ   10 
ATOM 10179 H H    . PHE A 1 56 ? -1.709  3.599   -2.765  1.00 0.00 ? 56 PHE A H    10 
ATOM 10180 H HA   . PHE A 1 56 ? 0.854   4.823   -3.452  1.00 0.00 ? 56 PHE A HA   10 
ATOM 10181 H HB2  . PHE A 1 56 ? 1.986   2.902   -2.172  1.00 0.00 ? 56 PHE A HB2  10 
ATOM 10182 H HB3  . PHE A 1 56 ? 1.343   4.240   -1.226  1.00 0.00 ? 56 PHE A HB3  10 
ATOM 10183 H HD1  . PHE A 1 56 ? -0.779  3.963   0.016   1.00 0.00 ? 56 PHE A HD1  10 
ATOM 10184 H HD2  . PHE A 1 56 ? 1.137   0.705   -1.940  1.00 0.00 ? 56 PHE A HD2  10 
ATOM 10185 H HE1  . PHE A 1 56 ? -2.116  2.383   1.347   1.00 0.00 ? 56 PHE A HE1  10 
ATOM 10186 H HE2  . PHE A 1 56 ? -0.197  -0.880  -0.614  1.00 0.00 ? 56 PHE A HE2  10 
ATOM 10187 H HZ   . PHE A 1 56 ? -1.826  -0.043  1.032   1.00 0.00 ? 56 PHE A HZ   10 
ATOM 10188 N N    . PRO A 1 57 ? 1.503   2.835   -4.946  1.00 0.00 ? 57 PRO A N    10 
ATOM 10189 C CA   . PRO A 1 57 ? 1.686   1.882   -6.045  1.00 0.00 ? 57 PRO A CA   10 
ATOM 10190 C C    . PRO A 1 57 ? 1.835   0.447   -5.550  1.00 0.00 ? 57 PRO A C    10 
ATOM 10191 O O    . PRO A 1 57 ? 2.780   0.124   -4.831  1.00 0.00 ? 57 PRO A O    10 
ATOM 10192 C CB   . PRO A 1 57 ? 2.979   2.354   -6.713  1.00 0.00 ? 57 PRO A CB   10 
ATOM 10193 C CG   . PRO A 1 57 ? 3.722   3.070   -5.638  1.00 0.00 ? 57 PRO A CG   10 
ATOM 10194 C CD   . PRO A 1 57 ? 2.676   3.707   -4.766  1.00 0.00 ? 57 PRO A CD   10 
ATOM 10195 H HA   . PRO A 1 57 ? 0.872   1.934   -6.754  1.00 0.00 ? 57 PRO A HA   10 
ATOM 10196 H HB2  . PRO A 1 57 ? 3.533   1.500   -7.076  1.00 0.00 ? 57 PRO A HB2  10 
ATOM 10197 H HB3  . PRO A 1 57 ? 2.744   3.013   -7.536  1.00 0.00 ? 57 PRO A HB3  10 
ATOM 10198 H HG2  . PRO A 1 57 ? 4.308   2.367   -5.067  1.00 0.00 ? 57 PRO A HG2  10 
ATOM 10199 H HG3  . PRO A 1 57 ? 4.358   3.826   -6.073  1.00 0.00 ? 57 PRO A HG3  10 
ATOM 10200 H HD2  . PRO A 1 57 ? 2.997   3.714   -3.735  1.00 0.00 ? 57 PRO A HD2  10 
ATOM 10201 H HD3  . PRO A 1 57 ? 2.464   4.711   -5.104  1.00 0.00 ? 57 PRO A HD3  10 
ATOM 10202 N N    . GLY A 1 58 ? 0.896   -0.410  -5.939  1.00 0.00 ? 58 GLY A N    10 
ATOM 10203 C CA   . GLY A 1 58 ? 0.943   -1.800  -5.525  1.00 0.00 ? 58 GLY A CA   10 
ATOM 10204 C C    . GLY A 1 58 ? 2.209   -2.498  -5.981  1.00 0.00 ? 58 GLY A C    10 
ATOM 10205 O O    . GLY A 1 58 ? 2.514   -3.601  -5.530  1.00 0.00 ? 58 GLY A O    10 
ATOM 10206 H H    . GLY A 1 58 ? 0.166   -0.095  -6.513  1.00 0.00 ? 58 GLY A H    10 
ATOM 10207 H HA2  . GLY A 1 58 ? 0.887   -1.845  -4.448  1.00 0.00 ? 58 GLY A HA2  10 
ATOM 10208 H HA3  . GLY A 1 58 ? 0.091   -2.316  -5.942  1.00 0.00 ? 58 GLY A HA3  10 
ATOM 10209 N N    . ASN A 1 59 ? 2.946   -1.855  -6.881  1.00 0.00 ? 59 ASN A N    10 
ATOM 10210 C CA   . ASN A 1 59 ? 4.185   -2.423  -7.400  1.00 0.00 ? 59 ASN A CA   10 
ATOM 10211 C C    . ASN A 1 59 ? 5.263   -2.456  -6.321  1.00 0.00 ? 59 ASN A C    10 
ATOM 10212 O O    . ASN A 1 59 ? 6.299   -3.101  -6.483  1.00 0.00 ? 59 ASN A O    10 
ATOM 10213 C CB   . ASN A 1 59 ? 4.676   -1.615  -8.603  1.00 0.00 ? 59 ASN A CB   10 
ATOM 10214 C CG   . ASN A 1 59 ? 3.649   -1.555  -9.717  1.00 0.00 ? 59 ASN A CG   10 
ATOM 10215 O OD1  . ASN A 1 59 ? 3.585   -2.445  -10.566 1.00 0.00 ? 59 ASN A OD1  10 
ATOM 10216 N ND2  . ASN A 1 59 ? 2.840   -0.502  -9.719  1.00 0.00 ? 59 ASN A ND2  10 
ATOM 10217 H H    . ASN A 1 59 ? 2.651   -0.978  -7.203  1.00 0.00 ? 59 ASN A H    10 
ATOM 10218 H HA   . ASN A 1 59 ? 3.979   -3.435  -7.717  1.00 0.00 ? 59 ASN A HA   10 
ATOM 10219 H HB2  . ASN A 1 59 ? 4.894   -0.606  -8.286  1.00 0.00 ? 59 ASN A HB2  10 
ATOM 10220 H HB3  . ASN A 1 59 ? 5.576   -2.069  -8.991  1.00 0.00 ? 59 ASN A HB3  10 
ATOM 10221 H HD21 . ASN A 1 59 ? 2.949   0.167   -9.012  1.00 0.00 ? 59 ASN A HD21 10 
ATOM 10222 H HD22 . ASN A 1 59 ? 2.166   -0.439  -10.428 1.00 0.00 ? 59 ASN A HD22 10 
ATOM 10223 N N    . TYR A 1 60 ? 5.011   -1.757  -5.220  1.00 0.00 ? 60 TYR A N    10 
ATOM 10224 C CA   . TYR A 1 60 ? 5.960   -1.704  -4.114  1.00 0.00 ? 60 TYR A CA   10 
ATOM 10225 C C    . TYR A 1 60 ? 5.527   -2.628  -2.980  1.00 0.00 ? 60 TYR A C    10 
ATOM 10226 O O    . TYR A 1 60 ? 6.354   -3.105  -2.202  1.00 0.00 ? 60 TYR A O    10 
ATOM 10227 C CB   . TYR A 1 60 ? 6.093   -0.271  -3.597  1.00 0.00 ? 60 TYR A CB   10 
ATOM 10228 C CG   . TYR A 1 60 ? 6.905   0.627   -4.503  1.00 0.00 ? 60 TYR A CG   10 
ATOM 10229 C CD1  . TYR A 1 60 ? 6.460   0.943   -5.781  1.00 0.00 ? 60 TYR A CD1  10 
ATOM 10230 C CD2  . TYR A 1 60 ? 8.118   1.158   -4.082  1.00 0.00 ? 60 TYR A CD2  10 
ATOM 10231 C CE1  . TYR A 1 60 ? 7.198   1.762   -6.612  1.00 0.00 ? 60 TYR A CE1  10 
ATOM 10232 C CE2  . TYR A 1 60 ? 8.863   1.979   -4.907  1.00 0.00 ? 60 TYR A CE2  10 
ATOM 10233 C CZ   . TYR A 1 60 ? 8.399   2.278   -6.171  1.00 0.00 ? 60 TYR A CZ   10 
ATOM 10234 O OH   . TYR A 1 60 ? 9.138   3.095   -6.996  1.00 0.00 ? 60 TYR A OH   10 
ATOM 10235 H H    . TYR A 1 60 ? 4.168   -1.263  -5.149  1.00 0.00 ? 60 TYR A H    10 
ATOM 10236 H HA   . TYR A 1 60 ? 6.920   -2.033  -4.485  1.00 0.00 ? 60 TYR A HA   10 
ATOM 10237 H HB2  . TYR A 1 60 ? 5.110   0.162   -3.498  1.00 0.00 ? 60 TYR A HB2  10 
ATOM 10238 H HB3  . TYR A 1 60 ? 6.574   -0.288  -2.629  1.00 0.00 ? 60 TYR A HB3  10 
ATOM 10239 H HD1  . TYR A 1 60 ? 5.519   0.538   -6.124  1.00 0.00 ? 60 TYR A HD1  10 
ATOM 10240 H HD2  . TYR A 1 60 ? 8.479   0.921   -3.092  1.00 0.00 ? 60 TYR A HD2  10 
ATOM 10241 H HE1  . TYR A 1 60 ? 6.835   1.997   -7.602  1.00 0.00 ? 60 TYR A HE1  10 
ATOM 10242 H HE2  . TYR A 1 60 ? 9.803   2.383   -4.561  1.00 0.00 ? 60 TYR A HE2  10 
ATOM 10243 H HH   . TYR A 1 60 ? 8.828   3.999   -6.912  1.00 0.00 ? 60 TYR A HH   10 
ATOM 10244 N N    . VAL A 1 61 ? 4.224   -2.877  -2.893  1.00 0.00 ? 61 VAL A N    10 
ATOM 10245 C CA   . VAL A 1 61 ? 3.680   -3.745  -1.855  1.00 0.00 ? 61 VAL A CA   10 
ATOM 10246 C C    . VAL A 1 61 ? 3.174   -5.056  -2.446  1.00 0.00 ? 61 VAL A C    10 
ATOM 10247 O O    . VAL A 1 61 ? 3.081   -5.205  -3.664  1.00 0.00 ? 61 VAL A O    10 
ATOM 10248 C CB   . VAL A 1 61 ? 2.528   -3.058  -1.097  1.00 0.00 ? 61 VAL A CB   10 
ATOM 10249 C CG1  . VAL A 1 61 ? 2.994   -1.739  -0.499  1.00 0.00 ? 61 VAL A CG1  10 
ATOM 10250 C CG2  . VAL A 1 61 ? 1.337   -2.844  -2.018  1.00 0.00 ? 61 VAL A CG2  10 
ATOM 10251 H H    . VAL A 1 61 ? 3.615   -2.467  -3.542  1.00 0.00 ? 61 VAL A H    10 
ATOM 10252 H HA   . VAL A 1 61 ? 4.470   -3.959  -1.151  1.00 0.00 ? 61 VAL A HA   10 
ATOM 10253 H HB   . VAL A 1 61 ? 2.220   -3.705  -0.289  1.00 0.00 ? 61 VAL A HB   10 
ATOM 10254 H HG11 . VAL A 1 61 ? 3.739   -1.931  0.260   1.00 0.00 ? 61 VAL A HG11 10 
ATOM 10255 H HG12 . VAL A 1 61 ? 3.422   -1.122  -1.276  1.00 0.00 ? 61 VAL A HG12 10 
ATOM 10256 H HG13 . VAL A 1 61 ? 2.153   -1.228  -0.055  1.00 0.00 ? 61 VAL A HG13 10 
ATOM 10257 H HG21 . VAL A 1 61 ? 1.436   -3.477  -2.886  1.00 0.00 ? 61 VAL A HG21 10 
ATOM 10258 H HG22 . VAL A 1 61 ? 0.426   -3.093  -1.493  1.00 0.00 ? 61 VAL A HG22 10 
ATOM 10259 H HG23 . VAL A 1 61 ? 1.302   -1.810  -2.327  1.00 0.00 ? 61 VAL A HG23 10 
ATOM 10260 N N    . ALA A 1 62 ? 2.846   -6.004  -1.574  1.00 0.00 ? 62 ALA A N    10 
ATOM 10261 C CA   . ALA A 1 62 ? 2.346   -7.302  -2.009  1.00 0.00 ? 62 ALA A CA   10 
ATOM 10262 C C    . ALA A 1 62 ? 1.506   -7.960  -0.919  1.00 0.00 ? 62 ALA A C    10 
ATOM 10263 O O    . ALA A 1 62 ? 1.678   -7.701  0.272   1.00 0.00 ? 62 ALA A O    10 
ATOM 10264 C CB   . ALA A 1 62 ? 3.504   -8.207  -2.404  1.00 0.00 ? 62 ALA A CB   10 
ATOM 10265 H H    . ALA A 1 62 ? 2.941   -5.825  -0.615  1.00 0.00 ? 62 ALA A H    10 
ATOM 10266 H HA   . ALA A 1 62 ? 1.728   -7.147  -2.881  1.00 0.00 ? 62 ALA A HA   10 
ATOM 10267 H HB1  . ALA A 1 62 ? 4.437   -7.736  -2.133  1.00 0.00 ? 62 ALA A HB1  10 
ATOM 10268 H HB2  . ALA A 1 62 ? 3.414   -9.152  -1.889  1.00 0.00 ? 62 ALA A HB2  10 
ATOM 10269 H HB3  . ALA A 1 62 ? 3.481   -8.375  -3.471  1.00 0.00 ? 62 ALA A HB3  10 
ATOM 10270 N N    . PRO A 1 63 ? 0.574   -8.831  -1.334  1.00 0.00 ? 63 PRO A N    10 
ATOM 10271 C CA   . PRO A 1 63 ? -0.311  -9.543  -0.409  1.00 0.00 ? 63 PRO A CA   10 
ATOM 10272 C C    . PRO A 1 63 ? 0.433   -10.585 0.420   1.00 0.00 ? 63 PRO A C    10 
ATOM 10273 O O    . PRO A 1 63 ? 0.670   -11.703 -0.037  1.00 0.00 ? 63 PRO A O    10 
ATOM 10274 C CB   . PRO A 1 63 ? -1.322  -10.222 -1.337  1.00 0.00 ? 63 PRO A CB   10 
ATOM 10275 C CG   . PRO A 1 63 ? -0.604  -10.373 -2.633  1.00 0.00 ? 63 PRO A CG   10 
ATOM 10276 C CD   . PRO A 1 63 ? 0.314   -9.187  -2.739  1.00 0.00 ? 63 PRO A CD   10 
ATOM 10277 H HA   . PRO A 1 63 ? -0.827  -8.861  0.251   1.00 0.00 ? 63 PRO A HA   10 
ATOM 10278 H HB2  . PRO A 1 63 ? -1.605  -11.181 -0.926  1.00 0.00 ? 63 PRO A HB2  10 
ATOM 10279 H HB3  . PRO A 1 63 ? -2.197  -9.597  -1.441  1.00 0.00 ? 63 PRO A HB3  10 
ATOM 10280 H HG2  . PRO A 1 63 ? -0.034  -11.290 -2.632  1.00 0.00 ? 63 PRO A HG2  10 
ATOM 10281 H HG3  . PRO A 1 63 ? -1.314  -10.371 -3.448  1.00 0.00 ? 63 PRO A HG3  10 
ATOM 10282 H HD2  . PRO A 1 63 ? 1.229   -9.462  -3.243  1.00 0.00 ? 63 PRO A HD2  10 
ATOM 10283 H HD3  . PRO A 1 63 ? -0.176  -8.376  -3.258  1.00 0.00 ? 63 PRO A HD3  10 
ATOM 10284 N N    . VAL A 1 64 ? 0.800   -10.210 1.642   1.00 0.00 ? 64 VAL A N    10 
ATOM 10285 C CA   . VAL A 1 64 ? 1.516   -11.113 2.535   1.00 0.00 ? 64 VAL A CA   10 
ATOM 10286 C C    . VAL A 1 64 ? 0.684   -12.351 2.848   1.00 0.00 ? 64 VAL A C    10 
ATOM 10287 O O    . VAL A 1 64 ? 1.225   -13.420 3.130   1.00 0.00 ? 64 VAL A O    10 
ATOM 10288 C CB   . VAL A 1 64 ? 1.893   -10.414 3.855   1.00 0.00 ? 64 VAL A CB   10 
ATOM 10289 C CG1  . VAL A 1 64 ? 0.764   -9.507  4.320   1.00 0.00 ? 64 VAL A CG1  10 
ATOM 10290 C CG2  . VAL A 1 64 ? 2.237   -11.442 4.922   1.00 0.00 ? 64 VAL A CG2  10 
ATOM 10291 H H    . VAL A 1 64 ? 0.583   -9.306  1.950   1.00 0.00 ? 64 VAL A H    10 
ATOM 10292 H HA   . VAL A 1 64 ? 2.427   -11.418 2.041   1.00 0.00 ? 64 VAL A HA   10 
ATOM 10293 H HB   . VAL A 1 64 ? 2.766   -9.803  3.678   1.00 0.00 ? 64 VAL A HB   10 
ATOM 10294 H HG11 . VAL A 1 64 ? 0.990   -8.485  4.053   1.00 0.00 ? 64 VAL A HG11 10 
ATOM 10295 H HG12 . VAL A 1 64 ? -0.159  -9.809  3.847   1.00 0.00 ? 64 VAL A HG12 10 
ATOM 10296 H HG13 . VAL A 1 64 ? 0.661   -9.584  5.393   1.00 0.00 ? 64 VAL A HG13 10 
ATOM 10297 H HG21 . VAL A 1 64 ? 2.504   -10.934 5.837   1.00 0.00 ? 64 VAL A HG21 10 
ATOM 10298 H HG22 . VAL A 1 64 ? 1.381   -12.077 5.100   1.00 0.00 ? 64 VAL A HG22 10 
ATOM 10299 H HG23 . VAL A 1 64 ? 3.069   -12.044 4.588   1.00 0.00 ? 64 VAL A HG23 10 
ATOM 10300 N N    . SER A 1 65 ? -0.636  -12.200 2.796   1.00 0.00 ? 65 SER A N    10 
ATOM 10301 C CA   . SER A 1 65 ? -1.544  -13.305 3.078   1.00 0.00 ? 65 SER A CA   10 
ATOM 10302 C C    . SER A 1 65 ? -1.131  -14.557 2.309   1.00 0.00 ? 65 SER A C    10 
ATOM 10303 O O    . SER A 1 65 ? -1.331  -15.678 2.773   1.00 0.00 ? 65 SER A O    10 
ATOM 10304 C CB   . SER A 1 65 ? -2.979  -12.919 2.713   1.00 0.00 ? 65 SER A CB   10 
ATOM 10305 O OG   . SER A 1 65 ? -3.643  -12.327 3.816   1.00 0.00 ? 65 SER A OG   10 
ATOM 10306 H H    . SER A 1 65 ? -1.007  -11.322 2.566   1.00 0.00 ? 65 SER A H    10 
ATOM 10307 H HA   . SER A 1 65 ? -1.494  -13.514 4.136   1.00 0.00 ? 65 SER A HA   10 
ATOM 10308 H HB2  . SER A 1 65 ? -2.963  -12.214 1.897   1.00 0.00 ? 65 SER A HB2  10 
ATOM 10309 H HB3  . SER A 1 65 ? -3.521  -13.804 2.414   1.00 0.00 ? 65 SER A HB3  10 
ATOM 10310 H HG   . SER A 1 65 ? -3.931  -13.013 4.423   1.00 0.00 ? 65 SER A HG   10 
ATOM 10311 N N    . GLY A 1 66 ? -0.552  -14.355 1.129   1.00 0.00 ? 66 GLY A N    10 
ATOM 10312 C CA   . GLY A 1 66 ? -0.120  -15.475 0.313   1.00 0.00 ? 66 GLY A CA   10 
ATOM 10313 C C    . GLY A 1 66 ? -1.057  -15.742 -0.848  1.00 0.00 ? 66 GLY A C    10 
ATOM 10314 O O    . GLY A 1 66 ? -1.960  -14.957 -1.139  1.00 0.00 ? 66 GLY A O    10 
ATOM 10315 H H    . GLY A 1 66 ? -0.418  -13.438 0.809   1.00 0.00 ? 66 GLY A H    10 
ATOM 10316 H HA2  . GLY A 1 66 ? 0.866   -15.264 -0.074  1.00 0.00 ? 66 GLY A HA2  10 
ATOM 10317 H HA3  . GLY A 1 66 ? -0.071  -16.358 0.933   1.00 0.00 ? 66 GLY A HA3  10 
ATOM 10318 N N    . PRO A 1 67 ? -0.846  -16.875 -1.534  1.00 0.00 ? 67 PRO A N    10 
ATOM 10319 C CA   . PRO A 1 67 ? -1.668  -17.270 -2.682  1.00 0.00 ? 67 PRO A CA   10 
ATOM 10320 C C    . PRO A 1 67 ? -3.083  -17.666 -2.273  1.00 0.00 ? 67 PRO A C    10 
ATOM 10321 O O    . PRO A 1 67 ? -4.058  -17.270 -2.911  1.00 0.00 ? 67 PRO A O    10 
ATOM 10322 C CB   . PRO A 1 67 ? -0.921  -18.476 -3.256  1.00 0.00 ? 67 PRO A CB   10 
ATOM 10323 C CG   . PRO A 1 67 ? -0.160  -19.034 -2.103  1.00 0.00 ? 67 PRO A CG   10 
ATOM 10324 C CD   . PRO A 1 67 ? 0.211   -17.858 -1.243  1.00 0.00 ? 67 PRO A CD   10 
ATOM 10325 H HA   . PRO A 1 67 ? -1.716  -16.487 -3.424  1.00 0.00 ? 67 PRO A HA   10 
ATOM 10326 H HB2  . PRO A 1 67 ? -1.631  -19.191 -3.646  1.00 0.00 ? 67 PRO A HB2  10 
ATOM 10327 H HB3  . PRO A 1 67 ? -0.259  -18.151 -4.045  1.00 0.00 ? 67 PRO A HB3  10 
ATOM 10328 H HG2  . PRO A 1 67 ? -0.784  -19.721 -1.550  1.00 0.00 ? 67 PRO A HG2  10 
ATOM 10329 H HG3  . PRO A 1 67 ? 0.729   -19.534 -2.457  1.00 0.00 ? 67 PRO A HG3  10 
ATOM 10330 H HD2  . PRO A 1 67 ? 0.202   -18.136 -0.199  1.00 0.00 ? 67 PRO A HD2  10 
ATOM 10331 H HD3  . PRO A 1 67 ? 1.181   -17.475 -1.526  1.00 0.00 ? 67 PRO A HD3  10 
ATOM 10332 N N    . SER A 1 68 ? -3.188  -18.449 -1.204  1.00 0.00 ? 68 SER A N    10 
ATOM 10333 C CA   . SER A 1 68 ? -4.483  -18.901 -0.711  1.00 0.00 ? 68 SER A CA   10 
ATOM 10334 C C    . SER A 1 68 ? -5.507  -17.771 -0.758  1.00 0.00 ? 68 SER A C    10 
ATOM 10335 O O    . SER A 1 68 ? -5.223  -16.645 -0.351  1.00 0.00 ? 68 SER A O    10 
ATOM 10336 C CB   . SER A 1 68 ? -4.353  -19.428 0.719   1.00 0.00 ? 68 SER A CB   10 
ATOM 10337 O OG   . SER A 1 68 ? -3.284  -20.351 0.828   1.00 0.00 ? 68 SER A OG   10 
ATOM 10338 H H    . SER A 1 68 ? -2.373  -18.732 -0.737  1.00 0.00 ? 68 SER A H    10 
ATOM 10339 H HA   . SER A 1 68 ? -4.820  -19.703 -1.352  1.00 0.00 ? 68 SER A HA   10 
ATOM 10340 H HB2  . SER A 1 68 ? -4.170  -18.602 1.389   1.00 0.00 ? 68 SER A HB2  10 
ATOM 10341 H HB3  . SER A 1 68 ? -5.271  -19.924 1.002   1.00 0.00 ? 68 SER A HB3  10 
ATOM 10342 H HG   . SER A 1 68 ? -3.529  -21.057 1.430   1.00 0.00 ? 68 SER A HG   10 
ATOM 10343 N N    . SER A 1 69 ? -6.699  -18.081 -1.258  1.00 0.00 ? 69 SER A N    10 
ATOM 10344 C CA   . SER A 1 69 ? -7.765  -17.091 -1.363  1.00 0.00 ? 69 SER A CA   10 
ATOM 10345 C C    . SER A 1 69 ? -8.329  -16.754 0.014   1.00 0.00 ? 69 SER A C    10 
ATOM 10346 O O    . SER A 1 69 ? -8.486  -15.584 0.363   1.00 0.00 ? 69 SER A O    10 
ATOM 10347 C CB   . SER A 1 69 ? -8.882  -17.608 -2.272  1.00 0.00 ? 69 SER A CB   10 
ATOM 10348 O OG   . SER A 1 69 ? -9.299  -18.904 -1.881  1.00 0.00 ? 69 SER A OG   10 
ATOM 10349 H H    . SER A 1 69 ? -6.864  -18.996 -1.567  1.00 0.00 ? 69 SER A H    10 
ATOM 10350 H HA   . SER A 1 69 ? -7.344  -16.196 -1.796  1.00 0.00 ? 69 SER A HA   10 
ATOM 10351 H HB2  . SER A 1 69 ? -9.727  -16.938 -2.216  1.00 0.00 ? 69 SER A HB2  10 
ATOM 10352 H HB3  . SER A 1 69 ? -8.523  -17.649 -3.290  1.00 0.00 ? 69 SER A HB3  10 
ATOM 10353 H HG   . SER A 1 69 ? -8.949  -19.552 -2.497  1.00 0.00 ? 69 SER A HG   10 
ATOM 10354 N N    . GLY A 1 70 ? -8.634  -17.788 0.792   1.00 0.00 ? 70 GLY A N    10 
ATOM 10355 C CA   . GLY A 1 70 ? -9.178  -17.582 2.121   1.00 0.00 ? 70 GLY A CA   10 
ATOM 10356 C C    . GLY A 1 70 ? -10.688 -17.707 2.155   1.00 0.00 ? 70 GLY A C    10 
ATOM 10357 O O    . GLY A 1 70 ? -11.247 -18.305 3.075   1.00 0.00 ? 70 GLY A O    10 
ATOM 10358 H H    . GLY A 1 70 ? -8.488  -18.699 0.460   1.00 0.00 ? 70 GLY A H    10 
ATOM 10359 H HA2  . GLY A 1 70 ? -8.751  -18.313 2.791   1.00 0.00 ? 70 GLY A HA2  10 
ATOM 10360 H HA3  . GLY A 1 70 ? -8.902  -16.594 2.461   1.00 0.00 ? 70 GLY A HA3  10 
ATOM 10361 N N    . GLY A 1 1  ? -24.703 3.430   12.479  1.00 0.00 ? 1  GLY A N    11 
ATOM 10362 C CA   . GLY A 1 1  ? -24.076 2.346   11.745  1.00 0.00 ? 1  GLY A CA   11 
ATOM 10363 C C    . GLY A 1 1  ? -23.112 1.548   12.599  1.00 0.00 ? 1  GLY A C    11 
ATOM 10364 O O    . GLY A 1 1  ? -22.928 1.843   13.780  1.00 0.00 ? 1  GLY A O    11 
ATOM 10365 H H1   . GLY A 1 1  ? -24.170 4.206   12.752  1.00 0.00 ? 1  GLY A H1   11 
ATOM 10366 H HA2  . GLY A 1 1  ? -24.846 1.685   11.375  1.00 0.00 ? 1  GLY A HA2  11 
ATOM 10367 H HA3  . GLY A 1 1  ? -23.537 2.760   10.905  1.00 0.00 ? 1  GLY A HA3  11 
ATOM 10368 N N    . SER A 1 2  ? -22.495 0.533   12.002  1.00 0.00 ? 2  SER A N    11 
ATOM 10369 C CA   . SER A 1 2  ? -21.549 -0.314  12.718  1.00 0.00 ? 2  SER A CA   11 
ATOM 10370 C C    . SER A 1 2  ? -20.281 -0.528  11.896  1.00 0.00 ? 2  SER A C    11 
ATOM 10371 O O    . SER A 1 2  ? -20.333 -0.625  10.670  1.00 0.00 ? 2  SER A O    11 
ATOM 10372 C CB   . SER A 1 2  ? -22.189 -1.663  13.050  1.00 0.00 ? 2  SER A CB   11 
ATOM 10373 O OG   . SER A 1 2  ? -22.986 -1.576  14.218  1.00 0.00 ? 2  SER A OG   11 
ATOM 10374 H H    . SER A 1 2  ? -22.684 0.348   11.058  1.00 0.00 ? 2  SER A H    11 
ATOM 10375 H HA   . SER A 1 2  ? -21.286 0.186   13.638  1.00 0.00 ? 2  SER A HA   11 
ATOM 10376 H HB2  . SER A 1 2  ? -22.812 -1.976  12.226  1.00 0.00 ? 2  SER A HB2  11 
ATOM 10377 H HB3  . SER A 1 2  ? -21.412 -2.397  13.213  1.00 0.00 ? 2  SER A HB3  11 
ATOM 10378 H HG   . SER A 1 2  ? -22.450 -1.780  14.988  1.00 0.00 ? 2  SER A HG   11 
ATOM 10379 N N    . SER A 1 3  ? -19.144 -0.602  12.580  1.00 0.00 ? 3  SER A N    11 
ATOM 10380 C CA   . SER A 1 3  ? -17.863 -0.800  11.914  1.00 0.00 ? 3  SER A CA   11 
ATOM 10381 C C    . SER A 1 3  ? -16.794 -1.237  12.912  1.00 0.00 ? 3  SER A C    11 
ATOM 10382 O O    . SER A 1 3  ? -16.992 -1.161  14.124  1.00 0.00 ? 3  SER A O    11 
ATOM 10383 C CB   . SER A 1 3  ? -17.425 0.486   11.210  1.00 0.00 ? 3  SER A CB   11 
