data_2DA6
# 
_entry.id   2DA6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DA6         
RCSB  RCSB025177   
WWPDB D_1000025177 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DA6 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-13 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ohnishi, S.'                                            1 
'Kigawa, T.'                                             2 
'Sato, M.'                                               3 
'Koshiba, S.'                                            4 
'Inoue, M.'                                              5 
'Yokoyama, S.'                                           6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the homeobox domain of Hepatocyte nuclear factor 1-beta (HNF-1beta)' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ohnishi, S.'  1 
primary 'Kigawa, T.'   2 
primary 'Sato, M.'     3 
primary 'Koshiba, S.'  4 
primary 'Inoue, M.'    5 
primary 'Yokoyama, S.' 6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Hepatocyte nuclear factor 1-beta' 
_entity.formula_weight             11416.564 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'homeobox domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'HNF-1beta, HNF-1B, Variant hepatic nuclear factor 1, VHNF1, Homeoprotein LFB3, Transcription factor 2, TCF-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRK
EEAFRQKLAMDAYSSNSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRK
EEAFRQKLAMDAYSSNSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ARG n 
1 9   ASN n 
1 10  ARG n 
1 11  PHE n 
1 12  LYS n 
1 13  TRP n 
1 14  GLY n 
1 15  PRO n 
1 16  ALA n 
1 17  SER n 
1 18  GLN n 
1 19  GLN n 
1 20  ILE n 
1 21  LEU n 
1 22  TYR n 
1 23  GLN n 
1 24  ALA n 
1 25  TYR n 
1 26  ASP n 
1 27  ARG n 
1 28  GLN n 
1 29  LYS n 
1 30  ASN n 
1 31  PRO n 
1 32  SER n 
1 33  LYS n 
1 34  GLU n 
1 35  GLU n 
1 36  ARG n 
1 37  GLU n 
1 38  ALA n 
1 39  LEU n 
1 40  VAL n 
1 41  GLU n 
1 42  GLU n 
1 43  CYS n 
1 44  ASN n 
1 45  ARG n 
1 46  ALA n 
1 47  GLU n 
1 48  CYS n 
1 49  LEU n 
1 50  GLN n 
1 51  ARG n 
1 52  GLY n 
1 53  VAL n 
1 54  SER n 
1 55  PRO n 
1 56  SER n 
1 57  LYS n 
1 58  ALA n 
1 59  HIS n 
1 60  GLY n 
1 61  LEU n 
1 62  GLY n 
1 63  SER n 
1 64  ASN n 
1 65  LEU n 
1 66  VAL n 
1 67  THR n 
1 68  GLU n 
1 69  VAL n 
1 70  ARG n 
1 71  VAL n 
1 72  TYR n 
1 73  ASN n 
1 74  TRP n 
1 75  PHE n 
1 76  ALA n 
1 77  ASN n 
1 78  ARG n 
1 79  ARG n 
1 80  LYS n 
1 81  GLU n 
1 82  GLU n 
1 83  ALA n 
1 84  PHE n 
1 85  ARG n 
1 86  GLN n 
1 87  LYS n 
1 88  LEU n 
1 89  ALA n 
1 90  MET n 
1 91  ASP n 
1 92  ALA n 
1 93  TYR n 
1 94  SER n 
1 95  SER n 
1 96  ASN n 
1 97  SER n 
1 98  GLY n 
1 99  PRO n 
1 100 SER n 
1 101 SER n 
1 102 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 HNF1B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050404-17 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HNF1B_HUMAN 
_struct_ref.pdbx_db_accession          P35680 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFRQK
LAMDAYSSN
;
_struct_ref.pdbx_align_begin           233 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DA6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 96 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P35680 
_struct_ref_seq.db_align_beg                  233 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  321 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       96 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DA6 GLY A 1   ? UNP P35680 ? ? 'CLONING ARTIFACT' 1   1  
1 2DA6 SER A 2   ? UNP P35680 ? ? 'CLONING ARTIFACT' 2   2  
1 2DA6 SER A 3   ? UNP P35680 ? ? 'CLONING ARTIFACT' 3   3  
1 2DA6 GLY A 4   ? UNP P35680 ? ? 'CLONING ARTIFACT' 4   4  
1 2DA6 SER A 5   ? UNP P35680 ? ? 'CLONING ARTIFACT' 5   5  
1 2DA6 SER A 6   ? UNP P35680 ? ? 'CLONING ARTIFACT' 6   6  
1 2DA6 GLY A 7   ? UNP P35680 ? ? 'CLONING ARTIFACT' 7   7  
1 2DA6 SER A 97  ? UNP P35680 ? ? 'CLONING ARTIFACT' 97  8  
1 2DA6 GLY A 98  ? UNP P35680 ? ? 'CLONING ARTIFACT' 98  9  
1 2DA6 PRO A 99  ? UNP P35680 ? ? 'CLONING ARTIFACT' 99  10 
1 2DA6 SER A 100 ? UNP P35680 ? ? 'CLONING ARTIFACT' 100 11 
1 2DA6 SER A 101 ? UNP P35680 ? ? 'CLONING ARTIFACT' 101 12 
1 2DA6 GLY A 102 ? UNP P35680 ? ? 'CLONING ARTIFACT' 102 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         296 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.2mM protein U-15N,13C; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2DA6 
_pdbx_nmr_refine.method             'torsion angle dynamics, restrained molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2DA6 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DA6 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 3.5      Bruker          1 
processing           NMRPipe 20030801 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.932    'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2DA6 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DA6 
_struct.title                     'Solution structure of the homeobox domain of Hepatocyte nuclear factor 1-beta (HNF-1beta)' 
_struct.pdbx_descriptor           'Hepatocyte nuclear factor 1-beta' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DA6 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            
;homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA binding protein
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 14 ? ASP A 26 ? GLY A 14 ASP A 26 1 ? 13 
HELX_P HELX_P2 2 SER A 32 ? ARG A 51 ? SER A 32 ARG A 51 1 ? 20 
HELX_P HELX_P3 3 LYS A 57 ? LEU A 65 ? LYS A 57 LEU A 65 5 ? 9  
HELX_P HELX_P4 4 THR A 67 ? ASP A 91 ? THR A 67 ASP A 91 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2DA6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DA6 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -1.227  -16.986 -19.986 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 0.102   -16.569 -19.578 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 0.401   -16.914 -18.133 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -0.514  -17.127 -17.337 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -1.885  -16.316 -20.264 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 0.830   -17.054 -20.211 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 0.186   -15.499 -19.705 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 1.684   -16.973 -17.793 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 2.101   -17.301 -16.435 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 1.813   -16.143 -15.484 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 2.539   -15.149 -15.460 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 3.592   -17.641 -16.404 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 4.071   -17.717 -15.073 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 2.367   -16.793 -18.473 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 1.537   -18.164 -16.114 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 3.751   -18.594 -16.886 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 4.144   -16.875 -16.930 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 5.021   -17.575 -15.065 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 0.747   -16.280 -14.701 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 0.359   -15.245 -13.750 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 0.355   -13.871 -14.414 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 0.808   -12.886 -13.832 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 1.310   -15.241 -12.551 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 0.876   -16.150 -11.554 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 0.208   -17.096 -14.767 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -0.640  -15.468 -13.406 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 2.298   -15.528 -12.878 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 1.345   -14.249 -12.126 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 0.403   -16.877 -11.967 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -0.159  -13.814 -15.639 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -0.213  -12.557 -16.363 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -0.966  -12.675 -17.673 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -0.570  -13.432 -18.559 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -0.506  -14.632 -16.054 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -0.700  -11.818 -15.745 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 0.796   -12.231 -16.570 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -2.057  -11.925 -17.796 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -2.871  -11.953 -19.005 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -3.791  -10.737 -19.069 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -4.187  -10.189 -18.040 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -3.701  -13.237 -19.057 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -4.597  -13.221 -20.156 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -2.321  -11.341 -17.054 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -2.205  -11.930 -19.854 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -3.041  -14.085 -19.159 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -4.271  -13.331 -18.144 1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -5.412  -12.785 -19.898 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -4.126  -10.320 -20.286 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -4.995  -9.166  -20.486 1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -6.409  -9.459  -19.992 1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -7.140  -10.242 -20.597 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -5.030  -8.777  -21.965 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -5.454  -7.435  -22.130 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -3.778  -10.798 -21.068 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -4.591  -8.343  -19.916 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -4.042  -8.884  -22.386 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -5.717  -9.427  -22.489 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -6.065  -7.381  -22.868 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -6.786  -8.823  -18.887 1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -8.110  -9.028  -18.329 1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -8.260  -8.414  -16.951 1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -8.424  -9.127  -15.961 1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -6.161  -8.211  -18.446 1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -8.840  -8.586  -18.990 1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -8.299  -10.090 -18.259 1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . ARG A 1 8   ? -8.203  -7.088  -16.887 1.00 0.00 ? 8   ARG A N    1  
ATOM 67    C CA   . ARG A 1 8   ? -8.331  -6.378  -15.620 1.00 0.00 ? 8   ARG A CA   1  
ATOM 68    C C    . ARG A 1 8   ? -9.624  -6.766  -14.907 1.00 0.00 ? 8   ARG A C    1  
ATOM 69    O O    . ARG A 1 8   ? -10.671 -6.909  -15.536 1.00 0.00 ? 8   ARG A O    1  
ATOM 70    C CB   . ARG A 1 8   ? -8.298  -4.866  -15.852 1.00 0.00 ? 8   ARG A CB   1  
ATOM 71    C CG   . ARG A 1 8   ? -7.900  -4.070  -14.620 1.00 0.00 ? 8   ARG A CG   1  
ATOM 72    C CD   . ARG A 1 8   ? -7.264  -2.741  -14.998 1.00 0.00 ? 8   ARG A CD   1  
ATOM 73    N NE   . ARG A 1 8   ? -7.361  -1.761  -13.919 1.00 0.00 ? 8   ARG A NE   1  
ATOM 74    C CZ   . ARG A 1 8   ? -6.645  -0.644  -13.874 1.00 0.00 ? 8   ARG A CZ   1  
ATOM 75    N NH1  . ARG A 1 8   ? -5.784  -0.365  -14.844 1.00 0.00 ? 8   ARG A NH1  1  
ATOM 76    N NH2  . ARG A 1 8   ? -6.789  0.198   -12.859 1.00 0.00 ? 8   ARG A NH2  1  
ATOM 77    H H    . ARG A 1 8   ? -8.071  -6.574  -17.711 1.00 0.00 ? 8   ARG A H    1  
ATOM 78    H HA   . ARG A 1 8   ? -7.494  -6.656  -14.998 1.00 0.00 ? 8   ARG A HA   1  
ATOM 79    H HB2  . ARG A 1 8   ? -7.589  -4.650  -16.638 1.00 0.00 ? 8   ARG A HB2  1  
ATOM 80    H HB3  . ARG A 1 8   ? -9.279  -4.541  -16.163 1.00 0.00 ? 8   ARG A HB3  1  
ATOM 81    H HG2  . ARG A 1 8   ? -8.781  -3.878  -14.026 1.00 0.00 ? 8   ARG A HG2  1  
ATOM 82    H HG3  . ARG A 1 8   ? -7.193  -4.646  -14.043 1.00 0.00 ? 8   ARG A HG3  1  
ATOM 83    H HD2  . ARG A 1 8   ? -6.223  -2.907  -15.228 1.00 0.00 ? 8   ARG A HD2  1  
ATOM 84    H HD3  . ARG A 1 8   ? -7.767  -2.352  -15.871 1.00 0.00 ? 8   ARG A HD3  1  
ATOM 85    H HE   . ARG A 1 8   ? -7.991  -1.947  -13.192 1.00 0.00 ? 8   ARG A HE   1  
ATOM 86    H HH11 . ARG A 1 8   ? -5.674  -0.997  -15.610 1.00 0.00 ? 8   ARG A HH11 1  
ATOM 87    H HH12 . ARG A 1 8   ? -5.247  0.478   -14.808 1.00 0.00 ? 8   ARG A HH12 1  
ATOM 88    H HH21 . ARG A 1 8   ? -7.437  -0.008  -12.127 1.00 0.00 ? 8   ARG A HH21 1  
ATOM 89    H HH22 . ARG A 1 8   ? -6.250  1.039   -12.826 1.00 0.00 ? 8   ARG A HH22 1  
ATOM 90    N N    . ASN A 1 9   ? -9.540  -6.934  -13.592 1.00 0.00 ? 9   ASN A N    1  
ATOM 91    C CA   . ASN A 1 9   ? -10.703 -7.307  -12.794 1.00 0.00 ? 9   ASN A CA   1  
ATOM 92    C C    . ASN A 1 9   ? -10.573 -6.784  -11.366 1.00 0.00 ? 9   ASN A C    1  
ATOM 93    O O    . ASN A 1 9   ? -9.468  -6.528  -10.887 1.00 0.00 ? 9   ASN A O    1  
ATOM 94    C CB   . ASN A 1 9   ? -10.872 -8.827  -12.779 1.00 0.00 ? 9   ASN A CB   1  
ATOM 95    C CG   . ASN A 1 9   ? -9.708  -9.532  -12.109 1.00 0.00 ? 9   ASN A CG   1  
ATOM 96    O OD1  . ASN A 1 9   ? -9.859  -10.125 -11.041 1.00 0.00 ? 9   ASN A OD1  1  
ATOM 97    N ND2  . ASN A 1 9   ? -8.539  -9.469  -12.735 1.00 0.00 ? 9   ASN A ND2  1  
ATOM 98    H H    . ASN A 1 9   ? -8.677  -6.806  -13.147 1.00 0.00 ? 9   ASN A H    1  
ATOM 99    H HA   . ASN A 1 9   ? -11.574 -6.861  -13.250 1.00 0.00 ? 9   ASN A HA   1  
ATOM 100   H HB2  . ASN A 1 9   ? -11.776 -9.078  -12.243 1.00 0.00 ? 9   ASN A HB2  1  
ATOM 101   H HB3  . ASN A 1 9   ? -10.949 -9.185  -13.795 1.00 0.00 ? 9   ASN A HB3  1  
ATOM 102   H HD21 . ASN A 1 9   ? -8.493  -8.978  -13.582 1.00 0.00 ? 9   ASN A HD21 1  
ATOM 103   H HD22 . ASN A 1 9   ? -7.769  -9.916  -12.324 1.00 0.00 ? 9   ASN A HD22 1  
ATOM 104   N N    . ARG A 1 10  ? -11.708 -6.630  -10.692 1.00 0.00 ? 10  ARG A N    1  
ATOM 105   C CA   . ARG A 1 10  ? -11.721 -6.139  -9.320  1.00 0.00 ? 10  ARG A CA   1  
ATOM 106   C C    . ARG A 1 10  ? -11.108 -7.163  -8.369  1.00 0.00 ? 10  ARG A C    1  
ATOM 107   O O    . ARG A 1 10  ? -11.575 -8.299  -8.279  1.00 0.00 ? 10  ARG A O    1  
ATOM 108   C CB   . ARG A 1 10  ? -13.152 -5.816  -8.885  1.00 0.00 ? 10  ARG A CB   1  
ATOM 109   C CG   . ARG A 1 10  ? -13.675 -4.500  -9.439  1.00 0.00 ? 10  ARG A CG   1  
ATOM 110   C CD   . ARG A 1 10  ? -13.342 -3.337  -8.518  1.00 0.00 ? 10  ARG A CD   1  
ATOM 111   N NE   . ARG A 1 10  ? -13.590 -2.046  -9.155  1.00 0.00 ? 10  ARG A NE   1  
ATOM 112   C CZ   . ARG A 1 10  ? -12.852 -1.563  -10.148 1.00 0.00 ? 10  ARG A CZ   1  
ATOM 113   N NH1  . ARG A 1 10  ? -11.825 -2.259  -10.615 1.00 0.00 ? 10  ARG A NH1  1  
ATOM 114   N NH2  . ARG A 1 10  ? -13.141 -0.380  -10.676 1.00 0.00 ? 10  ARG A NH2  1  
ATOM 115   H H    . ARG A 1 10  ? -12.557 -6.852  -11.129 1.00 0.00 ? 10  ARG A H    1  
ATOM 116   H HA   . ARG A 1 10  ? -11.131 -5.235  -9.286  1.00 0.00 ? 10  ARG A HA   1  
ATOM 117   H HB2  . ARG A 1 10  ? -13.806 -6.607  -9.222  1.00 0.00 ? 10  ARG A HB2  1  
ATOM 118   H HB3  . ARG A 1 10  ? -13.185 -5.766  -7.808  1.00 0.00 ? 10  ARG A HB3  1  
ATOM 119   H HG2  . ARG A 1 10  ? -13.223 -4.321  -10.404 1.00 0.00 ? 10  ARG A HG2  1  
ATOM 120   H HG3  . ARG A 1 10  ? -14.747 -4.567  -9.548  1.00 0.00 ? 10  ARG A HG3  1  
ATOM 121   H HD2  . ARG A 1 10  ? -13.952 -3.412  -7.630  1.00 0.00 ? 10  ARG A HD2  1  
ATOM 122   H HD3  . ARG A 1 10  ? -12.300 -3.398  -8.245  1.00 0.00 ? 10  ARG A HD3  1  
ATOM 123   H HE   . ARG A 1 10  ? -14.344 -1.515  -8.826  1.00 0.00 ? 10  ARG A HE   1  
ATOM 124   H HH11 . ARG A 1 10  ? -11.606 -3.151  -10.220 1.00 0.00 ? 10  ARG A HH11 1  
ATOM 125   H HH12 . ARG A 1 10  ? -11.272 -1.893  -11.364 1.00 0.00 ? 10  ARG A HH12 1  
ATOM 126   H HH21 . ARG A 1 10  ? -13.915 0.148   -10.327 1.00 0.00 ? 10  ARG A HH21 1  
ATOM 127   H HH22 . ARG A 1 10  ? -12.585 -0.017  -11.423 1.00 0.00 ? 10  ARG A HH22 1  
ATOM 128   N N    . PHE A 1 11  ? -10.060 -6.753  -7.663  1.00 0.00 ? 11  PHE A N    1  
ATOM 129   C CA   . PHE A 1 11  ? -9.382  -7.635  -6.720  1.00 0.00 ? 11  PHE A CA   1  
ATOM 130   C C    . PHE A 1 11  ? -9.076  -6.905  -5.416  1.00 0.00 ? 11  PHE A C    1  
ATOM 131   O O    . PHE A 1 11  ? -8.798  -5.706  -5.412  1.00 0.00 ? 11  PHE A O    1  
ATOM 132   C CB   . PHE A 1 11  ? -8.087  -8.173  -7.333  1.00 0.00 ? 11  PHE A CB   1  
ATOM 133   C CG   . PHE A 1 11  ? -7.041  -8.520  -6.313  1.00 0.00 ? 11  PHE A CG   1  
ATOM 134   C CD1  . PHE A 1 11  ? -6.377  -7.524  -5.615  1.00 0.00 ? 11  PHE A CD1  1  
ATOM 135   C CD2  . PHE A 1 11  ? -6.720  -9.843  -6.053  1.00 0.00 ? 11  PHE A CD2  1  
ATOM 136   C CE1  . PHE A 1 11  ? -5.413  -7.840  -4.675  1.00 0.00 ? 11  PHE A CE1  1  
ATOM 137   C CE2  . PHE A 1 11  ? -5.758  -10.165 -5.114  1.00 0.00 ? 11  PHE A CE2  1  
ATOM 138   C CZ   . PHE A 1 11  ? -5.103  -9.163  -4.426  1.00 0.00 ? 11  PHE A CZ   1  
ATOM 139   H H    . PHE A 1 11  ? -9.735  -5.836  -7.779  1.00 0.00 ? 11  PHE A H    1  
ATOM 140   H HA   . PHE A 1 11  ? -10.041 -8.463  -6.509  1.00 0.00 ? 11  PHE A HA   1  
ATOM 141   H HB2  . PHE A 1 11  ? -8.308  -9.066  -7.898  1.00 0.00 ? 11  PHE A HB2  1  
ATOM 142   H HB3  . PHE A 1 11  ? -7.673  -7.426  -7.994  1.00 0.00 ? 11  PHE A HB3  1  
ATOM 143   H HD1  . PHE A 1 11  ? -6.619  -6.489  -5.810  1.00 0.00 ? 11  PHE A HD1  1  
ATOM 144   H HD2  . PHE A 1 11  ? -7.231  -10.628 -6.591  1.00 0.00 ? 11  PHE A HD2  1  
ATOM 145   H HE1  . PHE A 1 11  ? -4.903  -7.054  -4.139  1.00 0.00 ? 11  PHE A HE1  1  
ATOM 146   H HE2  . PHE A 1 11  ? -5.517  -11.200 -4.921  1.00 0.00 ? 11  PHE A HE2  1  
ATOM 147   H HZ   . PHE A 1 11  ? -4.351  -9.412  -3.692  1.00 0.00 ? 11  PHE A HZ   1  
ATOM 148   N N    . LYS A 1 12  ? -9.130  -7.637  -4.308  1.00 0.00 ? 12  LYS A N    1  
ATOM 149   C CA   . LYS A 1 12  ? -8.858  -7.062  -2.996  1.00 0.00 ? 12  LYS A CA   1  
ATOM 150   C C    . LYS A 1 12  ? -7.900  -7.945  -2.203  1.00 0.00 ? 12  LYS A C    1  
ATOM 151   O O    . LYS A 1 12  ? -8.066  -9.163  -2.148  1.00 0.00 ? 12  LYS A O    1  
ATOM 152   C CB   . LYS A 1 12  ? -10.163 -6.877  -2.217  1.00 0.00 ? 12  LYS A CB   1  
ATOM 153   C CG   . LYS A 1 12  ? -9.989  -6.123  -0.910  1.00 0.00 ? 12  LYS A CG   1  
ATOM 154   C CD   . LYS A 1 12  ? -9.910  -4.623  -1.139  1.00 0.00 ? 12  LYS A CD   1  
ATOM 155   C CE   . LYS A 1 12  ? -11.275 -4.036  -1.465  1.00 0.00 ? 12  LYS A CE   1  
ATOM 156   N NZ   . LYS A 1 12  ? -11.336 -2.577  -1.171  1.00 0.00 ? 12  LYS A NZ   1  
ATOM 157   H H    . LYS A 1 12  ? -9.357  -8.589  -4.375  1.00 0.00 ? 12  LYS A H    1  
ATOM 158   H HA   . LYS A 1 12  ? -8.399  -6.097  -3.146  1.00 0.00 ? 12  LYS A HA   1  
ATOM 159   H HB2  . LYS A 1 12  ? -10.862 -6.332  -2.834  1.00 0.00 ? 12  LYS A HB2  1  
ATOM 160   H HB3  . LYS A 1 12  ? -10.575 -7.851  -1.995  1.00 0.00 ? 12  LYS A HB3  1  
ATOM 161   H HG2  . LYS A 1 12  ? -10.832 -6.335  -0.269  1.00 0.00 ? 12  LYS A HG2  1  
ATOM 162   H HG3  . LYS A 1 12  ? -9.078  -6.454  -0.433  1.00 0.00 ? 12  LYS A HG3  1  
ATOM 163   H HD2  . LYS A 1 12  ? -9.532  -4.151  -0.244  1.00 0.00 ? 12  LYS A HD2  1  
ATOM 164   H HD3  . LYS A 1 12  ? -9.237  -4.428  -1.962  1.00 0.00 ? 12  LYS A HD3  1  
ATOM 165   H HE2  . LYS A 1 12  ? -11.478 -4.192  -2.514  1.00 0.00 ? 12  LYS A HE2  1  
ATOM 166   H HE3  . LYS A 1 12  ? -12.021 -4.545  -0.874  1.00 0.00 ? 12  LYS A HE3  1  
ATOM 167   H HZ1  . LYS A 1 12  ? -12.300 -2.311  -0.887  1.00 0.00 ? 12  LYS A HZ1  1  
ATOM 168   H HZ2  . LYS A 1 12  ? -11.073 -2.031  -2.016  1.00 0.00 ? 12  LYS A HZ2  1  
ATOM 169   H HZ3  . LYS A 1 12  ? -10.680 -2.340  -0.400  1.00 0.00 ? 12  LYS A HZ3  1  
ATOM 170   N N    . TRP A 1 13  ? -6.901  -7.322  -1.589  1.00 0.00 ? 13  TRP A N    1  
ATOM 171   C CA   . TRP A 1 13  ? -5.917  -8.053  -0.797  1.00 0.00 ? 13  TRP A CA   1  
ATOM 172   C C    . TRP A 1 13  ? -6.564  -8.674  0.436   1.00 0.00 ? 13  TRP A C    1  
ATOM 173   O O    . TRP A 1 13  ? -7.691  -8.334  0.795   1.00 0.00 ? 13  TRP A O    1  
ATOM 174   C CB   . TRP A 1 13  ? -4.778  -7.122  -0.376  1.00 0.00 ? 13  TRP A CB   1  
ATOM 175   C CG   . TRP A 1 13  ? -3.929  -6.666  -1.524  1.00 0.00 ? 13  TRP A CG   1  
ATOM 176   C CD1  . TRP A 1 13  ? -3.899  -5.418  -2.076  1.00 0.00 ? 13  TRP A CD1  1  
ATOM 177   C CD2  . TRP A 1 13  ? -2.988  -7.456  -2.260  1.00 0.00 ? 13  TRP A CD2  1  
ATOM 178   N NE1  . TRP A 1 13  ? -2.997  -5.383  -3.112  1.00 0.00 ? 13  TRP A NE1  1  
ATOM 179   C CE2  . TRP A 1 13  ? -2.424  -6.621  -3.244  1.00 0.00 ? 13  TRP A CE2  1  
ATOM 180   C CE3  . TRP A 1 13  ? -2.566  -8.785  -2.183  1.00 0.00 ? 13  TRP A CE3  1  
ATOM 181   C CZ2  . TRP A 1 13  ? -1.462  -7.074  -4.142  1.00 0.00 ? 13  TRP A CZ2  1  
ATOM 182   C CZ3  . TRP A 1 13  ? -1.611  -9.234  -3.075  1.00 0.00 ? 13  TRP A CZ3  1  
ATOM 183   C CH2  . TRP A 1 13  ? -1.067  -8.381  -4.044  1.00 0.00 ? 13  TRP A CH2  1  
ATOM 184   H H    . TRP A 1 13  ? -6.821  -6.349  -1.670  1.00 0.00 ? 13  TRP A H    1  
ATOM 185   H HA   . TRP A 1 13  ? -5.515  -8.842  -1.415  1.00 0.00 ? 13  TRP A HA   1  
ATOM 186   H HB2  . TRP A 1 13  ? -5.194  -6.247  0.099   1.00 0.00 ? 13  TRP A HB2  1  
ATOM 187   H HB3  . TRP A 1 13  ? -4.141  -7.640  0.326   1.00 0.00 ? 13  TRP A HB3  1  
ATOM 188   H HD1  . TRP A 1 13  ? -4.504  -4.590  -1.740  1.00 0.00 ? 13  TRP A HD1  1  
ATOM 189   H HE1  . TRP A 1 13  ? -2.795  -4.599  -3.665  1.00 0.00 ? 13  TRP A HE1  1  
ATOM 190   H HE3  . TRP A 1 13  ? -2.974  -9.459  -1.443  1.00 0.00 ? 13  TRP A HE3  1  
ATOM 191   H HZ2  . TRP A 1 13  ? -1.032  -6.429  -4.895  1.00 0.00 ? 13  TRP A HZ2  1  
ATOM 192   H HZ3  . TRP A 1 13  ? -1.273  -10.259 -3.031  1.00 0.00 ? 13  TRP A HZ3  1  
ATOM 193   H HH2  . TRP A 1 13  ? -0.324  -8.774  -4.720  1.00 0.00 ? 13  TRP A HH2  1  
ATOM 194   N N    . GLY A 1 14  ? -5.844  -9.587  1.081   1.00 0.00 ? 14  GLY A N    1  
ATOM 195   C CA   . GLY A 1 14  ? -6.365  -10.241 2.267   1.00 0.00 ? 14  GLY A CA   1  
ATOM 196   C C    . GLY A 1 14  ? -5.661  -9.794  3.532   1.00 0.00 ? 14  GLY A C    1  
ATOM 197   O O    . GLY A 1 14  ? -4.794  -8.920  3.510   1.00 0.00 ? 14  GLY A O    1  
ATOM 198   H H    . GLY A 1 14  ? -4.952  -9.819  0.748   1.00 0.00 ? 14  GLY A H    1  
ATOM 199   H HA2  . GLY A 1 14  ? -7.418  -10.017 2.355   1.00 0.00 ? 14  GLY A HA2  1  
ATOM 200   H HA3  . GLY A 1 14  ? -6.243  -11.309 2.158   1.00 0.00 ? 14  GLY A HA3  1  
ATOM 201   N N    . PRO A 1 15  ? -6.036  -10.400 4.668   1.00 0.00 ? 15  PRO A N    1  
ATOM 202   C CA   . PRO A 1 15  ? -5.447  -10.075 5.971   1.00 0.00 ? 15  PRO A CA   1  
ATOM 203   C C    . PRO A 1 15  ? -4.000  -10.540 6.085   1.00 0.00 ? 15  PRO A C    1  
ATOM 204   O O    . PRO A 1 15  ? -3.171  -9.875  6.706   1.00 0.00 ? 15  PRO A O    1  
ATOM 205   C CB   . PRO A 1 15  ? -6.333  -10.835 6.961   1.00 0.00 ? 15  PRO A CB   1  
ATOM 206   C CG   . PRO A 1 15  ? -6.898  -11.966 6.172   1.00 0.00 ? 15  PRO A CG   1  
ATOM 207   C CD   . PRO A 1 15  ? -7.063  -11.451 4.769   1.00 0.00 ? 15  PRO A CD   1  
ATOM 208   H HA   . PRO A 1 15  ? -5.501  -9.016  6.177   1.00 0.00 ? 15  PRO A HA   1  
ATOM 209   H HB2  . PRO A 1 15  ? -5.732  -11.190 7.786   1.00 0.00 ? 15  PRO A HB2  1  
ATOM 210   H HB3  . PRO A 1 15  ? -7.111  -10.183 7.328   1.00 0.00 ? 15  PRO A HB3  1  
ATOM 211   H HG2  . PRO A 1 15  ? -6.215  -12.801 6.187   1.00 0.00 ? 15  PRO A HG2  1  
ATOM 212   H HG3  . PRO A 1 15  ? -7.855  -12.255 6.580   1.00 0.00 ? 15  PRO A HG3  1  
ATOM 213   H HD2  . PRO A 1 15  ? -6.881  -12.239 4.054   1.00 0.00 ? 15  PRO A HD2  1  
ATOM 214   H HD3  . PRO A 1 15  ? -8.051  -11.037 4.633   1.00 0.00 ? 15  PRO A HD3  1  
ATOM 215   N N    . ALA A 1 16  ? -3.702  -11.686 5.481   1.00 0.00 ? 16  ALA A N    1  
ATOM 216   C CA   . ALA A 1 16  ? -2.353  -12.238 5.514   1.00 0.00 ? 16  ALA A CA   1  
ATOM 217   C C    . ALA A 1 16  ? -1.507  -11.688 4.370   1.00 0.00 ? 16  ALA A C    1  
ATOM 218   O O    . ALA A 1 16  ? -0.390  -11.217 4.583   1.00 0.00 ? 16  ALA A O    1  
ATOM 219   C CB   . ALA A 1 16  ? -2.404  -13.757 5.452   1.00 0.00 ? 16  ALA A CB   1  
ATOM 220   H H    . ALA A 1 16  ? -4.405  -12.170 5.002   1.00 0.00 ? 16  ALA A H    1  
ATOM 221   H HA   . ALA A 1 16  ? -1.899  -11.955 6.453   1.00 0.00 ? 16  ALA A HA   1  
ATOM 222   H HB1  . ALA A 1 16  ? -2.438  -14.074 4.420   1.00 0.00 ? 16  ALA A HB1  1  
ATOM 223   H HB2  . ALA A 1 16  ? -1.523  -14.166 5.925   1.00 0.00 ? 16  ALA A HB2  1  
ATOM 224   H HB3  . ALA A 1 16  ? -3.285  -14.109 5.966   1.00 0.00 ? 16  ALA A HB3  1  
ATOM 225   N N    . SER A 1 17  ? -2.047  -11.752 3.157   1.00 0.00 ? 17  SER A N    1  
ATOM 226   C CA   . SER A 1 17  ? -1.339  -11.265 1.979   1.00 0.00 ? 17  SER A CA   1  
ATOM 227   C C    . SER A 1 17  ? -0.764  -9.873  2.228   1.00 0.00 ? 17  SER A C    1  
ATOM 228   O O    . SER A 1 17  ? 0.452   -9.683  2.220   1.00 0.00 ? 17  SER A O    1  
ATOM 229   C CB   . SER A 1 17  ? -2.277  -11.233 0.771   1.00 0.00 ? 17  SER A CB   1  
ATOM 230   O OG   . SER A 1 17  ? -2.412  -12.521 0.196   1.00 0.00 ? 17  SER A OG   1  
ATOM 231   H H    . SER A 1 17  ? -2.941  -12.139 3.052   1.00 0.00 ? 17  SER A H    1  
ATOM 232   H HA   . SER A 1 17  ? -0.526  -11.946 1.775   1.00 0.00 ? 17  SER A HA   1  
ATOM 233   H HB2  . SER A 1 17  ? -3.251  -10.888 1.084   1.00 0.00 ? 17  SER A HB2  1  
ATOM 234   H HB3  . SER A 1 17  ? -1.878  -10.559 0.027   1.00 0.00 ? 17  SER A HB3  1  
ATOM 235   H HG   . SER A 1 17  ? -3.204  -12.549 -0.346  1.00 0.00 ? 17  SER A HG   1  
ATOM 236   N N    . GLN A 1 18  ? -1.648  -8.906  2.448   1.00 0.00 ? 18  GLN A N    1  
ATOM 237   C CA   . GLN A 1 18  ? -1.229  -7.531  2.698   1.00 0.00 ? 18  GLN A CA   1  
ATOM 238   C C    . GLN A 1 18  ? 0.026   -7.494  3.563   1.00 0.00 ? 18  GLN A C    1  
ATOM 239   O O    . GLN A 1 18  ? 1.059   -6.967  3.151   1.00 0.00 ? 18  GLN A O    1  
ATOM 240   C CB   . GLN A 1 18  ? -2.354  -6.749  3.377   1.00 0.00 ? 18  GLN A CB   1  
ATOM 241   C CG   . GLN A 1 18  ? -3.394  -6.213  2.407   1.00 0.00 ? 18  GLN A CG   1  
ATOM 242   C CD   . GLN A 1 18  ? -4.115  -4.990  2.940   1.00 0.00 ? 18  GLN A CD   1  
ATOM 243   O OE1  . GLN A 1 18  ? -3.536  -4.183  3.668   1.00 0.00 ? 18  GLN A OE1  1  
ATOM 244   N NE2  . GLN A 1 18  ? -5.384  -4.846  2.579   1.00 0.00 ? 18  GLN A NE2  1  
ATOM 245   H H    . GLN A 1 18  ? -2.604  -9.120  2.441   1.00 0.00 ? 18  GLN A H    1  
ATOM 246   H HA   . GLN A 1 18  ? -1.009  -7.074  1.745   1.00 0.00 ? 18  GLN A HA   1  
ATOM 247   H HB2  . GLN A 1 18  ? -2.852  -7.396  4.083   1.00 0.00 ? 18  GLN A HB2  1  
ATOM 248   H HB3  . GLN A 1 18  ? -1.925  -5.912  3.908   1.00 0.00 ? 18  GLN A HB3  1  
ATOM 249   H HG2  . GLN A 1 18  ? -2.903  -5.947  1.482   1.00 0.00 ? 18  GLN A HG2  1  
ATOM 250   H HG3  . GLN A 1 18  ? -4.123  -6.987  2.216   1.00 0.00 ? 18  GLN A HG3  1  
ATOM 251   H HE21 . GLN A 1 18  ? -5.780  -5.530  1.998   1.00 0.00 ? 18  GLN A HE21 1  
ATOM 252   H HE22 . GLN A 1 18  ? -5.874  -4.066  2.910   1.00 0.00 ? 18  GLN A HE22 1  
ATOM 253   N N    . GLN A 1 19  ? -0.071  -8.056  4.763   1.00 0.00 ? 19  GLN A N    1  
ATOM 254   C CA   . GLN A 1 19  ? 1.057   -8.086  5.686   1.00 0.00 ? 19  GLN A CA   1  
ATOM 255   C C    . GLN A 1 19  ? 2.338   -8.499  4.968   1.00 0.00 ? 19  GLN A C    1  
ATOM 256   O O    . GLN A 1 19  ? 3.380   -7.862  5.122   1.00 0.00 ? 19  GLN A O    1  
ATOM 257   C CB   . GLN A 1 19  ? 0.774   -9.047  6.841   1.00 0.00 ? 19  GLN A CB   1  
ATOM 258   C CG   . GLN A 1 19  ? -0.391  -8.617  7.719   1.00 0.00 ? 19  GLN A CG   1  
ATOM 259   C CD   . GLN A 1 19  ? -0.041  -7.451  8.622   1.00 0.00 ? 19  GLN A CD   1  
ATOM 260   O OE1  . GLN A 1 19  ? 0.031   -6.305  8.175   1.00 0.00 ? 19  GLN A OE1  1  
ATOM 261   N NE2  . GLN A 1 19  ? 0.179   -7.736  9.900   1.00 0.00 ? 19  GLN A NE2  1  
ATOM 262   H H    . GLN A 1 19  ? -0.921  -8.460  5.034   1.00 0.00 ? 19  GLN A H    1  
ATOM 263   H HA   . GLN A 1 19  ? 1.187   -7.090  6.083   1.00 0.00 ? 19  GLN A HA   1  
ATOM 264   H HB2  . GLN A 1 19  ? 0.550   -10.023 6.435   1.00 0.00 ? 19  GLN A HB2  1  
ATOM 265   H HB3  . GLN A 1 19  ? 1.656   -9.118  7.460   1.00 0.00 ? 19  GLN A HB3  1  
ATOM 266   H HG2  . GLN A 1 19  ? -1.215  -8.327  7.085   1.00 0.00 ? 19  GLN A HG2  1  
ATOM 267   H HG3  . GLN A 1 19  ? -0.688  -9.453  8.335   1.00 0.00 ? 19  GLN A HG3  1  
ATOM 268   H HE21 . GLN A 1 19  ? 0.105   -8.671  10.184  1.00 0.00 ? 19  GLN A HE21 1  
ATOM 269   H HE22 . GLN A 1 19  ? 0.407   -7.001  10.505  1.00 0.00 ? 19  GLN A HE22 1  
ATOM 270   N N    . ILE A 1 20  ? 2.251   -9.567  4.183   1.00 0.00 ? 20  ILE A N    1  
ATOM 271   C CA   . ILE A 1 20  ? 3.403   -10.064 3.441   1.00 0.00 ? 20  ILE A CA   1  
ATOM 272   C C    . ILE A 1 20  ? 4.010   -8.970  2.569   1.00 0.00 ? 20  ILE A C    1  
ATOM 273   O O    . ILE A 1 20  ? 5.230   -8.819  2.503   1.00 0.00 ? 20  ILE A O    1  
ATOM 274   C CB   . ILE A 1 20  ? 3.025   -11.263 2.551   1.00 0.00 ? 20  ILE A CB   1  
ATOM 275   C CG1  . ILE A 1 20  ? 2.500   -12.417 3.407   1.00 0.00 ? 20  ILE A CG1  1  
ATOM 276   C CG2  . ILE A 1 20  ? 4.223   -11.710 1.727   1.00 0.00 ? 20  ILE A CG2  1  
ATOM 277   C CD1  . ILE A 1 20  ? 1.488   -13.287 2.694   1.00 0.00 ? 20  ILE A CD1  1  
ATOM 278   H H    . ILE A 1 20  ? 1.393   -10.032 4.101   1.00 0.00 ? 20  ILE A H    1  
ATOM 279   H HA   . ILE A 1 20  ? 4.144   -10.392 4.156   1.00 0.00 ? 20  ILE A HA   1  
ATOM 280   H HB   . ILE A 1 20  ? 2.249   -10.946 1.870   1.00 0.00 ? 20  ILE A HB   1  
ATOM 281   H HG12 . ILE A 1 20  ? 3.327   -13.043 3.702   1.00 0.00 ? 20  ILE A HG12 1  
ATOM 282   H HG13 . ILE A 1 20  ? 2.027   -12.013 4.291   1.00 0.00 ? 20  ILE A HG13 1  
ATOM 283   H HG21 . ILE A 1 20  ? 5.079   -11.834 2.374   1.00 0.00 ? 20  ILE A HG21 1  
ATOM 284   H HG22 . ILE A 1 20  ? 3.998   -12.650 1.246   1.00 0.00 ? 20  ILE A HG22 1  
ATOM 285   H HG23 . ILE A 1 20  ? 4.444   -10.965 0.978   1.00 0.00 ? 20  ILE A HG23 1  
ATOM 286   H HD11 . ILE A 1 20  ? 1.480   -13.042 1.643   1.00 0.00 ? 20  ILE A HD11 1  
ATOM 287   H HD12 . ILE A 1 20  ? 1.754   -14.326 2.821   1.00 0.00 ? 20  ILE A HD12 1  
ATOM 288   H HD13 . ILE A 1 20  ? 0.507   -13.113 3.111   1.00 0.00 ? 20  ILE A HD13 1  
ATOM 289   N N    . LEU A 1 21  ? 3.150   -8.206  1.904   1.00 0.00 ? 21  LEU A N    1  
ATOM 290   C CA   . LEU A 1 21  ? 3.600   -7.123  1.037   1.00 0.00 ? 21  LEU A CA   1  
ATOM 291   C C    . LEU A 1 21  ? 4.418   -6.102  1.822   1.00 0.00 ? 21  LEU A C    1  
ATOM 292   O O    . LEU A 1 21  ? 5.455   -5.631  1.354   1.00 0.00 ? 21  LEU A O    1  
ATOM 293   C CB   . LEU A 1 21  ? 2.400   -6.436  0.382   1.00 0.00 ? 21  LEU A CB   1  
ATOM 294   C CG   . LEU A 1 21  ? 1.367   -7.361  -0.263  1.00 0.00 ? 21  LEU A CG   1  
ATOM 295   C CD1  . LEU A 1 21  ? 0.280   -6.550  -0.951  1.00 0.00 ? 21  LEU A CD1  1  
ATOM 296   C CD2  . LEU A 1 21  ? 2.038   -8.304  -1.251  1.00 0.00 ? 21  LEU A CD2  1  
ATOM 297   H H    . LEU A 1 21  ? 2.189   -8.375  1.997   1.00 0.00 ? 21  LEU A H    1  
ATOM 298   H HA   . LEU A 1 21  ? 4.224   -7.552  0.268   1.00 0.00 ? 21  LEU A HA   1  
ATOM 299   H HB2  . LEU A 1 21  ? 1.897   -5.855  1.139   1.00 0.00 ? 21  LEU A HB2  1  
ATOM 300   H HB3  . LEU A 1 21  ? 2.778   -5.775  -0.385  1.00 0.00 ? 21  LEU A HB3  1  
ATOM 301   H HG   . LEU A 1 21  ? 0.900   -7.960  0.507   1.00 0.00 ? 21  LEU A HG   1  
ATOM 302   H HD11 . LEU A 1 21  ? -0.685  -6.838  -0.562  1.00 0.00 ? 21  LEU A HD11 1  
ATOM 303   H HD12 . LEU A 1 21  ? 0.310   -6.737  -2.014  1.00 0.00 ? 21  LEU A HD12 1  
ATOM 304   H HD13 . LEU A 1 21  ? 0.445   -5.498  -0.766  1.00 0.00 ? 21  LEU A HD13 1  
ATOM 305   H HD21 . LEU A 1 21  ? 2.237   -7.776  -2.173  1.00 0.00 ? 21  LEU A HD21 1  
ATOM 306   H HD22 . LEU A 1 21  ? 1.385   -9.141  -1.450  1.00 0.00 ? 21  LEU A HD22 1  
ATOM 307   H HD23 . LEU A 1 21  ? 2.967   -8.662  -0.833  1.00 0.00 ? 21  LEU A HD23 1  
ATOM 308   N N    . TYR A 1 22  ? 3.946   -5.767  3.018   1.00 0.00 ? 22  TYR A N    1  
ATOM 309   C CA   . TYR A 1 22  ? 4.634   -4.802  3.868   1.00 0.00 ? 22  TYR A CA   1  
ATOM 310   C C    . TYR A 1 22  ? 6.013   -5.317  4.271   1.00 0.00 ? 22  TYR A C    1  
ATOM 311   O O    . TYR A 1 22  ? 7.008   -4.600  4.169   1.00 0.00 ? 22  TYR A O    1  
ATOM 312   C CB   . TYR A 1 22  ? 3.802   -4.508  5.117   1.00 0.00 ? 22  TYR A CB   1  
ATOM 313   C CG   . TYR A 1 22  ? 2.521   -3.759  4.828   1.00 0.00 ? 22  TYR A CG   1  
ATOM 314   C CD1  . TYR A 1 22  ? 2.520   -2.378  4.671   1.00 0.00 ? 22  TYR A CD1  1  
ATOM 315   C CD2  . TYR A 1 22  ? 1.310   -4.432  4.714   1.00 0.00 ? 22  TYR A CD2  1  
ATOM 316   C CE1  . TYR A 1 22  ? 1.352   -1.690  4.408   1.00 0.00 ? 22  TYR A CE1  1  
ATOM 317   C CE2  . TYR A 1 22  ? 0.137   -3.752  4.449   1.00 0.00 ? 22  TYR A CE2  1  
ATOM 318   C CZ   . TYR A 1 22  ? 0.163   -2.381  4.298   1.00 0.00 ? 22  TYR A CZ   1  
ATOM 319   O OH   . TYR A 1 22  ? -1.004  -1.700  4.036   1.00 0.00 ? 22  TYR A OH   1  
ATOM 320   H H    . TYR A 1 22  ? 3.115   -6.177  3.336   1.00 0.00 ? 22  TYR A H    1  
ATOM 321   H HA   . TYR A 1 22  ? 4.754   -3.889  3.303   1.00 0.00 ? 22  TYR A HA   1  
ATOM 322   H HB2  . TYR A 1 22  ? 3.541   -5.439  5.595   1.00 0.00 ? 22  TYR A HB2  1  
ATOM 323   H HB3  . TYR A 1 22  ? 4.389   -3.910  5.799   1.00 0.00 ? 22  TYR A HB3  1  
ATOM 324   H HD1  . TYR A 1 22  ? 3.453   -1.840  4.759   1.00 0.00 ? 22  TYR A HD1  1  
ATOM 325   H HD2  . TYR A 1 22  ? 1.294   -5.505  4.833   1.00 0.00 ? 22  TYR A HD2  1  
ATOM 326   H HE1  . TYR A 1 22  ? 1.371   -0.616  4.289   1.00 0.00 ? 22  TYR A HE1  1  
ATOM 327   H HE2  . TYR A 1 22  ? -0.793  -4.293  4.363   1.00 0.00 ? 22  TYR A HE2  1  
ATOM 328   H HH   . TYR A 1 22  ? -0.897  -0.777  4.279   1.00 0.00 ? 22  TYR A HH   1  
ATOM 329   N N    . GLN A 1 23  ? 6.061   -6.564  4.728   1.00 0.00 ? 23  GLN A N    1  
ATOM 330   C CA   . GLN A 1 23  ? 7.317   -7.175  5.146   1.00 0.00 ? 23  GLN A CA   1  
ATOM 331   C C    . GLN A 1 23  ? 8.345   -7.133  4.020   1.00 0.00 ? 23  GLN A C    1  
ATOM 332   O O    . GLN A 1 23  ? 9.546   -7.031  4.267   1.00 0.00 ? 23  GLN A O    1  
ATOM 333   C CB   . GLN A 1 23  ? 7.083   -8.621  5.585   1.00 0.00 ? 23  GLN A CB   1  
ATOM 334   C CG   . GLN A 1 23  ? 6.769   -8.764  7.066   1.00 0.00 ? 23  GLN A CG   1  
ATOM 335   C CD   . GLN A 1 23  ? 8.015   -8.769  7.929   1.00 0.00 ? 23  GLN A CD   1  
ATOM 336   O OE1  . GLN A 1 23  ? 8.585   -9.824  8.211   1.00 0.00 ? 23  GLN A OE1  1  
ATOM 337   N NE2  . GLN A 1 23  ? 8.444   -7.587  8.355   1.00 0.00 ? 23  GLN A NE2  1  
ATOM 338   H H    . GLN A 1 23  ? 5.234   -7.084  4.785   1.00 0.00 ? 23  GLN A H    1  
ATOM 339   H HA   . GLN A 1 23  ? 7.697   -6.611  5.985   1.00 0.00 ? 23  GLN A HA   1  
ATOM 340   H HB2  . GLN A 1 23  ? 6.256   -9.027  5.022   1.00 0.00 ? 23  GLN A HB2  1  
ATOM 341   H HB3  . GLN A 1 23  ? 7.971   -9.198  5.371   1.00 0.00 ? 23  GLN A HB3  1  
ATOM 342   H HG2  . GLN A 1 23  ? 6.143   -7.938  7.369   1.00 0.00 ? 23  GLN A HG2  1  
ATOM 343   H HG3  . GLN A 1 23  ? 6.238   -9.692  7.219   1.00 0.00 ? 23  GLN A HG3  1  
ATOM 344   H HE21 . GLN A 1 23  ? 7.939   -6.789  8.093   1.00 0.00 ? 23  GLN A HE21 1  
ATOM 345   H HE22 . GLN A 1 23  ? 9.247   -7.561  8.916   1.00 0.00 ? 23  GLN A HE22 1  
ATOM 346   N N    . ALA A 1 24  ? 7.864   -7.212  2.784   1.00 0.00 ? 24  ALA A N    1  
ATOM 347   C CA   . ALA A 1 24  ? 8.741   -7.182  1.620   1.00 0.00 ? 24  ALA A CA   1  
ATOM 348   C C    . ALA A 1 24  ? 9.076   -5.748  1.223   1.00 0.00 ? 24  ALA A C    1  
ATOM 349   O O    . ALA A 1 24  ? 10.218  -5.439  0.881   1.00 0.00 ? 24  ALA A O    1  
ATOM 350   C CB   . ALA A 1 24  ? 8.097   -7.917  0.454   1.00 0.00 ? 24  ALA A CB   1  
ATOM 351   H H    . ALA A 1 24  ? 6.897   -7.292  2.651   1.00 0.00 ? 24  ALA A H    1  
ATOM 352   H HA   . ALA A 1 24  ? 9.656   -7.696  1.877   1.00 0.00 ? 24  ALA A HA   1  
ATOM 353   H HB1  . ALA A 1 24  ? 8.650   -8.823  0.252   1.00 0.00 ? 24  ALA A HB1  1  
ATOM 354   H HB2  . ALA A 1 24  ? 7.077   -8.165  0.705   1.00 0.00 ? 24  ALA A HB2  1  
ATOM 355   H HB3  . ALA A 1 24  ? 8.110   -7.285  -0.421  1.00 0.00 ? 24  ALA A HB3  1  
ATOM 356   N N    . TYR A 1 25  ? 8.075   -4.877  1.270   1.00 0.00 ? 25  TYR A N    1  
ATOM 357   C CA   . TYR A 1 25  ? 8.263   -3.476  0.911   1.00 0.00 ? 25  TYR A CA   1  
ATOM 358   C C    . TYR A 1 25  ? 9.206   -2.785  1.892   1.00 0.00 ? 25  TYR A C    1  
ATOM 359   O O    . TYR A 1 25  ? 10.001  -1.928  1.507   1.00 0.00 ? 25  TYR A O    1  
ATOM 360   C CB   . TYR A 1 25  ? 6.917   -2.750  0.883   1.00 0.00 ? 25  TYR A CB   1  
ATOM 361   C CG   . TYR A 1 25  ? 6.993   -1.355  0.303   1.00 0.00 ? 25  TYR A CG   1  
ATOM 362   C CD1  . TYR A 1 25  ? 7.577   -0.316  1.017   1.00 0.00 ? 25  TYR A CD1  1  
ATOM 363   C CD2  . TYR A 1 25  ? 6.482   -1.077  -0.958  1.00 0.00 ? 25  TYR A CD2  1  
ATOM 364   C CE1  . TYR A 1 25  ? 7.648   0.960   0.492   1.00 0.00 ? 25  TYR A CE1  1  
ATOM 365   C CE2  . TYR A 1 25  ? 6.550   0.195   -1.492  1.00 0.00 ? 25  TYR A CE2  1  
ATOM 366   C CZ   . TYR A 1 25  ? 7.134   1.210   -0.763  1.00 0.00 ? 25  TYR A CZ   1  
ATOM 367   O OH   . TYR A 1 25  ? 7.203   2.479   -1.291  1.00 0.00 ? 25  TYR A OH   1  
ATOM 368   H H    . TYR A 1 25  ? 7.187   -5.183  1.550   1.00 0.00 ? 25  TYR A H    1  
ATOM 369   H HA   . TYR A 1 25  ? 8.700   -3.442  -0.076  1.00 0.00 ? 25  TYR A HA   1  
ATOM 370   H HB2  . TYR A 1 25  ? 6.221   -3.319  0.286   1.00 0.00 ? 25  TYR A HB2  1  
ATOM 371   H HB3  . TYR A 1 25  ? 6.537   -2.670  1.891   1.00 0.00 ? 25  TYR A HB3  1  
ATOM 372   H HD1  . TYR A 1 25  ? 7.978   -0.515  2.000   1.00 0.00 ? 25  TYR A HD1  1  
ATOM 373   H HD2  . TYR A 1 25  ? 6.025   -1.874  -1.526  1.00 0.00 ? 25  TYR A HD2  1  
ATOM 374   H HE1  . TYR A 1 25  ? 8.105   1.755   1.062   1.00 0.00 ? 25  TYR A HE1  1  
ATOM 375   H HE2  . TYR A 1 25  ? 6.147   0.392   -2.475  1.00 0.00 ? 25  TYR A HE2  1  
ATOM 376   H HH   . TYR A 1 25  ? 7.904   2.969   -0.855  1.00 0.00 ? 25  TYR A HH   1  
ATOM 377   N N    . ASP A 1 26  ? 9.110   -3.164  3.161   1.00 0.00 ? 26  ASP A N    1  
ATOM 378   C CA   . ASP A 1 26  ? 9.955   -2.584  4.199   1.00 0.00 ? 26  ASP A CA   1  
ATOM 379   C C    . ASP A 1 26  ? 11.431  -2.820  3.893   1.00 0.00 ? 26  ASP A C    1  
ATOM 380   O O    . ASP A 1 26  ? 12.281  -1.986  4.206   1.00 0.00 ? 26  ASP A O    1  
ATOM 381   C CB   . ASP A 1 26  ? 9.602   -3.176  5.564   1.00 0.00 ? 26  ASP A CB   1  