ATOM 10384 O OG   . SER A 1 3  ? -17.176 1.520   12.147  1.00 0.00 ? 3  SER A OG   11 
ATOM 10385 H H    . SER A 1 3  ? -19.168 -0.517  13.557  1.00 0.00 ? 3  SER A H    11 
ATOM 10386 H HA   . SER A 1 3  ? -17.989 -1.579  11.177  1.00 0.00 ? 3  SER A HA   11 
ATOM 10387 H HB2  . SER A 1 3  ? -16.521 0.297   10.652  1.00 0.00 ? 3  SER A HB2  11 
ATOM 10388 H HB3  . SER A 1 3  ? -18.205 0.807   10.536  1.00 0.00 ? 3  SER A HB3  11 
ATOM 10389 H HG   . SER A 1 3  ? -17.559 1.283   12.995  1.00 0.00 ? 3  SER A HG   11 
ATOM 10390 N N    . GLY A 1 4  ? -15.659 -1.694  12.392  1.00 0.00 ? 4  GLY A N    11 
ATOM 10391 C CA   . GLY A 1 4  ? -14.575 -2.136  13.249  1.00 0.00 ? 4  GLY A CA   11 
ATOM 10392 C C    . GLY A 1 4  ? -13.241 -2.162  12.531  1.00 0.00 ? 4  GLY A C    11 
ATOM 10393 O O    . GLY A 1 4  ? -12.712 -1.117  12.151  1.00 0.00 ? 4  GLY A O    11 
ATOM 10394 H H    . GLY A 1 4  ? -15.557 -1.731  11.417  1.00 0.00 ? 4  GLY A H    11 
ATOM 10395 H HA2  . GLY A 1 4  ? -14.504 -1.468  14.095  1.00 0.00 ? 4  GLY A HA2  11 
ATOM 10396 H HA3  . GLY A 1 4  ? -14.797 -3.131  13.607  1.00 0.00 ? 4  GLY A HA3  11 
ATOM 10397 N N    . SER A 1 5  ? -12.693 -3.359  12.345  1.00 0.00 ? 5  SER A N    11 
ATOM 10398 C CA   . SER A 1 5  ? -11.409 -3.517  11.672  1.00 0.00 ? 5  SER A CA   11 
ATOM 10399 C C    . SER A 1 5  ? -11.592 -4.143  10.293  1.00 0.00 ? 5  SER A C    11 
ATOM 10400 O O    . SER A 1 5  ? -12.259 -5.167  10.148  1.00 0.00 ? 5  SER A O    11 
ATOM 10401 C CB   . SER A 1 5  ? -10.469 -4.379  12.516  1.00 0.00 ? 5  SER A CB   11 
ATOM 10402 O OG   . SER A 1 5  ? -10.082 -3.704  13.700  1.00 0.00 ? 5  SER A OG   11 
ATOM 10403 H H    . SER A 1 5  ? -13.164 -4.155  12.671  1.00 0.00 ? 5  SER A H    11 
ATOM 10404 H HA   . SER A 1 5  ? -10.975 -2.535  11.554  1.00 0.00 ? 5  SER A HA   11 
ATOM 10405 H HB2  . SER A 1 5  ? -10.972 -5.295  12.787  1.00 0.00 ? 5  SER A HB2  11 
ATOM 10406 H HB3  . SER A 1 5  ? -9.584  -4.611  11.941  1.00 0.00 ? 5  SER A HB3  11 
ATOM 10407 H HG   . SER A 1 5  ? -9.834  -4.346  14.369  1.00 0.00 ? 5  SER A HG   11 
ATOM 10408 N N    . SER A 1 6  ? -10.994 -3.519  9.283   1.00 0.00 ? 6  SER A N    11 
ATOM 10409 C CA   . SER A 1 6  ? -11.093 -4.012  7.914   1.00 0.00 ? 6  SER A CA   11 
ATOM 10410 C C    . SER A 1 6  ? -9.813  -3.720  7.137   1.00 0.00 ? 6  SER A C    11 
ATOM 10411 O O    . SER A 1 6  ? -9.028  -2.852  7.516   1.00 0.00 ? 6  SER A O    11 
ATOM 10412 C CB   . SER A 1 6  ? -12.290 -3.375  7.205   1.00 0.00 ? 6  SER A CB   11 
ATOM 10413 O OG   . SER A 1 6  ? -13.501 -3.681  7.875   1.00 0.00 ? 6  SER A OG   11 
ATOM 10414 H H    . SER A 1 6  ? -10.476 -2.707  9.462   1.00 0.00 ? 6  SER A H    11 
ATOM 10415 H HA   . SER A 1 6  ? -11.238 -5.082  7.956   1.00 0.00 ? 6  SER A HA   11 
ATOM 10416 H HB2  . SER A 1 6  ? -12.164 -2.303  7.185   1.00 0.00 ? 6  SER A HB2  11 
ATOM 10417 H HB3  . SER A 1 6  ? -12.347 -3.750  6.193   1.00 0.00 ? 6  SER A HB3  11 
ATOM 10418 H HG   . SER A 1 6  ? -14.244 -3.395  7.339   1.00 0.00 ? 6  SER A HG   11 
ATOM 10419 N N    . GLY A 1 7  ? -9.609  -4.453  6.047   1.00 0.00 ? 7  GLY A N    11 
ATOM 10420 C CA   . GLY A 1 7  ? -8.423  -4.258  5.233   1.00 0.00 ? 7  GLY A CA   11 
ATOM 10421 C C    . GLY A 1 7  ? -7.585  -5.516  5.119   1.00 0.00 ? 7  GLY A C    11 
ATOM 10422 O O    . GLY A 1 7  ? -7.440  -6.265  6.086   1.00 0.00 ? 7  GLY A O    11 
ATOM 10423 H H    . GLY A 1 7  ? -10.269 -5.131  5.793   1.00 0.00 ? 7  GLY A H    11 
ATOM 10424 H HA2  . GLY A 1 7  ? -8.726  -3.949  4.244   1.00 0.00 ? 7  GLY A HA2  11 
ATOM 10425 H HA3  . GLY A 1 7  ? -7.822  -3.478  5.675   1.00 0.00 ? 7  GLY A HA3  11 
ATOM 10426 N N    . THR A 1 8  ? -7.032  -5.752  3.934   1.00 0.00 ? 8  THR A N    11 
ATOM 10427 C CA   . THR A 1 8  ? -6.207  -6.930  3.696   1.00 0.00 ? 8  THR A CA   11 
ATOM 10428 C C    . THR A 1 8  ? -4.753  -6.667  4.070   1.00 0.00 ? 8  THR A C    11 
ATOM 10429 O O    . THR A 1 8  ? -4.195  -5.607  3.785   1.00 0.00 ? 8  THR A O    11 
ATOM 10430 C CB   . THR A 1 8  ? -6.273  -7.374  2.222   1.00 0.00 ? 8  THR A CB   11 
ATOM 10431 O OG1  . THR A 1 8  ? -7.632  -7.627  1.848   1.00 0.00 ? 8  THR A OG1  11 
ATOM 10432 C CG2  . THR A 1 8  ? -5.438  -8.625  1.996   1.00 0.00 ? 8  THR A CG2  11 
ATOM 10433 H H    . THR A 1 8  ? -7.185  -5.118  3.202   1.00 0.00 ? 8  THR A H    11 
ATOM 10434 H HA   . THR A 1 8  ? -6.587  -7.733  4.310   1.00 0.00 ? 8  THR A HA   11 
ATOM 10435 H HB   . THR A 1 8  ? -5.879  -6.579  1.605   1.00 0.00 ? 8  THR A HB   11 
ATOM 10436 H HG1  . THR A 1 8  ? -7.858  -8.537  2.059   1.00 0.00 ? 8  THR A HG1  11 
ATOM 10437 H HG21 . THR A 1 8  ? -4.485  -8.516  2.493   1.00 0.00 ? 8  THR A HG21 11 
ATOM 10438 H HG22 . THR A 1 8  ? -5.278  -8.765  0.937   1.00 0.00 ? 8  THR A HG22 11 
ATOM 10439 H HG23 . THR A 1 8  ? -5.957  -9.482  2.399   1.00 0.00 ? 8  THR A HG23 11 
ATOM 10440 N N    . PRO A 1 9  ? -4.122  -7.653  4.725   1.00 0.00 ? 9  PRO A N    11 
ATOM 10441 C CA   . PRO A 1 9  ? -2.723  -7.551  5.151   1.00 0.00 ? 9  PRO A CA   11 
ATOM 10442 C C    . PRO A 1 9  ? -1.754  -7.580  3.974   1.00 0.00 ? 9  PRO A C    11 
ATOM 10443 O O    . PRO A 1 9  ? -1.825  -8.465  3.121   1.00 0.00 ? 9  PRO A O    11 
ATOM 10444 C CB   . PRO A 1 9  ? -2.530  -8.788  6.033   1.00 0.00 ? 9  PRO A CB   11 
ATOM 10445 C CG   . PRO A 1 9  ? -3.546  -9.762  5.545   1.00 0.00 ? 9  PRO A CG   11 
ATOM 10446 C CD   . PRO A 1 9  ? -4.725  -8.943  5.098   1.00 0.00 ? 9  PRO A CD   11 
ATOM 10447 H HA   . PRO A 1 9  ? -2.550  -6.660  5.737   1.00 0.00 ? 9  PRO A HA   11 
ATOM 10448 H HB2  . PRO A 1 9  ? -1.526  -9.168  5.909   1.00 0.00 ? 9  PRO A HB2  11 
ATOM 10449 H HB3  . PRO A 1 9  ? -2.698  -8.527  7.067   1.00 0.00 ? 9  PRO A HB3  11 
ATOM 10450 H HG2  . PRO A 1 9  ? -3.146  -10.327 4.717   1.00 0.00 ? 9  PRO A HG2  11 
ATOM 10451 H HG3  . PRO A 1 9  ? -3.833  -10.425 6.348   1.00 0.00 ? 9  PRO A HG3  11 
ATOM 10452 H HD2  . PRO A 1 9  ? -5.205  -9.405  4.248   1.00 0.00 ? 9  PRO A HD2  11 
ATOM 10453 H HD3  . PRO A 1 9  ? -5.428  -8.819  5.909   1.00 0.00 ? 9  PRO A HD3  11 
ATOM 10454 N N    . TYR A 1 10 ? -0.850  -6.607  3.934   1.00 0.00 ? 10 TYR A N    11 
ATOM 10455 C CA   . TYR A 1 10 ? 0.132   -6.520  2.860   1.00 0.00 ? 10 TYR A CA   11 
ATOM 10456 C C    . TYR A 1 10 ? 1.515   -6.189  3.412   1.00 0.00 ? 10 TYR A C    11 
ATOM 10457 O O    . TYR A 1 10 ? 1.680   -5.966  4.611   1.00 0.00 ? 10 TYR A O    11 
ATOM 10458 C CB   . TYR A 1 10 ? -0.290  -5.462  1.839   1.00 0.00 ? 10 TYR A CB   11 
ATOM 10459 C CG   . TYR A 1 10 ? -1.174  -6.001  0.737   1.00 0.00 ? 10 TYR A CG   11 
ATOM 10460 C CD1  . TYR A 1 10 ? -2.483  -6.386  0.996   1.00 0.00 ? 10 TYR A CD1  11 
ATOM 10461 C CD2  . TYR A 1 10 ? -0.698  -6.127  -0.562  1.00 0.00 ? 10 TYR A CD2  11 
ATOM 10462 C CE1  . TYR A 1 10 ? -3.294  -6.880  -0.008  1.00 0.00 ? 10 TYR A CE1  11 
ATOM 10463 C CE2  . TYR A 1 10 ? -1.502  -6.619  -1.572  1.00 0.00 ? 10 TYR A CE2  11 
ATOM 10464 C CZ   . TYR A 1 10 ? -2.799  -6.994  -1.290  1.00 0.00 ? 10 TYR A CZ   11 
ATOM 10465 O OH   . TYR A 1 10 ? -3.603  -7.485  -2.293  1.00 0.00 ? 10 TYR A OH   11 
ATOM 10466 H H    . TYR A 1 10 ? -0.844  -5.931  4.643   1.00 0.00 ? 10 TYR A H    11 
ATOM 10467 H HA   . TYR A 1 10 ? 0.173   -7.482  2.370   1.00 0.00 ? 10 TYR A HA   11 
ATOM 10468 H HB2  . TYR A 1 10 ? -0.834  -4.679  2.346   1.00 0.00 ? 10 TYR A HB2  11 
ATOM 10469 H HB3  . TYR A 1 10 ? 0.593   -5.041  1.381   1.00 0.00 ? 10 TYR A HB3  11 
ATOM 10470 H HD1  . TYR A 1 10 ? -2.868  -6.296  2.001   1.00 0.00 ? 10 TYR A HD1  11 
ATOM 10471 H HD2  . TYR A 1 10 ? 0.318   -5.832  -0.780  1.00 0.00 ? 10 TYR A HD2  11 
ATOM 10472 H HE1  . TYR A 1 10 ? -4.310  -7.174  0.213   1.00 0.00 ? 10 TYR A HE1  11 
ATOM 10473 H HE2  . TYR A 1 10 ? -1.115  -6.708  -2.576  1.00 0.00 ? 10 TYR A HE2  11 
ATOM 10474 H HH   . TYR A 1 10 ? -4.332  -7.976  -1.907  1.00 0.00 ? 10 TYR A HH   11 
ATOM 10475 N N    . ARG A 1 11 ? 2.506   -6.156  2.526   1.00 0.00 ? 11 ARG A N    11 
ATOM 10476 C CA   . ARG A 1 11 ? 3.875   -5.852  2.923   1.00 0.00 ? 11 ARG A CA   11 
ATOM 10477 C C    . ARG A 1 11 ? 4.595   -5.064  1.833   1.00 0.00 ? 11 ARG A C    11 
ATOM 10478 O O    . ARG A 1 11 ? 4.562   -5.436  0.660   1.00 0.00 ? 11 ARG A O    11 
ATOM 10479 C CB   . ARG A 1 11 ? 4.640   -7.142  3.224   1.00 0.00 ? 11 ARG A CB   11 
ATOM 10480 C CG   . ARG A 1 11 ? 6.146   -6.953  3.306   1.00 0.00 ? 11 ARG A CG   11 
ATOM 10481 C CD   . ARG A 1 11 ? 6.809   -8.088  4.070   1.00 0.00 ? 11 ARG A CD   11 
ATOM 10482 N NE   . ARG A 1 11 ? 8.201   -8.276  3.670   1.00 0.00 ? 11 ARG A NE   11 
ATOM 10483 C CZ   . ARG A 1 11 ? 8.569   -8.716  2.472   1.00 0.00 ? 11 ARG A CZ   11 
ATOM 10484 N NH1  . ARG A 1 11 ? 7.652   -9.010  1.560   1.00 0.00 ? 11 ARG A NH1  11 
ATOM 10485 N NH2  . ARG A 1 11 ? 9.856   -8.861  2.183   1.00 0.00 ? 11 ARG A NH2  11 
ATOM 10486 H H    . ARG A 1 11 ? 2.311   -6.342  1.584   1.00 0.00 ? 11 ARG A H    11 
ATOM 10487 H HA   . ARG A 1 11 ? 3.835   -5.251  3.819   1.00 0.00 ? 11 ARG A HA   11 
ATOM 10488 H HB2  . ARG A 1 11 ? 4.298   -7.538  4.169   1.00 0.00 ? 11 ARG A HB2  11 
ATOM 10489 H HB3  . ARG A 1 11 ? 4.431   -7.860  2.445   1.00 0.00 ? 11 ARG A HB3  11 
ATOM 10490 H HG2  . ARG A 1 11 ? 6.550   -6.923  2.305   1.00 0.00 ? 11 ARG A HG2  11 
ATOM 10491 H HG3  . ARG A 1 11 ? 6.355   -6.021  3.808   1.00 0.00 ? 11 ARG A HG3  11 
ATOM 10492 H HD2  . ARG A 1 11 ? 6.775   -7.862  5.125   1.00 0.00 ? 11 ARG A HD2  11 
ATOM 10493 H HD3  . ARG A 1 11 ? 6.263   -9.000  3.880   1.00 0.00 ? 11 ARG A HD3  11 
ATOM 10494 H HE   . ARG A 1 11 ? 8.895   -8.065  4.329   1.00 0.00 ? 11 ARG A HE   11 
ATOM 10495 H HH11 . ARG A 1 11 ? 6.682   -8.901  1.775   1.00 0.00 ? 11 ARG A HH11 11 
ATOM 10496 H HH12 . ARG A 1 11 ? 7.932   -9.340  0.658   1.00 0.00 ? 11 ARG A HH12 11 
ATOM 10497 H HH21 . ARG A 1 11 ? 10.550  -8.640  2.868   1.00 0.00 ? 11 ARG A HH21 11 
ATOM 10498 H HH22 . ARG A 1 11 ? 10.132  -9.192  1.281   1.00 0.00 ? 11 ARG A HH22 11 
ATOM 10499 N N    . ALA A 1 12 ? 5.244   -3.974  2.228   1.00 0.00 ? 12 ALA A N    11 
ATOM 10500 C CA   . ALA A 1 12 ? 5.972   -3.134  1.286   1.00 0.00 ? 12 ALA A CA   11 
ATOM 10501 C C    . ALA A 1 12 ? 7.332   -3.737  0.951   1.00 0.00 ? 12 ALA A C    11 
ATOM 10502 O O    . ALA A 1 12 ? 8.248   -3.719  1.773   1.00 0.00 ? 12 ALA A O    11 
ATOM 10503 C CB   . ALA A 1 12 ? 6.139   -1.730  1.848   1.00 0.00 ? 12 ALA A CB   11 
ATOM 10504 H H    . ALA A 1 12 ? 5.233   -3.729  3.177   1.00 0.00 ? 12 ALA A H    11 
ATOM 10505 H HA   . ALA A 1 12 ? 5.388   -3.065  0.379   1.00 0.00 ? 12 ALA A HA   11 
ATOM 10506 H HB1  . ALA A 1 12 ? 5.894   -1.734  2.901   1.00 0.00 ? 12 ALA A HB1  11 
ATOM 10507 H HB2  . ALA A 1 12 ? 7.161   -1.409  1.717   1.00 0.00 ? 12 ALA A HB2  11 
ATOM 10508 H HB3  . ALA A 1 12 ? 5.479   -1.053  1.328   1.00 0.00 ? 12 ALA A HB3  11 
ATOM 10509 N N    . MET A 1 13 ? 7.456   -4.271  -0.260  1.00 0.00 ? 13 MET A N    11 
ATOM 10510 C CA   . MET A 1 13 ? 8.706   -4.879  -0.702  1.00 0.00 ? 13 MET A CA   11 
ATOM 10511 C C    . MET A 1 13 ? 9.815   -3.836  -0.794  1.00 0.00 ? 13 MET A C    11 
ATOM 10512 O O    . MET A 1 13 ? 10.993  -4.152  -0.621  1.00 0.00 ? 13 MET A O    11 
ATOM 10513 C CB   . MET A 1 13 ? 8.515   -5.559  -2.059  1.00 0.00 ? 13 MET A CB   11 
ATOM 10514 C CG   . MET A 1 13 ? 7.355   -6.541  -2.089  1.00 0.00 ? 13 MET A CG   11 
ATOM 10515 S SD   . MET A 1 13 ? 7.541   -7.796  -3.371  1.00 0.00 ? 13 MET A SD   11 
ATOM 10516 C CE   . MET A 1 13 ? 6.927   -6.911  -4.802  1.00 0.00 ? 13 MET A CE   11 
ATOM 10517 H H    . MET A 1 13 ? 6.690   -4.255  -0.871  1.00 0.00 ? 13 MET A H    11 
ATOM 10518 H HA   . MET A 1 13 ? 8.988   -5.624  0.027   1.00 0.00 ? 13 MET A HA   11 
ATOM 10519 H HB2  . MET A 1 13 ? 8.334   -4.800  -2.806  1.00 0.00 ? 13 MET A HB2  11 
ATOM 10520 H HB3  . MET A 1 13 ? 9.418   -6.094  -2.312  1.00 0.00 ? 13 MET A HB3  11 
ATOM 10521 H HG2  . MET A 1 13 ? 7.293   -7.034  -1.130  1.00 0.00 ? 13 MET A HG2  11 
ATOM 10522 H HG3  . MET A 1 13 ? 6.442   -5.994  -2.269  1.00 0.00 ? 13 MET A HG3  11 
ATOM 10523 H HE1  . MET A 1 13 ? 7.031   -7.530  -5.680  1.00 0.00 ? 13 MET A HE1  11 
ATOM 10524 H HE2  . MET A 1 13 ? 5.885   -6.667  -4.654  1.00 0.00 ? 13 MET A HE2  11 
ATOM 10525 H HE3  . MET A 1 13 ? 7.495   -6.001  -4.933  1.00 0.00 ? 13 MET A HE3  11 
ATOM 10526 N N    . TYR A 1 14 ? 9.432   -2.594  -1.069  1.00 0.00 ? 14 TYR A N    11 
ATOM 10527 C CA   . TYR A 1 14 ? 10.395  -1.506  -1.187  1.00 0.00 ? 14 TYR A CA   11 
ATOM 10528 C C    . TYR A 1 14 ? 9.834   -0.216  -0.597  1.00 0.00 ? 14 TYR A C    11 
ATOM 10529 O O    . TYR A 1 14 ? 8.639   0.058   -0.700  1.00 0.00 ? 14 TYR A O    11 
ATOM 10530 C CB   . TYR A 1 14 ? 10.773  -1.287  -2.653  1.00 0.00 ? 14 TYR A CB   11 
ATOM 10531 C CG   . TYR A 1 14 ? 10.828  -2.564  -3.460  1.00 0.00 ? 14 TYR A CG   11 
ATOM 10532 C CD1  . TYR A 1 14 ? 11.851  -3.486  -3.270  1.00 0.00 ? 14 TYR A CD1  11 
ATOM 10533 C CD2  . TYR A 1 14 ? 9.859   -2.849  -4.414  1.00 0.00 ? 14 TYR A CD2  11 
ATOM 10534 C CE1  . TYR A 1 14 ? 11.906  -4.653  -4.006  1.00 0.00 ? 14 TYR A CE1  11 
ATOM 10535 C CE2  . TYR A 1 14 ? 9.906   -4.015  -5.154  1.00 0.00 ? 14 TYR A CE2  11 
ATOM 10536 C CZ   . TYR A 1 14 ? 10.931  -4.914  -4.947  1.00 0.00 ? 14 TYR A CZ   11 
ATOM 10537 O OH   . TYR A 1 14 ? 10.982  -6.076  -5.682  1.00 0.00 ? 14 TYR A OH   11 
ATOM 10538 H H    . TYR A 1 14 ? 8.479   -2.405  -1.197  1.00 0.00 ? 14 TYR A H    11 
ATOM 10539 H HA   . TYR A 1 14 ? 11.281  -1.785  -0.635  1.00 0.00 ? 14 TYR A HA   11 
ATOM 10540 H HB2  . TYR A 1 14 ? 10.044  -0.637  -3.112  1.00 0.00 ? 14 TYR A HB2  11 
ATOM 10541 H HB3  . TYR A 1 14 ? 11.746  -0.821  -2.701  1.00 0.00 ? 14 TYR A HB3  11 
ATOM 10542 H HD1  . TYR A 1 14 ? 12.613  -3.279  -2.533  1.00 0.00 ? 14 TYR A HD1  11 
ATOM 10543 H HD2  . TYR A 1 14 ? 9.057   -2.143  -4.575  1.00 0.00 ? 14 TYR A HD2  11 
ATOM 10544 H HE1  . TYR A 1 14 ? 12.709  -5.358  -3.844  1.00 0.00 ? 14 TYR A HE1  11 
ATOM 10545 H HE2  . TYR A 1 14 ? 9.143   -4.219  -5.891  1.00 0.00 ? 14 TYR A HE2  11 
ATOM 10546 H HH   . TYR A 1 14 ? 10.169  -6.172  -6.184  1.00 0.00 ? 14 TYR A HH   11 
ATOM 10547 N N    . GLN A 1 15 ? 10.707  0.573   0.022   1.00 0.00 ? 15 GLN A N    11 
ATOM 10548 C CA   . GLN A 1 15 ? 10.300  1.834   0.629   1.00 0.00 ? 15 GLN A CA   11 
ATOM 10549 C C    . GLN A 1 15 ? 9.842   2.827   -0.434  1.00 0.00 ? 15 GLN A C    11 
ATOM 10550 O O    . GLN A 1 15 ? 10.405  2.885   -1.527  1.00 0.00 ? 15 GLN A O    11 
ATOM 10551 C CB   . GLN A 1 15 ? 11.452  2.431   1.439   1.00 0.00 ? 15 GLN A CB   11 
ATOM 10552 C CG   . GLN A 1 15 ? 11.092  3.727   2.146   1.00 0.00 ? 15 GLN A CG   11 
ATOM 10553 C CD   . GLN A 1 15 ? 12.288  4.636   2.344   1.00 0.00 ? 15 GLN A CD   11 
ATOM 10554 O OE1  . GLN A 1 15 ? 12.713  5.333   1.422   1.00 0.00 ? 15 GLN A OE1  11 
ATOM 10555 N NE2  . GLN A 1 15 ? 12.841  4.634   3.552   1.00 0.00 ? 15 GLN A NE2  11 
ATOM 10556 H H    . GLN A 1 15 ? 11.646  0.300   0.072   1.00 0.00 ? 15 GLN A H    11 
ATOM 10557 H HA   . GLN A 1 15 ? 9.473   1.631   1.293   1.00 0.00 ? 15 GLN A HA   11 
ATOM 10558 H HB2  . GLN A 1 15 ? 11.763  1.713   2.184   1.00 0.00 ? 15 GLN A HB2  11 
ATOM 10559 H HB3  . GLN A 1 15 ? 12.280  2.628   0.773   1.00 0.00 ? 15 GLN A HB3  11 
ATOM 10560 H HG2  . GLN A 1 15 ? 10.355  4.252   1.556   1.00 0.00 ? 15 GLN A HG2  11 
ATOM 10561 H HG3  . GLN A 1 15 ? 10.674  3.490   3.114   1.00 0.00 ? 15 GLN A HG3  11 
ATOM 10562 H HE21 . GLN A 1 15 ? 12.450  4.053   4.238   1.00 0.00 ? 15 GLN A HE21 11 
ATOM 10563 H HE22 . GLN A 1 15 ? 13.616  5.212   3.708   1.00 0.00 ? 15 GLN A HE22 11 
ATOM 10564 N N    . TYR A 1 16 ? 8.818   3.607   -0.106  1.00 0.00 ? 16 TYR A N    11 
ATOM 10565 C CA   . TYR A 1 16 ? 8.283   4.596   -1.034  1.00 0.00 ? 16 TYR A CA   11 
ATOM 10566 C C    . TYR A 1 16 ? 8.471   6.010   -0.492  1.00 0.00 ? 16 TYR A C    11 
ATOM 10567 O O    . TYR A 1 16 ? 8.364   6.244   0.712   1.00 0.00 ? 16 TYR A O    11 
ATOM 10568 C CB   . TYR A 1 16 ? 6.799   4.331   -1.295  1.00 0.00 ? 16 TYR A CB   11 
ATOM 10569 C CG   . TYR A 1 16 ? 6.175   5.298   -2.276  1.00 0.00 ? 16 TYR A CG   11 
ATOM 10570 C CD1  . TYR A 1 16 ? 6.395   5.172   -3.642  1.00 0.00 ? 16 TYR A CD1  11 
ATOM 10571 C CD2  . TYR A 1 16 ? 5.363   6.336   -1.836  1.00 0.00 ? 16 TYR A CD2  11 
ATOM 10572 C CE1  . TYR A 1 16 ? 5.827   6.054   -4.541  1.00 0.00 ? 16 TYR A CE1  11 
ATOM 10573 C CE2  . TYR A 1 16 ? 4.789   7.222   -2.729  1.00 0.00 ? 16 TYR A CE2  11 
ATOM 10574 C CZ   . TYR A 1 16 ? 5.025   7.076   -4.080  1.00 0.00 ? 16 TYR A CZ   11 
ATOM 10575 O OH   . TYR A 1 16 ? 4.456   7.956   -4.973  1.00 0.00 ? 16 TYR A OH   11 
ATOM 10576 H H    . TYR A 1 16 ? 8.411   3.515   0.780   1.00 0.00 ? 16 TYR A H    11 
ATOM 10577 H HA   . TYR A 1 16 ? 8.824   4.505   -1.965  1.00 0.00 ? 16 TYR A HA   11 
ATOM 10578 H HB2  . TYR A 1 16 ? 6.683   3.335   -1.693  1.00 0.00 ? 16 TYR A HB2  11 
ATOM 10579 H HB3  . TYR A 1 16 ? 6.257   4.407   -0.364  1.00 0.00 ? 16 TYR A HB3  11 
ATOM 10580 H HD1  . TYR A 1 16 ? 7.024   4.370   -4.000  1.00 0.00 ? 16 TYR A HD1  11 
ATOM 10581 H HD2  . TYR A 1 16 ? 5.180   6.448   -0.777  1.00 0.00 ? 16 TYR A HD2  11 
ATOM 10582 H HE1  . TYR A 1 16 ? 6.011   5.940   -5.599  1.00 0.00 ? 16 TYR A HE1  11 
ATOM 10583 H HE2  . TYR A 1 16 ? 4.161   8.023   -2.368  1.00 0.00 ? 16 TYR A HE2  11 
ATOM 10584 H HH   . TYR A 1 16 ? 5.140   8.326   -5.536  1.00 0.00 ? 16 TYR A HH   11 
ATOM 10585 N N    . ARG A 1 17 ? 8.751   6.949   -1.390  1.00 0.00 ? 17 ARG A N    11 
ATOM 10586 C CA   . ARG A 1 17 ? 8.954   8.340   -1.003  1.00 0.00 ? 17 ARG A CA   11 
ATOM 10587 C C    . ARG A 1 17 ? 7.861   9.231   -1.585  1.00 0.00 ? 17 ARG A C    11 
ATOM 10588 O O    . ARG A 1 17 ? 8.001   9.801   -2.668  1.00 0.00 ? 17 ARG A O    11 