ATOM 382   C CG   . ASP A 1 26  ? 9.865   -2.208  6.701   1.00 0.00 ? 26  ASP A CG   1  
ATOM 383   O OD1  . ASP A 1 26  ? 10.911  -1.526  6.669   1.00 0.00 ? 26  ASP A OD1  1  
ATOM 384   O OD2  . ASP A 1 26  ? 9.026   -2.132  7.622   1.00 0.00 ? 26  ASP A OD2  1  
ATOM 385   H H    . ASP A 1 26  ? 8.456   -3.852  3.407   1.00 0.00 ? 26  ASP A H    1  
ATOM 386   H HA   . ASP A 1 26  ? 9.771   -1.520  4.220   1.00 0.00 ? 26  ASP A HA   1  
ATOM 387   H HB2  . ASP A 1 26  ? 8.555   -3.439  5.576   1.00 0.00 ? 26  ASP A HB2  1  
ATOM 388   H HB3  . ASP A 1 26  ? 10.194  -4.064  5.727   1.00 0.00 ? 26  ASP A HB3  1  
ATOM 389   N N    . ARG A 1 27  ? 11.728  -3.962  3.282   1.00 0.00 ? 27  ARG A N    1  
ATOM 390   C CA   . ARG A 1 27  ? 13.101  -4.310  2.937   1.00 0.00 ? 27  ARG A CA   1  
ATOM 391   C C    . ARG A 1 27  ? 13.490  -3.713  1.587   1.00 0.00 ? 27  ARG A C    1  
ATOM 392   O O    . ARG A 1 27  ? 14.542  -3.090  1.454   1.00 0.00 ? 27  ARG A O    1  
ATOM 393   C CB   . ARG A 1 27  ? 13.272  -5.830  2.904   1.00 0.00 ? 27  ARG A CB   1  
ATOM 394   C CG   . ARG A 1 27  ? 12.702  -6.534  4.124   1.00 0.00 ? 27  ARG A CG   1  
ATOM 395   C CD   . ARG A 1 27  ? 12.790  -8.046  3.987   1.00 0.00 ? 27  ARG A CD   1  
ATOM 396   N NE   . ARG A 1 27  ? 12.801  -8.714  5.285   1.00 0.00 ? 27  ARG A NE   1  
ATOM 397   C CZ   . ARG A 1 27  ? 13.797  -8.608  6.158   1.00 0.00 ? 27  ARG A CZ   1  
ATOM 398   N NH1  . ARG A 1 27  ? 14.857  -7.865  5.873   1.00 0.00 ? 27  ARG A NH1  1  
ATOM 399   N NH2  . ARG A 1 27  ? 13.733  -9.246  7.320   1.00 0.00 ? 27  ARG A NH2  1  
ATOM 400   H H    . ARG A 1 27  ? 11.006  -4.587  3.059   1.00 0.00 ? 27  ARG A H    1  
ATOM 401   H HA   . ARG A 1 27  ? 13.748  -3.900  3.698   1.00 0.00 ? 27  ARG A HA   1  
ATOM 402   H HB2  . ARG A 1 27  ? 12.774  -6.217  2.027   1.00 0.00 ? 27  ARG A HB2  1  
ATOM 403   H HB3  . ARG A 1 27  ? 14.325  -6.059  2.841   1.00 0.00 ? 27  ARG A HB3  1  
ATOM 404   H HG2  . ARG A 1 27  ? 13.261  -6.230  4.997   1.00 0.00 ? 27  ARG A HG2  1  
ATOM 405   H HG3  . ARG A 1 27  ? 11.667  -6.251  4.241   1.00 0.00 ? 27  ARG A HG3  1  
ATOM 406   H HD2  . ARG A 1 27  ? 11.938  -8.392  3.421   1.00 0.00 ? 27  ARG A HD2  1  
ATOM 407   H HD3  . ARG A 1 27  ? 13.698  -8.293  3.457   1.00 0.00 ? 27  ARG A HD3  1  
ATOM 408   H HE   . ARG A 1 27  ? 12.027  -9.268  5.517   1.00 0.00 ? 27  ARG A HE   1  
ATOM 409   H HH11 . ARG A 1 27  ? 14.907  -7.382  4.999   1.00 0.00 ? 27  ARG A HH11 1  
ATOM 410   H HH12 . ARG A 1 27  ? 15.605  -7.786  6.532   1.00 0.00 ? 27  ARG A HH12 1  
ATOM 411   H HH21 . ARG A 1 27  ? 12.935  -9.807  7.539   1.00 0.00 ? 27  ARG A HH21 1  
ATOM 412   H HH22 . ARG A 1 27  ? 14.483  -9.166  7.976   1.00 0.00 ? 27  ARG A HH22 1  
ATOM 413   N N    . GLN A 1 28  ? 12.633  -3.910  0.591   1.00 0.00 ? 28  GLN A N    1  
ATOM 414   C CA   . GLN A 1 28  ? 12.888  -3.393  -0.749  1.00 0.00 ? 28  GLN A CA   1  
ATOM 415   C C    . GLN A 1 28  ? 11.690  -2.602  -1.264  1.00 0.00 ? 28  GLN A C    1  
ATOM 416   O O    . GLN A 1 28  ? 10.574  -3.117  -1.331  1.00 0.00 ? 28  GLN A O    1  
ATOM 417   C CB   . GLN A 1 28  ? 13.208  -4.540  -1.709  1.00 0.00 ? 28  GLN A CB   1  
ATOM 418   C CG   . GLN A 1 28  ? 13.522  -4.080  -3.123  1.00 0.00 ? 28  GLN A CG   1  
ATOM 419   C CD   . GLN A 1 28  ? 14.914  -3.492  -3.250  1.00 0.00 ? 28  GLN A CD   1  
ATOM 420   O OE1  . GLN A 1 28  ? 15.910  -4.162  -2.974  1.00 0.00 ? 28  GLN A OE1  1  
ATOM 421   N NE2  . GLN A 1 28  ? 14.990  -2.235  -3.669  1.00 0.00 ? 28  GLN A NE2  1  
ATOM 422   H H    . GLN A 1 28  ? 11.811  -4.415  0.759   1.00 0.00 ? 28  GLN A H    1  
ATOM 423   H HA   . GLN A 1 28  ? 13.741  -2.734  -0.692  1.00 0.00 ? 28  GLN A HA   1  
ATOM 424   H HB2  . GLN A 1 28  ? 14.061  -5.083  -1.331  1.00 0.00 ? 28  GLN A HB2  1  
ATOM 425   H HB3  . GLN A 1 28  ? 12.358  -5.206  -1.751  1.00 0.00 ? 28  GLN A HB3  1  
ATOM 426   H HG2  . GLN A 1 28  ? 13.444  -4.926  -3.790  1.00 0.00 ? 28  GLN A HG2  1  
ATOM 427   H HG3  . GLN A 1 28  ? 12.802  -3.328  -3.411  1.00 0.00 ? 28  GLN A HG3  1  
ATOM 428   H HE21 . GLN A 1 28  ? 14.155  -1.762  -3.869  1.00 0.00 ? 28  GLN A HE21 1  
ATOM 429   H HE22 . GLN A 1 28  ? 15.877  -1.830  -3.759  1.00 0.00 ? 28  GLN A HE22 1  
ATOM 430   N N    . LYS A 1 29  ? 11.929  -1.346  -1.627  1.00 0.00 ? 29  LYS A N    1  
ATOM 431   C CA   . LYS A 1 29  ? 10.871  -0.482  -2.137  1.00 0.00 ? 29  LYS A CA   1  
ATOM 432   C C    . LYS A 1 29  ? 10.510  -0.854  -3.572  1.00 0.00 ? 29  LYS A C    1  
ATOM 433   O O    . LYS A 1 29  ? 9.369   -0.681  -3.999  1.00 0.00 ? 29  LYS A O    1  
ATOM 434   C CB   . LYS A 1 29  ? 11.305  0.984   -2.072  1.00 0.00 ? 29  LYS A CB   1  
ATOM 435   C CG   . LYS A 1 29  ? 11.908  1.381   -0.736  1.00 0.00 ? 29  LYS A CG   1  
ATOM 436   C CD   . LYS A 1 29  ? 10.843  1.860   0.236   1.00 0.00 ? 29  LYS A CD   1  
ATOM 437   C CE   . LYS A 1 29  ? 11.273  1.650   1.680   1.00 0.00 ? 29  LYS A CE   1  
ATOM 438   N NZ   . LYS A 1 29  ? 12.107  2.778   2.180   1.00 0.00 ? 29  LYS A NZ   1  
ATOM 439   H H    . LYS A 1 29  ? 12.840  -0.992  -1.550  1.00 0.00 ? 29  LYS A H    1  
ATOM 440   H HA   . LYS A 1 29  ? 10.001  -0.619  -1.513  1.00 0.00 ? 29  LYS A HA   1  
ATOM 441   H HB2  . LYS A 1 29  ? 12.040  1.163   -2.843  1.00 0.00 ? 29  LYS A HB2  1  
ATOM 442   H HB3  . LYS A 1 29  ? 10.444  1.610   -2.255  1.00 0.00 ? 29  LYS A HB3  1  
ATOM 443   H HG2  . LYS A 1 29  ? 12.411  0.525   -0.310  1.00 0.00 ? 29  LYS A HG2  1  
ATOM 444   H HG3  . LYS A 1 29  ? 12.621  2.177   -0.896  1.00 0.00 ? 29  LYS A HG3  1  
ATOM 445   H HD2  . LYS A 1 29  ? 10.667  2.913   0.074   1.00 0.00 ? 29  LYS A HD2  1  
ATOM 446   H HD3  . LYS A 1 29  ? 9.931   1.309   0.057   1.00 0.00 ? 29  LYS A HD3  1  
ATOM 447   H HE2  . LYS A 1 29  ? 10.390  1.567   2.296   1.00 0.00 ? 29  LYS A HE2  1  
ATOM 448   H HE3  . LYS A 1 29  ? 11.843  0.736   1.743   1.00 0.00 ? 29  LYS A HE3  1  
ATOM 449   H HZ1  . LYS A 1 29  ? 11.522  3.439   2.730   1.00 0.00 ? 29  LYS A HZ1  1  
ATOM 450   H HZ2  . LYS A 1 29  ? 12.531  3.291   1.381   1.00 0.00 ? 29  LYS A HZ2  1  
ATOM 451   H HZ3  . LYS A 1 29  ? 12.868  2.417   2.789   1.00 0.00 ? 29  LYS A HZ3  1  
ATOM 452   N N    . ASN A 1 30  ? 11.489  -1.366  -4.310  1.00 0.00 ? 30  ASN A N    1  
ATOM 453   C CA   . ASN A 1 30  ? 11.274  -1.762  -5.697  1.00 0.00 ? 30  ASN A CA   1  
ATOM 454   C C    . ASN A 1 30  ? 11.660  -3.222  -5.911  1.00 0.00 ? 30  ASN A C    1  
ATOM 455   O O    . ASN A 1 30  ? 12.765  -3.540  -6.352  1.00 0.00 ? 30  ASN A O    1  
ATOM 456   C CB   . ASN A 1 30  ? 12.082  -0.866  -6.637  1.00 0.00 ? 30  ASN A CB   1  
ATOM 457   C CG   . ASN A 1 30  ? 13.533  -0.744  -6.214  1.00 0.00 ? 30  ASN A CG   1  
ATOM 458   O OD1  . ASN A 1 30  ? 14.313  -1.687  -6.351  1.00 0.00 ? 30  ASN A OD1  1  
ATOM 459   N ND2  . ASN A 1 30  ? 13.903  0.422   -5.696  1.00 0.00 ? 30  ASN A ND2  1  
ATOM 460   H H    . ASN A 1 30  ? 12.378  -1.479  -3.913  1.00 0.00 ? 30  ASN A H    1  
ATOM 461   H HA   . ASN A 1 30  ? 10.223  -1.644  -5.916  1.00 0.00 ? 30  ASN A HA   1  
ATOM 462   H HB2  . ASN A 1 30  ? 12.052  -1.280  -7.634  1.00 0.00 ? 30  ASN A HB2  1  
ATOM 463   H HB3  . ASN A 1 30  ? 11.645  0.121   -6.648  1.00 0.00 ? 30  ASN A HB3  1  
ATOM 464   H HD21 . ASN A 1 30  ? 13.228  1.128   -5.617  1.00 0.00 ? 30  ASN A HD21 1  
ATOM 465   H HD22 . ASN A 1 30  ? 14.835  0.528   -5.415  1.00 0.00 ? 30  ASN A HD22 1  
ATOM 466   N N    . PRO A 1 31  ? 10.729  -4.134  -5.593  1.00 0.00 ? 31  PRO A N    1  
ATOM 467   C CA   . PRO A 1 31  ? 10.948  -5.575  -5.743  1.00 0.00 ? 31  PRO A CA   1  
ATOM 468   C C    . PRO A 1 31  ? 11.007  -6.003  -7.205  1.00 0.00 ? 31  PRO A C    1  
ATOM 469   O O    . PRO A 1 31  ? 10.162  -5.613  -8.011  1.00 0.00 ? 31  PRO A O    1  
ATOM 470   C CB   . PRO A 1 31  ? 9.728   -6.193  -5.054  1.00 0.00 ? 31  PRO A CB   1  
ATOM 471   C CG   . PRO A 1 31  ? 8.672   -5.146  -5.142  1.00 0.00 ? 31  PRO A CG   1  
ATOM 472   C CD   . PRO A 1 31  ? 9.390   -3.827  -5.062  1.00 0.00 ? 31  PRO A CD   1  
ATOM 473   H HA   . PRO A 1 31  ? 11.848  -5.894  -5.239  1.00 0.00 ? 31  PRO A HA   1  
ATOM 474   H HB2  . PRO A 1 31  ? 9.436   -7.095  -5.574  1.00 0.00 ? 31  PRO A HB2  1  
ATOM 475   H HB3  . PRO A 1 31  ? 9.969   -6.425  -4.028  1.00 0.00 ? 31  PRO A HB3  1  
ATOM 476   H HG2  . PRO A 1 31  ? 8.148   -5.231  -6.082  1.00 0.00 ? 31  PRO A HG2  1  
ATOM 477   H HG3  . PRO A 1 31  ? 7.984   -5.249  -4.316  1.00 0.00 ? 31  PRO A HG3  1  
ATOM 478   H HD2  . PRO A 1 31  ? 8.892   -3.089  -5.674  1.00 0.00 ? 31  PRO A HD2  1  
ATOM 479   H HD3  . PRO A 1 31  ? 9.450   -3.492  -4.037  1.00 0.00 ? 31  PRO A HD3  1  
ATOM 480   N N    . SER A 1 32  ? 12.010  -6.809  -7.541  1.00 0.00 ? 32  SER A N    1  
ATOM 481   C CA   . SER A 1 32  ? 12.181  -7.287  -8.908  1.00 0.00 ? 32  SER A CA   1  
ATOM 482   C C    . SER A 1 32  ? 11.466  -8.620  -9.111  1.00 0.00 ? 32  SER A C    1  
ATOM 483   O O    . SER A 1 32  ? 10.812  -9.132  -8.202  1.00 0.00 ? 32  SER A O    1  
ATOM 484   C CB   . SER A 1 32  ? 13.667  -7.437  -9.236  1.00 0.00 ? 32  SER A CB   1  
ATOM 485   O OG   . SER A 1 32  ? 14.219  -6.209  -9.677  1.00 0.00 ? 32  SER A OG   1  
ATOM 486   H H    . SER A 1 32  ? 12.651  -7.085  -6.854  1.00 0.00 ? 32  SER A H    1  
ATOM 487   H HA   . SER A 1 32  ? 11.746  -6.555  -9.573  1.00 0.00 ? 32  SER A HA   1  
ATOM 488   H HB2  . SER A 1 32  ? 14.197  -7.760  -8.353  1.00 0.00 ? 32  SER A HB2  1  
ATOM 489   H HB3  . SER A 1 32  ? 13.788  -8.174  -10.018 1.00 0.00 ? 32  SER A HB3  1  
ATOM 490   H HG   . SER A 1 32  ? 14.806  -5.861  -9.002  1.00 0.00 ? 32  SER A HG   1  
ATOM 491   N N    . LYS A 1 33  ? 11.597  -9.178  -10.309 1.00 0.00 ? 33  LYS A N    1  
ATOM 492   C CA   . LYS A 1 33  ? 10.966  -10.452 -10.634 1.00 0.00 ? 33  LYS A CA   1  
ATOM 493   C C    . LYS A 1 33  ? 11.120  -11.443 -9.485  1.00 0.00 ? 33  LYS A C    1  
ATOM 494   O O    . LYS A 1 33  ? 10.250  -12.283 -9.258  1.00 0.00 ? 33  LYS A O    1  
ATOM 495   C CB   . LYS A 1 33  ? 11.576  -11.036 -11.910 1.00 0.00 ? 33  LYS A CB   1  
ATOM 496   C CG   . LYS A 1 33  ? 10.881  -12.297 -12.394 1.00 0.00 ? 33  LYS A CG   1  
ATOM 497   C CD   . LYS A 1 33  ? 9.731   -11.975 -13.333 1.00 0.00 ? 33  LYS A CD   1  
ATOM 498   C CE   . LYS A 1 33  ? 9.017   -13.236 -13.793 1.00 0.00 ? 33  LYS A CE   1  
ATOM 499   N NZ   . LYS A 1 33  ? 9.734   -13.900 -14.918 1.00 0.00 ? 33  LYS A NZ   1  
ATOM 500   H H    . LYS A 1 33  ? 12.132  -8.722  -10.993 1.00 0.00 ? 33  LYS A H    1  
ATOM 501   H HA   . LYS A 1 33  ? 9.915   -10.269 -10.798 1.00 0.00 ? 33  LYS A HA   1  
ATOM 502   H HB2  . LYS A 1 33  ? 11.519  -10.295 -12.694 1.00 0.00 ? 33  LYS A HB2  1  
ATOM 503   H HB3  . LYS A 1 33  ? 12.614  -11.271 -11.724 1.00 0.00 ? 33  LYS A HB3  1  
ATOM 504   H HG2  . LYS A 1 33  ? 11.597  -12.913 -12.918 1.00 0.00 ? 33  LYS A HG2  1  
ATOM 505   H HG3  . LYS A 1 33  ? 10.497  -12.836 -11.540 1.00 0.00 ? 33  LYS A HG3  1  
ATOM 506   H HD2  . LYS A 1 33  ? 9.023   -11.343 -12.817 1.00 0.00 ? 33  LYS A HD2  1  
ATOM 507   H HD3  . LYS A 1 33  ? 10.118  -11.454 -14.197 1.00 0.00 ? 33  LYS A HD3  1  
ATOM 508   H HE2  . LYS A 1 33  ? 8.955   -13.923 -12.963 1.00 0.00 ? 33  LYS A HE2  1  
ATOM 509   H HE3  . LYS A 1 33  ? 8.021   -12.973 -14.118 1.00 0.00 ? 33  LYS A HE3  1  
ATOM 510   H HZ1  . LYS A 1 33  ? 10.340  -13.213 -15.409 1.00 0.00 ? 33  LYS A HZ1  1  
ATOM 511   H HZ2  . LYS A 1 33  ? 9.050   -14.289 -15.597 1.00 0.00 ? 33  LYS A HZ2  1  
ATOM 512   H HZ3  . LYS A 1 33  ? 10.327  -14.674 -14.556 1.00 0.00 ? 33  LYS A HZ3  1  
ATOM 513   N N    . GLU A 1 34  ? 12.231  -11.338 -8.763  1.00 0.00 ? 34  GLU A N    1  
ATOM 514   C CA   . GLU A 1 34  ? 12.497  -12.226 -7.637  1.00 0.00 ? 34  GLU A CA   1  
ATOM 515   C C    . GLU A 1 34  ? 11.735  -11.771 -6.394  1.00 0.00 ? 34  GLU A C    1  
ATOM 516   O O    . GLU A 1 34  ? 10.998  -12.548 -5.788  1.00 0.00 ? 34  GLU A O    1  
ATOM 517   C CB   . GLU A 1 34  ? 13.997  -12.274 -7.340  1.00 0.00 ? 34  GLU A CB   1  
ATOM 518   C CG   . GLU A 1 34  ? 14.826  -12.836 -8.483  1.00 0.00 ? 34  GLU A CG   1  
ATOM 519   C CD   . GLU A 1 34  ? 16.157  -13.393 -8.018  1.00 0.00 ? 34  GLU A CD   1  
ATOM 520   O OE1  . GLU A 1 34  ? 16.154  -14.363 -7.233  1.00 0.00 ? 34  GLU A OE1  1  
ATOM 521   O OE2  . GLU A 1 34  ? 17.203  -12.858 -8.442  1.00 0.00 ? 34  GLU A OE2  1  
ATOM 522   H H    . GLU A 1 34  ? 12.887  -10.647 -8.993  1.00 0.00 ? 34  GLU A H    1  
ATOM 523   H HA   . GLU A 1 34  ? 12.161  -13.215 -7.908  1.00 0.00 ? 34  GLU A HA   1  
ATOM 524   H HB2  . GLU A 1 34  ? 14.343  -11.273 -7.129  1.00 0.00 ? 34  GLU A HB2  1  
ATOM 525   H HB3  . GLU A 1 34  ? 14.159  -12.891 -6.468  1.00 0.00 ? 34  GLU A HB3  1  
ATOM 526   H HG2  . GLU A 1 34  ? 14.268  -13.628 -8.959  1.00 0.00 ? 34  GLU A HG2  1  
ATOM 527   H HG3  . GLU A 1 34  ? 15.011  -12.047 -9.197  1.00 0.00 ? 34  GLU A HG3  1  
ATOM 528   N N    . GLU A 1 35  ? 11.921  -10.508 -6.023  1.00 0.00 ? 35  GLU A N    1  
ATOM 529   C CA   . GLU A 1 35  ? 11.253  -9.952  -4.852  1.00 0.00 ? 35  GLU A CA   1  
ATOM 530   C C    . GLU A 1 35  ? 9.737   -10.049 -4.993  1.00 0.00 ? 35  GLU A C    1  
ATOM 531   O O    . GLU A 1 35  ? 9.067   -10.690 -4.182  1.00 0.00 ? 35  GLU A O    1  
ATOM 532   C CB   . GLU A 1 35  ? 11.664  -8.492  -4.649  1.00 0.00 ? 35  GLU A CB   1  
ATOM 533   C CG   . GLU A 1 35  ? 13.154  -8.306  -4.415  1.00 0.00 ? 35  GLU A CG   1  
ATOM 534   C CD   . GLU A 1 35  ? 13.611  -8.875  -3.086  1.00 0.00 ? 35  GLU A CD   1  
ATOM 535   O OE1  . GLU A 1 35  ? 13.290  -8.271  -2.041  1.00 0.00 ? 35  GLU A OE1  1  
ATOM 536   O OE2  . GLU A 1 35  ? 14.290  -9.923  -3.090  1.00 0.00 ? 35  GLU A OE2  1  
ATOM 537   H H    . GLU A 1 35  ? 12.521  -9.939  -6.547  1.00 0.00 ? 35  GLU A H    1  
ATOM 538   H HA   . GLU A 1 35  ? 11.560  -10.525 -3.991  1.00 0.00 ? 35  GLU A HA   1  
ATOM 539   H HB2  . GLU A 1 35  ? 11.385  -7.926  -5.526  1.00 0.00 ? 35  GLU A HB2  1  
ATOM 540   H HB3  . GLU A 1 35  ? 11.135  -8.097  -3.794  1.00 0.00 ? 35  GLU A HB3  1  
ATOM 541   H HG2  . GLU A 1 35  ? 13.695  -8.803  -5.207  1.00 0.00 ? 35  GLU A HG2  1  
ATOM 542   H HG3  . GLU A 1 35  ? 13.380  -7.250  -4.435  1.00 0.00 ? 35  GLU A HG3  1  
ATOM 543   N N    . ARG A 1 36  ? 9.202   -9.410  -6.028  1.00 0.00 ? 36  ARG A N    1  
ATOM 544   C CA   . ARG A 1 36  ? 7.765   -9.423  -6.275  1.00 0.00 ? 36  ARG A CA   1  
ATOM 545   C C    . ARG A 1 36  ? 7.222   -10.849 -6.250  1.00 0.00 ? 36  ARG A C    1  
ATOM 546   O O    . ARG A 1 36  ? 6.268   -11.147 -5.532  1.00 0.00 ? 36  ARG A O    1  
ATOM 547   C CB   . ARG A 1 36  ? 7.452   -8.769  -7.622  1.00 0.00 ? 36  ARG A CB   1  
ATOM 548   C CG   . ARG A 1 36  ? 7.340   -7.255  -7.553  1.00 0.00 ? 36  ARG A CG   1  
ATOM 549   C CD   . ARG A 1 36  ? 6.373   -6.720  -8.598  1.00 0.00 ? 36  ARG A CD   1  
ATOM 550   N NE   . ARG A 1 36  ? 7.015   -6.544  -9.898  1.00 0.00 ? 36  ARG A NE   1  
ATOM 551   C CZ   . ARG A 1 36  ? 7.737   -5.478  -10.224 1.00 0.00 ? 36  ARG A CZ   1  
ATOM 552   N NH1  . ARG A 1 36  ? 7.907   -4.496  -9.348  1.00 0.00 ? 36  ARG A NH1  1  
ATOM 553   N NH2  . ARG A 1 36  ? 8.289   -5.391  -11.427 1.00 0.00 ? 36  ARG A NH2  1  
ATOM 554   H H    . ARG A 1 36  ? 9.787   -8.916  -6.640  1.00 0.00 ? 36  ARG A H    1  
ATOM 555   H HA   . ARG A 1 36  ? 7.288   -8.855  -5.490  1.00 0.00 ? 36  ARG A HA   1  
ATOM 556   H HB2  . ARG A 1 36  ? 8.236   -9.018  -8.321  1.00 0.00 ? 36  ARG A HB2  1  
ATOM 557   H HB3  . ARG A 1 36  ? 6.515   -9.161  -7.989  1.00 0.00 ? 36  ARG A HB3  1  
ATOM 558   H HG2  . ARG A 1 36  ? 6.984   -6.974  -6.573  1.00 0.00 ? 36  ARG A HG2  1  
ATOM 559   H HG3  . ARG A 1 36  ? 8.315   -6.823  -7.722  1.00 0.00 ? 36  ARG A HG3  1  
ATOM 560   H HD2  . ARG A 1 36  ? 5.555   -7.416  -8.703  1.00 0.00 ? 36  ARG A HD2  1  
ATOM 561   H HD3  . ARG A 1 36  ? 5.994   -5.766  -8.263  1.00 0.00 ? 36  ARG A HD3  1  
ATOM 562   H HE   . ARG A 1 36  ? 6.902   -7.258  -10.560 1.00 0.00 ? 36  ARG A HE   1  
ATOM 563   H HH11 . ARG A 1 36  ? 7.493   -4.559  -8.441  1.00 0.00 ? 36  ARG A HH11 1  
ATOM 564   H HH12 . ARG A 1 36  ? 8.452   -3.695  -9.596  1.00 0.00 ? 36  ARG A HH12 1  
ATOM 565   H HH21 . ARG A 1 36  ? 8.163   -6.129  -12.089 1.00 0.00 ? 36  ARG A HH21 1  
ATOM 566   H HH22 . ARG A 1 36  ? 8.832   -4.588  -11.671 1.00 0.00 ? 36  ARG A HH22 1  
ATOM 567   N N    . GLU A 1 37  ? 7.837   -11.724 -7.040  1.00 0.00 ? 37  GLU A N    1  
ATOM 568   C CA   . GLU A 1 37  ? 7.413   -13.118 -7.109  1.00 0.00 ? 37  GLU A CA   1  
ATOM 569   C C    . GLU A 1 37  ? 7.239   -13.704 -5.711  1.00 0.00 ? 37  GLU A C    1  
ATOM 570   O O    . GLU A 1 37  ? 6.185   -14.245 -5.380  1.00 0.00 ? 37  GLU A O    1  
ATOM 571   C CB   . GLU A 1 37  ? 8.431   -13.944 -7.897  1.00 0.00 ? 37  GLU A CB   1  
ATOM 572   C CG   . GLU A 1 37  ? 8.219   -13.899 -9.401  1.00 0.00 ? 37  GLU A CG   1  
ATOM 573   C CD   . GLU A 1 37  ? 7.172   -14.889 -9.873  1.00 0.00 ? 37  GLU A CD   1  
ATOM 574   O OE1  . GLU A 1 37  ? 6.232   -15.172 -9.102  1.00 0.00 ? 37  GLU A OE1  1  
ATOM 575   O OE2  . GLU A 1 37  ? 7.294   -15.381 -11.015 1.00 0.00 ? 37  GLU A OE2  1  
ATOM 576   H H    . GLU A 1 37  ? 8.591   -11.426 -7.589  1.00 0.00 ? 37  GLU A H    1  
ATOM 577   H HA   . GLU A 1 37  ? 6.463   -13.151 -7.621  1.00 0.00 ? 37  GLU A HA   1  
ATOM 578   H HB2  . GLU A 1 37  ? 9.422   -13.573 -7.683  1.00 0.00 ? 37  GLU A HB2  1  
ATOM 579   H HB3  . GLU A 1 37  ? 8.365   -14.974 -7.577  1.00 0.00 ? 37  GLU A HB3  1  
ATOM 580   H HG2  . GLU A 1 37  ? 7.901   -12.904 -9.677  1.00 0.00 ? 37  GLU A HG2  1  
ATOM 581   H HG3  . GLU A 1 37  ? 9.154   -14.125 -9.891  1.00 0.00 ? 37  GLU A HG3  1  
ATOM 582   N N    . ALA A 1 38  ? 8.282   -13.591 -4.895  1.00 0.00 ? 38  ALA A N    1  
ATOM 583   C CA   . ALA A 1 38  ? 8.245   -14.107 -3.532  1.00 0.00 ? 38  ALA A CA   1  
ATOM 584   C C    . ALA A 1 38  ? 6.963   -13.688 -2.821  1.00 0.00 ? 38  ALA A C    1  
ATOM 585   O O    . ALA A 1 38  ? 6.566   -14.296 -1.826  1.00 0.00 ? 38  ALA A O    1  
ATOM 586   C CB   . ALA A 1 38  ? 9.463   -13.631 -2.754  1.00 0.00 ? 38  ALA A CB   1  
ATOM 587   H H    . ALA A 1 38  ? 9.095   -13.148 -5.216  1.00 0.00 ? 38  ALA A H    1  
ATOM 588   H HA   . ALA A 1 38  ? 8.280   -15.186 -3.583  1.00 0.00 ? 38  ALA A HA   1  
ATOM 589   H HB1  . ALA A 1 38  ? 9.182   -13.445 -1.727  1.00 0.00 ? 38  ALA A HB1  1  
ATOM 590   H HB2  . ALA A 1 38  ? 10.229  -14.391 -2.786  1.00 0.00 ? 38  ALA A HB2  1  
ATOM 591   H HB3  . ALA A 1 38  ? 9.838   -12.721 -3.196  1.00 0.00 ? 38  ALA A HB3  1  
ATOM 592   N N    . LEU A 1 39  ? 6.320   -12.646 -3.336  1.00 0.00 ? 39  LEU A N    1  
ATOM 593   C CA   . LEU A 1 39  ? 5.082   -12.145 -2.749  1.00 0.00 ? 39  LEU A CA   1  
ATOM 594   C C    . LEU A 1 39  ? 3.866   -12.748 -3.445  1.00 0.00 ? 39  LEU A C    1  
ATOM 595   O O    . LEU A 1 39  ? 2.800   -12.888 -2.845  1.00 0.00 ? 39  LEU A O    1  
ATOM 596   C CB   . LEU A 1 39  ? 5.032   -10.619 -2.842  1.00 0.00 ? 39  LEU A CB   1  
ATOM 597   C CG   . LEU A 1 39  ? 6.327   -9.883  -2.497  1.00 0.00 ? 39  LEU A CG   1  
ATOM 598   C CD1  . LEU A 1 39  ? 6.100   -8.379  -2.489  1.00 0.00 ? 39  LEU A CD1  1  
ATOM 599   C CD2  . LEU A 1 39  ? 6.865   -10.350 -1.153  1.00 0.00 ? 39  LEU A CD2  1  
ATOM 600   H H    . LEU A 1 39  ? 6.685   -12.203 -4.129  1.00 0.00 ? 39  LEU A H    1  
ATOM 601   H HA   . LEU A 1 39  ? 5.067   -12.435 -1.709  1.00 0.00 ? 39  LEU A HA   1  
ATOM 602   H HB2  . LEU A 1 39  ? 4.763   -10.358 -3.854  1.00 0.00 ? 39  LEU A HB2  1  
ATOM 603   H HB3  . LEU A 1 39  ? 4.263   -10.272 -2.166  1.00 0.00 ? 39  LEU A HB3  1  
ATOM 604   H HG   . LEU A 1 39  ? 7.071   -10.103 -3.251  1.00 0.00 ? 39  LEU A HG   1  
ATOM 605   H HD11 . LEU A 1 39  ? 6.737   -7.923  -1.746  1.00 0.00 ? 39  LEU A HD11 1  
ATOM 606   H HD12 . LEU A 1 39  ? 5.067   -8.172  -2.253  1.00 0.00 ? 39  LEU A HD12 1  
ATOM 607   H HD13 . LEU A 1 39  ? 6.335   -7.974  -3.462  1.00 0.00 ? 39  LEU A HD13 1  
ATOM 608   H HD21 . LEU A 1 39  ? 6.645   -11.400 -1.023  1.00 0.00 ? 39  LEU A HD21 1  
ATOM 609   H HD22 . LEU A 1 39  ? 6.396   -9.784  -0.361  1.00 0.00 ? 39  LEU A HD22 1  
ATOM 610   H HD23 . LEU A 1 39  ? 7.933   -10.199 -1.120  1.00 0.00 ? 39  LEU A HD23 1  
ATOM 611   N N    . VAL A 1 40  ? 4.034   -13.106 -4.714  1.00 0.00 ? 40  VAL A N    1  
ATOM 612   C CA   . VAL A 1 40  ? 2.951   -13.698 -5.491  1.00 0.00 ? 40  VAL A CA   1  
ATOM 613   C C    . VAL A 1 40  ? 2.615   -15.097 -4.989  1.00 0.00 ? 40  VAL A C    1  
ATOM 614   O O    . VAL A 1 40  ? 1.446   -15.466 -4.885  1.00 0.00 ? 40  VAL A O    1  
ATOM 615   C CB   . VAL A 1 40  ? 3.311   -13.774 -6.987  1.00 0.00 ? 40  VAL A CB   1  
ATOM 616   C CG1  . VAL A 1 40  ? 2.282   -14.601 -7.742  1.00 0.00 ? 40  VAL A CG1  1  
ATOM 617   C CG2  . VAL A 1 40  ? 3.423   -12.377 -7.580  1.00 0.00 ? 40  VAL A CG2  1  
ATOM 618   H H    . VAL A 1 40  ? 4.907   -12.969 -5.138  1.00 0.00 ? 40  VAL A H    1  
ATOM 619   H HA   . VAL A 1 40  ? 2.080   -13.068 -5.384  1.00 0.00 ? 40  VAL A HA   1  
ATOM 620   H HB   . VAL A 1 40  ? 4.271   -14.260 -7.082  1.00 0.00 ? 40  VAL A HB   1  
ATOM 621   H HG11 . VAL A 1 40  ? 2.441   -14.490 -8.805  1.00 0.00 ? 40  VAL A HG11 1  
ATOM 622   H HG12 . VAL A 1 40  ? 2.385   -15.641 -7.469  1.00 0.00 ? 40  VAL A HG12 1  
ATOM 623   H HG13 . VAL A 1 40  ? 1.289   -14.259 -7.489  1.00 0.00 ? 40  VAL A HG13 1  
ATOM 624   H HG21 . VAL A 1 40  ? 4.335   -11.913 -7.236  1.00 0.00 ? 40  VAL A HG21 1  
ATOM 625   H HG22 . VAL A 1 40  ? 3.436   -12.443 -8.658  1.00 0.00 ? 40  VAL A HG22 1  
ATOM 626   H HG23 . VAL A 1 40  ? 2.577   -11.784 -7.266  1.00 0.00 ? 40  VAL A HG23 1  
ATOM 627   N N    . GLU A 1 41  ? 3.650   -15.872 -4.677  1.00 0.00 ? 41  GLU A N    1  
ATOM 628   C CA   . GLU A 1 41  ? 3.463   -17.232 -4.185  1.00 0.00 ? 41  GLU A CA   1  
ATOM 629   C C    . GLU A 1 41  ? 3.140   -17.232 -2.694  1.00 0.00 ? 41  GLU A C    1  
ATOM 630   O O    . GLU A 1 41  ? 2.231   -17.930 -2.246  1.00 0.00 ? 41  GLU A O    1  
ATOM 631   C CB   . GLU A 1 41  ? 4.717   -18.069 -4.446  1.00 0.00 ? 41  GLU A CB   1  
ATOM 632   C CG   . GLU A 1 41  ? 5.980   -17.479 -3.840  1.00 0.00 ? 41  GLU A CG   1  
ATOM 633   C CD   . GLU A 1 41  ? 7.213   -18.307 -4.143  1.00 0.00 ? 41  GLU A CD   1  
ATOM 634   O OE1  . GLU A 1 41  ? 7.184   -19.530 -3.888  1.00 0.00 ? 41  GLU A OE1  1  
ATOM 635   O OE2  . GLU A 1 41  ? 8.208   -17.733 -4.633  1.00 0.00 ? 41  GLU A OE2  1  
ATOM 636   H H    . GLU A 1 41  ? 4.559   -15.522 -4.781  1.00 0.00 ? 41  GLU A H    1  
ATOM 637   H HA   . GLU A 1 41  ? 2.633   -17.668 -4.721  1.00 0.00 ? 41  GLU A HA   1  
ATOM 638   H HB2  . GLU A 1 41  ? 4.570   -19.056 -4.032  1.00 0.00 ? 41  GLU A HB2  1  
ATOM 639   H HB3  . GLU A 1 41  ? 4.862   -18.155 -5.513  1.00 0.00 ? 41  GLU A HB3  1  
ATOM 640   H HG2  . GLU A 1 41  ? 6.125   -16.486 -4.238  1.00 0.00 ? 41  GLU A HG2  1  
ATOM 641   H HG3  . GLU A 1 41  ? 5.856   -17.422 -2.768  1.00 0.00 ? 41  GLU A HG3  1  
ATOM 642   N N    . GLU A 1 42  ? 3.892   -16.444 -1.932  1.00 0.00 ? 42  GLU A N    1  
ATOM 643   C CA   . GLU A 1 42  ? 3.686   -16.354 -0.491  1.00 0.00 ? 42  GLU A CA   1  
ATOM 644   C C    . GLU A 1 42  ? 2.254   -15.935 -0.171  1.00 0.00 ? 42  GLU A C    1  
ATOM 645   O O    . GLU A 1 42  ? 1.592   -16.541 0.672   1.00 0.00 ? 42  GLU A O    1  
ATOM 646   C CB   . GLU A 1 42  ? 4.671   -15.358 0.126   1.00 0.00 ? 42  GLU A CB   1  
ATOM 647   C CG   . GLU A 1 42  ? 4.678   -15.371 1.646   1.00 0.00 ? 42  GLU A CG   1  
ATOM 648   C CD   . GLU A 1 42  ? 5.468   -16.533 2.216   1.00 0.00 ? 42  GLU A CD   1  
ATOM 649   O OE1  . GLU A 1 42  ? 6.700   -16.566 2.018   1.00 0.00 ? 42  GLU A OE1  1  
ATOM 650   O OE2  . GLU A 1 42  ? 4.854   -17.410 2.859   1.00 0.00 ? 42  GLU A OE2  1  
ATOM 651   H H    . GLU A 1 42  ? 4.601   -15.911 -2.348  1.00 0.00 ? 42  GLU A H    1  
ATOM 652   H HA   . GLU A 1 42  ? 3.865   -17.331 -0.069  1.00 0.00 ? 42  GLU A HA   1  
ATOM 653   H HB2  . GLU A 1 42  ? 5.666   -15.593 -0.220  1.00 0.00 ? 42  GLU A HB2  1  
ATOM 654   H HB3  . GLU A 1 42  ? 4.411   -14.363 -0.203  1.00 0.00 ? 42  GLU A HB3  1  
ATOM 655   H HG2  . GLU A 1 42  ? 5.117   -14.450 1.999   1.00 0.00 ? 42  GLU A HG2  1  
ATOM 656   H HG3  . GLU A 1 42  ? 3.659   -15.441 1.997   1.00 0.00 ? 42  GLU A HG3  1  
ATOM 657   N N    . CYS A 1 43  ? 1.783   -14.894 -0.849  1.00 0.00 ? 43  CYS A N    1  
ATOM 658   C CA   . CYS A 1 43  ? 0.431   -14.392 -0.636  1.00 0.00 ? 43  CYS A CA   1  
ATOM 659   C C    . CYS A 1 43  ? -0.604  -15.465 -0.955  1.00 0.00 ? 43  CYS A C    1  
ATOM 660   O O    . CYS A 1 43  ? -1.311  -15.944 -0.069  1.00 0.00 ? 43  CYS A O    1  
ATOM 661   C CB   . CYS A 1 43  ? 0.182   -13.154 -1.500  1.00 0.00 ? 43  CYS A CB   1  
ATOM 662   S SG   . CYS A 1 43  ? 1.099   -11.688 -0.970  1.00 0.00 ? 43  CYS A SG   1  
ATOM 663   H H    . CYS A 1 43  ? 2.359   -14.452 -1.507  1.00 0.00 ? 43  CYS A H    1  
ATOM 664   H HA   . CYS A 1 43  ? 0.339   -14.119 0.404   1.00 0.00 ? 43  CYS A HA   1  
ATOM 665   H HB2  . CYS A 1 43  ? 0.471   -13.371 -2.518  1.00 0.00 ? 43  CYS A HB2  1  
ATOM 666   H HB3  . CYS A 1 43  ? -0.870  -12.912 -1.475  1.00 0.00 ? 43  CYS A HB3  1  
ATOM 667   H HG   . CYS A 1 43  ? 2.177   -11.583 -1.733  1.00 0.00 ? 43  CYS A HG   1  
ATOM 668   N N    . ASN A 1 44  ? -0.689  -15.839 -2.228  1.00 0.00 ? 44  ASN A N    1  
ATOM 669   C CA   . ASN A 1 44  ? -1.640  -16.854 -2.665  1.00 0.00 ? 44  ASN A CA   1  
ATOM 670   C C    . ASN A 1 44  ? -1.624  -18.055 -1.724  1.00 0.00 ? 44  ASN A C    1  
ATOM 671   O O    . ASN A 1 44  ? -2.654  -18.689 -1.493  1.00 0.00 ? 44  ASN A O    1  
ATOM 672   C CB   . ASN A 1 44  ? -1.316  -17.306 -4.091  1.00 0.00 ? 44  ASN A CB   1  
ATOM 673   C CG   . ASN A 1 44  ? -1.970  -16.426 -5.139  1.00 0.00 ? 44  ASN A CG   1  
ATOM 674   O OD1  . ASN A 1 44  ? -3.153  -16.100 -5.041  1.00 0.00 ? 44  ASN A OD1  1  
ATOM 675   N ND2  . ASN A 1 44  ? -1.201  -16.038 -6.149  1.00 0.00 ? 44  ASN A ND2  1  
ATOM 676   H H    . ASN A 1 44  ? -0.099  -15.421 -2.890  1.00 0.00 ? 44  ASN A H    1  
ATOM 677   H HA   . ASN A 1 44  ? -2.625  -16.414 -2.652  1.00 0.00 ? 44  ASN A HA   1  
ATOM 678   H HB2  . ASN A 1 44  ? -0.246  -17.273 -4.238  1.00 0.00 ? 44  ASN A HB2  1  
ATOM 679   H HB3  . ASN A 1 44  ? -1.663  -18.319 -4.229  1.00 0.00 ? 44  ASN A HB3  1  
ATOM 680   H HD21 . ASN A 1 44  ? -0.268  -16.337 -6.162  1.00 0.00 ? 44  ASN A HD21 1  
ATOM 681   H HD22 . ASN A 1 44  ? -1.598  -15.468 -6.841  1.00 0.00 ? 44  ASN A HD22 1  
ATOM 682   N N    . ARG A 1 45  ? -0.450  -18.361 -1.183  1.00 0.00 ? 45  ARG A N    1  
ATOM 683   C CA   . ARG A 1 45  ? -0.300  -19.485 -0.267  1.00 0.00 ? 45  ARG A CA   1  
ATOM 684   C C    . ARG A 1 45  ? -1.022  -19.214 1.049   1.00 0.00 ? 45  ARG A C    1  
ATOM 685   O O    . ARG A 1 45  ? -1.911  -19.966 1.447   1.00 0.00 ? 45  ARG A O    1  
ATOM 686   C CB   . ARG A 1 45  ? 1.182   -19.759 -0.001  1.00 0.00 ? 45  ARG A CB   1  
ATOM 687   C CG   . ARG A 1 45  ? 1.425   -20.726 1.146   1.00 0.00 ? 45  ARG A CG   1  
ATOM 688   C CD   . ARG A 1 45  ? 2.834   -20.587 1.702   1.00 0.00 ? 45  ARG A CD   1  
ATOM 689   N NE   . ARG A 1 45  ? 2.896   -20.915 3.124   1.00 0.00 ? 45  ARG A NE   1  
ATOM 690   C CZ   . ARG A 1 45  ? 4.024   -20.930 3.826   1.00 0.00 ? 45  ARG A CZ   1  
ATOM 691   N NH1  . ARG A 1 45  ? 5.177   -20.636 3.241   1.00 0.00 ? 45  ARG A NH1  1  
ATOM 692   N NH2  . ARG A 1 45  ? 3.999   -21.239 5.116   1.00 0.00 ? 45  ARG A NH2  1  
ATOM 693   H H    . ARG A 1 45  ? 0.335   -17.818 -1.406  1.00 0.00 ? 45  ARG A H    1  
ATOM 694   H HA   . ARG A 1 45  ? -0.740  -20.354 -0.733  1.00 0.00 ? 45  ARG A HA   1  
ATOM 695   H HB2  . ARG A 1 45  ? 1.625   -20.176 -0.894  1.00 0.00 ? 45  ARG A HB2  1  
ATOM 696   H HB3  . ARG A 1 45  ? 1.672   -18.826 0.233   1.00 0.00 ? 45  ARG A HB3  1  
ATOM 697   H HG2  . ARG A 1 45  ? 0.717   -20.520 1.935   1.00 0.00 ? 45  ARG A HG2  1  
ATOM 698   H HG3  . ARG A 1 45  ? 1.286   -21.736 0.789   1.00 0.00 ? 45  ARG A HG3  1  
ATOM 699   H HD2  . ARG A 1 45  ? 3.488   -21.254 1.160   1.00 0.00 ? 45  ARG A HD2  1  
ATOM 700   H HD3  . ARG A 1 45  ? 3.163   -19.568 1.562   1.00 0.00 ? 45  ARG A HD3  1  
ATOM 701   H HE   . ARG A 1 45  ? 2.056   -21.136 3.576   1.00 0.00 ? 45  ARG A HE   1  
ATOM 702   H HH11 . ARG A 1 45  ? 5.198   -20.402 2.269   1.00 0.00 ? 45  ARG A HH11 1  
ATOM 703   H HH12 . ARG A 1 45  ? 6.024   -20.647 3.772   1.00 0.00 ? 45  ARG A HH12 1  
ATOM 704   H HH21 . ARG A 1 45  ? 3.132   -21.460 5.561   1.00 0.00 ? 45  ARG A HH21 1  
ATOM 705   H HH22 . ARG A 1 45  ? 4.848   -21.249 5.644   1.00 0.00 ? 45  ARG A HH22 1  
ATOM 706   N N    . ALA A 1 46  ? -0.633  -18.135 1.720   1.00 0.00 ? 46  ALA A N    1  
ATOM 707   C CA   . ALA A 1 46  ? -1.244  -17.763 2.991   1.00 0.00 ? 46  ALA A CA   1  
ATOM 708   C C    . ALA A 1 46  ? -2.754  -17.599 2.846   1.00 0.00 ? 46  ALA A C    1  
ATOM 709   O O    . ALA A 1 46  ? -3.511  -17.906 3.767   1.00 0.00 ? 46  ALA A O    1  
ATOM 710   C CB   . ALA A 1 46  ? -0.620  -16.482 3.522   1.00 0.00 ? 46  ALA A CB   1  
ATOM 711   H H    . ALA A 1 46  ? 0.081   -17.574 1.352   1.00 0.00 ? 46  ALA A H    1  
ATOM 712   H HA   . ALA A 1 46  ? -1.045  -18.553 3.701   1.00 0.00 ? 46  ALA A HA   1  
ATOM 713   H HB1  . ALA A 1 46  ? -1.402  -15.805 3.836   1.00 0.00 ? 46  ALA A HB1  1  
ATOM 714   H HB2  . ALA A 1 46  ? 0.015   -16.713 4.364   1.00 0.00 ? 46  ALA A HB2  1  
ATOM 715   H HB3  . ALA A 1 46  ? -0.033  -16.018 2.743   1.00 0.00 ? 46  ALA A HB3  1  
ATOM 716   N N    . GLU A 1 47  ? -3.183  -17.113 1.686   1.00 0.00 ? 47  GLU A N    1  
ATOM 717   C CA   . GLU A 1 47  ? -4.603  -16.907 1.424   1.00 0.00 ? 47  GLU A CA   1  
ATOM 718   C C    . GLU A 1 47  ? -5.365  -18.227 1.486   1.00 0.00 ? 47  GLU A C    1  
ATOM 719   O O    . GLU A 1 47  ? -6.460  -18.298 2.044   1.00 0.00 ? 47  GLU A O    1  
ATOM 720   C CB   . GLU A 1 47  ? -4.801  -16.254 0.054   1.00 0.00 ? 47  GLU A CB   1  
ATOM 721   C CG   . GLU A 1 47  ? -4.269  -14.833 -0.027  1.00 0.00 ? 47  GLU A CG   1  
ATOM 722   C CD   . GLU A 1 47  ? -5.010  -13.990 -1.045  1.00 0.00 ? 47  GLU A CD   1  
ATOM 723   O OE1  . GLU A 1 47  ? -4.942  -14.315 -2.249  1.00 0.00 ? 47  GLU A OE1  1  
ATOM 724   O OE2  . GLU A 1 47  ? -5.659  -13.003 -0.638  1.00 0.00 ? 47  GLU A OE2  1  
ATOM 725   H H    . GLU A 1 47  ? -2.530  -16.887 0.991   1.00 0.00 ? 47  GLU A H    1  
ATOM 726   H HA   . GLU A 1 47  ? -4.988  -16.246 2.186   1.00 0.00 ? 47  GLU A HA   1  
ATOM 727   H HB2  . GLU A 1 47  ? -4.295  -16.850 -0.692  1.00 0.00 ? 47  GLU A HB2  1  
ATOM 728   H HB3  . GLU A 1 47  ? -5.857  -16.234 -0.171  1.00 0.00 ? 47  GLU A HB3  1  
ATOM 729   H HG2  . GLU A 1 47  ? -4.369  -14.370 0.943   1.00 0.00 ? 47  GLU A HG2  1  
ATOM 730   H HG3  . GLU A 1 47  ? -3.225  -14.869 -0.301  1.00 0.00 ? 47  GLU A HG3  1  
ATOM 731   N N    . CYS A 1 48  ? -4.778  -19.270 0.909   1.00 0.00 ? 48  CYS A N    1  
ATOM 732   C CA   . CYS A 1 48  ? -5.401  -20.588 0.897   1.00 0.00 ? 48  CYS A CA   1  
ATOM 733   C C    . CYS A 1 48  ? -5.464  -21.173 2.304   1.00 0.00 ? 48  CYS A C    1  
ATOM 734   O O    . CYS A 1 48  ? -6.454  -21.799 2.685   1.00 0.00 ? 48  CYS A O    1  
ATOM 735   C CB   . CYS A 1 48  ? -4.629  -21.532 -0.027  1.00 0.00 ? 48  CYS A CB   1  
ATOM 736   S SG   . CYS A 1 48  ? -4.862  -21.194 -1.788  1.00 0.00 ? 48  CYS A SG   1  
ATOM 737   H H    . CYS A 1 48  ? -3.904  -19.151 0.480   1.00 0.00 ? 48  CYS A H    1  
ATOM 738   H HA   . CYS A 1 48  ? -6.407  -20.475 0.522   1.00 0.00 ? 48  CYS A HA   1  
ATOM 739   H HB2  . CYS A 1 48  ? -3.574  -21.448 0.186   1.00 0.00 ? 48  CYS A HB2  1  
ATOM 740   H HB3  . CYS A 1 48  ? -4.948  -22.546 0.160   1.00 0.00 ? 48  CYS A HB3  1  
ATOM 741   H HG   . CYS A 1 48  ? -3.673  -20.949 -2.317  1.00 0.00 ? 48  CYS A HG   1  
ATOM 742   N N    . LEU A 1 49  ? -4.400  -20.967 3.072   1.00 0.00 ? 49  LEU A N    1  
ATOM 743   C CA   . LEU A 1 49  ? -4.332  -21.475 4.438   1.00 0.00 ? 49  LEU A CA   1  
ATOM 744   C C    . LEU A 1 49  ? -5.418  -20.848 5.307   1.00 0.00 ? 49  LEU A C    1  
ATOM 745   O O    . LEU A 1 49  ? -6.271  -21.547 5.851   1.00 0.00 ? 49  LEU A O    1  
ATOM 746   C CB   . LEU A 1 49  ? -2.955  -21.194 5.040   1.00 0.00 ? 49  LEU A CB   1  
ATOM 747   C CG   . LEU A 1 49  ? -1.754  -21.542 4.160   1.00 0.00 ? 49  LEU A CG   1  
ATOM 748   C CD1  . LEU A 1 49  ? -0.511  -21.750 5.011   1.00 0.00 ? 49  LEU A CD1  1  
ATOM 749   C CD2  . LEU A 1 49  ? -2.045  -22.782 3.327   1.00 0.00 ? 49  LEU A CD2  1  
ATOM 750   H H    . LEU A 1 49  ? -3.641  -20.462 2.714   1.00 0.00 ? 49  LEU A H    1  
ATOM 751   H HA   . LEU A 1 49  ? -4.490  -22.543 4.402   1.00 0.00 ? 49  LEU A HA   1  
ATOM 752   H HB2  . LEU A 1 49  ? -2.903  -20.141 5.269   1.00 0.00 ? 49  LEU A HB2  1  
ATOM 753   H HB3  . LEU A 1 49  ? -2.872  -21.764 5.955   1.00 0.00 ? 49  LEU A HB3  1  
ATOM 754   H HG   . LEU A 1 49  ? -1.561  -20.721 3.484   1.00 0.00 ? 49  LEU A HG   1  
ATOM 755   H HD11 . LEU A 1 49  ? -0.767  -21.644 6.055   1.00 0.00 ? 49  LEU A HD11 1  
ATOM 756   H HD12 . LEU A 1 49  ? 0.234   -21.014 4.747   1.00 0.00 ? 49  LEU A HD12 1  
ATOM 757   H HD13 . LEU A 1 49  ? -0.116  -22.740 4.836   1.00 0.00 ? 49  LEU A HD13 1  
ATOM 758   H HD21 . LEU A 1 49  ? -2.680  -22.514 2.495   1.00 0.00 ? 49  LEU A HD21 1  
ATOM 759   H HD22 . LEU A 1 49  ? -2.544  -23.518 3.939   1.00 0.00 ? 49  LEU A HD22 1  
ATOM 760   H HD23 . LEU A 1 49  ? -1.117  -23.191 2.954   1.00 0.00 ? 49  LEU A HD23 1  
ATOM 761   N N    . GLN A 1 50  ? -5.378  -19.525 5.429   1.00 0.00 ? 50  GLN A N    1  
ATOM 762   C CA   . GLN A 1 50  ? -6.360  -18.803 6.231   1.00 0.00 ? 50  GLN A CA   1  
ATOM 763   C C    . GLN A 1 50  ? -7.779  -19.136 5.783   1.00 0.00 ? 50  GLN A C    1  
ATOM 764   O O    . GLN A 1 50  ? -8.672  -19.330 6.609   1.00 0.00 ? 50  GLN A O    1  
ATOM 765   C CB   . GLN A 1 50  ? -6.121  -17.295 6.131   1.00 0.00 ? 50  GLN A CB   1  
ATOM 766   C CG   . GLN A 1 50  ? -6.413  -16.723 4.754   1.00 0.00 ? 50  GLN A CG   1  
ATOM 767   C CD   . GLN A 1 50  ? -5.949  -15.287 4.609   1.00 0.00 ? 50  GLN A CD   1  
ATOM 768   O OE1  . GLN A 1 50  ? -6.743  -14.352 4.718   1.00 0.00 ? 50  GLN A OE1  1  
ATOM 769   N NE2  . GLN A 1 50  ? -4.658  -15.104 4.361   1.00 0.00 ? 50  GLN A NE2  1  
ATOM 770   H H    . GLN A 1 50  ? -4.673  -19.023 4.971   1.00 0.00 ? 50  GLN A H    1  
ATOM 771   H HA   . GLN A 1 50  ? -6.239  -19.110 7.259   1.00 0.00 ? 50  GLN A HA   1  
ATOM 772   H HB2  . GLN A 1 50  ? -6.755  -16.795 6.848   1.00 0.00 ? 50  GLN A HB2  1  
ATOM 773   H HB3  . GLN A 1 50  ? -5.088  -17.090 6.371   1.00 0.00 ? 50  GLN A HB3  1  
ATOM 774   H HG2  . GLN A 1 50  ? -5.908  -17.325 4.013   1.00 0.00 ? 50  GLN A HG2  1  
ATOM 775   H HG3  . GLN A 1 50  ? -7.479  -16.761 4.581   1.00 0.00 ? 50  GLN A HG3  1  
ATOM 776   H HE21 . GLN A 1 50  ? -4.085  -15.897 4.285   1.00 0.00 ? 50  GLN A HE21 1  
ATOM 777   H HE22 . GLN A 1 50  ? -4.331  -14.187 4.261   1.00 0.00 ? 50  GLN A HE22 1  
ATOM 778   N N    . ARG A 1 51  ? -7.981  -19.200 4.471   1.00 0.00 ? 51  ARG A N    1  
ATOM 779   C CA   . ARG A 1 51  ? -9.292  -19.508 3.913   1.00 0.00 ? 51  ARG A CA   1  
ATOM 780   C C    . ARG A 1 51  ? -9.554  -21.011 3.938   1.00 0.00 ? 51  ARG A C    1  
ATOM 781   O O    . ARG A 1 51  ? -10.570 -21.483 3.429   1.00 0.00 ? 51  ARG A O    1  
ATOM 782   C CB   . ARG A 1 51  ? -9.396  -18.986 2.479   1.00 0.00 ? 51  ARG A CB   1  
ATOM 783   C CG   . ARG A 1 51  ? -9.664  -17.492 2.393   1.00 0.00 ? 51  ARG A CG   1  
ATOM 784   C CD   . ARG A 1 51  ? -9.305  -16.939 1.023   1.00 0.00 ? 51  ARG A CD   1  
ATOM 785   N NE   . ARG A 1 51  ? -9.449  -15.487 0.963   1.00 0.00 ? 51  ARG A NE   1  
ATOM 786   C CZ   . ARG A 1 51  ? -10.623 -14.866 0.948   1.00 0.00 ? 51  ARG A CZ   1  
ATOM 787   N NH1  . ARG A 1 51  ? -11.748 -15.566 0.989   1.00 0.00 ? 51  ARG A NH1  1  
ATOM 788   N NH2  . ARG A 1 51  ? -10.673 -13.541 0.893   1.00 0.00 ? 51  ARG A NH2  1  
ATOM 789   H H    . ARG A 1 51  ? -7.230  -19.036 3.863   1.00 0.00 ? 51  ARG A H    1  
ATOM 790   H HA   . ARG A 1 51  ? -10.035 -19.015 4.521   1.00 0.00 ? 51  ARG A HA   1  
ATOM 791   H HB2  . ARG A 1 51  ? -8.468  -19.192 1.965   1.00 0.00 ? 51  ARG A HB2  1  
ATOM 792   H HB3  . ARG A 1 51  ? -10.199 -19.503 1.978   1.00 0.00 ? 51  ARG A HB3  1  
ATOM 793   H HG2  . ARG A 1 51  ? -10.713 -17.313 2.577   1.00 0.00 ? 51  ARG A HG2  1  
ATOM 794   H HG3  . ARG A 1 51  ? -9.073  -16.986 3.142   1.00 0.00 ? 51  ARG A HG3  1  
ATOM 795   H HD2  . ARG A 1 51  ? -8.280  -17.199 0.802   1.00 0.00 ? 51  ARG A HD2  1  
ATOM 796   H HD3  . ARG A 1 51  ? -9.956  -17.387 0.287   1.00 0.00 ? 51  ARG A HD3  1  
ATOM 797   H HE   . ARG A 1 51  ? -8.630  -14.951 0.932   1.00 0.00 ? 51  ARG A HE   1  
ATOM 798   H HH11 . ARG A 1 51  ? -11.714 -16.564 1.032   1.00 0.00 ? 51  ARG A HH11 1  
ATOM 799   H HH12 . ARG A 1 51  ? -12.631 -15.095 0.979   1.00 0.00 ? 51  ARG A HH12 1  
ATOM 800   H HH21 . ARG A 1 51  ? -9.826  -13.010 0.862   1.00 0.00 ? 51  ARG A HH21 1  
ATOM 801   H HH22 . ARG A 1 51  ? -11.556 -13.074 0.882   1.00 0.00 ? 51  ARG A HH22 1  
ATOM 802   N N    . GLY A 1 52  ? -8.630  -21.758 4.535   1.00 0.00 ? 52  GLY A N    1  
ATOM 803   C CA   . GLY A 1 52  ? -8.779  -23.199 4.615   1.00 0.00 ? 52  GLY A CA   1  
ATOM 804   C C    . GLY A 1 52  ? -8.333  -23.900 3.346   1.00 0.00 ? 52  GLY A C    1  
ATOM 805   O O    . GLY A 1 52  ? -7.924  -25.060 3.380   1.00 0.00 ? 52  GLY A O    1  
ATOM 806   H H    . GLY A 1 52  ? -7.840  -21.327 4.923   1.00 0.00 ? 52  GLY A H    1  
ATOM 807   H HA2  . GLY A 1 52  ? -8.191  -23.566 5.442   1.00 0.00 ? 52  GLY A HA2  1  
ATOM 808   H HA3  . GLY A 1 52  ? -9.819  -23.433 4.794   1.00 0.00 ? 52  GLY A HA3  1  
ATOM 809   N N    . VAL A 1 53  ? -8.413  -23.194 2.223   1.00 0.00 ? 53  VAL A N    1  
ATOM 810   C CA   . VAL A 1 53  ? -8.015  -23.755 0.937   1.00 0.00 ? 53  VAL A CA   1  
ATOM 811   C C    . VAL A 1 53  ? -6.572  -24.244 0.975   1.00 0.00 ? 53  VAL A C    1  
ATOM 812   O O    . VAL A 1 53  ? -5.852  -24.014 1.947   1.00 0.00 ? 53  VAL A O    1  
ATOM 813   C CB   . VAL A 1 53  ? -8.167  -22.724 -0.196  1.00 0.00 ? 53  VAL A CB   1  
ATOM 814   C CG1  . VAL A 1 53  ? -8.329  -23.424 -1.537  1.00 0.00 ? 53  VAL A CG1  1  
ATOM 815   C CG2  . VAL A 1 53  ? -9.344  -21.801 0.078   1.00 0.00 ? 53  VAL A CG2  1  
ATOM 816   H H    . VAL A 1 53  ? -8.747  -22.273 2.260   1.00 0.00 ? 53  VAL A H    1  
ATOM 817   H HA   . VAL A 1 53  ? -8.663  -24.592 0.723   1.00 0.00 ? 53  VAL A HA   1  
ATOM 818   H HB   . VAL A 1 53  ? -7.268  -22.125 -0.234  1.00 0.00 ? 53  VAL A HB   1  
ATOM 819   H HG11 . VAL A 1 53  ? -8.513  -24.476 -1.374  1.00 0.00 ? 53  VAL A HG11 1  