ATOM 10589 C CB   . ARG A 1 17 ? 10.327  8.826   -1.472  1.00 0.00 ? 17 ARG A CB   11 
ATOM 10590 C CG   . ARG A 1 17 ? 11.483  8.244   -0.676  1.00 0.00 ? 17 ARG A CG   11 
ATOM 10591 C CD   . ARG A 1 17 ? 12.663  9.202   -0.624  1.00 0.00 ? 17 ARG A CD   11 
ATOM 10592 N NE   . ARG A 1 17 ? 13.752  8.687   0.201   1.00 0.00 ? 17 ARG A NE   11 
ATOM 10593 C CZ   . ARG A 1 17 ? 14.575  7.720   -0.188  1.00 0.00 ? 17 ARG A CZ   11 
ATOM 10594 N NH1  . ARG A 1 17 ? 14.435  7.167   -1.384  1.00 0.00 ? 17 ARG A NH1  11 
ATOM 10595 N NH2  . ARG A 1 17 ? 15.542  7.305   0.621   1.00 0.00 ? 17 ARG A NH2  11 
ATOM 10596 H H    . ARG A 1 17 ? 8.823   6.700   -2.335  1.00 0.00 ? 17 ARG A H    11 
ATOM 10597 H HA   . ARG A 1 17 ? 8.911   8.394   0.074   1.00 0.00 ? 17 ARG A HA   11 
ATOM 10598 H HB2  . ARG A 1 17 ? 10.459  8.552   -2.508  1.00 0.00 ? 17 ARG A HB2  11 
ATOM 10599 H HB3  . ARG A 1 17 ? 10.363  9.901   -1.385  1.00 0.00 ? 17 ARG A HB3  11 
ATOM 10600 H HG2  . ARG A 1 17 ? 11.151  8.046   0.333   1.00 0.00 ? 17 ARG A HG2  11 
ATOM 10601 H HG3  . ARG A 1 17 ? 11.800  7.322   -1.140  1.00 0.00 ? 17 ARG A HG3  11 
ATOM 10602 H HD2  . ARG A 1 17 ? 13.028  9.357   -1.629  1.00 0.00 ? 17 ARG A HD2  11 
ATOM 10603 H HD3  . ARG A 1 17 ? 12.327  10.143  -0.215  1.00 0.00 ? 17 ARG A HD3  11 
ATOM 10604 H HE   . ARG A 1 17 ? 13.873  9.082   1.090   1.00 0.00 ? 17 ARG A HE   11 
ATOM 10605 H HH11 . ARG A 1 17 ? 13.707  7.478   -1.996  1.00 0.00 ? 17 ARG A HH11 11 
ATOM 10606 H HH12 . ARG A 1 17 ? 15.057  6.440   -1.675  1.00 0.00 ? 17 ARG A HH12 11 
ATOM 10607 H HH21 . ARG A 1 17 ? 15.651  7.720   1.523   1.00 0.00 ? 17 ARG A HH21 11 
ATOM 10608 H HH22 . ARG A 1 17 ? 16.161  6.578   0.327   1.00 0.00 ? 17 ARG A HH22 11 
ATOM 10609 N N    . PRO A 1 18 ? 6.746   9.356   -0.851  1.00 0.00 ? 18 PRO A N    11 
ATOM 10610 C CA   . PRO A 1 18 ? 5.607   10.177  -1.274  1.00 0.00 ? 18 PRO A CA   11 
ATOM 10611 C C    . PRO A 1 18 ? 5.920   11.668  -1.231  1.00 0.00 ? 18 PRO A C    11 
ATOM 10612 O O    . PRO A 1 18 ? 6.229   12.216  -0.173  1.00 0.00 ? 18 PRO A O    11 
ATOM 10613 C CB   . PRO A 1 18 ? 4.520   9.828   -0.254  1.00 0.00 ? 18 PRO A CB   11 
ATOM 10614 C CG   . PRO A 1 18 ? 5.265   9.380   0.955   1.00 0.00 ? 18 PRO A CG   11 
ATOM 10615 C CD   . PRO A 1 18 ? 6.510   8.706   0.449   1.00 0.00 ? 18 PRO A CD   11 
ATOM 10616 H HA   . PRO A 1 18 ? 5.272   9.909   -2.266  1.00 0.00 ? 18 PRO A HA   11 
ATOM 10617 H HB2  . PRO A 1 18 ? 3.921   10.704  -0.049  1.00 0.00 ? 18 PRO A HB2  11 
ATOM 10618 H HB3  . PRO A 1 18 ? 3.893   9.041   -0.645  1.00 0.00 ? 18 PRO A HB3  11 
ATOM 10619 H HG2  . PRO A 1 18 ? 5.523   10.233  1.565   1.00 0.00 ? 18 PRO A HG2  11 
ATOM 10620 H HG3  . PRO A 1 18 ? 4.664   8.682   1.519   1.00 0.00 ? 18 PRO A HG3  11 
ATOM 10621 H HD2  . PRO A 1 18 ? 7.335   8.881   1.123   1.00 0.00 ? 18 PRO A HD2  11 
ATOM 10622 H HD3  . PRO A 1 18 ? 6.341   7.646   0.324   1.00 0.00 ? 18 PRO A HD3  11 
ATOM 10623 N N    . GLN A 1 19 ? 5.837   12.320  -2.386  1.00 0.00 ? 19 GLN A N    11 
ATOM 10624 C CA   . GLN A 1 19 ? 6.111   13.749  -2.479  1.00 0.00 ? 19 GLN A CA   11 
ATOM 10625 C C    . GLN A 1 19 ? 5.098   14.551  -1.670  1.00 0.00 ? 19 GLN A C    11 
ATOM 10626 O O    . GLN A 1 19 ? 5.429   15.587  -1.095  1.00 0.00 ? 19 GLN A O    11 
ATOM 10627 C CB   . GLN A 1 19 ? 6.088   14.200  -3.940  1.00 0.00 ? 19 GLN A CB   11 
ATOM 10628 C CG   . GLN A 1 19 ? 7.031   13.413  -4.835  1.00 0.00 ? 19 GLN A CG   11 
ATOM 10629 C CD   . GLN A 1 19 ? 6.598   13.420  -6.288  1.00 0.00 ? 19 GLN A CD   11 
ATOM 10630 O OE1  . GLN A 1 19 ? 6.505   14.475  -6.916  1.00 0.00 ? 19 GLN A OE1  11 
ATOM 10631 N NE2  . GLN A 1 19 ? 6.331   12.238  -6.832  1.00 0.00 ? 19 GLN A NE2  11 
ATOM 10632 H H    . GLN A 1 19 ? 5.585   11.828  -3.195  1.00 0.00 ? 19 GLN A H    11 
ATOM 10633 H HA   . GLN A 1 19 ? 7.096   13.923  -2.073  1.00 0.00 ? 19 GLN A HA   11 
ATOM 10634 H HB2  . GLN A 1 19 ? 5.085   14.089  -4.323  1.00 0.00 ? 19 GLN A HB2  11 
ATOM 10635 H HB3  . GLN A 1 19 ? 6.369   15.242  -3.987  1.00 0.00 ? 19 GLN A HB3  11 
ATOM 10636 H HG2  . GLN A 1 19 ? 8.018   13.848  -4.768  1.00 0.00 ? 19 GLN A HG2  11 
ATOM 10637 H HG3  . GLN A 1 19 ? 7.065   12.391  -4.489  1.00 0.00 ? 19 GLN A HG3  11 
ATOM 10638 H HE21 . GLN A 1 19 ? 6.425   11.439  -6.271  1.00 0.00 ? 19 GLN A HE21 11 
ATOM 10639 H HE22 . GLN A 1 19 ? 6.048   12.213  -7.769  1.00 0.00 ? 19 GLN A HE22 11 
ATOM 10640 N N    . ASN A 1 20 ? 3.861   14.065  -1.630  1.00 0.00 ? 20 ASN A N    11 
ATOM 10641 C CA   . ASN A 1 20 ? 2.799   14.738  -0.892  1.00 0.00 ? 20 ASN A CA   11 
ATOM 10642 C C    . ASN A 1 20 ? 2.284   13.859  0.243   1.00 0.00 ? 20 ASN A C    11 
ATOM 10643 O O    . ASN A 1 20 ? 2.574   12.664  0.296   1.00 0.00 ? 20 ASN A O    11 
ATOM 10644 C CB   . ASN A 1 20 ? 1.648   15.102  -1.832  1.00 0.00 ? 20 ASN A CB   11 
ATOM 10645 C CG   . ASN A 1 20 ? 1.262   13.954  -2.745  1.00 0.00 ? 20 ASN A CG   11 
ATOM 10646 O OD1  . ASN A 1 20 ? 2.109   13.159  -3.152  1.00 0.00 ? 20 ASN A OD1  11 
ATOM 10647 N ND2  . ASN A 1 20 ? -0.022  13.864  -3.072  1.00 0.00 ? 20 ASN A ND2  11 
ATOM 10648 H H    . ASN A 1 20 ? 3.659   13.234  -2.109  1.00 0.00 ? 20 ASN A H    11 
ATOM 10649 H HA   . ASN A 1 20 ? 3.209   15.644  -0.473  1.00 0.00 ? 20 ASN A HA   11 
ATOM 10650 H HB2  . ASN A 1 20 ? 0.784   15.375  -1.245  1.00 0.00 ? 20 ASN A HB2  11 
ATOM 10651 H HB3  . ASN A 1 20 ? 1.942   15.942  -2.444  1.00 0.00 ? 20 ASN A HB3  11 
ATOM 10652 H HD21 . ASN A 1 20 ? -0.640  14.534  -2.710  1.00 0.00 ? 20 ASN A HD21 11 
ATOM 10653 H HD22 . ASN A 1 20 ? -0.299  13.131  -3.660  1.00 0.00 ? 20 ASN A HD22 11 
ATOM 10654 N N    . GLU A 1 21 ? 1.518   14.459  1.149   1.00 0.00 ? 21 GLU A N    11 
ATOM 10655 C CA   . GLU A 1 21 ? 0.963   13.730  2.283   1.00 0.00 ? 21 GLU A CA   11 
ATOM 10656 C C    . GLU A 1 21 ? -0.106  12.742  1.824   1.00 0.00 ? 21 GLU A C    11 
ATOM 10657 O O    . GLU A 1 21 ? -0.191  11.623  2.331   1.00 0.00 ? 21 GLU A O    11 
ATOM 10658 C CB   . GLU A 1 21 ? 0.368   14.704  3.302   1.00 0.00 ? 21 GLU A CB   11 
ATOM 10659 C CG   . GLU A 1 21 ? -0.718  15.598  2.728   1.00 0.00 ? 21 GLU A CG   11 
ATOM 10660 C CD   . GLU A 1 21 ? -1.268  16.576  3.748   1.00 0.00 ? 21 GLU A CD   11 
ATOM 10661 O OE1  . GLU A 1 21 ? -0.487  17.409  4.253   1.00 0.00 ? 21 GLU A OE1  11 
ATOM 10662 O OE2  . GLU A 1 21 ? -2.480  16.509  4.041   1.00 0.00 ? 21 GLU A OE2  11 
ATOM 10663 H H    . GLU A 1 21 ? 1.322   15.414  1.052   1.00 0.00 ? 21 GLU A H    11 
ATOM 10664 H HA   . GLU A 1 21 ? 1.766   13.181  2.750   1.00 0.00 ? 21 GLU A HA   11 
ATOM 10665 H HB2  . GLU A 1 21 ? -0.054  14.138  4.120   1.00 0.00 ? 21 GLU A HB2  11 
ATOM 10666 H HB3  . GLU A 1 21 ? 1.159   15.334  3.683   1.00 0.00 ? 21 GLU A HB3  11 
ATOM 10667 H HG2  . GLU A 1 21 ? -0.307  16.157  1.901   1.00 0.00 ? 21 GLU A HG2  11 
ATOM 10668 H HG3  . GLU A 1 21 ? -1.528  14.977  2.374   1.00 0.00 ? 21 GLU A HG3  11 
ATOM 10669 N N    . ASP A 1 22 ? -0.920  13.164  0.863   1.00 0.00 ? 22 ASP A N    11 
ATOM 10670 C CA   . ASP A 1 22 ? -1.984  12.317  0.335   1.00 0.00 ? 22 ASP A CA   11 
ATOM 10671 C C    . ASP A 1 22 ? -1.494  10.885  0.146   1.00 0.00 ? 22 ASP A C    11 
ATOM 10672 O O    . ASP A 1 22 ? -2.151  9.934   0.569   1.00 0.00 ? 22 ASP A O    11 
ATOM 10673 C CB   . ASP A 1 22 ? -2.495  12.874  -0.995  1.00 0.00 ? 22 ASP A CB   11 
ATOM 10674 C CG   . ASP A 1 22 ? -2.967  14.310  -0.878  1.00 0.00 ? 22 ASP A CG   11 
ATOM 10675 O OD1  . ASP A 1 22 ? -2.107  15.210  -0.764  1.00 0.00 ? 22 ASP A OD1  11 
ATOM 10676 O OD2  . ASP A 1 22 ? -4.195  14.535  -0.901  1.00 0.00 ? 22 ASP A OD2  11 
ATOM 10677 H H    . ASP A 1 22 ? -0.802  14.067  0.499   1.00 0.00 ? 22 ASP A H    11 
ATOM 10678 H HA   . ASP A 1 22 ? -2.793  12.317  1.050   1.00 0.00 ? 22 ASP A HA   11 
ATOM 10679 H HB2  . ASP A 1 22 ? -1.699  12.834  -1.724  1.00 0.00 ? 22 ASP A HB2  11 
ATOM 10680 H HB3  . ASP A 1 22 ? -3.322  12.269  -1.336  1.00 0.00 ? 22 ASP A HB3  11 
ATOM 10681 N N    . GLU A 1 23 ? -0.338  10.739  -0.493  1.00 0.00 ? 23 GLU A N    11 
ATOM 10682 C CA   . GLU A 1 23 ? 0.238   9.422   -0.739  1.00 0.00 ? 23 GLU A CA   11 
ATOM 10683 C C    . GLU A 1 23 ? 0.763   8.808   0.555   1.00 0.00 ? 23 GLU A C    11 
ATOM 10684 O O    . GLU A 1 23 ? 1.334   9.501   1.398   1.00 0.00 ? 23 GLU A O    11 
ATOM 10685 C CB   . GLU A 1 23 ? 1.368   9.518   -1.766  1.00 0.00 ? 23 GLU A CB   11 
ATOM 10686 C CG   . GLU A 1 23 ? 0.958   10.204  -3.059  1.00 0.00 ? 23 GLU A CG   11 
ATOM 10687 C CD   . GLU A 1 23 ? 2.055   10.179  -4.105  1.00 0.00 ? 23 GLU A CD   11 
ATOM 10688 O OE1  . GLU A 1 23 ? 3.089   10.847  -3.896  1.00 0.00 ? 23 GLU A OE1  11 
ATOM 10689 O OE2  . GLU A 1 23 ? 1.880   9.491   -5.133  1.00 0.00 ? 23 GLU A OE2  11 
ATOM 10690 H H    . GLU A 1 23 ? 0.140   11.536  -0.806  1.00 0.00 ? 23 GLU A H    11 
ATOM 10691 H HA   . GLU A 1 23 ? -0.542  8.788   -1.133  1.00 0.00 ? 23 GLU A HA   11 
ATOM 10692 H HB2  . GLU A 1 23 ? 2.186   10.073  -1.332  1.00 0.00 ? 23 GLU A HB2  11 
ATOM 10693 H HB3  . GLU A 1 23 ? 1.707   8.521   -2.004  1.00 0.00 ? 23 GLU A HB3  11 
ATOM 10694 H HG2  . GLU A 1 23 ? 0.090   9.701   -3.458  1.00 0.00 ? 23 GLU A HG2  11 
ATOM 10695 H HG3  . GLU A 1 23 ? 0.710   11.232  -2.843  1.00 0.00 ? 23 GLU A HG3  11 
ATOM 10696 N N    . LEU A 1 24 ? 0.566   7.503   0.706   1.00 0.00 ? 24 LEU A N    11 
ATOM 10697 C CA   . LEU A 1 24 ? 1.019   6.793   1.898   1.00 0.00 ? 24 LEU A CA   11 
ATOM 10698 C C    . LEU A 1 24 ? 2.461   6.324   1.736   1.00 0.00 ? 24 LEU A C    11 
ATOM 10699 O O    . LEU A 1 24 ? 2.796   5.637   0.772   1.00 0.00 ? 24 LEU A O    11 
ATOM 10700 C CB   . LEU A 1 24 ? 0.110   5.596   2.179   1.00 0.00 ? 24 LEU A CB   11 
ATOM 10701 C CG   . LEU A 1 24 ? 0.150   5.042   3.604   1.00 0.00 ? 24 LEU A CG   11 
ATOM 10702 C CD1  . LEU A 1 24 ? -0.476  6.029   4.577   1.00 0.00 ? 24 LEU A CD1  11 
ATOM 10703 C CD2  . LEU A 1 24 ? -0.561  3.698   3.674   1.00 0.00 ? 24 LEU A CD2  11 
ATOM 10704 H H    . LEU A 1 24 ? 0.105   7.003   0.001   1.00 0.00 ? 24 LEU A H    11 
ATOM 10705 H HA   . LEU A 1 24 ? 0.967   7.478   2.731   1.00 0.00 ? 24 LEU A HA   11 
ATOM 10706 H HB2  . LEU A 1 24 ? -0.906  5.895   1.969   1.00 0.00 ? 24 LEU A HB2  11 
ATOM 10707 H HB3  . LEU A 1 24 ? 0.395   4.800   1.505   1.00 0.00 ? 24 LEU A HB3  11 
ATOM 10708 H HG   . LEU A 1 24 ? 1.180   4.893   3.896   1.00 0.00 ? 24 LEU A HG   11 
ATOM 10709 H HD11 . LEU A 1 24 ? 0.032   6.979   4.503   1.00 0.00 ? 24 LEU A HD11 11 
ATOM 10710 H HD12 . LEU A 1 24 ? -0.384  5.649   5.584   1.00 0.00 ? 24 LEU A HD12 11 
ATOM 10711 H HD13 . LEU A 1 24 ? -1.521  6.159   4.336   1.00 0.00 ? 24 LEU A HD13 11 
ATOM 10712 H HD21 . LEU A 1 24 ? -1.412  3.776   4.334   1.00 0.00 ? 24 LEU A HD21 11 
ATOM 10713 H HD22 . LEU A 1 24 ? 0.121   2.950   4.053   1.00 0.00 ? 24 LEU A HD22 11 
ATOM 10714 H HD23 . LEU A 1 24 ? -0.894  3.415   2.687   1.00 0.00 ? 24 LEU A HD23 11 
ATOM 10715 N N    . GLU A 1 25 ? 3.310   6.698   2.689   1.00 0.00 ? 25 GLU A N    11 
ATOM 10716 C CA   . GLU A 1 25 ? 4.716   6.313   2.652   1.00 0.00 ? 25 GLU A CA   11 
ATOM 10717 C C    . GLU A 1 25 ? 4.886   4.839   3.005   1.00 0.00 ? 25 GLU A C    11 
ATOM 10718 O O    . GLU A 1 25 ? 4.179   4.308   3.862   1.00 0.00 ? 25 GLU A O    11 
ATOM 10719 C CB   . GLU A 1 25 ? 5.529   7.178   3.618   1.00 0.00 ? 25 GLU A CB   11 
ATOM 10720 C CG   . GLU A 1 25 ? 7.032   6.999   3.477   1.00 0.00 ? 25 GLU A CG   11 
ATOM 10721 C CD   . GLU A 1 25 ? 7.806   7.665   4.598   1.00 0.00 ? 25 GLU A CD   11 
ATOM 10722 O OE1  . GLU A 1 25 ? 7.781   8.911   4.677   1.00 0.00 ? 25 GLU A OE1  11 
ATOM 10723 O OE2  . GLU A 1 25 ? 8.437   6.940   5.396   1.00 0.00 ? 25 GLU A OE2  11 
ATOM 10724 H H    . GLU A 1 25 ? 2.983   7.245   3.433   1.00 0.00 ? 25 GLU A H    11 
ATOM 10725 H HA   . GLU A 1 25 ? 5.078   6.475   1.648   1.00 0.00 ? 25 GLU A HA   11 
ATOM 10726 H HB2  . GLU A 1 25 ? 5.292   8.216   3.440   1.00 0.00 ? 25 GLU A HB2  11 
ATOM 10727 H HB3  . GLU A 1 25 ? 5.251   6.923   4.630   1.00 0.00 ? 25 GLU A HB3  11 
ATOM 10728 H HG2  . GLU A 1 25 ? 7.258   5.943   3.482   1.00 0.00 ? 25 GLU A HG2  11 
ATOM 10729 H HG3  . GLU A 1 25 ? 7.346   7.429   2.538   1.00 0.00 ? 25 GLU A HG3  11 
ATOM 10730 N N    . LEU A 1 26 ? 5.830   4.182   2.339   1.00 0.00 ? 26 LEU A N    11 
ATOM 10731 C CA   . LEU A 1 26 ? 6.094   2.768   2.581   1.00 0.00 ? 26 LEU A CA   11 
ATOM 10732 C C    . LEU A 1 26 ? 7.554   2.544   2.961   1.00 0.00 ? 26 LEU A C    11 
ATOM 10733 O O    . LEU A 1 26 ? 8.424   3.348   2.624   1.00 0.00 ? 26 LEU A O    11 
ATOM 10734 C CB   . LEU A 1 26 ? 5.746   1.944   1.339   1.00 0.00 ? 26 LEU A CB   11 
ATOM 10735 C CG   . LEU A 1 26 ? 4.281   1.974   0.903   1.00 0.00 ? 26 LEU A CG   11 
ATOM 10736 C CD1  . LEU A 1 26 ? 4.123   1.358   -0.479  1.00 0.00 ? 26 LEU A CD1  11 
ATOM 10737 C CD2  . LEU A 1 26 ? 3.408   1.249   1.916   1.00 0.00 ? 26 LEU A CD2  11 
ATOM 10738 H H    . LEU A 1 26 ? 6.361   4.658   1.668   1.00 0.00 ? 26 LEU A H    11 
ATOM 10739 H HA   . LEU A 1 26 ? 5.468   2.450   3.401   1.00 0.00 ? 26 LEU A HA   11 
ATOM 10740 H HB2  . LEU A 1 26 ? 6.343   2.314   0.520   1.00 0.00 ? 26 LEU A HB2  11 
ATOM 10741 H HB3  . LEU A 1 26 ? 6.012   0.916   1.541   1.00 0.00 ? 26 LEU A HB3  11 
ATOM 10742 H HG   . LEU A 1 26 ? 3.949   3.002   0.849   1.00 0.00 ? 26 LEU A HG   11 
ATOM 10743 H HD11 . LEU A 1 26 ? 4.381   0.310   -0.437  1.00 0.00 ? 26 LEU A HD11 11 
ATOM 10744 H HD12 . LEU A 1 26 ? 4.777   1.862   -1.175  1.00 0.00 ? 26 LEU A HD12 11 
ATOM 10745 H HD13 . LEU A 1 26 ? 3.099   1.464   -0.805  1.00 0.00 ? 26 LEU A HD13 11 
ATOM 10746 H HD21 . LEU A 1 26 ? 2.751   1.958   2.397   1.00 0.00 ? 26 LEU A HD21 11 
ATOM 10747 H HD22 . LEU A 1 26 ? 4.035   0.776   2.658   1.00 0.00 ? 26 LEU A HD22 11 
ATOM 10748 H HD23 . LEU A 1 26 ? 2.819   0.498   1.411   1.00 0.00 ? 26 LEU A HD23 11 
ATOM 10749 N N    . ARG A 1 27 ? 7.816   1.446   3.663   1.00 0.00 ? 27 ARG A N    11 
ATOM 10750 C CA   . ARG A 1 27 ? 9.171   1.116   4.088   1.00 0.00 ? 27 ARG A CA   11 
ATOM 10751 C C    . ARG A 1 27 ? 9.464   -0.365  3.868   1.00 0.00 ? 27 ARG A C    11 
ATOM 10752 O O    . ARG A 1 27 ? 8.665   -1.226  4.235   1.00 0.00 ? 27 ARG A O    11 
ATOM 10753 C CB   . ARG A 1 27 ? 9.366   1.472   5.563   1.00 0.00 ? 27 ARG A CB   11 
ATOM 10754 C CG   . ARG A 1 27 ? 10.682  0.976   6.140   1.00 0.00 ? 27 ARG A CG   11 
ATOM 10755 C CD   . ARG A 1 27 ? 11.791  2.000   5.957   1.00 0.00 ? 27 ARG A CD   11 
ATOM 10756 N NE   . ARG A 1 27 ? 11.725  3.063   6.956   1.00 0.00 ? 27 ARG A NE   11 
ATOM 10757 C CZ   . ARG A 1 27 ? 12.653  4.004   7.091   1.00 0.00 ? 27 ARG A CZ   11 
ATOM 10758 N NH1  . ARG A 1 27 ? 13.712  4.014   6.294   1.00 0.00 ? 27 ARG A NH1  11 
ATOM 10759 N NH2  . ARG A 1 27 ? 12.522  4.938   8.024   1.00 0.00 ? 27 ARG A NH2  11 
ATOM 10760 H H    . ARG A 1 27 ? 7.080   0.844   3.901   1.00 0.00 ? 27 ARG A H    11 
ATOM 10761 H HA   . ARG A 1 27 ? 9.857   1.699   3.492   1.00 0.00 ? 27 ARG A HA   11 
ATOM 10762 H HB2  . ARG A 1 27 ? 9.334   2.546   5.669   1.00 0.00 ? 27 ARG A HB2  11 
ATOM 10763 H HB3  . ARG A 1 27 ? 8.561   1.037   6.135   1.00 0.00 ? 27 ARG A HB3  11 
ATOM 10764 H HG2  . ARG A 1 27 ? 10.553  0.787   7.195   1.00 0.00 ? 27 ARG A HG2  11 
ATOM 10765 H HG3  . ARG A 1 27 ? 10.962  0.062   5.639   1.00 0.00 ? 27 ARG A HG3  11 
ATOM 10766 H HD2  . ARG A 1 27 ? 12.744  1.499   6.041   1.00 0.00 ? 27 ARG A HD2  11 
ATOM 10767 H HD3  . ARG A 1 27 ? 11.701  2.437   4.974   1.00 0.00 ? 27 ARG A HD3  11 
ATOM 10768 H HE   . ARG A 1 27 ? 10.951  3.075   7.556   1.00 0.00 ? 27 ARG A HE   11 
ATOM 10769 H HH11 . ARG A 1 27 ? 13.813  3.313   5.589   1.00 0.00 ? 27 ARG A HH11 11 
ATOM 10770 H HH12 . ARG A 1 27 ? 14.409  4.725   6.396   1.00 0.00 ? 27 ARG A HH12 11 
ATOM 10771 H HH21 . ARG A 1 27 ? 11.725  4.934   8.627   1.00 0.00 ? 27 ARG A HH21 11 
ATOM 10772 H HH22 . ARG A 1 27 ? 13.221  5.646   8.125   1.00 0.00 ? 27 ARG A HH22 11 
ATOM 10773 N N    . GLU A 1 28 ? 10.613  -0.653  3.266   1.00 0.00 ? 28 GLU A N    11 
ATOM 10774 C CA   . GLU A 1 28 ? 11.010  -2.030  2.996   1.00 0.00 ? 28 GLU A CA   11 
ATOM 10775 C C    . GLU A 1 28 ? 10.866  -2.892  4.246   1.00 0.00 ? 28 GLU A C    11 
ATOM 10776 O O    . GLU A 1 28 ? 11.646  -2.773  5.190   1.00 0.00 ? 28 GLU A O    11 
ATOM 10777 C CB   . GLU A 1 28 ? 12.455  -2.078  2.494   1.00 0.00 ? 28 GLU A CB   11 
ATOM 10778 C CG   . GLU A 1 28 ? 12.875  -3.446  1.981   1.00 0.00 ? 28 GLU A CG   11 
ATOM 10779 C CD   . GLU A 1 28 ? 14.377  -3.567  1.807   1.00 0.00 ? 28 GLU A CD   11 
ATOM 10780 O OE1  . GLU A 1 28 ? 14.929  -2.874  0.926   1.00 0.00 ? 28 GLU A OE1  11 
ATOM 10781 O OE2  . GLU A 1 28 ? 14.999  -4.354  2.550   1.00 0.00 ? 28 GLU A OE2  11 
ATOM 10782 H H    . GLU A 1 28 ? 11.208  0.078   2.996   1.00 0.00 ? 28 GLU A H    11 
ATOM 10783 H HA   . GLU A 1 28 ? 10.359  -2.418  2.228   1.00 0.00 ? 28 GLU A HA   11 
ATOM 10784 H HB2  . GLU A 1 28 ? 12.568  -1.365  1.691   1.00 0.00 ? 28 GLU A HB2  11 
ATOM 10785 H HB3  . GLU A 1 28 ? 13.114  -1.802  3.303   1.00 0.00 ? 28 GLU A HB3  11 
ATOM 10786 H HG2  . GLU A 1 28 ? 12.549  -4.196  2.686   1.00 0.00 ? 28 GLU A HG2  11 
ATOM 10787 H HG3  . GLU A 1 28 ? 12.401  -3.620  1.027   1.00 0.00 ? 28 GLU A HG3  11 
ATOM 10788 N N    . GLY A 1 29 ? 9.860   -3.763  4.245   1.00 0.00 ? 29 GLY A N    11 
ATOM 10789 C CA   . GLY A 1 29 ? 9.630   -4.633  5.383   1.00 0.00 ? 29 GLY A CA   11 
ATOM 10790 C C    . GLY A 1 29 ? 8.586   -4.080  6.333   1.00 0.00 ? 29 GLY A C    11 
ATOM 10791 O O    . GLY A 1 29 ? 8.705   -4.226  7.550   1.00 0.00 ? 29 GLY A O    11 
ATOM 10792 H H    . GLY A 1 29 ? 9.270   -3.814  3.464   1.00 0.00 ? 29 GLY A H    11 
ATOM 10793 H HA2  . GLY A 1 29 ? 9.303   -5.597  5.025   1.00 0.00 ? 29 GLY A HA2  11 
ATOM 10794 H HA3  . GLY A 1 29 ? 10.559  -4.756  5.921   1.00 0.00 ? 29 GLY A HA3  11 
ATOM 10795 N N    . ASP A 1 30 ? 7.561   -3.443  5.778   1.00 0.00 ? 30 ASP A N    11 
ATOM 10796 C CA   . ASP A 1 30 ? 6.492   -2.867  6.584   1.00 0.00 ? 30 ASP A CA   11 
ATOM 10797 C C    . ASP A 1 30 ? 5.134   -3.420  6.161   1.00 0.00 ? 30 ASP A C    11 
ATOM 10798 O O    . ASP A 1 30 ? 4.894   -3.667  4.980   1.00 0.00 ? 30 ASP A O    11 
ATOM 10799 C CB   . ASP A 1 30 ? 6.496   -1.342  6.460   1.00 0.00 ? 30 ASP A CB   11 
ATOM 10800 C CG   . ASP A 1 30 ? 7.433   -0.683  7.453   1.00 0.00 ? 30 ASP A CG   11 
ATOM 10801 O OD1  . ASP A 1 30 ? 8.458   -1.304  7.805   1.00 0.00 ? 30 ASP A OD1  11 
ATOM 10802 O OD2  . ASP A 1 30 ? 7.142   0.454   7.878   1.00 0.00 ? 30 ASP A OD2  11 
ATOM 10803 H H    . ASP A 1 30 ? 7.523   -3.360  4.802   1.00 0.00 ? 30 ASP A H    11 
ATOM 10804 H HA   . ASP A 1 30 ? 6.671   -3.135  7.614   1.00 0.00 ? 30 ASP A HA   11 
ATOM 10805 H HB2  . ASP A 1 30 ? 6.810   -1.069  5.462   1.00 0.00 ? 30 ASP A HB2  11 
ATOM 10806 H HB3  . ASP A 1 30 ? 5.497   -0.970  6.633   1.00 0.00 ? 30 ASP A HB3  11 
ATOM 10807 N N    . ARG A 1 31 ? 4.251   -3.612  7.135   1.00 0.00 ? 31 ARG A N    11 
ATOM 10808 C CA   . ARG A 1 31 ? 2.918   -4.138  6.865   1.00 0.00 ? 31 ARG A CA   11 
ATOM 10809 C C    . ARG A 1 31 ? 2.003   -3.047  6.318   1.00 0.00 ? 31 ARG A C    11 
ATOM 10810 O O    . ARG A 1 31 ? 2.189   -1.864  6.607   1.00 0.00 ? 31 ARG A O    11 
ATOM 10811 C CB   . ARG A 1 31 ? 2.314   -4.735  8.137   1.00 0.00 ? 31 ARG A CB   11 
ATOM 10812 C CG   . ARG A 1 31 ? 2.939   -6.059  8.546   1.00 0.00 ? 31 ARG A CG   11 
ATOM 10813 C CD   . ARG A 1 31 ? 2.286   -7.229  7.827   1.00 0.00 ? 31 ARG A CD   11 
ATOM 10814 N NE   . ARG A 1 31 ? 2.492   -8.490  8.534   1.00 0.00 ? 31 ARG A NE   11 
ATOM 10815 C CZ   . ARG A 1 31 ? 1.707   -9.551  8.388   1.00 0.00 ? 31 ARG A CZ   11 
ATOM 10816 N NH1  . ARG A 1 31 ? 0.669   -9.504  7.564   1.00 0.00 ? 31 ARG A NH1  11 
ATOM 10817 N NH2  . ARG A 1 31 ? 1.959   -10.663 9.066   1.00 0.00 ? 31 ARG A NH2  11 
ATOM 10818 H H    . ARG A 1 31 ? 4.501   -3.396  8.058   1.00 0.00 ? 31 ARG A H    11 
ATOM 10819 H HA   . ARG A 1 31 ? 3.013   -4.917  6.123   1.00 0.00 ? 31 ARG A HA   11 
ATOM 10820 H HB2  . ARG A 1 31 ? 2.447   -4.034  8.948   1.00 0.00 ? 31 ARG A HB2  11 
ATOM 10821 H HB3  . ARG A 1 31 ? 1.258   -4.894  7.979   1.00 0.00 ? 31 ARG A HB3  11 
ATOM 10822 H HG2  . ARG A 1 31 ? 3.991   -6.041  8.299   1.00 0.00 ? 31 ARG A HG2  11 
ATOM 10823 H HG3  . ARG A 1 31 ? 2.819   -6.189  9.611   1.00 0.00 ? 31 ARG A HG3  11 
ATOM 10824 H HD2  . ARG A 1 31 ? 1.226   -7.040  7.749   1.00 0.00 ? 31 ARG A HD2  11 
ATOM 10825 H HD3  . ARG A 1 31 ? 2.710   -7.308  6.837   1.00 0.00 ? 31 ARG A HD3  11 
ATOM 10826 H HE   . ARG A 1 31 ? 3.253   -8.547  9.147   1.00 0.00 ? 31 ARG A HE   11 
ATOM 10827 H HH11 . ARG A 1 31 ? 0.477   -8.667  7.051   1.00 0.00 ? 31 ARG A HH11 11 
ATOM 10828 H HH12 . ARG A 1 31 ? 0.080   -10.305 7.455   1.00 0.00 ? 31 ARG A HH12 11 
ATOM 10829 H HH21 . ARG A 1 31 ? 2.741   -10.703 9.687   1.00 0.00 ? 31 ARG A HH21 11 
ATOM 10830 H HH22 . ARG A 1 31 ? 1.368   -11.461 8.956   1.00 0.00 ? 31 ARG A HH22 11 
ATOM 10831 N N    . VAL A 1 32 ? 1.015   -3.451  5.526   1.00 0.00 ? 32 VAL A N    11 
ATOM 10832 C CA   . VAL A 1 32 ? 0.071   -2.508  4.939   1.00 0.00 ? 32 VAL A CA   11 
ATOM 10833 C C    . VAL A 1 32 ? -1.350  -3.059  4.976   1.00 0.00 ? 32 VAL A C    11 
ATOM 10834 O O    . VAL A 1 32 ? -1.583  -4.226  4.661   1.00 0.00 ? 32 VAL A O    11 
ATOM 10835 C CB   . VAL A 1 32 ? 0.443   -2.174  3.482   1.00 0.00 ? 32 VAL A CB   11 
ATOM 10836 C CG1  . VAL A 1 32 ? -0.486  -1.107  2.925   1.00 0.00 ? 32 VAL A CG1  11 
ATOM 10837 C CG2  . VAL A 1 32 ? 1.895   -1.729  3.392   1.00 0.00 ? 32 VAL A CG2  11 
ATOM 10838 H H    . VAL A 1 32 ? 0.919   -4.407  5.333   1.00 0.00 ? 32 VAL A H    11 
ATOM 10839 H HA   . VAL A 1 32 ? 0.108   -1.595  5.516   1.00 0.00 ? 32 VAL A HA   11 
ATOM 10840 H HB   . VAL A 1 32 ? 0.325   -3.069  2.888   1.00 0.00 ? 32 VAL A HB   11 
ATOM 10841 H HG11 . VAL A 1 32 ? -1.216  -0.839  3.674   1.00 0.00 ? 32 VAL A HG11 11 
ATOM 10842 H HG12 . VAL A 1 32 ? 0.090   -0.234  2.652   1.00 0.00 ? 32 VAL A HG12 11 
ATOM 10843 H HG13 . VAL A 1 32 ? -0.992  -1.491  2.051   1.00 0.00 ? 32 VAL A HG13 11 
ATOM 10844 H HG21 . VAL A 1 32 ? 2.167   -1.599  2.355   1.00 0.00 ? 32 VAL A HG21 11 
ATOM 10845 H HG22 . VAL A 1 32 ? 2.018   -0.793  3.917   1.00 0.00 ? 32 VAL A HG22 11 
ATOM 10846 H HG23 . VAL A 1 32 ? 2.530   -2.478  3.840   1.00 0.00 ? 32 VAL A HG23 11 
ATOM 10847 N N    . ASP A 1 33 ? -2.297  -2.211  5.361   1.00 0.00 ? 33 ASP A N    11 
ATOM 10848 C CA   . ASP A 1 33 ? -3.698  -2.612  5.437   1.00 0.00 ? 33 ASP A CA   11 
ATOM 10849 C C    . ASP A 1 33 ? -4.481  -2.079  4.242   1.00 0.00 ? 33 ASP A C    11 
ATOM 10850 O O    . ASP A 1 33 ? -5.171  -1.064  4.341   1.00 0.00 ? 33 ASP A O    11 
ATOM 10851 C CB   . ASP A 1 33 ? -4.324  -2.109  6.739   1.00 0.00 ? 33 ASP A CB   11 
ATOM 10852 C CG   . ASP A 1 33 ? -5.464  -2.990  7.211   1.00 0.00 ? 33 ASP A CG   11 
ATOM 10853 O OD1  . ASP A 1 33 ? -5.345  -4.228  7.094   1.00 0.00 ? 33 ASP A OD1  11 
ATOM 10854 O OD2  . ASP A 1 33 ? -6.474  -2.441  7.699   1.00 0.00 ? 33 ASP A OD2  11 
ATOM 10855 H H    . ASP A 1 33 ? -2.049  -1.293  5.599   1.00 0.00 ? 33 ASP A H    11 
ATOM 10856 H HA   . ASP A 1 33 ? -3.735  -3.690  5.424   1.00 0.00 ? 33 ASP A HA   11 
ATOM 10857 H HB2  . ASP A 1 33 ? -3.567  -2.087  7.510   1.00 0.00 ? 33 ASP A HB2  11 
ATOM 10858 H HB3  . ASP A 1 33 ? -4.704  -1.110  6.585   1.00 0.00 ? 33 ASP A HB3  11 
ATOM 10859 N N    . VAL A 1 34 ? -4.369  -2.769  3.112   1.00 0.00 ? 34 VAL A N    11 
ATOM 10860 C CA   . VAL A 1 34 ? -5.067  -2.366  1.897   1.00 0.00 ? 34 VAL A CA   11 
ATOM 10861 C C    . VAL A 1 34 ? -6.579  -2.415  2.090   1.00 0.00 ? 34 VAL A C    11 
ATOM 10862 O O    . VAL A 1 34 ? -7.101  -3.307  2.758   1.00 0.00 ? 34 VAL A O    11 
ATOM 10863 C CB   . VAL A 1 34 ? -4.684  -3.263  0.705   1.00 0.00 ? 34 VAL A CB   11 
ATOM 10864 C CG1  . VAL A 1 34 ? -5.691  -3.110  -0.424  1.00 0.00 ? 34 VAL A CG1  11 
ATOM 10865 C CG2  . VAL A 1 34 ? -3.278  -2.937  0.224   1.00 0.00 ? 34 VAL A CG2  11 
ATOM 10866 H H    . VAL A 1 34 ? -3.804  -3.570  3.095   1.00 0.00 ? 34 VAL A H    11 
ATOM 10867 H HA   . VAL A 1 34 ? -4.776  -1.352  1.666   1.00 0.00 ? 34 VAL A HA   11 
ATOM 10868 H HB   . VAL A 1 34 ? -4.699  -4.291  1.035   1.00 0.00 ? 34 VAL A HB   11 
ATOM 10869 H HG11 . VAL A 1 34 ? -5.776  -2.067  -0.691  1.00 0.00 ? 34 VAL A HG11 11 
ATOM 10870 H HG12 . VAL A 1 34 ? -5.359  -3.677  -1.282  1.00 0.00 ? 34 VAL A HG12 11 
ATOM 10871 H HG13 . VAL A 1 34 ? -6.653  -3.478  -0.100  1.00 0.00 ? 34 VAL A HG13 11 
ATOM 10872 H HG21 . VAL A 1 34 ? -2.944  -2.020  0.687   1.00 0.00 ? 34 VAL A HG21 11 
ATOM 10873 H HG22 . VAL A 1 34 ? -2.609  -3.741  0.495   1.00 0.00 ? 34 VAL A HG22 11 
ATOM 10874 H HG23 . VAL A 1 34 ? -3.282  -2.819  -0.849  1.00 0.00 ? 34 VAL A HG23 11 
ATOM 10875 N N    . MET A 1 35 ? -7.276  -1.450  1.499   1.00 0.00 ? 35 MET A N    11 
ATOM 10876 C CA   . MET A 1 35 ? -8.729  -1.384  1.605   1.00 0.00 ? 35 MET A CA   11 
ATOM 10877 C C    . MET A 1 35 ? -9.381  -1.533  0.234   1.00 0.00 ? 35 MET A C    11 
ATOM 10878 O O    . MET A 1 35 ? -10.216 -2.413  0.027   1.00 0.00 ? 35 MET A O    11 
ATOM 10879 C CB   . MET A 1 35 ? -9.156  -0.061  2.244   1.00 0.00 ? 35 MET A CB   11 
ATOM 10880 C CG   . MET A 1 35 ? -8.794  0.047   3.717   1.00 0.00 ? 35 MET A CG   11 
ATOM 10881 S SD   . MET A 1 35 ? -9.790  1.271   4.589   1.00 0.00 ? 35 MET A SD   11 
ATOM 10882 C CE   . MET A 1 35 ? -8.856  1.448   6.107   1.00 0.00 ? 35 MET A CE   11 
ATOM 10883 H H    . MET A 1 35 ? -6.804  -0.766  0.980   1.00 0.00 ? 35 MET A H    11 
ATOM 10884 H HA   . MET A 1 35 ? -9.053  -2.199  2.235   1.00 0.00 ? 35 MET A HA   11 
ATOM 10885 H HB2  . MET A 1 35 ? -8.677  0.751   1.718   1.00 0.00 ? 35 MET A HB2  11 
ATOM 10886 H HB3  . MET A 1 35 ? -10.227 0.042   2.151   1.00 0.00 ? 35 MET A HB3  11 
ATOM 10887 H HG2  . MET A 1 35 ? -8.945  -0.916  4.182   1.00 0.00 ? 35 MET A HG2  11 
ATOM 10888 H HG3  . MET A 1 35 ? -7.754  0.325   3.798   1.00 0.00 ? 35 MET A HG3  11 
ATOM 10889 H HE1  . MET A 1 35 ? -9.314  0.853   6.883   1.00 0.00 ? 35 MET A HE1  11 
ATOM 10890 H HE2  . MET A 1 35 ? -7.842  1.112   5.947   1.00 0.00 ? 35 MET A HE2  11 
ATOM 10891 H HE3  . MET A 1 35 ? -8.849  2.486   6.406   1.00 0.00 ? 35 MET A HE3  11 
ATOM 10892 N N    . GLN A 1 36 ? -8.994  -0.667  -0.698  1.00 0.00 ? 36 GLN A N    11 
ATOM 10893 C CA   . GLN A 1 36 ? -9.543  -0.703  -2.048  1.00 0.00 ? 36 GLN A CA   11 
ATOM 10894 C C    . GLN A 1 36 ? -8.453  -1.010  -3.071  1.00 0.00 ? 36 GLN A C    11 
ATOM 10895 O O    . GLN A 1 36 ? -7.292  -0.651  -2.879  1.00 0.00 ? 36 GLN A O    11 
ATOM 10896 C CB   . GLN A 1 36 ? -10.214 0.629   -2.385  1.00 0.00 ? 36 GLN A CB   11 
ATOM 10897 C CG   . GLN A 1 36 ? -10.912 0.635   -3.735  1.00 0.00 ? 36 GLN A CG   11 
ATOM 10898 C CD   . GLN A 1 36 ? -12.349 0.159   -3.651  1.00 0.00 ? 36 GLN A CD   11 
ATOM 10899 O OE1  . GLN A 1 36 ? -13.257 0.937   -3.356  1.00 0.00 ? 36 GLN A OE1  11 
ATOM 10900 N NE2  . GLN A 1 36 ? -12.563 -1.125  -3.910  1.00 0.00 ? 36 GLN A NE2  11 
ATOM 10901 H H    . GLN A 1 36 ? -8.325  0.011   -0.472  1.00 0.00 ? 36 GLN A H    11 
ATOM 10902 H HA   . GLN A 1 36 ? -10.283 -1.488  -2.084  1.00 0.00 ? 36 GLN A HA   11 
ATOM 10903 H HB2  . GLN A 1 36 ? -10.946 0.853   -1.624  1.00 0.00 ? 36 GLN A HB2  11 
ATOM 10904 H HB3  . GLN A 1 36 ? -9.463  1.406   -2.389  1.00 0.00 ? 36 GLN A HB3  11 
ATOM 10905 H HG2  . GLN A 1 36 ? -10.905 1.642   -4.125  1.00 0.00 ? 36 GLN A HG2  11 
ATOM 10906 H HG3  . GLN A 1 36 ? -10.371 -0.014  -4.408  1.00 0.00 ? 36 GLN A HG3  11 
ATOM 10907 H HE21 . GLN A 1 36 ? -11.791 -1.686  -4.137  1.00 0.00 ? 36 GLN A HE21 11 
ATOM 10908 H HE22 . GLN A 1 36 ? -13.482 -1.460  -3.862  1.00 0.00 ? 36 GLN A HE22 11 
ATOM 10909 N N    . GLN A 1 37 ? -8.836  -1.677  -4.155  1.00 0.00 ? 37 GLN A N    11 
ATOM 10910 C CA   . GLN A 1 37 ? -7.891  -2.032  -5.206  1.00 0.00 ? 37 GLN A CA   11 
ATOM 10911 C C    . GLN A 1 37 ? -8.254  -1.347  -6.519  1.00 0.00 ? 37 GLN A C    11 
ATOM 10912 O O    . GLN A 1 37 ? -9.388  -1.447  -6.990  1.00 0.00 ? 37 GLN A O    11 
ATOM 10913 C CB   . GLN A 1 37 ? -7.858  -3.549  -5.400  1.00 0.00 ? 37 GLN A CB   11 
ATOM 10914 C CG   . GLN A 1 37 ? -7.887  -4.330  -4.096  1.00 0.00 ? 37 GLN A CG   11 
ATOM 10915 C CD   . GLN A 1 37 ? -7.387  -5.752  -4.257  1.00 0.00 ? 37 GLN A CD   11 
ATOM 10916 O OE1  . GLN A 1 37 ? -6.399  -6.001  -4.947  1.00 0.00 ? 37 GLN A OE1  11 
ATOM 10917 N NE2  . GLN A 1 37 ? -8.070  -6.695  -3.618  1.00 0.00 ? 37 GLN A NE2  11 
ATOM 10918 H H    . GLN A 1 37 ? -9.776  -1.935  -4.249  1.00 0.00 ? 37 GLN A H    11 
ATOM 10919 H HA   . GLN A 1 37 ? -6.912  -1.697  -4.899  1.00 0.00 ? 37 GLN A HA   11 
ATOM 10920 H HB2  . GLN A 1 37 ? -8.713  -3.843  -5.990  1.00 0.00 ? 37 GLN A HB2  11 
ATOM 10921 H HB3  . GLN A 1 37 ? -6.956  -3.813  -5.932  1.00 0.00 ? 37 GLN A HB3  11 
ATOM 10922 H HG2  . GLN A 1 37 ? -7.262  -3.825  -3.375  1.00 0.00 ? 37 GLN A HG2  11 
ATOM 10923 H HG3  . GLN A 1 37 ? -8.904  -4.360  -3.732  1.00 0.00 ? 37 GLN A HG3  11 
ATOM 10924 H HE21 . GLN A 1 37 ? -8.848  -6.424  -3.087  1.00 0.00 ? 37 GLN A HE21 11 
ATOM 10925 H HE22 . GLN A 1 37 ? -7.769  -7.623  -3.704  1.00 0.00 ? 37 GLN A HE22 11 
ATOM 10926 N N    . CYS A 1 38 ? -7.286  -0.652  -7.106  1.00 0.00 ? 38 CYS A N    11 
ATOM 10927 C CA   . CYS A 1 38 ? -7.504  0.051   -8.365  1.00 0.00 ? 38 CYS A CA   11 
ATOM 10928 C C    . CYS A 1 38 ? -7.241  -0.868  -9.554  1.00 0.00 ? 38 CYS A C    11 
ATOM 10929 O O    . CYS A 1 38 ? -6.560  -1.886  -9.425  1.00 0.00 ? 38 CYS A O    11 
ATOM 10930 C CB   . CYS A 1 38 ? -6.603  1.283   -8.448  1.00 0.00 ? 38 CYS A CB   11 
ATOM 10931 S SG   . CYS A 1 38 ? -7.266  2.616   -9.475  1.00 0.00 ? 38 CYS A SG   11 
ATOM 10932 H H    . CYS A 1 38 ? -6.403  -0.610  -6.683  1.00 0.00 ? 38 CYS A H    11 
ATOM 10933 H HA   . CYS A 1 38 ? -8.536  0.367   -8.393  1.00 0.00 ? 38 CYS A HA   11 
ATOM 10934 H HB2  . CYS A 1 38 ? -6.453  1.679   -7.454  1.00 0.00 ? 38 CYS A HB2  11 
ATOM 10935 H HB3  . CYS A 1 38 ? -5.647  0.994   -8.860  1.00 0.00 ? 38 CYS A HB3  11 
ATOM 10936 H HG   . CYS A 1 38 ? -6.280  3.459   -9.737  1.00 0.00 ? 38 CYS A HG   11 
ATOM 10937 N N    . ASP A 1 39 ? -7.785  -0.504  -10.709 1.00 0.00 ? 39 ASP A N    11 
ATOM 10938 C CA   . ASP A 1 39 ? -7.610  -1.295  -11.921 1.00 0.00 ? 39 ASP A CA   11 
ATOM 10939 C C    . ASP A 1 39 ? -6.304  -0.934  -12.622 1.00 0.00 ? 39 ASP A C    11 
ATOM 10940 O O    . ASP A 1 39 ? -5.709  -1.762  -13.312 1.00 0.00 ? 39 ASP A O    11 
ATOM 10941 C CB   . ASP A 1 39 ? -8.789  -1.081  -12.871 1.00 0.00 ? 39 ASP A CB   11 
ATOM 10942 C CG   . ASP A 1 39 ? -8.891  0.352   -13.354 1.00 0.00 ? 39 ASP A CG   11 
ATOM 10943 O OD1  . ASP A 1 39 ? -8.709  1.271   -12.528 1.00 0.00 ? 39 ASP A OD1  11 
ATOM 10944 O OD2  . ASP A 1 39 ? -9.151  0.555   -14.558 1.00 0.00 ? 39 ASP A OD2  11 
ATOM 10945 H H    . ASP A 1 39 ? -8.318  0.319   -10.748 1.00 0.00 ? 39 ASP A H    11 
ATOM 10946 H HA   . ASP A 1 39 ? -7.574  -2.336  -11.635 1.00 0.00 ? 39 ASP A HA   11 
ATOM 10947 H HB2  . ASP A 1 39 ? -8.671  -1.724  -13.732 1.00 0.00 ? 39 ASP A HB2  11 
ATOM 10948 H HB3  . ASP A 1 39 ? -9.706  -1.336  -12.360 1.00 0.00 ? 39 ASP A HB3  11 
ATOM 10949 N N    . ASP A 1 40 ? -5.865  0.307   -12.441 1.00 0.00 ? 40 ASP A N    11 
ATOM 10950 C CA   . ASP A 1 40 ? -4.630  0.778   -13.056 1.00 0.00 ? 40 ASP A CA   11 
ATOM 10951 C C    . ASP A 1 40 ? -3.425  0.021   -12.506 1.00 0.00 ? 40 ASP A C    11 
ATOM 10952 O O    . ASP A 1 40 ? -2.459  -0.234  -13.223 1.00 0.00 ? 40 ASP A O    11 
ATOM 10953 C CB   . ASP A 1 40 ? -4.457  2.279   -12.817 1.00 0.00 ? 40 ASP A CB   11 
ATOM 10954 C CG   . ASP A 1 40 ? -5.651  3.083   -13.292 1.00 0.00 ? 40 ASP A CG   11 
ATOM 10955 O OD1  . ASP A 1 40 ? -6.791  2.715   -12.939 1.00 0.00 ? 40 ASP A OD1  11 
ATOM 10956 O OD2  . ASP A 1 40 ? -5.446  4.079   -14.017 1.00 0.00 ? 40 ASP A OD2  11 
ATOM 10957 H H    . ASP A 1 40 ? -6.384  0.920   -11.879 1.00 0.00 ? 40 ASP A H    11 
ATOM 10958 H HA   . ASP A 1 40 ? -4.698  0.598   -14.118 1.00 0.00 ? 40 ASP A HA   11 
ATOM 10959 H HB2  . ASP A 1 40 ? -4.325  2.456   -11.759 1.00 0.00 ? 40 ASP A HB2  11 
ATOM 10960 H HB3  . ASP A 1 40 ? -3.580  2.622   -13.347 1.00 0.00 ? 40 ASP A HB3  11 
ATOM 10961 N N    . GLY A 1 41 ? -3.491  -0.337  -11.227 1.00 0.00 ? 41 GLY A N    11 
ATOM 10962 C CA   . GLY A 1 41 ? -2.399  -1.060  -10.602 1.00 0.00 ? 41 GLY A CA   11 
ATOM 10963 C C    . GLY A 1 41 ? -1.949  -0.422  -9.303  1.00 0.00 ? 41 GLY A C    11 
ATOM 10964 O O    . GLY A 1 41 ? -0.808  -0.603  -8.878  1.00 0.00 ? 41 GLY A O    11 
ATOM 10965 H H    . GLY A 1 41 ? -4.287  -0.107  -10.703 1.00 0.00 ? 41 GLY A H    11 
ATOM 10966 H HA2  . GLY A 1 41 ? -2.720  -2.072  -10.402 1.00 0.00 ? 41 GLY A HA2  11 
ATOM 10967 H HA3  . GLY A 1 41 ? -1.563  -1.087  -11.285 1.00 0.00 ? 41 GLY A HA3  11 
ATOM 10968 N N    . TRP A 1 42 ? -2.846  0.327   -8.672  1.00 0.00 ? 42 TRP A N    11 
ATOM 10969 C CA   . TRP A 1 42 ? -2.533  0.996   -7.414  1.00 0.00 ? 42 TRP A CA   11 
ATOM 10970 C C    . TRP A 1 42 ? -3.433  0.492   -6.291  1.00 0.00 ? 42 TRP A C    11 
ATOM 10971 O O    . TRP A 1 42 ? -4.569  0.082   -6.530  1.00 0.00 ? 42 TRP A O    11 
ATOM 10972 C CB   . TRP A 1 42 ? -2.687  2.510   -7.566  1.00 0.00 ? 42 TRP A CB   11 
ATOM 10973 C CG   . TRP A 1 42 ? -1.447  3.186   -8.068  1.00 0.00 ? 42 TRP A CG   11 
ATOM 10974 C CD1  . TRP A 1 42 ? -0.807  2.950   -9.252  1.00 0.00 ? 42 TRP A CD1  11 
ATOM 10975 C CD2  . TRP A 1 42 ? -0.696  4.205   -7.400  1.00 0.00 ? 42 TRP A CD2  11 
ATOM 10976 N NE1  . TRP A 1 42 ? 0.296   3.762   -9.360  1.00 0.00 ? 42 TRP A NE1  11 
ATOM 10977 C CE2  . TRP A 1 42 ? 0.386   4.542   -8.237  1.00 0.00 ? 42 TRP A CE2  11 
ATOM 10978 C CE3  . TRP A 1 42 ? -0.833  4.868   -6.177  1.00 0.00 ? 42 TRP A CE3  11 
ATOM 10979 C CZ2  . TRP A 1 42 ? 1.324   5.510   -7.888  1.00 0.00 ? 42 TRP A CZ2  11 
ATOM 10980 C CZ3  . TRP A 1 42 ? 0.099   5.828   -5.832  1.00 0.00 ? 42 TRP A CZ3  11 
ATOM 10981 C CH2  . TRP A 1 42 ? 1.165   6.143   -6.685  1.00 0.00 ? 42 TRP A CH2  11 
ATOM 10982 H H    . TRP A 1 42 ? -3.739  0.433   -9.061  1.00 0.00 ? 42 TRP A H    11 
ATOM 10983 H HA   . TRP A 1 42 ? -1.507  0.771   -7.166  1.00 0.00 ? 42 TRP A HA   11 
ATOM 10984 H HB2  . TRP A 1 42 ? -3.484  2.717   -8.264  1.00 0.00 ? 42 TRP A HB2  11 
ATOM 10985 H HB3  . TRP A 1 42 ? -2.934  2.938   -6.605  1.00 0.00 ? 42 TRP A HB3  11 
ATOM 10986 H HD1  . TRP A 1 42 ? -1.131  2.228   -9.985  1.00 0.00 ? 42 TRP A HD1  11 
ATOM 10987 H HE1  . TRP A 1 42 ? 0.917   3.781   -10.118 1.00 0.00 ? 42 TRP A HE1  11 
ATOM 10988 H HE3  . TRP A 1 42 ? -1.648  4.639   -5.507  1.00 0.00 ? 42 TRP A HE3  11 
ATOM 10989 H HZ2  . TRP A 1 42 ? 2.151   5.765   -8.535  1.00 0.00 ? 42 TRP A HZ2  11 
ATOM 10990 H HZ3  . TRP A 1 42 ? 0.009   6.350   -4.891  1.00 0.00 ? 42 TRP A HZ3  11 
ATOM 10991 H HH2  . TRP A 1 42 ? 1.869   6.900   -6.375  1.00 0.00 ? 42 TRP A HH2  11 
ATOM 10992 N N    . PHE A 1 43 ? -2.918  0.524   -5.067  1.00 0.00 ? 43 PHE A N    11 
ATOM 10993 C CA   . PHE A 1 43 ? -3.676  0.069   -3.907  1.00 0.00 ? 43 PHE A CA   11 
ATOM 10994 C C    . PHE A 1 43 ? -3.880  1.207   -2.910  1.00 0.00 ? 43 PHE A C    11 
ATOM 10995 O O    . PHE A 1 43 ? -2.969  1.994   -2.654  1.00 0.00 ? 43 PHE A O    11 
ATOM 10996 C CB   . PHE A 1 43 ? -2.956  -1.097  -3.226  1.00 0.00 ? 43 PHE A CB   11 
ATOM 10997 C CG   . PHE A 1 43 ? -2.942  -2.354  -4.048  1.00 0.00 ? 43 PHE A CG   11 
ATOM 10998 C CD1  . PHE A 1 43 ? -4.088  -2.788  -4.694  1.00 0.00 ? 43 PHE A CD1  11 
ATOM 10999 C CD2  . PHE A 1 43 ? -1.783  -3.103  -4.173  1.00 0.00 ? 43 PHE A CD2  11 