ATOM 820   H HG12 . VAL A 1 53  ? -9.161  -22.990 -2.072  1.00 0.00 ? 53  VAL A HG12 1  
ATOM 821   H HG13 . VAL A 1 53  ? -7.426  -23.303 -2.117  1.00 0.00 ? 53  VAL A HG13 1  
ATOM 822   H HG21 . VAL A 1 53  ? -9.733  -21.426 -0.857  1.00 0.00 ? 53  VAL A HG21 1  
ATOM 823   H HG22 . VAL A 1 53  ? -10.119 -22.348 0.595   1.00 0.00 ? 53  VAL A HG22 1  
ATOM 824   H HG23 . VAL A 1 53  ? -9.019  -20.973 0.690   1.00 0.00 ? 53  VAL A HG23 1  
ATOM 825   N N    . SER A 1 54  ? -6.154  -24.920 -0.091  1.00 0.00 ? 54  SER A N    1  
ATOM 826   C CA   . SER A 1 54  ? -4.796  -25.445 -0.179  1.00 0.00 ? 54  SER A CA   1  
ATOM 827   C C    . SER A 1 54  ? -3.901  -24.504 -0.979  1.00 0.00 ? 54  SER A C    1  
ATOM 828   O O    . SER A 1 54  ? -4.307  -23.929 -1.989  1.00 0.00 ? 54  SER A O    1  
ATOM 829   C CB   . SER A 1 54  ? -4.804  -26.832 -0.824  1.00 0.00 ? 54  SER A CB   1  
ATOM 830   O OG   . SER A 1 54  ? -3.737  -27.627 -0.337  1.00 0.00 ? 54  SER A OG   1  
ATOM 831   H H    . SER A 1 54  ? -6.775  -25.071 -0.834  1.00 0.00 ? 54  SER A H    1  
ATOM 832   H HA   . SER A 1 54  ? -4.407  -25.527 0.825   1.00 0.00 ? 54  SER A HA   1  
ATOM 833   H HB2  . SER A 1 54  ? -5.737  -27.326 -0.599  1.00 0.00 ? 54  SER A HB2  1  
ATOM 834   H HB3  . SER A 1 54  ? -4.701  -26.729 -1.895  1.00 0.00 ? 54  SER A HB3  1  
ATOM 835   H HG   . SER A 1 54  ? -3.773  -28.496 -0.745  1.00 0.00 ? 54  SER A HG   1  
ATOM 836   N N    . PRO A 1 55  ? -2.651  -24.344 -0.519  1.00 0.00 ? 55  PRO A N    1  
ATOM 837   C CA   . PRO A 1 55  ? -1.671  -23.474 -1.177  1.00 0.00 ? 55  PRO A CA   1  
ATOM 838   C C    . PRO A 1 55  ? -1.210  -24.032 -2.518  1.00 0.00 ? 55  PRO A C    1  
ATOM 839   O O    . PRO A 1 55  ? -0.401  -23.416 -3.213  1.00 0.00 ? 55  PRO A O    1  
ATOM 840   C CB   . PRO A 1 55  ? -0.507  -23.438 -0.184  1.00 0.00 ? 55  PRO A CB   1  
ATOM 841   C CG   . PRO A 1 55  ? -0.627  -24.707 0.588   1.00 0.00 ? 55  PRO A CG   1  
ATOM 842   C CD   . PRO A 1 55  ? -2.099  -24.998 0.679   1.00 0.00 ? 55  PRO A CD   1  
ATOM 843   H HA   . PRO A 1 55  ? -2.058  -22.475 -1.317  1.00 0.00 ? 55  PRO A HA   1  
ATOM 844   H HB2  . PRO A 1 55  ? 0.428   -23.389 -0.723  1.00 0.00 ? 55  PRO A HB2  1  
ATOM 845   H HB3  . PRO A 1 55  ? -0.603  -22.575 0.459   1.00 0.00 ? 55  PRO A HB3  1  
ATOM 846   H HG2  . PRO A 1 55  ? -0.118  -25.503 0.066   1.00 0.00 ? 55  PRO A HG2  1  
ATOM 847   H HG3  . PRO A 1 55  ? -0.209  -24.577 1.575   1.00 0.00 ? 55  PRO A HG3  1  
ATOM 848   H HD2  . PRO A 1 55  ? -2.275  -26.064 0.652   1.00 0.00 ? 55  PRO A HD2  1  
ATOM 849   H HD3  . PRO A 1 55  ? -2.514  -24.568 1.578   1.00 0.00 ? 55  PRO A HD3  1  
ATOM 850   N N    . SER A 1 56  ? -1.729  -25.202 -2.878  1.00 0.00 ? 56  SER A N    1  
ATOM 851   C CA   . SER A 1 56  ? -1.367  -25.844 -4.136  1.00 0.00 ? 56  SER A CA   1  
ATOM 852   C C    . SER A 1 56  ? -2.509  -25.748 -5.144  1.00 0.00 ? 56  SER A C    1  
ATOM 853   O O    . SER A 1 56  ? -2.449  -26.332 -6.225  1.00 0.00 ? 56  SER A O    1  
ATOM 854   C CB   . SER A 1 56  ? -1.005  -27.311 -3.898  1.00 0.00 ? 56  SER A CB   1  
ATOM 855   O OG   . SER A 1 56  ? -0.337  -27.860 -5.021  1.00 0.00 ? 56  SER A OG   1  
ATOM 856   H H    . SER A 1 56  ? -2.369  -25.644 -2.282  1.00 0.00 ? 56  SER A H    1  
ATOM 857   H HA   . SER A 1 56  ? -0.506  -25.330 -4.535  1.00 0.00 ? 56  SER A HA   1  
ATOM 858   H HB2  . SER A 1 56  ? -0.357  -27.385 -3.038  1.00 0.00 ? 56  SER A HB2  1  
ATOM 859   H HB3  . SER A 1 56  ? -1.907  -27.878 -3.719  1.00 0.00 ? 56  SER A HB3  1  
ATOM 860   H HG   . SER A 1 56  ? -0.756  -28.687 -5.271  1.00 0.00 ? 56  SER A HG   1  
ATOM 861   N N    . LYS A 1 57  ? -3.549  -25.005 -4.780  1.00 0.00 ? 57  LYS A N    1  
ATOM 862   C CA   . LYS A 1 57  ? -4.705  -24.829 -5.650  1.00 0.00 ? 57  LYS A CA   1  
ATOM 863   C C    . LYS A 1 57  ? -5.118  -23.362 -5.716  1.00 0.00 ? 57  LYS A C    1  
ATOM 864   O O    . LYS A 1 57  ? -6.277  -23.045 -5.983  1.00 0.00 ? 57  LYS A O    1  
ATOM 865   C CB   . LYS A 1 57  ? -5.878  -25.678 -5.153  1.00 0.00 ? 57  LYS A CB   1  
ATOM 866   C CG   . LYS A 1 57  ? -5.492  -27.107 -4.813  1.00 0.00 ? 57  LYS A CG   1  
ATOM 867   C CD   . LYS A 1 57  ? -5.276  -27.940 -6.065  1.00 0.00 ? 57  LYS A CD   1  
ATOM 868   C CE   . LYS A 1 57  ? -4.638  -29.282 -5.739  1.00 0.00 ? 57  LYS A CE   1  
ATOM 869   N NZ   . LYS A 1 57  ? -3.154  -29.188 -5.669  1.00 0.00 ? 57  LYS A NZ   1  
ATOM 870   H H    . LYS A 1 57  ? -3.538  -24.563 -3.904  1.00 0.00 ? 57  LYS A H    1  
ATOM 871   H HA   . LYS A 1 57  ? -4.428  -25.157 -6.641  1.00 0.00 ? 57  LYS A HA   1  
ATOM 872   H HB2  . LYS A 1 57  ? -6.290  -25.217 -4.268  1.00 0.00 ? 57  LYS A HB2  1  
ATOM 873   H HB3  . LYS A 1 57  ? -6.637  -25.706 -5.921  1.00 0.00 ? 57  LYS A HB3  1  
ATOM 874   H HG2  . LYS A 1 57  ? -4.577  -27.097 -4.239  1.00 0.00 ? 57  LYS A HG2  1  
ATOM 875   H HG3  . LYS A 1 57  ? -6.282  -27.553 -4.226  1.00 0.00 ? 57  LYS A HG3  1  
ATOM 876   H HD2  . LYS A 1 57  ? -6.231  -28.114 -6.540  1.00 0.00 ? 57  LYS A HD2  1  
ATOM 877   H HD3  . LYS A 1 57  ? -4.630  -27.398 -6.741  1.00 0.00 ? 57  LYS A HD3  1  
ATOM 878   H HE2  . LYS A 1 57  ? -5.014  -29.622 -4.786  1.00 0.00 ? 57  LYS A HE2  1  
ATOM 879   H HE3  . LYS A 1 57  ? -4.910  -29.991 -6.507  1.00 0.00 ? 57  LYS A HE3  1  
ATOM 880   H HZ1  . LYS A 1 57  ? -2.848  -28.214 -5.874  1.00 0.00 ? 57  LYS A HZ1  1  
ATOM 881   H HZ2  . LYS A 1 57  ? -2.722  -29.828 -6.366  1.00 0.00 ? 57  LYS A HZ2  1  
ATOM 882   H HZ3  . LYS A 1 57  ? -2.823  -29.452 -4.720  1.00 0.00 ? 57  LYS A HZ3  1  
ATOM 883   N N    . ALA A 1 58  ? -4.163  -22.471 -5.472  1.00 0.00 ? 58  ALA A N    1  
ATOM 884   C CA   . ALA A 1 58  ? -4.427  -21.038 -5.507  1.00 0.00 ? 58  ALA A CA   1  
ATOM 885   C C    . ALA A 1 58  ? -5.132  -20.641 -6.800  1.00 0.00 ? 58  ALA A C    1  
ATOM 886   O O    . ALA A 1 58  ? -5.934  -19.707 -6.820  1.00 0.00 ? 58  ALA A O    1  
ATOM 887   C CB   . ALA A 1 58  ? -3.130  -20.258 -5.351  1.00 0.00 ? 58  ALA A CB   1  
ATOM 888   H H    . ALA A 1 58  ? -3.258  -22.785 -5.265  1.00 0.00 ? 58  ALA A H    1  
ATOM 889   H HA   . ALA A 1 58  ? -5.067  -20.796 -4.671  1.00 0.00 ? 58  ALA A HA   1  
ATOM 890   H HB1  . ALA A 1 58  ? -2.751  -19.992 -6.327  1.00 0.00 ? 58  ALA A HB1  1  
ATOM 891   H HB2  . ALA A 1 58  ? -3.316  -19.361 -4.780  1.00 0.00 ? 58  ALA A HB2  1  
ATOM 892   H HB3  . ALA A 1 58  ? -2.403  -20.869 -4.836  1.00 0.00 ? 58  ALA A HB3  1  
ATOM 893   N N    . HIS A 1 59  ? -4.829  -21.357 -7.878  1.00 0.00 ? 59  HIS A N    1  
ATOM 894   C CA   . HIS A 1 59  ? -5.434  -21.079 -9.175  1.00 0.00 ? 59  HIS A CA   1  
ATOM 895   C C    . HIS A 1 59  ? -6.933  -20.833 -9.034  1.00 0.00 ? 59  HIS A C    1  
ATOM 896   O O    . HIS A 1 59  ? -7.545  -20.170 -9.871  1.00 0.00 ? 59  HIS A O    1  
ATOM 897   C CB   . HIS A 1 59  ? -5.185  -22.241 -10.137 1.00 0.00 ? 59  HIS A CB   1  
ATOM 898   C CG   . HIS A 1 59  ? -5.594  -23.573 -9.587  1.00 0.00 ? 59  HIS A CG   1  
ATOM 899   N ND1  . HIS A 1 59  ? -6.877  -24.067 -9.687  1.00 0.00 ? 59  HIS A ND1  1  
ATOM 900   C CD2  . HIS A 1 59  ? -4.880  -24.516 -8.929  1.00 0.00 ? 59  HIS A CD2  1  
ATOM 901   C CE1  . HIS A 1 59  ? -6.935  -25.255 -9.113  1.00 0.00 ? 59  HIS A CE1  1  
ATOM 902   N NE2  . HIS A 1 59  ? -5.736  -25.551 -8.646  1.00 0.00 ? 59  HIS A NE2  1  
ATOM 903   H H    . HIS A 1 59  ? -4.182  -22.089 -7.799  1.00 0.00 ? 59  HIS A H    1  
ATOM 904   H HA   . HIS A 1 59  ? -4.972  -20.189 -9.573  1.00 0.00 ? 59  HIS A HA   1  
ATOM 905   H HB2  . HIS A 1 59  ? -5.744  -22.073 -11.046 1.00 0.00 ? 59  HIS A HB2  1  
ATOM 906   H HB3  . HIS A 1 59  ? -4.131  -22.287 -10.371 1.00 0.00 ? 59  HIS A HB3  1  
ATOM 907   H HD1  . HIS A 1 59  ? -7.633  -23.613 -10.114 1.00 0.00 ? 59  HIS A HD1  1  
ATOM 908   H HD2  . HIS A 1 59  ? -3.830  -24.464 -8.674  1.00 0.00 ? 59  HIS A HD2  1  
ATOM 909   H HE1  . HIS A 1 59  ? -7.813  -25.879 -9.039  1.00 0.00 ? 59  HIS A HE1  1  
ATOM 910   H HE2  . HIS A 1 59  ? -5.521  -26.336 -8.100  1.00 0.00 ? 59  HIS A HE2  1  
ATOM 911   N N    . GLY A 1 60  ? -7.519  -21.371 -7.968  1.00 0.00 ? 60  GLY A N    1  
ATOM 912   C CA   . GLY A 1 60  ? -8.941  -21.199 -7.737  1.00 0.00 ? 60  GLY A CA   1  
ATOM 913   C C    . GLY A 1 60  ? -9.285  -19.805 -7.254  1.00 0.00 ? 60  GLY A C    1  
ATOM 914   O O    . GLY A 1 60  ? -10.308 -19.239 -7.643  1.00 0.00 ? 60  GLY A O    1  
ATOM 915   H H    . GLY A 1 60  ? -6.980  -21.890 -7.334  1.00 0.00 ? 60  GLY A H    1  
ATOM 916   H HA2  . GLY A 1 60  ? -9.470  -21.390 -8.659  1.00 0.00 ? 60  GLY A HA2  1  
ATOM 917   H HA3  . GLY A 1 60  ? -9.262  -21.915 -6.995  1.00 0.00 ? 60  GLY A HA3  1  
ATOM 918   N N    . LEU A 1 61  ? -8.431  -19.248 -6.402  1.00 0.00 ? 61  LEU A N    1  
ATOM 919   C CA   . LEU A 1 61  ? -8.651  -17.910 -5.862  1.00 0.00 ? 61  LEU A CA   1  
ATOM 920   C C    . LEU A 1 61  ? -9.319  -17.010 -6.896  1.00 0.00 ? 61  LEU A C    1  
ATOM 921   O O    . LEU A 1 61  ? -10.155 -16.173 -6.557  1.00 0.00 ? 61  LEU A O    1  
ATOM 922   C CB   . LEU A 1 61  ? -7.324  -17.295 -5.415  1.00 0.00 ? 61  LEU A CB   1  
ATOM 923   C CG   . LEU A 1 61  ? -6.689  -17.905 -4.165  1.00 0.00 ? 61  LEU A CG   1  
ATOM 924   C CD1  . LEU A 1 61  ? -5.181  -17.707 -4.181  1.00 0.00 ? 61  LEU A CD1  1  
ATOM 925   C CD2  . LEU A 1 61  ? -7.295  -17.296 -2.908  1.00 0.00 ? 61  LEU A CD2  1  
ATOM 926   H H    . LEU A 1 61  ? -7.634  -19.747 -6.129  1.00 0.00 ? 61  LEU A H    1  
ATOM 927   H HA   . LEU A 1 61  ? -9.303  -18.002 -5.006  1.00 0.00 ? 61  LEU A HA   1  
ATOM 928   H HB2  . LEU A 1 61  ? -6.621  -17.400 -6.227  1.00 0.00 ? 61  LEU A HB2  1  
ATOM 929   H HB3  . LEU A 1 61  ? -7.495  -16.246 -5.222  1.00 0.00 ? 61  LEU A HB3  1  
ATOM 930   H HG   . LEU A 1 61  ? -6.886  -18.968 -4.150  1.00 0.00 ? 61  LEU A HG   1  
ATOM 931   H HD11 . LEU A 1 61  ? -4.802  -17.914 -5.170  1.00 0.00 ? 61  LEU A HD11 1  
ATOM 932   H HD12 . LEU A 1 61  ? -4.723  -18.380 -3.471  1.00 0.00 ? 61  LEU A HD12 1  
ATOM 933   H HD13 . LEU A 1 61  ? -4.949  -16.687 -3.911  1.00 0.00 ? 61  LEU A HD13 1  
ATOM 934   H HD21 . LEU A 1 61  ? -6.672  -16.483 -2.566  1.00 0.00 ? 61  LEU A HD21 1  
ATOM 935   H HD22 . LEU A 1 61  ? -7.358  -18.051 -2.137  1.00 0.00 ? 61  LEU A HD22 1  
ATOM 936   H HD23 . LEU A 1 61  ? -8.284  -16.923 -3.130  1.00 0.00 ? 61  LEU A HD23 1  
ATOM 937   N N    . GLY A 1 62  ? -8.947  -17.189 -8.160  1.00 0.00 ? 62  GLY A N    1  
ATOM 938   C CA   . GLY A 1 62  ? -9.521  -16.386 -9.224  1.00 0.00 ? 62  GLY A CA   1  
ATOM 939   C C    . GLY A 1 62  ? -9.411  -14.899 -8.952  1.00 0.00 ? 62  GLY A C    1  
ATOM 940   O O    . GLY A 1 62  ? -8.324  -14.327 -9.026  1.00 0.00 ? 62  GLY A O    1  
ATOM 941   H H    . GLY A 1 62  ? -8.276  -17.871 -8.371  1.00 0.00 ? 62  GLY A H    1  
ATOM 942   H HA2  . GLY A 1 62  ? -9.009  -16.612 -10.147 1.00 0.00 ? 62  GLY A HA2  1  
ATOM 943   H HA3  . GLY A 1 62  ? -10.565 -16.645 -9.330  1.00 0.00 ? 62  GLY A HA3  1  
ATOM 944   N N    . SER A 1 63  ? -10.540 -14.271 -8.639  1.00 0.00 ? 63  SER A N    1  
ATOM 945   C CA   . SER A 1 63  ? -10.567 -12.840 -8.361  1.00 0.00 ? 63  SER A CA   1  
ATOM 946   C C    . SER A 1 63  ? -9.708  -12.506 -7.145  1.00 0.00 ? 63  SER A C    1  
ATOM 947   O O    . SER A 1 63  ? -9.306  -11.360 -6.952  1.00 0.00 ? 63  SER A O    1  
ATOM 948   C CB   . SER A 1 63  ? -12.005 -12.371 -8.128  1.00 0.00 ? 63  SER A CB   1  
ATOM 949   O OG   . SER A 1 63  ? -12.666 -12.125 -9.357  1.00 0.00 ? 63  SER A OG   1  
ATOM 950   H H    . SER A 1 63  ? -11.375 -14.783 -8.596  1.00 0.00 ? 63  SER A H    1  
ATOM 951   H HA   . SER A 1 63  ? -10.166 -12.328 -9.223  1.00 0.00 ? 63  SER A HA   1  
ATOM 952   H HB2  . SER A 1 63  ? -12.546 -13.133 -7.589  1.00 0.00 ? 63  SER A HB2  1  
ATOM 953   H HB3  . SER A 1 63  ? -11.994 -11.459 -7.549  1.00 0.00 ? 63  SER A HB3  1  
ATOM 954   H HG   . SER A 1 63  ? -12.310 -12.705 -10.034 1.00 0.00 ? 63  SER A HG   1  
ATOM 955   N N    . ASN A 1 64  ? -9.432  -13.518 -6.328  1.00 0.00 ? 64  ASN A N    1  
ATOM 956   C CA   . ASN A 1 64  ? -8.621  -13.333 -5.130  1.00 0.00 ? 64  ASN A CA   1  
ATOM 957   C C    . ASN A 1 64  ? -7.213  -13.883 -5.336  1.00 0.00 ? 64  ASN A C    1  
ATOM 958   O O    . ASN A 1 64  ? -6.449  -14.035 -4.382  1.00 0.00 ? 64  ASN A O    1  
ATOM 959   C CB   . ASN A 1 64  ? -9.280  -14.021 -3.932  1.00 0.00 ? 64  ASN A CB   1  
ATOM 960   C CG   . ASN A 1 64  ? -10.565 -13.337 -3.508  1.00 0.00 ? 64  ASN A CG   1  
ATOM 961   O OD1  . ASN A 1 64  ? -11.604 -13.487 -4.151  1.00 0.00 ? 64  ASN A OD1  1  
ATOM 962   N ND2  . ASN A 1 64  ? -10.500 -12.580 -2.418  1.00 0.00 ? 64  ASN A ND2  1  
ATOM 963   H H    . ASN A 1 64  ? -9.782  -14.409 -6.536  1.00 0.00 ? 64  ASN A H    1  
ATOM 964   H HA   . ASN A 1 64  ? -8.557  -12.273 -4.934  1.00 0.00 ? 64  ASN A HA   1  
ATOM 965   H HB2  . ASN A 1 64  ? -9.509  -15.044 -4.194  1.00 0.00 ? 64  ASN A HB2  1  
ATOM 966   H HB3  . ASN A 1 64  ? -8.595  -14.011 -3.098  1.00 0.00 ? 64  ASN A HB3  1  
ATOM 967   H HD21 . ASN A 1 64  ? -9.639  -12.506 -1.956  1.00 0.00 ? 64  ASN A HD21 1  
ATOM 968   H HD22 . ASN A 1 64  ? -11.316 -12.127 -2.121  1.00 0.00 ? 64  ASN A HD22 1  
ATOM 969   N N    . LEU A 1 65  ? -6.877  -14.179 -6.586  1.00 0.00 ? 65  LEU A N    1  
ATOM 970   C CA   . LEU A 1 65  ? -5.560  -14.712 -6.918  1.00 0.00 ? 65  LEU A CA   1  
ATOM 971   C C    . LEU A 1 65  ? -4.546  -13.586 -7.096  1.00 0.00 ? 65  LEU A C    1  
ATOM 972   O O    . LEU A 1 65  ? -4.833  -12.573 -7.734  1.00 0.00 ? 65  LEU A O    1  
ATOM 973   C CB   . LEU A 1 65  ? -5.635  -15.553 -8.194  1.00 0.00 ? 65  LEU A CB   1  
ATOM 974   C CG   . LEU A 1 65  ? -4.334  -16.225 -8.633  1.00 0.00 ? 65  LEU A CG   1  
ATOM 975   C CD1  . LEU A 1 65  ? -4.211  -17.607 -8.009  1.00 0.00 ? 65  LEU A CD1  1  
ATOM 976   C CD2  . LEU A 1 65  ? -4.264  -16.314 -10.150 1.00 0.00 ? 65  LEU A CD2  1  
ATOM 977   H H    . LEU A 1 65  ? -7.528  -14.037 -7.304  1.00 0.00 ? 65  LEU A H    1  
ATOM 978   H HA   . LEU A 1 65  ? -5.241  -15.341 -6.101  1.00 0.00 ? 65  LEU A HA   1  
ATOM 979   H HB2  . LEU A 1 65  ? -6.370  -16.327 -8.037  1.00 0.00 ? 65  LEU A HB2  1  
ATOM 980   H HB3  . LEU A 1 65  ? -5.961  -14.906 -8.996  1.00 0.00 ? 65  LEU A HB3  1  
ATOM 981   H HG   . LEU A 1 65  ? -3.497  -15.631 -8.293  1.00 0.00 ? 65  LEU A HG   1  
ATOM 982   H HD11 . LEU A 1 65  ? -3.191  -17.771 -7.696  1.00 0.00 ? 65  LEU A HD11 1  
ATOM 983   H HD12 . LEU A 1 65  ? -4.488  -18.355 -8.737  1.00 0.00 ? 65  LEU A HD12 1  
ATOM 984   H HD13 . LEU A 1 65  ? -4.867  -17.676 -7.154  1.00 0.00 ? 65  LEU A HD13 1  
ATOM 985   H HD21 . LEU A 1 65  ? -3.243  -16.172 -10.472 1.00 0.00 ? 65  LEU A HD21 1  
ATOM 986   H HD22 . LEU A 1 65  ? -4.889  -15.547 -10.585 1.00 0.00 ? 65  LEU A HD22 1  
ATOM 987   H HD23 . LEU A 1 65  ? -4.611  -17.285 -10.470 1.00 0.00 ? 65  LEU A HD23 1  
ATOM 988   N N    . VAL A 1 66  ? -3.358  -13.772 -6.530  1.00 0.00 ? 66  VAL A N    1  
ATOM 989   C CA   . VAL A 1 66  ? -2.300  -12.774 -6.628  1.00 0.00 ? 66  VAL A CA   1  
ATOM 990   C C    . VAL A 1 66  ? -1.360  -13.082 -7.788  1.00 0.00 ? 66  VAL A C    1  
ATOM 991   O O    . VAL A 1 66  ? -1.088  -14.244 -8.090  1.00 0.00 ? 66  VAL A O    1  
ATOM 992   C CB   . VAL A 1 66  ? -1.481  -12.693 -5.326  1.00 0.00 ? 66  VAL A CB   1  
ATOM 993   C CG1  . VAL A 1 66  ? -0.540  -11.499 -5.360  1.00 0.00 ? 66  VAL A CG1  1  
ATOM 994   C CG2  . VAL A 1 66  ? -2.405  -12.620 -4.120  1.00 0.00 ? 66  VAL A CG2  1  
ATOM 995   H H    . VAL A 1 66  ? -3.189  -14.600 -6.034  1.00 0.00 ? 66  VAL A H    1  
ATOM 996   H HA   . VAL A 1 66  ? -2.763  -11.812 -6.798  1.00 0.00 ? 66  VAL A HA   1  
ATOM 997   H HB   . VAL A 1 66  ? -0.886  -13.590 -5.243  1.00 0.00 ? 66  VAL A HB   1  
ATOM 998   H HG11 . VAL A 1 66  ? 0.197   -11.600 -4.577  1.00 0.00 ? 66  VAL A HG11 1  
ATOM 999   H HG12 . VAL A 1 66  ? -0.045  -11.457 -6.319  1.00 0.00 ? 66  VAL A HG12 1  
ATOM 1000  H HG13 . VAL A 1 66  ? -1.105  -10.591 -5.207  1.00 0.00 ? 66  VAL A HG13 1  
ATOM 1001  H HG21 . VAL A 1 66  ? -3.191  -13.353 -4.224  1.00 0.00 ? 66  VAL A HG21 1  
ATOM 1002  H HG22 . VAL A 1 66  ? -1.841  -12.823 -3.221  1.00 0.00 ? 66  VAL A HG22 1  
ATOM 1003  H HG23 . VAL A 1 66  ? -2.839  -11.633 -4.057  1.00 0.00 ? 66  VAL A HG23 1  
ATOM 1004  N N    . THR A 1 67  ? -0.866  -12.032 -8.437  1.00 0.00 ? 67  THR A N    1  
ATOM 1005  C CA   . THR A 1 67  ? 0.044   -12.190 -9.565  1.00 0.00 ? 67  THR A CA   1  
ATOM 1006  C C    . THR A 1 67  ? 1.046   -11.043 -9.628  1.00 0.00 ? 67  THR A C    1  
ATOM 1007  O O    . THR A 1 67  ? 0.800   -9.963  -9.093  1.00 0.00 ? 67  THR A O    1  
ATOM 1008  C CB   . THR A 1 67  ? -0.723  -12.260 -10.899 1.00 0.00 ? 67  THR A CB   1  
ATOM 1009  O OG1  . THR A 1 67  ? -1.399  -11.021 -11.142 1.00 0.00 ? 67  THR A OG1  1  
ATOM 1010  C CG2  . THR A 1 67  ? -1.731  -13.399 -10.885 1.00 0.00 ? 67  THR A CG2  1  
ATOM 1011  H H    . THR A 1 67  ? -1.120  -11.131 -8.150  1.00 0.00 ? 67  THR A H    1  
ATOM 1012  H HA   . THR A 1 67  ? 0.581   -13.118 -9.434  1.00 0.00 ? 67  THR A HA   1  
ATOM 1013  H HB   . THR A 1 67  ? -0.014  -12.437 -11.696 1.00 0.00 ? 67  THR A HB   1  
ATOM 1014  H HG1  . THR A 1 67  ? -0.872  -10.296 -10.798 1.00 0.00 ? 67  THR A HG1  1  
ATOM 1015  H HG21 . THR A 1 67  ? -2.543  -13.154 -10.216 1.00 0.00 ? 67  THR A HG21 1  
ATOM 1016  H HG22 . THR A 1 67  ? -1.247  -14.304 -10.547 1.00 0.00 ? 67  THR A HG22 1  
ATOM 1017  H HG23 . THR A 1 67  ? -2.119  -13.549 -11.881 1.00 0.00 ? 67  THR A HG23 1  
ATOM 1018  N N    . GLU A 1 68  ? 2.176   -11.286 -10.285 1.00 0.00 ? 68  GLU A N    1  
ATOM 1019  C CA   . GLU A 1 68  ? 3.215   -10.272 -10.417 1.00 0.00 ? 68  GLU A CA   1  
ATOM 1020  C C    . GLU A 1 68  ? 2.604   -8.877  -10.525 1.00 0.00 ? 68  GLU A C    1  
ATOM 1021  O O    . GLU A 1 68  ? 3.079   -7.929  -9.900  1.00 0.00 ? 68  GLU A O    1  
ATOM 1022  C CB   . GLU A 1 68  ? 4.083   -10.556 -11.645 1.00 0.00 ? 68  GLU A CB   1  
ATOM 1023  C CG   . GLU A 1 68  ? 5.470   -9.940  -11.565 1.00 0.00 ? 68  GLU A CG   1  
ATOM 1024  C CD   . GLU A 1 68  ? 6.100   -9.742  -12.930 1.00 0.00 ? 68  GLU A CD   1  
ATOM 1025  O OE1  . GLU A 1 68  ? 5.349   -9.661  -13.924 1.00 0.00 ? 68  GLU A OE1  1  
ATOM 1026  O OE2  . GLU A 1 68  ? 7.344   -9.668  -13.003 1.00 0.00 ? 68  GLU A OE2  1  
ATOM 1027  H H    . GLU A 1 68  ? 2.313   -12.167 -10.690 1.00 0.00 ? 68  GLU A H    1  
ATOM 1028  H HA   . GLU A 1 68  ? 3.833   -10.313 -9.533  1.00 0.00 ? 68  GLU A HA   1  
ATOM 1029  H HB2  . GLU A 1 68  ? 4.192   -11.625 -11.754 1.00 0.00 ? 68  GLU A HB2  1  
ATOM 1030  H HB3  . GLU A 1 68  ? 3.588   -10.162 -12.520 1.00 0.00 ? 68  GLU A HB3  1  
ATOM 1031  H HG2  . GLU A 1 68  ? 5.396   -8.980  -11.077 1.00 0.00 ? 68  GLU A HG2  1  
ATOM 1032  H HG3  . GLU A 1 68  ? 6.106   -10.590 -10.982 1.00 0.00 ? 68  GLU A HG3  1  
ATOM 1033  N N    . VAL A 1 69  ? 1.547   -8.761  -11.323 1.00 0.00 ? 69  VAL A N    1  
ATOM 1034  C CA   . VAL A 1 69  ? 0.870   -7.483  -11.512 1.00 0.00 ? 69  VAL A CA   1  
ATOM 1035  C C    . VAL A 1 69  ? 0.323   -6.950  -10.193 1.00 0.00 ? 69  VAL A C    1  
ATOM 1036  O O    . VAL A 1 69  ? 0.664   -5.845  -9.769  1.00 0.00 ? 69  VAL A O    1  
ATOM 1037  C CB   . VAL A 1 69  ? -0.286  -7.606  -12.523 1.00 0.00 ? 69  VAL A CB   1  
ATOM 1038  C CG1  . VAL A 1 69  ? -1.246  -6.434  -12.381 1.00 0.00 ? 69  VAL A CG1  1  
ATOM 1039  C CG2  . VAL A 1 69  ? 0.255   -7.693  -13.942 1.00 0.00 ? 69  VAL A CG2  1  
ATOM 1040  H H    . VAL A 1 69  ? 1.215   -9.553  -11.794 1.00 0.00 ? 69  VAL A H    1  
ATOM 1041  H HA   . VAL A 1 69  ? 1.590   -6.779  -11.904 1.00 0.00 ? 69  VAL A HA   1  
ATOM 1042  H HB   . VAL A 1 69  ? -0.829  -8.515  -12.310 1.00 0.00 ? 69  VAL A HB   1  
ATOM 1043  H HG11 . VAL A 1 69  ? -1.717  -6.471  -11.409 1.00 0.00 ? 69  VAL A HG11 1  
ATOM 1044  H HG12 . VAL A 1 69  ? -0.701  -5.507  -12.484 1.00 0.00 ? 69  VAL A HG12 1  
ATOM 1045  H HG13 . VAL A 1 69  ? -2.003  -6.495  -13.149 1.00 0.00 ? 69  VAL A HG13 1  
ATOM 1046  H HG21 . VAL A 1 69  ? 1.086   -7.014  -14.052 1.00 0.00 ? 69  VAL A HG21 1  
ATOM 1047  H HG22 . VAL A 1 69  ? 0.586   -8.703  -14.140 1.00 0.00 ? 69  VAL A HG22 1  
ATOM 1048  H HG23 . VAL A 1 69  ? -0.524  -7.427  -14.641 1.00 0.00 ? 69  VAL A HG23 1  
ATOM 1049  N N    . ARG A 1 70  ? -0.527  -7.742  -9.548  1.00 0.00 ? 70  ARG A N    1  
ATOM 1050  C CA   . ARG A 1 70  ? -1.122  -7.349  -8.276  1.00 0.00 ? 70  ARG A CA   1  
ATOM 1051  C C    . ARG A 1 70  ? -0.087  -6.685  -7.374  1.00 0.00 ? 70  ARG A C    1  
ATOM 1052  O O    . ARG A 1 70  ? -0.308  -5.587  -6.861  1.00 0.00 ? 70  ARG A O    1  
ATOM 1053  C CB   . ARG A 1 70  ? -1.722  -8.567  -7.572  1.00 0.00 ? 70  ARG A CB   1  
ATOM 1054  C CG   . ARG A 1 70  ? -2.819  -9.254  -8.369  1.00 0.00 ? 70  ARG A CG   1  
ATOM 1055  C CD   . ARG A 1 70  ? -4.180  -8.636  -8.092  1.00 0.00 ? 70  ARG A CD   1  
ATOM 1056  N NE   . ARG A 1 70  ? -4.314  -7.312  -8.695  1.00 0.00 ? 70  ARG A NE   1  
ATOM 1057  C CZ   . ARG A 1 70  ? -4.568  -7.115  -9.984  1.00 0.00 ? 70  ARG A CZ   1  
ATOM 1058  N NH1  . ARG A 1 70  ? -4.717  -8.149  -10.800 1.00 0.00 ? 70  ARG A NH1  1  
ATOM 1059  N NH2  . ARG A 1 70  ? -4.676  -5.880  -10.458 1.00 0.00 ? 70  ARG A NH2  1  
ATOM 1060  H H    . ARG A 1 70  ? -0.760  -8.611  -9.936  1.00 0.00 ? 70  ARG A H    1  
ATOM 1061  H HA   . ARG A 1 70  ? -1.910  -6.640  -8.483  1.00 0.00 ? 70  ARG A HA   1  
ATOM 1062  H HB2  . ARG A 1 70  ? -0.937  -9.286  -7.389  1.00 0.00 ? 70  ARG A HB2  1  
ATOM 1063  H HB3  . ARG A 1 70  ? -2.138  -8.253  -6.626  1.00 0.00 ? 70  ARG A HB3  1  
ATOM 1064  H HG2  . ARG A 1 70  ? -2.600  -9.156  -9.423  1.00 0.00 ? 70  ARG A HG2  1  
ATOM 1065  H HG3  . ARG A 1 70  ? -2.846  -10.299 -8.101  1.00 0.00 ? 70  ARG A HG3  1  
ATOM 1066  H HD2  . ARG A 1 70  ? -4.944  -9.283  -8.495  1.00 0.00 ? 70  ARG A HD2  1  
ATOM 1067  H HD3  . ARG A 1 70  ? -4.309  -8.549  -7.023  1.00 0.00 ? 70  ARG A HD3  1  
ATOM 1068  H HE   . ARG A 1 70  ? -4.208  -6.534  -8.110  1.00 0.00 ? 70  ARG A HE   1  
ATOM 1069  H HH11 . ARG A 1 70  ? -4.637  -9.081  -10.445 1.00 0.00 ? 70  ARG A HH11 1  
ATOM 1070  H HH12 . ARG A 1 70  ? -4.910  -7.998  -11.769 1.00 0.00 ? 70  ARG A HH12 1  
ATOM 1071  H HH21 . ARG A 1 70  ? -4.565  -5.098  -9.846  1.00 0.00 ? 70  ARG A HH21 1  
ATOM 1072  H HH22 . ARG A 1 70  ? -4.868  -5.733  -11.428 1.00 0.00 ? 70  ARG A HH22 1  
ATOM 1073  N N    . VAL A 1 71  ? 1.044   -7.357  -7.184  1.00 0.00 ? 71  VAL A N    1  
ATOM 1074  C CA   . VAL A 1 71  ? 2.114   -6.832  -6.343  1.00 0.00 ? 71  VAL A CA   1  
ATOM 1075  C C    . VAL A 1 71  ? 2.708   -5.562  -6.941  1.00 0.00 ? 71  VAL A C    1  
ATOM 1076  O O    . VAL A 1 71  ? 3.060   -4.629  -6.218  1.00 0.00 ? 71  VAL A O    1  
ATOM 1077  C CB   . VAL A 1 71  ? 3.236   -7.869  -6.150  1.00 0.00 ? 71  VAL A CB   1  
ATOM 1078  C CG1  . VAL A 1 71  ? 4.115   -7.491  -4.968  1.00 0.00 ? 71  VAL A CG1  1  
ATOM 1079  C CG2  . VAL A 1 71  ? 2.648   -9.260  -5.964  1.00 0.00 ? 71  VAL A CG2  1  
ATOM 1080  H H    . VAL A 1 71  ? 1.162   -8.227  -7.619  1.00 0.00 ? 71  VAL A H    1  
ATOM 1081  H HA   . VAL A 1 71  ? 1.695   -6.601  -5.375  1.00 0.00 ? 71  VAL A HA   1  
ATOM 1082  H HB   . VAL A 1 71  ? 3.849   -7.877  -7.039  1.00 0.00 ? 71  VAL A HB   1  
ATOM 1083  H HG11 . VAL A 1 71  ? 5.154   -7.565  -5.254  1.00 0.00 ? 71  VAL A HG11 1  
ATOM 1084  H HG12 . VAL A 1 71  ? 3.895   -6.477  -4.665  1.00 0.00 ? 71  VAL A HG12 1  
ATOM 1085  H HG13 . VAL A 1 71  ? 3.920   -8.163  -4.145  1.00 0.00 ? 71  VAL A HG13 1  
ATOM 1086  H HG21 . VAL A 1 71  ? 3.138   -9.749  -5.135  1.00 0.00 ? 71  VAL A HG21 1  
ATOM 1087  H HG22 . VAL A 1 71  ? 1.590   -9.181  -5.760  1.00 0.00 ? 71  VAL A HG22 1  
ATOM 1088  H HG23 . VAL A 1 71  ? 2.798   -9.838  -6.863  1.00 0.00 ? 71  VAL A HG23 1  
ATOM 1089  N N    . TYR A 1 72  ? 2.818   -5.533  -8.264  1.00 0.00 ? 72  TYR A N    1  
ATOM 1090  C CA   . TYR A 1 72  ? 3.372   -4.377  -8.960  1.00 0.00 ? 72  TYR A CA   1  
ATOM 1091  C C    . TYR A 1 72  ? 2.514   -3.138  -8.727  1.00 0.00 ? 72  TYR A C    1  
ATOM 1092  O O    . TYR A 1 72  ? 3.030   -2.030  -8.582  1.00 0.00 ? 72  TYR A O    1  
ATOM 1093  C CB   . TYR A 1 72  ? 3.481   -4.662  -10.459 1.00 0.00 ? 72  TYR A CB   1  
ATOM 1094  C CG   . TYR A 1 72  ? 3.543   -3.413  -11.310 1.00 0.00 ? 72  TYR A CG   1  
ATOM 1095  C CD1  . TYR A 1 72  ? 2.422   -2.610  -11.483 1.00 0.00 ? 72  TYR A CD1  1  
ATOM 1096  C CD2  . TYR A 1 72  ? 4.722   -3.037  -11.941 1.00 0.00 ? 72  TYR A CD2  1  
ATOM 1097  C CE1  . TYR A 1 72  ? 2.474   -1.469  -12.259 1.00 0.00 ? 72  TYR A CE1  1  
ATOM 1098  C CE2  . TYR A 1 72  ? 4.784   -1.897  -12.718 1.00 0.00 ? 72  TYR A CE2  1  
ATOM 1099  C CZ   . TYR A 1 72  ? 3.657   -1.116  -12.874 1.00 0.00 ? 72  TYR A CZ   1  
ATOM 1100  O OH   . TYR A 1 72  ? 3.714   0.020   -13.649 1.00 0.00 ? 72  TYR A OH   1  
ATOM 1101  H H    . TYR A 1 72  ? 2.521   -6.307  -8.786  1.00 0.00 ? 72  TYR A H    1  
ATOM 1102  H HA   . TYR A 1 72  ? 4.361   -4.196  -8.566  1.00 0.00 ? 72  TYR A HA   1  
ATOM 1103  H HB2  . TYR A 1 72  ? 4.376   -5.235  -10.646 1.00 0.00 ? 72  TYR A HB2  1  
ATOM 1104  H HB3  . TYR A 1 72  ? 2.621   -5.235  -10.773 1.00 0.00 ? 72  TYR A HB3  1  
ATOM 1105  H HD1  . TYR A 1 72  ? 1.497   -2.890  -10.999 1.00 0.00 ? 72  TYR A HD1  1  
ATOM 1106  H HD2  . TYR A 1 72  ? 5.603   -3.651  -11.816 1.00 0.00 ? 72  TYR A HD2  1  
ATOM 1107  H HE1  . TYR A 1 72  ? 1.592   -0.857  -12.382 1.00 0.00 ? 72  TYR A HE1  1  
ATOM 1108  H HE2  . TYR A 1 72  ? 5.710   -1.620  -13.200 1.00 0.00 ? 72  TYR A HE2  1  
ATOM 1109  H HH   . TYR A 1 72  ? 3.087   0.666   -13.316 1.00 0.00 ? 72  TYR A HH   1  
ATOM 1110  N N    . ASN A 1 73  ? 1.200   -3.334  -8.692  1.00 0.00 ? 73  ASN A N    1  
ATOM 1111  C CA   . ASN A 1 73  ? 0.268   -2.233  -8.477  1.00 0.00 ? 73  ASN A CA   1  
ATOM 1112  C C    . ASN A 1 73  ? 0.326   -1.746  -7.032  1.00 0.00 ? 73  ASN A C    1  
ATOM 1113  O O    . ASN A 1 73  ? 0.446   -0.549  -6.774  1.00 0.00 ? 73  ASN A O    1  
ATOM 1114  C CB   . ASN A 1 73  ? -1.157  -2.668  -8.824  1.00 0.00 ? 73  ASN A CB   1  
ATOM 1115  C CG   . ASN A 1 73  ? -1.438  -2.595  -10.312 1.00 0.00 ? 73  ASN A CG   1  
ATOM 1116  O OD1  . ASN A 1 73  ? -1.700  -1.521  -10.854 1.00 0.00 ? 73  ASN A OD1  1  
ATOM 1117  N ND2  . ASN A 1 73  ? -1.384  -3.741  -10.981 1.00 0.00 ? 73  ASN A ND2  1  
ATOM 1118  H H    . ASN A 1 73  ? 0.848   -4.241  -8.814  1.00 0.00 ? 73  ASN A H    1  
ATOM 1119  H HA   . ASN A 1 73  ? 0.556   -1.423  -9.129  1.00 0.00 ? 73  ASN A HA   1  
ATOM 1120  H HB2  . ASN A 1 73  ? -1.305  -3.688  -8.499  1.00 0.00 ? 73  ASN A HB2  1  
ATOM 1121  H HB3  . ASN A 1 73  ? -1.858  -2.027  -8.312  1.00 0.00 ? 73  ASN A HB3  1  
ATOM 1122  H HD21 . ASN A 1 73  ? -1.169  -4.558  -10.484 1.00 0.00 ? 73  ASN A HD21 1  
ATOM 1123  H HD22 . ASN A 1 73  ? -1.560  -3.722  -11.945 1.00 0.00 ? 73  ASN A HD22 1  
ATOM 1124  N N    . TRP A 1 74  ? 0.239   -2.683  -6.094  1.00 0.00 ? 74  TRP A N    1  
ATOM 1125  C CA   . TRP A 1 74  ? 0.282   -2.350  -4.675  1.00 0.00 ? 74  TRP A CA   1  
ATOM 1126  C C    . TRP A 1 74  ? 1.531   -1.540  -4.343  1.00 0.00 ? 74  TRP A C    1  
ATOM 1127  O O    . TRP A 1 74  ? 1.451   -0.494  -3.699  1.00 0.00 ? 74  TRP A O    1  
ATOM 1128  C CB   . TRP A 1 74  ? 0.246   -3.624  -3.830  1.00 0.00 ? 74  TRP A CB   1  
ATOM 1129  C CG   . TRP A 1 74  ? 0.159   -3.358  -2.357  1.00 0.00 ? 74  TRP A CG   1  
ATOM 1130  C CD1  . TRP A 1 74  ? -0.977  -3.276  -1.605  1.00 0.00 ? 74  TRP A CD1  1  
ATOM 1131  C CD2  . TRP A 1 74  ? 1.253   -3.136  -1.461  1.00 0.00 ? 74  TRP A CD2  1  
ATOM 1132  N NE1  . TRP A 1 74  ? -0.656  -3.017  -0.294  1.00 0.00 ? 74  TRP A NE1  1  
ATOM 1133  C CE2  . TRP A 1 74  ? 0.706   -2.928  -0.180  1.00 0.00 ? 74  TRP A CE2  1  
ATOM 1134  C CE3  . TRP A 1 74  ? 2.642   -3.096  -1.615  1.00 0.00 ? 74  TRP A CE3  1  
ATOM 1135  C CZ2  . TRP A 1 74  ? 1.500   -2.682  0.937   1.00 0.00 ? 74  TRP A CZ2  1  
ATOM 1136  C CZ3  . TRP A 1 74  ? 3.428   -2.851  -0.505  1.00 0.00 ? 74  TRP A CZ3  1  
ATOM 1137  C CH2  . TRP A 1 74  ? 2.856   -2.647  0.757   1.00 0.00 ? 74  TRP A CH2  1  
ATOM 1138  H H    . TRP A 1 74  ? 0.145   -3.621  -6.363  1.00 0.00 ? 74  TRP A H    1  
ATOM 1139  H HA   . TRP A 1 74  ? -0.590  -1.754  -4.449  1.00 0.00 ? 74  TRP A HA   1  
ATOM 1140  H HB2  . TRP A 1 74  ? -0.614  -4.212  -4.113  1.00 0.00 ? 74  TRP A HB2  1  
ATOM 1141  H HB3  . TRP A 1 74  ? 1.145   -4.195  -4.014  1.00 0.00 ? 74  TRP A HB3  1  
ATOM 1142  H HD1  . TRP A 1 74  ? -1.976  -3.398  -1.996  1.00 0.00 ? 74  TRP A HD1  1  
ATOM 1143  H HE1  . TRP A 1 74  ? -1.298  -2.915  0.440   1.00 0.00 ? 74  TRP A HE1  1  
ATOM 1144  H HE3  . TRP A 1 74  ? 3.101   -3.250  -2.580  1.00 0.00 ? 74  TRP A HE3  1  
ATOM 1145  H HZ2  . TRP A 1 74  ? 1.075   -2.523  1.918   1.00 0.00 ? 74  TRP A HZ2  1  
ATOM 1146  H HZ3  . TRP A 1 74  ? 4.503   -2.815  -0.605  1.00 0.00 ? 74  TRP A HZ3  1  
ATOM 1147  H HH2  . TRP A 1 74  ? 3.509   -2.459  1.596   1.00 0.00 ? 74  TRP A HH2  1  
ATOM 1148  N N    . PHE A 1 75  ? 2.684   -2.030  -4.788  1.00 0.00 ? 75  PHE A N    1  
ATOM 1149  C CA   . PHE A 1 75  ? 3.950   -1.352  -4.537  1.00 0.00 ? 75  PHE A CA   1  
ATOM 1150  C C    . PHE A 1 75  ? 3.971   0.023   -5.199  1.00 0.00 ? 75  PHE A C    1  
ATOM 1151  O O    . PHE A 1 75  ? 4.543   0.972   -4.665  1.00 0.00 ? 75  PHE A O    1  
ATOM 1152  C CB   . PHE A 1 75  ? 5.117   -2.197  -5.053  1.00 0.00 ? 75  PHE A CB   1  
ATOM 1153  C CG   . PHE A 1 75  ? 5.647   -3.169  -4.038  1.00 0.00 ? 75  PHE A CG   1  
ATOM 1154  C CD1  . PHE A 1 75  ? 4.916   -4.293  -3.689  1.00 0.00 ? 75  PHE A CD1  1  
ATOM 1155  C CD2  . PHE A 1 75  ? 6.876   -2.960  -3.434  1.00 0.00 ? 75  PHE A CD2  1  
ATOM 1156  C CE1  . PHE A 1 75  ? 5.401   -5.190  -2.755  1.00 0.00 ? 75  PHE A CE1  1  
ATOM 1157  C CE2  . PHE A 1 75  ? 7.367   -3.853  -2.500  1.00 0.00 ? 75  PHE A CE2  1  
ATOM 1158  C CZ   . PHE A 1 75  ? 6.628   -4.970  -2.161  1.00 0.00 ? 75  PHE A CZ   1  
ATOM 1159  H H    . PHE A 1 75  ? 2.683   -2.868  -5.296  1.00 0.00 ? 75  PHE A H    1  
ATOM 1160  H HA   . PHE A 1 75  ? 4.052   -1.226  -3.470  1.00 0.00 ? 75  PHE A HA   1  
ATOM 1161  H HB2  . PHE A 1 75  ? 4.790   -2.761  -5.913  1.00 0.00 ? 75  PHE A HB2  1  
ATOM 1162  H HB3  . PHE A 1 75  ? 5.925   -1.542  -5.341  1.00 0.00 ? 75  PHE A HB3  1  
ATOM 1163  H HD1  . PHE A 1 75  ? 3.956   -4.468  -4.154  1.00 0.00 ? 75  PHE A HD1  1  
ATOM 1164  H HD2  . PHE A 1 75  ? 7.455   -2.086  -3.699  1.00 0.00 ? 75  PHE A HD2  1  
ATOM 1165  H HE1  . PHE A 1 75  ? 4.822   -6.062  -2.492  1.00 0.00 ? 75  PHE A HE1  1  
ATOM 1166  H HE2  . PHE A 1 75  ? 8.326   -3.677  -2.038  1.00 0.00 ? 75  PHE A HE2  1  
ATOM 1167  H HZ   . PHE A 1 75  ? 7.009   -5.668  -1.431  1.00 0.00 ? 75  PHE A HZ   1  
ATOM 1168  N N    . ALA A 1 76  ? 3.343   0.120   -6.366  1.00 0.00 ? 76  ALA A N    1  
ATOM 1169  C CA   . ALA A 1 76  ? 3.288   1.378   -7.102  1.00 0.00 ? 76  ALA A CA   1  
ATOM 1170  C C    . ALA A 1 76  ? 2.494   2.428   -6.334  1.00 0.00 ? 76  ALA A C    1  
ATOM 1171  O O    . ALA A 1 76  ? 2.883   3.594   -6.275  1.00 0.00 ? 76  ALA A O    1  
ATOM 1172  C CB   . ALA A 1 76  ? 2.681   1.157   -8.479  1.00 0.00 ? 76  ALA A CB   1  
ATOM 1173  H H    . ALA A 1 76  ? 2.906   -0.672  -6.741  1.00 0.00 ? 76  ALA A H    1  
ATOM 1174  H HA   . ALA A 1 76  ? 4.301   1.732   -7.234  1.00 0.00 ? 76  ALA A HA   1  
ATOM 1175  H HB1  . ALA A 1 76  ? 3.432   1.337   -9.235  1.00 0.00 ? 76  ALA A HB1  1  
ATOM 1176  H HB2  . ALA A 1 76  ? 2.326   0.140   -8.558  1.00 0.00 ? 76  ALA A HB2  1  
ATOM 1177  H HB3  . ALA A 1 76  ? 1.856   1.839   -8.622  1.00 0.00 ? 76  ALA A HB3  1  
ATOM 1178  N N    . ASN A 1 77  ? 1.378   2.008   -5.747  1.00 0.00 ? 77  ASN A N    1  
ATOM 1179  C CA   . ASN A 1 77  ? 0.528   2.914   -4.983  1.00 0.00 ? 77  ASN A CA   1  
ATOM 1180  C C    . ASN A 1 77  ? 1.191   3.300   -3.664  1.00 0.00 ? 77  ASN A C    1  
ATOM 1181  O O    . ASN A 1 77  ? 1.072   4.438   -3.208  1.00 0.00 ? 77  ASN A O    1  
ATOM 1182  C CB   . ASN A 1 77  ? -0.831  2.265   -4.712  1.00 0.00 ? 77  ASN A CB   1  
ATOM 1183  C CG   . ASN A 1 77  ? -1.929  3.289   -4.499  1.00 0.00 ? 77  ASN A CG   1  
ATOM 1184  O OD1  . ASN A 1 77  ? -2.516  3.371   -3.420  1.00 0.00 ? 77  ASN A OD1  1  
ATOM 1185  N ND2  . ASN A 1 77  ? -2.211  4.076   -5.530  1.00 0.00 ? 77  ASN A ND2  1  
ATOM 1186  H H    . ASN A 1 77  ? 1.120   1.066   -5.829  1.00 0.00 ? 77  ASN A H    1  
ATOM 1187  H HA   . ASN A 1 77  ? 0.379   3.805   -5.573  1.00 0.00 ? 77  ASN A HA   1  
ATOM 1188  H HB2  . ASN A 1 77  ? -1.102  1.646   -5.555  1.00 0.00 ? 77  ASN A HB2  1  
ATOM 1189  H HB3  . ASN A 1 77  ? -0.760  1.650   -3.827  1.00 0.00 ? 77  ASN A HB3  1  
ATOM 1190  H HD21 . ASN A 1 77  ? -1.703  3.954   -6.359  1.00 0.00 ? 77  ASN A HD21 1  
ATOM 1191  H HD22 . ASN A 1 77  ? -2.917  4.748   -5.420  1.00 0.00 ? 77  ASN A HD22 1  
ATOM 1192  N N    . ARG A 1 78  ? 1.890   2.347   -3.058  1.00 0.00 ? 78  ARG A N    1  
ATOM 1193  C CA   . ARG A 1 78  ? 2.572   2.587   -1.792  1.00 0.00 ? 78  ARG A CA   1  
ATOM 1194  C C    . ARG A 1 78  ? 3.688   3.613   -1.962  1.00 0.00 ? 78  ARG A C    1  
ATOM 1195  O O    . ARG A 1 78  ? 4.087   4.275   -1.004  1.00 0.00 ? 78  ARG A O    1  
ATOM 1196  C CB   . ARG A 1 78  ? 3.145   1.280   -1.241  1.00 0.00 ? 78  ARG A CB   1  
ATOM 1197  C CG   . ARG A 1 78  ? 2.091   0.221   -0.965  1.00 0.00 ? 78  ARG A CG   1  
ATOM 1198  C CD   . ARG A 1 78  ? 1.557   0.323   0.455   1.00 0.00 ? 78  ARG A CD   1  
ATOM 1199  N NE   . ARG A 1 78  ? 0.170   -0.124  0.551   1.00 0.00 ? 78  ARG A NE   1  
ATOM 1200  C CZ   . ARG A 1 78  ? -0.630  0.175   1.569   1.00 0.00 ? 78  ARG A CZ   1  
ATOM 1201  N NH1  . ARG A 1 78  ? -0.183  0.918   2.571   1.00 0.00 ? 78  ARG A NH1  1  
ATOM 1202  N NH2  . ARG A 1 78  ? -1.880  -0.269  1.585   1.00 0.00 ? 78  ARG A NH2  1  
ATOM 1203  H H    . ARG A 1 78  ? 1.948   1.460   -3.471  1.00 0.00 ? 78  ARG A H    1  
ATOM 1204  H HA   . ARG A 1 78  ? 1.846   2.974   -1.092  1.00 0.00 ? 78  ARG A HA   1  
ATOM 1205  H HB2  . ARG A 1 78  ? 3.848   0.879   -1.957  1.00 0.00 ? 78  ARG A HB2  1  
ATOM 1206  H HB3  . ARG A 1 78  ? 3.664   1.490   -0.318  1.00 0.00 ? 78  ARG A HB3  1  
ATOM 1207  H HG2  . ARG A 1 78  ? 1.272   0.352   -1.657  1.00 0.00 ? 78  ARG A HG2  1  
ATOM 1208  H HG3  . ARG A 1 78  ? 2.530   -0.756  -1.106  1.00 0.00 ? 78  ARG A HG3  1  
ATOM 1209  H HD2  . ARG A 1 78  ? 2.168   -0.289  1.100   1.00 0.00 ? 78  ARG A HD2  1  
ATOM 1210  H HD3  . ARG A 1 78  ? 1.616   1.353   0.774   1.00 0.00 ? 78  ARG A HD3  1  
ATOM 1211  H HE   . ARG A 1 78  ? -0.182  -0.674  -0.179  1.00 0.00 ? 78  ARG A HE   1  
ATOM 1212  H HH11 . ARG A 1 78  ? 0.759   1.255   2.562   1.00 0.00 ? 78  ARG A HH11 1  
ATOM 1213  H HH12 . ARG A 1 78  ? -0.787  1.143   3.336   1.00 0.00 ? 78  ARG A HH12 1  
ATOM 1214  H HH21 . ARG A 1 78  ? -2.221  -0.829  0.830   1.00 0.00 ? 78  ARG A HH21 1  
ATOM 1215  H HH22 . ARG A 1 78  ? -2.481  -0.043  2.351   1.00 0.00 ? 78  ARG A HH22 1  
ATOM 1216  N N    . ARG A 1 79  ? 4.188   3.739   -3.187  1.00 0.00 ? 79  ARG A N    1  
ATOM 1217  C CA   . ARG A 1 79  ? 5.259   4.682   -3.482  1.00 0.00 ? 79  ARG A CA   1  
ATOM 1218  C C    . ARG A 1 79  ? 4.693   6.012   -3.971  1.00 0.00 ? 79  ARG A C    1  
ATOM 1219  O O    . ARG A 1 79  ? 5.321   7.060   -3.821  1.00 0.00 ? 79  ARG A O    1  
ATOM 1220  C CB   . ARG A 1 79  ? 6.205   4.101   -4.535  1.00 0.00 ? 79  ARG A CB   1  
ATOM 1221  C CG   . ARG A 1 79  ? 7.348   3.291   -3.945  1.00 0.00 ? 79  ARG A CG   1  
ATOM 1222  C CD   . ARG A 1 79  ? 8.502   3.159   -4.928  1.00 0.00 ? 79  ARG A CD   1  
ATOM 1223  N NE   . ARG A 1 79  ? 9.293   4.383   -5.011  1.00 0.00 ? 79  ARG A NE   1  
ATOM 1224  C CZ   . ARG A 1 79  ? 10.291  4.556   -5.871  1.00 0.00 ? 79  ARG A CZ   1  
ATOM 1225  N NH1  . ARG A 1 79  ? 10.617  3.589   -6.717  1.00 0.00 ? 79  ARG A NH1  1  
ATOM 1226  N NH2  . ARG A 1 79  ? 10.964  5.700   -5.886  1.00 0.00 ? 79  ARG A NH2  1  
ATOM 1227  H H    . ARG A 1 79  ? 3.828   3.183   -3.910  1.00 0.00 ? 79  ARG A H    1  
ATOM 1228  H HA   . ARG A 1 79  ? 5.811   4.853   -2.570  1.00 0.00 ? 79  ARG A HA   1  
ATOM 1229  H HB2  . ARG A 1 79  ? 5.640   3.457   -5.193  1.00 0.00 ? 79  ARG A HB2  1  
ATOM 1230  H HB3  . ARG A 1 79  ? 6.626   4.911   -5.110  1.00 0.00 ? 79  ARG A HB3  1  
ATOM 1231  H HG2  . ARG A 1 79  ? 7.705   3.786   -3.054  1.00 0.00 ? 79  ARG A HG2  1  
ATOM 1232  H HG3  . ARG A 1 79  ? 6.987   2.306   -3.693  1.00 0.00 ? 79  ARG A HG3  1  
ATOM 1233  H HD2  . ARG A 1 79  ? 9.140   2.350   -4.605  1.00 0.00 ? 79  ARG A HD2  1  
ATOM 1234  H HD3  . ARG A 1 79  ? 8.100   2.933   -5.904  1.00 0.00 ? 79  ARG A HD3  1  
ATOM 1235  H HE   . ARG A 1 79  ? 9.069   5.111   -4.395  1.00 0.00 ? 79  ARG A HE   1  
ATOM 1236  H HH11 . ARG A 1 79  ? 10.110  2.727   -6.708  1.00 0.00 ? 79  ARG A HH11 1  
ATOM 1237  H HH12 . ARG A 1 79  ? 11.367  3.722   -7.364  1.00 0.00 ? 79  ARG A HH12 1  
ATOM 1238  H HH21 . ARG A 1 79  ? 10.721  6.431   -5.250  1.00 0.00 ? 79  ARG A HH21 1  
ATOM 1239  H HH22 . ARG A 1 79  ? 11.715  5.829   -6.533  1.00 0.00 ? 79  ARG A HH22 1  
ATOM 1240  N N    . LYS A 1 80  ? 3.502   5.962   -4.558  1.00 0.00 ? 80  LYS A N    1  
ATOM 1241  C CA   . LYS A 1 80  ? 2.849   7.161   -5.069  1.00 0.00 ? 80  LYS A CA   1  
ATOM 1242  C C    . LYS A 1 80  ? 2.222   7.965   -3.934  1.00 0.00 ? 80  LYS A C    1  
ATOM 1243  O O    . LYS A 1 80  ? 2.203   9.195   -3.970  1.00 0.00 ? 80  LYS A O    1  
ATOM 1244  C CB   . LYS A 1 80  ? 1.778   6.786   -6.095  1.00 0.00 ? 80  LYS A CB   1  
ATOM 1245  C CG   . LYS A 1 80  ? 2.304   6.687   -7.516  1.00 0.00 ? 80  LYS A CG   1  
ATOM 1246  C CD   . LYS A 1 80  ? 1.285   6.050   -8.446  1.00 0.00 ? 80  LYS A CD   1  
ATOM 1247  C CE   . LYS A 1 80  ? 0.247   7.060   -8.911  1.00 0.00 ? 80  LYS A CE   1  
ATOM 1248  N NZ   . LYS A 1 80  ? 0.864   8.172   -9.687  1.00 0.00 ? 80  LYS A NZ   1  
ATOM 1249  H H    . LYS A 1 80  ? 3.050   5.096   -4.649  1.00 0.00 ? 80  LYS A H    1  
ATOM 1250  H HA   . LYS A 1 80  ? 3.600   7.768   -5.551  1.00 0.00 ? 80  LYS A HA   1  
ATOM 1251  H HB2  . LYS A 1 80  ? 1.355   5.830   -5.823  1.00 0.00 ? 80  LYS A HB2  1  
ATOM 1252  H HB3  . LYS A 1 80  ? 0.998   7.534   -6.074  1.00 0.00 ? 80  LYS A HB3  1  
ATOM 1253  H HG2  . LYS A 1 80  ? 2.533   7.679   -7.876  1.00 0.00 ? 80  LYS A HG2  1  
ATOM 1254  H HG3  . LYS A 1 80  ? 3.203   6.086   -7.516  1.00 0.00 ? 80  LYS A HG3  1  
ATOM 1255  H HD2  . LYS A 1 80  ? 1.797   5.653   -9.310  1.00 0.00 ? 80  LYS A HD2  1  
ATOM 1256  H HD3  . LYS A 1 80  ? 0.784   5.248   -7.921  1.00 0.00 ? 80  LYS A HD3  1  
ATOM 1257  H HE2  . LYS A 1 80  ? -0.474  6.554   -9.535  1.00 0.00 ? 80  LYS A HE2  1  