ATOM 11000 C CE1  . PHE A 1 43 ? -4.079  -3.944  -5.451  1.00 0.00 ? 43 PHE A CE1  11 
ATOM 11001 C CE2  . PHE A 1 43 ? -1.767  -4.260  -4.929  1.00 0.00 ? 43 PHE A CE2  11 
ATOM 11002 C CZ   . PHE A 1 43 ? -2.917  -4.682  -5.568  1.00 0.00 ? 43 PHE A CZ   11 
ATOM 11003 H H    . PHE A 1 43 ? -2.006  0.861   -4.940  1.00 0.00 ? 43 PHE A H    11 
ATOM 11004 H HA   . PHE A 1 43 ? -4.641  -0.267  -4.253  1.00 0.00 ? 43 PHE A HA   11 
ATOM 11005 H HB2  . PHE A 1 43 ? -1.931  -0.816  -3.034  1.00 0.00 ? 43 PHE A HB2  11 
ATOM 11006 H HB3  . PHE A 1 43 ? -3.446  -1.316  -2.290  1.00 0.00 ? 43 PHE A HB3  11 
ATOM 11007 H HD1  . PHE A 1 43 ? -4.998  -2.212  -4.603  1.00 0.00 ? 43 PHE A HD1  11 
ATOM 11008 H HD2  . PHE A 1 43 ? -0.883  -2.775  -3.674  1.00 0.00 ? 43 PHE A HD2  11 
ATOM 11009 H HE1  . PHE A 1 43 ? -4.980  -4.271  -5.949  1.00 0.00 ? 43 PHE A HE1  11 
ATOM 11010 H HE2  . PHE A 1 43 ? -0.857  -4.834  -5.019  1.00 0.00 ? 43 PHE A HE2  11 
ATOM 11011 H HZ   . PHE A 1 43 ? -2.907  -5.585  -6.159  1.00 0.00 ? 43 PHE A HZ   11 
ATOM 11012 N N    . VAL A 1 44 ? -5.083  1.286   -2.351  1.00 0.00 ? 44 VAL A N    11 
ATOM 11013 C CA   . VAL A 1 44 ? -5.408  2.326   -1.382  1.00 0.00 ? 44 VAL A CA   11 
ATOM 11014 C C    . VAL A 1 44 ? -5.794  1.723   -0.036  1.00 0.00 ? 44 VAL A C    11 
ATOM 11015 O O    . VAL A 1 44 ? -6.596  0.792   0.031   1.00 0.00 ? 44 VAL A O    11 
ATOM 11016 C CB   . VAL A 1 44 ? -6.560  3.219   -1.881  1.00 0.00 ? 44 VAL A CB   11 
ATOM 11017 C CG1  . VAL A 1 44 ? -6.920  4.262   -0.834  1.00 0.00 ? 44 VAL A CG1  11 
ATOM 11018 C CG2  . VAL A 1 44 ? -6.187  3.881   -3.199  1.00 0.00 ? 44 VAL A CG2  11 
ATOM 11019 H H    . VAL A 1 44 ? -5.768  0.630   -2.595  1.00 0.00 ? 44 VAL A H    11 
ATOM 11020 H HA   . VAL A 1 44 ? -4.532  2.945   -1.250  1.00 0.00 ? 44 VAL A HA   11 
ATOM 11021 H HB   . VAL A 1 44 ? -7.425  2.595   -2.048  1.00 0.00 ? 44 VAL A HB   11 
ATOM 11022 H HG11 . VAL A 1 44 ? -7.994  4.313   -0.733  1.00 0.00 ? 44 VAL A HG11 11 
ATOM 11023 H HG12 . VAL A 1 44 ? -6.481  3.988   0.113   1.00 0.00 ? 44 VAL A HG12 11 
ATOM 11024 H HG13 . VAL A 1 44 ? -6.542  5.226   -1.142  1.00 0.00 ? 44 VAL A HG13 11 
ATOM 11025 H HG21 . VAL A 1 44 ? -6.579  4.887   -3.219  1.00 0.00 ? 44 VAL A HG21 11 
ATOM 11026 H HG22 . VAL A 1 44 ? -5.111  3.912   -3.295  1.00 0.00 ? 44 VAL A HG22 11 
ATOM 11027 H HG23 . VAL A 1 44 ? -6.605  3.314   -4.018  1.00 0.00 ? 44 VAL A HG23 11 
ATOM 11028 N N    . GLY A 1 45 ? -5.218  2.260   1.035   1.00 0.00 ? 45 GLY A N    11 
ATOM 11029 C CA   . GLY A 1 45 ? -5.515  1.762   2.365   1.00 0.00 ? 45 GLY A CA   11 
ATOM 11030 C C    . GLY A 1 45 ? -4.864  2.592   3.454   1.00 0.00 ? 45 GLY A C    11 
ATOM 11031 O O    . GLY A 1 45 ? -4.911  3.822   3.419   1.00 0.00 ? 45 GLY A O    11 
ATOM 11032 H H    . GLY A 1 45 ? -4.586  3.001   0.921   1.00 0.00 ? 45 GLY A H    11 
ATOM 11033 H HA2  . GLY A 1 45 ? -6.585  1.771   2.511   1.00 0.00 ? 45 GLY A HA2  11 
ATOM 11034 H HA3  . GLY A 1 45 ? -5.159  0.745   2.444   1.00 0.00 ? 45 GLY A HA3  11 
ATOM 11035 N N    . VAL A 1 46 ? -4.256  1.919   4.426   1.00 0.00 ? 46 VAL A N    11 
ATOM 11036 C CA   . VAL A 1 46 ? -3.594  2.603   5.530   1.00 0.00 ? 46 VAL A CA   11 
ATOM 11037 C C    . VAL A 1 46 ? -2.283  1.915   5.895   1.00 0.00 ? 46 VAL A C    11 
ATOM 11038 O O    . VAL A 1 46 ? -2.131  0.708   5.711   1.00 0.00 ? 46 VAL A O    11 
ATOM 11039 C CB   . VAL A 1 46 ? -4.496  2.659   6.777   1.00 0.00 ? 46 VAL A CB   11 
ATOM 11040 C CG1  . VAL A 1 46 ? -3.674  2.976   8.017   1.00 0.00 ? 46 VAL A CG1  11 
ATOM 11041 C CG2  . VAL A 1 46 ? -5.604  3.684   6.587   1.00 0.00 ? 46 VAL A CG2  11 
ATOM 11042 H H    . VAL A 1 46 ? -4.252  0.940   4.399   1.00 0.00 ? 46 VAL A H    11 
ATOM 11043 H HA   . VAL A 1 46 ? -3.383  3.616   5.218   1.00 0.00 ? 46 VAL A HA   11 
ATOM 11044 H HB   . VAL A 1 46 ? -4.950  1.689   6.912   1.00 0.00 ? 46 VAL A HB   11 
ATOM 11045 H HG11 . VAL A 1 46 ? -3.132  3.898   7.864   1.00 0.00 ? 46 VAL A HG11 11 
ATOM 11046 H HG12 . VAL A 1 46 ? -4.330  3.079   8.868   1.00 0.00 ? 46 VAL A HG12 11 
ATOM 11047 H HG13 . VAL A 1 46 ? -2.973  2.174   8.198   1.00 0.00 ? 46 VAL A HG13 11 
ATOM 11048 H HG21 . VAL A 1 46 ? -6.560  3.216   6.767   1.00 0.00 ? 46 VAL A HG21 11 
ATOM 11049 H HG22 . VAL A 1 46 ? -5.465  4.499   7.282   1.00 0.00 ? 46 VAL A HG22 11 
ATOM 11050 H HG23 . VAL A 1 46 ? -5.574  4.064   5.576   1.00 0.00 ? 46 VAL A HG23 11 
ATOM 11051 N N    . SER A 1 47 ? -1.338  2.692   6.414   1.00 0.00 ? 47 SER A N    11 
ATOM 11052 C CA   . SER A 1 47 ? -0.037  2.159   6.802   1.00 0.00 ? 47 SER A CA   11 
ATOM 11053 C C    . SER A 1 47 ? -0.069  1.639   8.236   1.00 0.00 ? 47 SER A C    11 
ATOM 11054 O O    . SER A 1 47 ? -0.800  2.159   9.080   1.00 0.00 ? 47 SER A O    11 
ATOM 11055 C CB   . SER A 1 47 ? 1.042   3.235   6.661   1.00 0.00 ? 47 SER A CB   11 
ATOM 11056 O OG   . SER A 1 47 ? 2.323   2.653   6.494   1.00 0.00 ? 47 SER A OG   11 
ATOM 11057 H H    . SER A 1 47 ? -1.519  3.648   6.536   1.00 0.00 ? 47 SER A H    11 
ATOM 11058 H HA   . SER A 1 47 ? 0.196   1.339   6.139   1.00 0.00 ? 47 SER A HA   11 
ATOM 11059 H HB2  . SER A 1 47 ? 0.823   3.849   5.801   1.00 0.00 ? 47 SER A HB2  11 
ATOM 11060 H HB3  . SER A 1 47 ? 1.052   3.849   7.550   1.00 0.00 ? 47 SER A HB3  11 
ATOM 11061 H HG   . SER A 1 47 ? 2.265   1.924   5.872   1.00 0.00 ? 47 SER A HG   11 
ATOM 11062 N N    . ARG A 1 48 ? 0.728   0.611   8.504   1.00 0.00 ? 48 ARG A N    11 
ATOM 11063 C CA   . ARG A 1 48 ? 0.791   0.019   9.835   1.00 0.00 ? 48 ARG A CA   11 
ATOM 11064 C C    . ARG A 1 48 ? 1.972   0.578   10.623  1.00 0.00 ? 48 ARG A C    11 
ATOM 11065 O O    . ARG A 1 48 ? 2.430   -0.032  11.590  1.00 0.00 ? 48 ARG A O    11 
ATOM 11066 C CB   . ARG A 1 48 ? 0.905   -1.503  9.735   1.00 0.00 ? 48 ARG A CB   11 
ATOM 11067 C CG   . ARG A 1 48 ? -0.336  -2.171  9.166   1.00 0.00 ? 48 ARG A CG   11 
ATOM 11068 C CD   . ARG A 1 48 ? -1.491  -2.136  10.154  1.00 0.00 ? 48 ARG A CD   11 
ATOM 11069 N NE   . ARG A 1 48 ? -1.105  -2.653  11.465  1.00 0.00 ? 48 ARG A NE   11 
ATOM 11070 C CZ   . ARG A 1 48 ? -1.061  -3.947  11.760  1.00 0.00 ? 48 ARG A CZ   11 
ATOM 11071 N NH1  . ARG A 1 48 ? -1.375  -4.851  10.842  1.00 0.00 ? 48 ARG A NH1  11 
ATOM 11072 N NH2  . ARG A 1 48 ? -0.700  -4.340  12.975  1.00 0.00 ? 48 ARG A NH2  11 
ATOM 11073 H H    . ARG A 1 48 ? 1.287   0.240   7.790   1.00 0.00 ? 48 ARG A H    11 
ATOM 11074 H HA   . ARG A 1 48 ? -0.123  0.269   10.353  1.00 0.00 ? 48 ARG A HA   11 
ATOM 11075 H HB2  . ARG A 1 48 ? 1.743   -1.749  9.099   1.00 0.00 ? 48 ARG A HB2  11 
ATOM 11076 H HB3  . ARG A 1 48 ? 1.083   -1.904  10.721  1.00 0.00 ? 48 ARG A HB3  11 
ATOM 11077 H HG2  . ARG A 1 48 ? -0.632  -1.652  8.265   1.00 0.00 ? 48 ARG A HG2  11 
ATOM 11078 H HG3  . ARG A 1 48 ? -0.105  -3.199  8.932   1.00 0.00 ? 48 ARG A HG3  11 
ATOM 11079 H HD2  . ARG A 1 48 ? -1.822  -1.114  10.265  1.00 0.00 ? 48 ARG A HD2  11 
ATOM 11080 H HD3  . ARG A 1 48 ? -2.299  -2.735  9.764   1.00 0.00 ? 48 ARG A HD3  11 
ATOM 11081 H HE   . ARG A 1 48 ? -0.869  -2.002  12.158  1.00 0.00 ? 48 ARG A HE   11 
ATOM 11082 H HH11 . ARG A 1 48 ? -1.646  -4.558  9.925   1.00 0.00 ? 48 ARG A HH11 11 
ATOM 11083 H HH12 . ARG A 1 48 ? -1.340  -5.825  11.066  1.00 0.00 ? 48 ARG A HH12 11 
ATOM 11084 H HH21 . ARG A 1 48 ? -0.462  -3.662  13.669  1.00 0.00 ? 48 ARG A HH21 11 
ATOM 11085 H HH22 . ARG A 1 48 ? -0.667  -5.314  13.196  1.00 0.00 ? 48 ARG A HH22 11 
ATOM 11086 N N    . ARG A 1 49 ? 2.461   1.740   10.203  1.00 0.00 ? 49 ARG A N    11 
ATOM 11087 C CA   . ARG A 1 49 ? 3.589   2.380   10.868  1.00 0.00 ? 49 ARG A CA   11 
ATOM 11088 C C    . ARG A 1 49 ? 3.272   3.835   11.199  1.00 0.00 ? 49 ARG A C    11 
ATOM 11089 O O    . ARG A 1 49 ? 3.543   4.306   12.304  1.00 0.00 ? 49 ARG A O    11 
ATOM 11090 C CB   . ARG A 1 49 ? 4.837   2.306   9.986   1.00 0.00 ? 49 ARG A CB   11 
ATOM 11091 C CG   . ARG A 1 49 ? 5.951   3.242   10.427  1.00 0.00 ? 49 ARG A CG   11 
ATOM 11092 C CD   . ARG A 1 49 ? 7.315   2.725   9.998   1.00 0.00 ? 49 ARG A CD   11 
ATOM 11093 N NE   . ARG A 1 49 ? 8.358   3.734   10.160  1.00 0.00 ? 49 ARG A NE   11 
ATOM 11094 C CZ   . ARG A 1 49 ? 8.474   4.803   9.379   1.00 0.00 ? 49 ARG A CZ   11 
ATOM 11095 N NH1  . ARG A 1 49 ? 7.615   5.000   8.389   1.00 0.00 ? 49 ARG A NH1  11 
ATOM 11096 N NH2  . ARG A 1 49 ? 9.450   5.677   9.589   1.00 0.00 ? 49 ARG A NH2  11 
ATOM 11097 H H    . ARG A 1 49 ? 2.053   2.177   9.426   1.00 0.00 ? 49 ARG A H    11 
ATOM 11098 H HA   . ARG A 1 49 ? 3.778   1.847   11.788  1.00 0.00 ? 49 ARG A HA   11 
ATOM 11099 H HB2  . ARG A 1 49 ? 5.218   1.296   10.004  1.00 0.00 ? 49 ARG A HB2  11 
ATOM 11100 H HB3  . ARG A 1 49 ? 4.563   2.561   8.973   1.00 0.00 ? 49 ARG A HB3  11 
ATOM 11101 H HG2  . ARG A 1 49 ? 5.790   4.213   9.982   1.00 0.00 ? 49 ARG A HG2  11 
ATOM 11102 H HG3  . ARG A 1 49 ? 5.930   3.329   11.503  1.00 0.00 ? 49 ARG A HG3  11 
ATOM 11103 H HD2  . ARG A 1 49 ? 7.564   1.864   10.601  1.00 0.00 ? 49 ARG A HD2  11 
ATOM 11104 H HD3  . ARG A 1 49 ? 7.265   2.435   8.960   1.00 0.00 ? 49 ARG A HD3  11 
ATOM 11105 H HE   . ARG A 1 49 ? 9.004   3.608   10.886  1.00 0.00 ? 49 ARG A HE   11 
ATOM 11106 H HH11 . ARG A 1 49 ? 6.878   4.344   8.229   1.00 0.00 ? 49 ARG A HH11 11 
ATOM 11107 H HH12 . ARG A 1 49 ? 7.703   5.806   7.803   1.00 0.00 ? 49 ARG A HH12 11 
ATOM 11108 H HH21 . ARG A 1 49 ? 10.099  5.531   10.335  1.00 0.00 ? 49 ARG A HH21 11 
ATOM 11109 H HH22 . ARG A 1 49 ? 9.536   6.480   9.001   1.00 0.00 ? 49 ARG A HH22 11 
ATOM 11110 N N    . THR A 1 50 ? 2.696   4.544   10.233  1.00 0.00 ? 50 THR A N    11 
ATOM 11111 C CA   . THR A 1 50 ? 2.343   5.946   10.420  1.00 0.00 ? 50 THR A CA   11 
ATOM 11112 C C    . THR A 1 50 ? 0.840   6.113   10.613  1.00 0.00 ? 50 THR A C    11 
ATOM 11113 O O    . THR A 1 50 ? 0.363   7.206   10.917  1.00 0.00 ? 50 THR A O    11 
ATOM 11114 C CB   . THR A 1 50 ? 2.794   6.803   9.222   1.00 0.00 ? 50 THR A CB   11 
ATOM 11115 O OG1  . THR A 1 50 ? 2.336   6.216   7.999   1.00 0.00 ? 50 THR A OG1  11 
ATOM 11116 C CG2  . THR A 1 50 ? 4.309   6.935   9.191   1.00 0.00 ? 50 THR A CG2  11 
ATOM 11117 H H    . THR A 1 50 ? 2.505   4.113   9.374   1.00 0.00 ? 50 THR A H    11 
ATOM 11118 H HA   . THR A 1 50 ? 2.852   6.303   11.303  1.00 0.00 ? 50 THR A HA   11 
ATOM 11119 H HB   . THR A 1 50 ? 2.364   7.789   9.323   1.00 0.00 ? 50 THR A HB   11 
ATOM 11120 H HG1  . THR A 1 50 ? 1.683   6.791   7.593   1.00 0.00 ? 50 THR A HG1  11 
ATOM 11121 H HG21 . THR A 1 50 ? 4.601   7.534   8.341   1.00 0.00 ? 50 THR A HG21 11 
ATOM 11122 H HG22 . THR A 1 50 ? 4.754   5.954   9.110   1.00 0.00 ? 50 THR A HG22 11 
ATOM 11123 H HG23 . THR A 1 50 ? 4.648   7.409   10.099  1.00 0.00 ? 50 THR A HG23 11 
ATOM 11124 N N    . GLN A 1 51 ? 0.100   5.024   10.434  1.00 0.00 ? 51 GLN A N    11 
ATOM 11125 C CA   . GLN A 1 51 ? -1.349  5.052   10.589  1.00 0.00 ? 51 GLN A CA   11 
ATOM 11126 C C    . GLN A 1 51 ? -1.972  6.122   9.699   1.00 0.00 ? 51 GLN A C    11 
ATOM 11127 O O    . GLN A 1 51 ? -2.947  6.771   10.078  1.00 0.00 ? 51 GLN A O    11 
ATOM 11128 C CB   . GLN A 1 51 ? -1.722  5.308   12.051  1.00 0.00 ? 51 GLN A CB   11 
ATOM 11129 C CG   . GLN A 1 51 ? -1.246  4.220   13.000  1.00 0.00 ? 51 GLN A CG   11 
ATOM 11130 C CD   . GLN A 1 51 ? 0.155   4.472   13.520  1.00 0.00 ? 51 GLN A CD   11 
ATOM 11131 O OE1  . GLN A 1 51 ? 1.142   4.222   12.827  1.00 0.00 ? 51 GLN A OE1  11 
ATOM 11132 N NE2  . GLN A 1 51 ? 0.250   4.969   14.748  1.00 0.00 ? 51 GLN A NE2  11 
ATOM 11133 H H    . GLN A 1 51 ? 0.539   4.182   10.192  1.00 0.00 ? 51 GLN A H    11 
ATOM 11134 H HA   . GLN A 1 51 ? -1.733  4.087   10.293  1.00 0.00 ? 51 GLN A HA   11 
ATOM 11135 H HB2  . GLN A 1 51 ? -1.285  6.244   12.363  1.00 0.00 ? 51 GLN A HB2  11 
ATOM 11136 H HB3  . GLN A 1 51 ? -2.797  5.377   12.129  1.00 0.00 ? 51 GLN A HB3  11 
ATOM 11137 H HG2  . GLN A 1 51 ? -1.922  4.171   13.840  1.00 0.00 ? 51 GLN A HG2  11 
ATOM 11138 H HG3  . GLN A 1 51 ? -1.256  3.275   12.477  1.00 0.00 ? 51 GLN A HG3  11 
ATOM 11139 H HE21 . GLN A 1 51 ? -0.579  5.142   15.242  1.00 0.00 ? 51 GLN A HE21 11 
ATOM 11140 H HE22 . GLN A 1 51 ? 1.143   5.141   15.110  1.00 0.00 ? 51 GLN A HE22 11 
ATOM 11141 N N    . LYS A 1 52 ? -1.401  6.302   8.512   1.00 0.00 ? 52 LYS A N    11 
ATOM 11142 C CA   . LYS A 1 52 ? -1.900  7.293   7.566   1.00 0.00 ? 52 LYS A CA   11 
ATOM 11143 C C    . LYS A 1 52 ? -2.747  6.633   6.482   1.00 0.00 ? 52 LYS A C    11 
ATOM 11144 O O    . LYS A 1 52 ? -2.568  5.455   6.172   1.00 0.00 ? 52 LYS A O    11 
ATOM 11145 C CB   . LYS A 1 52 ? -0.733  8.049   6.925   1.00 0.00 ? 52 LYS A CB   11 
ATOM 11146 C CG   . LYS A 1 52 ? -0.074  9.051   7.857   1.00 0.00 ? 52 LYS A CG   11 
ATOM 11147 C CD   . LYS A 1 52 ? -0.812  10.379  7.860   1.00 0.00 ? 52 LYS A CD   11 
ATOM 11148 C CE   . LYS A 1 52 ? -0.598  11.132  9.164   1.00 0.00 ? 52 LYS A CE   11 
ATOM 11149 N NZ   . LYS A 1 52 ? 0.591   12.026  9.099   1.00 0.00 ? 52 LYS A NZ   11 
ATOM 11150 H H    . LYS A 1 52 ? -0.626  5.754   8.266   1.00 0.00 ? 52 LYS A H    11 
ATOM 11151 H HA   . LYS A 1 52 ? -2.515  7.992   8.111   1.00 0.00 ? 52 LYS A HA   11 
ATOM 11152 H HB2  . LYS A 1 52 ? 0.014   7.334   6.611   1.00 0.00 ? 52 LYS A HB2  11 
ATOM 11153 H HB3  . LYS A 1 52 ? -1.097  8.580   6.058   1.00 0.00 ? 52 LYS A HB3  11 
ATOM 11154 H HG2  . LYS A 1 52 ? -0.072  8.650   8.859   1.00 0.00 ? 52 LYS A HG2  11 
ATOM 11155 H HG3  . LYS A 1 52 ? 0.944   9.216   7.531   1.00 0.00 ? 52 LYS A HG3  11 
ATOM 11156 H HD2  . LYS A 1 52 ? -0.449  10.985  7.044   1.00 0.00 ? 52 LYS A HD2  11 
ATOM 11157 H HD3  . LYS A 1 52 ? -1.869  10.193  7.730   1.00 0.00 ? 52 LYS A HD3  11 
ATOM 11158 H HE2  . LYS A 1 52 ? -1.475  11.728  9.368   1.00 0.00 ? 52 LYS A HE2  11 
ATOM 11159 H HE3  . LYS A 1 52 ? -0.457  10.415  9.959   1.00 0.00 ? 52 LYS A HE3  11 
ATOM 11160 H HZ1  . LYS A 1 52 ? 0.328   12.991  9.384   1.00 0.00 ? 52 LYS A HZ1  11 
ATOM 11161 H HZ2  . LYS A 1 52 ? 0.966   12.053  8.130   1.00 0.00 ? 52 LYS A HZ2  11 
ATOM 11162 H HZ3  . LYS A 1 52 ? 1.334   11.679  9.738   1.00 0.00 ? 52 LYS A HZ3  11 
ATOM 11163 N N    . PHE A 1 53 ? -3.669  7.399   5.910   1.00 0.00 ? 53 PHE A N    11 
ATOM 11164 C CA   . PHE A 1 53 ? -4.544  6.888   4.860   1.00 0.00 ? 53 PHE A CA   11 
ATOM 11165 C C    . PHE A 1 53 ? -4.305  7.626   3.546   1.00 0.00 ? 53 PHE A C    11 
ATOM 11166 O O    . PHE A 1 53 ? -4.177  8.849   3.523   1.00 0.00 ? 53 PHE A O    11 
ATOM 11167 C CB   . PHE A 1 53 ? -6.010  7.027   5.277   1.00 0.00 ? 53 PHE A CB   11 
ATOM 11168 C CG   . PHE A 1 53 ? -6.972  6.428   4.291   1.00 0.00 ? 53 PHE A CG   11 
ATOM 11169 C CD1  . PHE A 1 53 ? -7.126  6.980   3.030   1.00 0.00 ? 53 PHE A CD1  11 
ATOM 11170 C CD2  . PHE A 1 53 ? -7.722  5.312   4.626   1.00 0.00 ? 53 PHE A CD2  11 
ATOM 11171 C CE1  . PHE A 1 53 ? -8.011  6.431   2.122   1.00 0.00 ? 53 PHE A CE1  11 
ATOM 11172 C CE2  . PHE A 1 53 ? -8.608  4.758   3.722   1.00 0.00 ? 53 PHE A CE2  11 
ATOM 11173 C CZ   . PHE A 1 53 ? -8.752  5.318   2.468   1.00 0.00 ? 53 PHE A CZ   11 
ATOM 11174 H H    . PHE A 1 53 ? -3.764  8.331   6.200   1.00 0.00 ? 53 PHE A H    11 
ATOM 11175 H HA   . PHE A 1 53 ? -4.315  5.843   4.719   1.00 0.00 ? 53 PHE A HA   11 
ATOM 11176 H HB2  . PHE A 1 53 ? -6.155  6.532   6.225   1.00 0.00 ? 53 PHE A HB2  11 
ATOM 11177 H HB3  . PHE A 1 53 ? -6.249  8.074   5.382   1.00 0.00 ? 53 PHE A HB3  11 
ATOM 11178 H HD1  . PHE A 1 53 ? -6.546  7.850   2.758   1.00 0.00 ? 53 PHE A HD1  11 
ATOM 11179 H HD2  . PHE A 1 53 ? -7.609  4.872   5.608   1.00 0.00 ? 53 PHE A HD2  11 
ATOM 11180 H HE1  . PHE A 1 53 ? -8.122  6.870   1.142   1.00 0.00 ? 53 PHE A HE1  11 
ATOM 11181 H HE2  . PHE A 1 53 ? -9.186  3.888   3.996   1.00 0.00 ? 53 PHE A HE2  11 
ATOM 11182 H HZ   . PHE A 1 53 ? -9.445  4.887   1.760   1.00 0.00 ? 53 PHE A HZ   11 
ATOM 11183 N N    . GLY A 1 54 ? -4.246  6.872   2.453   1.00 0.00 ? 54 GLY A N    11 
ATOM 11184 C CA   . GLY A 1 54 ? -4.022  7.470   1.150   1.00 0.00 ? 54 GLY A CA   11 
ATOM 11185 C C    . GLY A 1 54 ? -3.924  6.436   0.046   1.00 0.00 ? 54 GLY A C    11 
ATOM 11186 O O    . GLY A 1 54 ? -4.534  5.369   0.128   1.00 0.00 ? 54 GLY A O    11 
ATOM 11187 H H    . GLY A 1 54 ? -4.355  5.901   2.532   1.00 0.00 ? 54 GLY A H    11 
ATOM 11188 H HA2  . GLY A 1 54 ? -4.838  8.141   0.929   1.00 0.00 ? 54 GLY A HA2  11 
ATOM 11189 H HA3  . GLY A 1 54 ? -3.102  8.035   1.180   1.00 0.00 ? 54 GLY A HA3  11 
ATOM 11190 N N    . THR A 1 55 ? -3.156  6.751   -0.992  1.00 0.00 ? 55 THR A N    11 
ATOM 11191 C CA   . THR A 1 55 ? -2.984  5.843   -2.119  1.00 0.00 ? 55 THR A CA   11 
ATOM 11192 C C    . THR A 1 55 ? -1.507  5.639   -2.439  1.00 0.00 ? 55 THR A C    11 
ATOM 11193 O O    . THR A 1 55 ? -0.723  6.588   -2.431  1.00 0.00 ? 55 THR A O    11 
ATOM 11194 C CB   . THR A 1 55 ? -3.703  6.365   -3.377  1.00 0.00 ? 55 THR A CB   11 
ATOM 11195 O OG1  . THR A 1 55 ? -3.469  5.479   -4.478  1.00 0.00 ? 55 THR A OG1  11 
ATOM 11196 C CG2  . THR A 1 55 ? -3.223  7.763   -3.734  1.00 0.00 ? 55 THR A CG2  11 
ATOM 11197 H H    . THR A 1 55 ? -2.696  7.616   -1.000  1.00 0.00 ? 55 THR A H    11 
ATOM 11198 H HA   . THR A 1 55 ? -3.419  4.891   -1.850  1.00 0.00 ? 55 THR A HA   11 
ATOM 11199 H HB   . THR A 1 55 ? -4.764  6.405   -3.176  1.00 0.00 ? 55 THR A HB   11 
ATOM 11200 H HG1  . THR A 1 55 ? -4.307  5.250   -4.888  1.00 0.00 ? 55 THR A HG1  11 
ATOM 11201 H HG21 . THR A 1 55 ? -2.697  7.734   -4.677  1.00 0.00 ? 55 THR A HG21 11 
ATOM 11202 H HG22 . THR A 1 55 ? -2.559  8.124   -2.962  1.00 0.00 ? 55 THR A HG22 11 
ATOM 11203 H HG23 . THR A 1 55 ? -4.072  8.425   -3.816  1.00 0.00 ? 55 THR A HG23 11 
ATOM 11204 N N    . PHE A 1 56 ? -1.134  4.395   -2.722  1.00 0.00 ? 56 PHE A N    11 