ATOM 1258  H HE3  . LYS A 1 80  ? -0.251  7.470   -8.045  1.00 0.00 ? 80  LYS A HE3  1  
ATOM 1259  H HZ1  . LYS A 1 80  ? 0.123   8.785   -10.082 1.00 0.00 ? 80  LYS A HZ1  1  
ATOM 1260  H HZ2  . LYS A 1 80  ? 1.435   7.789   -10.467 1.00 0.00 ? 80  LYS A HZ2  1  
ATOM 1261  H HZ3  . LYS A 1 80  ? 1.478   8.741   -9.069  1.00 0.00 ? 80  LYS A HZ3  1  
ATOM 1262  N N    . GLU A 1 81  ? 1.712   7.262   -2.928  1.00 0.00 ? 81  GLU A N    1  
ATOM 1263  C CA   . GLU A 1 81  ? 1.085   7.911   -1.783  1.00 0.00 ? 81  GLU A CA   1  
ATOM 1264  C C    . GLU A 1 81  ? 2.133   8.572   -0.892  1.00 0.00 ? 81  GLU A C    1  
ATOM 1265  O O    . GLU A 1 81  ? 2.009   9.744   -0.536  1.00 0.00 ? 81  GLU A O    1  
ATOM 1266  C CB   . GLU A 1 81  ? 0.277   6.896   -0.972  1.00 0.00 ? 81  GLU A CB   1  
ATOM 1267  C CG   . GLU A 1 81  ? 1.132   5.998   -0.095  1.00 0.00 ? 81  GLU A CG   1  
ATOM 1268  C CD   . GLU A 1 81  ? 0.318   4.947   0.634   1.00 0.00 ? 81  GLU A CD   1  
ATOM 1269  O OE1  . GLU A 1 81  ? -0.910  4.889   0.414   1.00 0.00 ? 81  GLU A OE1  1  
ATOM 1270  O OE2  . GLU A 1 81  ? 0.909   4.181   1.423   1.00 0.00 ? 81  GLU A OE2  1  
ATOM 1271  H H    . GLU A 1 81  ? 1.758   6.283   -2.957  1.00 0.00 ? 81  GLU A H    1  
ATOM 1272  H HA   . GLU A 1 81  ? 0.417   8.672   -2.158  1.00 0.00 ? 81  GLU A HA   1  
ATOM 1273  H HB2  . GLU A 1 81  ? -0.416  7.430   -0.339  1.00 0.00 ? 81  GLU A HB2  1  
ATOM 1274  H HB3  . GLU A 1 81  ? -0.281  6.272   -1.654  1.00 0.00 ? 81  GLU A HB3  1  
ATOM 1275  H HG2  . GLU A 1 81  ? 1.862   5.499   -0.716  1.00 0.00 ? 81  GLU A HG2  1  
ATOM 1276  H HG3  . GLU A 1 81  ? 1.641   6.609   0.636   1.00 0.00 ? 81  GLU A HG3  1  
ATOM 1277  N N    . GLU A 1 82  ? 3.163   7.811   -0.535  1.00 0.00 ? 82  GLU A N    1  
ATOM 1278  C CA   . GLU A 1 82  ? 4.231   8.323   0.315   1.00 0.00 ? 82  GLU A CA   1  
ATOM 1279  C C    . GLU A 1 82  ? 4.845   9.586   -0.282  1.00 0.00 ? 82  GLU A C    1  
ATOM 1280  O O    . GLU A 1 82  ? 5.234   10.502  0.442   1.00 0.00 ? 82  GLU A O    1  
ATOM 1281  C CB   . GLU A 1 82  ? 5.313   7.259   0.509   1.00 0.00 ? 82  GLU A CB   1  
ATOM 1282  C CG   . GLU A 1 82  ? 6.098   6.952   -0.756  1.00 0.00 ? 82  GLU A CG   1  
ATOM 1283  C CD   . GLU A 1 82  ? 7.206   5.943   -0.525  1.00 0.00 ? 82  GLU A CD   1  
ATOM 1284  O OE1  . GLU A 1 82  ? 7.042   5.074   0.357   1.00 0.00 ? 82  GLU A OE1  1  
ATOM 1285  O OE2  . GLU A 1 82  ? 8.237   6.023   -1.224  1.00 0.00 ? 82  GLU A OE2  1  
ATOM 1286  H H    . GLU A 1 82  ? 3.205   6.885   -0.851  1.00 0.00 ? 82  GLU A H    1  
ATOM 1287  H HA   . GLU A 1 82  ? 3.802   8.565   1.276   1.00 0.00 ? 82  GLU A HA   1  
ATOM 1288  H HB2  . GLU A 1 82  ? 6.006   7.599   1.264   1.00 0.00 ? 82  GLU A HB2  1  
ATOM 1289  H HB3  . GLU A 1 82  ? 4.846   6.346   0.847   1.00 0.00 ? 82  GLU A HB3  1  
ATOM 1290  H HG2  . GLU A 1 82  ? 5.421   6.556   -1.498  1.00 0.00 ? 82  GLU A HG2  1  
ATOM 1291  H HG3  . GLU A 1 82  ? 6.536   7.868   -1.123  1.00 0.00 ? 82  GLU A HG3  1  
ATOM 1292  N N    . ALA A 1 83  ? 4.928   9.626   -1.608  1.00 0.00 ? 83  ALA A N    1  
ATOM 1293  C CA   . ALA A 1 83  ? 5.493   10.775  -2.303  1.00 0.00 ? 83  ALA A CA   1  
ATOM 1294  C C    . ALA A 1 83  ? 4.450   11.872  -2.488  1.00 0.00 ? 83  ALA A C    1  
ATOM 1295  O O    . ALA A 1 83  ? 4.785   13.017  -2.792  1.00 0.00 ? 83  ALA A O    1  
ATOM 1296  C CB   . ALA A 1 83  ? 6.060   10.351  -3.650  1.00 0.00 ? 83  ALA A CB   1  
ATOM 1297  H H    . ALA A 1 83  ? 4.601   8.864   -2.131  1.00 0.00 ? 83  ALA A H    1  
ATOM 1298  H HA   . ALA A 1 83  ? 6.305   11.162  -1.704  1.00 0.00 ? 83  ALA A HA   1  
ATOM 1299  H HB1  . ALA A 1 83  ? 5.540   10.874  -4.440  1.00 0.00 ? 83  ALA A HB1  1  
ATOM 1300  H HB2  . ALA A 1 83  ? 7.112   10.593  -3.690  1.00 0.00 ? 83  ALA A HB2  1  
ATOM 1301  H HB3  . ALA A 1 83  ? 5.930   9.287   -3.776  1.00 0.00 ? 83  ALA A HB3  1  
ATOM 1302  N N    . PHE A 1 84  ? 3.183   11.514  -2.305  1.00 0.00 ? 84  PHE A N    1  
ATOM 1303  C CA   . PHE A 1 84  ? 2.090   12.468  -2.453  1.00 0.00 ? 84  PHE A CA   1  
ATOM 1304  C C    . PHE A 1 84  ? 2.291   13.673  -1.538  1.00 0.00 ? 84  PHE A C    1  
ATOM 1305  O O    . PHE A 1 84  ? 2.477   14.796  -2.005  1.00 0.00 ? 84  PHE A O    1  
ATOM 1306  C CB   . PHE A 1 84  ? 0.752   11.795  -2.142  1.00 0.00 ? 84  PHE A CB   1  
ATOM 1307  C CG   . PHE A 1 84  ? -0.437  12.563  -2.646  1.00 0.00 ? 84  PHE A CG   1  
ATOM 1308  C CD1  . PHE A 1 84  ? -0.747  13.808  -2.122  1.00 0.00 ? 84  PHE A CD1  1  
ATOM 1309  C CD2  . PHE A 1 84  ? -1.244  12.040  -3.643  1.00 0.00 ? 84  PHE A CD2  1  
ATOM 1310  C CE1  . PHE A 1 84  ? -1.840  14.516  -2.584  1.00 0.00 ? 84  PHE A CE1  1  
ATOM 1311  C CE2  . PHE A 1 84  ? -2.339  12.743  -4.109  1.00 0.00 ? 84  PHE A CE2  1  
ATOM 1312  C CZ   . PHE A 1 84  ? -2.637  13.983  -3.579  1.00 0.00 ? 84  PHE A CZ   1  
ATOM 1313  H H    . PHE A 1 84  ? 2.979   10.586  -2.064  1.00 0.00 ? 84  PHE A H    1  
ATOM 1314  H HA   . PHE A 1 84  ? 2.084   12.807  -3.477  1.00 0.00 ? 84  PHE A HA   1  
ATOM 1315  H HB2  . PHE A 1 84  ? 0.733   10.818  -2.600  1.00 0.00 ? 84  PHE A HB2  1  
ATOM 1316  H HB3  . PHE A 1 84  ? 0.651   11.688  -1.072  1.00 0.00 ? 84  PHE A HB3  1  
ATOM 1317  H HD1  . PHE A 1 84  ? -0.124  14.226  -1.345  1.00 0.00 ? 84  PHE A HD1  1  
ATOM 1318  H HD2  . PHE A 1 84  ? -1.012  11.069  -4.058  1.00 0.00 ? 84  PHE A HD2  1  
ATOM 1319  H HE1  . PHE A 1 84  ? -2.071  15.485  -2.168  1.00 0.00 ? 84  PHE A HE1  1  
ATOM 1320  H HE2  . PHE A 1 84  ? -2.959  12.324  -4.887  1.00 0.00 ? 84  PHE A HE2  1  
ATOM 1321  H HZ   . PHE A 1 84  ? -3.492  14.534  -3.941  1.00 0.00 ? 84  PHE A HZ   1  
ATOM 1322  N N    . ARG A 1 85  ? 2.252   13.429  -0.232  1.00 0.00 ? 85  ARG A N    1  
ATOM 1323  C CA   . ARG A 1 85  ? 2.428   14.493  0.749   1.00 0.00 ? 85  ARG A CA   1  
ATOM 1324  C C    . ARG A 1 85  ? 3.545   15.443  0.327   1.00 0.00 ? 85  ARG A C    1  
ATOM 1325  O O    . ARG A 1 85  ? 3.569   16.605  0.731   1.00 0.00 ? 85  ARG A O    1  
ATOM 1326  C CB   . ARG A 1 85  ? 2.741   13.900  2.125   1.00 0.00 ? 85  ARG A CB   1  
ATOM 1327  C CG   . ARG A 1 85  ? 1.521   13.346  2.841   1.00 0.00 ? 85  ARG A CG   1  
ATOM 1328  C CD   . ARG A 1 85  ? 1.889   12.756  4.193   1.00 0.00 ? 85  ARG A CD   1  
ATOM 1329  N NE   . ARG A 1 85  ? 0.759   12.759  5.118   1.00 0.00 ? 85  ARG A NE   1  
ATOM 1330  C CZ   . ARG A 1 85  ? 0.846   12.376  6.387   1.00 0.00 ? 85  ARG A CZ   1  
ATOM 1331  N NH1  . ARG A 1 85  ? 2.006   11.963  6.880   1.00 0.00 ? 85  ARG A NH1  1  
ATOM 1332  N NH2  . ARG A 1 85  ? -0.227  12.407  7.166   1.00 0.00 ? 85  ARG A NH2  1  
ATOM 1333  H H    . ARG A 1 85  ? 2.100   12.512  0.079   1.00 0.00 ? 85  ARG A H    1  
ATOM 1334  H HA   . ARG A 1 85  ? 1.503   15.047  0.808   1.00 0.00 ? 85  ARG A HA   1  
ATOM 1335  H HB2  . ARG A 1 85  ? 3.455   13.099  2.005   1.00 0.00 ? 85  ARG A HB2  1  
ATOM 1336  H HB3  . ARG A 1 85  ? 3.177   14.670  2.744   1.00 0.00 ? 85  ARG A HB3  1  
ATOM 1337  H HG2  . ARG A 1 85  ? 0.809   14.145  2.991   1.00 0.00 ? 85  ARG A HG2  1  
ATOM 1338  H HG3  . ARG A 1 85  ? 1.076   12.575  2.230   1.00 0.00 ? 85  ARG A HG3  1  
ATOM 1339  H HD2  . ARG A 1 85  ? 2.221   11.739  4.049   1.00 0.00 ? 85  ARG A HD2  1  
ATOM 1340  H HD3  . ARG A 1 85  ? 2.692   13.340  4.619   1.00 0.00 ? 85  ARG A HD3  1  
ATOM 1341  H HE   . ARG A 1 85  ? -0.108  13.061  4.775   1.00 0.00 ? 85  ARG A HE   1  
ATOM 1342  H HH11 . ARG A 1 85  ? 2.817   11.940  6.295   1.00 0.00 ? 85  ARG A HH11 1  
ATOM 1343  H HH12 . ARG A 1 85  ? 2.069   11.676  7.836   1.00 0.00 ? 85  ARG A HH12 1  
ATOM 1344  H HH21 . ARG A 1 85  ? -1.103  12.718  6.798   1.00 0.00 ? 85  ARG A HH21 1  
ATOM 1345  H HH22 . ARG A 1 85  ? -0.161  12.118  8.121   1.00 0.00 ? 85  ARG A HH22 1  
ATOM 1346  N N    . GLN A 1 86  ? 4.466   14.940  -0.488  1.00 0.00 ? 86  GLN A N    1  
ATOM 1347  C CA   . GLN A 1 86  ? 5.585   15.744  -0.964  1.00 0.00 ? 86  GLN A CA   1  
ATOM 1348  C C    . GLN A 1 86  ? 5.279   16.350  -2.330  1.00 0.00 ? 86  GLN A C    1  
ATOM 1349  O O    . GLN A 1 86  ? 5.718   17.456  -2.643  1.00 0.00 ? 86  GLN A O    1  
ATOM 1350  C CB   . GLN A 1 86  ? 6.854   14.893  -1.044  1.00 0.00 ? 86  GLN A CB   1  
ATOM 1351  C CG   . GLN A 1 86  ? 7.245   14.258  0.281   1.00 0.00 ? 86  GLN A CG   1  
ATOM 1352  C CD   . GLN A 1 86  ? 8.739   14.033  0.402   1.00 0.00 ? 86  GLN A CD   1  
ATOM 1353  O OE1  . GLN A 1 86  ? 9.483   14.193  -0.565  1.00 0.00 ? 86  GLN A OE1  1  
ATOM 1354  N NE2  . GLN A 1 86  ? 9.186   13.658  1.595   1.00 0.00 ? 86  GLN A NE2  1  
ATOM 1355  H H    . GLN A 1 86  ? 4.392   14.006  -0.776  1.00 0.00 ? 86  GLN A H    1  
ATOM 1356  H HA   . GLN A 1 86  ? 5.743   16.544  -0.257  1.00 0.00 ? 86  GLN A HA   1  
ATOM 1357  H HB2  . GLN A 1 86  ? 6.701   14.105  -1.766  1.00 0.00 ? 86  GLN A HB2  1  
ATOM 1358  H HB3  . GLN A 1 86  ? 7.672   15.518  -1.373  1.00 0.00 ? 86  GLN A HB3  1  
ATOM 1359  H HG2  . GLN A 1 86  ? 6.928   14.906  1.084   1.00 0.00 ? 86  GLN A HG2  1  
ATOM 1360  H HG3  . GLN A 1 86  ? 6.743   13.305  0.370   1.00 0.00 ? 86  GLN A HG3  1  
ATOM 1361  H HE21 . GLN A 1 86  ? 8.535   13.548  2.320   1.00 0.00 ? 86  GLN A HE21 1  
ATOM 1362  H HE22 . GLN A 1 86  ? 10.148  13.505  1.701   1.00 0.00 ? 86  GLN A HE22 1  
ATOM 1363  N N    . LYS A 1 87  ? 4.522   15.617  -3.140  1.00 0.00 ? 87  LYS A N    1  
ATOM 1364  C CA   . LYS A 1 87  ? 4.155   16.082  -4.473  1.00 0.00 ? 87  LYS A CA   1  
ATOM 1365  C C    . LYS A 1 87  ? 3.195   17.265  -4.391  1.00 0.00 ? 87  LYS A C    1  
ATOM 1366  O O    . LYS A 1 87  ? 3.264   18.190  -5.201  1.00 0.00 ? 87  LYS A O    1  
ATOM 1367  C CB   . LYS A 1 87  ? 3.514   14.945  -5.272  1.00 0.00 ? 87  LYS A CB   1  
ATOM 1368  C CG   . LYS A 1 87  ? 2.962   15.384  -6.618  1.00 0.00 ? 87  LYS A CG   1  
ATOM 1369  C CD   . LYS A 1 87  ? 1.508   15.811  -6.511  1.00 0.00 ? 87  LYS A CD   1  
ATOM 1370  C CE   . LYS A 1 87  ? 0.582   14.611  -6.382  1.00 0.00 ? 87  LYS A CE   1  
ATOM 1371  N NZ   . LYS A 1 87  ? 0.351   13.945  -7.694  1.00 0.00 ? 87  LYS A NZ   1  
ATOM 1372  H H    . LYS A 1 87  ? 4.201   14.743  -2.833  1.00 0.00 ? 87  LYS A H    1  
ATOM 1373  H HA   . LYS A 1 87  ? 5.057   16.399  -4.973  1.00 0.00 ? 87  LYS A HA   1  
ATOM 1374  H HB2  . LYS A 1 87  ? 4.255   14.179  -5.444  1.00 0.00 ? 87  LYS A HB2  1  
ATOM 1375  H HB3  . LYS A 1 87  ? 2.703   14.527  -4.694  1.00 0.00 ? 87  LYS A HB3  1  
ATOM 1376  H HG2  . LYS A 1 87  ? 3.545   16.218  -6.981  1.00 0.00 ? 87  LYS A HG2  1  
ATOM 1377  H HG3  . LYS A 1 87  ? 3.036   14.560  -7.313  1.00 0.00 ? 87  LYS A HG3  1  
ATOM 1378  H HD2  . LYS A 1 87  ? 1.388   16.439  -5.640  1.00 0.00 ? 87  LYS A HD2  1  
ATOM 1379  H HD3  . LYS A 1 87  ? 1.239   16.368  -7.398  1.00 0.00 ? 87  LYS A HD3  1  
ATOM 1380  H HE2  . LYS A 1 87  ? 1.027   13.902  -5.701  1.00 0.00 ? 87  LYS A HE2  1  
ATOM 1381  H HE3  . LYS A 1 87  ? -0.365  14.945  -5.985  1.00 0.00 ? 87  LYS A HE3  1  
ATOM 1382  H HZ1  . LYS A 1 87  ? 1.254   13.615  -8.091  1.00 0.00 ? 87  LYS A HZ1  1  
ATOM 1383  H HZ2  . LYS A 1 87  ? -0.084  14.613  -8.362  1.00 0.00 ? 87  LYS A HZ2  1  
ATOM 1384  H HZ3  . LYS A 1 87  ? -0.281  13.129  -7.574  1.00 0.00 ? 87  LYS A HZ3  1  
ATOM 1385  N N    . LEU A 1 88  ? 2.302   17.229  -3.409  1.00 0.00 ? 88  LEU A N    1  
ATOM 1386  C CA   . LEU A 1 88  ? 1.329   18.300  -3.220  1.00 0.00 ? 88  LEU A CA   1  
ATOM 1387  C C    . LEU A 1 88  ? 1.998   19.552  -2.662  1.00 0.00 ? 88  LEU A C    1  
ATOM 1388  O O    . LEU A 1 88  ? 1.375   20.609  -2.565  1.00 0.00 ? 88  LEU A O    1  
ATOM 1389  C CB   . LEU A 1 88  ? 0.213   17.842  -2.280  1.00 0.00 ? 88  LEU A CB   1  
ATOM 1390  C CG   . LEU A 1 88  ? 0.661   17.280  -0.930  1.00 0.00 ? 88  LEU A CG   1  
ATOM 1391  C CD1  . LEU A 1 88  ? 1.512   18.297  -0.185  1.00 0.00 ? 88  LEU A CD1  1  
ATOM 1392  C CD2  . LEU A 1 88  ? -0.545  16.876  -0.094  1.00 0.00 ? 88  LEU A CD2  1  
ATOM 1393  H H    . LEU A 1 88  ? 2.296   16.466  -2.794  1.00 0.00 ? 88  LEU A H    1  
ATOM 1394  H HA   . LEU A 1 88  ? 0.903   18.533  -4.185  1.00 0.00 ? 88  LEU A HA   1  
ATOM 1395  H HB2  . LEU A 1 88  ? -0.427  18.689  -2.089  1.00 0.00 ? 88  LEU A HB2  1  
ATOM 1396  H HB3  . LEU A 1 88  ? -0.352  17.073  -2.788  1.00 0.00 ? 88  LEU A HB3  1  
ATOM 1397  H HG   . LEU A 1 88  ? 1.264   16.398  -1.097  1.00 0.00 ? 88  LEU A HG   1  
ATOM 1398  H HD11 . LEU A 1 88  ? 2.547   18.176  -0.468  1.00 0.00 ? 88  LEU A HD11 1  
ATOM 1399  H HD12 . LEU A 1 88  ? 1.409   18.141  0.879   1.00 0.00 ? 88  LEU A HD12 1  
ATOM 1400  H HD13 . LEU A 1 88  ? 1.183   19.294  -0.436  1.00 0.00 ? 88  LEU A HD13 1  
ATOM 1401  H HD21 . LEU A 1 88  ? -0.894  15.905  -0.413  1.00 0.00 ? 88  LEU A HD21 1  
ATOM 1402  H HD22 . LEU A 1 88  ? -1.334  17.602  -0.225  1.00 0.00 ? 88  LEU A HD22 1  
ATOM 1403  H HD23 . LEU A 1 88  ? -0.263  16.834  0.947   1.00 0.00 ? 88  LEU A HD23 1  
ATOM 1404  N N    . ALA A 1 89  ? 3.270   19.425  -2.299  1.00 0.00 ? 89  ALA A N    1  
ATOM 1405  C CA   . ALA A 1 89  ? 4.024   20.547  -1.755  1.00 0.00 ? 89  ALA A CA   1  
ATOM 1406  C C    . ALA A 1 89  ? 4.795   21.274  -2.852  1.00 0.00 ? 89  ALA A C    1  
ATOM 1407  O O    . ALA A 1 89  ? 5.085   22.464  -2.735  1.00 0.00 ? 89  ALA A O    1  
ATOM 1408  C CB   . ALA A 1 89  ? 4.975   20.066  -0.669  1.00 0.00 ? 89  ALA A CB   1  
ATOM 1409  H H    . ALA A 1 89  ? 3.711   18.556  -2.400  1.00 0.00 ? 89  ALA A H    1  
ATOM 1410  H HA   . ALA A 1 89  ? 3.322   21.235  -1.305  1.00 0.00 ? 89  ALA A HA   1  
ATOM 1411  H HB1  . ALA A 1 89  ? 5.040   18.988  -0.699  1.00 0.00 ? 89  ALA A HB1  1  
ATOM 1412  H HB2  . ALA A 1 89  ? 5.954   20.491  -0.834  1.00 0.00 ? 89  ALA A HB2  1  
ATOM 1413  H HB3  . ALA A 1 89  ? 4.606   20.378  0.297   1.00 0.00 ? 89  ALA A HB3  1  
ATOM 1414  N N    . MET A 1 90  ? 5.124   20.550  -3.916  1.00 0.00 ? 90  MET A N    1  
ATOM 1415  C CA   . MET A 1 90  ? 5.861   21.127  -5.035  1.00 0.00 ? 90  MET A CA   1  
ATOM 1416  C C    . MET A 1 90  ? 5.052   22.233  -5.705  1.00 0.00 ? 90  MET A C    1  
ATOM 1417  O O    . MET A 1 90  ? 5.612   23.121  -6.349  1.00 0.00 ? 90  MET A O    1  
ATOM 1418  C CB   . MET A 1 90  ? 6.210   20.044  -6.057  1.00 0.00 ? 90  MET A CB   1  
ATOM 1419  C CG   . MET A 1 90  ? 6.878   18.823  -5.444  1.00 0.00 ? 90  MET A CG   1  
ATOM 1420  S SD   . MET A 1 90  ? 8.673   18.978  -5.370  1.00 0.00 ? 90  MET A SD   1  
ATOM 1421  C CE   . MET A 1 90  ? 9.104   17.484  -4.480  1.00 0.00 ? 90  MET A CE   1  
ATOM 1422  H H    . MET A 1 90  ? 4.864   19.605  -3.952  1.00 0.00 ? 90  MET A H    1  
ATOM 1423  H HA   . MET A 1 90  ? 6.774   21.551  -4.646  1.00 0.00 ? 90  MET A HA   1  
ATOM 1424  H HB2  . MET A 1 90  ? 5.304   19.723  -6.548  1.00 0.00 ? 90  MET A HB2  1  
ATOM 1425  H HB3  . MET A 1 90  ? 6.880   20.462  -6.793  1.00 0.00 ? 90  MET A HB3  1  
ATOM 1426  H HG2  . MET A 1 90  ? 6.501   18.688  -4.441  1.00 0.00 ? 90  MET A HG2  1  
ATOM 1427  H HG3  . MET A 1 90  ? 6.629   17.958  -6.039  1.00 0.00 ? 90  MET A HG3  1  
ATOM 1428  H HE1  . MET A 1 90  ? 8.552   16.650  -4.887  1.00 0.00 ? 90  MET A HE1  1  
ATOM 1429  H HE2  . MET A 1 90  ? 10.163  17.299  -4.580  1.00 0.00 ? 90  MET A HE2  1  
ATOM 1430  H HE3  . MET A 1 90  ? 8.857   17.604  -3.435  1.00 0.00 ? 90  MET A HE3  1  
ATOM 1431  N N    . ASP A 1 91  ? 3.734   22.174  -5.550  1.00 0.00 ? 91  ASP A N    1  
ATOM 1432  C CA   . ASP A 1 91  ? 2.849   23.171  -6.141  1.00 0.00 ? 91  ASP A CA   1  
ATOM 1433  C C    . ASP A 1 91  ? 3.158   24.562  -5.597  1.00 0.00 ? 91  ASP A C    1  
ATOM 1434  O O    . ASP A 1 91  ? 4.048   24.730  -4.764  1.00 0.00 ? 91  ASP A O    1  
ATOM 1435  C CB   . ASP A 1 91  ? 1.388   22.815  -5.863  1.00 0.00 ? 91  ASP A CB   1  
ATOM 1436  C CG   . ASP A 1 91  ? 0.455   23.309  -6.951  1.00 0.00 ? 91  ASP A CG   1  
ATOM 1437  O OD1  . ASP A 1 91  ? 0.907   24.097  -7.808  1.00 0.00 ? 91  ASP A OD1  1  
ATOM 1438  O OD2  . ASP A 1 91  ? -0.727  22.906  -6.947  1.00 0.00 ? 91  ASP A OD2  1  
ATOM 1439  H H    . ASP A 1 91  ? 3.347   21.441  -5.026  1.00 0.00 ? 91  ASP A H    1  
ATOM 1440  H HA   . ASP A 1 91  ? 3.013   23.171  -7.208  1.00 0.00 ? 91  ASP A HA   1  
ATOM 1441  H HB2  . ASP A 1 91  ? 1.292   21.741  -5.794  1.00 0.00 ? 91  ASP A HB2  1  
ATOM 1442  H HB3  . ASP A 1 91  ? 1.087   23.260  -4.926  1.00 0.00 ? 91  ASP A HB3  1  
ATOM 1443  N N    . ALA A 1 92  ? 2.418   25.557  -6.075  1.00 0.00 ? 92  ALA A N    1  
ATOM 1444  C CA   . ALA A 1 92  ? 2.613   26.933  -5.636  1.00 0.00 ? 92  ALA A CA   1  
ATOM 1445  C C    . ALA A 1 92  ? 2.167   27.117  -4.190  1.00 0.00 ? 92  ALA A C    1  
ATOM 1446  O O    . ALA A 1 92  ? 1.668   26.183  -3.561  1.00 0.00 ? 92  ALA A O    1  
ATOM 1447  C CB   . ALA A 1 92  ? 1.859   27.890  -6.548  1.00 0.00 ? 92  ALA A CB   1  
ATOM 1448  H H    . ALA A 1 92  ? 1.724   25.360  -6.738  1.00 0.00 ? 92  ALA A H    1  
ATOM 1449  H HA   . ALA A 1 92  ? 3.667   27.161  -5.709  1.00 0.00 ? 92  ALA A HA   1  
ATOM 1450  H HB1  . ALA A 1 92  ? 2.349   28.853  -6.542  1.00 0.00 ? 92  ALA A HB1  1  
ATOM 1451  H HB2  . ALA A 1 92  ? 1.850   27.496  -7.554  1.00 0.00 ? 92  ALA A HB2  1  
ATOM 1452  H HB3  . ALA A 1 92  ? 0.845   28.000  -6.194  1.00 0.00 ? 92  ALA A HB3  1  
ATOM 1453  N N    . TYR A 1 93  ? 2.352   28.324  -3.667  1.00 0.00 ? 93  TYR A N    1  
ATOM 1454  C CA   . TYR A 1 93  ? 1.971   28.628  -2.293  1.00 0.00 ? 93  TYR A CA   1  
ATOM 1455  C C    . TYR A 1 93  ? 2.498   27.565  -1.334  1.00 0.00 ? 93  TYR A C    1  
ATOM 1456  O O    . TYR A 1 93  ? 1.782   27.108  -0.443  1.00 0.00 ? 93  TYR A O    1  
ATOM 1457  C CB   . TYR A 1 93  ? 0.450   28.731  -2.174  1.00 0.00 ? 93  TYR A CB   1  
ATOM 1458  C CG   . TYR A 1 93  ? -0.128  29.959  -2.839  1.00 0.00 ? 93  TYR A CG   1  
ATOM 1459  C CD1  . TYR A 1 93  ? 0.047   31.221  -2.284  1.00 0.00 ? 93  TYR A CD1  1  
ATOM 1460  C CD2  . TYR A 1 93  ? -0.849  29.858  -4.022  1.00 0.00 ? 93  TYR A CD2  1  
ATOM 1461  C CE1  . TYR A 1 93  ? -0.481  32.346  -2.888  1.00 0.00 ? 93  TYR A CE1  1  
ATOM 1462  C CE2  . TYR A 1 93  ? -1.379  30.978  -4.634  1.00 0.00 ? 93  TYR A CE2  1  
ATOM 1463  C CZ   . TYR A 1 93  ? -1.192  32.219  -4.063  1.00 0.00 ? 93  TYR A CZ   1  
ATOM 1464  O OH   . TYR A 1 93  ? -1.718  33.338  -4.669  1.00 0.00 ? 93  TYR A OH   1  
ATOM 1465  H H    . TYR A 1 93  ? 2.755   29.027  -4.218  1.00 0.00 ? 93  TYR A H    1  
ATOM 1466  H HA   . TYR A 1 93  ? 2.408   29.581  -2.031  1.00 0.00 ? 93  TYR A HA   1  
ATOM 1467  H HB2  . TYR A 1 93  ? 0.000   27.863  -2.632  1.00 0.00 ? 93  TYR A HB2  1  
ATOM 1468  H HB3  . TYR A 1 93  ? 0.179   28.760  -1.128  1.00 0.00 ? 93  TYR A HB3  1  
ATOM 1469  H HD1  . TYR A 1 93  ? 0.605   31.317  -1.364  1.00 0.00 ? 93  TYR A HD1  1  
ATOM 1470  H HD2  . TYR A 1 93  ? -0.994  28.884  -4.467  1.00 0.00 ? 93  TYR A HD2  1  
ATOM 1471  H HE1  . TYR A 1 93  ? -0.334  33.318  -2.442  1.00 0.00 ? 93  TYR A HE1  1  
ATOM 1472  H HE2  . TYR A 1 93  ? -1.937  30.879  -5.554  1.00 0.00 ? 93  TYR A HE2  1  
ATOM 1473  H HH   . TYR A 1 93  ? -2.080  33.097  -5.525  1.00 0.00 ? 93  TYR A HH   1  
ATOM 1474  N N    . SER A 1 94  ? 3.754   27.176  -1.523  1.00 0.00 ? 94  SER A N    1  
ATOM 1475  C CA   . SER A 1 94  ? 4.378   26.165  -0.678  1.00 0.00 ? 94  SER A CA   1  
ATOM 1476  C C    . SER A 1 94  ? 5.824   26.535  -0.364  1.00 0.00 ? 94  SER A C    1  
ATOM 1477  O O    . SER A 1 94  ? 6.298   27.606  -0.741  1.00 0.00 ? 94  SER A O    1  
ATOM 1478  C CB   . SER A 1 94  ? 4.325   24.797  -1.360  1.00 0.00 ? 94  SER A CB   1  
ATOM 1479  O OG   . SER A 1 94  ? 4.747   23.770  -0.479  1.00 0.00 ? 94  SER A OG   1  
ATOM 1480  H H    . SER A 1 94  ? 4.274   27.578  -2.251  1.00 0.00 ? 94  SER A H    1  
ATOM 1481  H HA   . SER A 1 94  ? 3.822   26.118  0.247   1.00 0.00 ? 94  SER A HA   1  
ATOM 1482  H HB2  . SER A 1 94  ? 3.313   24.592  -1.674  1.00 0.00 ? 94  SER A HB2  1  
ATOM 1483  H HB3  . SER A 1 94  ? 4.976   24.803  -2.223  1.00 0.00 ? 94  SER A HB3  1  
ATOM 1484  H HG   . SER A 1 94  ? 4.369   22.933  -0.758  1.00 0.00 ? 94  SER A HG   1  
ATOM 1485  N N    . SER A 1 95  ? 6.520   25.639  0.329   1.00 0.00 ? 95  SER A N    1  
ATOM 1486  C CA   . SER A 1 95  ? 7.912   25.872  0.697   1.00 0.00 ? 95  SER A CA   1  
ATOM 1487  C C    . SER A 1 95  ? 8.851   25.431  -0.422  1.00 0.00 ? 95  SER A C    1  
ATOM 1488  O O    . SER A 1 95  ? 9.865   24.780  -0.175  1.00 0.00 ? 95  SER A O    1  
ATOM 1489  C CB   . SER A 1 95  ? 8.252   25.124  1.988   1.00 0.00 ? 95  SER A CB   1  
ATOM 1490  O OG   . SER A 1 95  ? 8.365   23.731  1.755   1.00 0.00 ? 95  SER A OG   1  
ATOM 1491  H H    . SER A 1 95  ? 6.087   24.803  0.601   1.00 0.00 ? 95  SER A H    1  
ATOM 1492  H HA   . SER A 1 95  ? 8.039   26.931  0.861   1.00 0.00 ? 95  SER A HA   1  
ATOM 1493  H HB2  . SER A 1 95  ? 9.190   25.489  2.376   1.00 0.00 ? 95  SER A HB2  1  
ATOM 1494  H HB3  . SER A 1 95  ? 7.470   25.293  2.715   1.00 0.00 ? 95  SER A HB3  1  
ATOM 1495  H HG   . SER A 1 95  ? 9.292   23.496  1.663   1.00 0.00 ? 95  SER A HG   1  
ATOM 1496  N N    . ASN A 1 96  ? 8.505   25.792  -1.653  1.00 0.00 ? 96  ASN A N    1  
ATOM 1497  C CA   . ASN A 1 96  ? 9.315   25.434  -2.811  1.00 0.00 ? 96  ASN A CA   1  
ATOM 1498  C C    . ASN A 1 96  ? 8.766   26.079  -4.080  1.00 0.00 ? 96  ASN A C    1  
ATOM 1499  O O    . ASN A 1 96  ? 7.560   26.287  -4.211  1.00 0.00 ? 96  ASN A O    1  
ATOM 1500  C CB   . ASN A 1 96  ? 9.362   23.913  -2.977  1.00 0.00 ? 96  ASN A CB   1  
ATOM 1501  C CG   . ASN A 1 96  ? 7.983   23.283  -2.918  1.00 0.00 ? 96  ASN A CG   1  
ATOM 1502  O OD1  . ASN A 1 96  ? 6.968   23.974  -3.006  1.00 0.00 ? 96  ASN A OD1  1  
ATOM 1503  N ND2  . ASN A 1 96  ? 7.942   21.965  -2.767  1.00 0.00 ? 96  ASN A ND2  1  
ATOM 1504  H H    . ASN A 1 96  ? 7.684   26.311  -1.786  1.00 0.00 ? 96  ASN A H    1  
ATOM 1505  H HA   . ASN A 1 96  ? 10.317  25.799  -2.640  1.00 0.00 ? 96  ASN A HA   1  
ATOM 1506  H HB2  . ASN A 1 96  ? 9.804   23.675  -3.933  1.00 0.00 ? 96  ASN A HB2  1  
ATOM 1507  H HB3  . ASN A 1 96  ? 9.966   23.489  -2.189  1.00 0.00 ? 96  ASN A HB3  1  
ATOM 1508  H HD21 . ASN A 1 96  ? 8.791   21.479  -2.704  1.00 0.00 ? 96  ASN A HD21 1  
ATOM 1509  H HD22 . ASN A 1 96  ? 7.064   21.531  -2.726  1.00 0.00 ? 96  ASN A HD22 1  
ATOM 1510  N N    . SER A 1 97  ? 9.660   26.392  -5.012  1.00 0.00 ? 97  SER A N    1  
ATOM 1511  C CA   . SER A 1 97  ? 9.266   27.016  -6.270  1.00 0.00 ? 97  SER A CA   1  
ATOM 1512  C C    . SER A 1 97  ? 8.330   26.105  -7.059  1.00 0.00 ? 97  SER A C    1  
ATOM 1513  O O    . SER A 1 97  ? 8.433   24.881  -6.990  1.00 0.00 ? 97  SER A O    1  
ATOM 1514  C CB   . SER A 1 97  ? 10.502  27.346  -7.109  1.00 0.00 ? 97  SER A CB   1  
ATOM 1515  O OG   . SER A 1 97  ? 11.064  28.588  -6.722  1.00 0.00 ? 97  SER A OG   1  
ATOM 1516  H H    . SER A 1 97  ? 10.608  26.201  -4.849  1.00 0.00 ? 97  SER A H    1  
ATOM 1517  H HA   . SER A 1 97  ? 8.745   27.933  -6.036  1.00 0.00 ? 97  SER A HA   1  
ATOM 1518  H HB2  . SER A 1 97  ? 11.242  26.573  -6.975  1.00 0.00 ? 97  SER A HB2  1  
ATOM 1519  H HB3  . SER A 1 97  ? 10.222  27.401  -8.151  1.00 0.00 ? 97  SER A HB3  1  
ATOM 1520  H HG   . SER A 1 97  ? 10.469  29.300  -6.969  1.00 0.00 ? 97  SER A HG   1  
ATOM 1521  N N    . GLY A 1 98  ? 7.416   26.713  -7.809  1.00 0.00 ? 98  GLY A N    1  
ATOM 1522  C CA   . GLY A 1 98  ? 6.474   25.943  -8.600  1.00 0.00 ? 98  GLY A CA   1  
ATOM 1523  C C    . GLY A 1 98  ? 5.403   26.809  -9.232  1.00 0.00 ? 98  GLY A C    1  
ATOM 1524  O O    . GLY A 1 98  ? 5.089   27.897  -8.749  1.00 0.00 ? 98  GLY A O    1  
ATOM 1525  H H    . GLY A 1 98  ? 7.380   27.692  -7.825  1.00 0.00 ? 98  GLY A H    1  
ATOM 1526  H HA2  . GLY A 1 98  ? 7.014   25.428  -9.381  1.00 0.00 ? 98  GLY A HA2  1  
ATOM 1527  H HA3  . GLY A 1 98  ? 5.999   25.212  -7.962  1.00 0.00 ? 98  GLY A HA3  1  
ATOM 1528  N N    . PRO A 1 99  ? 4.824   26.326  -10.341 1.00 0.00 ? 99  PRO A N    1  
ATOM 1529  C CA   . PRO A 1 99  ? 3.774   27.049  -11.065 1.00 0.00 ? 99  PRO A CA   1  
ATOM 1530  C C    . PRO A 1 99  ? 2.464   27.102  -10.286 1.00 0.00 ? 99  PRO A C    1  
ATOM 1531  O O    . PRO A 1 99  ? 2.235   26.297  -9.384  1.00 0.00 ? 99  PRO A O    1  
ATOM 1532  C CB   . PRO A 1 99  ? 3.601   26.231  -12.348 1.00 0.00 ? 99  PRO A CB   1  
ATOM 1533  C CG   . PRO A 1 99  ? 4.052   24.858  -11.986 1.00 0.00 ? 99  PRO A CG   1  
ATOM 1534  C CD   . PRO A 1 99  ? 5.149   25.036  -10.974 1.00 0.00 ? 99  PRO A CD   1  
ATOM 1535  H HA   . PRO A 1 99  ? 4.084   28.053  -11.315 1.00 0.00 ? 99  PRO A HA   1  
ATOM 1536  H HB2  . PRO A 1 99  ? 2.562   26.241  -12.646 1.00 0.00 ? 99  PRO A HB2  1  
ATOM 1537  H HB3  . PRO A 1 99  ? 4.210   26.653  -13.133 1.00 0.00 ? 99  PRO A HB3  1  
ATOM 1538  H HG2  . PRO A 1 99  ? 3.232   24.304  -11.557 1.00 0.00 ? 99  PRO A HG2  1  
ATOM 1539  H HG3  . PRO A 1 99  ? 4.430   24.354  -12.863 1.00 0.00 ? 99  PRO A HG3  1  
ATOM 1540  H HD2  . PRO A 1 99  ? 5.128   24.236  -10.250 1.00 0.00 ? 99  PRO A HD2  1  
ATOM 1541  H HD3  . PRO A 1 99  ? 6.111   25.080  -11.463 1.00 0.00 ? 99  PRO A HD3  1  
ATOM 1542  N N    . SER A 1 100 ? 1.608   28.055  -10.641 1.00 0.00 ? 100 SER A N    1  
ATOM 1543  C CA   . SER A 1 100 ? 0.322   28.215  -9.973  1.00 0.00 ? 100 SER A CA   1  
ATOM 1544  C C    . SER A 1 100 ? -0.708  27.242  -10.538 1.00 0.00 ? 100 SER A C    1  
ATOM 1545  O O    . SER A 1 100 ? -0.556  26.736  -11.650 1.00 0.00 ? 100 SER A O    1  
ATOM 1546  C CB   . SER A 1 100 ? -0.179  29.652  -10.124 1.00 0.00 ? 100 SER A CB   1  
ATOM 1547  O OG   . SER A 1 100 ? -0.982  30.031  -9.019  1.00 0.00 ? 100 SER A OG   1  
ATOM 1548  H H    . SER A 1 100 ? 1.849   28.667  -11.369 1.00 0.00 ? 100 SER A H    1  
ATOM 1549  H HA   . SER A 1 100 ? 0.465   28.001  -8.924  1.00 0.00 ? 100 SER A HA   1  
ATOM 1550  H HB2  . SER A 1 100 ? 0.665   30.321  -10.185 1.00 0.00 ? 100 SER A HB2  1  
ATOM 1551  H HB3  . SER A 1 100 ? -0.768  29.732  -11.026 1.00 0.00 ? 100 SER A HB3  1  
ATOM 1552  H HG   . SER A 1 100 ? -1.886  30.168  -9.312  1.00 0.00 ? 100 SER A HG   1  
ATOM 1553  N N    . SER A 1 101 ? -1.758  26.987  -9.764  1.00 0.00 ? 101 SER A N    1  
ATOM 1554  C CA   . SER A 1 101 ? -2.813  26.072  -10.184 1.00 0.00 ? 101 SER A CA   1  
ATOM 1555  C C    . SER A 1 101 ? -3.964  26.072  -9.182  1.00 0.00 ? 101 SER A C    1  
ATOM 1556  O O    . SER A 1 101 ? -3.752  26.199  -7.977  1.00 0.00 ? 101 SER A O    1  
ATOM 1557  C CB   . SER A 1 101 ? -2.257  24.655  -10.340 1.00 0.00 ? 101 SER A CB   1  
ATOM 1558  O OG   . SER A 1 101 ? -1.808  24.145  -9.097  1.00 0.00 ? 101 SER A OG   1  
ATOM 1559  H H    . SER A 1 101 ? -1.823  27.421  -8.888  1.00 0.00 ? 101 SER A H    1  
ATOM 1560  H HA   . SER A 1 101 ? -3.184  26.411  -11.140 1.00 0.00 ? 101 SER A HA   1  
ATOM 1561  H HB2  . SER A 1 101 ? -3.031  24.008  -10.723 1.00 0.00 ? 101 SER A HB2  1  
ATOM 1562  H HB3  . SER A 1 101 ? -1.427  24.671  -11.031 1.00 0.00 ? 101 SER A HB3  1  
ATOM 1563  H HG   . SER A 1 101 ? -0.989  23.660  -9.226  1.00 0.00 ? 101 SER A HG   1  
ATOM 1564  N N    . GLY A 1 102 ? -5.184  25.929  -9.691  1.00 0.00 ? 102 GLY A N    1  
ATOM 1565  C CA   . GLY A 1 102 ? -6.350  25.915  -8.828  1.00 0.00 ? 102 GLY A CA   1  
ATOM 1566  C C    . GLY A 1 102 ? -7.361  24.861  -9.235  1.00 0.00 ? 102 GLY A C    1  
ATOM 1567  O O    . GLY A 1 102 ? -8.309  24.585  -8.502  1.00 0.00 ? 102 GLY A O    1  
ATOM 1568  H H    . GLY A 1 102 ? -5.292  25.832  -10.660 1.00 0.00 ? 102 GLY A H    1  
ATOM 1569  H HA2  . GLY A 1 102 ? -6.033  25.722  -7.814  1.00 0.00 ? 102 GLY A HA2  1  
ATOM 1570  H HA3  . GLY A 1 102 ? -6.824  26.885  -8.867  1.00 0.00 ? 102 GLY A HA3  1  
ATOM 1571  N N    . GLY A 1 1   ? -15.195 -14.691 -21.273 1.00 0.00 ? 1   GLY A N    2  
ATOM 1572  C CA   . GLY A 1 1   ? -14.334 -14.826 -20.113 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1573  C C    . GLY A 1 1   ? -13.985 -13.488 -19.491 1.00 0.00 ? 1   GLY A C    2  
ATOM 1574  O O    . GLY A 1 1   ? -14.658 -13.031 -18.568 1.00 0.00 ? 1   GLY A O    2  
ATOM 1575  H H1   . GLY A 1 1   ? -14.950 -14.074 -21.994 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1576  H HA2  . GLY A 1 1   ? -14.834 -15.435 -19.375 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1577  H HA3  . GLY A 1 1   ? -13.421 -15.319 -20.413 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1578  N N    . SER A 1 2   ? -12.928 -12.860 -19.997 1.00 0.00 ? 2   SER A N    2  
ATOM 1579  C CA   . SER A 1 2   ? -12.487 -11.569 -19.481 1.00 0.00 ? 2   SER A CA   2  
ATOM 1580  C C    . SER A 1 2   ? -12.158 -10.612 -20.622 1.00 0.00 ? 2   SER A C    2  
ATOM 1581  O O    . SER A 1 2   ? -11.481 -10.982 -21.581 1.00 0.00 ? 2   SER A O    2  
ATOM 1582  C CB   . SER A 1 2   ? -11.263 -11.747 -18.580 1.00 0.00 ? 2   SER A CB   2  
ATOM 1583  O OG   . SER A 1 2   ? -10.213 -12.402 -19.270 1.00 0.00 ? 2   SER A OG   2  
ATOM 1584  H H    . SER A 1 2   ? -12.431 -13.276 -20.732 1.00 0.00 ? 2   SER A H    2  
ATOM 1585  H HA   . SER A 1 2   ? -13.295 -11.152 -18.898 1.00 0.00 ? 2   SER A HA   2  
ATOM 1586  H HB2  . SER A 1 2   ? -10.915 -10.779 -18.255 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1587  H HB3  . SER A 1 2   ? -11.537 -12.340 -17.719 1.00 0.00 ? 2   SER A HB3  2  
ATOM 1588  H HG   . SER A 1 2   ? -9.469  -12.527 -18.677 1.00 0.00 ? 2   SER A HG   2  
ATOM 1589  N N    . SER A 1 3   ? -12.643 -9.379  -20.511 1.00 0.00 ? 3   SER A N    2  
ATOM 1590  C CA   . SER A 1 3   ? -12.404 -8.369  -21.534 1.00 0.00 ? 3   SER A CA   2  
ATOM 1591  C C    . SER A 1 3   ? -12.568 -6.965  -20.960 1.00 0.00 ? 3   SER A C    2  
ATOM 1592  O O    . SER A 1 3   ? -13.633 -6.607  -20.459 1.00 0.00 ? 3   SER A O    2  
ATOM 1593  C CB   . SER A 1 3   ? -13.363 -8.567  -22.710 1.00 0.00 ? 3   SER A CB   2  
ATOM 1594  O OG   . SER A 1 3   ? -14.679 -8.168  -22.367 1.00 0.00 ? 3   SER A OG   2  
ATOM 1595  H H    . SER A 1 3   ? -13.176 -9.145  -19.722 1.00 0.00 ? 3   SER A H    2  
ATOM 1596  H HA   . SER A 1 3   ? -11.390 -8.485  -21.885 1.00 0.00 ? 3   SER A HA   2  
ATOM 1597  H HB2  . SER A 1 3   ? -13.028 -7.975  -23.548 1.00 0.00 ? 3   SER A HB2  2  
ATOM 1598  H HB3  . SER A 1 3   ? -13.377 -9.611  -22.988 1.00 0.00 ? 3   SER A HB3  2  
ATOM 1599  H HG   . SER A 1 3   ? -15.026 -7.588  -23.049 1.00 0.00 ? 3   SER A HG   2  
ATOM 1600  N N    . GLY A 1 4   ? -11.503 -6.172  -21.038 1.00 0.00 ? 4   GLY A N    2  
ATOM 1601  C CA   . GLY A 1 4   ? -11.549 -4.816  -20.522 1.00 0.00 ? 4   GLY A CA   2  
ATOM 1602  C C    . GLY A 1 4   ? -10.323 -4.467  -19.701 1.00 0.00 ? 4   GLY A C    2  
ATOM 1603  O O    . GLY A 1 4   ? -9.871  -5.264  -18.879 1.00 0.00 ? 4   GLY A O    2  
ATOM 1604  H H    . GLY A 1 4   ? -10.680 -6.511  -21.448 1.00 0.00 ? 4   GLY A H    2  
ATOM 1605  H HA2  . GLY A 1 4   ? -11.621 -4.130  -21.352 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1606  H HA3  . GLY A 1 4   ? -12.426 -4.709  -19.901 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1607  N N    . SER A 1 5   ? -9.783  -3.273  -19.925 1.00 0.00 ? 5   SER A N    2  
ATOM 1608  C CA   . SER A 1 5   ? -8.599  -2.823  -19.203 1.00 0.00 ? 5   SER A CA   2  
ATOM 1609  C C    . SER A 1 5   ? -8.856  -1.481  -18.523 1.00 0.00 ? 5   SER A C    2  
ATOM 1610  O O    . SER A 1 5   ? -8.549  -1.302  -17.344 1.00 0.00 ? 5   SER A O    2  
ATOM 1611  C CB   . SER A 1 5   ? -7.409  -2.704  -20.157 1.00 0.00 ? 5   SER A CB   2  
ATOM 1612  O OG   . SER A 1 5   ? -6.194  -2.560  -19.442 1.00 0.00 ? 5   SER A OG   2  
ATOM 1613  H H    . SER A 1 5   ? -10.190 -2.683  -20.594 1.00 0.00 ? 5   SER A H    2  
ATOM 1614  H HA   . SER A 1 5   ? -8.371  -3.559  -18.447 1.00 0.00 ? 5   SER A HA   2  
ATOM 1615  H HB2  . SER A 1 5   ? -7.350  -3.592  -20.768 1.00 0.00 ? 5   SER A HB2  2  
ATOM 1616  H HB3  . SER A 1 5   ? -7.544  -1.839  -20.791 1.00 0.00 ? 5   SER A HB3  2  
ATOM 1617  H HG   . SER A 1 5   ? -5.681  -1.844  -19.824 1.00 0.00 ? 5   SER A HG   2  
ATOM 1618  N N    . SER A 1 6   ? -9.421  -0.542  -19.274 1.00 0.00 ? 6   SER A N    2  
ATOM 1619  C CA   . SER A 1 6   ? -9.716  0.785   -18.746 1.00 0.00 ? 6   SER A CA   2  
ATOM 1620  C C    . SER A 1 6   ? -10.787 0.712   -17.662 1.00 0.00 ? 6   SER A C    2  
ATOM 1621  O O    . SER A 1 6   ? -11.544 -0.255  -17.586 1.00 0.00 ? 6   SER A O    2  
ATOM 1622  C CB   . SER A 1 6   ? -10.175 1.714   -19.871 1.00 0.00 ? 6   SER A CB   2  
ATOM 1623  O OG   . SER A 1 6   ? -9.081  2.118   -20.676 1.00 0.00 ? 6   SER A OG   2  
ATOM 1624  H H    . SER A 1 6   ? -9.642  -0.746  -20.207 1.00 0.00 ? 6   SER A H    2  
ATOM 1625  H HA   . SER A 1 6   ? -8.808  1.178   -18.312 1.00 0.00 ? 6   SER A HA   2  
ATOM 1626  H HB2  . SER A 1 6   ? -10.892 1.198   -20.491 1.00 0.00 ? 6   SER A HB2  2  
ATOM 1627  H HB3  . SER A 1 6   ? -10.635 2.593   -19.442 1.00 0.00 ? 6   SER A HB3  2  
ATOM 1628  H HG   . SER A 1 6   ? -9.287  1.957   -21.600 1.00 0.00 ? 6   SER A HG   2  
ATOM 1629  N N    . GLY A 1 7   ? -10.844 1.743   -16.824 1.00 0.00 ? 7   GLY A N    2  
ATOM 1630  C CA   . GLY A 1 7   ? -11.825 1.777   -15.755 1.00 0.00 ? 7   GLY A CA   2  
ATOM 1631  C C    . GLY A 1 7   ? -11.232 1.403   -14.412 1.00 0.00 ? 7   GLY A C    2  
ATOM 1632  O O    . GLY A 1 7   ? -10.324 2.072   -13.918 1.00 0.00 ? 7   GLY A O    2  
ATOM 1633  H H    . GLY A 1 7   ? -10.214 2.486   -16.933 1.00 0.00 ? 7   GLY A H    2  
ATOM 1634  H HA2  . GLY A 1 7   ? -12.236 2.774   -15.691 1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1635  H HA3  . GLY A 1 7   ? -12.620 1.085   -15.990 1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1636  N N    . ARG A 1 8   ? -11.747 0.331   -13.818 1.00 0.00 ? 8   ARG A N    2  
ATOM 1637  C CA   . ARG A 1 8   ? -11.264 -0.129  -12.521 1.00 0.00 ? 8   ARG A CA   2  
ATOM 1638  C C    . ARG A 1 8   ? -11.354 -1.649  -12.416 1.00 0.00 ? 8   ARG A C    2  
ATOM 1639  O O    . ARG A 1 8   ? -12.265 -2.266  -12.966 1.00 0.00 ? 8   ARG A O    2  
ATOM 1640  C CB   . ARG A 1 8   ? -12.069 0.519   -11.394 1.00 0.00 ? 8   ARG A CB   2  
ATOM 1641  C CG   . ARG A 1 8   ? -11.507 0.244   -10.008 1.00 0.00 ? 8   ARG A CG   2  
ATOM 1642  C CD   . ARG A 1 8   ? -12.311 0.954   -8.930  1.00 0.00 ? 8   ARG A CD   2  
ATOM 1643  N NE   . ARG A 1 8   ? -11.711 0.797   -7.608  1.00 0.00 ? 8   ARG A NE   2  
ATOM 1644  C CZ   . ARG A 1 8   ? -11.719 -0.344  -6.928  1.00 0.00 ? 8   ARG A CZ   2  
ATOM 1645  N NH1  . ARG A 1 8   ? -12.293 -1.423  -7.443  1.00 0.00 ? 8   ARG A NH1  2  
ATOM 1646  N NH2  . ARG A 1 8   ? -11.153 -0.407  -5.730  1.00 0.00 ? 8   ARG A NH2  2  
ATOM 1647  H H    . ARG A 1 8   ? -12.469 -0.161  -14.261 1.00 0.00 ? 8   ARG A H    2  
ATOM 1648  H HA   . ARG A 1 8   ? -10.229 0.165   -12.429 1.00 0.00 ? 8   ARG A HA   2  
ATOM 1649  H HB2  . ARG A 1 8   ? -12.083 1.588   -11.546 1.00 0.00 ? 8   ARG A HB2  2  
ATOM 1650  H HB3  . ARG A 1 8   ? -13.081 0.145   -11.429 1.00 0.00 ? 8   ARG A HB3  2  
ATOM 1651  H HG2  . ARG A 1 8   ? -11.537 -0.820  -9.822  1.00 0.00 ? 8   ARG A HG2  2  
ATOM 1652  H HG3  . ARG A 1 8   ? -10.485 0.590   -9.970  1.00 0.00 ? 8   ARG A HG3  2  
ATOM 1653  H HD2  . ARG A 1 8   ? -12.361 2.005   -9.170  1.00 0.00 ? 8   ARG A HD2  2  
ATOM 1654  H HD3  . ARG A 1 8   ? -13.309 0.541   -8.914  1.00 0.00 ? 8   ARG A HD3  2  
ATOM 1655  H HE   . ARG A 1 8   ? -11.282 1.582   -7.208  1.00 0.00 ? 8   ARG A HE   2  
ATOM 1656  H HH11 . ARG A 1 8   ? -12.720 -1.378  -8.346  1.00 0.00 ? 8   ARG A HH11 2  
ATOM 1657  H HH12 . ARG A 1 8   ? -12.296 -2.281  -6.929  1.00 0.00 ? 8   ARG A HH12 2  
ATOM 1658  H HH21 . ARG A 1 8   ? -10.719 0.404   -5.338  1.00 0.00 ? 8   ARG A HH21 2  
ATOM 1659  H HH22 . ARG A 1 8   ? -11.159 -1.266  -5.218  1.00 0.00 ? 8   ARG A HH22 2  
ATOM 1660  N N    . ASN A 1 9   ? -10.402 -2.246  -11.706 1.00 0.00 ? 9   ASN A N    2  
ATOM 1661  C CA   . ASN A 1 9   ? -10.374 -3.693  -11.530 1.00 0.00 ? 9   ASN A CA   2  
ATOM 1662  C C    . ASN A 1 9   ? -11.008 -4.092  -10.201 1.00 0.00 ? 9   ASN A C    2  
ATOM 1663  O O    . ASN A 1 9   ? -11.264 -3.245  -9.345  1.00 0.00 ? 9   ASN A O    2  
ATOM 1664  C CB   . ASN A 1 9   ? -8.934  -4.208  -11.596 1.00 0.00 ? 9   ASN A CB   2  
ATOM 1665  C CG   . ASN A 1 9   ? -8.856  -5.719  -11.505 1.00 0.00 ? 9   ASN A CG   2  
ATOM 1666  O OD1  . ASN A 1 9   ? -9.704  -6.429  -12.045 1.00 0.00 ? 9   ASN A OD1  2  
ATOM 1667  N ND2  . ASN A 1 9   ? -7.834  -6.218  -10.820 1.00 0.00 ? 9   ASN A ND2  2  
ATOM 1668  H H    . ASN A 1 9   ? -9.702  -1.700  -11.291 1.00 0.00 ? 9   ASN A H    2  
ATOM 1669  H HA   . ASN A 1 9   ? -10.942 -4.136  -12.334 1.00 0.00 ? 9   ASN A HA   2  
ATOM 1670  H HB2  . ASN A 1 9   ? -8.490  -3.899  -12.531 1.00 0.00 ? 9   ASN A HB2  2  
ATOM 1671  H HB3  . ASN A 1 9   ? -8.369  -3.786  -10.778 1.00 0.00 ? 9   ASN A HB3  2  
ATOM 1672  H HD21 . ASN A 1 9   ? -7.196  -5.592  -10.416 1.00 0.00 ? 9   ASN A HD21 2  
ATOM 1673  H HD22 . ASN A 1 9   ? -7.758  -7.193  -10.746 1.00 0.00 ? 9   ASN A HD22 2  
ATOM 1674  N N    . ARG A 1 10  ? -11.257 -5.387  -10.035 1.00 0.00 ? 10  ARG A N    2  
ATOM 1675  C CA   . ARG A 1 10  ? -11.862 -5.898  -8.811  1.00 0.00 ? 10  ARG A CA   2  
ATOM 1676  C C    . ARG A 1 10  ? -10.965 -6.947  -8.159  1.00 0.00 ? 10  ARG A C    2  
ATOM 1677  O O    . ARG A 1 10  ? -10.899 -8.090  -8.612  1.00 0.00 ? 10  ARG A O    2  
ATOM 1678  C CB   . ARG A 1 10  ? -13.236 -6.500  -9.108  1.00 0.00 ? 10  ARG A CB   2  
ATOM 1679  C CG   . ARG A 1 10  ? -14.138 -6.591  -7.888  1.00 0.00 ? 10  ARG A CG   2  
ATOM 1680  C CD   . ARG A 1 10  ? -13.847 -7.841  -7.073  1.00 0.00 ? 10  ARG A CD   2  
ATOM 1681  N NE   . ARG A 1 10  ? -15.028 -8.315  -6.357  1.00 0.00 ? 10  ARG A NE   2  
ATOM 1682  C CZ   . ARG A 1 10  ? -15.449 -7.797  -5.209  1.00 0.00 ? 10  ARG A CZ   2  
ATOM 1683  N NH1  . ARG A 1 10  ? -14.789 -6.793  -4.650  1.00 0.00 ? 10  ARG A NH1  2  
ATOM 1684  N NH2  . ARG A 1 10  ? -16.534 -8.283  -4.618  1.00 0.00 ? 10  ARG A NH2  2  
ATOM 1685  H H    . ARG A 1 10  ? -11.030 -6.013  -10.754 1.00 0.00 ? 10  ARG A H    2  
ATOM 1686  H HA   . ARG A 1 10  ? -11.981 -5.070  -8.129  1.00 0.00 ? 10  ARG A HA   2  
ATOM 1687  H HB2  . ARG A 1 10  ? -13.731 -5.889  -9.849  1.00 0.00 ? 10  ARG A HB2  2  
ATOM 1688  H HB3  . ARG A 1 10  ? -13.102 -7.495  -9.505  1.00 0.00 ? 10  ARG A HB3  2  
ATOM 1689  H HG2  . ARG A 1 10  ? -13.976 -5.723  -7.266  1.00 0.00 ? 10  ARG A HG2  2  
ATOM 1690  H HG3  . ARG A 1 10  ? -15.167 -6.616  -8.214  1.00 0.00 ? 10  ARG A HG3  2  
ATOM 1691  H HD2  . ARG A 1 10  ? -13.506 -8.619  -7.740  1.00 0.00 ? 10  ARG A HD2  2  
ATOM 1692  H HD3  . ARG A 1 10  ? -13.070 -7.615  -6.357  1.00 0.00 ? 10  ARG A HD3  2  
ATOM 1693  H HE   . ARG A 1 10  ? -15.531 -9.057  -6.753  1.00 0.00 ? 10  ARG A HE   2  