ATOM 11205 C CA   . PHE A 1 56 ? 0.249   4.067   -3.045  1.00 0.00 ? 56 PHE A CA   11 
ATOM 11206 C C    . PHE A 1 56 ? 0.315   3.015   -4.149  1.00 0.00 ? 56 PHE A C    11 
ATOM 11207 O O    . PHE A 1 56 ? -0.623  2.248   -4.368  1.00 0.00 ? 56 PHE A O    11 
ATOM 11208 C CB   . PHE A 1 56 ? 0.980   3.562   -1.800  1.00 0.00 ? 56 PHE A CB   11 
ATOM 11209 C CG   . PHE A 1 56 ? 0.160   2.621   -0.964  1.00 0.00 ? 56 PHE A CG   11 
ATOM 11210 C CD1  . PHE A 1 56 ? -0.777  3.107   -0.067  1.00 0.00 ? 56 PHE A CD1  11 
ATOM 11211 C CD2  . PHE A 1 56 ? 0.327   1.250   -1.075  1.00 0.00 ? 56 PHE A CD2  11 
ATOM 11212 C CE1  . PHE A 1 56 ? -1.533  2.244   0.704   1.00 0.00 ? 56 PHE A CE1  11 
ATOM 11213 C CE2  . PHE A 1 56 ? -0.426  0.382   -0.307  1.00 0.00 ? 56 PHE A CE2  11 
ATOM 11214 C CZ   . PHE A 1 56 ? -1.357  0.880   0.584   1.00 0.00 ? 56 PHE A CZ   11 
ATOM 11215 H H    . PHE A 1 56 ? -1.806  3.681   -2.713  1.00 0.00 ? 56 PHE A H    11 
ATOM 11216 H HA   . PHE A 1 56 ? 0.730   4.968   -3.394  1.00 0.00 ? 56 PHE A HA   11 
ATOM 11217 H HB2  . PHE A 1 56 ? 1.876   3.041   -2.103  1.00 0.00 ? 56 PHE A HB2  11 
ATOM 11218 H HB3  . PHE A 1 56 ? 1.251   4.406   -1.183  1.00 0.00 ? 56 PHE A HB3  11 
ATOM 11219 H HD1  . PHE A 1 56 ? -0.915  4.175   0.028   1.00 0.00 ? 56 PHE A HD1  11 
ATOM 11220 H HD2  . PHE A 1 56 ? 1.056   0.859   -1.770  1.00 0.00 ? 56 PHE A HD2  11 
ATOM 11221 H HE1  . PHE A 1 56 ? -2.260  2.637   1.399   1.00 0.00 ? 56 PHE A HE1  11 
ATOM 11222 H HE2  . PHE A 1 56 ? -0.286  -0.685  -0.403  1.00 0.00 ? 56 PHE A HE2  11 
ATOM 11223 H HZ   . PHE A 1 56 ? -1.947  0.204   1.184   1.00 0.00 ? 56 PHE A HZ   11 
ATOM 11224 N N    . PRO A 1 57 ? 1.450   2.977   -4.863  1.00 0.00 ? 57 PRO A N    11 
ATOM 11225 C CA   . PRO A 1 57 ? 1.667   2.025   -5.956  1.00 0.00 ? 57 PRO A CA   11 
ATOM 11226 C C    . PRO A 1 57 ? 1.819   0.593   -5.455  1.00 0.00 ? 57 PRO A C    11 
ATOM 11227 O O    . PRO A 1 57 ? 2.815   0.249   -4.821  1.00 0.00 ? 57 PRO A O    11 
ATOM 11228 C CB   . PRO A 1 57 ? 2.971   2.509   -6.595  1.00 0.00 ? 57 PRO A CB   11 
ATOM 11229 C CG   . PRO A 1 57 ? 3.682   3.233   -5.504  1.00 0.00 ? 57 PRO A CG   11 
ATOM 11230 C CD   . PRO A 1 57 ? 2.610   3.862   -4.657  1.00 0.00 ? 57 PRO A CD   11 
ATOM 11231 H HA   . PRO A 1 57 ? 0.869   2.068   -6.683  1.00 0.00 ? 57 PRO A HA   11 
ATOM 11232 H HB2  . PRO A 1 57 ? 3.541   1.659   -6.944  1.00 0.00 ? 57 PRO A HB2  11 
ATOM 11233 H HB3  . PRO A 1 57 ? 2.748   3.165   -7.423  1.00 0.00 ? 57 PRO A HB3  11 
ATOM 11234 H HG2  . PRO A 1 57 ? 4.262   2.536   -4.919  1.00 0.00 ? 57 PRO A HG2  11 
ATOM 11235 H HG3  . PRO A 1 57 ? 4.321   3.995   -5.925  1.00 0.00 ? 57 PRO A HG3  11 
ATOM 11236 H HD2  . PRO A 1 57 ? 2.907   3.873   -3.619  1.00 0.00 ? 57 PRO A HD2  11 
ATOM 11237 H HD3  . PRO A 1 57 ? 2.396   4.863   -5.001  1.00 0.00 ? 57 PRO A HD3  11 
ATOM 11238 N N    . GLY A 1 58 ? 0.823   -0.240  -5.745  1.00 0.00 ? 58 GLY A N    11 
ATOM 11239 C CA   . GLY A 1 58 ? 0.867   -1.626  -5.316  1.00 0.00 ? 58 GLY A CA   11 
ATOM 11240 C C    . GLY A 1 58 ? 2.124   -2.336  -5.776  1.00 0.00 ? 58 GLY A C    11 
ATOM 11241 O O    . GLY A 1 58 ? 2.457   -3.409  -5.276  1.00 0.00 ? 58 GLY A O    11 
ATOM 11242 H H    . GLY A 1 58 ? 0.053   0.090   -6.254  1.00 0.00 ? 58 GLY A H    11 
ATOM 11243 H HA2  . GLY A 1 58 ? 0.820   -1.659  -4.238  1.00 0.00 ? 58 GLY A HA2  11 
ATOM 11244 H HA3  . GLY A 1 58 ? 0.008   -2.142  -5.720  1.00 0.00 ? 58 GLY A HA3  11 
ATOM 11245 N N    . ASN A 1 59 ? 2.824   -1.736  -6.734  1.00 0.00 ? 59 ASN A N    11 
ATOM 11246 C CA   . ASN A 1 59 ? 4.052   -2.319  -7.263  1.00 0.00 ? 59 ASN A CA   11 
ATOM 11247 C C    . ASN A 1 59 ? 5.149   -2.333  -6.203  1.00 0.00 ? 59 ASN A C    11 
ATOM 11248 O O    . ASN A 1 59 ? 6.186   -2.973  -6.376  1.00 0.00 ? 59 ASN A O    11 
ATOM 11249 C CB   . ASN A 1 59 ? 4.524   -1.538  -8.491  1.00 0.00 ? 59 ASN A CB   11 
ATOM 11250 C CG   . ASN A 1 59 ? 3.490   -1.525  -9.600  1.00 0.00 ? 59 ASN A CG   11 
ATOM 11251 O OD1  . ASN A 1 59 ? 3.552   -2.327  -10.531 1.00 0.00 ? 59 ASN A OD1  11 
ATOM 11252 N ND2  . ASN A 1 59 ? 2.533   -0.609  -9.505  1.00 0.00 ? 59 ASN A ND2  11 
ATOM 11253 H H    . ASN A 1 59 ? 2.508   -0.880  -7.093  1.00 0.00 ? 59 ASN A H    11 
ATOM 11254 H HA   . ASN A 1 59 ? 3.836   -3.336  -7.555  1.00 0.00 ? 59 ASN A HA   11 
ATOM 11255 H HB2  . ASN A 1 59 ? 4.729   -0.517  -8.204  1.00 0.00 ? 59 ASN A HB2  11 
ATOM 11256 H HB3  . ASN A 1 59 ? 5.428   -1.989  -8.871  1.00 0.00 ? 59 ASN A HB3  11 
ATOM 11257 H HD21 . ASN A 1 59 ? 2.546   -0.003  -8.736  1.00 0.00 ? 59 ASN A HD21 11 
ATOM 11258 H HD22 . ASN A 1 59 ? 1.851   -0.579  -10.209 1.00 0.00 ? 59 ASN A HD22 11 
ATOM 11259 N N    . TYR A 1 60 ? 4.912   -1.624  -5.105  1.00 0.00 ? 60 TYR A N    11 
ATOM 11260 C CA   . TYR A 1 60 ? 5.880   -1.553  -4.017  1.00 0.00 ? 60 TYR A CA   11 
ATOM 11261 C C    . TYR A 1 60 ? 5.477   -2.473  -2.869  1.00 0.00 ? 60 TYR A C    11 
ATOM 11262 O O    . TYR A 1 60 ? 6.277   -2.759  -1.977  1.00 0.00 ? 60 TYR A O    11 
ATOM 11263 C CB   . TYR A 1 60 ? 6.006   -0.115  -3.512  1.00 0.00 ? 60 TYR A CB   11 
ATOM 11264 C CG   . TYR A 1 60 ? 6.776   0.790   -4.447  1.00 0.00 ? 60 TYR A CG   11 
ATOM 11265 C CD1  . TYR A 1 60 ? 6.280   1.103   -5.707  1.00 0.00 ? 60 TYR A CD1  11 
ATOM 11266 C CD2  . TYR A 1 60 ? 7.999   1.332   -4.072  1.00 0.00 ? 60 TYR A CD2  11 
ATOM 11267 C CE1  . TYR A 1 60 ? 6.980   1.928   -6.566  1.00 0.00 ? 60 TYR A CE1  11 
ATOM 11268 C CE2  . TYR A 1 60 ? 8.705   2.159   -4.924  1.00 0.00 ? 60 TYR A CE2  11 
ATOM 11269 C CZ   . TYR A 1 60 ? 8.192   2.454   -6.169  1.00 0.00 ? 60 TYR A CZ   11 
ATOM 11270 O OH   . TYR A 1 60 ? 8.893   3.277   -7.021  1.00 0.00 ? 60 TYR A OH   11 
ATOM 11271 H H    . TYR A 1 60 ? 4.066   -1.134  -5.024  1.00 0.00 ? 60 TYR A H    11 
ATOM 11272 H HA   . TYR A 1 60 ? 6.836   -1.874  -4.402  1.00 0.00 ? 60 TYR A HA   11 
ATOM 11273 H HB2  . TYR A 1 60 ? 5.020   0.303   -3.384  1.00 0.00 ? 60 TYR A HB2  11 
ATOM 11274 H HB3  . TYR A 1 60 ? 6.516   -0.118  -2.559  1.00 0.00 ? 60 TYR A HB3  11 
ATOM 11275 H HD1  . TYR A 1 60 ? 5.330   0.689   -6.015  1.00 0.00 ? 60 TYR A HD1  11 
ATOM 11276 H HD2  . TYR A 1 60 ? 8.399   1.098   -3.096  1.00 0.00 ? 60 TYR A HD2  11 
ATOM 11277 H HE1  . TYR A 1 60 ? 6.578   2.160   -7.541  1.00 0.00 ? 60 TYR A HE1  11 
ATOM 11278 H HE2  . TYR A 1 60 ? 9.654   2.571   -4.614  1.00 0.00 ? 60 TYR A HE2  11 
ATOM 11279 H HH   . TYR A 1 60 ? 8.672   3.060   -7.929  1.00 0.00 ? 60 TYR A HH   11 
ATOM 11280 N N    . VAL A 1 61 ? 4.231   -2.935  -2.898  1.00 0.00 ? 61 VAL A N    11 
ATOM 11281 C CA   . VAL A 1 61 ? 3.721   -3.825  -1.862  1.00 0.00 ? 61 VAL A CA   11 
ATOM 11282 C C    . VAL A 1 61 ? 3.271   -5.156  -2.453  1.00 0.00 ? 61 VAL A C    11 
ATOM 11283 O O    . VAL A 1 61 ? 3.251   -5.330  -3.671  1.00 0.00 ? 61 VAL A O    11 
ATOM 11284 C CB   . VAL A 1 61 ? 2.540   -3.187  -1.106  1.00 0.00 ? 61 VAL A CB   11 
ATOM 11285 C CG1  . VAL A 1 61 ? 2.926   -1.815  -0.572  1.00 0.00 ? 61 VAL A CG1  11 
ATOM 11286 C CG2  . VAL A 1 61 ? 1.319   -3.093  -2.007  1.00 0.00 ? 61 VAL A CG2  11 
ATOM 11287 H H    . VAL A 1 61 ? 3.641   -2.671  -3.634  1.00 0.00 ? 61 VAL A H    11 
ATOM 11288 H HA   . VAL A 1 61 ? 4.518   -4.006  -1.155  1.00 0.00 ? 61 VAL A HA   11 
ATOM 11289 H HB   . VAL A 1 61 ? 2.293   -3.819  -0.265  1.00 0.00 ? 61 VAL A HB   11 
ATOM 11290 H HG11 . VAL A 1 61 ? 3.475   -1.930  0.351   1.00 0.00 ? 61 VAL A HG11 11 
ATOM 11291 H HG12 . VAL A 1 61 ? 3.542   -1.307  -1.299  1.00 0.00 ? 61 VAL A HG12 11 
ATOM 11292 H HG13 . VAL A 1 61 ? 2.032   -1.236  -0.389  1.00 0.00 ? 61 VAL A HG13 11 
ATOM 11293 H HG21 . VAL A 1 61 ? 1.137   -2.059  -2.260  1.00 0.00 ? 61 VAL A HG21 11 
ATOM 11294 H HG22 . VAL A 1 61 ? 1.494   -3.658  -2.911  1.00 0.00 ? 61 VAL A HG22 11 
ATOM 11295 H HG23 . VAL A 1 61 ? 0.459   -3.495  -1.493  1.00 0.00 ? 61 VAL A HG23 11 
ATOM 11296 N N    . ALA A 1 62 ? 2.911   -6.093  -1.582  1.00 0.00 ? 62 ALA A N    11 
ATOM 11297 C CA   . ALA A 1 62 ? 2.460   -7.408  -2.017  1.00 0.00 ? 62 ALA A CA   11 
ATOM 11298 C C    . ALA A 1 62 ? 1.520   -8.033  -0.992  1.00 0.00 ? 62 ALA A C    11 
ATOM 11299 O O    . ALA A 1 62 ? 1.658   -7.834  0.215   1.00 0.00 ? 62 ALA A O    11 
ATOM 11300 C CB   . ALA A 1 62 ? 3.652   -8.320  -2.268  1.00 0.00 ? 62 ALA A CB   11 
ATOM 11301 H H    . ALA A 1 62 ? 2.949   -5.894  -0.623  1.00 0.00 ? 62 ALA A H    11 
ATOM 11302 H HA   . ALA A 1 62 ? 1.929   -7.287  -2.951  1.00 0.00 ? 62 ALA A HA   11 
ATOM 11303 H HB1  . ALA A 1 62 ? 3.409   -9.022  -3.052  1.00 0.00 ? 62 ALA A HB1  11 
ATOM 11304 H HB2  . ALA A 1 62 ? 4.503   -7.725  -2.566  1.00 0.00 ? 62 ALA A HB2  11 
ATOM 11305 H HB3  . ALA A 1 62 ? 3.889   -8.859  -1.363  1.00 0.00 ? 62 ALA A HB3  11 
ATOM 11306 N N    . PRO A 1 63 ? 0.540   -8.808  -1.481  1.00 0.00 ? 63 PRO A N    11 
ATOM 11307 C CA   . PRO A 1 63 ? -0.443  -9.477  -0.624  1.00 0.00 ? 63 PRO A CA   11 
ATOM 11308 C C    . PRO A 1 63 ? 0.175   -10.607 0.193   1.00 0.00 ? 63 PRO A C    11 
ATOM 11309 O O    . PRO A 1 63 ? 0.327   -11.728 -0.294  1.00 0.00 ? 63 PRO A O    11 
ATOM 11310 C CB   . PRO A 1 63 ? -1.462  -10.034 -1.621  1.00 0.00 ? 63 PRO A CB   11 
ATOM 11311 C CG   . PRO A 1 63 ? -0.700  -10.198 -2.890  1.00 0.00 ? 63 PRO A CG   11 
ATOM 11312 C CD   . PRO A 1 63 ? 0.316   -9.089  -2.909  1.00 0.00 ? 63 PRO A CD   11 
ATOM 11313 H HA   . PRO A 1 63 ? -0.931  -8.779  0.041   1.00 0.00 ? 63 PRO A HA   11 
ATOM 11314 H HB2  . PRO A 1 63 ? -1.840  -10.981 -1.261  1.00 0.00 ? 63 PRO A HB2  11 
ATOM 11315 H HB3  . PRO A 1 63 ? -2.277  -9.335  -1.737  1.00 0.00 ? 63 PRO A HB3  11 
ATOM 11316 H HG2  . PRO A 1 63 ? -0.208  -11.158 -2.902  1.00 0.00 ? 63 PRO A HG2  11 
ATOM 11317 H HG3  . PRO A 1 63 ? -1.369  -10.107 -3.734  1.00 0.00 ? 63 PRO A HG3  11 
ATOM 11318 H HD2  . PRO A 1 63 ? 1.227   -9.421  -3.385  1.00 0.00 ? 63 PRO A HD2  11 
ATOM 11319 H HD3  . PRO A 1 63 ? -0.082  -8.221  -3.415  1.00 0.00 ? 63 PRO A HD3  11 
ATOM 11320 N N    . VAL A 1 64 ? 0.530   -10.305 1.438   1.00 0.00 ? 64 VAL A N    11 
ATOM 11321 C CA   . VAL A 1 64 ? 1.131   -11.296 2.323   1.00 0.00 ? 64 VAL A CA   11 
ATOM 11322 C C    . VAL A 1 64 ? 0.105   -12.335 2.761   1.00 0.00 ? 64 VAL A C    11 
ATOM 11323 O O    . VAL A 1 64 ? 0.459   -13.452 3.138   1.00 0.00 ? 64 VAL A O    11 
ATOM 11324 C CB   . VAL A 1 64 ? 1.742   -10.635 3.573   1.00 0.00 ? 64 VAL A CB   11 
ATOM 11325 C CG1  . VAL A 1 64 ? 0.805   -9.572  4.127   1.00 0.00 ? 64 VAL A CG1  11 
ATOM 11326 C CG2  . VAL A 1 64 ? 2.056   -11.683 4.630   1.00 0.00 ? 64 VAL A CG2  11 
ATOM 11327 H H    . VAL A 1 64 ? 0.384   -9.394  1.769   1.00 0.00 ? 64 VAL A H    11 
ATOM 11328 H HA   . VAL A 1 64 ? 1.923   -11.792 1.781   1.00 0.00 ? 64 VAL A HA   11 
ATOM 11329 H HB   . VAL A 1 64 ? 2.666   -10.155 3.286   1.00 0.00 ? 64 VAL A HB   11 
ATOM 11330 H HG11 . VAL A 1 64 ? 0.863   -9.568  5.205   1.00 0.00 ? 64 VAL A HG11 11 
ATOM 11331 H HG12 . VAL A 1 64 ? 1.095   -8.603  3.746   1.00 0.00 ? 64 VAL A HG12 11 
ATOM 11332 H HG13 . VAL A 1 64 ? -0.208  -9.790  3.822   1.00 0.00 ? 64 VAL A HG13 11 
ATOM 11333 H HG21 . VAL A 1 64 ? 2.728   -11.263 5.363   1.00 0.00 ? 64 VAL A HG21 11 
ATOM 11334 H HG22 . VAL A 1 64 ? 1.141   -11.991 5.116   1.00 0.00 ? 64 VAL A HG22 11 
ATOM 11335 H HG23 . VAL A 1 64 ? 2.520   -12.538 4.162   1.00 0.00 ? 64 VAL A HG23 11 
ATOM 11336 N N    . SER A 1 65 ? -1.169  -11.959 2.709   1.00 0.00 ? 65 SER A N    11 
ATOM 11337 C CA   . SER A 1 65 ? -2.248  -12.857 3.104   1.00 0.00 ? 65 SER A CA   11 
ATOM 11338 C C    . SER A 1 65 ? -2.091  -14.221 2.437   1.00 0.00 ? 65 SER A C    11 
ATOM 11339 O O    . SER A 1 65 ? -2.596  -15.228 2.931   1.00 0.00 ? 65 SER A O    11 
ATOM 11340 C CB   . SER A 1 65 ? -3.604  -12.251 2.738   1.00 0.00 ? 65 SER A CB   11 
ATOM 11341 O OG   . SER A 1 65 ? -4.000  -12.636 1.433   1.00 0.00 ? 65 SER A OG   11 
ATOM 11342 H H    . SER A 1 65 ? -1.388  -11.055 2.400   1.00 0.00 ? 65 SER A H    11 
ATOM 11343 H HA   . SER A 1 65 ? -2.197  -12.986 4.175   1.00 0.00 ? 65 SER A HA   11 
ATOM 11344 H HB2  . SER A 1 65 ? -4.349  -12.591 3.442   1.00 0.00 ? 65 SER A HB2  11 
ATOM 11345 H HB3  . SER A 1 65 ? -3.536  -11.174 2.778   1.00 0.00 ? 65 SER A HB3  11 
ATOM 11346 H HG   . SER A 1 65 ? -4.133  -11.852 0.895   1.00 0.00 ? 65 SER A HG   11 
ATOM 11347 N N    . GLY A 1 66 ? -1.386  -14.244 1.309   1.00 0.00 ? 66 GLY A N    11 
ATOM 11348 C CA   . GLY A 1 66 ? -1.174  -15.487 0.592   1.00 0.00 ? 66 GLY A CA   11 
ATOM 11349 C C    . GLY A 1 66 ? -0.926  -16.658 1.522   1.00 0.00 ? 66 GLY A C    11 
ATOM 11350 O O    . GLY A 1 66 ? -0.327  -16.515 2.588   1.00 0.00 ? 66 GLY A O    11 
ATOM 11351 H H    . GLY A 1 66 ? -1.006  -13.409 0.962   1.00 0.00 ? 66 GLY A H    11 
ATOM 11352 H HA2  . GLY A 1 66 ? -2.047  -15.697 -0.008  1.00 0.00 ? 66 GLY A HA2  11 
ATOM 11353 H HA3  . GLY A 1 66 ? -0.321  -15.373 -0.060  1.00 0.00 ? 66 GLY A HA3  11 
ATOM 11354 N N    . PRO A 1 67 ? -1.393  -17.849 1.119   1.00 0.00 ? 67 PRO A N    11 
ATOM 11355 C CA   . PRO A 1 67 ? -1.231  -19.072 1.910   1.00 0.00 ? 67 PRO A CA   11 
ATOM 11356 C C    . PRO A 1 67 ? 0.217   -19.546 1.954   1.00 0.00 ? 67 PRO A C    11 
ATOM 11357 O O    . PRO A 1 67 ? 0.594   -20.343 2.813   1.00 0.00 ? 67 PRO A O    11 
ATOM 11358 C CB   . PRO A 1 67 ? -2.105  -20.090 1.173   1.00 0.00 ? 67 PRO A CB   11 
ATOM 11359 C CG   . PRO A 1 67 ? -2.163  -19.593 -0.230  1.00 0.00 ? 67 PRO A CG   11 
ATOM 11360 C CD   . PRO A 1 67 ? -2.116  -18.092 -0.140  1.00 0.00 ? 67 PRO A CD   11 
ATOM 11361 H HA   . PRO A 1 67 ? -1.598  -18.944 2.918   1.00 0.00 ? 67 PRO A HA   11 
ATOM 11362 H HB2  . PRO A 1 67 ? -1.647  -21.068 1.228   1.00 0.00 ? 67 PRO A HB2  11 
ATOM 11363 H HB3  . PRO A 1 67 ? -3.086  -20.120 1.622   1.00 0.00 ? 67 PRO A HB3  11 
ATOM 11364 H HG2  . PRO A 1 67 ? -1.315  -19.962 -0.786  1.00 0.00 ? 67 PRO A HG2  11 
ATOM 11365 H HG3  . PRO A 1 67 ? -3.085  -19.911 -0.694  1.00 0.00 ? 67 PRO A HG3  11 
ATOM 11366 H HD2  . PRO A 1 67 ? -1.577  -17.681 -0.981  1.00 0.00 ? 67 PRO A HD2  11 
ATOM 11367 H HD3  . PRO A 1 67 ? -3.116  -17.686 -0.095  1.00 0.00 ? 67 PRO A HD3  11 
ATOM 11368 N N    . SER A 1 68 ? 1.026   -19.050 1.023   1.00 0.00 ? 68 SER A N    11 
ATOM 11369 C CA   . SER A 1 68 ? 2.433   -19.426 0.954   1.00 0.00 ? 68 SER A CA   11 
ATOM 11370 C C    . SER A 1 68 ? 3.152   -19.081 2.254   1.00 0.00 ? 68 SER A C    11 
ATOM 11371 O O    . SER A 1 68 ? 3.328   -17.909 2.587   1.00 0.00 ? 68 SER A O    11 
ATOM 11372 C CB   . SER A 1 68 ? 3.114   -18.722 -0.221  1.00 0.00 ? 68 SER A CB   11 
ATOM 11373 O OG   . SER A 1 68 ? 3.110   -17.316 -0.045  1.00 0.00 ? 68 SER A OG   11 
ATOM 11374 H H    . SER A 1 68 ? 0.667   -18.418 0.366   1.00 0.00 ? 68 SER A H    11 
ATOM 11375 H HA   . SER A 1 68 ? 2.484   -20.494 0.801   1.00 0.00 ? 68 SER A HA   11 
ATOM 11376 H HB2  . SER A 1 68 ? 4.136   -19.060 -0.297  1.00 0.00 ? 68 SER A HB2  11 
ATOM 11377 H HB3  . SER A 1 68 ? 2.587   -18.960 -1.134  1.00 0.00 ? 68 SER A HB3  11 
ATOM 11378 H HG   . SER A 1 68 ? 2.209   -16.989 -0.100  1.00 0.00 ? 68 SER A HG   11 
ATOM 11379 N N    . SER A 1 69 ? 3.566   -20.110 2.986   1.00 0.00 ? 69 SER A N    11 
ATOM 11380 C CA   . SER A 1 69 ? 4.263   -19.917 4.252   1.00 0.00 ? 69 SER A CA   11 
ATOM 11381 C C    . SER A 1 69 ? 5.417   -18.933 4.092   1.00 0.00 ? 69 SER A C    11 
ATOM 11382 O O    . SER A 1 69 ? 5.940   -18.744 2.995   1.00 0.00 ? 69 SER A O    11 
ATOM 11383 C CB   . SER A 1 69 ? 4.787   -21.254 4.779   1.00 0.00 ? 69 SER A CB   11 
ATOM 11384 O OG   . SER A 1 69 ? 3.756   -21.994 5.409   1.00 0.00 ? 69 SER A OG   11 
ATOM 11385 H H    . SER A 1 69 ? 3.396   -21.022 2.668   1.00 0.00 ? 69 SER A H    11 
ATOM 11386 H HA   . SER A 1 69 ? 3.556   -19.513 4.961   1.00 0.00 ? 69 SER A HA   11 
ATOM 11387 H HB2  . SER A 1 69 ? 5.179   -21.834 3.957   1.00 0.00 ? 69 SER A HB2  11 
ATOM 11388 H HB3  . SER A 1 69 ? 5.573   -21.071 5.498   1.00 0.00 ? 69 SER A HB3  11 
ATOM 11389 H HG   . SER A 1 69 ? 3.587   -21.630 6.281   1.00 0.00 ? 69 SER A HG   11 
ATOM 11390 N N    . GLY A 1 70 ? 5.810   -18.306 5.198   1.00 0.00 ? 70 GLY A N    11 
ATOM 11391 C CA   . GLY A 1 70 ? 6.900   -17.348 5.160   1.00 0.00 ? 70 GLY A CA   11 
ATOM 11392 C C    . GLY A 1 70 ? 7.053   -16.592 6.465   1.00 0.00 ? 70 GLY A C    11 
ATOM 11393 O O    . GLY A 1 70 ? 6.639   -17.072 7.520   1.00 0.00 ? 70 GLY A O    11 
ATOM 11394 H H    . GLY A 1 70 ? 5.357   -18.496 6.045   1.00 0.00 ? 70 GLY A H    11 
ATOM 11395 H HA2  . GLY A 1 70 ? 7.820   -17.874 4.950   1.00 0.00 ? 70 GLY A HA2  11 
ATOM 11396 H HA3  . GLY A 1 70 ? 6.713   -16.639 4.366   1.00 0.00 ? 70 GLY A HA3  11 
ATOM 11397 N N    . GLY A 1 1  ? -16.949 -6.116  19.974  1.00 0.00 ? 1  GLY A N    12 
ATOM 11398 C CA   . GLY A 1 1  ? -17.708 -4.934  19.612  1.00 0.00 ? 1  GLY A CA   12 
ATOM 11399 C C    . GLY A 1 1  ? -18.843 -5.244  18.656  1.00 0.00 ? 1  GLY A C    12 
ATOM 11400 O O    . GLY A 1 1  ? -19.220 -6.403  18.484  1.00 0.00 ? 1  GLY A O    12 
ATOM 11401 H H1   . GLY A 1 1  ? -17.214 -6.646  20.755  1.00 0.00 ? 1  GLY A H1   12 
ATOM 11402 H HA2  . GLY A 1 1  ? -18.117 -4.493  20.509  1.00 0.00 ? 1  GLY A HA2  12 
ATOM 11403 H HA3  . GLY A 1 1  ? -17.043 -4.223  19.144  1.00 0.00 ? 1  GLY A HA3  12 
ATOM 11404 N N    . SER A 1 2  ? -19.389 -4.205  18.032  1.00 0.00 ? 2  SER A N    12 
ATOM 11405 C CA   . SER A 1 2  ? -20.492 -4.371  17.093  1.00 0.00 ? 2  SER A CA   12 
ATOM 11406 C C    . SER A 1 2  ? -20.025 -5.089  15.830  1.00 0.00 ? 2  SER A C    12 
ATOM 11407 O O    . SER A 1 2  ? -20.640 -6.062  15.392  1.00 0.00 ? 2  SER A O    12 
ATOM 11408 C CB   . SER A 1 2  ? -21.089 -3.011  16.728  1.00 0.00 ? 2  SER A CB   12 
ATOM 11409 O OG   . SER A 1 2  ? -20.132 -2.190  16.082  1.00 0.00 ? 2  SER A OG   12 
ATOM 11410 H H    . SER A 1 2  ? -19.045 -3.305  18.211  1.00 0.00 ? 2  SER A H    12 