ATOM 1694  H HH11 . ARG A 1 10  ? -13.973 -6.424  -5.093  1.00 0.00 ? 10  ARG A HH11 2  
ATOM 1695  H HH12 . ARG A 1 10  ? -15.109 -6.403  -3.786  1.00 0.00 ? 10  ARG A HH12 2  
ATOM 1696  H HH21 . ARG A 1 10  ? -17.034 -9.040  -5.037  1.00 0.00 ? 10  ARG A HH21 2  
ATOM 1697  H HH22 . ARG A 1 10  ? -16.850 -7.892  -3.755  1.00 0.00 ? 10  ARG A HH22 2  
ATOM 1698  N N    . PHE A 1 11  ? -10.277 -6.550  -7.094  1.00 0.00 ? 11  PHE A N    2  
ATOM 1699  C CA   . PHE A 1 11  ? -9.383  -7.455  -6.381  1.00 0.00 ? 11  PHE A CA   2  
ATOM 1700  C C    . PHE A 1 11  ? -8.869  -6.811  -5.096  1.00 0.00 ? 11  PHE A C    2  
ATOM 1701  O O    . PHE A 1 11  ? -8.033  -5.908  -5.132  1.00 0.00 ? 11  PHE A O    2  
ATOM 1702  C CB   . PHE A 1 11  ? -8.205  -7.851  -7.273  1.00 0.00 ? 11  PHE A CB   2  
ATOM 1703  C CG   . PHE A 1 11  ? -6.963  -8.201  -6.505  1.00 0.00 ? 11  PHE A CG   2  
ATOM 1704  C CD1  . PHE A 1 11  ? -6.035  -7.225  -6.180  1.00 0.00 ? 11  PHE A CD1  2  
ATOM 1705  C CD2  . PHE A 1 11  ? -6.722  -9.507  -6.109  1.00 0.00 ? 11  PHE A CD2  2  
ATOM 1706  C CE1  . PHE A 1 11  ? -4.891  -7.543  -5.473  1.00 0.00 ? 11  PHE A CE1  2  
ATOM 1707  C CE2  . PHE A 1 11  ? -5.580  -9.831  -5.401  1.00 0.00 ? 11  PHE A CE2  2  
ATOM 1708  C CZ   . PHE A 1 11  ? -4.663  -8.849  -5.084  1.00 0.00 ? 11  PHE A CZ   2  
ATOM 1709  H H    . PHE A 1 11  ? -10.372 -5.626  -6.781  1.00 0.00 ? 11  PHE A H    2  
ATOM 1710  H HA   . PHE A 1 11  ? -9.944  -8.341  -6.126  1.00 0.00 ? 11  PHE A HA   2  
ATOM 1711  H HB2  . PHE A 1 11  ? -8.483  -8.711  -7.864  1.00 0.00 ? 11  PHE A HB2  2  
ATOM 1712  H HB3  . PHE A 1 11  ? -7.969  -7.028  -7.931  1.00 0.00 ? 11  PHE A HB3  2  
ATOM 1713  H HD1  . PHE A 1 11  ? -6.212  -6.202  -6.484  1.00 0.00 ? 11  PHE A HD1  2  
ATOM 1714  H HD2  . PHE A 1 11  ? -7.438  -10.276 -6.357  1.00 0.00 ? 11  PHE A HD2  2  
ATOM 1715  H HE1  . PHE A 1 11  ? -4.176  -6.772  -5.227  1.00 0.00 ? 11  PHE A HE1  2  
ATOM 1716  H HE2  . PHE A 1 11  ? -5.404  -10.853 -5.099  1.00 0.00 ? 11  PHE A HE2  2  
ATOM 1717  H HZ   . PHE A 1 11  ? -3.770  -9.100  -4.531  1.00 0.00 ? 11  PHE A HZ   2  
ATOM 1718  N N    . LYS A 1 12  ? -9.376  -7.282  -3.962  1.00 0.00 ? 12  LYS A N    2  
ATOM 1719  C CA   . LYS A 1 12  ? -8.970  -6.755  -2.665  1.00 0.00 ? 12  LYS A CA   2  
ATOM 1720  C C    . LYS A 1 12  ? -8.048  -7.733  -1.944  1.00 0.00 ? 12  LYS A C    2  
ATOM 1721  O O    . LYS A 1 12  ? -8.293  -8.939  -1.936  1.00 0.00 ? 12  LYS A O    2  
ATOM 1722  C CB   . LYS A 1 12  ? -10.199 -6.465  -1.801  1.00 0.00 ? 12  LYS A CB   2  
ATOM 1723  C CG   . LYS A 1 12  ? -9.861  -6.075  -0.372  1.00 0.00 ? 12  LYS A CG   2  
ATOM 1724  C CD   . LYS A 1 12  ? -9.466  -4.611  -0.272  1.00 0.00 ? 12  LYS A CD   2  
ATOM 1725  C CE   . LYS A 1 12  ? -10.680 -3.700  -0.361  1.00 0.00 ? 12  LYS A CE   2  
ATOM 1726  N NZ   . LYS A 1 12  ? -10.302 -2.307  -0.728  1.00 0.00 ? 12  LYS A NZ   2  
ATOM 1727  H H    . LYS A 1 12  ? -10.040 -8.003  -3.998  1.00 0.00 ? 12  LYS A H    2  
ATOM 1728  H HA   . LYS A 1 12  ? -8.434  -5.833  -2.834  1.00 0.00 ? 12  LYS A HA   2  
ATOM 1729  H HB2  . LYS A 1 12  ? -10.758 -5.657  -2.250  1.00 0.00 ? 12  LYS A HB2  2  
ATOM 1730  H HB3  . LYS A 1 12  ? -10.821 -7.349  -1.773  1.00 0.00 ? 12  LYS A HB3  2  
ATOM 1731  H HG2  . LYS A 1 12  ? -10.725 -6.248  0.253   1.00 0.00 ? 12  LYS A HG2  2  
ATOM 1732  H HG3  . LYS A 1 12  ? -9.038  -6.685  -0.028  1.00 0.00 ? 12  LYS A HG3  2  
ATOM 1733  H HD2  . LYS A 1 12  ? -8.973  -4.444  0.673   1.00 0.00 ? 12  LYS A HD2  2  
ATOM 1734  H HD3  . LYS A 1 12  ? -8.789  -4.374  -1.081  1.00 0.00 ? 12  LYS A HD3  2  
ATOM 1735  H HE2  . LYS A 1 12  ? -11.354 -4.090  -1.108  1.00 0.00 ? 12  LYS A HE2  2  
ATOM 1736  H HE3  . LYS A 1 12  ? -11.176 -3.688  0.599   1.00 0.00 ? 12  LYS A HE3  2  
ATOM 1737  H HZ1  . LYS A 1 12  ? -9.397  -2.053  -0.283  1.00 0.00 ? 12  LYS A HZ1  2  
ATOM 1738  H HZ2  . LYS A 1 12  ? -11.033 -1.641  -0.404  1.00 0.00 ? 12  LYS A HZ2  2  
ATOM 1739  H HZ3  . LYS A 1 12  ? -10.205 -2.223  -1.760  1.00 0.00 ? 12  LYS A HZ3  2  
ATOM 1740  N N    . TRP A 1 13  ? -6.989  -7.206  -1.340  1.00 0.00 ? 13  TRP A N    2  
ATOM 1741  C CA   . TRP A 1 13  ? -6.032  -8.034  -0.616  1.00 0.00 ? 13  TRP A CA   2  
ATOM 1742  C C    . TRP A 1 13  ? -6.659  -8.611  0.649   1.00 0.00 ? 13  TRP A C    2  
ATOM 1743  O O    . TRP A 1 13  ? -7.704  -8.147  1.102   1.00 0.00 ? 13  TRP A O    2  
ATOM 1744  C CB   . TRP A 1 13  ? -4.789  -7.217  -0.256  1.00 0.00 ? 13  TRP A CB   2  
ATOM 1745  C CG   . TRP A 1 13  ? -4.011  -6.762  -1.454  1.00 0.00 ? 13  TRP A CG   2  
ATOM 1746  C CD1  . TRP A 1 13  ? -4.013  -5.512  -2.005  1.00 0.00 ? 13  TRP A CD1  2  
ATOM 1747  C CD2  . TRP A 1 13  ? -3.120  -7.552  -2.247  1.00 0.00 ? 13  TRP A CD2  2  
ATOM 1748  N NE1  . TRP A 1 13  ? -3.176  -5.478  -3.094  1.00 0.00 ? 13  TRP A NE1  2  
ATOM 1749  C CE2  . TRP A 1 13  ? -2.615  -6.716  -3.264  1.00 0.00 ? 13  TRP A CE2  2  
ATOM 1750  C CE3  . TRP A 1 13  ? -2.696  -8.882  -2.198  1.00 0.00 ? 13  TRP A CE3  2  
ATOM 1751  C CZ2  . TRP A 1 13  ? -1.712  -7.171  -4.220  1.00 0.00 ? 13  TRP A CZ2  2  
ATOM 1752  C CZ3  . TRP A 1 13  ? -1.800  -9.332  -3.148  1.00 0.00 ? 13  TRP A CZ3  2  
ATOM 1753  C CH2  . TRP A 1 13  ? -1.314  -8.478  -4.148  1.00 0.00 ? 13  TRP A CH2  2  
ATOM 1754  H H    . TRP A 1 13  ? -6.848  -6.237  -1.382  1.00 0.00 ? 13  TRP A H    2  
ATOM 1755  H HA   . TRP A 1 13  ? -5.742  -8.848  -1.264  1.00 0.00 ? 13  TRP A HA   2  
ATOM 1756  H HB2  . TRP A 1 13  ? -5.090  -6.341  0.299   1.00 0.00 ? 13  TRP A HB2  2  
ATOM 1757  H HB3  . TRP A 1 13  ? -4.136  -7.821  0.357   1.00 0.00 ? 13  TRP A HB3  2  
ATOM 1758  H HD1  . TRP A 1 13  ? -4.594  -4.683  -1.631  1.00 0.00 ? 13  TRP A HD1  2  
ATOM 1759  H HE1  . TRP A 1 13  ? -3.007  -4.694  -3.658  1.00 0.00 ? 13  TRP A HE1  2  
ATOM 1760  H HE3  . TRP A 1 13  ? -3.059  -9.556  -1.435  1.00 0.00 ? 13  TRP A HE3  2  
ATOM 1761  H HZ2  . TRP A 1 13  ? -1.328  -6.525  -4.996  1.00 0.00 ? 13  TRP A HZ2  2  
ATOM 1762  H HZ3  . TRP A 1 13  ? -1.461  -10.358 -3.126  1.00 0.00 ? 13  TRP A HZ3  2  
ATOM 1763  H HH2  . TRP A 1 13  ? -0.615  -8.872  -4.869  1.00 0.00 ? 13  TRP A HH2  2  
ATOM 1764  N N    . GLY A 1 14  ? -6.013  -9.627  1.214   1.00 0.00 ? 14  GLY A N    2  
ATOM 1765  C CA   . GLY A 1 14  ? -6.523  -10.251 2.421   1.00 0.00 ? 14  GLY A CA   2  
ATOM 1766  C C    . GLY A 1 14  ? -5.762  -9.824  3.660   1.00 0.00 ? 14  GLY A C    2  
ATOM 1767  O O    . GLY A 1 14  ? -4.926  -8.921  3.621   1.00 0.00 ? 14  GLY A O    2  
ATOM 1768  H H    . GLY A 1 14  ? -5.184  -9.956  0.808   1.00 0.00 ? 14  GLY A H    2  
ATOM 1769  H HA2  . GLY A 1 14  ? -7.563  -9.983  2.540   1.00 0.00 ? 14  GLY A HA2  2  
ATOM 1770  H HA3  . GLY A 1 14  ? -6.447  -11.323 2.318   1.00 0.00 ? 14  GLY A HA3  2  
ATOM 1771  N N    . PRO A 1 15  ? -6.052  -10.480 4.793   1.00 0.00 ? 15  PRO A N    2  
ATOM 1772  C CA   . PRO A 1 15  ? -5.400  -10.180 6.071   1.00 0.00 ? 15  PRO A CA   2  
ATOM 1773  C C    . PRO A 1 15  ? -3.935  -10.600 6.088   1.00 0.00 ? 15  PRO A C    2  
ATOM 1774  O O    . PRO A 1 15  ? -3.074  -9.866  6.572   1.00 0.00 ? 15  PRO A O    2  
ATOM 1775  C CB   . PRO A 1 15  ? -6.204  -11.003 7.081   1.00 0.00 ? 15  PRO A CB   2  
ATOM 1776  C CG   . PRO A 1 15  ? -6.777  -12.125 6.286   1.00 0.00 ? 15  PRO A CG   2  
ATOM 1777  C CD   . PRO A 1 15  ? -7.038  -11.567 4.913   1.00 0.00 ? 15  PRO A CD   2  
ATOM 1778  H HA   . PRO A 1 15  ? -5.476  -9.131  6.318   1.00 0.00 ? 15  PRO A HA   2  
ATOM 1779  H HB2  . PRO A 1 15  ? -5.546  -11.365 7.859   1.00 0.00 ? 15  PRO A HB2  2  
ATOM 1780  H HB3  . PRO A 1 15  ? -6.980  -10.390 7.515   1.00 0.00 ? 15  PRO A HB3  2  
ATOM 1781  H HG2  . PRO A 1 15  ? -6.068  -12.937 6.232   1.00 0.00 ? 15  PRO A HG2  2  
ATOM 1782  H HG3  . PRO A 1 15  ? -7.700  -12.459 6.736   1.00 0.00 ? 15  PRO A HG3  2  
ATOM 1783  H HD2  . PRO A 1 15  ? -6.872  -12.324 4.161   1.00 0.00 ? 15  PRO A HD2  2  
ATOM 1784  H HD3  . PRO A 1 15  ? -8.045  -11.182 4.848   1.00 0.00 ? 15  PRO A HD3  2  
ATOM 1785  N N    . ALA A 1 16  ? -3.658  -11.786 5.555   1.00 0.00 ? 16  ALA A N    2  
ATOM 1786  C CA   . ALA A 1 16  ? -2.296  -12.302 5.506   1.00 0.00 ? 16  ALA A CA   2  
ATOM 1787  C C    . ALA A 1 16  ? -1.519  -11.694 4.343   1.00 0.00 ? 16  ALA A C    2  
ATOM 1788  O O    . ALA A 1 16  ? -0.439  -11.136 4.531   1.00 0.00 ? 16  ALA A O    2  
ATOM 1789  C CB   . ALA A 1 16  ? -2.310  -13.820 5.398   1.00 0.00 ? 16  ALA A CB   2  
ATOM 1790  H H    . ALA A 1 16  ? -4.387  -12.326 5.185   1.00 0.00 ? 16  ALA A H    2  
ATOM 1791  H HA   . ALA A 1 16  ? -1.805  -12.037 6.432   1.00 0.00 ? 16  ALA A HA   2  
ATOM 1792  H HB1  . ALA A 1 16  ? -1.385  -14.217 5.790   1.00 0.00 ? 16  ALA A HB1  2  
ATOM 1793  H HB2  . ALA A 1 16  ? -3.140  -14.213 5.965   1.00 0.00 ? 16  ALA A HB2  2  
ATOM 1794  H HB3  . ALA A 1 16  ? -2.414  -14.105 4.362   1.00 0.00 ? 16  ALA A HB3  2  
ATOM 1795  N N    . SER A 1 17  ? -2.077  -11.807 3.142   1.00 0.00 ? 17  SER A N    2  
ATOM 1796  C CA   . SER A 1 17  ? -1.434  -11.272 1.948   1.00 0.00 ? 17  SER A CA   2  
ATOM 1797  C C    . SER A 1 17  ? -0.866  -9.881  2.213   1.00 0.00 ? 17  SER A C    2  
ATOM 1798  O O    . SER A 1 17  ? 0.344   -9.669  2.137   1.00 0.00 ? 17  SER A O    2  
ATOM 1799  C CB   . SER A 1 17  ? -2.431  -11.215 0.788   1.00 0.00 ? 17  SER A CB   2  
ATOM 1800  O OG   . SER A 1 17  ? -2.561  -12.481 0.165   1.00 0.00 ? 17  SER A OG   2  
ATOM 1801  H H    . SER A 1 17  ? -2.940  -12.263 3.057   1.00 0.00 ? 17  SER A H    2  
ATOM 1802  H HA   . SER A 1 17  ? -0.624  -11.934 1.682   1.00 0.00 ? 17  SER A HA   2  
ATOM 1803  H HB2  . SER A 1 17  ? -3.397  -10.911 1.162   1.00 0.00 ? 17  SER A HB2  2  
ATOM 1804  H HB3  . SER A 1 17  ? -2.087  -10.500 0.056   1.00 0.00 ? 17  SER A HB3  2  
ATOM 1805  H HG   . SER A 1 17  ? -3.479  -12.630 -0.071  1.00 0.00 ? 17  SER A HG   2  
ATOM 1806  N N    . GLN A 1 18  ? -1.749  -8.938  2.525   1.00 0.00 ? 18  GLN A N    2  
ATOM 1807  C CA   . GLN A 1 18  ? -1.336  -7.567  2.802   1.00 0.00 ? 18  GLN A CA   2  
ATOM 1808  C C    . GLN A 1 18  ? -0.091  -7.541  3.682   1.00 0.00 ? 18  GLN A C    2  
ATOM 1809  O O    . GLN A 1 18  ? 0.933   -6.969  3.308   1.00 0.00 ? 18  GLN A O    2  
ATOM 1810  C CB   . GLN A 1 18  ? -2.470  -6.797  3.479   1.00 0.00 ? 18  GLN A CB   2  
ATOM 1811  C CG   . GLN A 1 18  ? -3.515  -6.272  2.507   1.00 0.00 ? 18  GLN A CG   2  
ATOM 1812  C CD   . GLN A 1 18  ? -4.248  -5.056  3.039   1.00 0.00 ? 18  GLN A CD   2  
ATOM 1813  O OE1  . GLN A 1 18  ? -3.751  -4.353  3.919   1.00 0.00 ? 18  GLN A OE1  2  
ATOM 1814  N NE2  . GLN A 1 18  ? -5.438  -4.803  2.507   1.00 0.00 ? 18  GLN A NE2  2  
ATOM 1815  H H    . GLN A 1 18  ? -2.699  -9.169  2.570   1.00 0.00 ? 18  GLN A H    2  
ATOM 1816  H HA   . GLN A 1 18  ? -1.105  -7.094  1.859   1.00 0.00 ? 18  GLN A HA   2  
ATOM 1817  H HB2  . GLN A 1 18  ? -2.962  -7.450  4.184   1.00 0.00 ? 18  GLN A HB2  2  
ATOM 1818  H HB3  . GLN A 1 18  ? -2.051  -5.956  4.012   1.00 0.00 ? 18  GLN A HB3  2  
ATOM 1819  H HG2  . GLN A 1 18  ? -3.024  -6.001  1.584   1.00 0.00 ? 18  GLN A HG2  2  
ATOM 1820  H HG3  . GLN A 1 18  ? -4.234  -7.054  2.315   1.00 0.00 ? 18  GLN A HG3  2  
ATOM 1821  H HE21 . GLN A 1 18  ? -5.771  -5.407  1.810   1.00 0.00 ? 18  GLN A HE21 2  
ATOM 1822  H HE22 . GLN A 1 18  ? -5.934  -4.024  2.832   1.00 0.00 ? 18  GLN A HE22 2  
ATOM 1823  N N    . GLN A 1 19  ? -0.186  -8.162  4.853   1.00 0.00 ? 19  GLN A N    2  
ATOM 1824  C CA   . GLN A 1 19  ? 0.932   -8.209  5.786   1.00 0.00 ? 19  GLN A CA   2  
ATOM 1825  C C    . GLN A 1 19  ? 2.222   -8.601  5.072   1.00 0.00 ? 19  GLN A C    2  
ATOM 1826  O O    . GLN A 1 19  ? 3.262   -7.969  5.257   1.00 0.00 ? 19  GLN A O    2  
ATOM 1827  C CB   . GLN A 1 19  ? 0.640   -9.197  6.917   1.00 0.00 ? 19  GLN A CB   2  
ATOM 1828  C CG   . GLN A 1 19  ? -0.583  -8.833  7.742   1.00 0.00 ? 19  GLN A CG   2  
ATOM 1829  C CD   . GLN A 1 19  ? -0.309  -7.718  8.732   1.00 0.00 ? 19  GLN A CD   2  
ATOM 1830  O OE1  . GLN A 1 19  ? -0.006  -7.969  9.898   1.00 0.00 ? 19  GLN A OE1  2  
ATOM 1831  N NE2  . GLN A 1 19  ? -0.415  -6.478  8.270   1.00 0.00 ? 19  GLN A NE2  2  
ATOM 1832  H H    . GLN A 1 19  ? -1.029  -8.600  5.094   1.00 0.00 ? 19  GLN A H    2  
ATOM 1833  H HA   . GLN A 1 19  ? 1.055   -7.222  6.206   1.00 0.00 ? 19  GLN A HA   2  
ATOM 1834  H HB2  . GLN A 1 19  ? 0.483   -10.177 6.491   1.00 0.00 ? 19  GLN A HB2  2  
ATOM 1835  H HB3  . GLN A 1 19  ? 1.495   -9.233  7.577   1.00 0.00 ? 19  GLN A HB3  2  
ATOM 1836  H HG2  . GLN A 1 19  ? -1.370  -8.515  7.074   1.00 0.00 ? 19  GLN A HG2  2  
ATOM 1837  H HG3  . GLN A 1 19  ? -0.907  -9.708  8.287   1.00 0.00 ? 19  GLN A HG3  2  
ATOM 1838  H HE21 . GLN A 1 19  ? -0.663  -6.354  7.329   1.00 0.00 ? 19  GLN A HE21 2  
ATOM 1839  H HE22 . GLN A 1 19  ? -0.245  -5.738  8.888   1.00 0.00 ? 19  GLN A HE22 2  
ATOM 1840  N N    . ILE A 1 20  ? 2.145   -9.648  4.257   1.00 0.00 ? 20  ILE A N    2  
ATOM 1841  C CA   . ILE A 1 20  ? 3.306   -10.124 3.515   1.00 0.00 ? 20  ILE A CA   2  
ATOM 1842  C C    . ILE A 1 20  ? 3.898   -9.016  2.651   1.00 0.00 ? 20  ILE A C    2  
ATOM 1843  O O    . ILE A 1 20  ? 5.118   -8.895  2.526   1.00 0.00 ? 20  ILE A O    2  
ATOM 1844  C CB   . ILE A 1 20  ? 2.948   -11.323 2.618   1.00 0.00 ? 20  ILE A CB   2  
ATOM 1845  C CG1  . ILE A 1 20  ? 2.426   -12.485 3.466   1.00 0.00 ? 20  ILE A CG1  2  
ATOM 1846  C CG2  . ILE A 1 20  ? 4.158   -11.756 1.803   1.00 0.00 ? 20  ILE A CG2  2  
ATOM 1847  C CD1  . ILE A 1 20  ? 1.503   -13.416 2.712   1.00 0.00 ? 20  ILE A CD1  2  
ATOM 1848  H H    . ILE A 1 20  ? 1.288   -10.111 4.152   1.00 0.00 ? 20  ILE A H    2  
ATOM 1849  H HA   . ILE A 1 20  ? 4.050   -10.444 4.230   1.00 0.00 ? 20  ILE A HA   2  
ATOM 1850  H HB   . ILE A 1 20  ? 2.175   -11.012 1.931   1.00 0.00 ? 20  ILE A HB   2  
ATOM 1851  H HG12 . ILE A 1 20  ? 3.262   -13.065 3.823   1.00 0.00 ? 20  ILE A HG12 2  
ATOM 1852  H HG13 . ILE A 1 20  ? 1.882   -12.088 4.311   1.00 0.00 ? 20  ILE A HG13 2  
ATOM 1853  H HG21 . ILE A 1 20  ? 3.932   -12.675 1.284   1.00 0.00 ? 20  ILE A HG21 2  
ATOM 1854  H HG22 . ILE A 1 20  ? 4.401   -10.988 1.084   1.00 0.00 ? 20  ILE A HG22 2  
ATOM 1855  H HG23 . ILE A 1 20  ? 4.999   -11.911 2.463   1.00 0.00 ? 20  ILE A HG23 2  
ATOM 1856  H HD11 . ILE A 1 20  ? 1.723   -13.365 1.656   1.00 0.00 ? 20  ILE A HD11 2  
ATOM 1857  H HD12 . ILE A 1 20  ? 1.645   -14.427 3.063   1.00 0.00 ? 20  ILE A HD12 2  
ATOM 1858  H HD13 . ILE A 1 20  ? 0.477   -13.119 2.880   1.00 0.00 ? 20  ILE A HD13 2  
ATOM 1859  N N    . LEU A 1 21  ? 3.028   -8.206  2.058   1.00 0.00 ? 21  LEU A N    2  
ATOM 1860  C CA   . LEU A 1 21  ? 3.464   -7.105  1.206   1.00 0.00 ? 21  LEU A CA   2  
ATOM 1861  C C    . LEU A 1 21  ? 4.271   -6.086  2.004   1.00 0.00 ? 21  LEU A C    2  
ATOM 1862  O O    . LEU A 1 21  ? 5.270   -5.554  1.520   1.00 0.00 ? 21  LEU A O    2  
ATOM 1863  C CB   . LEU A 1 21  ? 2.256   -6.424  0.561   1.00 0.00 ? 21  LEU A CB   2  
ATOM 1864  C CG   . LEU A 1 21  ? 1.243   -7.350  -0.113  1.00 0.00 ? 21  LEU A CG   2  
ATOM 1865  C CD1  . LEU A 1 21  ? 0.170   -6.541  -0.824  1.00 0.00 ? 21  LEU A CD1  2  
ATOM 1866  C CD2  . LEU A 1 21  ? 1.943   -8.285  -1.088  1.00 0.00 ? 21  LEU A CD2  2  
ATOM 1867  H H    . LEU A 1 21  ? 2.069   -8.352  2.195   1.00 0.00 ? 21  LEU A H    2  
ATOM 1868  H HA   . LEU A 1 21  ? 4.092   -7.516  0.430   1.00 0.00 ? 21  LEU A HA   2  
ATOM 1869  H HB2  . LEU A 1 21  ? 1.738   -5.872  1.331   1.00 0.00 ? 21  LEU A HB2  2  
ATOM 1870  H HB3  . LEU A 1 21  ? 2.625   -5.736  -0.186  1.00 0.00 ? 21  LEU A HB3  2  
ATOM 1871  H HG   . LEU A 1 21  ? 0.759   -7.954  0.642   1.00 0.00 ? 21  LEU A HG   2  
ATOM 1872  H HD11 . LEU A 1 21  ? 0.629   -5.715  -1.346  1.00 0.00 ? 21  LEU A HD11 2  
ATOM 1873  H HD12 . LEU A 1 21  ? -0.535  -6.162  -0.099  1.00 0.00 ? 21  LEU A HD12 2  
ATOM 1874  H HD13 . LEU A 1 21  ? -0.347  -7.172  -1.532  1.00 0.00 ? 21  LEU A HD13 2  
ATOM 1875  H HD21 . LEU A 1 21  ? 2.797   -8.735  -0.605  1.00 0.00 ? 21  LEU A HD21 2  
ATOM 1876  H HD22 . LEU A 1 21  ? 2.271   -7.725  -1.951  1.00 0.00 ? 21  LEU A HD22 2  
ATOM 1877  H HD23 . LEU A 1 21  ? 1.257   -9.059  -1.400  1.00 0.00 ? 21  LEU A HD23 2  
ATOM 1878  N N    . TYR A 1 22  ? 3.832   -5.821  3.230   1.00 0.00 ? 22  TYR A N    2  
ATOM 1879  C CA   . TYR A 1 22  ? 4.513   -4.866  4.095   1.00 0.00 ? 22  TYR A CA   2  
ATOM 1880  C C    . TYR A 1 22  ? 5.894   -5.379  4.492   1.00 0.00 ? 22  TYR A C    2  
ATOM 1881  O O    . TYR A 1 22  ? 6.880   -4.644  4.436   1.00 0.00 ? 22  TYR A O    2  
ATOM 1882  C CB   . TYR A 1 22  ? 3.678   -4.595  5.348   1.00 0.00 ? 22  TYR A CB   2  
ATOM 1883  C CG   . TYR A 1 22  ? 2.401   -3.835  5.071   1.00 0.00 ? 22  TYR A CG   2  
ATOM 1884  C CD1  . TYR A 1 22  ? 2.405   -2.450  4.958   1.00 0.00 ? 22  TYR A CD1  2  
ATOM 1885  C CD2  . TYR A 1 22  ? 1.190   -4.500  4.925   1.00 0.00 ? 22  TYR A CD2  2  
ATOM 1886  C CE1  . TYR A 1 22  ? 1.240   -1.750  4.706   1.00 0.00 ? 22  TYR A CE1  2  
ATOM 1887  C CE2  . TYR A 1 22  ? 0.021   -3.810  4.671   1.00 0.00 ? 22  TYR A CE2  2  
ATOM 1888  C CZ   . TYR A 1 22  ? 0.051   -2.435  4.563   1.00 0.00 ? 22  TYR A CZ   2  
ATOM 1889  O OH   . TYR A 1 22  ? -1.112  -1.743  4.312   1.00 0.00 ? 22  TYR A OH   2  
ATOM 1890  H H    . TYR A 1 22  ? 3.030   -6.277  3.560   1.00 0.00 ? 22  TYR A H    2  
ATOM 1891  H HA   . TYR A 1 22  ? 4.629   -3.943  3.545   1.00 0.00 ? 22  TYR A HA   2  
ATOM 1892  H HB2  . TYR A 1 22  ? 3.411   -5.535  5.805   1.00 0.00 ? 22  TYR A HB2  2  
ATOM 1893  H HB3  . TYR A 1 22  ? 4.265   -4.015  6.045   1.00 0.00 ? 22  TYR A HB3  2  
ATOM 1894  H HD1  . TYR A 1 22  ? 3.338   -1.916  5.070   1.00 0.00 ? 22  TYR A HD1  2  
ATOM 1895  H HD2  . TYR A 1 22  ? 1.170   -5.577  5.011   1.00 0.00 ? 22  TYR A HD2  2  
ATOM 1896  H HE1  . TYR A 1 22  ? 1.263   -0.674  4.620   1.00 0.00 ? 22  TYR A HE1  2  
ATOM 1897  H HE2  . TYR A 1 22  ? -0.910  -4.345  4.560   1.00 0.00 ? 22  TYR A HE2  2  
ATOM 1898  H HH   . TYR A 1 22  ? -1.856  -2.223  4.683   1.00 0.00 ? 22  TYR A HH   2  
ATOM 1899  N N    . GLN A 1 23  ? 5.955   -6.645  4.893   1.00 0.00 ? 23  GLN A N    2  
ATOM 1900  C CA   . GLN A 1 23  ? 7.215   -7.257  5.299   1.00 0.00 ? 23  GLN A CA   2  
ATOM 1901  C C    . GLN A 1 23  ? 8.234   -7.210  4.165   1.00 0.00 ? 23  GLN A C    2  
ATOM 1902  O O    . GLN A 1 23  ? 9.430   -7.045  4.400   1.00 0.00 ? 23  GLN A O    2  
ATOM 1903  C CB   . GLN A 1 23  ? 6.985   -8.705  5.735   1.00 0.00 ? 23  GLN A CB   2  
ATOM 1904  C CG   . GLN A 1 23  ? 6.681   -8.853  7.217   1.00 0.00 ? 23  GLN A CG   2  
ATOM 1905  C CD   . GLN A 1 23  ? 7.935   -8.962  8.062   1.00 0.00 ? 23  GLN A CD   2  
ATOM 1906  O OE1  . GLN A 1 23  ? 8.268   -8.050  8.819   1.00 0.00 ? 23  GLN A OE1  2  
ATOM 1907  N NE2  . GLN A 1 23  ? 8.638   -10.082 7.937   1.00 0.00 ? 23  GLN A NE2  2  
ATOM 1908  H H    . GLN A 1 23  ? 5.135   -7.179  4.916   1.00 0.00 ? 23  GLN A H    2  
ATOM 1909  H HA   . GLN A 1 23  ? 7.601   -6.696  6.137   1.00 0.00 ? 23  GLN A HA   2  
ATOM 1910  H HB2  . GLN A 1 23  ? 6.154   -9.109  5.176   1.00 0.00 ? 23  GLN A HB2  2  
ATOM 1911  H HB3  . GLN A 1 23  ? 7.872   -9.280  5.512   1.00 0.00 ? 23  GLN A HB3  2  
ATOM 1912  H HG2  . GLN A 1 23  ? 6.119   -7.991  7.544   1.00 0.00 ? 23  GLN A HG2  2  
ATOM 1913  H HG3  . GLN A 1 23  ? 6.088   -9.744  7.362   1.00 0.00 ? 23  GLN A HG3  2  
ATOM 1914  H HE21 . GLN A 1 23  ? 8.313   -10.765 7.313   1.00 0.00 ? 23  GLN A HE21 2  
ATOM 1915  H HE22 . GLN A 1 23  ? 9.453   -10.179 8.470   1.00 0.00 ? 23  GLN A HE22 2  
ATOM 1916  N N    . ALA A 1 24  ? 7.751   -7.356  2.936   1.00 0.00 ? 24  ALA A N    2  
ATOM 1917  C CA   . ALA A 1 24  ? 8.619   -7.329  1.766   1.00 0.00 ? 24  ALA A CA   2  
ATOM 1918  C C    . ALA A 1 24  ? 9.001   -5.899  1.398   1.00 0.00 ? 24  ALA A C    2  
ATOM 1919  O O    . ALA A 1 24  ? 10.148  -5.624  1.046   1.00 0.00 ? 24  ALA A O    2  
ATOM 1920  C CB   . ALA A 1 24  ? 7.941   -8.015  0.589   1.00 0.00 ? 24  ALA A CB   2  
ATOM 1921  H H    . ALA A 1 24  ? 6.787   -7.485  2.813   1.00 0.00 ? 24  ALA A H    2  
ATOM 1922  H HA   . ALA A 1 24  ? 9.517   -7.881  2.004   1.00 0.00 ? 24  ALA A HA   2  
ATOM 1923  H HB1  . ALA A 1 24  ? 8.501   -8.898  0.317   1.00 0.00 ? 24  ALA A HB1  2  
ATOM 1924  H HB2  . ALA A 1 24  ? 6.937   -8.298  0.867   1.00 0.00 ? 24  ALA A HB2  2  
ATOM 1925  H HB3  . ALA A 1 24  ? 7.906   -7.338  -0.251  1.00 0.00 ? 24  ALA A HB3  2  
ATOM 1926  N N    . TYR A 1 25  ? 8.033   -4.994  1.482   1.00 0.00 ? 25  TYR A N    2  
ATOM 1927  C CA   . TYR A 1 25  ? 8.267   -3.592  1.156   1.00 0.00 ? 25  TYR A CA   2  
ATOM 1928  C C    . TYR A 1 25  ? 9.210   -2.947  2.166   1.00 0.00 ? 25  TYR A C    2  
ATOM 1929  O O    . TYR A 1 25  ? 9.993   -2.061  1.824   1.00 0.00 ? 25  TYR A O    2  
ATOM 1930  C CB   . TYR A 1 25  ? 6.943   -2.827  1.118   1.00 0.00 ? 25  TYR A CB   2  
ATOM 1931  C CG   . TYR A 1 25  ? 7.075   -1.413  0.600   1.00 0.00 ? 25  TYR A CG   2  
ATOM 1932  C CD1  . TYR A 1 25  ? 7.800   -0.460  1.303   1.00 0.00 ? 25  TYR A CD1  2  
ATOM 1933  C CD2  . TYR A 1 25  ? 6.473   -1.030  -0.593  1.00 0.00 ? 25  TYR A CD2  2  
ATOM 1934  C CE1  . TYR A 1 25  ? 7.923   0.834   0.834   1.00 0.00 ? 25  TYR A CE1  2  
ATOM 1935  C CE2  . TYR A 1 25  ? 6.592   0.261   -1.070  1.00 0.00 ? 25  TYR A CE2  2  
ATOM 1936  C CZ   . TYR A 1 25  ? 7.318   1.189   -0.353  1.00 0.00 ? 25  TYR A CZ   2  
ATOM 1937  O OH   . TYR A 1 25  ? 7.437   2.476   -0.825  1.00 0.00 ? 25  TYR A OH   2  
ATOM 1938  H H    . TYR A 1 25  ? 7.139   -5.274  1.770   1.00 0.00 ? 25  TYR A H    2  
ATOM 1939  H HA   . TYR A 1 25  ? 8.723   -3.551  0.177   1.00 0.00 ? 25  TYR A HA   2  
ATOM 1940  H HB2  . TYR A 1 25  ? 6.250   -3.351  0.477   1.00 0.00 ? 25  TYR A HB2  2  
ATOM 1941  H HB3  . TYR A 1 25  ? 6.534   -2.778  2.117   1.00 0.00 ? 25  TYR A HB3  2  
ATOM 1942  H HD1  . TYR A 1 25  ? 8.274   -0.741  2.233   1.00 0.00 ? 25  TYR A HD1  2  
ATOM 1943  H HD2  . TYR A 1 25  ? 5.905   -1.760  -1.152  1.00 0.00 ? 25  TYR A HD2  2  
ATOM 1944  H HE1  . TYR A 1 25  ? 8.492   1.561   1.395   1.00 0.00 ? 25  TYR A HE1  2  
ATOM 1945  H HE2  . TYR A 1 25  ? 6.117   0.539   -2.000  1.00 0.00 ? 25  TYR A HE2  2  
ATOM 1946  H HH   . TYR A 1 25  ? 8.081   2.498   -1.537  1.00 0.00 ? 25  TYR A HH   2  
ATOM 1947  N N    . ASP A 1 26  ? 9.130   -3.400  3.413   1.00 0.00 ? 26  ASP A N    2  
ATOM 1948  C CA   . ASP A 1 26  ? 9.978   -2.869  4.474   1.00 0.00 ? 26  ASP A CA   2  
ATOM 1949  C C    . ASP A 1 26  ? 11.452  -3.099  4.159   1.00 0.00 ? 26  ASP A C    2  
ATOM 1950  O O    . ASP A 1 26  ? 12.309  -2.294  4.525   1.00 0.00 ? 26  ASP A O    2  
ATOM 1951  C CB   . ASP A 1 26  ? 9.622   -3.520  5.812   1.00 0.00 ? 26  ASP A CB   2  
ATOM 1952  C CG   . ASP A 1 26  ? 9.891   -2.604  6.991   1.00 0.00 ? 26  ASP A CG   2  
ATOM 1953  O OD1  . ASP A 1 26  ? 10.797  -1.751  6.884   1.00 0.00 ? 26  ASP A OD1  2  
ATOM 1954  O OD2  . ASP A 1 26  ? 9.197   -2.742  8.020   1.00 0.00 ? 26  ASP A OD2  2  
ATOM 1955  H H    . ASP A 1 26  ? 8.486   -4.108  3.624   1.00 0.00 ? 26  ASP A H    2  
ATOM 1956  H HA   . ASP A 1 26  ? 9.799   -1.807  4.542   1.00 0.00 ? 26  ASP A HA   2  
ATOM 1957  H HB2  . ASP A 1 26  ? 8.573   -3.777  5.813   1.00 0.00 ? 26  ASP A HB2  2  
ATOM 1958  H HB3  . ASP A 1 26  ? 10.209  -4.418  5.936   1.00 0.00 ? 26  ASP A HB3  2  
ATOM 1959  N N    . ARG A 1 27  ? 11.741  -4.204  3.478   1.00 0.00 ? 27  ARG A N    2  
ATOM 1960  C CA   . ARG A 1 27  ? 13.113  -4.541  3.116   1.00 0.00 ? 27  ARG A CA   2  
ATOM 1961  C C    . ARG A 1 27  ? 13.527  -3.826  1.833   1.00 0.00 ? 27  ARG A C    2  
ATOM 1962  O O    . ARG A 1 27  ? 14.600  -3.228  1.763   1.00 0.00 ? 27  ARG A O    2  
ATOM 1963  C CB   . ARG A 1 27  ? 13.259  -6.053  2.940   1.00 0.00 ? 27  ARG A CB   2  
ATOM 1964  C CG   . ARG A 1 27  ? 12.738  -6.857  4.120   1.00 0.00 ? 27  ARG A CG   2  
ATOM 1965  C CD   . ARG A 1 27  ? 13.022  -8.342  3.952   1.00 0.00 ? 27  ARG A CD   2  
ATOM 1966  N NE   . ARG A 1 27  ? 13.061  -9.040  5.234   1.00 0.00 ? 27  ARG A NE   2  
ATOM 1967  C CZ   . ARG A 1 27  ? 14.110  -9.024  6.048   1.00 0.00 ? 27  ARG A CZ   2  
ATOM 1968  N NH1  . ARG A 1 27  ? 15.201  -8.348  5.715   1.00 0.00 ? 27  ARG A NH1  2  
ATOM 1969  N NH2  . ARG A 1 27  ? 14.070  -9.684  7.198   1.00 0.00 ? 27  ARG A NH2  2  
ATOM 1970  H H    . ARG A 1 27  ? 11.015  -4.807  3.215   1.00 0.00 ? 27  ARG A H    2  
ATOM 1971  H HA   . ARG A 1 27  ? 13.758  -4.216  3.918   1.00 0.00 ? 27  ARG A HA   2  
ATOM 1972  H HB2  . ARG A 1 27  ? 12.714  -6.356  2.058   1.00 0.00 ? 27  ARG A HB2  2  
ATOM 1973  H HB3  . ARG A 1 27  ? 14.304  -6.288  2.806   1.00 0.00 ? 27  ARG A HB3  2  
ATOM 1974  H HG2  . ARG A 1 27  ? 13.221  -6.510  5.022   1.00 0.00 ? 27  ARG A HG2  2  
ATOM 1975  H HG3  . ARG A 1 27  ? 11.671  -6.710  4.201   1.00 0.00 ? 27  ARG A HG3  2  
ATOM 1976  H HD2  . ARG A 1 27  ? 12.245  -8.776  3.340   1.00 0.00 ? 27  ARG A HD2  2  
ATOM 1977  H HD3  . ARG A 1 27  ? 13.975  -8.458  3.459   1.00 0.00 ? 27  ARG A HD3  2  
ATOM 1978  H HE   . ARG A 1 27  ? 12.265  -9.546  5.500   1.00 0.00 ? 27  ARG A HE   2  
ATOM 1979  H HH11 . ARG A 1 27  ? 15.234  -7.849  4.849   1.00 0.00 ? 27  ARG A HH11 2  
ATOM 1980  H HH12 . ARG A 1 27  ? 15.990  -8.336  6.330   1.00 0.00 ? 27  ARG A HH12 2  
ATOM 1981  H HH21 . ARG A 1 27  ? 13.249  -10.195 7.452   1.00 0.00 ? 27  ARG A HH21 2  
ATOM 1982  H HH22 . ARG A 1 27  ? 14.860  -9.672  7.810   1.00 0.00 ? 27  ARG A HH22 2  
ATOM 1983  N N    . GLN A 1 28  ? 12.669  -3.895  0.820   1.00 0.00 ? 28  GLN A N    2  
ATOM 1984  C CA   . GLN A 1 28  ? 12.947  -3.255  -0.461  1.00 0.00 ? 28  GLN A CA   2  
ATOM 1985  C C    . GLN A 1 28  ? 11.768  -2.398  -0.908  1.00 0.00 ? 28  GLN A C    2  
ATOM 1986  O O    . GLN A 1 28  ? 10.611  -2.804  -0.792  1.00 0.00 ? 28  GLN A O    2  
ATOM 1987  C CB   . GLN A 1 28  ? 13.258  -4.310  -1.524  1.00 0.00 ? 28  GLN A CB   2  
ATOM 1988  C CG   . GLN A 1 28  ? 13.519  -3.725  -2.903  1.00 0.00 ? 28  GLN A CG   2  
ATOM 1989  C CD   . GLN A 1 28  ? 14.889  -3.085  -3.016  1.00 0.00 ? 28  GLN A CD   2  
ATOM 1990  O OE1  . GLN A 1 28  ? 15.370  -2.451  -2.076  1.00 0.00 ? 28  GLN A OE1  2  
ATOM 1991  N NE2  . GLN A 1 28  ? 15.525  -3.248  -4.170  1.00 0.00 ? 28  GLN A NE2  2  
ATOM 1992  H H    . GLN A 1 28  ? 11.830  -4.387  0.937   1.00 0.00 ? 28  GLN A H    2  
ATOM 1993  H HA   . GLN A 1 28  ? 13.810  -2.620  -0.333  1.00 0.00 ? 28  GLN A HA   2  
ATOM 1994  H HB2  . GLN A 1 28  ? 14.134  -4.863  -1.220  1.00 0.00 ? 28  GLN A HB2  2  
ATOM 1995  H HB3  . GLN A 1 28  ? 12.421  -4.988  -1.598  1.00 0.00 ? 28  GLN A HB3  2  
ATOM 1996  H HG2  . GLN A 1 28  ? 13.448  -4.516  -3.635  1.00 0.00 ? 28  GLN A HG2  2  
ATOM 1997  H HG3  . GLN A 1 28  ? 12.770  -2.976  -3.109  1.00 0.00 ? 28  GLN A HG3  2  
ATOM 1998  H HE21 . GLN A 1 28  ? 15.080  -3.764  -4.875  1.00 0.00 ? 28  GLN A HE21 2  
ATOM 1999  H HE22 . GLN A 1 28  ? 16.412  -2.844  -4.270  1.00 0.00 ? 28  GLN A HE22 2  
ATOM 2000  N N    . LYS A 1 29  ? 12.068  -1.209  -1.421  1.00 0.00 ? 29  LYS A N    2  
ATOM 2001  C CA   . LYS A 1 29  ? 11.034  -0.293  -1.888  1.00 0.00 ? 29  LYS A CA   2  
ATOM 2002  C C    . LYS A 1 29  ? 10.609  -0.633  -3.313  1.00 0.00 ? 29  LYS A C    2  
ATOM 2003  O O    . LYS A 1 29  ? 9.435   -0.521  -3.664  1.00 0.00 ? 29  LYS A O    2  
ATOM 2004  C CB   . LYS A 1 29  ? 11.536  1.151   -1.824  1.00 0.00 ? 29  LYS A CB   2  
ATOM 2005  C CG   . LYS A 1 29  ? 12.185  1.511   -0.499  1.00 0.00 ? 29  LYS A CG   2  
ATOM 2006  C CD   . LYS A 1 29  ? 11.162  2.023   0.502   1.00 0.00 ? 29  LYS A CD   2  
ATOM 2007  C CE   . LYS A 1 29  ? 11.683  1.929   1.928   1.00 0.00 ? 29  LYS A CE   2  
ATOM 2008  N NZ   . LYS A 1 29  ? 10.722  2.507   2.908   1.00 0.00 ? 29  LYS A NZ   2  
ATOM 2009  H H    . LYS A 1 29  ? 13.009  -0.942  -1.488  1.00 0.00 ? 29  LYS A H    2  
ATOM 2010  H HA   . LYS A 1 29  ? 10.179  -0.398  -1.236  1.00 0.00 ? 29  LYS A HA   2  
ATOM 2011  H HB2  . LYS A 1 29  ? 12.262  1.302   -2.609  1.00 0.00 ? 29  LYS A HB2  2  
ATOM 2012  H HB3  . LYS A 1 29  ? 10.700  1.817   -1.984  1.00 0.00 ? 29  LYS A HB3  2  
ATOM 2013  H HG2  . LYS A 1 29  ? 12.662  0.632   -0.091  1.00 0.00 ? 29  LYS A HG2  2  
ATOM 2014  H HG3  . LYS A 1 29  ? 12.925  2.280   -0.668  1.00 0.00 ? 29  LYS A HG3  2  
ATOM 2015  H HD2  . LYS A 1 29  ? 10.939  3.056   0.280   1.00 0.00 ? 29  LYS A HD2  2  
ATOM 2016  H HD3  . LYS A 1 29  ? 10.261  1.432   0.417   1.00 0.00 ? 29  LYS A HD3  2  
ATOM 2017  H HE2  . LYS A 1 29  ? 11.849  0.891   2.169   1.00 0.00 ? 29  LYS A HE2  2  
ATOM 2018  H HE3  . LYS A 1 29  ? 12.617  2.468   1.992   1.00 0.00 ? 29  LYS A HE3  2  
ATOM 2019  H HZ1  . LYS A 1 29  ? 10.871  2.083   3.847   1.00 0.00 ? 29  LYS A HZ1  2  
ATOM 2020  H HZ2  . LYS A 1 29  ? 9.745   2.315   2.606   1.00 0.00 ? 29  LYS A HZ2  2  
ATOM 2021  H HZ3  . LYS A 1 29  ? 10.857  3.535   2.978   1.00 0.00 ? 29  LYS A HZ3  2  
ATOM 2022  N N    . ASN A 1 30  ? 11.572  -1.048  -4.129  1.00 0.00 ? 30  ASN A N    2  
ATOM 2023  C CA   . ASN A 1 30  ? 11.297  -1.404  -5.516  1.00 0.00 ? 30  ASN A CA   2  
ATOM 2024  C C    . ASN A 1 30  ? 11.580  -2.883  -5.765  1.00 0.00 ? 30  ASN A C    2  
ATOM 2025  O O    . ASN A 1 30  ? 12.665  -3.268  -6.200  1.00 0.00 ? 30  ASN A O    2  
ATOM 2026  C CB   . ASN A 1 30  ? 12.140  -0.547  -6.462  1.00 0.00 ? 30  ASN A CB   2  
ATOM 2027  C CG   . ASN A 1 30  ? 12.021  0.935   -6.160  1.00 0.00 ? 30  ASN A CG   2  
ATOM 2028  O OD1  . ASN A 1 30  ? 11.008  1.562   -6.466  1.00 0.00 ? 30  ASN A OD1  2  
ATOM 2029  N ND2  . ASN A 1 30  ? 13.060  1.500   -5.556  1.00 0.00 ? 30  ASN A ND2  2  
ATOM 2030  H H    . ASN A 1 30  ? 12.489  -1.116  -3.791  1.00 0.00 ? 30  ASN A H    2  
ATOM 2031  H HA   . ASN A 1 30  ? 10.252  -1.213  -5.707  1.00 0.00 ? 30  ASN A HA   2  
ATOM 2032  H HB2  . ASN A 1 30  ? 13.178  -0.831  -6.367  1.00 0.00 ? 30  ASN A HB2  2  
ATOM 2033  H HB3  . ASN A 1 30  ? 11.816  -0.716  -7.478  1.00 0.00 ? 30  ASN A HB3  2  
ATOM 2034  H HD21 . ASN A 1 30  ? 13.834  0.938   -5.342  1.00 0.00 ? 30  ASN A HD21 2  
ATOM 2035  H HD22 . ASN A 1 30  ? 13.010  2.457   -5.348  1.00 0.00 ? 30  ASN A HD22 2  
ATOM 2036  N N    . PRO A 1 31  ? 10.581  -3.732  -5.482  1.00 0.00 ? 31  PRO A N    2  
ATOM 2037  C CA   . PRO A 1 31  ? 10.698  -5.182  -5.667  1.00 0.00 ? 31  PRO A CA   2  
ATOM 2038  C C    . PRO A 1 31  ? 10.746  -5.575  -7.139  1.00 0.00 ? 31  PRO A C    2  
ATOM 2039  O O    . PRO A 1 31  ? 9.915   -5.140  -7.936  1.00 0.00 ? 31  PRO A O    2  
ATOM 2040  C CB   . PRO A 1 31  ? 9.427   -5.727  -5.010  1.00 0.00 ? 31  PRO A CB   2  
ATOM 2041  C CG   . PRO A 1 31  ? 8.451   -4.604  -5.083  1.00 0.00 ? 31  PRO A CG   2  
ATOM 2042  C CD   . PRO A 1 31  ? 9.260   -3.343  -4.959  1.00 0.00 ? 31  PRO A CD   2  
ATOM 2043  H HA   . PRO A 1 31  ? 11.566  -5.578  -5.161  1.00 0.00 ? 31  PRO A HA   2  
ATOM 2044  H HB2  . PRO A 1 31  ? 9.078   -6.591  -5.557  1.00 0.00 ? 31  PRO A HB2  2  
ATOM 2045  H HB3  . PRO A 1 31  ? 9.636   -6.002  -3.987  1.00 0.00 ? 31  PRO A HB3  2  
ATOM 2046  H HG2  . PRO A 1 31  ? 7.935   -4.627  -6.031  1.00 0.00 ? 31  PRO A HG2  2  
ATOM 2047  H HG3  . PRO A 1 31  ? 7.746   -4.677  -4.268  1.00 0.00 ? 31  PRO A HG3  2  
ATOM 2048  H HD2  . PRO A 1 31  ? 8.826   -2.555  -5.557  1.00 0.00 ? 31  PRO A HD2  2  
ATOM 2049  H HD3  . PRO A 1 31  ? 9.330   -3.039  -3.925  1.00 0.00 ? 31  PRO A HD3  2  
ATOM 2050  N N    . SER A 1 32  ? 11.725  -6.402  -7.494  1.00 0.00 ? 32  SER A N    2  
ATOM 2051  C CA   . SER A 1 32  ? 11.884  -6.852  -8.872  1.00 0.00 ? 32  SER A CA   2  
ATOM 2052  C C    . SER A 1 32  ? 11.211  -8.205  -9.083  1.00 0.00 ? 32  SER A C    2  
ATOM 2053  O O    . SER A 1 32  ? 10.664  -8.792  -8.149  1.00 0.00 ? 32  SER A O    2  
ATOM 2054  C CB   . SER A 1 32  ? 13.368  -6.946  -9.232  1.00 0.00 ? 32  SER A CB   2  
ATOM 2055  O OG   . SER A 1 32  ? 13.853  -5.708  -9.722  1.00 0.00 ? 32  SER A OG   2  
ATOM 2056  H H    . SER A 1 32  ? 12.357  -6.715  -6.813  1.00 0.00 ? 32  SER A H    2  
ATOM 2057  H HA   . SER A 1 32  ? 11.411  -6.125  -9.515  1.00 0.00 ? 32  SER A HA   2  
ATOM 2058  H HB2  . SER A 1 32  ? 13.933  -7.217  -8.354  1.00 0.00 ? 32  SER A HB2  2  
ATOM 2059  H HB3  . SER A 1 32  ? 13.503  -7.699  -9.995  1.00 0.00 ? 32  SER A HB3  2  
ATOM 2060  H HG   . SER A 1 32  ? 13.318  -4.992  -9.371  1.00 0.00 ? 32  SER A HG   2  
ATOM 2061  N N    . LYS A 1 33  ? 11.256  -8.696  -10.317 1.00 0.00 ? 33  LYS A N    2  
ATOM 2062  C CA   . LYS A 1 33  ? 10.653  -9.980  -10.653 1.00 0.00 ? 33  LYS A CA   2  
ATOM 2063  C C    . LYS A 1 33  ? 10.792  -10.965 -9.496  1.00 0.00 ? 33  LYS A C    2  
ATOM 2064  O O    . LYS A 1 33  ? 9.814   -11.583 -9.077  1.00 0.00 ? 33  LYS A O    2  
ATOM 2065  C CB   . LYS A 1 33  ? 11.305  -10.559 -11.911 1.00 0.00 ? 33  LYS A CB   2  
ATOM 2066  C CG   . LYS A 1 33  ? 10.691  -11.872 -12.365 1.00 0.00 ? 33  LYS A CG   2  
ATOM 2067  C CD   . LYS A 1 33  ? 11.250  -13.049 -11.584 1.00 0.00 ? 33  LYS A CD   2  
ATOM 2068  C CE   . LYS A 1 33  ? 10.931  -14.371 -12.265 1.00 0.00 ? 33  LYS A CE   2  
ATOM 2069  N NZ   . LYS A 1 33  ? 11.991  -14.766 -13.234 1.00 0.00 ? 33  LYS A NZ   2  
ATOM 2070  H H    . LYS A 1 33  ? 11.707  -8.181  -11.019 1.00 0.00 ? 33  LYS A H    2  
ATOM 2071  H HA   . LYS A 1 33  ? 9.604   -9.814  -10.845 1.00 0.00 ? 33  LYS A HA   2  
ATOM 2072  H HB2  . LYS A 1 33  ? 11.208  -9.843  -12.714 1.00 0.00 ? 33  LYS A HB2  2  
ATOM 2073  H HB3  . LYS A 1 33  ? 12.354  -10.726 -11.713 1.00 0.00 ? 33  LYS A HB3  2  
ATOM 2074  H HG2  . LYS A 1 33  ? 9.622   -11.830 -12.215 1.00 0.00 ? 33  LYS A HG2  2  
ATOM 2075  H HG3  . LYS A 1 33  ? 10.903  -12.014 -13.415 1.00 0.00 ? 33  LYS A HG3  2  
ATOM 2076  H HD2  . LYS A 1 33  ? 12.323  -12.944 -11.511 1.00 0.00 ? 33  LYS A HD2  2  
ATOM 2077  H HD3  . LYS A 1 33  ? 10.819  -13.051 -10.593 1.00 0.00 ? 33  LYS A HD3  2  
ATOM 2078  H HE2  . LYS A 1 33  ? 10.842  -15.137 -11.510 1.00 0.00 ? 33  LYS A HE2  2  
ATOM 2079  H HE3  . LYS A 1 33  ? 9.993   -14.273 -12.790 1.00 0.00 ? 33  LYS A HE3  2  
ATOM 2080  H HZ1  . LYS A 1 33  ? 12.840  -15.083 -12.724 1.00 0.00 ? 33  LYS A HZ1  2  
ATOM 2081  H HZ2  . LYS A 1 33  ? 12.244  -13.957 -13.836 1.00 0.00 ? 33  LYS A HZ2  2  
ATOM 2082  H HZ3  . LYS A 1 33  ? 11.652  -15.542 -13.838 1.00 0.00 ? 33  LYS A HZ3  2  
ATOM 2083  N N    . GLU A 1 34  ? 12.011  -11.104 -8.986  1.00 0.00 ? 34  GLU A N    2  
ATOM 2084  C CA   . GLU A 1 34  ? 12.275  -12.014 -7.877  1.00 0.00 ? 34  GLU A CA   2  
ATOM 2085  C C    . GLU A 1 34  ? 11.484  -11.606 -6.638  1.00 0.00 ? 34  GLU A C    2  
ATOM 2086  O O    . GLU A 1 34  ? 10.613  -12.342 -6.176  1.00 0.00 ? 34  GLU A O    2  
ATOM 2087  C CB   . GLU A 1 34  ? 13.771  -12.040 -7.555  1.00 0.00 ? 34  GLU A CB   2  
ATOM 2088  C CG   . GLU A 1 34  ? 14.626  -12.599 -8.680  1.00 0.00 ? 34  GLU A CG   2  
ATOM 2089  C CD   . GLU A 1 34  ? 15.905  -13.241 -8.177  1.00 0.00 ? 34  GLU A CD   2  
ATOM 2090  O OE1  . GLU A 1 34  ? 15.827  -14.343 -7.595  1.00 0.00 ? 34  GLU A OE1  2  
ATOM 2091  O OE2  . GLU A 1 34  ? 16.983  -12.640 -8.366  1.00 0.00 ? 34  GLU A OE2  2  
ATOM 2092  H H    . GLU A 1 34  ? 12.750  -10.584 -9.364  1.00 0.00 ? 34  GLU A H    2  
ATOM 2093  H HA   . GLU A 1 34  ? 11.964  -13.003 -8.179  1.00 0.00 ? 34  GLU A HA   2  
ATOM 2094  H HB2  . GLU A 1 34  ? 14.100  -11.033 -7.347  1.00 0.00 ? 34  GLU A HB2  2  
ATOM 2095  H HB3  . GLU A 1 34  ? 13.926  -12.649 -6.677  1.00 0.00 ? 34  GLU A HB3  2  
ATOM 2096  H HG2  . GLU A 1 34  ? 14.054  -13.343 -9.214  1.00 0.00 ? 34  GLU A HG2  2  
ATOM 2097  H HG3  . GLU A 1 34  ? 14.884  -11.794 -9.352  1.00 0.00 ? 34  GLU A HG3  2  
ATOM 2098  N N    . GLU A 1 35  ? 11.795  -10.428 -6.106  1.00 0.00 ? 35  GLU A N    2  
ATOM 2099  C CA   . GLU A 1 35  ? 11.114  -9.923  -4.920  1.00 0.00 ? 35  GLU A CA   2  
ATOM 2100  C C    . GLU A 1 35  ? 9.600   -10.038 -5.071  1.00 0.00 ? 35  GLU A C    2  
ATOM 2101  O O    . GLU A 1 35  ? 8.950   -10.804 -4.360  1.00 0.00 ? 35  GLU A O    2  
ATOM 2102  C CB   . GLU A 1 35  ? 11.502  -8.465  -4.663  1.00 0.00 ? 35  GLU A CB   2  
ATOM 2103  C CG   . GLU A 1 35  ? 12.979  -8.273  -4.361  1.00 0.00 ? 35  GLU A CG   2  
ATOM 2104  C CD   . GLU A 1 35  ? 13.340  -8.669  -2.942  1.00 0.00 ? 35  GLU A CD   2  
ATOM 2105  O OE1  . GLU A 1 35  ? 13.170  -7.831  -2.032  1.00 0.00 ? 35  GLU A OE1  2  
ATOM 2106  O OE2  . GLU A 1 35  ? 13.792  -9.816  -2.743  1.00 0.00 ? 35  GLU A OE2  2  
ATOM 2107  H H    . GLU A 1 35  ? 12.498  -9.887  -6.521  1.00 0.00 ? 35  GLU A H    2  
ATOM 2108  H HA   . GLU A 1 35  ? 11.426  -10.522 -4.078  1.00 0.00 ? 35  GLU A HA   2  
ATOM 2109  H HB2  . GLU A 1 35  ? 11.256  -7.880  -5.537  1.00 0.00 ? 35  GLU A HB2  2  
ATOM 2110  H HB3  . GLU A 1 35  ? 10.933  -8.096  -3.823  1.00 0.00 ? 35  GLU A HB3  2  
ATOM 2111  H HG2  . GLU A 1 35  ? 13.555  -8.878  -5.045  1.00 0.00 ? 35  GLU A HG2  2  
ATOM 2112  H HG3  . GLU A 1 35  ? 13.230  -7.232  -4.503  1.00 0.00 ? 35  GLU A HG3  2  
ATOM 2113  N N    . ARG A 1 36  ? 9.044   -9.270  -6.003  1.00 0.00 ? 36  ARG A N    2  
ATOM 2114  C CA   . ARG A 1 36  ? 7.607   -9.283  -6.247  1.00 0.00 ? 36  ARG A CA   2  
ATOM 2115  C C    . ARG A 1 36  ? 7.077   -10.714 -6.293  1.00 0.00 ? 36  ARG A C    2  
ATOM 2116  O O    . ARG A 1 36  ? 6.091   -11.041 -5.633  1.00 0.00 ? 36  ARG A O    2  
ATOM 2117  C CB   . ARG A 1 36  ? 7.284   -8.567  -7.559  1.00 0.00 ? 36  ARG A CB   2  
ATOM 2118  C CG   . ARG A 1 36  ? 7.110   -7.064  -7.406  1.00 0.00 ? 36  ARG A CG   2  
ATOM 2119  C CD   . ARG A 1 36  ? 6.170   -6.502  -8.460  1.00 0.00 ? 36  ARG A CD   2  
ATOM 2120  N NE   . ARG A 1 36  ? 6.877   -6.134  -9.684  1.00 0.00 ? 36  ARG A NE   2  
ATOM 2121  C CZ   . ARG A 1 36  ? 7.510   -4.978  -9.848  1.00 0.00 ? 36  ARG A CZ   2  
ATOM 2122  N NH1  . ARG A 1 36  ? 7.524   -4.082  -8.872  1.00 0.00 ? 36  ARG A NH1  2  
ATOM 2123  N NH2  . ARG A 1 36  ? 8.131   -4.716  -10.992 1.00 0.00 ? 36  ARG A NH2  2  
ATOM 2124  H H    . ARG A 1 36  ? 9.614   -8.679  -6.539  1.00 0.00 ? 36  ARG A H    2  
ATOM 2125  H HA   . ARG A 1 36  ? 7.127   -8.760  -5.434  1.00 0.00 ? 36  ARG A HA   2  
ATOM 2126  H HB2  . ARG A 1 36  ? 8.087   -8.744  -8.260  1.00 0.00 ? 36  ARG A HB2  2  
ATOM 2127  H HB3  . ARG A 1 36  ? 6.369   -8.974  -7.962  1.00 0.00 ? 36  ARG A HB3  2  
ATOM 2128  H HG2  . ARG A 1 36  ? 6.702   -6.856  -6.428  1.00 0.00 ? 36  ARG A HG2  2  
ATOM 2129  H HG3  . ARG A 1 36  ? 8.075   -6.588  -7.505  1.00 0.00 ? 36  ARG A HG3  2  
ATOM 2130  H HD2  . ARG A 1 36  ? 5.427   -7.249  -8.696  1.00 0.00 ? 36  ARG A HD2  2  
ATOM 2131  H HD3  . ARG A 1 36  ? 5.684   -5.625  -8.059  1.00 0.00 ? 36  ARG A HD3  2  
ATOM 2132  H HE   . ARG A 1 36  ? 6.879   -6.782  -10.419 1.00 0.00 ? 36  ARG A HE   2  
ATOM 2133  H HH11 . ARG A 1 36  ? 7.058   -4.277  -8.009  1.00 0.00 ? 36  ARG A HH11 2  
ATOM 2134  H HH12 . ARG A 1 36  ? 8.003   -3.212  -8.997  1.00 0.00 ? 36  ARG A HH12 2  
ATOM 2135  H HH21 . ARG A 1 36  ? 8.122   -5.390  -11.730 1.00 0.00 ? 36  ARG A HH21 2  
ATOM 2136  H HH22 . ARG A 1 36  ? 8.606   -3.846  -11.114 1.00 0.00 ? 36  ARG A HH22 2  
ATOM 2137  N N    . GLU A 1 37  ? 7.739   -11.560 -7.075  1.00 0.00 ? 37  GLU A N    2  
ATOM 2138  C CA   . GLU A 1 37  ? 7.332   -12.954 -7.207  1.00 0.00 ? 37  GLU A CA   2  
ATOM 2139  C C    . GLU A 1 37  ? 7.178   -13.608 -5.837  1.00 0.00 ? 37  GLU A C    2  
ATOM 2140  O O    . GLU A 1 37  ? 6.173   -14.262 -5.560  1.00 0.00 ? 37  GLU A O    2  
ATOM 2141  C CB   . GLU A 1 37  ? 8.354   -13.729 -8.042  1.00 0.00 ? 37  GLU A CB   2  
ATOM 2142  C CG   . GLU A 1 37  ? 8.107   -13.645 -9.539  1.00 0.00 ? 37  GLU A CG   2  
ATOM 2143  C CD   . GLU A 1 37  ? 7.111   -14.679 -10.025 1.00 0.00 ? 37  GLU A CD   2  
ATOM 2144  O OE1  . GLU A 1 37  ? 7.491   -15.865 -10.129 1.00 0.00 ? 37  GLU A OE1  2  
ATOM 2145  O OE2  . GLU A 1 37  ? 5.952   -14.305 -10.303 1.00 0.00 ? 37  GLU A OE2  2  
ATOM 2146  H H    . GLU A 1 37  ? 8.517   -11.239 -7.576  1.00 0.00 ? 37  GLU A H    2  
ATOM 2147  H HA   . GLU A 1 37  ? 6.378   -12.976 -7.712  1.00 0.00 ? 37  GLU A HA   2  
ATOM 2148  H HB2  . GLU A 1 37  ? 9.339   -13.338 -7.838  1.00 0.00 ? 37  GLU A HB2  2  
ATOM 2149  H HB3  . GLU A 1 37  ? 8.323   -14.769 -7.752  1.00 0.00 ? 37  GLU A HB3  2  
ATOM 2150  H HG2  . GLU A 1 37  ? 7.725   -12.662 -9.773  1.00 0.00 ? 37  GLU A HG2  2  
ATOM 2151  H HG3  . GLU A 1 37  ? 9.043   -13.797 -10.055 1.00 0.00 ? 37  GLU A HG3  2  
ATOM 2152  N N    . ALA A 1 38  ? 8.181   -13.426 -4.985  1.00 0.00 ? 38  ALA A N    2  
ATOM 2153  C CA   . ALA A 1 38  ? 8.157   -13.996 -3.644  1.00 0.00 ? 38  ALA A CA   2  
ATOM 2154  C C    . ALA A 1 38  ? 6.866   -13.635 -2.917  1.00 0.00 ? 38  ALA A C    2  
ATOM 2155  O O    . ALA A 1 38  ? 6.480   -14.294 -1.950  1.00 0.00 ? 38  ALA A O    2  
ATOM 2156  C CB   . ALA A 1 38  ? 9.364   -13.522 -2.847  1.00 0.00 ? 38  ALA A CB   2  
ATOM 2157  H H    . ALA A 1 38  ? 8.955   -12.894 -5.265  1.00 0.00 ? 38  ALA A H    2  
ATOM 2158  H HA   . ALA A 1 38  ? 8.217   -15.071 -3.737  1.00 0.00 ? 38  ALA A HA   2  
ATOM 2159  H HB1  . ALA A 1 38  ? 9.665   -12.546 -3.197  1.00 0.00 ? 38  ALA A HB1  2  
ATOM 2160  H HB2  . ALA A 1 38  ? 9.105   -13.466 -1.801  1.00 0.00 ? 38  ALA A HB2  2  
ATOM 2161  H HB3  . ALA A 1 38  ? 10.178  -14.219 -2.980  1.00 0.00 ? 38  ALA A HB3  2  
ATOM 2162  N N    . LEU A 1 39  ? 6.203   -12.584 -3.386  1.00 0.00 ? 39  LEU A N    2  
ATOM 2163  C CA   . LEU A 1 39  ? 4.954   -12.134 -2.780  1.00 0.00 ? 39  LEU A CA   2  
ATOM 2164  C C    . LEU A 1 39  ? 3.752   -12.741 -3.496  1.00 0.00 ? 39  LEU A C    2  
ATOM 2165  O O    . LEU A 1 39  ? 2.689   -12.924 -2.901  1.00 0.00 ? 39  LEU A O    2  
ATOM 2166  C CB   . LEU A 1 39  ? 4.867   -10.608 -2.817  1.00 0.00 ? 39  LEU A CB   2  
ATOM 2167  C CG   . LEU A 1 39  ? 6.166   -9.854  -2.526  1.00 0.00 ? 39  LEU A CG   2  
ATOM 2168  C CD1  . LEU A 1 39  ? 5.913   -8.356  -2.472  1.00 0.00 ? 39  LEU A CD1  2  
ATOM 2169  C CD2  . LEU A 1 39  ? 6.784   -10.340 -1.223  1.00 0.00 ? 39  LEU A CD2  2  
ATOM 2170  H H    . LEU A 1 39  ? 6.560   -12.099 -4.158  1.00 0.00 ? 39  LEU A H    2  
ATOM 2171  H HA   . LEU A 1 39  ? 4.949   -12.462 -1.751  1.00 0.00 ? 39  LEU A HA   2  
ATOM 2172  H HB2  . LEU A 1 39  ? 4.532   -10.320 -3.801  1.00 0.00 ? 39  LEU A HB2  2  
ATOM 2173  H HB3  . LEU A 1 39  ? 4.134   -10.301 -2.084  1.00 0.00 ? 39  LEU A HB3  2  
ATOM 2174  H HG   . LEU A 1 39  ? 6.871   -10.044 -3.323  1.00 0.00 ? 39  LEU A HG   2  
ATOM 2175  H HD11 . LEU A 1 39  ? 6.533   -7.913  -1.707  1.00 0.00 ? 39  LEU A HD11 2  
ATOM 2176  H HD12 . LEU A 1 39  ? 4.873   -8.174  -2.243  1.00 0.00 ? 39  LEU A HD12 2  
ATOM 2177  H HD13 . LEU A 1 39  ? 6.152   -7.916  -3.429  1.00 0.00 ? 39  LEU A HD13 2  
ATOM 2178  H HD21 . LEU A 1 39  ? 7.858   -10.240 -1.276  1.00 0.00 ? 39  LEU A HD21 2  
ATOM 2179  H HD22 . LEU A 1 39  ? 6.527   -11.378 -1.068  1.00 0.00 ? 39  LEU A HD22 2  
ATOM 2180  H HD23 . LEU A 1 39  ? 6.406   -9.748  -0.403  1.00 0.00 ? 39  LEU A HD23 2  
ATOM 2181  N N    . VAL A 1 40  ? 3.927   -13.053 -4.776  1.00 0.00 ? 40  VAL A N    2  
ATOM 2182  C CA   . VAL A 1 40  ? 2.858   -13.643 -5.573  1.00 0.00 ? 40  VAL A CA   2  
ATOM 2183  C C    . VAL A 1 40  ? 2.541   -15.059 -5.105  1.00 0.00 ? 40  VAL A C    2  
ATOM 2184  O O    . VAL A 1 40  ? 1.379   -15.462 -5.059  1.00 0.00 ? 40  VAL A O    2  
ATOM 2185  C CB   . VAL A 1 40  ? 3.226   -13.679 -7.068  1.00 0.00 ? 40  VAL A CB   2  
ATOM 2186  C CG1  . VAL A 1 40  ? 2.236   -14.535 -7.841  1.00 0.00 ? 40  VAL A CG1  2  
ATOM 2187  C CG2  . VAL A 1 40  ? 3.282   -12.269 -7.636  1.00 0.00 ? 40  VAL A CG2  2  
ATOM 2188  H H    . VAL A 1 40  ? 4.797   -12.884 -5.194  1.00 0.00 ? 40  VAL A H    2  
ATOM 2189  H HA   . VAL A 1 40  ? 1.977   -13.029 -5.455  1.00 0.00 ? 40  VAL A HA   2  
ATOM 2190  H HB   . VAL A 1 40  ? 4.206   -14.123 -7.166  1.00 0.00 ? 40  VAL A HB   2  
ATOM 2191  H HG11 . VAL A 1 40  ? 1.229   -14.275 -7.548  1.00 0.00 ? 40  VAL A HG11 2  
ATOM 2192  H HG12 . VAL A 1 40  ? 2.359   -14.362 -8.900  1.00 0.00 ? 40  VAL A HG12 2  
ATOM 2193  H HG13 . VAL A 1 40  ? 2.415   -15.578 -7.624  1.00 0.00 ? 40  VAL A HG13 2  
ATOM 2194  H HG21 . VAL A 1 40  ? 2.281   -11.929 -7.854  1.00 0.00 ? 40  VAL A HG21 2  
ATOM 2195  H HG22 . VAL A 1 40  ? 3.738   -11.607 -6.914  1.00 0.00 ? 40  VAL A HG22 2  
ATOM 2196  H HG23 . VAL A 1 40  ? 3.868   -12.269 -8.543  1.00 0.00 ? 40  VAL A HG23 2  
ATOM 2197  N N    . GLU A 1 41  ? 3.582   -15.809 -4.758  1.00 0.00 ? 41  GLU A N    2  
ATOM 2198  C CA   . GLU A 1 41  ? 3.413   -17.181 -4.293  1.00 0.00 ? 41  GLU A CA   2  
ATOM 2199  C C    . GLU A 1 41  ? 3.117   -17.216 -2.796  1.00 0.00 ? 41  GLU A C    2  
ATOM 2200  O O    . GLU A 1 41  ? 2.244   -17.955 -2.344  1.00 0.00 ? 41  GLU A O    2  
ATOM 2201  C CB   . GLU A 1 41  ? 4.668   -18.003 -4.595  1.00 0.00 ? 41  GLU A CB   2  
ATOM 2202  C CG   . GLU A 1 41  ? 5.926   -17.457 -3.941  1.00 0.00 ? 41  GLU A CG   2  
ATOM 2203  C CD   . GLU A 1 41  ? 7.162   -18.263 -4.291  1.00 0.00 ? 41  GLU A CD   2  
ATOM 2204  O OE1  . GLU A 1 41  ? 7.549   -18.271 -5.478  1.00 0.00 ? 41  GLU A OE1  2  
ATOM 2205  O OE2  . GLU A 1 41  ? 7.742   -18.885 -3.377  1.00 0.00 ? 41  GLU A OE2  2  
ATOM 2206  H H    . GLU A 1 41  ? 4.484   -15.431 -4.816  1.00 0.00 ? 41  GLU A H    2  
ATOM 2207  H HA   . GLU A 1 41  ? 2.576   -17.610 -4.823  1.00 0.00 ? 41  GLU A HA   2  
ATOM 2208  H HB2  . GLU A 1 41  ? 4.514   -19.014 -4.246  1.00 0.00 ? 41  GLU A HB2  2  
ATOM 2209  H HB3  . GLU A 1 41  ? 4.822   -18.021 -5.664  1.00 0.00 ? 41  GLU A HB3  2  
ATOM 2210  H HG2  . GLU A 1 41  ? 6.074   -16.439 -4.268  1.00 0.00 ? 41  GLU A HG2  2  
ATOM 2211  H HG3  . GLU A 1 41  ? 5.795   -17.474 -2.869  1.00 0.00 ? 41  GLU A HG3  2  
ATOM 2212  N N    . GLU A 1 42  ? 3.853   -16.412 -2.035  1.00 0.00 ? 42  GLU A N    2  
ATOM 2213  C CA   . GLU A 1 42  ? 3.670   -16.352 -0.589  1.00 0.00 ? 42  GLU A CA   2  
ATOM 2214  C C    . GLU A 1 42  ? 2.237   -15.961 -0.238  1.00 0.00 ? 42  GLU A C    2  
ATOM 2215  O O    . GLU A 1 42  ? 1.614   -16.565 0.636   1.00 0.00 ? 42  GLU A O    2  
ATOM 2216  C CB   . GLU A 1 42  ? 4.650   -15.354 0.030   1.00 0.00 ? 42  GLU A CB   2  
ATOM 2217  C CG   . GLU A 1 42  ? 4.638   -15.352 1.550   1.00 0.00 ? 42  GLU A CG   2  
ATOM 2218  C CD   . GLU A 1 42  ? 5.328   -16.566 2.140   1.00 0.00 ? 42  GLU A CD   2  
ATOM 2219  O OE1  . GLU A 1 42  ? 5.114   -17.682 1.622   1.00 0.00 ? 42  GLU A OE1  2  
ATOM 2220  O OE2  . GLU A 1 42  ? 6.083   -16.400 3.121   1.00 0.00 ? 42  GLU A OE2  2  
ATOM 2221  H H    . GLU A 1 42  ? 4.534   -15.847 -2.454  1.00 0.00 ? 42  GLU A H    2  
ATOM 2222  H HA   . GLU A 1 42  ? 3.870   -17.335 -0.189  1.00 0.00 ? 42  GLU A HA   2  
ATOM 2223  H HB2  . GLU A 1 42  ? 5.649   -15.595 -0.301  1.00 0.00 ? 42  GLU A HB2  2  
ATOM 2224  H HB3  . GLU A 1 42  ? 4.397   -14.361 -0.312  1.00 0.00 ? 42  GLU A HB3  2  
ATOM 2225  H HG2  . GLU A 1 42  ? 5.143   -14.464 1.900   1.00 0.00 ? 42  GLU A HG2  2  
ATOM 2226  H HG3  . GLU A 1 42  ? 3.612   -15.339 1.889   1.00 0.00 ? 42  GLU A HG3  2  
ATOM 2227  N N    . CYS A 1 43  ? 1.722   -14.947 -0.924  1.00 0.00 ? 43  CYS A N    2  
ATOM 2228  C CA   . CYS A 1 43  ? 0.364   -14.473 -0.684  1.00 0.00 ? 43  CYS A CA   2  
ATOM 2229  C C    . CYS A 1 43  ? -0.656  -15.561 -1.005  1.00 0.00 ? 43  CYS A C    2  
ATOM 2230  O O    . CYS A 1 43  ? -1.311  -16.095 -0.112  1.00 0.00 ? 43  CYS A O    2  
ATOM 2231  C CB   . CYS A 1 43  ? 0.080   -13.227 -1.523  1.00 0.00 ? 43  CYS A CB   2  
ATOM 2232  S SG   . CYS A 1 43  ? 0.817   -11.711 -0.867  1.00 0.00 ? 43  CYS A SG   2  
ATOM 2233  H H    . CYS A 1 43  ? 2.268   -14.506 -1.608  1.00 0.00 ? 43  CYS A H    2  
ATOM 2234  H HA   . CYS A 1 43  ? 0.282   -14.219 0.362   1.00 0.00 ? 43  CYS A HA   2  
ATOM 2235  H HB2  . CYS A 1 43  ? 0.471   -13.376 -2.519  1.00 0.00 ? 43  CYS A HB2  2  
ATOM 2236  H HB3  . CYS A 1 43  ? -0.988  -13.077 -1.582  1.00 0.00 ? 43  CYS A HB3  2  
ATOM 2237  H HG   . CYS A 1 43  ? 1.969   -11.514 -1.489  1.00 0.00 ? 43  CYS A HG   2  
ATOM 2238  N N    . ASN A 1 44  ? -0.786  -15.882 -2.289  1.00 0.00 ? 44  ASN A N    2  
ATOM 2239  C CA   . ASN A 1 44  ? -1.728  -16.904 -2.729  1.00 0.00 ? 44  ASN A CA   2  
ATOM 2240  C C    . ASN A 1 44  ? -1.674  -18.124 -1.814  1.00 0.00 ? 44  ASN A C    2  
ATOM 2241  O O    . ASN A 1 44  ? -2.697  -18.753 -1.540  1.00 0.00 ? 44  ASN A O    2  
ATOM 2242  C CB   . ASN A 1 44  ? -1.426  -17.319 -4.170  1.00 0.00 ? 44  ASN A CB   2  
ATOM 2243  C CG   . ASN A 1 44  ? -2.044  -16.378 -5.185  1.00 0.00 ? 44  ASN A CG   2  
ATOM 2244  O OD1  . ASN A 1 44  ? -3.149  -15.871 -4.986  1.00 0.00 ? 44  ASN A OD1  2  
ATOM 2245  N ND2  . ASN A 1 44  ? -1.333  -16.139 -6.281  1.00 0.00 ? 44  ASN A ND2  2  
ATOM 2246  H H    . ASN A 1 44  ? -0.236  -15.420 -2.955  1.00 0.00 ? 44  ASN A H    2  
ATOM 2247  H HA   . ASN A 1 44  ? -2.720  -16.481 -2.687  1.00 0.00 ? 44  ASN A HA   2  
ATOM 2248  H HB2  . ASN A 1 44  ? -0.356  -17.326 -4.319  1.00 0.00 ? 44  ASN A HB2  2  
ATOM 2249  H HB3  . ASN A 1 44  ? -1.815  -18.312 -4.342  1.00 0.00 ? 44  ASN A HB3  2  
ATOM 2250  H HD21 . ASN A 1 44  ? -0.461  -16.578 -6.372  1.00 0.00 ? 44  ASN A HD21 2  
ATOM 2251  H HD22 . ASN A 1 44  ? -1.709  -15.534 -6.954  1.00 0.00 ? 44  ASN A HD22 2  
ATOM 2252  N N    . ARG A 1 45  ? -0.475  -18.452 -1.345  1.00 0.00 ? 45  ARG A N    2  
ATOM 2253  C CA   . ARG A 1 45  ? -0.287  -19.597 -0.462  1.00 0.00 ? 45  ARG A CA   2  
ATOM 2254  C C    . ARG A 1 45  ? -0.981  -19.369 0.878   1.00 0.00 ? 45  ARG A C    2  
ATOM 2255  O O    . ARG A 1 45  ? -1.856  -20.139 1.274   1.00 0.00 ? 45  ARG A O    2  
ATOM 2256  C CB   . ARG A 1 45  ? 1.204   -19.856 -0.239  1.00 0.00 ? 45  ARG A CB   2  
ATOM 2257  C CG   . ARG A 1 45  ? 1.490   -20.837 0.887   1.00 0.00 ? 45  ARG A CG   2  
ATOM 2258  C CD   . ARG A 1 45  ? 2.921   -20.712 1.385   1.00 0.00 ? 45  ARG A CD   2  
ATOM 2259  N NE   . ARG A 1 45  ? 3.041   -21.055 2.800   1.00 0.00 ? 45  ARG A NE   2  
ATOM 2260  C CZ   . ARG A 1 45  ? 2.614   -20.272 3.784   1.00 0.00 ? 45  ARG A CZ   2  
ATOM 2261  N NH1  . ARG A 1 45  ? 2.043   -19.107 3.510   1.00 0.00 ? 45  ARG A NH1  2  
ATOM 2262  N NH2  . ARG A 1 45  ? 2.758   -20.654 5.047   1.00 0.00 ? 45  ARG A NH2  2  
ATOM 2263  H H    . ARG A 1 45  ? 0.302   -17.912 -1.599  1.00 0.00 ? 45  ARG A H    2  
ATOM 2264  H HA   . ARG A 1 45  ? -0.726  -20.460 -0.939  1.00 0.00 ? 45  ARG A HA   2  
ATOM 2265  H HB2  . ARG A 1 45  ? 1.629   -20.254 -1.149  1.00 0.00 ? 45  ARG A HB2  2  
ATOM 2266  H HB3  . ARG A 1 45  ? 1.688   -18.921 -0.004  1.00 0.00 ? 45  ARG A HB3  2  
ATOM 2267  H HG2  . ARG A 1 45  ? 0.816   -20.635 1.707   1.00 0.00 ? 45  ARG A HG2  2  
ATOM 2268  H HG3  . ARG A 1 45  ? 1.329   -21.841 0.526   1.00 0.00 ? 45  ARG A HG3  2  
ATOM 2269  H HD2  . ARG A 1 45  ? 3.548   -21.376 0.809   1.00 0.00 ? 45  ARG A HD2  2  
ATOM 2270  H HD3  . ARG A 1 45  ? 3.250   -19.693 1.242   1.00 0.00 ? 45  ARG A HD3  2  
ATOM 2271  H HE   . ARG A 1 45  ? 3.460   -21.911 3.025   1.00 0.00 ? 45  ARG A HE   2  
ATOM 2272  H HH11 . ARG A 1 45  ? 1.932   -18.818 2.560   1.00 0.00 ? 45  ARG A HH11 2  
ATOM 2273  H HH12 . ARG A 1 45  ? 1.721   -18.520 4.253   1.00 0.00 ? 45  ARG A HH12 2  
ATOM 2274  H HH21 . ARG A 1 45  ? 3.188   -21.531 5.258   1.00 0.00 ? 45  ARG A HH21 2  
ATOM 2275  H HH22 . ARG A 1 45  ? 2.437   -20.064 5.787   1.00 0.00 ? 45  ARG A HH22 2  
ATOM 2276  N N    . ALA A 1 46  ? -0.583  -18.308 1.572   1.00 0.00 ? 46  ALA A N    2  
ATOM 2277  C CA   . ALA A 1 46  ? -1.168  -17.978 2.866   1.00 0.00 ? 46  ALA A CA   2  
ATOM 2278  C C    . ALA A 1 46  ? -2.684  -17.852 2.767   1.00 0.00 ? 46  ALA A C    2  
ATOM 2279  O O    . ALA A 1 46  ? -3.413  -18.326 3.638   1.00 0.00 ? 46  ALA A O    2  
ATOM 2280  C CB   . ALA A 1 46  ? -0.563  -16.690 3.405   1.00 0.00 ? 46  ALA A CB   2  
ATOM 2281  H H    . ALA A 1 46  ? 0.119   -17.732 1.204   1.00 0.00 ? 46  ALA A H    2  
ATOM 2282  H HA   . ALA A 1 46  ? -0.927  -18.776 3.554   1.00 0.00 ? 46  ALA A HA   2  
ATOM 2283  H HB1  . ALA A 1 46  ? -1.352  -16.046 3.764   1.00 0.00 ? 46  ALA A HB1  2  
ATOM 2284  H HB2  . ALA A 1 46  ? 0.110   -16.921 4.217   1.00 0.00 ? 46  ALA A HB2  2  
ATOM 2285  H HB3  . ALA A 1 46  ? -0.020  -16.190 2.617   1.00 0.00 ? 46  ALA A HB3  2  
ATOM 2286  N N    . GLU A 1 47  ? -3.152  -17.209 1.702   1.00 0.00 ? 47  GLU A N    2  
ATOM 2287  C CA   . GLU A 1 47  ? -4.583  -17.020 1.492   1.00 0.00 ? 47  GLU A CA   2  
ATOM 2288  C C    . GLU A 1 47  ? -5.327  -18.349 1.588   1.00 0.00 ? 47  GLU A C    2  
ATOM 2289  O O    . GLU A 1 47  ? -6.374  -18.441 2.229   1.00 0.00 ? 47  GLU A O    2  
ATOM 2290  C CB   . GLU A 1 47  ? -4.840  -16.376 0.128   1.00 0.00 ? 47  GLU A CB   2  
ATOM 2291  C CG   . GLU A 1 47  ? -4.301  -14.960 0.012   1.00 0.00 ? 47  GLU A CG   2  
ATOM 2292  C CD   . GLU A 1 47  ? -5.106  -14.107 -0.948  1.00 0.00 ? 47  GLU A CD   2  
ATOM 2293  O OE1  . GLU A 1 47  ? -5.106  -14.413 -2.159  1.00 0.00 ? 47  GLU A OE1  2  
ATOM 2294  O OE2  . GLU A 1 47  ? -5.737  -13.132 -0.488  1.00 0.00 ? 47  GLU A OE2  2  
ATOM 2295  H H    . GLU A 1 47  ? -2.521  -16.854 1.042   1.00 0.00 ? 47  GLU A H    2  
ATOM 2296  H HA   . GLU A 1 47  ? -4.947  -16.361 2.265   1.00 0.00 ? 47  GLU A HA   2  
ATOM 2297  H HB2  . GLU A 1 47  ? -4.373  -16.981 -0.636  1.00 0.00 ? 47  GLU A HB2  2  
ATOM 2298  H HB3  . GLU A 1 47  ? -5.905  -16.349 -0.048  1.00 0.00 ? 47  GLU A HB3  2  
ATOM 2299  H HG2  . GLU A 1 47  ? -4.326  -14.498 0.987   1.00 0.00 ? 47  GLU A HG2  2  
ATOM 2300  H HG3  . GLU A 1 47  ? -3.280  -15.005 -0.338  1.00 0.00 ? 47  GLU A HG3  2  
ATOM 2301  N N    . CYS A 1 48  ? -4.779  -19.375 0.945   1.00 0.00 ? 48  CYS A N    2  
ATOM 2302  C CA   . CYS A 1 48  ? -5.391  -20.699 0.956   1.00 0.00 ? 48  CYS A CA   2  
ATOM 2303  C C    . CYS A 1 48  ? -5.385  -21.289 2.363   1.00 0.00 ? 48  CYS A C    2  
ATOM 2304  O O    . CYS A 1 48  ? -6.343  -21.942 2.778   1.00 0.00 ? 48  CYS A O    2  
ATOM 2305  C CB   . CYS A 1 48  ? -4.653  -21.632 -0.005  1.00 0.00 ? 48  CYS A CB   2  
ATOM 2306  S SG   . CYS A 1 48  ? -5.068  -21.376 -1.746  1.00 0.00 ? 48  CYS A SG   2  
ATOM 2307  H H    . CYS A 1 48  ? -3.943  -19.239 0.451   1.00 0.00 ? 48  CYS A H    2  
ATOM 2308  H HA   . CYS A 1 48  ? -6.414  -20.593 0.628   1.00 0.00 ? 48  CYS A HA   2  
ATOM 2309  H HB2  . CYS A 1 48  ? -3.589  -21.482 0.105   1.00 0.00 ? 48  CYS A HB2  2  
ATOM 2310  H HB3  . CYS A 1 48  ? -4.893  -22.655 0.245   1.00 0.00 ? 48  CYS A HB3  2  
ATOM 2311  H HG   . CYS A 1 48  ? -3.943  -21.134 -2.402  1.00 0.00 ? 48  CYS A HG   2  
ATOM 2312  N N    . LEU A 1 49  ? -4.299  -21.056 3.092   1.00 0.00 ? 49  LEU A N    2  
ATOM 2313  C CA   . LEU A 1 49  ? -4.167  -21.565 4.452   1.00 0.00 ? 49  LEU A CA   2  
ATOM 2314  C C    . LEU A 1 49  ? -5.215  -20.945 5.370   1.00 0.00 ? 49  LEU A C    2  
ATOM 2315  O O    . LEU A 1 49  ? -6.018  -21.652 5.978   1.00 0.00 ? 49  LEU A O    2  
ATOM 2316  C CB   . LEU A 1 49  ? -2.765  -21.278 4.992   1.00 0.00 ? 49  LEU A CB   2  
ATOM 2317  C CG   . LEU A 1 49  ? -1.603  -21.619 4.058   1.00 0.00 ? 49  LEU A CG   2  
ATOM 2318  C CD1  . LEU A 1 49  ? -0.310  -21.760 4.845   1.00 0.00 ? 49  LEU A CD1  2  
ATOM 2319  C CD2  . LEU A 1 49  ? -1.900  -22.894 3.281   1.00 0.00 ? 49  LEU A CD2  2  
ATOM 2320  H H    . LEU A 1 49  ? -3.569  -20.528 2.707   1.00 0.00 ? 49  LEU A H    2  
ATOM 2321  H HA   . LEU A 1 49  ? -4.320  -22.634 4.422   1.00 0.00 ? 49  LEU A HA   2  
ATOM 2322  H HB2  . LEU A 1 49  ? -2.708  -20.224 5.219   1.00 0.00 ? 49  LEU A HB2  2  
ATOM 2323  H HB3  . LEU A 1 49  ? -2.638  -21.848 5.901   1.00 0.00 ? 49  LEU A HB3  2  
ATOM 2324  H HG   . LEU A 1 49  ? -1.474  -20.815 3.346   1.00 0.00 ? 49  LEU A HG   2  
ATOM 2325  H HD11 . LEU A 1 49  ? 0.140   -22.718 4.629   1.00 0.00 ? 49  LEU A HD11 2  
ATOM 2326  H HD12 . LEU A 1 49  ? -0.522  -21.692 5.901   1.00 0.00 ? 49  LEU A HD12 2  
ATOM 2327  H HD13 . LEU A 1 49  ? 0.371   -20.970 4.563   1.00 0.00 ? 49  LEU A HD13 2  
ATOM 2328  H HD21 . LEU A 1 49  ? -2.880  -22.822 2.834   1.00 0.00 ? 49  LEU A HD21 2  
ATOM 2329  H HD22 . LEU A 1 49  ? -1.872  -23.739 3.954   1.00 0.00 ? 49  LEU A HD22 2  
ATOM 2330  H HD23 . LEU A 1 49  ? -1.159  -23.024 2.507   1.00 0.00 ? 49  LEU A HD23 2  
ATOM 2331  N N    . GLN A 1 50  ? -5.201  -19.619 5.464   1.00 0.00 ? 50  GLN A N    2  
ATOM 2332  C CA   . GLN A 1 50  ? -6.152  -18.903 6.307   1.00 0.00 ? 50  GLN A CA   2  
ATOM 2333  C C    . GLN A 1 50  ? -7.587  -19.230 5.908   1.00 0.00 ? 50  GLN A C    2  
ATOM 2334  O O    . GLN A 1 50  ? -8.462  -19.374 6.762   1.00 0.00 ? 50  GLN A O    2  
ATOM 2335  C CB   . GLN A 1 50  ? -5.915  -17.395 6.213   1.00 0.00 ? 50  GLN A CB   2  
ATOM 2336  C CG   . GLN A 1 50  ? -6.139  -16.829 4.820   1.00 0.00 ? 50  GLN A CG   2  
ATOM 2337  C CD   . GLN A 1 50  ? -5.928  -15.330 4.759   1.00 0.00 ? 50  GLN A CD   2  
ATOM 2338  O OE1  . GLN A 1 50  ? -6.860  -14.551 4.962   1.00 0.00 ? 50  GLN A OE1  2  
ATOM 2339  N NE2  . GLN A 1 50  ? -4.698  -14.915 4.477   1.00 0.00 ? 50  GLN A NE2  2  
ATOM 2340  H H    . GLN A 1 50  ? -4.537  -19.110 4.955   1.00 0.00 ? 50  GLN A H    2  
ATOM 2341  H HA   . GLN A 1 50  ? -5.994  -19.220 7.327   1.00 0.00 ? 50  GLN A HA   2  
ATOM 2342  H HB2  . GLN A 1 50  ? -6.586  -16.894 6.895   1.00 0.00 ? 50  GLN A HB2  2  
ATOM 2343  H HB3  . GLN A 1 50  ? -4.896  -17.184 6.504   1.00 0.00 ? 50  GLN A HB3  2  
ATOM 2344  H HG2  . GLN A 1 50  ? -5.449  -17.302 4.138   1.00 0.00 ? 50  GLN A HG2  2  
ATOM 2345  H HG3  . GLN A 1 50  ? -7.152  -17.049 4.516   1.00 0.00 ? 50  GLN A HG3  2  
ATOM 2346  H HE21 . GLN A 1 50  ? -4.006  -15.593 4.325   1.00 0.00 ? 50  GLN A HE21 2  
ATOM 2347  H HE22 . GLN A 1 50  ? -4.534  -13.951 4.430   1.00 0.00 ? 50  GLN A HE22 2  
ATOM 2348  N N    . ARG A 1 51  ? -7.822  -19.345 4.605   1.00 0.00 ? 51  ARG A N    2  
ATOM 2349  C CA   . ARG A 1 51  ? -9.151  -19.653 4.092   1.00 0.00 ? 51  ARG A CA   2  
ATOM 2350  C C    . ARG A 1 51  ? -9.425  -21.153 4.156   1.00 0.00 ? 51  ARG A C    2  
ATOM 2351  O O    . ARG A 1 51  ? -10.456 -21.627 3.681   1.00 0.00 ? 51  ARG A O    2  
ATOM 2352  C CB   . ARG A 1 51  ? -9.293  -19.158 2.651   1.00 0.00 ? 51  ARG A CB   2  
ATOM 2353  C CG   . ARG A 1 51  ? -9.512  -17.658 2.541   1.00 0.00 ? 51  ARG A CG   2  
ATOM 2354  C CD   . ARG A 1 51  ? -9.167  -17.146 1.152   1.00 0.00 ? 51  ARG A CD   2  
ATOM 2355  N NE   . ARG A 1 51  ? -9.237  -15.689 1.073   1.00 0.00 ? 51  ARG A NE   2  
ATOM 2356  C CZ   . ARG A 1 51  ? -8.880  -14.993 -0.001  1.00 0.00 ? 51  ARG A CZ   2  
ATOM 2357  N NH1  . ARG A 1 51  ? -8.430  -15.618 -1.080  1.00 0.00 ? 51  ARG A NH1  2  
ATOM 2358  N NH2  . ARG A 1 51  ? -8.972  -13.670 0.004   1.00 0.00 ? 51  ARG A NH2  2  
ATOM 2359  H H    . ARG A 1 51  ? -7.083  -19.219 3.973   1.00 0.00 ? 51  ARG A H    2  
ATOM 2360  H HA   . ARG A 1 51  ? -9.873  -19.141 4.712   1.00 0.00 ? 51  ARG A HA   2  
ATOM 2361  H HB2  . ARG A 1 51  ? -8.395  -19.410 2.107   1.00 0.00 ? 51  ARG A HB2  2  
ATOM 2362  H HB3  . ARG A 1 51  ? -10.134 -19.658 2.194   1.00 0.00 ? 51  ARG A HB3  2  
ATOM 2363  H HG2  . ARG A 1 51  ? -10.550 -17.439 2.746   1.00 0.00 ? 51  ARG A HG2  2  
ATOM 2364  H HG3  . ARG A 1 51  ? -8.887  -17.159 3.266   1.00 0.00 ? 51  ARG A HG3  2  
ATOM 2365  H HD2  . ARG A 1 51  ? -8.164  -17.462 0.905   1.00 0.00 ? 51  ARG A HD2  2  
ATOM 2366  H HD3  . ARG A 1 51  ? -9.863  -17.569 0.443   1.00 0.00 ? 51  ARG A HD3  2  
ATOM 2367  H HE   . ARG A 1 51  ? -9.566  -15.207 1.860   1.00 0.00 ? 51  ARG A HE   2  
ATOM 2368  H HH11 . ARG A 1 51  ? -8.360  -16.615 -1.087  1.00 0.00 ? 51  ARG A HH11 2  
ATOM 2369  H HH12 . ARG A 1 51  ? -8.163  -15.092 -1.888  1.00 0.00 ? 51  ARG A HH12 2  
ATOM 2370  H HH21 . ARG A 1 51  ? -9.311  -13.195 0.816   1.00 0.00 ? 51  ARG A HH21 2  
ATOM 2371  H HH22 . ARG A 1 51  ? -8.703  -13.147 -0.804  1.00 0.00 ? 51  ARG A HH22 2  
ATOM 2372  N N    . GLY A 1 52  ? -8.492  -21.895 4.746   1.00 0.00 ? 52  GLY A N    2  
ATOM 2373  C CA   . GLY A 1 52  ? -8.651  -23.333 4.860   1.00 0.00 ? 52  GLY A CA   2  
ATOM 2374  C C    . GLY A 1 52  ? -8.247  -24.063 3.594   1.00 0.00 ? 52  GLY A C    2  
ATOM 2375  O O    . GLY A 1 52  ? -7.884  -25.239 3.636   1.00 0.00 ? 52  GLY A O    2  
ATOM 2376  H H    . GLY A 1 52  ? -7.690  -21.462 5.106   1.00 0.00 ? 52  GLY A H    2  
ATOM 2377  H HA2  . GLY A 1 52  ? -8.041  -23.687 5.678   1.00 0.00 ? 52  GLY A HA2  2  
ATOM 2378  H HA3  . GLY A 1 52  ? -9.686  -23.553 5.073   1.00 0.00 ? 52  GLY A HA3  2  
ATOM 2379  N N    . VAL A 1 53  ? -8.310  -23.365 2.464   1.00 0.00 ? 53  VAL A N    2  
ATOM 2380  C CA   . VAL A 1 53  ? -7.949  -23.955 1.181   1.00 0.00 ? 53  VAL A CA   2  
ATOM 2381  C C    . VAL A 1 53  ? -6.500  -24.428 1.182   1.00 0.00 ? 53  VAL A C    2  
ATOM 2382  O O    . VAL A 1 53  ? -5.760  -24.193 2.138   1.00 0.00 ? 53  VAL A O    2  
ATOM 2383  C CB   . VAL A 1 53  ? -8.150  -22.954 0.027   1.00 0.00 ? 53  VAL A CB   2  
ATOM 2384  C CG1  . VAL A 1 53  ? -8.309  -23.688 -1.295  1.00 0.00 ? 53  VAL A CG1  2  
ATOM 2385  C CG2  . VAL A 1 53  ? -9.351  -22.062 0.300   1.00 0.00 ? 53  VAL A CG2  2  
ATOM 2386  H H    . VAL A 1 53  ? -8.607  -22.432 2.495   1.00 0.00 ? 53  VAL A H    2  
ATOM 2387  H HA   . VAL A 1 53  ? -8.595  -24.804 1.009   1.00 0.00 ? 53  VAL A HA   2  
ATOM 2388  H HB   . VAL A 1 53  ? -7.271  -22.329 -0.037  1.00 0.00 ? 53  VAL A HB   2  
ATOM 2389  H HG11 . VAL A 1 53  ? -7.358  -23.721 -1.806  1.00 0.00 ? 53  VAL A HG11 2  
ATOM 2390  H HG12 . VAL A 1 53  ? -8.655  -24.694 -1.109  1.00 0.00 ? 53  VAL A HG12 2  
ATOM 2391  H HG13 . VAL A 1 53  ? -9.029  -23.168 -1.911  1.00 0.00 ? 53  VAL A HG13 2  
ATOM 2392  H HG21 . VAL A 1 53  ? -9.055  -21.245 0.941   1.00 0.00 ? 53  VAL A HG21 2  
ATOM 2393  H HG22 . VAL A 1 53  ? -9.727  -21.668 -0.634  1.00 0.00 ? 53  VAL A HG22 2  
ATOM 2394  H HG23 . VAL A 1 53  ? -10.126 -22.638 0.784   1.00 0.00 ? 53  VAL A HG23 2  
ATOM 2395  N N    . SER A 1 54  ? -6.100  -25.095 0.104   1.00 0.00 ? 54  SER A N    2  
ATOM 2396  C CA   . SER A 1 54  ? -4.739  -25.604 -0.019  1.00 0.00 ? 54  SER A CA   2  
ATOM 2397  C C    . SER A 1 54  ? -3.875  -24.654 -0.843  1.00 0.00 ? 54  SER A C    2  
ATOM 2398  O O    . SER A 1 54  ? -4.320  -24.071 -1.832  1.00 0.00 ? 54  SER A O    2  
ATOM 2399  C CB   . SER A 1 54  ? -4.747  -26.992 -0.662  1.00 0.00 ? 54  SER A CB   2  
ATOM 2400  O OG   . SER A 1 54  ? -3.648  -27.767 -0.217  1.00 0.00 ? 54  SER A OG   2  
ATOM 2401  H H    . SER A 1 54  ? -6.736  -25.250 -0.625  1.00 0.00 ? 54  SER A H    2  
ATOM 2402  H HA   . SER A 1 54  ? -4.323  -25.680 0.975   1.00 0.00 ? 54  SER A HA   2  
ATOM 2403  H HB2  . SER A 1 54  ? -5.661  -27.502 -0.399  1.00 0.00 ? 54  SER A HB2  2  
ATOM 2404  H HB3  . SER A 1 54  ? -4.689  -26.888 -1.736  1.00 0.00 ? 54  SER A HB3  2  
ATOM 2405  H HG   . SER A 1 54  ? -3.886  -28.697 -0.226  1.00 0.00 ? 54  SER A HG   2  
ATOM 2406  N N    . PRO A 1 55  ? -2.610  -24.495 -0.427  1.00 0.00 ? 55  PRO A N    2  
ATOM 2407  C CA   . PRO A 1 55  ? -1.656  -23.618 -1.113  1.00 0.00 ? 55  PRO A CA   2  
ATOM 2408  C C    . PRO A 1 55  ? -1.243  -24.163 -2.476  1.00 0.00 ? 55  PRO A C    2  
ATOM 2409  O O    . PRO A 1 55  ? -0.530  -23.500 -3.229  1.00 0.00 ? 55  PRO A O    2  
ATOM 2410  C CB   . PRO A 1 55  ? -0.456  -23.588 -0.163  1.00 0.00 ? 55  PRO A CB   2  
ATOM 2411  C CG   . PRO A 1 55  ? -0.545  -24.864 0.600   1.00 0.00 ? 55  PRO A CG   2  
ATOM 2412  C CD   . PRO A 1 55  ? -2.013  -25.160 0.743   1.00 0.00 ? 55  PRO A CD   2  
ATOM 2413  H HA   . PRO A 1 55  ? -2.050  -22.619 -1.230  1.00 0.00 ? 55  PRO A HA   2  
ATOM 2414  H HB2  . PRO A 1 55  ? 0.459   -23.533 -0.736  1.00 0.00 ? 55  PRO A HB2  2  
ATOM 2415  H HB3  . PRO A 1 55  ? -0.531  -22.731 0.490   1.00 0.00 ? 55  PRO A HB3  2  
ATOM 2416  H HG2  . PRO A 1 55  ? -0.055  -25.655 0.053   1.00 0.00 ? 55  PRO A HG2  2  
ATOM 2417  H HG3  . PRO A 1 55  ? -0.092  -24.742 1.573   1.00 0.00 ? 55  PRO A HG3  2  
ATOM 2418  H HD2  . PRO A 1 55  ? -2.188  -26.225 0.713   1.00 0.00 ? 55  PRO A HD2  2  
ATOM 2419  H HD3  . PRO A 1 55  ? -2.395  -24.738 1.661   1.00 0.00 ? 55  PRO A HD3  2  
ATOM 2420  N N    . SER A 1 56  ? -1.697  -25.373 -2.786  1.00 0.00 ? 56  SER A N    2  
ATOM 2421  C CA   . SER A 1 56  ? -1.372  -26.008 -4.058  1.00 0.00 ? 56  SER A CA   2  
ATOM 2422  C C    . SER A 1 56  ? -2.484  -25.782 -5.078  1.00 0.00 ? 56  SER A C    2  
ATOM 2423  O O    . SER A 1 56  ? -2.295  -25.991 -6.276  1.00 0.00 ? 56  SER A O    2  
ATOM 2424  C CB   . SER A 1 56  ? -1.142  -27.507 -3.859  1.00 0.00 ? 56  SER A CB   2  
ATOM 2425  O OG   . SER A 1 56  ? 0.083   -27.752 -3.191  1.00 0.00 ? 56  SER A OG   2  
ATOM 2426  H H    . SER A 1 56  ? -2.262  -25.851 -2.143  1.00 0.00 ? 56  SER A H    2  
ATOM 2427  H HA   . SER A 1 56  ? -0.462  -25.559 -4.429  1.00 0.00 ? 56  SER A HA   2  
ATOM 2428  H HB2  . SER A 1 56  ? -1.948  -27.917 -3.270  1.00 0.00 ? 56  SER A HB2  2  
ATOM 2429  H HB3  . SER A 1 56  ? -1.117  -27.995 -4.823  1.00 0.00 ? 56  SER A HB3  2  
ATOM 2430  H HG   . SER A 1 56  ? -0.032  -27.605 -2.249  1.00 0.00 ? 56  SER A HG   2  
ATOM 2431  N N    . LYS A 1 57  ? -3.645  -25.354 -4.593  1.00 0.00 ? 57  LYS A N    2  
ATOM 2432  C CA   . LYS A 1 57  ? -4.789  -25.099 -5.460  1.00 0.00 ? 57  LYS A CA   2  
ATOM 2433  C C    . LYS A 1 57  ? -5.157  -23.618 -5.453  1.00 0.00 ? 57  LYS A C    2  
ATOM 2434  O O    . LYS A 1 57  ? -6.333  -23.261 -5.507  1.00 0.00 ? 57  LYS A O    2  
ATOM 2435  C CB   . LYS A 1 57  ? -5.990  -25.936 -5.014  1.00 0.00 ? 57  LYS A CB   2  
ATOM 2436  C CG   . LYS A 1 57  ? -5.651  -27.393 -4.752  1.00 0.00 ? 57  LYS A CG   2  
ATOM 2437  C CD   . LYS A 1 57  ? -5.180  -28.093 -6.015  1.00 0.00 ? 57  LYS A CD   2  
ATOM 2438  C CE   . LYS A 1 57  ? -4.642  -29.483 -5.715  1.00 0.00 ? 57  LYS A CE   2  
ATOM 2439  N NZ   . LYS A 1 57  ? -3.681  -29.943 -6.756  1.00 0.00 ? 57  LYS A NZ   2  
ATOM 2440  H H    . LYS A 1 57  ? -3.734  -25.206 -3.628  1.00 0.00 ? 57  LYS A H    2  
ATOM 2441  H HA   . LYS A 1 57  ? -4.514  -25.384 -6.464  1.00 0.00 ? 57  LYS A HA   2  
ATOM 2442  H HB2  . LYS A 1 57  ? -6.392  -25.512 -4.106  1.00 0.00 ? 57  LYS A HB2  2  
ATOM 2443  H HB3  . LYS A 1 57  ? -6.746  -25.897 -5.785  1.00 0.00 ? 57  LYS A HB3  2  
ATOM 2444  H HG2  . LYS A 1 57  ? -4.867  -27.443 -4.011  1.00 0.00 ? 57  LYS A HG2  2  
ATOM 2445  H HG3  . LYS A 1 57  ? -6.533  -27.896 -4.380  1.00 0.00 ? 57  LYS A HG3  2  
ATOM 2446  H HD2  . LYS A 1 57  ? -6.011  -28.181 -6.699  1.00 0.00 ? 57  LYS A HD2  2  
ATOM 2447  H HD3  . LYS A 1 57  ? -4.397  -27.504 -6.472  1.00 0.00 ? 57  LYS A HD3  2  
ATOM 2448  H HE2  . LYS A 1 57  ? -4.141  -29.462 -4.759  1.00 0.00 ? 57  LYS A HE2  2  
ATOM 2449  H HE3  . LYS A 1 57  ? -5.471  -30.174 -5.671  1.00 0.00 ? 57  LYS A HE3  2  
ATOM 2450  H HZ1  . LYS A 1 57  ? -4.192  -30.198 -7.625  1.00 0.00 ? 57  LYS A HZ1  2  
ATOM 2451  H HZ2  . LYS A 1 57  ? -3.159  -30.776 -6.417  1.00 0.00 ? 57  LYS A HZ2  2  
ATOM 2452  H HZ3  . LYS A 1 57  ? -3.002  -29.187 -6.975  1.00 0.00 ? 57  LYS A HZ3  2  
ATOM 2453  N N    . ALA A 1 58  ? -4.143  -22.762 -5.388  1.00 0.00 ? 58  ALA A N    2  
ATOM 2454  C CA   . ALA A 1 58  ? -4.360  -21.320 -5.377  1.00 0.00 ? 58  ALA A CA   2  
ATOM 2455  C C    . ALA A 1 58  ? -5.059  -20.861 -6.653  1.00 0.00 ? 58  ALA A C    2  
ATOM 2456  O O    . ALA A 1 58  ? -5.734  -19.831 -6.667  1.00 0.00 ? 58  ALA A O    2  
ATOM 2457  C CB   . ALA A 1 58  ? -3.037  -20.588 -5.205  1.00 0.00 ? 58  ALA A CB   2  
ATOM 2458  H H    . ALA A 1 58  ? -3.227  -23.107 -5.347  1.00 0.00 ? 58  ALA A H    2  
ATOM 2459  H HA   . ALA A 1 58  ? -4.988  -21.084 -4.530  1.00 0.00 ? 58  ALA A HA   2  
ATOM 2460  H HB1  . ALA A 1 58  ? -2.291  -21.277 -4.836  1.00 0.00 ? 58  ALA A HB1  2  
ATOM 2461  H HB2  . ALA A 1 58  ? -2.720  -20.190 -6.157  1.00 0.00 ? 58  ALA A HB2  2  
ATOM 2462  H HB3  . ALA A 1 58  ? -3.163  -19.781 -4.499  1.00 0.00 ? 58  ALA A HB3  2  
ATOM 2463  N N    . HIS A 1 59  ? -4.892  -21.631 -7.723  1.00 0.00 ? 59  HIS A N    2  
ATOM 2464  C CA   . HIS A 1 59  ? -5.507  -21.303 -9.005  1.00 0.00 ? 59  HIS A CA   2  
ATOM 2465  C C    . HIS A 1 59  ? -6.996  -21.016 -8.835  1.00 0.00 ? 59  HIS A C    2  
ATOM 2466  O O    . HIS A 1 59  ? -7.580  -20.244 -9.594  1.00 0.00 ? 59  HIS A O    2  
ATOM 2467  C CB   . HIS A 1 59  ? -5.306  -22.447 -9.999  1.00 0.00 ? 59  HIS A CB   2  
ATOM 2468  C CG   . HIS A 1 59  ? -5.646  -23.794 -9.439  1.00 0.00 ? 59  HIS A CG   2  
ATOM 2469  N ND1  . HIS A 1 59  ? -6.886  -24.379 -9.587  1.00 0.00 ? 59  HIS A ND1  2  
ATOM 2470  C CD2  . HIS A 1 59  ? -4.899  -24.672 -8.729  1.00 0.00 ? 59  HIS A CD2  2  
ATOM 2471  C CE1  . HIS A 1 59  ? -6.887  -25.558 -8.990  1.00 0.00 ? 59  HIS A CE1  2  
ATOM 2472  N NE2  . HIS A 1 59  ? -5.693  -25.760 -8.462  1.00 0.00 ? 59  HIS A NE2  2  
ATOM 2473  H H    . HIS A 1 59  ? -4.343  -22.439 -7.650  1.00 0.00 ? 59  HIS A H    2  
ATOM 2474  H HA   . HIS A 1 59  ? -5.024  -20.417 -9.387  1.00 0.00 ? 59  HIS A HA   2  
ATOM 2475  H HB2  . HIS A 1 59  ? -5.933  -22.279 -10.862 1.00 0.00 ? 59  HIS A HB2  2  
ATOM 2476  H HB3  . HIS A 1 59  ? -4.271  -22.468 -10.310 1.00 0.00 ? 59  HIS A HB3  2  
ATOM 2477  H HD1  . HIS A 1 59  ? -7.651  -23.988 -10.057 1.00 0.00 ? 59  HIS A HD1  2  
ATOM 2478  H HD2  . HIS A 1 59  ? -3.869  -24.541 -8.427  1.00 0.00 ? 59  HIS A HD2  2  
ATOM 2479  H HE1  . HIS A 1 59  ? -7.722  -26.241 -8.943  1.00 0.00 ? 59  HIS A HE1  2  
ATOM 2480  H HE2  . HIS A 1 59  ? -5.450  -26.517 -7.890  1.00 0.00 ? 59  HIS A HE2  2  
ATOM 2481  N N    . GLY A 1 60  ? -7.604  -21.645 -7.834  1.00 0.00 ? 60  GLY A N    2  
ATOM 2482  C CA   . GLY A 1 60  ? -9.020  -21.444 -7.583  1.00 0.00 ? 60  GLY A CA   2  
ATOM 2483  C C    . GLY A 1 60  ? -9.340  -20.022 -7.167  1.00 0.00 ? 60  GLY A C    2  
ATOM 2484  O O    . GLY A 1 60  ? -10.395 -19.489 -7.511  1.00 0.00 ? 60  GLY A O    2  
ATOM 2485  H H    . GLY A 1 60  ? -7.088  -22.249 -7.260  1.00 0.00 ? 60  GLY A H    2  
ATOM 2486  H HA2  . GLY A 1 60  ? -9.570  -21.678 -8.483  1.00 0.00 ? 60  GLY A HA2  2  
ATOM 2487  H HA3  . GLY A 1 60  ? -9.333  -22.116 -6.798  1.00 0.00 ? 60  GLY A HA3  2  
ATOM 2488  N N    . LEU A 1 61  ? -8.428  -19.406 -6.423  1.00 0.00 ? 61  LEU A N    2  
ATOM 2489  C CA   . LEU A 1 61  ? -8.618  -18.037 -5.958  1.00 0.00 ? 61  LEU A CA   2  
ATOM 2490  C C    . LEU A 1 61  ? -9.256  -17.176 -7.043  1.00 0.00 ? 61  LEU A C    2  
ATOM 2491  O O    . LEU A 1 61  ? -10.063 -16.293 -6.755  1.00 0.00 ? 61  LEU A O    2  
ATOM 2492  C CB   . LEU A 1 61  ? -7.280  -17.431 -5.532  1.00 0.00 ? 61  LEU A CB   2  
ATOM 2493  C CG   . LEU A 1 61  ? -6.623  -18.054 -4.299  1.00 0.00 ? 61  LEU A CG   2  
ATOM 2494  C CD1  . LEU A 1 61  ? -5.150  -17.680 -4.233  1.00 0.00 ? 61  LEU A CD1  2  
ATOM 2495  C CD2  . LEU A 1 61  ? -7.344  -17.616 -3.032  1.00 0.00 ? 61  LEU A CD2  2  
ATOM 2496  H H    . LEU A 1 61  ? -7.607  -19.882 -6.181  1.00 0.00 ? 61  LEU A H    2  
ATOM 2497  H HA   . LEU A 1 61  ? -9.279  -18.066 -5.104  1.00 0.00 ? 61  LEU A HA   2  
ATOM 2498  H HB2  . LEU A 1 61  ? -6.593  -17.532 -6.358  1.00 0.00 ? 61  LEU A HB2  2  
ATOM 2499  H HB3  . LEU A 1 61  ? -7.442  -16.383 -5.327  1.00 0.00 ? 61  LEU A HB3  2  
ATOM 2500  H HG   . LEU A 1 61  ? -6.691  -19.131 -4.368  1.00 0.00 ? 61  LEU A HG   2  
ATOM 2501  H HD11 . LEU A 1 61  ? -4.782  -17.489 -5.229  1.00 0.00 ? 61  LEU A HD11 2  
ATOM 2502  H HD12 . LEU A 1 61  ? -4.592  -18.494 -3.793  1.00 0.00 ? 61  LEU A HD12 2  
ATOM 2503  H HD13 . LEU A 1 61  ? -5.031  -16.794 -3.627  1.00 0.00 ? 61  LEU A HD13 2  
ATOM 2504  H HD21 . LEU A 1 61  ? -8.342  -17.287 -3.282  1.00 0.00 ? 61  LEU A HD21 2  
ATOM 2505  H HD22 . LEU A 1 61  ? -6.801  -16.802 -2.573  1.00 0.00 ? 61  LEU A HD22 2  
ATOM 2506  H HD23 . LEU A 1 61  ? -7.399  -18.446 -2.345  1.00 0.00 ? 61  LEU A HD23 2  
ATOM 2507  N N    . GLY A 1 62  ? -8.890  -17.442 -8.294  1.00 0.00 ? 62  GLY A N    2  
ATOM 2508  C CA   . GLY A 1 62  ? -9.438  -16.685 -9.404  1.00 0.00 ? 62  GLY A CA   2  
ATOM 2509  C C    . GLY A 1 62  ? -9.298  -15.188 -9.210  1.00 0.00 ? 62  GLY A C    2  
ATOM 2510  O O    . GLY A 1 62  ? -8.213  -14.632 -9.378  1.00 0.00 ? 62  GLY A O    2  
ATOM 2511  H H    . GLY A 1 62  ? -8.242  -18.158 -8.463  1.00 0.00 ? 62  GLY A H    2  
ATOM 2512  H HA2  . GLY A 1 62  ? -8.923  -16.970 -10.309 1.00 0.00 ? 62  GLY A HA2  2  
ATOM 2513  H HA3  . GLY A 1 62  ? -10.486 -16.926 -9.507  1.00 0.00 ? 62  GLY A HA3  2  
ATOM 2514  N N    . SER A 1 63  ? -10.400 -14.533 -8.856  1.00 0.00 ? 63  SER A N    2  
ATOM 2515  C CA   . SER A 1 63  ? -10.396 -13.090 -8.645  1.00 0.00 ? 63  SER A CA   2  
ATOM 2516  C C    . SER A 1 63  ? -9.485  -12.714 -7.480  1.00 0.00 ? 63  SER A C    2  
ATOM 2517  O O    . SER A 1 63  ? -8.821  -11.679 -7.507  1.00 0.00 ? 63  SER A O    2  
ATOM 2518  C CB   . SER A 1 63  ? -11.817 -12.590 -8.377  1.00 0.00 ? 63  SER A CB   2  
ATOM 2519  O OG   . SER A 1 63  ? -12.355 -13.182 -7.208  1.00 0.00 ? 63  SER A OG   2  
ATOM 2520  H H    . SER A 1 63  ? -11.235 -15.032 -8.738  1.00 0.00 ? 63  SER A H    2  
ATOM 2521  H HA   . SER A 1 63  ? -10.023 -12.624 -9.544  1.00 0.00 ? 63  SER A HA   2  
ATOM 2522  H HB2  . SER A 1 63  ? -11.800 -11.518 -8.248  1.00 0.00 ? 63  SER A HB2  2  
ATOM 2523  H HB3  . SER A 1 63  ? -12.448 -12.841 -9.217  1.00 0.00 ? 63  SER A HB3  2  
ATOM 2524  H HG   . SER A 1 63  ? -12.359 -14.137 -7.305  1.00 0.00 ? 63  SER A HG   2  
ATOM 2525  N N    . ASN A 1 64  ? -9.460  -13.564 -6.459  1.00 0.00 ? 64  ASN A N    2  
ATOM 2526  C CA   . ASN A 1 64  ? -8.631  -13.321 -5.283  1.00 0.00 ? 64  ASN A CA   2  
ATOM 2527  C C    . ASN A 1 64  ? -7.208  -13.825 -5.508  1.00 0.00 ? 64  ASN A C    2  
ATOM 2528  O O    . ASN A 1 64  ? -6.395  -13.853 -4.583  1.00 0.00 ? 64  ASN A O    2  
ATOM 2529  C CB   . ASN A 1 64  ? -9.238  -14.003 -4.056  1.00 0.00 ? 64  ASN A CB   2  
ATOM 2530  C CG   . ASN A 1 64  ? -10.657 -13.545 -3.782  1.00 0.00 ? 64  ASN A CG   2  
ATOM 2531  O OD1  . ASN A 1 64  ? -11.610 -14.053 -4.373  1.00 0.00 ? 64  ASN A OD1  2  
ATOM 2532  N ND2  . ASN A 1 64  ? -10.804 -12.579 -2.882  1.00 0.00 ? 64  ASN A ND2  2  
ATOM 2533  H H    . ASN A 1 64  ? -10.012 -14.372 -6.495  1.00 0.00 ? 64  ASN A H    2  
ATOM 2534  H HA   . ASN A 1 64  ? -8.600  -12.255 -5.114  1.00 0.00 ? 64  ASN A HA   2  
ATOM 2535  H HB2  . ASN A 1 64  ? -9.250  -15.072 -4.215  1.00 0.00 ? 64  ASN A HB2  2  
ATOM 2536  H HB3  . ASN A 1 64  ? -8.633  -13.779 -3.190  1.00 0.00 ? 64  ASN A HB3  2  
ATOM 2537  H HD21 . ASN A 1 64  ? -9.999  -12.222 -2.451  1.00 0.00 ? 64  ASN A HD21 2  
ATOM 2538  H HD22 . ASN A 1 64  ? -11.711 -12.264 -2.686  1.00 0.00 ? 64  ASN A HD22 2  
ATOM 2539  N N    . LEU A 1 65  ? -6.915  -14.221 -6.741  1.00 0.00 ? 65  LEU A N    2  
ATOM 2540  C CA   . LEU A 1 65  ? -5.590  -14.724 -7.088  1.00 0.00 ? 65  LEU A CA   2  
ATOM 2541  C C    . LEU A 1 65  ? -4.596  -13.577 -7.244  1.00 0.00 ? 65  LEU A C    2  
ATOM 2542  O O    . LEU A 1 65  ? -4.919  -12.535 -7.814  1.00 0.00 ? 65  LEU A O    2  
ATOM 2543  C CB   . LEU A 1 65  ? -5.654  -15.537 -8.382  1.00 0.00 ? 65  LEU A CB   2  
ATOM 2544  C CG   . LEU A 1 65  ? -4.383  -16.298 -8.761  1.00 0.00 ? 65  LEU A CG   2  
ATOM 2545  C CD1  . LEU A 1 65  ? -4.369  -17.672 -8.108  1.00 0.00 ? 65  LEU A CD1  2  
ATOM 2546  C CD2  . LEU A 1 65  ? -4.266  -16.422 -10.273 1.00 0.00 ? 65  LEU A CD2  2  
ATOM 2547  H H    . LEU A 1 65  ? -7.604  -14.175 -7.435  1.00 0.00 ? 65  LEU A H    2  
ATOM 2548  H HA   . LEU A 1 65  ? -5.258  -15.365 -6.285  1.00 0.00 ? 65  LEU A HA   2  
ATOM 2549  H HB2  . LEU A 1 65  ? -6.452  -16.257 -8.281  1.00 0.00 ? 65  LEU A HB2  2  
ATOM 2550  H HB3  . LEU A 1 65  ? -5.886  -14.856 -9.189  1.00 0.00 ? 65  LEU A HB3  2  
ATOM 2551  H HG   . LEU A 1 65  ? -3.523  -15.750 -8.402  1.00 0.00 ? 65  LEU A HG   2  
ATOM 2552  H HD11 . LEU A 1 65  ? -5.366  -18.086 -8.119  1.00 0.00 ? 65  LEU A HD11 2  
ATOM 2553  H HD12 . LEU A 1 65  ? -4.028  -17.582 -7.087  1.00 0.00 ? 65  LEU A HD12 2  
ATOM 2554  H HD13 . LEU A 1 65  ? -3.702  -18.322 -8.654  1.00 0.00 ? 65  LEU A HD13 2  
ATOM 2555  H HD21 . LEU A 1 65  ? -4.908  -15.692 -10.744 1.00 0.00 ? 65  LEU A HD21 2  
ATOM 2556  H HD22 . LEU A 1 65  ? -4.566  -17.415 -10.576 1.00 0.00 ? 65  LEU A HD22 2  
ATOM 2557  H HD23 . LEU A 1 65  ? -3.243  -16.248 -10.570 1.00 0.00 ? 65  LEU A HD23 2  
ATOM 2558  N N    . VAL A 1 66  ? -3.385  -13.777 -6.735  1.00 0.00 ? 66  VAL A N    2  
ATOM 2559  C CA   . VAL A 1 66  ? -2.342  -12.761 -6.821  1.00 0.00 ? 66  VAL A CA   2  
ATOM 2560  C C    . VAL A 1 66  ? -1.406  -13.032 -7.993  1.00 0.00 ? 66  VAL A C    2  
ATOM 2561  O O    . VAL A 1 66  ? -1.203  -14.180 -8.389  1.00 0.00 ? 66  VAL A O    2  
ATOM 2562  C CB   . VAL A 1 66  ? -1.515  -12.695 -5.523  1.00 0.00 ? 66  VAL A CB   2  
ATOM 2563  C CG1  . VAL A 1 66  ? -0.627  -11.460 -5.518  1.00 0.00 ? 66  VAL A CG1  2  
ATOM 2564  C CG2  . VAL A 1 66  ? -2.430  -12.710 -4.308  1.00 0.00 ? 66  VAL A CG2  2  
ATOM 2565  H H    . VAL A 1 66  ? -3.187  -14.629 -6.293  1.00 0.00 ? 66  VAL A H    2  
ATOM 2566  H HA   . VAL A 1 66  ? -2.820  -11.804 -6.968  1.00 0.00 ? 66  VAL A HA   2  
ATOM 2567  H HB   . VAL A 1 66  ? -0.880  -13.568 -5.480  1.00 0.00 ? 66  VAL A HB   2  
ATOM 2568  H HG11 . VAL A 1 66  ? -0.220  -11.314 -4.528  1.00 0.00 ? 66  VAL A HG11 2  
ATOM 2569  H HG12 . VAL A 1 66  ? 0.179   -11.593 -6.224  1.00 0.00 ? 66  VAL A HG12 2  