ATOM 11411 H HA   . SER A 1 2  ? -21.250 -4.970  17.574  1.00 0.00 ? 2  SER A HA   12 
ATOM 11412 H HB2  . SER A 1 2  ? -21.928 -3.155  16.065  1.00 0.00 ? 2  SER A HB2  12 
ATOM 11413 H HB3  . SER A 1 2  ? -21.422 -2.514  17.628  1.00 0.00 ? 2  SER A HB3  12 
ATOM 11414 H HG   . SER A 1 2  ? -20.297 -2.189  15.136  1.00 0.00 ? 2  SER A HG   12 
ATOM 11415 N N    . SER A 1 3  ? -18.934 -4.602  15.249  1.00 0.00 ? 3  SER A N    12 
ATOM 11416 C CA   . SER A 1 3  ? -18.386 -5.194  14.034  1.00 0.00 ? 3  SER A CA   12 
ATOM 11417 C C    . SER A 1 3  ? -16.861 -5.133  14.040  1.00 0.00 ? 3  SER A C    12 
ATOM 11418 O O    . SER A 1 3  ? -16.263 -4.340  14.766  1.00 0.00 ? 3  SER A O    12 
ATOM 11419 C CB   . SER A 1 3  ? -18.931 -4.473  12.799  1.00 0.00 ? 3  SER A CB   12 
ATOM 11420 O OG   . SER A 1 3  ? -18.762 -5.260  11.633  1.00 0.00 ? 3  SER A OG   12 
ATOM 11421 H H    . SER A 1 3  ? -18.488 -3.824  15.645  1.00 0.00 ? 3  SER A H    12 
ATOM 11422 H HA   . SER A 1 3  ? -18.693 -6.228  14.001  1.00 0.00 ? 3  SER A HA   12 
ATOM 11423 H HB2  . SER A 1 3  ? -19.983 -4.275  12.936  1.00 0.00 ? 3  SER A HB2  12 
ATOM 11424 H HB3  . SER A 1 3  ? -18.403 -3.539  12.669  1.00 0.00 ? 3  SER A HB3  12 
ATOM 11425 H HG   . SER A 1 3  ? -19.557 -5.775  11.476  1.00 0.00 ? 3  SER A HG   12 
ATOM 11426 N N    . GLY A 1 4  ? -16.238 -5.978  13.224  1.00 0.00 ? 4  GLY A N    12 
ATOM 11427 C CA   . GLY A 1 4  ? -14.789 -6.005  13.150  1.00 0.00 ? 4  GLY A CA   12 
ATOM 11428 C C    . GLY A 1 4  ? -14.275 -5.760  11.745  1.00 0.00 ? 4  GLY A C    12 
ATOM 11429 O O    . GLY A 1 4  ? -14.007 -6.703  11.001  1.00 0.00 ? 4  GLY A O    12 
ATOM 11430 H H    . GLY A 1 4  ? -16.767 -6.587  12.667  1.00 0.00 ? 4  GLY A H    12 
ATOM 11431 H HA2  . GLY A 1 4  ? -14.392 -5.245  13.806  1.00 0.00 ? 4  GLY A HA2  12 
ATOM 11432 H HA3  . GLY A 1 4  ? -14.441 -6.972  13.484  1.00 0.00 ? 4  GLY A HA3  12 
ATOM 11433 N N    . SER A 1 5  ? -14.139 -4.489  11.380  1.00 0.00 ? 5  SER A N    12 
ATOM 11434 C CA   . SER A 1 5  ? -13.660 -4.122  10.053  1.00 0.00 ? 5  SER A CA   12 
ATOM 11435 C C    . SER A 1 5  ? -12.136 -4.162  9.996   1.00 0.00 ? 5  SER A C    12 
ATOM 11436 O O    . SER A 1 5  ? -11.457 -3.693  10.909  1.00 0.00 ? 5  SER A O    12 
ATOM 11437 C CB   . SER A 1 5  ? -14.159 -2.726  9.675   1.00 0.00 ? 5  SER A CB   12 
ATOM 11438 O OG   . SER A 1 5  ? -13.629 -2.315  8.427   1.00 0.00 ? 5  SER A OG   12 
ATOM 11439 H H    . SER A 1 5  ? -14.370 -3.781  12.018  1.00 0.00 ? 5  SER A H    12 
ATOM 11440 H HA   . SER A 1 5  ? -14.054 -4.838  9.348   1.00 0.00 ? 5  SER A HA   12 
ATOM 11441 H HB2  . SER A 1 5  ? -15.236 -2.737  9.609   1.00 0.00 ? 5  SER A HB2  12 
ATOM 11442 H HB3  . SER A 1 5  ? -13.852 -2.019  10.433  1.00 0.00 ? 5  SER A HB3  12 
ATOM 11443 H HG   . SER A 1 5  ? -13.399 -3.088  7.906   1.00 0.00 ? 5  SER A HG   12 
ATOM 11444 N N    . SER A 1 6  ? -11.605 -4.726  8.915   1.00 0.00 ? 6  SER A N    12 
ATOM 11445 C CA   . SER A 1 6  ? -10.161 -4.832  8.739   1.00 0.00 ? 6  SER A CA   12 
ATOM 11446 C C    . SER A 1 6  ? -9.814  -5.177  7.294   1.00 0.00 ? 6  SER A C    12 
ATOM 11447 O O    . SER A 1 6  ? -10.163 -6.247  6.798   1.00 0.00 ? 6  SER A O    12 
ATOM 11448 C CB   . SER A 1 6  ? -9.588  -5.893  9.680   1.00 0.00 ? 6  SER A CB   12 
ATOM 11449 O OG   . SER A 1 6  ? -8.303  -6.311  9.255   1.00 0.00 ? 6  SER A OG   12 
ATOM 11450 H H    . SER A 1 6  ? -12.199 -5.081  8.221   1.00 0.00 ? 6  SER A H    12 
ATOM 11451 H HA   . SER A 1 6  ? -9.727  -3.874  8.983   1.00 0.00 ? 6  SER A HA   12 
ATOM 11452 H HB2  . SER A 1 6  ? -9.509  -5.482  10.675  1.00 0.00 ? 6  SER A HB2  12 
ATOM 11453 H HB3  . SER A 1 6  ? -10.246 -6.750  9.695   1.00 0.00 ? 6  SER A HB3  12 
ATOM 11454 H HG   . SER A 1 6  ? -7.929  -6.909  9.905   1.00 0.00 ? 6  SER A HG   12 
ATOM 11455 N N    . GLY A 1 7  ? -9.125  -4.259  6.622   1.00 0.00 ? 7  GLY A N    12 
ATOM 11456 C CA   . GLY A 1 7  ? -8.742  -4.483  5.241   1.00 0.00 ? 7  GLY A CA   12 
ATOM 11457 C C    . GLY A 1 7  ? -7.886  -5.723  5.070   1.00 0.00 ? 7  GLY A C    12 
ATOM 11458 O O    . GLY A 1 7  ? -7.858  -6.593  5.942   1.00 0.00 ? 7  GLY A O    12 
ATOM 11459 H H    . GLY A 1 7  ? -8.875  -3.423  7.069   1.00 0.00 ? 7  GLY A H    12 
ATOM 11460 H HA2  . GLY A 1 7  ? -9.635  -4.590  4.644   1.00 0.00 ? 7  GLY A HA2  12 
ATOM 11461 H HA3  . GLY A 1 7  ? -8.186  -3.626  4.889   1.00 0.00 ? 7  GLY A HA3  12 
ATOM 11462 N N    . THR A 1 8  ? -7.186  -5.807  3.943   1.00 0.00 ? 8  THR A N    12 
ATOM 11463 C CA   . THR A 1 8  ? -6.328  -6.950  3.659   1.00 0.00 ? 8  THR A CA   12 
ATOM 11464 C C    . THR A 1 8  ? -4.878  -6.653  4.024   1.00 0.00 ? 8  THR A C    12 
ATOM 11465 O O    . THR A 1 8  ? -4.351  -5.576  3.745   1.00 0.00 ? 8  THR A O    12 
ATOM 11466 C CB   . THR A 1 8  ? -6.400  -7.352  2.174   1.00 0.00 ? 8  THR A CB   12 
ATOM 11467 O OG1  . THR A 1 8  ? -7.767  -7.449  1.758   1.00 0.00 ? 8  THR A OG1  12 
ATOM 11468 C CG2  . THR A 1 8  ? -5.698  -8.681  1.938   1.00 0.00 ? 8  THR A CG2  12 
ATOM 11469 H H    . THR A 1 8  ? -7.250  -5.082  3.287   1.00 0.00 ? 8  THR A H    12 
ATOM 11470 H HA   . THR A 1 8  ? -6.675  -7.783  4.253   1.00 0.00 ? 8  THR A HA   12 
ATOM 11471 H HB   . THR A 1 8  ? -5.907  -6.591  1.587   1.00 0.00 ? 8  THR A HB   12 
ATOM 11472 H HG1  . THR A 1 8  ? -8.298  -6.820  2.254   1.00 0.00 ? 8  THR A HG1  12 
ATOM 11473 H HG21 . THR A 1 8  ? -6.242  -9.469  2.437   1.00 0.00 ? 8  THR A HG21 12 
ATOM 11474 H HG22 . THR A 1 8  ? -4.693  -8.631  2.331   1.00 0.00 ? 8  THR A HG22 12 
ATOM 11475 H HG23 . THR A 1 8  ? -5.661  -8.884  0.879   1.00 0.00 ? 8  THR A HG23 12 
ATOM 11476 N N    . PRO A 1 9  ? -4.216  -7.630  4.662   1.00 0.00 ? 9  PRO A N    12 
ATOM 11477 C CA   . PRO A 1 9  ? -2.816  -7.496  5.077   1.00 0.00 ? 9  PRO A CA   12 
ATOM 11478 C C    . PRO A 1 9  ? -1.858  -7.487  3.891   1.00 0.00 ? 9  PRO A C    12 
ATOM 11479 O O    . PRO A 1 9  ? -2.008  -8.271  2.953   1.00 0.00 ? 9  PRO A O    12 
ATOM 11480 C CB   . PRO A 1 9  ? -2.584  -8.737  5.944   1.00 0.00 ? 9  PRO A CB   12 
ATOM 11481 C CG   . PRO A 1 9  ? -3.578  -9.732  5.455   1.00 0.00 ? 9  PRO A CG   12 
ATOM 11482 C CD   . PRO A 1 9  ? -4.782  -8.939  5.027   1.00 0.00 ? 9  PRO A CD   12 
ATOM 11483 H HA   . PRO A 1 9  ? -2.662  -6.607  5.670   1.00 0.00 ? 9  PRO A HA   12 
ATOM 11484 H HB2  . PRO A 1 9  ? -1.571  -9.089  5.807   1.00 0.00 ? 9  PRO A HB2  12 
ATOM 11485 H HB3  . PRO A 1 9  ? -2.749  -8.491  6.982   1.00 0.00 ? 9  PRO A HB3  12 
ATOM 11486 H HG2  . PRO A 1 9  ? -3.171  -10.277 4.617   1.00 0.00 ? 9  PRO A HG2  12 
ATOM 11487 H HG3  . PRO A 1 9  ? -3.841  -10.410 6.253   1.00 0.00 ? 9  PRO A HG3  12 
ATOM 11488 H HD2  . PRO A 1 9  ? -5.258  -9.404  4.176   1.00 0.00 ? 9  PRO A HD2  12 
ATOM 11489 H HD3  . PRO A 1 9  ? -5.480  -8.842  5.845   1.00 0.00 ? 9  PRO A HD3  12 
ATOM 11490 N N    . TYR A 1 10 ? -0.873  -6.597  3.939   1.00 0.00 ? 10 TYR A N    12 
ATOM 11491 C CA   . TYR A 1 10 ? 0.109   -6.486  2.867   1.00 0.00 ? 10 TYR A CA   12 
ATOM 11492 C C    . TYR A 1 10 ? 1.501   -6.213  3.430   1.00 0.00 ? 10 TYR A C    12 
ATOM 11493 O O    . TYR A 1 10 ? 1.666   -5.997  4.631   1.00 0.00 ? 10 TYR A O    12 
ATOM 11494 C CB   . TYR A 1 10 ? -0.289  -5.372  1.897   1.00 0.00 ? 10 TYR A CB   12 
ATOM 11495 C CG   . TYR A 1 10 ? -1.198  -5.836  0.782   1.00 0.00 ? 10 TYR A CG   12 
ATOM 11496 C CD1  . TYR A 1 10 ? -2.532  -6.139  1.028   1.00 0.00 ? 10 TYR A CD1  12 
ATOM 11497 C CD2  . TYR A 1 10 ? -0.724  -5.974  -0.516  1.00 0.00 ? 10 TYR A CD2  12 
ATOM 11498 C CE1  . TYR A 1 10 ? -3.367  -6.564  0.012   1.00 0.00 ? 10 TYR A CE1  12 
ATOM 11499 C CE2  . TYR A 1 10 ? -1.552  -6.397  -1.538  1.00 0.00 ? 10 TYR A CE2  12 
ATOM 11500 C CZ   . TYR A 1 10 ? -2.872  -6.691  -1.269  1.00 0.00 ? 10 TYR A CZ   12 
ATOM 11501 O OH   . TYR A 1 10 ? -3.699  -7.114  -2.284  1.00 0.00 ? 10 TYR A OH   12 
ATOM 11502 H H    . TYR A 1 10 ? -0.805  -6.000  4.713   1.00 0.00 ? 10 TYR A H    12 
ATOM 11503 H HA   . TYR A 1 10 ? 0.126   -7.425  2.334   1.00 0.00 ? 10 TYR A HA   12 
ATOM 11504 H HB2  . TYR A 1 10 ? -0.803  -4.596  2.442   1.00 0.00 ? 10 TYR A HB2  12 
ATOM 11505 H HB3  . TYR A 1 10 ? 0.603   -4.960  1.448   1.00 0.00 ? 10 TYR A HB3  12 
ATOM 11506 H HD1  . TYR A 1 10 ? -2.917  -6.038  2.032   1.00 0.00 ? 10 TYR A HD1  12 
ATOM 11507 H HD2  . TYR A 1 10 ? 0.311   -5.743  -0.724  1.00 0.00 ? 10 TYR A HD2  12 
ATOM 11508 H HE1  . TYR A 1 10 ? -4.401  -6.794  0.223   1.00 0.00 ? 10 TYR A HE1  12 
ATOM 11509 H HE2  . TYR A 1 10 ? -1.164  -6.497  -2.541  1.00 0.00 ? 10 TYR A HE2  12 
ATOM 11510 H HH   . TYR A 1 10 ? -3.938  -6.366  -2.835  1.00 0.00 ? 10 TYR A HH   12 
ATOM 11511 N N    . ARG A 1 11 ? 2.499   -6.224  2.552   1.00 0.00 ? 11 ARG A N    12 
ATOM 11512 C CA   . ARG A 1 11 ? 3.877   -5.978  2.960   1.00 0.00 ? 11 ARG A CA   12 
ATOM 11513 C C    . ARG A 1 11 ? 4.612   -5.143  1.916   1.00 0.00 ? 11 ARG A C    12 
ATOM 11514 O O    . ARG A 1 11 ? 4.590   -5.459  0.726   1.00 0.00 ? 11 ARG A O    12 
ATOM 11515 C CB   . ARG A 1 11 ? 4.611   -7.303  3.178   1.00 0.00 ? 11 ARG A CB   12 
ATOM 11516 C CG   . ARG A 1 11 ? 6.090   -7.136  3.484   1.00 0.00 ? 11 ARG A CG   12 
ATOM 11517 C CD   . ARG A 1 11 ? 6.806   -8.477  3.516   1.00 0.00 ? 11 ARG A CD   12 
ATOM 11518 N NE   . ARG A 1 11 ? 6.701   -9.184  2.242   1.00 0.00 ? 11 ARG A NE   12 
ATOM 11519 C CZ   . ARG A 1 11 ? 5.679   -9.968  1.919   1.00 0.00 ? 11 ARG A CZ   12 
ATOM 11520 N NH1  . ARG A 1 11 ? 4.678   -10.143 2.772   1.00 0.00 ? 11 ARG A NH1  12 
ATOM 11521 N NH2  . ARG A 1 11 ? 5.655   -10.577 0.741   1.00 0.00 ? 11 ARG A NH2  12 
ATOM 11522 H H    . ARG A 1 11 ? 2.304   -6.402  1.608   1.00 0.00 ? 11 ARG A H    12 
ATOM 11523 H HA   . ARG A 1 11 ? 3.855   -5.431  3.891   1.00 0.00 ? 11 ARG A HA   12 
ATOM 11524 H HB2  . ARG A 1 11 ? 4.151   -7.824  4.004   1.00 0.00 ? 11 ARG A HB2  12 
ATOM 11525 H HB3  . ARG A 1 11 ? 4.515   -7.903  2.286   1.00 0.00 ? 11 ARG A HB3  12 
ATOM 11526 H HG2  . ARG A 1 11 ? 6.539   -6.518  2.721   1.00 0.00 ? 11 ARG A HG2  12 
ATOM 11527 H HG3  . ARG A 1 11 ? 6.197   -6.658  4.447   1.00 0.00 ? 11 ARG A HG3  12 
ATOM 11528 H HD2  . ARG A 1 11 ? 7.850   -8.308  3.737   1.00 0.00 ? 11 ARG A HD2  12 
ATOM 11529 H HD3  . ARG A 1 11 ? 6.368   -9.086  4.293   1.00 0.00 ? 11 ARG A HD3  12 
ATOM 11530 H HE   . ARG A 1 11 ? 7.430   -9.068  1.598   1.00 0.00 ? 11 ARG A HE   12 
ATOM 11531 H HH11 . ARG A 1 11 ? 4.693   -9.685  3.660   1.00 0.00 ? 11 ARG A HH11 12 
ATOM 11532 H HH12 . ARG A 1 11 ? 3.909   -10.733 2.525   1.00 0.00 ? 11 ARG A HH12 12 
ATOM 11533 H HH21 . ARG A 1 11 ? 6.407   -10.447 0.095   1.00 0.00 ? 11 ARG A HH21 12 
ATOM 11534 H HH22 . ARG A 1 11 ? 4.885   -11.167 0.499   1.00 0.00 ? 11 ARG A HH22 12 
ATOM 11535 N N    . ALA A 1 12 ? 5.261   -4.076  2.369   1.00 0.00 ? 12 ALA A N    12 
ATOM 11536 C CA   . ALA A 1 12 ? 6.004   -3.196  1.475   1.00 0.00 ? 12 ALA A CA   12 
ATOM 11537 C C    . ALA A 1 12 ? 7.376   -3.777  1.148   1.00 0.00 ? 12 ALA A C    12 
ATOM 11538 O O    . ALA A 1 12 ? 8.303   -3.693  1.952   1.00 0.00 ? 12 ALA A O    12 
ATOM 11539 C CB   . ALA A 1 12 ? 6.148   -1.814  2.094   1.00 0.00 ? 12 ALA A CB   12 
ATOM 11540 H H    . ALA A 1 12 ? 5.242   -3.876  3.328   1.00 0.00 ? 12 ALA A H    12 
ATOM 11541 H HA   . ALA A 1 12 ? 5.439   -3.097  0.559   1.00 0.00 ? 12 ALA A HA   12 
ATOM 11542 H HB1  . ALA A 1 12 ? 5.275   -1.595  2.692   1.00 0.00 ? 12 ALA A HB1  12 
ATOM 11543 H HB2  . ALA A 1 12 ? 7.028   -1.789  2.719   1.00 0.00 ? 12 ALA A HB2  12 
ATOM 11544 H HB3  . ALA A 1 12 ? 6.242   -1.077  1.310   1.00 0.00 ? 12 ALA A HB3  12 
ATOM 11545 N N    . MET A 1 13 ? 7.496   -4.366  -0.037  1.00 0.00 ? 13 MET A N    12 
ATOM 11546 C CA   . MET A 1 13 ? 8.755   -4.961  -0.470  1.00 0.00 ? 13 MET A CA   12 
ATOM 11547 C C    . MET A 1 13 ? 9.881   -3.931  -0.442  1.00 0.00 ? 13 MET A C    12 
ATOM 11548 O O    . MET A 1 13 ? 11.031  -4.263  -0.156  1.00 0.00 ? 13 MET A O    12 
ATOM 11549 C CB   . MET A 1 13 ? 8.613   -5.539  -1.879  1.00 0.00 ? 13 MET A CB   12 
ATOM 11550 C CG   . MET A 1 13 ? 7.463   -6.524  -2.019  1.00 0.00 ? 13 MET A CG   12 
ATOM 11551 S SD   . MET A 1 13 ? 7.714   -7.699  -3.363  1.00 0.00 ? 13 MET A SD   12 
ATOM 11552 C CE   . MET A 1 13 ? 6.792   -6.908  -4.680  1.00 0.00 ? 13 MET A CE   12 
ATOM 11553 H H    . MET A 1 13 ? 6.721   -4.402  -0.636  1.00 0.00 ? 13 MET A H    12 
ATOM 11554 H HA   . MET A 1 13 ? 8.997   -5.760  0.214   1.00 0.00 ? 13 MET A HA   12 
ATOM 11555 H HB2  . MET A 1 13 ? 8.451   -4.729  -2.574  1.00 0.00 ? 13 MET A HB2  12 
ATOM 11556 H HB3  . MET A 1 13 ? 9.528   -6.050  -2.141  1.00 0.00 ? 13 MET A HB3  12 
ATOM 11557 H HG2  . MET A 1 13 ? 7.362   -7.073  -1.095  1.00 0.00 ? 13 MET A HG2  12 
ATOM 11558 H HG3  . MET A 1 13 ? 6.555   -5.970  -2.207  1.00 0.00 ? 13 MET A HG3  12 
ATOM 11559 H HE1  . MET A 1 13 ? 6.925   -7.464  -5.597  1.00 0.00 ? 13 MET A HE1  12 
ATOM 11560 H HE2  . MET A 1 13 ? 5.744   -6.886  -4.422  1.00 0.00 ? 13 MET A HE2  12 
ATOM 11561 H HE3  . MET A 1 13 ? 7.152   -5.899  -4.815  1.00 0.00 ? 13 MET A HE3  12 
ATOM 11562 N N    . TYR A 1 14 ? 9.541   -2.682  -0.740  1.00 0.00 ? 14 TYR A N    12 
ATOM 11563 C CA   . TYR A 1 14 ? 10.524  -1.605  -0.751  1.00 0.00 ? 14 TYR A CA   12 
ATOM 11564 C C    . TYR A 1 14 ? 9.946   -0.335  -0.135  1.00 0.00 ? 14 TYR A C    12 
ATOM 11565 O O    . TYR A 1 14 ? 8.732   -0.201  0.015   1.00 0.00 ? 14 TYR A O    12 
ATOM 11566 C CB   . TYR A 1 14 ? 10.988  -1.325  -2.181  1.00 0.00 ? 14 TYR A CB   12 
ATOM 11567 C CG   . TYR A 1 14 ? 11.007  -2.554  -3.063  1.00 0.00 ? 14 TYR A CG   12 
ATOM 11568 C CD1  . TYR A 1 14 ? 12.086  -3.430  -3.045  1.00 0.00 ? 14 TYR A CD1  12 
ATOM 11569 C CD2  . TYR A 1 14 ? 9.947   -2.838  -3.915  1.00 0.00 ? 14 TYR A CD2  12 
ATOM 11570 C CE1  . TYR A 1 14 ? 12.108  -4.553  -3.849  1.00 0.00 ? 14 TYR A CE1  12 
ATOM 11571 C CE2  . TYR A 1 14 ? 9.960   -3.959  -4.722  1.00 0.00 ? 14 TYR A CE2  12 
ATOM 11572 C CZ   . TYR A 1 14 ? 11.042  -4.813  -4.685  1.00 0.00 ? 14 TYR A CZ   12 
ATOM 11573 O OH   . TYR A 1 14 ? 11.059  -5.931  -5.488  1.00 0.00 ? 14 TYR A OH   12 
ATOM 11574 H H    . TYR A 1 14 ? 8.608   -2.480  -0.959  1.00 0.00 ? 14 TYR A H    12 
ATOM 11575 H HA   . TYR A 1 14 ? 11.372  -1.924  -0.163  1.00 0.00 ? 14 TYR A HA   12 
ATOM 11576 H HB2  . TYR A 1 14 ? 10.326  -0.604  -2.633  1.00 0.00 ? 14 TYR A HB2  12 
ATOM 11577 H HB3  . TYR A 1 14 ? 11.990  -0.921  -2.155  1.00 0.00 ? 14 TYR A HB3  12 
ATOM 11578 H HD1  . TYR A 1 14 ? 12.919  -3.223  -2.388  1.00 0.00 ? 14 TYR A HD1  12 
ATOM 11579 H HD2  . TYR A 1 14 ? 9.101   -2.166  -3.942  1.00 0.00 ? 14 TYR A HD2  12 
ATOM 11580 H HE1  . TYR A 1 14 ? 12.955  -5.222  -3.820  1.00 0.00 ? 14 TYR A HE1  12 
ATOM 11581 H HE2  . TYR A 1 14 ? 9.126   -4.163  -5.377  1.00 0.00 ? 14 TYR A HE2  12 
ATOM 11582 H HH   . TYR A 1 14 ? 10.717  -6.682  -4.998  1.00 0.00 ? 14 TYR A HH   12 
ATOM 11583 N N    . GLN A 1 15 ? 10.827  0.596   0.220   1.00 0.00 ? 15 GLN A N    12 
ATOM 11584 C CA   . GLN A 1 15 ? 10.405  1.856   0.821   1.00 0.00 ? 15 GLN A CA   12 
ATOM 11585 C C    . GLN A 1 15 ? 9.948   2.843   -0.248  1.00 0.00 ? 15 GLN A C    12 
ATOM 11586 O O    . GLN A 1 15 ? 10.523  2.906   -1.335  1.00 0.00 ? 15 GLN A O    12 
ATOM 11587 C CB   . GLN A 1 15 ? 11.547  2.463   1.637   1.00 0.00 ? 15 GLN A CB   12 
ATOM 11588 C CG   . GLN A 1 15 ? 11.186  3.781   2.303   1.00 0.00 ? 15 GLN A CG   12 
ATOM 11589 C CD   . GLN A 1 15 ? 12.169  4.177   3.386   1.00 0.00 ? 15 GLN A CD   12 
ATOM 11590 O OE1  . GLN A 1 15 ? 13.269  3.631   3.472   1.00 0.00 ? 15 GLN A OE1  12 
ATOM 11591 N NE2  . GLN A 1 15 ? 11.778  5.133   4.221   1.00 0.00 ? 15 GLN A NE2  12 
ATOM 11592 H H    . GLN A 1 15 ? 11.781  0.431   0.076   1.00 0.00 ? 15 GLN A H    12 
ATOM 11593 H HA   . GLN A 1 15 ? 9.575   1.648   1.479   1.00 0.00 ? 15 GLN A HA   12 
ATOM 11594 H HB2  . GLN A 1 15 ? 11.836  1.763   2.407   1.00 0.00 ? 15 GLN A HB2  12 
ATOM 11595 H HB3  . GLN A 1 15 ? 12.390  2.635   0.983   1.00 0.00 ? 15 GLN A HB3  12 
ATOM 11596 H HG2  . GLN A 1 15 ? 11.170  4.557   1.551   1.00 0.00 ? 15 GLN A HG2  12 
ATOM 11597 H HG3  . GLN A 1 15 ? 10.204  3.690   2.743   1.00 0.00 ? 15 GLN A HG3  12 
ATOM 11598 H HE21 . GLN A 1 15 ? 10.887  5.522   4.093   1.00 0.00 ? 15 GLN A HE21 12 
ATOM 11599 H HE22 . GLN A 1 15 ? 12.393  5.408   4.931   1.00 0.00 ? 15 GLN A HE22 12 
ATOM 11600 N N    . TYR A 1 16 ? 8.911   3.610   0.067   1.00 0.00 ? 16 TYR A N    12 
ATOM 11601 C CA   . TYR A 1 16 ? 8.374   4.592   -0.869  1.00 0.00 ? 16 TYR A CA   12 
ATOM 11602 C C    . TYR A 1 16 ? 8.435   5.997   -0.277  1.00 0.00 ? 16 TYR A C    12 
ATOM 11603 O O    . TYR A 1 16 ? 8.361   6.174   0.939   1.00 0.00 ? 16 TYR A O    12 
ATOM 11604 C CB   . TYR A 1 16 ? 6.931   4.242   -1.235  1.00 0.00 ? 16 TYR A CB   12 
ATOM 11605 C CG   . TYR A 1 16 ? 6.289   5.234   -2.179  1.00 0.00 ? 16 TYR A CG   12 
ATOM 11606 C CD1  . TYR A 1 16 ? 6.666   5.297   -3.515  1.00 0.00 ? 16 TYR A CD1  12 
ATOM 11607 C CD2  . TYR A 1 16 ? 5.304   6.108   -1.735  1.00 0.00 ? 16 TYR A CD2  12 
ATOM 11608 C CE1  . TYR A 1 16 ? 6.083   6.202   -4.380  1.00 0.00 ? 16 TYR A CE1  12 
ATOM 11609 C CE2  . TYR A 1 16 ? 4.714   7.016   -2.593  1.00 0.00 ? 16 TYR A CE2  12 
ATOM 11610 C CZ   . TYR A 1 16 ? 5.107   7.059   -3.914  1.00 0.00 ? 16 TYR A CZ   12 
ATOM 11611 O OH   . TYR A 1 16 ? 4.523   7.961   -4.774  1.00 0.00 ? 16 TYR A OH   12 
ATOM 11612 H H    . TYR A 1 16 ? 8.494   3.513   0.948   1.00 0.00 ? 16 TYR A H    12 
ATOM 11613 H HA   . TYR A 1 16 ? 8.980   4.563   -1.763  1.00 0.00 ? 16 TYR A HA   12 
ATOM 11614 H HB2  . TYR A 1 16 ? 6.912   3.274   -1.710  1.00 0.00 ? 16 TYR A HB2  12 
ATOM 11615 H HB3  . TYR A 1 16 ? 6.336   4.208   -0.334  1.00 0.00 ? 16 TYR A HB3  12 