ATOM 2570  H HG13 . VAL A 1 66  ? -1.212  -10.596 -5.796  1.00 0.00 ? 66  VAL A HG13 2  
ATOM 2571  H HG21 . VAL A 1 66  ? -1.833  -12.759 -3.409  1.00 0.00 ? 66  VAL A HG21 2  
ATOM 2572  H HG22 . VAL A 1 66  ? -3.026  -11.808 -4.294  1.00 0.00 ? 66  VAL A HG22 2  
ATOM 2573  H HG23 . VAL A 1 66  ? -3.080  -13.570 -4.356  1.00 0.00 ? 66  VAL A HG23 2  
ATOM 2574  N N    . THR A 1 67  ? -0.837  -11.966 -8.548  1.00 0.00 ? 67  THR A N    2  
ATOM 2575  C CA   . THR A 1 67  ? 0.077   -12.087 -9.676  1.00 0.00 ? 67  THR A CA   2  
ATOM 2576  C C    . THR A 1 67  ? 1.108   -10.964 -9.672  1.00 0.00 ? 67  THR A C    2  
ATOM 2577  O O    . THR A 1 67  ? 0.860   -9.885  -9.133  1.00 0.00 ? 67  THR A O    2  
ATOM 2578  C CB   . THR A 1 67  ? -0.680  -12.069 -11.017 1.00 0.00 ? 67  THR A CB   2  
ATOM 2579  O OG1  . THR A 1 67  ? -1.170  -10.750 -11.285 1.00 0.00 ? 67  THR A OG1  2  
ATOM 2580  C CG2  . THR A 1 67  ? -1.840  -13.052 -10.997 1.00 0.00 ? 67  THR A CG2  2  
ATOM 2581  H H    . THR A 1 67  ? -1.039  -11.076 -8.188  1.00 0.00 ? 67  THR A H    2  
ATOM 2582  H HA   . THR A 1 67  ? 0.590   -13.034 -9.589  1.00 0.00 ? 67  THR A HA   2  
ATOM 2583  H HB   . THR A 1 67  ? 0.003   -12.357 -11.803 1.00 0.00 ? 67  THR A HB   2  
ATOM 2584  H HG1  . THR A 1 67  ? -0.938  -10.499 -12.183 1.00 0.00 ? 67  THR A HG1  2  
ATOM 2585  H HG21 . THR A 1 67  ? -2.522  -12.789 -10.202 1.00 0.00 ? 67  THR A HG21 2  
ATOM 2586  H HG22 . THR A 1 67  ? -1.463  -14.051 -10.832 1.00 0.00 ? 67  THR A HG22 2  
ATOM 2587  H HG23 . THR A 1 67  ? -2.360  -13.015 -11.942 1.00 0.00 ? 67  THR A HG23 2  
ATOM 2588  N N    . GLU A 1 68  ? 2.262   -11.224 -10.277 1.00 0.00 ? 68  GLU A N    2  
ATOM 2589  C CA   . GLU A 1 68  ? 3.330   -10.233 -10.342 1.00 0.00 ? 68  GLU A CA   2  
ATOM 2590  C C    . GLU A 1 68  ? 2.758   -8.823  -10.459 1.00 0.00 ? 68  GLU A C    2  
ATOM 2591  O O    . GLU A 1 68  ? 3.245   -7.888  -9.824  1.00 0.00 ? 68  GLU A O    2  
ATOM 2592  C CB   . GLU A 1 68  ? 4.252   -10.521 -11.528 1.00 0.00 ? 68  GLU A CB   2  
ATOM 2593  C CG   . GLU A 1 68  ? 5.656   -9.966  -11.357 1.00 0.00 ? 68  GLU A CG   2  
ATOM 2594  C CD   . GLU A 1 68  ? 6.322   -9.645  -12.681 1.00 0.00 ? 68  GLU A CD   2  
ATOM 2595  O OE1  . GLU A 1 68  ? 6.817   -10.585 -13.339 1.00 0.00 ? 68  GLU A OE1  2  
ATOM 2596  O OE2  . GLU A 1 68  ? 6.349   -8.456  -13.059 1.00 0.00 ? 68  GLU A OE2  2  
ATOM 2597  H H    . GLU A 1 68  ? 2.400   -12.103 -10.688 1.00 0.00 ? 68  GLU A H    2  
ATOM 2598  H HA   . GLU A 1 68  ? 3.902   -10.301 -9.429  1.00 0.00 ? 68  GLU A HA   2  
ATOM 2599  H HB2  . GLU A 1 68  ? 4.323   -11.590 -11.662 1.00 0.00 ? 68  GLU A HB2  2  
ATOM 2600  H HB3  . GLU A 1 68  ? 3.821   -10.084 -12.417 1.00 0.00 ? 68  GLU A HB3  2  
ATOM 2601  H HG2  . GLU A 1 68  ? 5.603   -9.061  -10.770 1.00 0.00 ? 68  GLU A HG2  2  
ATOM 2602  H HG3  . GLU A 1 68  ? 6.257   -10.697 -10.836 1.00 0.00 ? 68  GLU A HG3  2  
ATOM 2603  N N    . VAL A 1 69  ? 1.720   -8.678  -11.277 1.00 0.00 ? 69  VAL A N    2  
ATOM 2604  C CA   . VAL A 1 69  ? 1.080   -7.384  -11.478 1.00 0.00 ? 69  VAL A CA   2  
ATOM 2605  C C    . VAL A 1 69  ? 0.425   -6.889  -10.193 1.00 0.00 ? 69  VAL A C    2  
ATOM 2606  O O    . VAL A 1 69  ? 0.694   -5.778  -9.736  1.00 0.00 ? 69  VAL A O    2  
ATOM 2607  C CB   . VAL A 1 69  ? 0.016   -7.451  -12.591 1.00 0.00 ? 69  VAL A CB   2  
ATOM 2608  C CG1  . VAL A 1 69  ? -0.957  -6.288  -12.470 1.00 0.00 ? 69  VAL A CG1  2  
ATOM 2609  C CG2  . VAL A 1 69  ? 0.679   -7.462  -13.960 1.00 0.00 ? 69  VAL A CG2  2  
ATOM 2610  H H    . VAL A 1 69  ? 1.376   -9.461  -11.756 1.00 0.00 ? 69  VAL A H    2  
ATOM 2611  H HA   . VAL A 1 69  ? 1.841   -6.678  -11.778 1.00 0.00 ? 69  VAL A HA   2  
ATOM 2612  H HB   . VAL A 1 69  ? -0.539  -8.370  -12.475 1.00 0.00 ? 69  VAL A HB   2  
ATOM 2613  H HG11 . VAL A 1 69  ? -1.606  -6.271  -13.333 1.00 0.00 ? 69  VAL A HG11 2  
ATOM 2614  H HG12 . VAL A 1 69  ? -1.549  -6.405  -11.574 1.00 0.00 ? 69  VAL A HG12 2  
ATOM 2615  H HG13 . VAL A 1 69  ? -0.405  -5.361  -12.417 1.00 0.00 ? 69  VAL A HG13 2  
ATOM 2616  H HG21 . VAL A 1 69  ? 1.397   -8.267  -14.005 1.00 0.00 ? 69  VAL A HG21 2  
ATOM 2617  H HG22 . VAL A 1 69  ? -0.073  -7.607  -14.723 1.00 0.00 ? 69  VAL A HG22 2  
ATOM 2618  H HG23 . VAL A 1 69  ? 1.181   -6.521  -14.125 1.00 0.00 ? 69  VAL A HG23 2  
ATOM 2619  N N    . ARG A 1 70  ? -0.436  -7.721  -9.616  1.00 0.00 ? 70  ARG A N    2  
ATOM 2620  C CA   . ARG A 1 70  ? -1.130  -7.368  -8.384  1.00 0.00 ? 70  ARG A CA   2  
ATOM 2621  C C    . ARG A 1 70  ? -0.180  -6.694  -7.399  1.00 0.00 ? 70  ARG A C    2  
ATOM 2622  O O    . ARG A 1 70  ? -0.476  -5.624  -6.867  1.00 0.00 ? 70  ARG A O    2  
ATOM 2623  C CB   . ARG A 1 70  ? -1.745  -8.614  -7.745  1.00 0.00 ? 70  ARG A CB   2  
ATOM 2624  C CG   . ARG A 1 70  ? -2.746  -9.326  -8.639  1.00 0.00 ? 70  ARG A CG   2  
ATOM 2625  C CD   . ARG A 1 70  ? -4.137  -8.724  -8.510  1.00 0.00 ? 70  ARG A CD   2  
ATOM 2626  N NE   . ARG A 1 70  ? -4.948  -8.958  -9.701  1.00 0.00 ? 70  ARG A NE   2  
ATOM 2627  C CZ   . ARG A 1 70  ? -4.905  -8.187  -10.782 1.00 0.00 ? 70  ARG A CZ   2  
ATOM 2628  N NH1  . ARG A 1 70  ? -4.094  -7.139  -10.822 1.00 0.00 ? 70  ARG A NH1  2  
ATOM 2629  N NH2  . ARG A 1 70  ? -5.674  -8.465  -11.827 1.00 0.00 ? 70  ARG A NH2  2  
ATOM 2630  H H    . ARG A 1 70  ? -0.609  -8.593  -10.029 1.00 0.00 ? 70  ARG A H    2  
ATOM 2631  H HA   . ARG A 1 70  ? -1.920  -6.676  -8.635  1.00 0.00 ? 70  ARG A HA   2  
ATOM 2632  H HB2  . ARG A 1 70  ? -0.954  -9.308  -7.503  1.00 0.00 ? 70  ARG A HB2  2  
ATOM 2633  H HB3  . ARG A 1 70  ? -2.250  -8.325  -6.835  1.00 0.00 ? 70  ARG A HB3  2  
ATOM 2634  H HG2  . ARG A 1 70  ? -2.423  -9.240  -9.666  1.00 0.00 ? 70  ARG A HG2  2  
ATOM 2635  H HG3  . ARG A 1 70  ? -2.787  -10.368 -8.359  1.00 0.00 ? 70  ARG A HG3  2  
ATOM 2636  H HD2  . ARG A 1 70  ? -4.629  -9.168  -7.658  1.00 0.00 ? 70  ARG A HD2  2  
ATOM 2637  H HD3  . ARG A 1 70  ? -4.040  -7.660  -8.354  1.00 0.00 ? 70  ARG A HD3  2  
ATOM 2638  H HE   . ARG A 1 70  ? -5.554  -9.727  -9.694  1.00 0.00 ? 70  ARG A HE   2  
ATOM 2639  H HH11 . ARG A 1 70  ? -3.513  -6.928  -10.036 1.00 0.00 ? 70  ARG A HH11 2  
ATOM 2640  H HH12 . ARG A 1 70  ? -4.063  -6.561  -11.637 1.00 0.00 ? 70  ARG A HH12 2  
ATOM 2641  H HH21 . ARG A 1 70  ? -6.286  -9.255  -11.801 1.00 0.00 ? 70  ARG A HH21 2  
ATOM 2642  H HH22 . ARG A 1 70  ? -5.641  -7.885  -12.640 1.00 0.00 ? 70  ARG A HH22 2  
ATOM 2643  N N    . VAL A 1 71  ? 0.964   -7.328  -7.159  1.00 0.00 ? 71  VAL A N    2  
ATOM 2644  C CA   . VAL A 1 71  ? 1.958   -6.790  -6.238  1.00 0.00 ? 71  VAL A CA   2  
ATOM 2645  C C    . VAL A 1 71  ? 2.573   -5.505  -6.783  1.00 0.00 ? 71  VAL A C    2  
ATOM 2646  O O    . VAL A 1 71  ? 2.837   -4.565  -6.034  1.00 0.00 ? 71  VAL A O    2  
ATOM 2647  C CB   . VAL A 1 71  ? 3.080   -7.809  -5.966  1.00 0.00 ? 71  VAL A CB   2  
ATOM 2648  C CG1  . VAL A 1 71  ? 3.967   -7.334  -4.825  1.00 0.00 ? 71  VAL A CG1  2  
ATOM 2649  C CG2  . VAL A 1 71  ? 2.493   -9.178  -5.662  1.00 0.00 ? 71  VAL A CG2  2  
ATOM 2650  H H    . VAL A 1 71  ? 1.143   -8.177  -7.613  1.00 0.00 ? 71  VAL A H    2  
ATOM 2651  H HA   . VAL A 1 71  ? 1.463   -6.572  -5.303  1.00 0.00 ? 71  VAL A HA   2  
ATOM 2652  H HB   . VAL A 1 71  ? 3.688   -7.890  -6.855  1.00 0.00 ? 71  VAL A HB   2  
ATOM 2653  H HG11 . VAL A 1 71  ? 5.004   -7.475  -5.093  1.00 0.00 ? 71  VAL A HG11 2  
ATOM 2654  H HG12 . VAL A 1 71  ? 3.782   -6.287  -4.636  1.00 0.00 ? 71  VAL A HG12 2  
ATOM 2655  H HG13 . VAL A 1 71  ? 3.745   -7.905  -3.936  1.00 0.00 ? 71  VAL A HG13 2  
ATOM 2656  H HG21 . VAL A 1 71  ? 1.416   -9.109  -5.631  1.00 0.00 ? 71  VAL A HG21 2  
ATOM 2657  H HG22 . VAL A 1 71  ? 2.786   -9.876  -6.434  1.00 0.00 ? 71  VAL A HG22 2  
ATOM 2658  H HG23 . VAL A 1 71  ? 2.860   -9.524  -4.707  1.00 0.00 ? 71  VAL A HG23 2  
ATOM 2659  N N    . TYR A 1 72  ? 2.799   -5.473  -8.092  1.00 0.00 ? 72  TYR A N    2  
ATOM 2660  C CA   . TYR A 1 72  ? 3.386   -4.305  -8.737  1.00 0.00 ? 72  TYR A CA   2  
ATOM 2661  C C    . TYR A 1 72  ? 2.531   -3.064  -8.498  1.00 0.00 ? 72  TYR A C    2  
ATOM 2662  O O    . TYR A 1 72  ? 3.052   -1.969  -8.289  1.00 0.00 ? 72  TYR A O    2  
ATOM 2663  C CB   . TYR A 1 72  ? 3.539   -4.549  -10.240 1.00 0.00 ? 72  TYR A CB   2  
ATOM 2664  C CG   . TYR A 1 72  ? 3.761   -3.286  -11.039 1.00 0.00 ? 72  TYR A CG   2  
ATOM 2665  C CD1  . TYR A 1 72  ? 2.721   -2.393  -11.268 1.00 0.00 ? 72  TYR A CD1  2  
ATOM 2666  C CD2  . TYR A 1 72  ? 5.011   -2.984  -11.567 1.00 0.00 ? 72  TYR A CD2  2  
ATOM 2667  C CE1  . TYR A 1 72  ? 2.918   -1.238  -11.999 1.00 0.00 ? 72  TYR A CE1  2  
ATOM 2668  C CE2  . TYR A 1 72  ? 5.218   -1.830  -12.297 1.00 0.00 ? 72  TYR A CE2  2  
ATOM 2669  C CZ   . TYR A 1 72  ? 4.169   -0.960  -12.511 1.00 0.00 ? 72  TYR A CZ   2  
ATOM 2670  O OH   . TYR A 1 72  ? 4.371   0.189   -13.240 1.00 0.00 ? 72  TYR A OH   2  
ATOM 2671  H H    . TYR A 1 72  ? 2.568   -6.254  -8.637  1.00 0.00 ? 72  TYR A H    2  
ATOM 2672  H HA   . TYR A 1 72  ? 4.363   -4.144  -8.307  1.00 0.00 ? 72  TYR A HA   2  
ATOM 2673  H HB2  . TYR A 1 72  ? 4.384   -5.200  -10.407 1.00 0.00 ? 72  TYR A HB2  2  
ATOM 2674  H HB3  . TYR A 1 72  ? 2.644   -5.026  -10.613 1.00 0.00 ? 72  TYR A HB3  2  
ATOM 2675  H HD1  . TYR A 1 72  ? 1.742   -2.614  -10.866 1.00 0.00 ? 72  TYR A HD1  2  
ATOM 2676  H HD2  . TYR A 1 72  ? 5.830   -3.668  -11.398 1.00 0.00 ? 72  TYR A HD2  2  
ATOM 2677  H HE1  . TYR A 1 72  ? 2.097   -0.556  -12.167 1.00 0.00 ? 72  TYR A HE1  2  
ATOM 2678  H HE2  . TYR A 1 72  ? 6.197   -1.613  -12.699 1.00 0.00 ? 72  TYR A HE2  2  
ATOM 2679  H HH   . TYR A 1 72  ? 4.493   0.930   -12.641 1.00 0.00 ? 72  TYR A HH   2  
ATOM 2680  N N    . ASN A 1 73  ? 1.215   -3.244  -8.528  1.00 0.00 ? 73  ASN A N    2  
ATOM 2681  C CA   . ASN A 1 73  ? 0.287   -2.140  -8.314  1.00 0.00 ? 73  ASN A CA   2  
ATOM 2682  C C    . ASN A 1 73  ? 0.287   -1.705  -6.852  1.00 0.00 ? 73  ASN A C    2  
ATOM 2683  O O    . ASN A 1 73  ? 0.343   -0.513  -6.549  1.00 0.00 ? 73  ASN A O    2  
ATOM 2684  C CB   . ASN A 1 73  ? -1.127  -2.545  -8.737  1.00 0.00 ? 73  ASN A CB   2  
ATOM 2685  C CG   . ASN A 1 73  ? -1.379  -2.310  -10.214 1.00 0.00 ? 73  ASN A CG   2  
ATOM 2686  O OD1  . ASN A 1 73  ? -1.615  -1.180  -10.642 1.00 0.00 ? 73  ASN A OD1  2  
ATOM 2687  N ND2  . ASN A 1 73  ? -1.329  -3.379  -11.000 1.00 0.00 ? 73  ASN A ND2  2  
ATOM 2688  H H    . ASN A 1 73  ? 0.859   -4.141  -8.699  1.00 0.00 ? 73  ASN A H    2  
ATOM 2689  H HA   . ASN A 1 73  ? 0.612   -1.311  -8.925  1.00 0.00 ? 73  ASN A HA   2  
ATOM 2690  H HB2  . ASN A 1 73  ? -1.270  -3.596  -8.530  1.00 0.00 ? 73  ASN A HB2  2  
ATOM 2691  H HB3  . ASN A 1 73  ? -1.844  -1.970  -8.171  1.00 0.00 ? 73  ASN A HB3  2  
ATOM 2692  H HD21 . ASN A 1 73  ? -1.136  -4.248  -10.589 1.00 0.00 ? 73  ASN A HD21 2  
ATOM 2693  H HD22 . ASN A 1 73  ? -1.487  -3.256  -11.959 1.00 0.00 ? 73  ASN A HD22 2  
ATOM 2694  N N    . TRP A 1 74  ? 0.226   -2.678  -5.951  1.00 0.00 ? 74  TRP A N    2  
ATOM 2695  C CA   . TRP A 1 74  ? 0.220   -2.395  -4.520  1.00 0.00 ? 74  TRP A CA   2  
ATOM 2696  C C    . TRP A 1 74  ? 1.412   -1.528  -4.131  1.00 0.00 ? 74  TRP A C    2  
ATOM 2697  O O    . TRP A 1 74  ? 1.270   -0.558  -3.386  1.00 0.00 ? 74  TRP A O    2  
ATOM 2698  C CB   . TRP A 1 74  ? 0.241   -3.700  -3.722  1.00 0.00 ? 74  TRP A CB   2  
ATOM 2699  C CG   . TRP A 1 74  ? 0.108   -3.493  -2.243  1.00 0.00 ? 74  TRP A CG   2  
ATOM 2700  C CD1  . TRP A 1 74  ? -1.050  -3.469  -1.519  1.00 0.00 ? 74  TRP A CD1  2  
ATOM 2701  C CD2  . TRP A 1 74  ? 1.172   -3.281  -1.309  1.00 0.00 ? 74  TRP A CD2  2  
ATOM 2702  N NE1  . TRP A 1 74  ? -0.770  -3.254  -0.192  1.00 0.00 ? 74  TRP A NE1  2  
ATOM 2703  C CE2  . TRP A 1 74  ? 0.585   -3.136  -0.036  1.00 0.00 ? 74  TRP A CE2  2  
ATOM 2704  C CE3  . TRP A 1 74  ? 2.562   -3.201  -1.423  1.00 0.00 ? 74  TRP A CE3  2  
ATOM 2705  C CZ2  . TRP A 1 74  ? 1.343   -2.914  1.111   1.00 0.00 ? 74  TRP A CZ2  2  
ATOM 2706  C CZ3  . TRP A 1 74  ? 3.312   -2.980  -0.283  1.00 0.00 ? 74  TRP A CZ3  2  
ATOM 2707  C CH2  . TRP A 1 74  ? 2.702   -2.840  0.970   1.00 0.00 ? 74  TRP A CH2  2  
ATOM 2708  H H    . TRP A 1 74  ? 0.184   -3.609  -6.254  1.00 0.00 ? 74  TRP A H    2  
ATOM 2709  H HA   . TRP A 1 74  ? -0.690  -1.859  -4.293  1.00 0.00 ? 74  TRP A HA   2  
ATOM 2710  H HB2  . TRP A 1 74  ? -0.577  -4.326  -4.045  1.00 0.00 ? 74  TRP A HB2  2  
ATOM 2711  H HB3  . TRP A 1 74  ? 1.175   -4.211  -3.905  1.00 0.00 ? 74  TRP A HB3  2  
ATOM 2712  H HD1  . TRP A 1 74  ? -2.034  -3.599  -1.943  1.00 0.00 ? 74  TRP A HD1  2  
ATOM 2713  H HE1  . TRP A 1 74  ? -1.434  -3.196  0.527   1.00 0.00 ? 74  TRP A HE1  2  
ATOM 2714  H HE3  . TRP A 1 74  ? 3.051   -3.306  -2.380  1.00 0.00 ? 74  TRP A HE3  2  
ATOM 2715  H HZ2  . TRP A 1 74  ? 0.887   -2.805  2.085   1.00 0.00 ? 74  TRP A HZ2  2  
ATOM 2716  H HZ3  . TRP A 1 74  ? 4.388   -2.915  -0.352  1.00 0.00 ? 74  TRP A HZ3  2  
ATOM 2717  H HH2  . TRP A 1 74  ? 3.327   -2.669  1.833   1.00 0.00 ? 74  TRP A HH2  2  
ATOM 2718  N N    . PHE A 1 75  ? 2.587   -1.883  -4.640  1.00 0.00 ? 75  PHE A N    2  
ATOM 2719  C CA   . PHE A 1 75  ? 3.805   -1.137  -4.345  1.00 0.00 ? 75  PHE A CA   2  
ATOM 2720  C C    . PHE A 1 75  ? 3.758   0.252   -4.977  1.00 0.00 ? 75  PHE A C    2  
ATOM 2721  O O    . PHE A 1 75  ? 4.197   1.233   -4.377  1.00 0.00 ? 75  PHE A O    2  
ATOM 2722  C CB   . PHE A 1 75  ? 5.031   -1.899  -4.852  1.00 0.00 ? 75  PHE A CB   2  
ATOM 2723  C CG   . PHE A 1 75  ? 5.565   -2.898  -3.867  1.00 0.00 ? 75  PHE A CG   2  
ATOM 2724  C CD1  . PHE A 1 75  ? 4.896   -4.090  -3.637  1.00 0.00 ? 75  PHE A CD1  2  
ATOM 2725  C CD2  . PHE A 1 75  ? 6.736   -2.647  -3.171  1.00 0.00 ? 75  PHE A CD2  2  
ATOM 2726  C CE1  . PHE A 1 75  ? 5.385   -5.011  -2.730  1.00 0.00 ? 75  PHE A CE1  2  
ATOM 2727  C CE2  . PHE A 1 75  ? 7.231   -3.564  -2.263  1.00 0.00 ? 75  PHE A CE2  2  
ATOM 2728  C CZ   . PHE A 1 75  ? 6.555   -4.749  -2.043  1.00 0.00 ? 75  PHE A CZ   2  
ATOM 2729  H H    . PHE A 1 75  ? 2.637   -2.666  -5.228  1.00 0.00 ? 75  PHE A H    2  
ATOM 2730  H HA   . PHE A 1 75  ? 3.876   -1.030  -3.274  1.00 0.00 ? 75  PHE A HA   2  
ATOM 2731  H HB2  . PHE A 1 75  ? 4.768   -2.431  -5.754  1.00 0.00 ? 75  PHE A HB2  2  
ATOM 2732  H HB3  . PHE A 1 75  ? 5.819   -1.194  -5.072  1.00 0.00 ? 75  PHE A HB3  2  
ATOM 2733  H HD1  . PHE A 1 75  ? 3.983   -4.297  -4.174  1.00 0.00 ? 75  PHE A HD1  2  
ATOM 2734  H HD2  . PHE A 1 75  ? 7.267   -1.720  -3.342  1.00 0.00 ? 75  PHE A HD2  2  
ATOM 2735  H HE1  . PHE A 1 75  ? 4.855   -5.936  -2.560  1.00 0.00 ? 75  PHE A HE1  2  
ATOM 2736  H HE2  . PHE A 1 75  ? 8.145   -3.356  -1.727  1.00 0.00 ? 75  PHE A HE2  2  
ATOM 2737  H HZ   . PHE A 1 75  ? 6.938   -5.466  -1.334  1.00 0.00 ? 75  PHE A HZ   2  
ATOM 2738  N N    . ALA A 1 76  ? 3.223   0.325   -6.191  1.00 0.00 ? 76  ALA A N    2  
ATOM 2739  C CA   . ALA A 1 76  ? 3.117   1.593   -6.904  1.00 0.00 ? 76  ALA A CA   2  
ATOM 2740  C C    . ALA A 1 76  ? 2.368   2.629   -6.073  1.00 0.00 ? 76  ALA A C    2  
ATOM 2741  O O    . ALA A 1 76  ? 2.780   3.784   -5.986  1.00 0.00 ? 76  ALA A O    2  
ATOM 2742  C CB   . ALA A 1 76  ? 2.427   1.388   -8.244  1.00 0.00 ? 76  ALA A CB   2  
ATOM 2743  H H    . ALA A 1 76  ? 2.890   -0.492  -6.617  1.00 0.00 ? 76  ALA A H    2  
ATOM 2744  H HA   . ALA A 1 76  ? 4.118   1.953   -7.093  1.00 0.00 ? 76  ALA A HA   2  
ATOM 2745  H HB1  . ALA A 1 76  ? 1.708   2.179   -8.402  1.00 0.00 ? 76  ALA A HB1  2  
ATOM 2746  H HB2  . ALA A 1 76  ? 3.162   1.406   -9.034  1.00 0.00 ? 76  ALA A HB2  2  
ATOM 2747  H HB3  . ALA A 1 76  ? 1.919   0.435   -8.245  1.00 0.00 ? 76  ALA A HB3  2  
ATOM 2748  N N    . ASN A 1 77  ? 1.264   2.207   -5.464  1.00 0.00 ? 77  ASN A N    2  
ATOM 2749  C CA   . ASN A 1 77  ? 0.456   3.099   -4.641  1.00 0.00 ? 77  ASN A CA   2  
ATOM 2750  C C    . ASN A 1 77  ? 1.216   3.518   -3.386  1.00 0.00 ? 77  ASN A C    2  
ATOM 2751  O O    . ASN A 1 77  ? 1.060   4.637   -2.898  1.00 0.00 ? 77  ASN A O    2  
ATOM 2752  C CB   . ASN A 1 77  ? -0.858  2.419   -4.252  1.00 0.00 ? 77  ASN A CB   2  
ATOM 2753  C CG   . ASN A 1 77  ? -1.952  3.417   -3.929  1.00 0.00 ? 77  ASN A CG   2  
ATOM 2754  O OD1  . ASN A 1 77  ? -2.162  3.771   -2.769  1.00 0.00 ? 77  ASN A OD1  2  
ATOM 2755  N ND2  . ASN A 1 77  ? -2.657  3.876   -4.957  1.00 0.00 ? 77  ASN A ND2  2  
ATOM 2756  H H    . ASN A 1 77  ? 0.986   1.273   -5.571  1.00 0.00 ? 77  ASN A H    2  
ATOM 2757  H HA   . ASN A 1 77  ? 0.236   3.980   -5.225  1.00 0.00 ? 77  ASN A HA   2  
ATOM 2758  H HB2  . ASN A 1 77  ? -1.192  1.801   -5.073  1.00 0.00 ? 77  ASN A HB2  2  
ATOM 2759  H HB3  . ASN A 1 77  ? -0.693  1.799   -3.384  1.00 0.00 ? 77  ASN A HB3  2  
ATOM 2760  H HD21 . ASN A 1 77  ? -2.434  3.549   -5.854  1.00 0.00 ? 77  ASN A HD21 2  
ATOM 2761  H HD22 . ASN A 1 77  ? -3.370  4.523   -4.777  1.00 0.00 ? 77  ASN A HD22 2  
ATOM 2762  N N    . ARG A 1 78  ? 2.039   2.611   -2.869  1.00 0.00 ? 78  ARG A N    2  
ATOM 2763  C CA   . ARG A 1 78  ? 2.822   2.886   -1.670  1.00 0.00 ? 78  ARG A CA   2  
ATOM 2764  C C    . ARG A 1 78  ? 3.949   3.869   -1.971  1.00 0.00 ? 78  ARG A C    2  
ATOM 2765  O O    . ARG A 1 78  ? 4.428   4.571   -1.080  1.00 0.00 ? 78  ARG A O    2  
ATOM 2766  C CB   . ARG A 1 78  ? 3.401   1.587   -1.105  1.00 0.00 ? 78  ARG A CB   2  
ATOM 2767  C CG   . ARG A 1 78  ? 2.349   0.534   -0.800  1.00 0.00 ? 78  ARG A CG   2  
ATOM 2768  C CD   . ARG A 1 78  ? 1.784   0.699   0.602   1.00 0.00 ? 78  ARG A CD   2  
ATOM 2769  N NE   . ARG A 1 78  ? 0.810   1.785   0.676   1.00 0.00 ? 78  ARG A NE   2  
ATOM 2770  C CZ   . ARG A 1 78  ? 0.047   2.016   1.738   1.00 0.00 ? 78  ARG A CZ   2  
ATOM 2771  N NH1  . ARG A 1 78  ? 0.145   1.243   2.810   1.00 0.00 ? 78  ARG A NH1  2  
ATOM 2772  N NH2  . ARG A 1 78  ? -0.817  3.024   1.728   1.00 0.00 ? 78  ARG A NH2  2  
ATOM 2773  H H    . ARG A 1 78  ? 2.120   1.736   -3.303  1.00 0.00 ? 78  ARG A H    2  
ATOM 2774  H HA   . ARG A 1 78  ? 2.163   3.325   -0.936  1.00 0.00 ? 78  ARG A HA   2  
ATOM 2775  H HB2  . ARG A 1 78  ? 4.095   1.174   -1.822  1.00 0.00 ? 78  ARG A HB2  2  
ATOM 2776  H HB3  . ARG A 1 78  ? 3.930   1.812   -0.191  1.00 0.00 ? 78  ARG A HB3  2  
ATOM 2777  H HG2  . ARG A 1 78  ? 1.543   0.625   -1.513  1.00 0.00 ? 78  ARG A HG2  2  
ATOM 2778  H HG3  . ARG A 1 78  ? 2.798   -0.445  -0.885  1.00 0.00 ? 78  ARG A HG3  2  
ATOM 2779  H HD2  . ARG A 1 78  ? 1.304   -0.223  0.894   1.00 0.00 ? 78  ARG A HD2  2  
ATOM 2780  H HD3  . ARG A 1 78  ? 2.598   0.911   1.280   1.00 0.00 ? 78  ARG A HD3  2  
ATOM 2781  H HE   . ARG A 1 78  ? 0.721   2.368   -0.106  1.00 0.00 ? 78  ARG A HE   2  
ATOM 2782  H HH11 . ARG A 1 78  ? 0.795   0.484   2.820   1.00 0.00 ? 78  ARG A HH11 2  
ATOM 2783  H HH12 . ARG A 1 78  ? -0.431  1.421   3.609   1.00 0.00 ? 78  ARG A HH12 2  
ATOM 2784  H HH21 . ARG A 1 78  ? -0.893  3.609   0.922   1.00 0.00 ? 78  ARG A HH21 2  
ATOM 2785  H HH22 . ARG A 1 78  ? -1.391  3.198   2.528   1.00 0.00 ? 78  ARG A HH22 2  
ATOM 2786  N N    . ARG A 1 79  ? 4.368   3.913   -3.231  1.00 0.00 ? 79  ARG A N    2  
ATOM 2787  C CA   . ARG A 1 79  ? 5.440   4.809   -3.649  1.00 0.00 ? 79  ARG A CA   2  
ATOM 2788  C C    . ARG A 1 79  ? 4.874   6.116   -4.197  1.00 0.00 ? 79  ARG A C    2  
ATOM 2789  O O    . ARG A 1 79  ? 5.537   7.153   -4.169  1.00 0.00 ? 79  ARG A O    2  
ATOM 2790  C CB   . ARG A 1 79  ? 6.313   4.135   -4.709  1.00 0.00 ? 79  ARG A CB   2  
ATOM 2791  C CG   . ARG A 1 79  ? 7.453   3.315   -4.128  1.00 0.00 ? 79  ARG A CG   2  
ATOM 2792  C CD   . ARG A 1 79  ? 8.585   3.147   -5.129  1.00 0.00 ? 79  ARG A CD   2  
ATOM 2793  N NE   . ARG A 1 79  ? 9.380   4.365   -5.266  1.00 0.00 ? 79  ARG A NE   2  
ATOM 2794  C CZ   . ARG A 1 79  ? 10.198  4.819   -4.322  1.00 0.00 ? 79  ARG A CZ   2  
ATOM 2795  N NH1  . ARG A 1 79  ? 10.328  4.159   -3.180  1.00 0.00 ? 79  ARG A NH1  2  
ATOM 2796  N NH2  . ARG A 1 79  ? 10.887  5.934   -4.521  1.00 0.00 ? 79  ARG A NH2  2  
ATOM 2797  H H    . ARG A 1 79  ? 3.947   3.329   -3.896  1.00 0.00 ? 79  ARG A H    2  
ATOM 2798  H HA   . ARG A 1 79  ? 6.046   5.028   -2.783  1.00 0.00 ? 79  ARG A HA   2  
ATOM 2799  H HB2  . ARG A 1 79  ? 5.695   3.479   -5.304  1.00 0.00 ? 79  ARG A HB2  2  
ATOM 2800  H HB3  . ARG A 1 79  ? 6.735   4.896   -5.347  1.00 0.00 ? 79  ARG A HB3  2  
ATOM 2801  H HG2  . ARG A 1 79  ? 7.834   3.816   -3.250  1.00 0.00 ? 79  ARG A HG2  2  
ATOM 2802  H HG3  . ARG A 1 79  ? 7.079   2.340   -3.853  1.00 0.00 ? 79  ARG A HG3  2  
ATOM 2803  H HD2  . ARG A 1 79  ? 9.227   2.345   -4.794  1.00 0.00 ? 79  ARG A HD2  2  
ATOM 2804  H HD3  . ARG A 1 79  ? 8.164   2.893   -6.089  1.00 0.00 ? 79  ARG A HD3  2  
ATOM 2805  H HE   . ARG A 1 79  ? 9.299   4.868   -6.102  1.00 0.00 ? 79  ARG A HE   2  
ATOM 2806  H HH11 . ARG A 1 79  ? 9.811   3.317   -3.027  1.00 0.00 ? 79  ARG A HH11 2  
ATOM 2807  H HH12 . ARG A 1 79  ? 10.946  4.502   -2.471  1.00 0.00 ? 79  ARG A HH12 2  
ATOM 2808  H HH21 . ARG A 1 79  ? 10.792  6.434   -5.382  1.00 0.00 ? 79  ARG A HH21 2  
ATOM 2809  H HH22 . ARG A 1 79  ? 11.502  6.275   -3.811  1.00 0.00 ? 79  ARG A HH22 2  
ATOM 2810  N N    . LYS A 1 80  ? 3.644   6.059   -4.696  1.00 0.00 ? 80  LYS A N    2  
ATOM 2811  C CA   . LYS A 1 80  ? 2.987   7.236   -5.250  1.00 0.00 ? 80  LYS A CA   2  
ATOM 2812  C C    . LYS A 1 80  ? 2.384   8.095   -4.143  1.00 0.00 ? 80  LYS A C    2  
ATOM 2813  O O    . LYS A 1 80  ? 2.321   9.318   -4.259  1.00 0.00 ? 80  LYS A O    2  
ATOM 2814  C CB   . LYS A 1 80  ? 1.895   6.819   -6.238  1.00 0.00 ? 80  LYS A CB   2  
ATOM 2815  C CG   . LYS A 1 80  ? 2.423   6.484   -7.622  1.00 0.00 ? 80  LYS A CG   2  
ATOM 2816  C CD   . LYS A 1 80  ? 1.322   5.958   -8.527  1.00 0.00 ? 80  LYS A CD   2  
ATOM 2817  C CE   . LYS A 1 80  ? 0.424   7.081   -9.024  1.00 0.00 ? 80  LYS A CE   2  
ATOM 2818  N NZ   . LYS A 1 80  ? -0.438  6.643   -10.156 1.00 0.00 ? 80  LYS A NZ   2  
ATOM 2819  H H    . LYS A 1 80  ? 3.166   5.202   -4.691  1.00 0.00 ? 80  LYS A H    2  
ATOM 2820  H HA   . LYS A 1 80  ? 3.732   7.816   -5.774  1.00 0.00 ? 80  LYS A HA   2  
ATOM 2821  H HB2  . LYS A 1 80  ? 1.387   5.949   -5.849  1.00 0.00 ? 80  LYS A HB2  2  
ATOM 2822  H HB3  . LYS A 1 80  ? 1.184   7.627   -6.333  1.00 0.00 ? 80  LYS A HB3  2  
ATOM 2823  H HG2  . LYS A 1 80  ? 2.841   7.376   -8.064  1.00 0.00 ? 80  LYS A HG2  2  
ATOM 2824  H HG3  . LYS A 1 80  ? 3.193   5.730   -7.531  1.00 0.00 ? 80  LYS A HG3  2  
ATOM 2825  H HD2  . LYS A 1 80  ? 1.770   5.468   -9.379  1.00 0.00 ? 80  LYS A HD2  2  
ATOM 2826  H HD3  . LYS A 1 80  ? 0.723   5.247   -7.975  1.00 0.00 ? 80  LYS A HD3  2  
ATOM 2827  H HE2  . LYS A 1 80  ? -0.205  7.408   -8.210  1.00 0.00 ? 80  LYS A HE2  2  
ATOM 2828  H HE3  . LYS A 1 80  ? 1.045   7.902   -9.351  1.00 0.00 ? 80  LYS A HE3  2  
ATOM 2829  H HZ1  . LYS A 1 80  ? 0.080   5.973   -10.761 1.00 0.00 ? 80  LYS A HZ1  2  
ATOM 2830  H HZ2  . LYS A 1 80  ? -0.719  7.463   -10.730 1.00 0.00 ? 80  LYS A HZ2  2  
ATOM 2831  H HZ3  . LYS A 1 80  ? -1.294  6.176   -9.795  1.00 0.00 ? 80  LYS A HZ3  2  
ATOM 2832  N N    . GLU A 1 81  ? 1.944   7.445   -3.070  1.00 0.00 ? 81  GLU A N    2  
ATOM 2833  C CA   . GLU A 1 81  ? 1.347   8.151   -1.942  1.00 0.00 ? 81  GLU A CA   2  
ATOM 2834  C C    . GLU A 1 81  ? 2.418   8.849   -1.109  1.00 0.00 ? 81  GLU A C    2  
ATOM 2835  O O    . GLU A 1 81  ? 2.270   10.014  -0.740  1.00 0.00 ? 81  GLU A O    2  
ATOM 2836  C CB   . GLU A 1 81  ? 0.557   7.178   -1.064  1.00 0.00 ? 81  GLU A CB   2  
ATOM 2837  C CG   . GLU A 1 81  ? 1.432   6.308   -0.178  1.00 0.00 ? 81  GLU A CG   2  
ATOM 2838  C CD   . GLU A 1 81  ? 0.625   5.389   0.718   1.00 0.00 ? 81  GLU A CD   2  
ATOM 2839  O OE1  . GLU A 1 81  ? -0.621  5.451   0.662   1.00 0.00 ? 81  GLU A OE1  2  
ATOM 2840  O OE2  . GLU A 1 81  ? 1.239   4.607   1.474   1.00 0.00 ? 81  GLU A OE2  2  
ATOM 2841  H H    . GLU A 1 81  ? 2.022   6.469   -3.036  1.00 0.00 ? 81  GLU A H    2  
ATOM 2842  H HA   . GLU A 1 81  ? 0.673   8.895   -2.336  1.00 0.00 ? 81  GLU A HA   2  
ATOM 2843  H HB2  . GLU A 1 81  ? -0.111  7.744   -0.431  1.00 0.00 ? 81  GLU A HB2  2  
ATOM 2844  H HB3  . GLU A 1 81  ? -0.028  6.532   -1.701  1.00 0.00 ? 81  GLU A HB3  2  
ATOM 2845  H HG2  . GLU A 1 81  ? 2.071   5.705   -0.805  1.00 0.00 ? 81  GLU A HG2  2  
ATOM 2846  H HG3  . GLU A 1 81  ? 2.042   6.948   0.444   1.00 0.00 ? 81  GLU A HG3  2  
ATOM 2847  N N    . GLU A 1 82  ? 3.496   8.128   -0.817  1.00 0.00 ? 82  GLU A N    2  
ATOM 2848  C CA   . GLU A 1 82  ? 4.591   8.679   -0.026  1.00 0.00 ? 82  GLU A CA   2  
ATOM 2849  C C    . GLU A 1 82  ? 5.188   9.909   -0.705  1.00 0.00 ? 82  GLU A C    2  
ATOM 2850  O O    . GLU A 1 82  ? 5.580   10.868  -0.041  1.00 0.00 ? 82  GLU A O    2  
ATOM 2851  C CB   . GLU A 1 82  ? 5.678   7.623   0.186   1.00 0.00 ? 82  GLU A CB   2  
ATOM 2852  C CG   . GLU A 1 82  ? 6.433   7.263   -1.083  1.00 0.00 ? 82  GLU A CG   2  
ATOM 2853  C CD   . GLU A 1 82  ? 7.640   6.385   -0.814  1.00 0.00 ? 82  GLU A CD   2  
ATOM 2854  O OE1  . GLU A 1 82  ? 7.494   5.386   -0.080  1.00 0.00 ? 82  GLU A OE1  2  
ATOM 2855  O OE2  . GLU A 1 82  ? 8.729   6.697   -1.338  1.00 0.00 ? 82  GLU A OE2  2  
ATOM 2856  H H    . GLU A 1 82  ? 3.557   7.205   -1.139  1.00 0.00 ? 82  GLU A H    2  
ATOM 2857  H HA   . GLU A 1 82  ? 4.193   8.970   0.934   1.00 0.00 ? 82  GLU A HA   2  
ATOM 2858  H HB2  . GLU A 1 82  ? 6.388   7.994   0.910   1.00 0.00 ? 82  GLU A HB2  2  
ATOM 2859  H HB3  . GLU A 1 82  ? 5.219   6.725   0.573   1.00 0.00 ? 82  GLU A HB3  2  
ATOM 2860  H HG2  . GLU A 1 82  ? 5.764   6.735   -1.747  1.00 0.00 ? 82  GLU A HG2  2  
ATOM 2861  H HG3  . GLU A 1 82  ? 6.766   8.173   -1.558  1.00 0.00 ? 82  GLU A HG3  2  
ATOM 2862  N N    . ALA A 1 83  ? 5.252   9.872   -2.032  1.00 0.00 ? 83  ALA A N    2  
ATOM 2863  C CA   . ALA A 1 83  ? 5.798   10.983  -2.801  1.00 0.00 ? 83  ALA A CA   2  
ATOM 2864  C C    . ALA A 1 83  ? 4.738   12.048  -3.056  1.00 0.00 ? 83  ALA A C    2  
ATOM 2865  O O    . ALA A 1 83  ? 5.054   13.173  -3.446  1.00 0.00 ? 83  ALA A O    2  
ATOM 2866  C CB   . ALA A 1 83  ? 6.373   10.482  -4.117  1.00 0.00 ? 83  ALA A CB   2  
ATOM 2867  H H    . ALA A 1 83  ? 4.923   9.080   -2.504  1.00 0.00 ? 83  ALA A H    2  
ATOM 2868  H HA   . ALA A 1 83  ? 6.604   11.421  -2.228  1.00 0.00 ? 83  ALA A HA   2  
ATOM 2869  H HB1  . ALA A 1 83  ? 5.729   10.787  -4.929  1.00 0.00 ? 83  ALA A HB1  2  
ATOM 2870  H HB2  . ALA A 1 83  ? 7.358   10.899  -4.262  1.00 0.00 ? 83  ALA A HB2  2  
ATOM 2871  H HB3  . ALA A 1 83  ? 6.438   9.404   -4.094  1.00 0.00 ? 83  ALA A HB3  2  
ATOM 2872  N N    . PHE A 1 84  ? 3.478   11.688  -2.835  1.00 0.00 ? 84  PHE A N    2  
ATOM 2873  C CA   . PHE A 1 84  ? 2.370   12.612  -3.043  1.00 0.00 ? 84  PHE A CA   2  
ATOM 2874  C C    . PHE A 1 84  ? 2.561   13.884  -2.221  1.00 0.00 ? 84  PHE A C    2  
ATOM 2875  O O    . PHE A 1 84  ? 2.736   14.971  -2.771  1.00 0.00 ? 84  PHE A O    2  
ATOM 2876  C CB   . PHE A 1 84  ? 1.044   11.945  -2.670  1.00 0.00 ? 84  PHE A CB   2  
ATOM 2877  C CG   . PHE A 1 84  ? -0.157  12.630  -3.257  1.00 0.00 ? 84  PHE A CG   2  
ATOM 2878  C CD1  . PHE A 1 84  ? -0.478  13.928  -2.893  1.00 0.00 ? 84  PHE A CD1  2  
ATOM 2879  C CD2  . PHE A 1 84  ? -0.966  11.976  -4.173  1.00 0.00 ? 84  PHE A CD2  2  
ATOM 2880  C CE1  . PHE A 1 84  ? -1.583  14.560  -3.430  1.00 0.00 ? 84  PHE A CE1  2  
ATOM 2881  C CE2  . PHE A 1 84  ? -2.072  12.604  -4.714  1.00 0.00 ? 84  PHE A CE2  2  
ATOM 2882  C CZ   . PHE A 1 84  ? -2.380  13.898  -4.343  1.00 0.00 ? 84  PHE A CZ   2  
ATOM 2883  H H    . PHE A 1 84  ? 3.289   10.777  -2.525  1.00 0.00 ? 84  PHE A H    2  
ATOM 2884  H HA   . PHE A 1 84  ? 2.350   12.874  -4.089  1.00 0.00 ? 84  PHE A HA   2  
ATOM 2885  H HB2  . PHE A 1 84  ? 1.050   10.926  -3.025  1.00 0.00 ? 84  PHE A HB2  2  
ATOM 2886  H HB3  . PHE A 1 84  ? 0.938   11.948  -1.596  1.00 0.00 ? 84  PHE A HB3  2  
ATOM 2887  H HD1  . PHE A 1 84  ? 0.146   14.448  -2.180  1.00 0.00 ? 84  PHE A HD1  2  
ATOM 2888  H HD2  . PHE A 1 84  ? -0.725  10.963  -4.464  1.00 0.00 ? 84  PHE A HD2  2  
ATOM 2889  H HE1  . PHE A 1 84  ? -1.822  15.572  -3.138  1.00 0.00 ? 84  PHE A HE1  2  
ATOM 2890  H HE2  . PHE A 1 84  ? -2.693  12.082  -5.427  1.00 0.00 ? 84  PHE A HE2  2  
ATOM 2891  H HZ   . PHE A 1 84  ? -3.244  14.389  -4.764  1.00 0.00 ? 84  PHE A HZ   2  
ATOM 2892  N N    . ARG A 1 85  ? 2.526   13.738  -0.900  1.00 0.00 ? 85  ARG A N    2  
ATOM 2893  C CA   . ARG A 1 85  ? 2.693   14.874  -0.002  1.00 0.00 ? 85  ARG A CA   2  
ATOM 2894  C C    . ARG A 1 85  ? 3.810   15.792  -0.488  1.00 0.00 ? 85  ARG A C    2  
ATOM 2895  O O    . ARG A 1 85  ? 3.826   16.983  -0.179  1.00 0.00 ? 85  ARG A O    2  
ATOM 2896  C CB   . ARG A 1 85  ? 2.998   14.389  1.417   1.00 0.00 ? 85  ARG A CB   2  
ATOM 2897  C CG   . ARG A 1 85  ? 1.756   14.171  2.266   1.00 0.00 ? 85  ARG A CG   2  
ATOM 2898  C CD   . ARG A 1 85  ? 2.110   13.997  3.735   1.00 0.00 ? 85  ARG A CD   2  
ATOM 2899  N NE   . ARG A 1 85  ? 2.202   15.278  4.431   1.00 0.00 ? 85  ARG A NE   2  
ATOM 2900  C CZ   . ARG A 1 85  ? 2.619   15.403  5.686   1.00 0.00 ? 85  ARG A CZ   2  
ATOM 2901  N NH1  . ARG A 1 85  ? 2.980   14.332  6.379   1.00 0.00 ? 85  ARG A NH1  2  
ATOM 2902  N NH2  . ARG A 1 85  ? 2.675   16.603  6.251   1.00 0.00 ? 85  ARG A NH2  2  
ATOM 2903  H H    . ARG A 1 85  ? 2.383   12.846  -0.521  1.00 0.00 ? 85  ARG A H    2  
ATOM 2904  H HA   . ARG A 1 85  ? 1.766   15.429  0.008   1.00 0.00 ? 85  ARG A HA   2  
ATOM 2905  H HB2  . ARG A 1 85  ? 3.535   13.454  1.357   1.00 0.00 ? 85  ARG A HB2  2  
ATOM 2906  H HB3  . ARG A 1 85  ? 3.620   15.122  1.908   1.00 0.00 ? 85  ARG A HB3  2  
ATOM 2907  H HG2  . ARG A 1 85  ? 1.106   15.028  2.163   1.00 0.00 ? 85  ARG A HG2  2  
ATOM 2908  H HG3  . ARG A 1 85  ? 1.246   13.285  1.920   1.00 0.00 ? 85  ARG A HG3  2  
ATOM 2909  H HD2  . ARG A 1 85  ? 1.346   13.396  4.206   1.00 0.00 ? 85  ARG A HD2  2  
ATOM 2910  H HD3  . ARG A 1 85  ? 3.061   13.490  3.804   1.00 0.00 ? 85  ARG A HD3  2  
ATOM 2911  H HE   . ARG A 1 85  ? 1.940   16.082  3.938   1.00 0.00 ? 85  ARG A HE   2  
ATOM 2912  H HH11 . ARG A 1 85  ? 2.939   13.427  5.955   1.00 0.00 ? 85  ARG A HH11 2  
ATOM 2913  H HH12 . ARG A 1 85  ? 3.294   14.429  7.323   1.00 0.00 ? 85  ARG A HH12 2  
ATOM 2914  H HH21 . ARG A 1 85  ? 2.404   17.413  5.732   1.00 0.00 ? 85  ARG A HH21 2  
ATOM 2915  H HH22 . ARG A 1 85  ? 2.988   16.696  7.195   1.00 0.00 ? 85  ARG A HH22 2  
ATOM 2916  N N    . GLN A 1 86  ? 4.743   15.229  -1.250  1.00 0.00 ? 86  GLN A N    2  
ATOM 2917  C CA   . GLN A 1 86  ? 5.864   15.997  -1.777  1.00 0.00 ? 86  GLN A CA   2  
ATOM 2918  C C    . GLN A 1 86  ? 5.544   16.545  -3.164  1.00 0.00 ? 86  GLN A C    2  
ATOM 2919  O O    . GLN A 1 86  ? 5.951   17.653  -3.514  1.00 0.00 ? 86  GLN A O    2  
ATOM 2920  C CB   . GLN A 1 86  ? 7.122   15.128  -1.837  1.00 0.00 ? 86  GLN A CB   2  
ATOM 2921  C CG   . GLN A 1 86  ? 7.511   14.528  -0.496  1.00 0.00 ? 86  GLN A CG   2  
ATOM 2922  C CD   . GLN A 1 86  ? 8.923   13.975  -0.492  1.00 0.00 ? 86  GLN A CD   2  
ATOM 2923  O OE1  . GLN A 1 86  ? 9.888   14.705  -0.721  1.00 0.00 ? 86  GLN A OE1  2  
ATOM 2924  N NE2  . GLN A 1 86  ? 9.051   12.680  -0.230  1.00 0.00 ? 86  GLN A NE2  2  
ATOM 2925  H H    . GLN A 1 86  ? 4.675   14.275  -1.461  1.00 0.00 ? 86  GLN A H    2  
ATOM 2926  H HA   . GLN A 1 86  ? 6.042   16.825  -1.109  1.00 0.00 ? 86  GLN A HA   2  
ATOM 2927  H HB2  . GLN A 1 86  ? 6.954   14.320  -2.534  1.00 0.00 ? 86  GLN A HB2  2  
ATOM 2928  H HB3  . GLN A 1 86  ? 7.945   15.731  -2.190  1.00 0.00 ? 86  GLN A HB3  2  
ATOM 2929  H HG2  . GLN A 1 86  ? 7.439   15.294  0.261   1.00 0.00 ? 86  GLN A HG2  2  
ATOM 2930  H HG3  . GLN A 1 86  ? 6.825   13.727  -0.262  1.00 0.00 ? 86  GLN A HG3  2  
ATOM 2931  H HE21 . GLN A 1 86  ? 8.237   12.160  -0.058  1.00 0.00 ? 86  GLN A HE21 2  
ATOM 2932  H HE22 . GLN A 1 86  ? 9.951   12.296  -0.221  1.00 0.00 ? 86  GLN A HE22 2  
ATOM 2933  N N    . LYS A 1 87  ? 4.813   15.762  -3.950  1.00 0.00 ? 87  LYS A N    2  
ATOM 2934  C CA   . LYS A 1 87  ? 4.437   16.169  -5.299  1.00 0.00 ? 87  LYS A CA   2  
ATOM 2935  C C    . LYS A 1 87  ? 3.547   17.407  -5.266  1.00 0.00 ? 87  LYS A C    2  
ATOM 2936  O O    . LYS A 1 87  ? 3.752   18.352  -6.029  1.00 0.00 ? 87  LYS A O    2  
ATOM 2937  C CB   . LYS A 1 87  ? 3.712   15.026  -6.014  1.00 0.00 ? 87  LYS A CB   2  
ATOM 2938  C CG   . LYS A 1 87  ? 3.080   15.438  -7.333  1.00 0.00 ? 87  LYS A CG   2  
ATOM 2939  C CD   . LYS A 1 87  ? 1.915   14.534  -7.699  1.00 0.00 ? 87  LYS A CD   2  
ATOM 2940  C CE   . LYS A 1 87  ? 0.812   14.595  -6.654  1.00 0.00 ? 87  LYS A CE   2  
ATOM 2941  N NZ   . LYS A 1 87  ? -0.519  14.259  -7.232  1.00 0.00 ? 87  LYS A NZ   2  
ATOM 2942  H H    . LYS A 1 87  ? 4.518   14.889  -3.614  1.00 0.00 ? 87  LYS A H    2  
ATOM 2943  H HA   . LYS A 1 87  ? 5.341   16.404  -5.839  1.00 0.00 ? 87  LYS A HA   2  
ATOM 2944  H HB2  . LYS A 1 87  ? 4.420   14.234  -6.210  1.00 0.00 ? 87  LYS A HB2  2  
ATOM 2945  H HB3  . LYS A 1 87  ? 2.933   14.649  -5.368  1.00 0.00 ? 87  LYS A HB3  2  
ATOM 2946  H HG2  . LYS A 1 87  ? 2.721   16.453  -7.248  1.00 0.00 ? 87  LYS A HG2  2  
ATOM 2947  H HG3  . LYS A 1 87  ? 3.826   15.382  -8.112  1.00 0.00 ? 87  LYS A HG3  2  
ATOM 2948  H HD2  . LYS A 1 87  ? 1.512   14.848  -8.650  1.00 0.00 ? 87  LYS A HD2  2  
ATOM 2949  H HD3  . LYS A 1 87  ? 2.271   13.516  -7.775  1.00 0.00 ? 87  LYS A HD3  2  
ATOM 2950  H HE2  . LYS A 1 87  ? 1.040   13.892  -5.867  1.00 0.00 ? 87  LYS A HE2  2  
ATOM 2951  H HE3  . LYS A 1 87  ? 0.776   15.594  -6.246  1.00 0.00 ? 87  LYS A HE3  2  
ATOM 2952  H HZ1  . LYS A 1 87  ? -0.400  13.767  -8.141  1.00 0.00 ? 87  LYS A HZ1  2  
ATOM 2953  H HZ2  . LYS A 1 87  ? -1.069  15.127  -7.391  1.00 0.00 ? 87  LYS A HZ2  2  
ATOM 2954  H HZ3  . LYS A 1 87  ? -1.046  13.642  -6.582  1.00 0.00 ? 87  LYS A HZ3  2  
ATOM 2955  N N    . LEU A 1 88  ? 2.560   17.397  -4.377  1.00 0.00 ? 88  LEU A N    2  
ATOM 2956  C CA   . LEU A 1 88  ? 1.640   18.521  -4.243  1.00 0.00 ? 88  LEU A CA   2  
ATOM 2957  C C    . LEU A 1 88  ? 2.368   19.765  -3.746  1.00 0.00 ? 88  LEU A C    2  
ATOM 2958  O O    . LEU A 1 88  ? 1.799   20.856  -3.706  1.00 0.00 ? 88  LEU A O    2  
ATOM 2959  C CB   . LEU A 1 88  ? 0.503   18.164  -3.284  1.00 0.00 ? 88  LEU A CB   2  
ATOM 2960  C CG   . LEU A 1 88  ? 0.923   17.594  -1.928  1.00 0.00 ? 88  LEU A CG   2  
ATOM 2961  C CD1  . LEU A 1 88  ? 1.752   18.609  -1.156  1.00 0.00 ? 88  LEU A CD1  2  
ATOM 2962  C CD2  . LEU A 1 88  ? -0.299  17.177  -1.123  1.00 0.00 ? 88  LEU A CD2  2  
ATOM 2963  H H    . LEU A 1 88  ? 2.446   16.616  -3.797  1.00 0.00 ? 88  LEU A H    2  
ATOM 2964  H HA   . LEU A 1 88  ? 1.225   18.727  -5.219  1.00 0.00 ? 88  LEU A HA   2  
ATOM 2965  H HB2  . LEU A 1 88  ? -0.070  19.060  -3.102  1.00 0.00 ? 88  LEU A HB2  2  
ATOM 2966  H HB3  . LEU A 1 88  ? -0.123  17.431  -3.772  1.00 0.00 ? 88  LEU A HB3  2  
ATOM 2967  H HG   . LEU A 1 88  ? 1.535   16.716  -2.088  1.00 0.00 ? 88  LEU A HG   2  
ATOM 2968  H HD11 . LEU A 1 88  ? 1.665   18.414  -0.098  1.00 0.00 ? 88  LEU A HD11 2  
ATOM 2969  H HD12 . LEU A 1 88  ? 1.392   19.604  -1.370  1.00 0.00 ? 88  LEU A HD12 2  
ATOM 2970  H HD13 . LEU A 1 88  ? 2.788   18.529  -1.454  1.00 0.00 ? 88  LEU A HD13 2  
ATOM 2971  H HD21 . LEU A 1 88  ? -0.302  16.103  -1.005  1.00 0.00 ? 88  LEU A HD21 2  
ATOM 2972  H HD22 . LEU A 1 88  ? -1.194  17.484  -1.643  1.00 0.00 ? 88  LEU A HD22 2  
ATOM 2973  H HD23 . LEU A 1 88  ? -0.267  17.646  -0.151  1.00 0.00 ? 88  LEU A HD23 2  
ATOM 2974  N N    . ALA A 1 89  ? 3.631   19.594  -3.369  1.00 0.00 ? 89  ALA A N    2  
ATOM 2975  C CA   . ALA A 1 89  ? 4.439   20.704  -2.878  1.00 0.00 ? 89  ALA A CA   2  
ATOM 2976  C C    . ALA A 1 89  ? 5.276   21.311  -3.999  1.00 0.00 ? 89  ALA A C    2  
ATOM 2977  O O    . ALA A 1 89  ? 5.386   22.531  -4.113  1.00 0.00 ? 89  ALA A O    2  
ATOM 2978  C CB   . ALA A 1 89  ? 5.335   20.241  -1.739  1.00 0.00 ? 89  ALA A CB   2  
ATOM 2979  H H    . ALA A 1 89  ? 4.029   18.701  -3.424  1.00 0.00 ? 89  ALA A H    2  
ATOM 2980  H HA   . ALA A 1 89  ? 3.769   21.460  -2.493  1.00 0.00 ? 89  ALA A HA   2  
ATOM 2981  H HB1  . ALA A 1 89  ? 5.275   19.166  -1.649  1.00 0.00 ? 89  ALA A HB1  2  
ATOM 2982  H HB2  . ALA A 1 89  ? 6.355   20.530  -1.943  1.00 0.00 ? 89  ALA A HB2  2  
ATOM 2983  H HB3  . ALA A 1 89  ? 5.009   20.698  -0.817  1.00 0.00 ? 89  ALA A HB3  2  
ATOM 2984  N N    . MET A 1 90  ? 5.865   20.451  -4.824  1.00 0.00 ? 90  MET A N    2  
ATOM 2985  C CA   . MET A 1 90  ? 6.692   20.904  -5.936  1.00 0.00 ? 90  MET A CA   2  
ATOM 2986  C C    . MET A 1 90  ? 5.857   21.670  -6.958  1.00 0.00 ? 90  MET A C    2  
ATOM 2987  O O    . MET A 1 90  ? 6.292   22.693  -7.487  1.00 0.00 ? 90  MET A O    2  
ATOM 2988  C CB   . MET A 1 90  ? 7.376   19.712  -6.609  1.00 0.00 ? 90  MET A CB   2  
ATOM 2989  C CG   . MET A 1 90  ? 8.163   18.839  -5.646  1.00 0.00 ? 90  MET A CG   2  
ATOM 2990  S SD   . MET A 1 90  ? 8.990   17.465  -6.470  1.00 0.00 ? 90  MET A SD   2  
ATOM 2991  C CE   . MET A 1 90  ? 9.193   16.324  -5.104  1.00 0.00 ? 90  MET A CE   2  
ATOM 2992  H H    . MET A 1 90  ? 5.739   19.489  -4.683  1.00 0.00 ? 90  MET A H    2  
ATOM 2993  H HA   . MET A 1 90  ? 7.448   21.564  -5.539  1.00 0.00 ? 90  MET A HA   2  
ATOM 2994  H HB2  . MET A 1 90  ? 6.623   19.100  -7.083  1.00 0.00 ? 90  MET A HB2  2  
ATOM 2995  H HB3  . MET A 1 90  ? 8.055   20.081  -7.364  1.00 0.00 ? 90  MET A HB3  2  
ATOM 2996  H HG2  . MET A 1 90  ? 8.909   19.448  -5.156  1.00 0.00 ? 90  MET A HG2  2  
ATOM 2997  H HG3  . MET A 1 90  ? 7.484   18.442  -4.906  1.00 0.00 ? 90  MET A HG3  2  
ATOM 2998  H HE1  . MET A 1 90  ? 9.865   15.530  -5.395  1.00 0.00 ? 90  MET A HE1  2  
ATOM 2999  H HE2  . MET A 1 90  ? 9.603   16.850  -4.255  1.00 0.00 ? 90  MET A HE2  2  
ATOM 3000  H HE3  . MET A 1 90  ? 8.233   15.905  -4.840  1.00 0.00 ? 90  MET A HE3  2  
ATOM 3001  N N    . ASP A 1 91  ? 4.658   21.168  -7.231  1.00 0.00 ? 91  ASP A N    2  
ATOM 3002  C CA   . ASP A 1 91  ? 3.762   21.806  -8.189  1.00 0.00 ? 91  ASP A CA   2  
ATOM 3003  C C    . ASP A 1 91  ? 3.510   23.262  -7.811  1.00 0.00 ? 91  ASP A C    2  
ATOM 3004  O O    . ASP A 1 91  ? 3.986   23.737  -6.781  1.00 0.00 ? 91  ASP A O    2  
ATOM 3005  C CB   . ASP A 1 91  ? 2.436   21.047  -8.263  1.00 0.00 ? 91  ASP A CB   2  
ATOM 3006  C CG   . ASP A 1 91  ? 1.709   21.279  -9.572  1.00 0.00 ? 91  ASP A CG   2  
ATOM 3007  O OD1  . ASP A 1 91  ? 2.324   21.068  -10.639 1.00 0.00 ? 91  ASP A OD1  2  