ATOM 11616 H HD1  . TYR A 1 16 ? 7.430   4.624   -3.876  1.00 0.00 ? 16 TYR A HD1  12 
ATOM 11617 H HD2  . TYR A 1 16 ? 4.999   6.072   -0.699  1.00 0.00 ? 16 TYR A HD2  12 
ATOM 11618 H HE1  . TYR A 1 16 ? 6.390   6.236   -5.415  1.00 0.00 ? 16 TYR A HE1  12 
ATOM 11619 H HE2  . TYR A 1 16 ? 3.951   7.687   -2.229  1.00 0.00 ? 16 TYR A HE2  12 
ATOM 11620 H HH   . TYR A 1 16 ? 3.674   8.236   -4.419  1.00 0.00 ? 16 TYR A HH   12 
ATOM 11621 N N    . ARG A 1 17 ? 8.569   6.992   -1.147  1.00 0.00 ? 17 ARG A N    12 
ATOM 11622 C CA   . ARG A 1 17 ? 8.640   8.382   -0.713  1.00 0.00 ? 17 ARG A CA   12 
ATOM 11623 C C    . ARG A 1 17 ? 7.521   9.206   -1.342  1.00 0.00 ? 17 ARG A C    12 
ATOM 11624 O O    . ARG A 1 17 ? 7.674   9.791   -2.415  1.00 0.00 ? 17 ARG A O    12 
ATOM 11625 C CB   . ARG A 1 17 ? 9.998   8.984   -1.078  1.00 0.00 ? 17 ARG A CB   12 
ATOM 11626 C CG   . ARG A 1 17 ? 11.118  8.578   -0.135  1.00 0.00 ? 17 ARG A CG   12 
ATOM 11627 C CD   . ARG A 1 17 ? 12.362  9.428   -0.347  1.00 0.00 ? 17 ARG A CD   12 
ATOM 11628 N NE   . ARG A 1 17 ? 13.545  8.828   0.263   1.00 0.00 ? 17 ARG A NE   12 
ATOM 11629 C CZ   . ARG A 1 17 ? 14.788  9.197   -0.027  1.00 0.00 ? 17 ARG A CZ   12 
ATOM 11630 N NH1  . ARG A 1 17 ? 15.008  10.159  -0.911  1.00 0.00 ? 17 ARG A NH1  12 
ATOM 11631 N NH2  . ARG A 1 17 ? 15.814  8.603   0.570   1.00 0.00 ? 17 ARG A NH2  12 
ATOM 11632 H H    . ARG A 1 17 ? 8.623   6.788   -2.104  1.00 0.00 ? 17 ARG A H    12 
ATOM 11633 H HA   . ARG A 1 17 ? 8.525   8.401   0.360   1.00 0.00 ? 17 ARG A HA   12 
ATOM 11634 H HB2  . ARG A 1 17 ? 10.264  8.665   -2.075  1.00 0.00 ? 17 ARG A HB2  12 
ATOM 11635 H HB3  . ARG A 1 17 ? 9.917   10.061  -1.063  1.00 0.00 ? 17 ARG A HB3  12 
ATOM 11636 H HG2  . ARG A 1 17 ? 10.781  8.702   0.884   1.00 0.00 ? 17 ARG A HG2  12 
ATOM 11637 H HG3  . ARG A 1 17 ? 11.366  7.542   -0.310  1.00 0.00 ? 17 ARG A HG3  12 
ATOM 11638 H HD2  . ARG A 1 17 ? 12.531  9.536   -1.408  1.00 0.00 ? 17 ARG A HD2  12 
ATOM 11639 H HD3  . ARG A 1 17 ? 12.196  10.400  0.092   1.00 0.00 ? 17 ARG A HD3  12 
ATOM 11640 H HE   . ARG A 1 17 ? 13.405  8.114   0.919   1.00 0.00 ? 17 ARG A HE   12 
ATOM 11641 H HH11 . ARG A 1 17 ? 14.237  10.609  -1.362  1.00 0.00 ? 17 ARG A HH11 12 
ATOM 11642 H HH12 . ARG A 1 17 ? 15.945  10.436  -1.127  1.00 0.00 ? 17 ARG A HH12 12 
ATOM 11643 H HH21 . ARG A 1 17 ? 15.652  7.877   1.238   1.00 0.00 ? 17 ARG A HH21 12 
ATOM 11644 H HH22 . ARG A 1 17 ? 16.748  8.882   0.352   1.00 0.00 ? 17 ARG A HH22 12 
ATOM 11645 N N    . PRO A 1 18 ? 6.366   9.254   -0.661  1.00 0.00 ? 18 PRO A N    12 
ATOM 11646 C CA   . PRO A 1 18 ? 5.198   10.004  -1.134  1.00 0.00 ? 18 PRO A CA   12 
ATOM 11647 C C    . PRO A 1 18 ? 5.413   11.512  -1.070  1.00 0.00 ? 18 PRO A C    12 
ATOM 11648 O O    . PRO A 1 18 ? 5.505   12.089  0.013   1.00 0.00 ? 18 PRO A O    12 
ATOM 11649 C CB   . PRO A 1 18 ? 4.090   9.580   -0.168  1.00 0.00 ? 18 PRO A CB   12 
ATOM 11650 C CG   . PRO A 1 18 ? 4.805   9.172   1.074   1.00 0.00 ? 18 PRO A CG   12 
ATOM 11651 C CD   . PRO A 1 18 ? 6.112   8.582   0.624   1.00 0.00 ? 18 PRO A CD   12 
ATOM 11652 H HA   . PRO A 1 18 ? 4.928   9.722   -2.141  1.00 0.00 ? 18 PRO A HA   12 
ATOM 11653 H HB2  . PRO A 1 18 ? 3.427   10.414  0.013   1.00 0.00 ? 18 PRO A HB2  12 
ATOM 11654 H HB3  . PRO A 1 18 ? 3.534   8.757   -0.591  1.00 0.00 ? 18 PRO A HB3  12 
ATOM 11655 H HG2  . PRO A 1 18 ? 4.978   10.035  1.698   1.00 0.00 ? 18 PRO A HG2  12 
ATOM 11656 H HG3  . PRO A 1 18 ? 4.224   8.433   1.606   1.00 0.00 ? 18 PRO A HG3  12 
ATOM 11657 H HD2  . PRO A 1 18 ? 6.892   8.805   1.337   1.00 0.00 ? 18 PRO A HD2  12 
ATOM 11658 H HD3  . PRO A 1 18 ? 6.017   7.515   0.488   1.00 0.00 ? 18 PRO A HD3  12 
ATOM 11659 N N    . GLN A 1 19 ? 5.490   12.144  -2.236  1.00 0.00 ? 19 GLN A N    12 
ATOM 11660 C CA   . GLN A 1 19 ? 5.694   13.586  -2.311  1.00 0.00 ? 19 GLN A CA   12 
ATOM 11661 C C    . GLN A 1 19 ? 4.376   14.332  -2.131  1.00 0.00 ? 19 GLN A C    12 
ATOM 11662 O O    . GLN A 1 19 ? 4.312   15.549  -2.300  1.00 0.00 ? 19 GLN A O    12 
ATOM 11663 C CB   . GLN A 1 19 ? 6.328   13.964  -3.651  1.00 0.00 ? 19 GLN A CB   12 
ATOM 11664 C CG   . GLN A 1 19 ? 7.836   13.773  -3.685  1.00 0.00 ? 19 GLN A CG   12 
ATOM 11665 C CD   . GLN A 1 19 ? 8.589   14.982  -3.168  1.00 0.00 ? 19 GLN A CD   12 
ATOM 11666 O OE1  . GLN A 1 19 ? 8.786   15.961  -3.889  1.00 0.00 ? 19 GLN A OE1  12 
ATOM 11667 N NE2  . GLN A 1 19 ? 9.016   14.921  -1.912  1.00 0.00 ? 19 GLN A NE2  12 
ATOM 11668 H H    . GLN A 1 19 ? 5.409   11.629  -3.065  1.00 0.00 ? 19 GLN A H    12 
ATOM 11669 H HA   . GLN A 1 19 ? 6.364   13.868  -1.514  1.00 0.00 ? 19 GLN A HA   12 
ATOM 11670 H HB2  . GLN A 1 19 ? 5.892   13.354  -4.427  1.00 0.00 ? 19 GLN A HB2  12 
ATOM 11671 H HB3  . GLN A 1 19 ? 6.114   15.002  -3.857  1.00 0.00 ? 19 GLN A HB3  12 
ATOM 11672 H HG2  . GLN A 1 19 ? 8.092   12.920  -3.074  1.00 0.00 ? 19 GLN A HG2  12 
ATOM 11673 H HG3  . GLN A 1 19 ? 8.139   13.587  -4.705  1.00 0.00 ? 19 GLN A HG3  12 
ATOM 11674 H HE21 . GLN A 1 19 ? 8.824   14.109  -1.397  1.00 0.00 ? 19 GLN A HE21 12 
ATOM 11675 H HE22 . GLN A 1 19 ? 9.506   15.689  -1.552  1.00 0.00 ? 19 GLN A HE22 12 
ATOM 11676 N N    . ASN A 1 20 ? 3.325   13.593  -1.788  1.00 0.00 ? 20 ASN A N    12 
ATOM 11677 C CA   . ASN A 1 20 ? 2.008   14.185  -1.586  1.00 0.00 ? 20 ASN A CA   12 
ATOM 11678 C C    . ASN A 1 20 ? 1.284   13.517  -0.421  1.00 0.00 ? 20 ASN A C    12 
ATOM 11679 O O    . ASN A 1 20 ? 1.487   12.335  -0.148  1.00 0.00 ? 20 ASN A O    12 
ATOM 11680 C CB   . ASN A 1 20 ? 1.169   14.061  -2.860  1.00 0.00 ? 20 ASN A CB   12 
ATOM 11681 C CG   . ASN A 1 20 ? -0.051  14.962  -2.839  1.00 0.00 ? 20 ASN A CG   12 
ATOM 11682 O OD1  . ASN A 1 20 ? 0.033   16.130  -2.460  1.00 0.00 ? 20 ASN A OD1  12 
ATOM 11683 N ND2  . ASN A 1 20 ? -1.193  14.420  -3.247  1.00 0.00 ? 20 ASN A ND2  12 
ATOM 11684 H H    . ASN A 1 20 ? 3.439   12.627  -1.668  1.00 0.00 ? 20 ASN A H    12 
ATOM 11685 H HA   . ASN A 1 20 ? 2.146   15.231  -1.357  1.00 0.00 ? 20 ASN A HA   12 
ATOM 11686 H HB2  . ASN A 1 20 ? 1.777   14.331  -3.711  1.00 0.00 ? 20 ASN A HB2  12 
ATOM 11687 H HB3  . ASN A 1 20 ? 0.838   13.039  -2.968  1.00 0.00 ? 20 ASN A HB3  12 
ATOM 11688 H HD21 . ASN A 1 20 ? -1.184  13.483  -3.534  1.00 0.00 ? 20 ASN A HD21 12 
ATOM 11689 H HD22 . ASN A 1 20 ? -1.997  14.981  -3.244  1.00 0.00 ? 20 ASN A HD22 12 
ATOM 11690 N N    . GLU A 1 21 ? 0.440   14.284  0.263   1.00 0.00 ? 21 GLU A N    12 
ATOM 11691 C CA   . GLU A 1 21 ? -0.313  13.766  1.399   1.00 0.00 ? 21 GLU A CA   12 
ATOM 11692 C C    . GLU A 1 21 ? -1.287  12.678  0.955   1.00 0.00 ? 21 GLU A C    12 
ATOM 11693 O O    . GLU A 1 21 ? -1.566  11.738  1.700   1.00 0.00 ? 21 GLU A O    12 
ATOM 11694 C CB   . GLU A 1 21 ? -1.076  14.897  2.092   1.00 0.00 ? 21 GLU A CB   12 
ATOM 11695 C CG   . GLU A 1 21 ? -2.098  15.579  1.198   1.00 0.00 ? 21 GLU A CG   12 
ATOM 11696 C CD   . GLU A 1 21 ? -2.806  16.727  1.891   1.00 0.00 ? 21 GLU A CD   12 
ATOM 11697 O OE1  . GLU A 1 21 ? -3.278  16.530  3.030   1.00 0.00 ? 21 GLU A OE1  12 
ATOM 11698 O OE2  . GLU A 1 21 ? -2.887  17.821  1.295   1.00 0.00 ? 21 GLU A OE2  12 
ATOM 11699 H H    . GLU A 1 21 ? 0.321   15.220  -0.003  1.00 0.00 ? 21 GLU A H    12 
ATOM 11700 H HA   . GLU A 1 21 ? 0.391   13.339  2.096   1.00 0.00 ? 21 GLU A HA   12 
ATOM 11701 H HB2  . GLU A 1 21 ? -1.591  14.494  2.951   1.00 0.00 ? 21 GLU A HB2  12 
ATOM 11702 H HB3  . GLU A 1 21 ? -0.368  15.641  2.425   1.00 0.00 ? 21 GLU A HB3  12 
ATOM 11703 H HG2  . GLU A 1 21 ? -1.594  15.962  0.323   1.00 0.00 ? 21 GLU A HG2  12 
ATOM 11704 H HG3  . GLU A 1 21 ? -2.836  14.850  0.895   1.00 0.00 ? 21 GLU A HG3  12 
ATOM 11705 N N    . ASP A 1 22 ? -1.801  12.813  -0.262  1.00 0.00 ? 22 ASP A N    12 
ATOM 11706 C CA   . ASP A 1 22 ? -2.743  11.842  -0.806  1.00 0.00 ? 22 ASP A CA   12 
ATOM 11707 C C    . ASP A 1 22 ? -2.102  10.462  -0.911  1.00 0.00 ? 22 ASP A C    12 
ATOM 11708 O O    . ASP A 1 22 ? -2.796  9.447   -0.965  1.00 0.00 ? 22 ASP A O    12 
ATOM 11709 C CB   . ASP A 1 22 ? -3.237  12.294  -2.182  1.00 0.00 ? 22 ASP A CB   12 
ATOM 11710 C CG   . ASP A 1 22 ? -3.678  13.744  -2.191  1.00 0.00 ? 22 ASP A CG   12 
ATOM 11711 O OD1  . ASP A 1 22 ? -2.988  14.579  -1.568  1.00 0.00 ? 22 ASP A OD1  12 
ATOM 11712 O OD2  . ASP A 1 22 ? -4.713  14.046  -2.821  1.00 0.00 ? 22 ASP A OD2  12 
ATOM 11713 H H    . ASP A 1 22 ? -1.540  13.584  -0.809  1.00 0.00 ? 22 ASP A H    12 
ATOM 11714 H HA   . ASP A 1 22 ? -3.585  11.784  -0.133  1.00 0.00 ? 22 ASP A HA   12 
ATOM 11715 H HB2  . ASP A 1 22 ? -2.439  12.175  -2.900  1.00 0.00 ? 22 ASP A HB2  12 
ATOM 11716 H HB3  . ASP A 1 22 ? -4.075  11.679  -2.476  1.00 0.00 ? 22 ASP A HB3  12 
ATOM 11717 N N    . GLU A 1 23 ? -0.773  10.433  -0.939  1.00 0.00 ? 23 GLU A N    12 
ATOM 11718 C CA   . GLU A 1 23 ? -0.039  9.177   -1.039  1.00 0.00 ? 23 GLU A CA   12 
ATOM 11719 C C    . GLU A 1 23 ? 0.431   8.710   0.336   1.00 0.00 ? 23 GLU A C    12 
ATOM 11720 O O    . GLU A 1 23 ? 0.754   9.523   1.203   1.00 0.00 ? 23 GLU A O    12 
ATOM 11721 C CB   . GLU A 1 23 ? 1.162   9.335   -1.974  1.00 0.00 ? 23 GLU A CB   12 
ATOM 11722 C CG   . GLU A 1 23 ? 0.824   10.018  -3.289  1.00 0.00 ? 23 GLU A CG   12 
ATOM 11723 C CD   . GLU A 1 23 ? 2.008   10.082  -4.234  1.00 0.00 ? 23 GLU A CD   12 
ATOM 11724 O OE1  . GLU A 1 23 ? 2.848   10.992  -4.070  1.00 0.00 ? 23 GLU A OE1  12 
ATOM 11725 O OE2  . GLU A 1 23 ? 2.094   9.224   -5.137  1.00 0.00 ? 23 GLU A OE2  12 
ATOM 11726 H H    . GLU A 1 23 ? -0.275  11.275  -0.892  1.00 0.00 ? 23 GLU A H    12 
ATOM 11727 H HA   . GLU A 1 23 ? -0.707  8.434   -1.449  1.00 0.00 ? 23 GLU A HA   12 
ATOM 11728 H HB2  . GLU A 1 23 ? 1.919   9.920   -1.472  1.00 0.00 ? 23 GLU A HB2  12 
ATOM 11729 H HB3  . GLU A 1 23 ? 1.563   8.357   -2.194  1.00 0.00 ? 23 GLU A HB3  12 
ATOM 11730 H HG2  . GLU A 1 23 ? 0.028   9.469   -3.770  1.00 0.00 ? 23 GLU A HG2  12 
ATOM 11731 H HG3  . GLU A 1 23 ? 0.492   11.024  -3.082  1.00 0.00 ? 23 GLU A HG3  12 
ATOM 11732 N N    . LEU A 1 24 ? 0.465   7.396   0.528   1.00 0.00 ? 24 LEU A N    12 
ATOM 11733 C CA   . LEU A 1 24 ? 0.895   6.820   1.798   1.00 0.00 ? 24 LEU A CA   12 
ATOM 11734 C C    . LEU A 1 24 ? 2.362   6.404   1.738   1.00 0.00 ? 24 LEU A C    12 
ATOM 11735 O O    . LEU A 1 24 ? 2.847   5.955   0.701   1.00 0.00 ? 24 LEU A O    12 
ATOM 11736 C CB   . LEU A 1 24 ? 0.025   5.613   2.153   1.00 0.00 ? 24 LEU A CB   12 
ATOM 11737 C CG   . LEU A 1 24 ? 0.049   5.176   3.618   1.00 0.00 ? 24 LEU A CG   12 
ATOM 11738 C CD1  . LEU A 1 24 ? -0.617  6.223   4.498   1.00 0.00 ? 24 LEU A CD1  12 
ATOM 11739 C CD2  . LEU A 1 24 ? -0.634  3.826   3.783   1.00 0.00 ? 24 LEU A CD2  12 
ATOM 11740 H H    . LEU A 1 24 ? 0.196   6.799   -0.200  1.00 0.00 ? 24 LEU A H    12 
ATOM 11741 H HA   . LEU A 1 24 ? 0.778   7.575   2.561   1.00 0.00 ? 24 LEU A HA   12 
ATOM 11742 H HB2  . LEU A 1 24 ? -0.995  5.854   1.896   1.00 0.00 ? 24 LEU A HB2  12 
ATOM 11743 H HB3  . LEU A 1 24 ? 0.358   4.778   1.552   1.00 0.00 ? 24 LEU A HB3  12 
ATOM 11744 H HG   . LEU A 1 24 ? 1.076   5.075   3.940   1.00 0.00 ? 24 LEU A HG   12 
ATOM 11745 H HD11 . LEU A 1 24 ? -0.239  7.201   4.242   1.00 0.00 ? 24 LEU A HD11 12 
ATOM 11746 H HD12 . LEU A 1 24 ? -0.399  6.013   5.535   1.00 0.00 ? 24 LEU A HD12 12 
ATOM 11747 H HD13 . LEU A 1 24 ? -1.685  6.198   4.342   1.00 0.00 ? 24 LEU A HD13 12 
ATOM 11748 H HD21 . LEU A 1 24 ? -0.975  3.476   2.821   1.00 0.00 ? 24 LEU A HD21 12 
ATOM 11749 H HD22 . LEU A 1 24 ? -1.479  3.929   4.449   1.00 0.00 ? 24 LEU A HD22 12 
ATOM 11750 H HD23 . LEU A 1 24 ? 0.067   3.117   4.197   1.00 0.00 ? 24 LEU A HD23 12 
ATOM 11751 N N    . GLU A 1 25 ? 3.060   6.555   2.859   1.00 0.00 ? 25 GLU A N    12 
ATOM 11752 C CA   . GLU A 1 25 ? 4.471   6.194   2.934   1.00 0.00 ? 25 GLU A CA   12 
ATOM 11753 C C    . GLU A 1 25 ? 4.636   4.720   3.293   1.00 0.00 ? 25 GLU A C    12 
ATOM 11754 O O    . GLU A 1 25 ? 3.825   4.153   4.026   1.00 0.00 ? 25 GLU A O    12 
ATOM 11755 C CB   . GLU A 1 25 ? 5.190   7.066   3.966   1.00 0.00 ? 25 GLU A CB   12 
ATOM 11756 C CG   . GLU A 1 25 ? 6.692   7.149   3.751   1.00 0.00 ? 25 GLU A CG   12 
ATOM 11757 C CD   . GLU A 1 25 ? 7.340   8.239   4.582   1.00 0.00 ? 25 GLU A CD   12 
ATOM 11758 O OE1  . GLU A 1 25 ? 7.383   8.096   5.821   1.00 0.00 ? 25 GLU A OE1  12 
ATOM 11759 O OE2  . GLU A 1 25 ? 7.804   9.237   3.991   1.00 0.00 ? 25 GLU A OE2  12 
ATOM 11760 H H    . GLU A 1 25 ? 2.617   6.918   3.654   1.00 0.00 ? 25 GLU A H    12 
ATOM 11761 H HA   . GLU A 1 25 ? 4.909   6.366   1.963   1.00 0.00 ? 25 GLU A HA   12 
ATOM 11762 H HB2  . GLU A 1 25 ? 4.784   8.065   3.920   1.00 0.00 ? 25 GLU A HB2  12 
ATOM 11763 H HB3  . GLU A 1 25 ? 5.010   6.659   4.950   1.00 0.00 ? 25 GLU A HB3  12 
ATOM 11764 H HG2  . GLU A 1 25 ? 7.134   6.202   4.021   1.00 0.00 ? 25 GLU A HG2  12 
ATOM 11765 H HG3  . GLU A 1 25 ? 6.883   7.350   2.708   1.00 0.00 ? 25 GLU A HG3  12 
ATOM 11766 N N    . LEU A 1 26 ? 5.693   4.105   2.772   1.00 0.00 ? 26 LEU A N    12 
ATOM 11767 C CA   . LEU A 1 26 ? 5.966   2.697   3.037   1.00 0.00 ? 26 LEU A CA   12 
ATOM 11768 C C    . LEU A 1 26 ? 7.397   2.503   3.527   1.00 0.00 ? 26 LEU A C    12 
ATOM 11769 O O    . LEU A 1 26 ? 8.181   3.451   3.576   1.00 0.00 ? 26 LEU A O    12 
ATOM 11770 C CB   . LEU A 1 26 ? 5.730   1.865   1.775   1.00 0.00 ? 26 LEU A CB   12 
ATOM 11771 C CG   . LEU A 1 26 ? 4.316   1.915   1.193   1.00 0.00 ? 26 LEU A CG   12 
ATOM 11772 C CD1  . LEU A 1 26 ? 4.277   1.246   -0.172  1.00 0.00 ? 26 LEU A CD1  12 
ATOM 11773 C CD2  . LEU A 1 26 ? 3.326   1.255   2.142   1.00 0.00 ? 26 LEU A CD2  12 
ATOM 11774 H H    . LEU A 1 26 ? 6.304   4.609   2.196   1.00 0.00 ? 26 LEU A H    12 
ATOM 11775 H HA   . LEU A 1 26 ? 5.286   2.367   3.808   1.00 0.00 ? 26 LEU A HA   12 
ATOM 11776 H HB2  . LEU A 1 26 ? 6.412   2.215   1.016   1.00 0.00 ? 26 LEU A HB2  12 
ATOM 11777 H HB3  . LEU A 1 26 ? 5.955   0.835   2.012   1.00 0.00 ? 26 LEU A HB3  12 
ATOM 11778 H HG   . LEU A 1 26 ? 4.022   2.948   1.067   1.00 0.00 ? 26 LEU A HG   12 
ATOM 11779 H HD11 . LEU A 1 26 ? 4.783   1.870   -0.893  1.00 0.00 ? 26 LEU A HD11 12 
ATOM 11780 H HD12 . LEU A 1 26 ? 3.250   1.106   -0.475  1.00 0.00 ? 26 LEU A HD12 12 
ATOM 11781 H HD13 . LEU A 1 26 ? 4.770   0.286   -0.116  1.00 0.00 ? 26 LEU A HD13 12 
ATOM 11782 H HD21 . LEU A 1 26 ? 2.780   2.017   2.678   1.00 0.00 ? 26 LEU A HD21 12 
ATOM 11783 H HD22 . LEU A 1 26 ? 3.860   0.634   2.845   1.00 0.00 ? 26 LEU A HD22 12 
ATOM 11784 H HD23 . LEU A 1 26 ? 2.636   0.648   1.575   1.00 0.00 ? 26 LEU A HD23 12 
ATOM 11785 N N    . ARG A 1 27 ? 7.732   1.268   3.887   1.00 0.00 ? 27 ARG A N    12 
ATOM 11786 C CA   . ARG A 1 27 ? 9.069   0.949   4.372   1.00 0.00 ? 27 ARG A CA   12 
ATOM 11787 C C    . ARG A 1 27 ? 9.427   -0.502  4.066   1.00 0.00 ? 27 ARG A C    12 
ATOM 11788 O O    . ARG A 1 27 ? 8.644   -1.413  4.332   1.00 0.00 ? 27 ARG A O    12 
ATOM 11789 C CB   . ARG A 1 27 ? 9.163   1.202   5.878   1.00 0.00 ? 27 ARG A CB   12 
ATOM 11790 C CG   . ARG A 1 27 ? 10.497  0.798   6.482   1.00 0.00 ? 27 ARG A CG   12 
ATOM 11791 C CD   . ARG A 1 27 ? 10.613  1.248   7.929   1.00 0.00 ? 27 ARG A CD   12 
ATOM 11792 N NE   . ARG A 1 27 ? 11.825  0.740   8.566   1.00 0.00 ? 27 ARG A NE   12 
ATOM 11793 C CZ   . ARG A 1 27 ? 13.047  1.168   8.266   1.00 0.00 ? 27 ARG A CZ   12 
ATOM 11794 N NH1  . ARG A 1 27 ? 13.217  2.106   7.346   1.00 0.00 ? 27 ARG A NH1  12 
ATOM 11795 N NH2  . ARG A 1 27 ? 14.101  0.656   8.889   1.00 0.00 ? 27 ARG A NH2  12 
ATOM 11796 H H    . ARG A 1 27 ? 7.063   0.554   3.825   1.00 0.00 ? 27 ARG A H    12 
ATOM 11797 H HA   . ARG A 1 27 ? 9.769   1.595   3.863   1.00 0.00 ? 27 ARG A HA   12 
ATOM 11798 H HB2  . ARG A 1 27 ? 9.013   2.256   6.064   1.00 0.00 ? 27 ARG A HB2  12 
ATOM 11799 H HB3  . ARG A 1 27 ? 8.383   0.643   6.373   1.00 0.00 ? 27 ARG A HB3  12 
ATOM 11800 H HG2  . ARG A 1 27 ? 10.588  -0.278  6.443   1.00 0.00 ? 27 ARG A HG2  12 
ATOM 11801 H HG3  . ARG A 1 27 ? 11.293  1.249   5.908   1.00 0.00 ? 27 ARG A HG3  12 
ATOM 11802 H HD2  . ARG A 1 27 ? 10.629  2.328   7.956   1.00 0.00 ? 27 ARG A HD2  12 
ATOM 11803 H HD3  . ARG A 1 27 ? 9.753   0.888   8.474   1.00 0.00 ? 27 ARG A HD3  12 
ATOM 11804 H HE   . ARG A 1 27 ? 11.722  0.046   9.249   1.00 0.00 ? 27 ARG A HE   12 
ATOM 11805 H HH11 . ARG A 1 27 ? 12.425  2.494   6.876   1.00 0.00 ? 27 ARG A HH11 12 
ATOM 11806 H HH12 . ARG A 1 27 ? 14.138  2.428   7.123   1.00 0.00 ? 27 ARG A HH12 12 
ATOM 11807 H HH21 . ARG A 1 27 ? 13.977  -0.051  9.584   1.00 0.00 ? 27 ARG A HH21 12 
ATOM 11808 H HH22 . ARG A 1 27 ? 15.020  0.979   8.663   1.00 0.00 ? 27 ARG A HH22 12 
ATOM 11809 N N    . GLU A 1 28 ? 10.614  -0.708  3.504   1.00 0.00 ? 28 GLU A N    12 
ATOM 11810 C CA   . GLU A 1 28 ? 11.074  -2.049  3.161   1.00 0.00 ? 28 GLU A CA   12 
ATOM 11811 C C    . GLU A 1 28 ? 10.945  -2.990  4.355   1.00 0.00 ? 28 GLU A C    12 
ATOM 11812 O O    . GLU A 1 28 ? 11.715  -2.907  5.311   1.00 0.00 ? 28 GLU A O    12 
ATOM 11813 C CB   . GLU A 1 28 ? 12.528  -2.007  2.685   1.00 0.00 ? 28 GLU A CB   12 
ATOM 11814 C CG   . GLU A 1 28 ? 13.064  -3.359  2.246   1.00 0.00 ? 28 GLU A CG   12 
ATOM 11815 C CD   . GLU A 1 28 ? 14.565  -3.476  2.420   1.00 0.00 ? 28 GLU A CD   12 
ATOM 11816 O OE1  . GLU A 1 28 ? 15.014  -3.723  3.559   1.00 0.00 ? 28 GLU A OE1  12 
ATOM 11817 O OE2  . GLU A 1 28 ? 15.292  -3.321  1.416   1.00 0.00 ? 28 GLU A OE2  12 
ATOM 11818 H H    . GLU A 1 28 ? 11.194  0.059   3.316   1.00 0.00 ? 28 GLU A H    12 
ATOM 11819 H HA   . GLU A 1 28 ? 10.453  -2.417  2.359   1.00 0.00 ? 28 GLU A HA   12 
ATOM 11820 H HB2  . GLU A 1 28 ? 12.602  -1.325  1.851   1.00 0.00 ? 28 GLU A HB2  12 
ATOM 11821 H