ATOM 3008  O OD2  . ASP A 1 91  ? 0.524   21.671  -9.531  1.00 0.00 ? 91  ASP A OD2  2  
ATOM 3009  H H    . ASP A 1 91  ? 4.368   20.349  -6.777  1.00 0.00 ? 91  ASP A H    2  
ATOM 3010  H HA   . ASP A 1 91  ? 4.238   21.776  -9.158  1.00 0.00 ? 91  ASP A HA   2  
ATOM 3011  H HB2  . ASP A 1 91  ? 2.628   19.989  -8.162  1.00 0.00 ? 91  ASP A HB2  2  
ATOM 3012  H HB3  . ASP A 1 91  ? 1.798   21.372  -7.454  1.00 0.00 ? 91  ASP A HB3  2  
ATOM 3013  N N    . ALA A 1 92  ? 2.758   23.964  -8.652  1.00 0.00 ? 92  ALA A N    2  
ATOM 3014  C CA   . ALA A 1 92  ? 2.441   25.365  -8.405  1.00 0.00 ? 92  ALA A CA   2  
ATOM 3015  C C    . ALA A 1 92  ? 1.105   25.507  -7.682  1.00 0.00 ? 92  ALA A C    2  
ATOM 3016  O O    . ALA A 1 92  ? 0.051   25.202  -8.240  1.00 0.00 ? 92  ALA A O    2  
ATOM 3017  C CB   . ALA A 1 92  ? 2.420   26.140  -9.714  1.00 0.00 ? 92  ALA A CB   2  
ATOM 3018  H H    . ALA A 1 92  ? 2.406   23.529  -9.456  1.00 0.00 ? 92  ALA A H    2  
ATOM 3019  H HA   . ALA A 1 92  ? 3.221   25.779  -7.783  1.00 0.00 ? 92  ALA A HA   2  
ATOM 3020  H HB1  . ALA A 1 92  ? 3.413   26.156  -10.138 1.00 0.00 ? 92  ALA A HB1  2  
ATOM 3021  H HB2  . ALA A 1 92  ? 1.741   25.661  -10.405 1.00 0.00 ? 92  ALA A HB2  2  
ATOM 3022  H HB3  . ALA A 1 92  ? 2.091   27.152  -9.528  1.00 0.00 ? 92  ALA A HB3  2  
ATOM 3023  N N    . TYR A 1 93  ? 1.158   25.972  -6.439  1.00 0.00 ? 93  TYR A N    2  
ATOM 3024  C CA   . TYR A 1 93  ? -0.048  26.151  -5.639  1.00 0.00 ? 93  TYR A CA   2  
ATOM 3025  C C    . TYR A 1 93  ? -1.064  27.021  -6.373  1.00 0.00 ? 93  TYR A C    2  
ATOM 3026  O O    . TYR A 1 93  ? -0.744  27.657  -7.376  1.00 0.00 ? 93  TYR A O    2  
ATOM 3027  C CB   . TYR A 1 93  ? 0.299   26.781  -4.289  1.00 0.00 ? 93  TYR A CB   2  
ATOM 3028  C CG   . TYR A 1 93  ? 0.381   28.290  -4.328  1.00 0.00 ? 93  TYR A CG   2  
ATOM 3029  C CD1  . TYR A 1 93  ? -0.752  29.072  -4.135  1.00 0.00 ? 93  TYR A CD1  2  
ATOM 3030  C CD2  . TYR A 1 93  ? 1.589   28.935  -4.560  1.00 0.00 ? 93  TYR A CD2  2  
ATOM 3031  C CE1  . TYR A 1 93  ? -0.683  30.451  -4.170  1.00 0.00 ? 93  TYR A CE1  2  
ATOM 3032  C CE2  . TYR A 1 93  ? 1.668   30.314  -4.596  1.00 0.00 ? 93  TYR A CE2  2  
ATOM 3033  C CZ   . TYR A 1 93  ? 0.529   31.067  -4.401  1.00 0.00 ? 93  TYR A CZ   2  
ATOM 3034  O OH   . TYR A 1 93  ? 0.604   32.441  -4.437  1.00 0.00 ? 93  TYR A OH   2  
ATOM 3035  H H    . TYR A 1 93  ? 2.028   26.198  -6.049  1.00 0.00 ? 93  TYR A H    2  
ATOM 3036  H HA   . TYR A 1 93  ? -0.482  25.176  -5.469  1.00 0.00 ? 93  TYR A HA   2  
ATOM 3037  H HB2  . TYR A 1 93  ? -0.456  26.509  -3.568  1.00 0.00 ? 93  TYR A HB2  2  
ATOM 3038  H HB3  . TYR A 1 93  ? 1.257   26.405  -3.960  1.00 0.00 ? 93  TYR A HB3  2  
ATOM 3039  H HD1  . TYR A 1 93  ? -1.700  28.586  -3.954  1.00 0.00 ? 93  TYR A HD1  2  
ATOM 3040  H HD2  . TYR A 1 93  ? 2.479   28.342  -4.713  1.00 0.00 ? 93  TYR A HD2  2  
ATOM 3041  H HE1  . TYR A 1 93  ? -1.574  31.042  -4.017  1.00 0.00 ? 93  TYR A HE1  2  
ATOM 3042  H HE2  . TYR A 1 93  ? 2.617   30.796  -4.777  1.00 0.00 ? 93  TYR A HE2  2  
ATOM 3043  H HH   . TYR A 1 93  ? 1.284   32.741  -3.830  1.00 0.00 ? 93  TYR A HH   2  
ATOM 3044  N N    . SER A 1 94  ? -2.292  27.044  -5.863  1.00 0.00 ? 94  SER A N    2  
ATOM 3045  C CA   . SER A 1 94  ? -3.357  27.832  -6.470  1.00 0.00 ? 94  SER A CA   2  
ATOM 3046  C C    . SER A 1 94  ? -4.385  28.254  -5.424  1.00 0.00 ? 94  SER A C    2  
ATOM 3047  O O    . SER A 1 94  ? -4.287  27.878  -4.255  1.00 0.00 ? 94  SER A O    2  
ATOM 3048  C CB   . SER A 1 94  ? -4.042  27.034  -7.581  1.00 0.00 ? 94  SER A CB   2  
ATOM 3049  O OG   . SER A 1 94  ? -4.480  25.773  -7.107  1.00 0.00 ? 94  SER A OG   2  
ATOM 3050  H H    . SER A 1 94  ? -2.485  26.515  -5.060  1.00 0.00 ? 94  SER A H    2  
ATOM 3051  H HA   . SER A 1 94  ? -2.912  28.718  -6.897  1.00 0.00 ? 94  SER A HA   2  
ATOM 3052  H HB2  . SER A 1 94  ? -4.896  27.586  -7.943  1.00 0.00 ? 94  SER A HB2  2  
ATOM 3053  H HB3  . SER A 1 94  ? -3.344  26.879  -8.391  1.00 0.00 ? 94  SER A HB3  2  
ATOM 3054  H HG   . SER A 1 94  ? -4.863  25.273  -7.832  1.00 0.00 ? 94  SER A HG   2  
ATOM 3055  N N    . SER A 1 95  ? -5.369  29.037  -5.852  1.00 0.00 ? 95  SER A N    2  
ATOM 3056  C CA   . SER A 1 95  ? -6.414  29.514  -4.953  1.00 0.00 ? 95  SER A CA   2  
ATOM 3057  C C    . SER A 1 95  ? -6.987  28.365  -4.129  1.00 0.00 ? 95  SER A C    2  
ATOM 3058  O O    . SER A 1 95  ? -7.554  27.418  -4.673  1.00 0.00 ? 95  SER A O    2  
ATOM 3059  C CB   . SER A 1 95  ? -7.531  30.192  -5.749  1.00 0.00 ? 95  SER A CB   2  
ATOM 3060  O OG   . SER A 1 95  ? -8.459  30.825  -4.886  1.00 0.00 ? 95  SER A OG   2  
ATOM 3061  H H    . SER A 1 95  ? -5.392  29.302  -6.796  1.00 0.00 ? 95  SER A H    2  
ATOM 3062  H HA   . SER A 1 95  ? -5.971  30.235  -4.284  1.00 0.00 ? 95  SER A HA   2  
ATOM 3063  H HB2  . SER A 1 95  ? -7.102  30.935  -6.404  1.00 0.00 ? 95  SER A HB2  2  
ATOM 3064  H HB3  . SER A 1 95  ? -8.051  29.450  -6.337  1.00 0.00 ? 95  SER A HB3  2  
ATOM 3065  H HG   . SER A 1 95  ? -9.133  31.266  -5.408  1.00 0.00 ? 95  SER A HG   2  
ATOM 3066  N N    . ASN A 1 96  ? -6.834  28.456  -2.812  1.00 0.00 ? 96  ASN A N    2  
ATOM 3067  C CA   . ASN A 1 96  ? -7.335  27.425  -1.911  1.00 0.00 ? 96  ASN A CA   2  
ATOM 3068  C C    . ASN A 1 96  ? -8.428  27.980  -1.003  1.00 0.00 ? 96  ASN A C    2  
ATOM 3069  O O    . ASN A 1 96  ? -8.389  29.145  -0.608  1.00 0.00 ? 96  ASN A O    2  
ATOM 3070  C CB   . ASN A 1 96  ? -6.193  26.858  -1.065  1.00 0.00 ? 96  ASN A CB   2  
ATOM 3071  C CG   . ASN A 1 96  ? -6.567  25.554  -0.387  1.00 0.00 ? 96  ASN A CG   2  
ATOM 3072  O OD1  . ASN A 1 96  ? -6.704  25.493  0.835   1.00 0.00 ? 96  ASN A OD1  2  
ATOM 3073  N ND2  . ASN A 1 96  ? -6.735  24.502  -1.181  1.00 0.00 ? 96  ASN A ND2  2  
ATOM 3074  H H    . ASN A 1 96  ? -6.373  29.235  -2.437  1.00 0.00 ? 96  ASN A H    2  
ATOM 3075  H HA   . ASN A 1 96  ? -7.752  26.632  -2.514  1.00 0.00 ? 96  ASN A HA   2  
ATOM 3076  H HB2  . ASN A 1 96  ? -5.338  26.678  -1.700  1.00 0.00 ? 96  ASN A HB2  2  
ATOM 3077  H HB3  . ASN A 1 96  ? -5.927  27.575  -0.303  1.00 0.00 ? 96  ASN A HB3  2  
ATOM 3078  H HD21 . ASN A 1 96  ? -6.610  24.624  -2.145  1.00 0.00 ? 96  ASN A HD21 2  
ATOM 3079  H HD22 . ASN A 1 96  ? -6.978  23.647  -0.769  1.00 0.00 ? 96  ASN A HD22 2  
ATOM 3080  N N    . SER A 1 97  ? -9.403  27.137  -0.675  1.00 0.00 ? 97  SER A N    2  
ATOM 3081  C CA   . SER A 1 97  ? -10.509 27.544  0.184   1.00 0.00 ? 97  SER A CA   2  
ATOM 3082  C C    . SER A 1 97  ? -11.001 26.371  1.027   1.00 0.00 ? 97  SER A C    2  
ATOM 3083  O O    . SER A 1 97  ? -11.120 25.248  0.539   1.00 0.00 ? 97  SER A O    2  
ATOM 3084  C CB   . SER A 1 97  ? -11.658 28.100  -0.658  1.00 0.00 ? 97  SER A CB   2  
ATOM 3085  O OG   . SER A 1 97  ? -12.700 28.595  0.164   1.00 0.00 ? 97  SER A OG   2  
ATOM 3086  H H    . SER A 1 97  ? -9.378  26.220  -1.022  1.00 0.00 ? 97  SER A H    2  
ATOM 3087  H HA   . SER A 1 97  ? -10.148 28.320  0.843   1.00 0.00 ? 97  SER A HA   2  
ATOM 3088  H HB2  . SER A 1 97  ? -11.291 28.905  -1.277  1.00 0.00 ? 97  SER A HB2  2  
ATOM 3089  H HB3  . SER A 1 97  ? -12.053 27.315  -1.287  1.00 0.00 ? 97  SER A HB3  2  
ATOM 3090  H HG   . SER A 1 97  ? -13.366 29.019  -0.382  1.00 0.00 ? 97  SER A HG   2  
ATOM 3091  N N    . GLY A 1 98  ? -11.287 26.643  2.297   1.00 0.00 ? 98  GLY A N    2  
ATOM 3092  C CA   . GLY A 1 98  ? -11.764 25.601  3.188   1.00 0.00 ? 98  GLY A CA   2  
ATOM 3093  C C    . GLY A 1 98  ? -11.436 25.887  4.640   1.00 0.00 ? 98  GLY A C    2  
ATOM 3094  O O    . GLY A 1 98  ? -10.491 26.610  4.955   1.00 0.00 ? 98  GLY A O    2  
ATOM 3095  H H    . GLY A 1 98  ? -11.173 27.557  2.631   1.00 0.00 ? 98  GLY A H    2  
ATOM 3096  H HA2  . GLY A 1 98  ? -12.835 25.514  3.082   1.00 0.00 ? 98  GLY A HA2  2  
ATOM 3097  H HA3  . GLY A 1 98  ? -11.307 24.664  2.906   1.00 0.00 ? 98  GLY A HA3  2  
ATOM 3098  N N    . PRO A 1 99  ? -12.231 25.311  5.555   1.00 0.00 ? 99  PRO A N    2  
ATOM 3099  C CA   . PRO A 1 99  ? -12.041 25.494  6.997   1.00 0.00 ? 99  PRO A CA   2  
ATOM 3100  C C    . PRO A 1 99  ? -10.784 24.799  7.508   1.00 0.00 ? 99  PRO A C    2  
ATOM 3101  O O    . PRO A 1 99  ? -10.498 24.815  8.705   1.00 0.00 ? 99  PRO A O    2  
ATOM 3102  C CB   . PRO A 1 99  ? -13.291 24.853  7.604   1.00 0.00 ? 99  PRO A CB   2  
ATOM 3103  C CG   . PRO A 1 99  ? -13.735 23.855  6.591   1.00 0.00 ? 99  PRO A CG   2  
ATOM 3104  C CD   . PRO A 1 99  ? -13.376 24.437  5.251   1.00 0.00 ? 99  PRO A CD   2  
ATOM 3105  H HA   . PRO A 1 99  ? -12.005 26.541  7.262   1.00 0.00 ? 99  PRO A HA   2  
ATOM 3106  H HB2  . PRO A 1 99  ? -13.037 24.379  8.541   1.00 0.00 ? 99  PRO A HB2  2  
ATOM 3107  H HB3  . PRO A 1 99  ? -14.044 25.609  7.768   1.00 0.00 ? 99  PRO A HB3  2  
ATOM 3108  H HG2  . PRO A 1 99  ? -13.217 22.921  6.744   1.00 0.00 ? 99  PRO A HG2  2  
ATOM 3109  H HG3  . PRO A 1 99  ? -14.803 23.710  6.662   1.00 0.00 ? 99  PRO A HG3  2  
ATOM 3110  H HD2  . PRO A 1 99  ? -13.093 23.654  4.563   1.00 0.00 ? 99  PRO A HD2  2  
ATOM 3111  H HD3  . PRO A 1 99  ? -14.202 25.009  4.855   1.00 0.00 ? 99  PRO A HD3  2  
ATOM 3112  N N    . SER A 1 100 ? -10.037 24.189  6.594   1.00 0.00 ? 100 SER A N    2  
ATOM 3113  C CA   . SER A 1 100 ? -8.811  23.484  6.954   1.00 0.00 ? 100 SER A CA   2  
ATOM 3114  C C    . SER A 1 100 ? -7.967  24.318  7.912   1.00 0.00 ? 100 SER A C    2  
ATOM 3115  O O    . SER A 1 100 ? -7.991  25.548  7.869   1.00 0.00 ? 100 SER A O    2  
ATOM 3116  C CB   . SER A 1 100 ? -8.002  23.153  5.699   1.00 0.00 ? 100 SER A CB   2  
ATOM 3117  O OG   . SER A 1 100 ? -8.689  22.223  4.879   1.00 0.00 ? 100 SER A OG   2  
ATOM 3118  H H    . SER A 1 100 ? -10.318 24.211  5.655   1.00 0.00 ? 100 SER A H    2  
ATOM 3119  H HA   . SER A 1 100 ? -9.090  22.564  7.445   1.00 0.00 ? 100 SER A HA   2  
ATOM 3120  H HB2  . SER A 1 100 ? -7.832  24.056  5.133   1.00 0.00 ? 100 SER A HB2  2  
ATOM 3121  H HB3  . SER A 1 100 ? -7.052  22.726  5.989   1.00 0.00 ? 100 SER A HB3  2  
ATOM 3122  H HG   . SER A 1 100 ? -9.308  22.691  4.314   1.00 0.00 ? 100 SER A HG   2  
ATOM 3123  N N    . SER A 1 101 ? -7.220  23.639  8.777   1.00 0.00 ? 101 SER A N    2  
ATOM 3124  C CA   . SER A 1 101 ? -6.371  24.316  9.750   1.00 0.00 ? 101 SER A CA   2  
ATOM 3125  C C    . SER A 1 101 ? -4.900  24.201  9.359   1.00 0.00 ? 101 SER A C    2  
ATOM 3126  O O    . SER A 1 101 ? -4.159  25.182  9.394   1.00 0.00 ? 101 SER A O    2  
ATOM 3127  C CB   . SER A 1 101 ? -6.587  23.727  11.145  1.00 0.00 ? 101 SER A CB   2  
ATOM 3128  O OG   . SER A 1 101 ? -6.084  22.404  11.224  1.00 0.00 ? 101 SER A OG   2  
ATOM 3129  H H    . SER A 1 101 ? -7.244  22.659  8.762   1.00 0.00 ? 101 SER A H    2  
ATOM 3130  H HA   . SER A 1 101 ? -6.647  25.360  9.762   1.00 0.00 ? 101 SER A HA   2  
ATOM 3131  H HB2  . SER A 1 101 ? -6.076  24.337  11.874  1.00 0.00 ? 101 SER A HB2  2  
ATOM 3132  H HB3  . SER A 1 101 ? -7.644  23.712  11.366  1.00 0.00 ? 101 SER A HB3  2  
ATOM 3133  H HG   . SER A 1 101 ? -6.705  21.854  11.707  1.00 0.00 ? 101 SER A HG   2  
ATOM 3134  N N    . GLY A 1 102 ? -4.485  22.994  8.987   1.00 0.00 ? 102 GLY A N    2  
ATOM 3135  C CA   . GLY A 1 102 ? -3.106  22.771  8.596   1.00 0.00 ? 102 GLY A CA   2  
ATOM 3136  C C    . GLY A 1 102 ? -2.990  22.012  7.289   1.00 0.00 ? 102 GLY A C    2  
ATOM 3137  O O    . GLY A 1 102 ? -1.886  21.753  6.810   1.00 0.00 ? 102 GLY A O    2  
ATOM 3138  H H    . GLY A 1 102 ? -5.122  22.248  8.979   1.00 0.00 ? 102 GLY A H    2  
ATOM 3139  H HA2  . GLY A 1 102 ? -2.615  23.727  8.490   1.00 0.00 ? 102 GLY A HA2  2  
ATOM 3140  H HA3  . GLY A 1 102 ? -2.610  22.207  9.372   1.00 0.00 ? 102 GLY A HA3  2  
ATOM 3141  N N    . GLY A 1 1   ? -17.282 15.498  -5.261  1.00 0.00 ? 1   GLY A N    3  
ATOM 3142  C CA   . GLY A 1 1   ? -16.709 15.024  -6.508  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3143  C C    . GLY A 1 1   ? -16.096 13.644  -6.376  1.00 0.00 ? 1   GLY A C    3  
ATOM 3144  O O    . GLY A 1 1   ? -15.770 13.205  -5.273  1.00 0.00 ? 1   GLY A O    3  
ATOM 3145  H H1   . GLY A 1 1   ? -16.994 16.357  -4.887  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3146  H HA2  . GLY A 1 1   ? -17.484 14.992  -7.259  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3147  H HA3  . GLY A 1 1   ? -15.943 15.716  -6.824  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3148  N N    . SER A 1 2   ? -15.941 12.957  -7.503  1.00 0.00 ? 2   SER A N    3  
ATOM 3149  C CA   . SER A 1 2   ? -15.368 11.616  -7.508  1.00 0.00 ? 2   SER A CA   3  
ATOM 3150  C C    . SER A 1 2   ? -13.874 11.664  -7.813  1.00 0.00 ? 2   SER A C    3  
ATOM 3151  O O    . SER A 1 2   ? -13.417 12.492  -8.601  1.00 0.00 ? 2   SER A O    3  
ATOM 3152  C CB   . SER A 1 2   ? -16.082 10.737  -8.538  1.00 0.00 ? 2   SER A CB   3  
ATOM 3153  O OG   . SER A 1 2   ? -17.484 10.741  -8.327  1.00 0.00 ? 2   SER A OG   3  
ATOM 3154  H H    . SER A 1 2   ? -16.220 13.361  -8.351  1.00 0.00 ? 2   SER A H    3  
ATOM 3155  H HA   . SER A 1 2   ? -15.510 11.191  -6.526  1.00 0.00 ? 2   SER A HA   3  
ATOM 3156  H HB2  . SER A 1 2   ? -15.879 11.112  -9.529  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3157  H HB3  . SER A 1 2   ? -15.720 9.723   -8.454  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3158  H HG   . SER A 1 2   ? -17.667 10.880  -7.395  1.00 0.00 ? 2   SER A HG   3  
ATOM 3159  N N    . SER A 1 3   ? -13.119 10.770  -7.183  1.00 0.00 ? 3   SER A N    3  
ATOM 3160  C CA   . SER A 1 3   ? -11.676 10.712  -7.383  1.00 0.00 ? 3   SER A CA   3  
ATOM 3161  C C    . SER A 1 3   ? -11.195 9.266   -7.459  1.00 0.00 ? 3   SER A C    3  
ATOM 3162  O O    . SER A 1 3   ? -11.174 8.554   -6.456  1.00 0.00 ? 3   SER A O    3  
ATOM 3163  C CB   . SER A 1 3   ? -10.953 11.443  -6.250  1.00 0.00 ? 3   SER A CB   3  
ATOM 3164  O OG   . SER A 1 3   ? -10.940 12.842  -6.472  1.00 0.00 ? 3   SER A OG   3  
ATOM 3165  H H    . SER A 1 3   ? -13.542 10.136  -6.567  1.00 0.00 ? 3   SER A H    3  
ATOM 3166  H HA   . SER A 1 3   ? -11.451 11.204  -8.318  1.00 0.00 ? 3   SER A HA   3  
ATOM 3167  H HB2  . SER A 1 3   ? -11.457 11.243  -5.317  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3168  H HB3  . SER A 1 3   ? -9.933  11.090  -6.191  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3169  H HG   . SER A 1 3   ? -11.736 13.099  -6.943  1.00 0.00 ? 3   SER A HG   3  
ATOM 3170  N N    . GLY A 1 4   ? -10.810 8.839   -8.658  1.00 0.00 ? 4   GLY A N    3  
ATOM 3171  C CA   . GLY A 1 4   ? -10.335 7.481   -8.844  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3172  C C    . GLY A 1 4   ? -9.567  7.307   -10.140 1.00 0.00 ? 4   GLY A C    3  
ATOM 3173  O O    . GLY A 1 4   ? -8.914  8.238   -10.612 1.00 0.00 ? 4   GLY A O    3  
ATOM 3174  H H    . GLY A 1 4   ? -10.848 9.452   -9.422  1.00 0.00 ? 4   GLY A H    3  
ATOM 3175  H HA2  . GLY A 1 4   ? -9.690  7.220   -8.018  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3176  H HA3  . GLY A 1 4   ? -11.184 6.813   -8.850  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3177  N N    . SER A 1 5   ? -9.644  6.112   -10.716 1.00 0.00 ? 5   SER A N    3  
ATOM 3178  C CA   . SER A 1 5   ? -8.947  5.818   -11.962 1.00 0.00 ? 5   SER A CA   3  
ATOM 3179  C C    . SER A 1 5   ? -9.514  4.563   -12.619 1.00 0.00 ? 5   SER A C    3  
ATOM 3180  O O    . SER A 1 5   ? -9.324  3.451   -12.126 1.00 0.00 ? 5   SER A O    3  
ATOM 3181  C CB   . SER A 1 5   ? -7.449  5.639   -11.703 1.00 0.00 ? 5   SER A CB   3  
ATOM 3182  O OG   . SER A 1 5   ? -7.219  4.696   -10.672 1.00 0.00 ? 5   SER A OG   3  
ATOM 3183  H H    . SER A 1 5   ? -10.181 5.410   -10.291 1.00 0.00 ? 5   SER A H    3  
ATOM 3184  H HA   . SER A 1 5   ? -9.091  6.655   -12.628 1.00 0.00 ? 5   SER A HA   3  
ATOM 3185  H HB2  . SER A 1 5   ? -6.969  5.293   -12.606 1.00 0.00 ? 5   SER A HB2  3  
ATOM 3186  H HB3  . SER A 1 5   ? -7.022  6.588   -11.410 1.00 0.00 ? 5   SER A HB3  3  
ATOM 3187  H HG   . SER A 1 5   ? -7.077  3.828   -11.057 1.00 0.00 ? 5   SER A HG   3  
ATOM 3188  N N    . SER A 1 6   ? -10.211 4.750   -13.735 1.00 0.00 ? 6   SER A N    3  
ATOM 3189  C CA   . SER A 1 6   ? -10.809 3.635   -14.459 1.00 0.00 ? 6   SER A CA   3  
ATOM 3190  C C    . SER A 1 6   ? -9.891  2.417   -14.436 1.00 0.00 ? 6   SER A C    3  
ATOM 3191  O O    . SER A 1 6   ? -8.688  2.527   -14.672 1.00 0.00 ? 6   SER A O    3  
ATOM 3192  C CB   . SER A 1 6   ? -11.105 4.037   -15.905 1.00 0.00 ? 6   SER A CB   3  
ATOM 3193  O OG   . SER A 1 6   ? -12.124 3.225   -16.462 1.00 0.00 ? 6   SER A OG   3  
ATOM 3194  H H    . SER A 1 6   ? -10.327 5.661   -14.079 1.00 0.00 ? 6   SER A H    3  
ATOM 3195  H HA   . SER A 1 6   ? -11.737 3.380   -13.968 1.00 0.00 ? 6   SER A HA   3  
ATOM 3196  H HB2  . SER A 1 6   ? -11.429 5.067   -15.930 1.00 0.00 ? 6   SER A HB2  3  
ATOM 3197  H HB3  . SER A 1 6   ? -10.209 3.927   -16.497 1.00 0.00 ? 6   SER A HB3  3  
ATOM 3198  H HG   . SER A 1 6   ? -12.982 3.542   -16.171 1.00 0.00 ? 6   SER A HG   3  
ATOM 3199  N N    . GLY A 1 7   ? -10.467 1.253   -14.150 1.00 0.00 ? 7   GLY A N    3  
ATOM 3200  C CA   . GLY A 1 7   ? -9.687  0.031   -14.101 1.00 0.00 ? 7   GLY A CA   3  
ATOM 3201  C C    . GLY A 1 7   ? -10.547 -1.197  -13.877 1.00 0.00 ? 7   GLY A C    3  
ATOM 3202  O O    . GLY A 1 7   ? -11.232 -1.306  -12.860 1.00 0.00 ? 7   GLY A O    3  
ATOM 3203  H H    . GLY A 1 7   ? -11.431 1.225   -13.971 1.00 0.00 ? 7   GLY A H    3  
ATOM 3204  H HA2  . GLY A 1 7   ? -9.154  -0.081  -15.034 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3205  H HA3  . GLY A 1 7   ? -8.971  0.106   -13.296 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3206  N N    . ARG A 1 8   ? -10.513 -2.124  -14.830 1.00 0.00 ? 8   ARG A N    3  
ATOM 3207  C CA   . ARG A 1 8   ? -11.298 -3.349  -14.733 1.00 0.00 ? 8   ARG A CA   3  
ATOM 3208  C C    . ARG A 1 8   ? -10.546 -4.414  -13.941 1.00 0.00 ? 8   ARG A C    3  
ATOM 3209  O O    . ARG A 1 8   ? -11.096 -5.024  -13.025 1.00 0.00 ? 8   ARG A O    3  
ATOM 3210  C CB   . ARG A 1 8   ? -11.632 -3.877  -16.129 1.00 0.00 ? 8   ARG A CB   3  
ATOM 3211  C CG   . ARG A 1 8   ? -12.908 -4.702  -16.178 1.00 0.00 ? 8   ARG A CG   3  
ATOM 3212  C CD   . ARG A 1 8   ? -14.144 -3.826  -16.045 1.00 0.00 ? 8   ARG A CD   3  
ATOM 3213  N NE   . ARG A 1 8   ? -14.505 -3.192  -17.311 1.00 0.00 ? 8   ARG A NE   3  
ATOM 3214  C CZ   . ARG A 1 8   ? -15.056 -3.844  -18.328 1.00 0.00 ? 8   ARG A CZ   3  
ATOM 3215  N NH1  . ARG A 1 8   ? -15.308 -5.142  -18.229 1.00 0.00 ? 8   ARG A NH1  3  
ATOM 3216  N NH2  . ARG A 1 8   ? -15.356 -3.198  -19.448 1.00 0.00 ? 8   ARG A NH2  3  
ATOM 3217  H H    . ARG A 1 8   ? -9.947  -1.979  -15.617 1.00 0.00 ? 8   ARG A H    3  
ATOM 3218  H HA   . ARG A 1 8   ? -12.216 -3.114  -14.217 1.00 0.00 ? 8   ARG A HA   3  
ATOM 3219  H HB2  . ARG A 1 8   ? -11.746 -3.039  -16.801 1.00 0.00 ? 8   ARG A HB2  3  
ATOM 3220  H HB3  . ARG A 1 8   ? -10.816 -4.495  -16.472 1.00 0.00 ? 8   ARG A HB3  3  
ATOM 3221  H HG2  . ARG A 1 8   ? -12.951 -5.225  -17.123 1.00 0.00 ? 8   ARG A HG2  3  
ATOM 3222  H HG3  . ARG A 1 8   ? -12.895 -5.416  -15.369 1.00 0.00 ? 8   ARG A HG3  3  
ATOM 3223  H HD2  . ARG A 1 8   ? -14.968 -4.438  -15.712 1.00 0.00 ? 8   ARG A HD2  3  
ATOM 3224  H HD3  . ARG A 1 8   ? -13.946 -3.058  -15.312 1.00 0.00 ? 8   ARG A HD3  3  
ATOM 3225  H HE   . ARG A 1 8   ? -14.327 -2.234  -17.405 1.00 0.00 ? 8   ARG A HE   3  
ATOM 3226  H HH11 . ARG A 1 8   ? -15.084 -5.631  -17.386 1.00 0.00 ? 8   ARG A HH11 3  
ATOM 3227  H HH12 . ARG A 1 8   ? -15.724 -5.631  -18.996 1.00 0.00 ? 8   ARG A HH12 3  
ATOM 3228  H HH21 . ARG A 1 8   ? -15.167 -2.220  -19.526 1.00 0.00 ? 8   ARG A HH21 3  
ATOM 3229  H HH22 . ARG A 1 8   ? -15.770 -3.690  -20.213 1.00 0.00 ? 8   ARG A HH22 3  
ATOM 3230  N N    . ASN A 1 9   ? -9.285  -4.633  -14.301 1.00 0.00 ? 9   ASN A N    3  
ATOM 3231  C CA   . ASN A 1 9   ? -8.459  -5.626  -13.625 1.00 0.00 ? 9   ASN A CA   3  
ATOM 3232  C C    . ASN A 1 9   ? -8.063  -5.146  -12.232 1.00 0.00 ? 9   ASN A C    3  
ATOM 3233  O O    . ASN A 1 9   ? -7.010  -4.535  -12.051 1.00 0.00 ? 9   ASN A O    3  
ATOM 3234  C CB   . ASN A 1 9   ? -7.205  -5.923  -14.450 1.00 0.00 ? 9   ASN A CB   3  
ATOM 3235  C CG   . ASN A 1 9   ? -7.511  -6.730  -15.697 1.00 0.00 ? 9   ASN A CG   3  
ATOM 3236  O OD1  . ASN A 1 9   ? -7.558  -6.191  -16.802 1.00 0.00 ? 9   ASN A OD1  3  
ATOM 3237  N ND2  . ASN A 1 9   ? -7.720  -8.030  -15.523 1.00 0.00 ? 9   ASN A ND2  3  
ATOM 3238  H H    . ASN A 1 9   ? -8.902  -4.115  -15.039 1.00 0.00 ? 9   ASN A H    3  
ATOM 3239  H HA   . ASN A 1 9   ? -9.039  -6.531  -13.530 1.00 0.00 ? 9   ASN A HA   3  
ATOM 3240  H HB2  . ASN A 1 9   ? -6.750  -4.990  -14.751 1.00 0.00 ? 9   ASN A HB2  3  
ATOM 3241  H HB3  . ASN A 1 9   ? -6.506  -6.481  -13.844 1.00 0.00 ? 9   ASN A HB3  3  
ATOM 3242  H HD21 . ASN A 1 9   ? -7.666  -8.391  -14.613 1.00 0.00 ? 9   ASN A HD21 3  
ATOM 3243  H HD22 . ASN A 1 9   ? -7.919  -8.575  -16.313 1.00 0.00 ? 9   ASN A HD22 3  
ATOM 3244  N N    . ARG A 1 10  ? -8.913  -5.429  -11.251 1.00 0.00 ? 10  ARG A N    3  
ATOM 3245  C CA   . ARG A 1 10  ? -8.653  -5.027  -9.874  1.00 0.00 ? 10  ARG A CA   3  
ATOM 3246  C C    . ARG A 1 10  ? -9.188  -6.066  -8.893  1.00 0.00 ? 10  ARG A C    3  
ATOM 3247  O O    . ARG A 1 10  ? -9.914  -6.982  -9.278  1.00 0.00 ? 10  ARG A O    3  
ATOM 3248  C CB   . ARG A 1 10  ? -9.290  -3.665  -9.589  1.00 0.00 ? 10  ARG A CB   3  
ATOM 3249  C CG   . ARG A 1 10  ? -10.809 -3.681  -9.638  1.00 0.00 ? 10  ARG A CG   3  
ATOM 3250  C CD   . ARG A 1 10  ? -11.407 -3.990  -8.274  1.00 0.00 ? 10  ARG A CD   3  
ATOM 3251  N NE   . ARG A 1 10  ? -11.654 -2.777  -7.498  1.00 0.00 ? 10  ARG A NE   3  
ATOM 3252  C CZ   . ARG A 1 10  ? -12.572 -1.873  -7.821  1.00 0.00 ? 10  ARG A CZ   3  
ATOM 3253  N NH1  . ARG A 1 10  ? -13.325 -2.043  -8.899  1.00 0.00 ? 10  ARG A NH1  3  
ATOM 3254  N NH2  . ARG A 1 10  ? -12.738 -0.795  -7.065  1.00 0.00 ? 10  ARG A NH2  3  
ATOM 3255  H H    . ARG A 1 10  ? -9.736  -5.920  -11.457 1.00 0.00 ? 10  ARG A H    3  
ATOM 3256  H HA   . ARG A 1 10  ? -7.584  -4.947  -9.748  1.00 0.00 ? 10  ARG A HA   3  
ATOM 3257  H HB2  . ARG A 1 10  ? -8.987  -3.338  -8.605  1.00 0.00 ? 10  ARG A HB2  3  
ATOM 3258  H HB3  . ARG A 1 10  ? -8.935  -2.955  -10.321 1.00 0.00 ? 10  ARG A HB3  3  
ATOM 3259  H HG2  . ARG A 1 10  ? -11.160 -2.713  -9.962  1.00 0.00 ? 10  ARG A HG2  3  
ATOM 3260  H HG3  . ARG A 1 10  ? -11.129 -4.436  -10.341 1.00 0.00 ? 10  ARG A HG3  3  
ATOM 3261  H HD2  . ARG A 1 10  ? -12.341 -4.512  -8.416  1.00 0.00 ? 10  ARG A HD2  3  
ATOM 3262  H HD3  . ARG A 1 10  ? -10.721 -4.621  -7.730  1.00 0.00 ? 10  ARG A HD3  3  
ATOM 3263  H HE   . ARG A 1 10  ? -11.109 -2.632  -6.698  1.00 0.00 ? 10  ARG A HE   3  
ATOM 3264  H HH11 . ARG A 1 10  ? -13.203 -2.855  -9.470  1.00 0.00 ? 10  ARG A HH11 3  
ATOM 3265  H HH12 . ARG A 1 10  ? -14.017 -1.361  -9.139  1.00 0.00 ? 10  ARG A HH12 3  
ATOM 3266  H HH21 . ARG A 1 10  ? -12.172 -0.663  -6.252  1.00 0.00 ? 10  ARG A HH21 3  
ATOM 3267  H HH22 . ARG A 1 10  ? -13.429 -0.115  -7.309  1.00 0.00 ? 10  ARG A HH22 3  
ATOM 3268  N N    . PHE A 1 11  ? -8.824  -5.917  -7.624  1.00 0.00 ? 11  PHE A N    3  
ATOM 3269  C CA   . PHE A 1 11  ? -9.265  -6.843  -6.588  1.00 0.00 ? 11  PHE A CA   3  
ATOM 3270  C C    . PHE A 1 11  ? -8.941  -6.300  -5.199  1.00 0.00 ? 11  PHE A C    3  
ATOM 3271  O O    . PHE A 1 11  ? -8.393  -5.207  -5.059  1.00 0.00 ? 11  PHE A O    3  
ATOM 3272  C CB   . PHE A 1 11  ? -8.606  -8.210  -6.781  1.00 0.00 ? 11  PHE A CB   3  
ATOM 3273  C CG   . PHE A 1 11  ? -7.295  -8.350  -6.061  1.00 0.00 ? 11  PHE A CG   3  
ATOM 3274  C CD1  . PHE A 1 11  ? -6.489  -7.245  -5.841  1.00 0.00 ? 11  PHE A CD1  3  
ATOM 3275  C CD2  . PHE A 1 11  ? -6.869  -9.587  -5.605  1.00 0.00 ? 11  PHE A CD2  3  
ATOM 3276  C CE1  . PHE A 1 11  ? -5.282  -7.370  -5.178  1.00 0.00 ? 11  PHE A CE1  3  
ATOM 3277  C CE2  . PHE A 1 11  ? -5.663  -9.718  -4.942  1.00 0.00 ? 11  PHE A CE2  3  
ATOM 3278  C CZ   . PHE A 1 11  ? -4.868  -8.609  -4.730  1.00 0.00 ? 11  PHE A CZ   3  
ATOM 3279  H H    . PHE A 1 11  ? -8.243  -5.166  -7.378  1.00 0.00 ? 11  PHE A H    3  
ATOM 3280  H HA   . PHE A 1 11  ? -10.335 -6.953  -6.677  1.00 0.00 ? 11  PHE A HA   3  
ATOM 3281  H HB2  . PHE A 1 11  ? -9.270  -8.977  -6.412  1.00 0.00 ? 11  PHE A HB2  3  
ATOM 3282  H HB3  . PHE A 1 11  ? -8.427  -8.369  -7.833  1.00 0.00 ? 11  PHE A HB3  3  
ATOM 3283  H HD1  . PHE A 1 11  ? -6.812  -6.275  -6.192  1.00 0.00 ? 11  PHE A HD1  3  
ATOM 3284  H HD2  . PHE A 1 11  ? -7.488  -10.456 -5.772  1.00 0.00 ? 11  PHE A HD2  3  
ATOM 3285  H HE1  . PHE A 1 11  ? -4.663  -6.500  -5.014  1.00 0.00 ? 11  PHE A HE1  3  
ATOM 3286  H HE2  . PHE A 1 11  ? -5.342  -10.688 -4.593  1.00 0.00 ? 11  PHE A HE2  3  
ATOM 3287  H HZ   . PHE A 1 11  ? -3.926  -8.709  -4.211  1.00 0.00 ? 11  PHE A HZ   3  
ATOM 3288  N N    . LYS A 1 12  ? -9.283  -7.073  -4.174  1.00 0.00 ? 12  LYS A N    3  
ATOM 3289  C CA   . LYS A 1 12  ? -9.029  -6.673  -2.795  1.00 0.00 ? 12  LYS A CA   3  
ATOM 3290  C C    . LYS A 1 12  ? -8.096  -7.663  -2.105  1.00 0.00 ? 12  LYS A C    3  
ATOM 3291  O O    . LYS A 1 12  ? -8.324  -8.872  -2.138  1.00 0.00 ? 12  LYS A O    3  
ATOM 3292  C CB   . LYS A 1 12  ? -10.345 -6.571  -2.020  1.00 0.00 ? 12  LYS A CB   3  
ATOM 3293  C CG   . LYS A 1 12  ? -10.230 -5.781  -0.728  1.00 0.00 ? 12  LYS A CG   3  
ATOM 3294  C CD   . LYS A 1 12  ? -11.334 -6.148  0.250   1.00 0.00 ? 12  LYS A CD   3  
ATOM 3295  C CE   . LYS A 1 12  ? -12.617 -5.388  -0.047  1.00 0.00 ? 12  LYS A CE   3  
ATOM 3296  N NZ   . LYS A 1 12  ? -13.513 -5.327  1.141   1.00 0.00 ? 12  LYS A NZ   3  
ATOM 3297  H H    . LYS A 1 12  ? -9.718  -7.935  -4.349  1.00 0.00 ? 12  LYS A H    3  
ATOM 3298  H HA   . LYS A 1 12  ? -8.555  -5.703  -2.813  1.00 0.00 ? 12  LYS A HA   3  
ATOM 3299  H HB2  . LYS A 1 12  ? -11.081 -6.091  -2.648  1.00 0.00 ? 12  LYS A HB2  3  
ATOM 3300  H HB3  . LYS A 1 12  ? -10.684 -7.568  -1.779  1.00 0.00 ? 12  LYS A HB3  3  
ATOM 3301  H HG2  . LYS A 1 12  ? -9.275  -5.991  -0.271  1.00 0.00 ? 12  LYS A HG2  3  
ATOM 3302  H HG3  . LYS A 1 12  ? -10.299 -4.726  -0.955  1.00 0.00 ? 12  LYS A HG3  3  
ATOM 3303  H HD2  . LYS A 1 12  ? -11.531 -7.207  0.175   1.00 0.00 ? 12  LYS A HD2  3  
ATOM 3304  H HD3  . LYS A 1 12  ? -11.008 -5.910  1.252   1.00 0.00 ? 12  LYS A HD3  3  
ATOM 3305  H HE2  . LYS A 1 12  ? -12.364 -4.383  -0.348  1.00 0.00 ? 12  LYS A HE2  3  
ATOM 3306  H HE3  . LYS A 1 12  ? -13.136 -5.885  -0.853  1.00 0.00 ? 12  LYS A HE3  3  
ATOM 3307  H HZ1  . LYS A 1 12  ? -13.941 -4.382  1.218   1.00 0.00 ? 12  LYS A HZ1  3  
ATOM 3308  H HZ2  . LYS A 1 12  ? -12.971 -5.520  2.007   1.00 0.00 ? 12  LYS A HZ2  3  
ATOM 3309  H HZ3  . LYS A 1 12  ? -14.271 -6.033  1.054   1.00 0.00 ? 12  LYS A HZ3  3  
ATOM 3310  N N    . TRP A 1 13  ? -7.046  -7.142  -1.479  1.00 0.00 ? 13  TRP A N    3  
ATOM 3311  C CA   . TRP A 1 13  ? -6.079  -7.980  -0.780  1.00 0.00 ? 13  TRP A CA   3  
ATOM 3312  C C    . TRP A 1 13  ? -6.704  -8.614  0.458   1.00 0.00 ? 13  TRP A C    3  
ATOM 3313  O O    . TRP A 1 13  ? -7.832  -8.293  0.829   1.00 0.00 ? 13  TRP A O    3  
ATOM 3314  C CB   . TRP A 1 13  ? -4.852  -7.158  -0.383  1.00 0.00 ? 13  TRP A CB   3  
ATOM 3315  C CG   . TRP A 1 13  ? -4.031  -6.713  -1.555  1.00 0.00 ? 13  TRP A CG   3  
ATOM 3316  C CD1  . TRP A 1 13  ? -4.019  -5.471  -2.123  1.00 0.00 ? 13  TRP A CD1  3  
ATOM 3317  C CD2  . TRP A 1 13  ? -3.105  -7.508  -2.304  1.00 0.00 ? 13  TRP A CD2  3  
ATOM 3318  N NE1  . TRP A 1 13  ? -3.141  -5.446  -3.179  1.00 0.00 ? 13  TRP A NE1  3  
ATOM 3319  C CE2  . TRP A 1 13  ? -2.566  -6.682  -3.310  1.00 0.00 ? 13  TRP A CE2  3  
ATOM 3320  C CE3  . TRP A 1 13  ? -2.676  -8.835  -2.220  1.00 0.00 ? 13  TRP A CE3  3  
ATOM 3321  C CZ2  . TRP A 1 13  ? -1.624  -7.143  -4.225  1.00 0.00 ? 13  TRP A CZ2  3  
ATOM 3322  C CZ3  . TRP A 1 13  ? -1.741  -9.291  -3.129  1.00 0.00 ? 13  TRP A CZ3  3  
ATOM 3323  C CH2  . TRP A 1 13  ? -1.222  -8.448  -4.120  1.00 0.00 ? 13  TRP A CH2  3  
ATOM 3324  H H    . TRP A 1 13  ? -6.918  -6.170  -1.488  1.00 0.00 ? 13  TRP A H    3  
ATOM 3325  H HA   . TRP A 1 13  ? -5.773  -8.765  -1.455  1.00 0.00 ? 13  TRP A HA   3  
ATOM 3326  H HB2  . TRP A 1 13  ? -5.175  -6.277  0.152   1.00 0.00 ? 13  TRP A HB2  3  
ATOM 3327  H HB3  . TRP A 1 13  ? -4.221  -7.754  0.260   1.00 0.00 ? 13  TRP A HB3  3  
ATOM 3328  H HD1  . TRP A 1 13  ? -4.618  -4.641  -1.782  1.00 0.00 ? 13  TRP A HD1  3  
ATOM 3329  H HE1  . TRP A 1 13  ? -2.955  -4.667  -3.746  1.00 0.00 ? 13  TRP A HE1  3  
ATOM 3330  H HE3  . TRP A 1 13  ? -3.064  -9.501  -1.463  1.00 0.00 ? 13  TRP A HE3  3  
ATOM 3331  H HZ2  . TRP A 1 13  ? -1.214  -6.505  -4.995  1.00 0.00 ? 13  TRP A HZ2  3  
ATOM 3332  H HZ3  . TRP A 1 13  ? -1.398  -10.314 -3.081  1.00 0.00 ? 13  TRP A HZ3  3  
ATOM 3333  H HH2  . TRP A 1 13  ? -0.494  -8.846  -4.809  1.00 0.00 ? 13  TRP A HH2  3  
ATOM 3334  N N    . GLY A 1 14  ? -5.963  -9.515  1.095   1.00 0.00 ? 14  GLY A N    3  
ATOM 3335  C CA   . GLY A 1 14  ? -6.461  -10.179 2.285   1.00 0.00 ? 14  GLY A CA   3  
ATOM 3336  C C    . GLY A 1 14  ? -5.744  -9.731  3.543   1.00 0.00 ? 14  GLY A C    3  
ATOM 3337  O O    . GLY A 1 14  ? -4.897  -8.838  3.515   1.00 0.00 ? 14  GLY A O    3  
ATOM 3338  H H    . GLY A 1 14  ? -5.070  -9.732  0.754   1.00 0.00 ? 14  GLY A H    3  
ATOM 3339  H HA2  . GLY A 1 14  ? -7.515  -9.966  2.389   1.00 0.00 ? 14  GLY A HA2  3  
ATOM 3340  H HA3  . GLY A 1 14  ? -6.330  -11.245 2.170   1.00 0.00 ? 14  GLY A HA3  3  
ATOM 3341  N N    . PRO A 1 15  ? -6.083  -10.359 4.678   1.00 0.00 ? 15  PRO A N    3  
ATOM 3342  C CA   . PRO A 1 15  ? -5.478  -10.036 5.974   1.00 0.00 ? 15  PRO A CA   3  
ATOM 3343  C C    . PRO A 1 15  ? -4.018  -10.469 6.055   1.00 0.00 ? 15  PRO A C    3  
ATOM 3344  O O    . PRO A 1 15  ? -3.176  -9.749  6.592   1.00 0.00 ? 15  PRO A O    3  
ATOM 3345  C CB   . PRO A 1 15  ? -6.327  -10.828 6.970   1.00 0.00 ? 15  PRO A CB   3  
ATOM 3346  C CG   . PRO A 1 15  ? -6.881  -11.962 6.178   1.00 0.00 ? 15  PRO A CG   3  
ATOM 3347  C CD   . PRO A 1 15  ? -7.084  -11.434 4.785   1.00 0.00 ? 15  PRO A CD   3  
ATOM 3348  H HA   . PRO A 1 15  ? -5.552  -8.981  6.194   1.00 0.00 ? 15  PRO A HA   3  
ATOM 3349  H HB2  . PRO A 1 15  ? -5.703  -11.179 7.780   1.00 0.00 ? 15  PRO A HB2  3  
ATOM 3350  H HB3  . PRO A 1 15  ? -7.113  -10.198 7.360   1.00 0.00 ? 15  PRO A HB3  3  
ATOM 3351  H HG2  . PRO A 1 15  ? -6.179  -12.782 6.170   1.00 0.00 ? 15  PRO A HG2  3  
ATOM 3352  H HG3  . PRO A 1 15  ? -7.824  -12.278 6.600   1.00 0.00 ? 15  PRO A HG3  3  
ATOM 3353  H HD2  . PRO A 1 15  ? -6.897  -12.209 4.057   1.00 0.00 ? 15  PRO A HD2  3  
ATOM 3354  H HD3  . PRO A 1 15  ? -8.084  -11.041 4.673   1.00 0.00 ? 15  PRO A HD3  3  
ATOM 3355  N N    . ALA A 1 16  ? -3.725  -11.649 5.519   1.00 0.00 ? 16  ALA A N    3  
ATOM 3356  C CA   . ALA A 1 16  ? -2.366  -12.176 5.530   1.00 0.00 ? 16  ALA A CA   3  
ATOM 3357  C C    . ALA A 1 16  ? -1.558  -11.635 4.355   1.00 0.00 ? 16  ALA A C    3  
ATOM 3358  O O    . ALA A 1 16  ? -0.480  -11.070 4.539   1.00 0.00 ? 16  ALA A O    3  
ATOM 3359  C CB   . ALA A 1 16  ? -2.390  -13.698 5.500   1.00 0.00 ? 16  ALA A CB   3  
ATOM 3360  H H    . ALA A 1 16  ? -4.439  -12.177 5.106   1.00 0.00 ? 16  ALA A H    3  
ATOM 3361  H HA   . ALA A 1 16  ? -1.895  -11.866 6.451   1.00 0.00 ? 16  ALA A HA   3  
ATOM 3362  H HB1  . ALA A 1 16  ? -3.282  -14.052 5.996   1.00 0.00 ? 16  ALA A HB1  3  
ATOM 3363  H HB2  . ALA A 1 16  ? -2.389  -14.037 4.475   1.00 0.00 ? 16  ALA A HB2  3  
ATOM 3364  H HB3  . ALA A 1 16  ? -1.518  -14.081 6.008   1.00 0.00 ? 16  ALA A HB3  3  
ATOM 3365  N N    . SER A 1 17  ? -2.086  -11.812 3.148   1.00 0.00 ? 17  SER A N    3  
ATOM 3366  C CA   . SER A 1 17  ? -1.411  -11.345 1.943   1.00 0.00 ? 17  SER A CA   3  
ATOM 3367  C C    . SER A 1 17  ? -0.825  -9.953  2.153   1.00 0.00 ? 17  SER A C    3  
ATOM 3368  O O    . SER A 1 17  ? 0.373   -9.738  1.969   1.00 0.00 ? 17  SER A O    3  
ATOM 3369  C CB   . SER A 1 17  ? -2.384  -11.329 0.762   1.00 0.00 ? 17  SER A CB   3  
ATOM 3370  O OG   . SER A 1 17  ? -2.429  -12.591 0.121   1.00 0.00 ? 17  SER A OG   3  
ATOM 3371  H H    . SER A 1 17  ? -2.949  -12.270 3.066   1.00 0.00 ? 17  SER A H    3  
ATOM 3372  H HA   . SER A 1 17  ? -0.607  -12.033 1.726   1.00 0.00 ? 17  SER A HA   3  
ATOM 3373  H HB2  . SER A 1 17  ? -3.373  -11.083 1.117   1.00 0.00 ? 17  SER A HB2  3  
ATOM 3374  H HB3  . SER A 1 17  ? -2.063  -10.586 0.046   1.00 0.00 ? 17  SER A HB3  3  
ATOM 3375  H HG   . SER A 1 17  ? -2.188  -13.278 0.747   1.00 0.00 ? 17  SER A HG   3  
ATOM 3376  N N    . GLN A 1 18  ? -1.678  -9.011  2.540   1.00 0.00 ? 18  GLN A N    3  
ATOM 3377  C CA   . GLN A 1 18  ? -1.246  -7.638  2.775   1.00 0.00 ? 18  GLN A CA   3  
ATOM 3378  C C    . GLN A 1 18  ? 0.026   -7.605  3.616   1.00 0.00 ? 18  GLN A C    3  
ATOM 3379  O O    . GLN A 1 18  ? 1.057   -7.095  3.177   1.00 0.00 ? 18  GLN A O    3  
ATOM 3380  C CB   . GLN A 1 18  ? -2.352  -6.844  3.472   1.00 0.00 ? 18  GLN A CB   3  
ATOM 3381  C CG   . GLN A 1 18  ? -3.424  -6.333  2.522   1.00 0.00 ? 18  GLN A CG   3  
ATOM 3382  C CD   . GLN A 1 18  ? -4.174  -5.139  3.078   1.00 0.00 ? 18  GLN A CD   3  
ATOM 3383  O OE1  . GLN A 1 18  ? -3.691  -4.450  3.977   1.00 0.00 ? 18  GLN A OE1  3  
ATOM 3384  N NE2  . GLN A 1 18  ? -5.364  -4.886  2.545   1.00 0.00 ? 18  GLN A NE2  3  
ATOM 3385  H H    . GLN A 1 18  ? -2.621  -9.244  2.671   1.00 0.00 ? 18  GLN A H    3  
ATOM 3386  H HA   . GLN A 1 18  ? -1.041  -7.187  1.817   1.00 0.00 ? 18  GLN A HA   3  
ATOM 3387  H HB2  . GLN A 1 18  ? -2.825  -7.478  4.207   1.00 0.00 ? 18  GLN A HB2  3  
ATOM 3388  H HB3  . GLN A 1 18  ? -1.910  -5.995  3.971   1.00 0.00 ? 18  GLN A HB3  3  
ATOM 3389  H HG2  . GLN A 1 18  ? -2.956  -6.043  1.593   1.00 0.00 ? 18  GLN A HG2  3  
ATOM 3390  H HG3  . GLN A 1 18  ? -4.130  -7.129  2.336   1.00 0.00 ? 18  GLN A HG3  3  
ATOM 3391  H HE21 . GLN A 1 18  ? -5.686  -5.478  1.833   1.00 0.00 ? 18  GLN A HE21 3  
ATOM 3392  H HE22 . GLN A 1 18  ? -5.871  -4.121  2.885   1.00 0.00 ? 18  GLN A HE22 3  
ATOM 3393  N N    . GLN A 1 19  ? -0.055  -8.150  4.825   1.00 0.00 ? 19  GLN A N    3  
ATOM 3394  C CA   . GLN A 1 19  ? 1.090   -8.181  5.727   1.00 0.00 ? 19  GLN A CA   3  
ATOM 3395  C C    . GLN A 1 19  ? 2.358   -8.589  4.983   1.00 0.00 ? 19  GLN A C    3  
ATOM 3396  O O    . GLN A 1 19  ? 3.414   -7.980  5.158   1.00 0.00 ? 19  GLN A O    3  
ATOM 3397  C CB   . GLN A 1 19  ? 0.830   -9.149  6.883   1.00 0.00 ? 19  GLN A CB   3  
ATOM 3398  C CG   . GLN A 1 19  ? -0.361  -8.760  7.745   1.00 0.00 ? 19  GLN A CG   3  
ATOM 3399  C CD   . GLN A 1 19  ? -0.237  -7.361  8.314   1.00 0.00 ? 19  GLN A CD   3  
ATOM 3400  O OE1  . GLN A 1 19  ? 0.847   -6.933  8.712   1.00 0.00 ? 19  GLN A OE1  3  
ATOM 3401  N NE2  . GLN A 1 19  ? -1.350  -6.638  8.354   1.00 0.00 ? 19  GLN A NE2  3  
ATOM 3402  H H    . GLN A 1 19  ? -0.904  -8.540  5.118   1.00 0.00 ? 19  GLN A H    3  
ATOM 3403  H HA   . GLN A 1 19  ? 1.225   -7.187  6.125   1.00 0.00 ? 19  GLN A HA   3  
ATOM 3404  H HB2  . GLN A 1 19  ? 0.649   -10.134 6.479   1.00 0.00 ? 19  GLN A HB2  3  
ATOM 3405  H HB3  . GLN A 1 19  ? 1.706   -9.183  7.513   1.00 0.00 ? 19  GLN A HB3  3  
ATOM 3406  H HG2  . GLN A 1 19  ? -1.256  -8.810  7.143   1.00 0.00 ? 19  GLN A HG2  3  
ATOM 3407  H HG3  . GLN A 1 19  ? -0.439  -9.460  8.564   1.00 0.00 ? 19  GLN A HG3  3  
ATOM 3408  H HE21 . GLN A 1 19  ? -2.178  -7.044  8.020   1.00 0.00 ? 19  GLN A HE21 3  
ATOM 3409  H HE22 . GLN A 1 19  ? -1.300  -5.730  8.718   1.00 0.00 ? 19  GLN A HE22 3  
ATOM 3410  N N    . ILE A 1 20  ? 2.246   -9.621  4.155   1.00 0.00 ? 20  ILE A N    3  
ATOM 3411  C CA   . ILE A 1 20  ? 3.383   -10.109 3.384   1.00 0.00 ? 20  ILE A CA   3  
ATOM 3412  C C    . ILE A 1 20  ? 3.964   -9.007  2.504   1.00 0.00 ? 20  ILE A C    3  
ATOM 3413  O O    . ILE A 1 20  ? 5.182   -8.876  2.377   1.00 0.00 ? 20  ILE A O    3  
ATOM 3414  C CB   . ILE A 1 20  ? 2.991   -11.305 2.498   1.00 0.00 ? 20  ILE A CB   3  
ATOM 3415  C CG1  . ILE A 1 20  ? 2.455   -12.451 3.358   1.00 0.00 ? 20  ILE A CG1  3  
ATOM 3416  C CG2  . ILE A 1 20  ? 4.184   -11.768 1.674   1.00 0.00 ? 20  ILE A CG2  3  
ATOM 3417  C CD1  . ILE A 1 20  ? 1.454   -13.329 2.640   1.00 0.00 ? 20  ILE A CD1  3  
ATOM 3418  H H    . ILE A 1 20  ? 1.378   -10.065 4.058   1.00 0.00 ? 20  ILE A H    3  
ATOM 3419  H HA   . ILE A 1 20  ? 4.142   -10.435 4.081   1.00 0.00 ? 20  ILE A HA   3  
ATOM 3420  H HB   . ILE A 1 20  ? 2.218   -10.983 1.817   1.00 0.00 ? 20  ILE A HB   3  
ATOM 3421  H HG12 . ILE A 1 20  ? 3.278   -13.075 3.670   1.00 0.00 ? 20  ILE A HG12 3  
ATOM 3422  H HG13 . ILE A 1 20  ? 1.970   -12.039 4.231   1.00 0.00 ? 20  ILE A HG13 3  
ATOM 3423  H HG21 . ILE A 1 20  ? 3.956   -12.718 1.213   1.00 0.00 ? 20  ILE A HG21 3  
ATOM 3424  H HG22 . ILE A 1 20  ? 4.395   -11.038 0.907   1.00 0.00 ? 20  ILE A HG22 3  
ATOM 3425  H HG23 . ILE A 1 20  ? 5.045   -11.876 2.316   1.00 0.00 ? 20  ILE A HG23 3  
ATOM 3426  H HD11 . ILE A 1 20  ? 1.878   -14.311 2.489   1.00 0.00 ? 20  ILE A HD11 3  
ATOM 3427  H HD12 . ILE A 1 20  ? 0.555   -13.411 3.233   1.00 0.00 ? 20  ILE A HD12 3  
ATOM 3428  H HD13 . ILE A 1 20  ? 1.213   -12.891 1.682   1.00 0.00 ? 20  ILE A HD13 3  
ATOM 3429  N N    . LEU A 1 21  ? 3.084   -8.216  1.899   1.00 0.00 ? 21  LEU A N    3  
ATOM 3430  C CA   . LEU A 1 21  ? 3.509   -7.123  1.031   1.00 0.00 ? 21  LEU A CA   3  
ATOM 3431  C C    . LEU A 1 21  ? 4.317   -6.091  1.811   1.00 0.00 ? 21  LEU A C    3  
ATOM 3432  O O    . LEU A 1 21  ? 5.278   -5.520  1.295   1.00 0.00 ? 21  LEU A O    3  
ATOM 3433  C CB   . LEU A 1 21  ? 2.293   -6.455  0.387   1.00 0.00 ? 21  LEU A CB   3  
ATOM 3434  C CG   . LEU A 1 21  ? 1.275   -7.395  -0.259  1.00 0.00 ? 21  LEU A CG   3  
ATOM 3435  C CD1  . LEU A 1 21  ? 0.189   -6.600  -0.968  1.00 0.00 ? 21  LEU A CD1  3  
ATOM 3436  C CD2  . LEU A 1 21  ? 1.965   -8.342  -1.230  1.00 0.00 ? 21  LEU A CD2  3  
ATOM 3437  H H    . LEU A 1 21  ? 2.127   -8.370  2.038   1.00 0.00 ? 21  LEU A H    3  
ATOM 3438  H HA   . LEU A 1 21  ? 4.134   -7.539  0.255   1.00 0.00 ? 21  LEU A HA   3  
ATOM 3439  H HB2  . LEU A 1 21  ? 1.782   -5.890  1.152   1.00 0.00 ? 21  LEU A HB2  3  
ATOM 3440  H HB3  . LEU A 1 21  ? 2.653   -5.780  -0.377  1.00 0.00 ? 21  LEU A HB3  3  
ATOM 3441  H HG   . LEU A 1 21  ? 0.803   -7.990  0.511   1.00 0.00 ? 21  LEU A HG   3  
ATOM 3442  H HD11 . LEU A 1 21  ? -0.368  -7.254  -1.621  1.00 0.00 ? 21  LEU A HD11 3  
ATOM 3443  H HD12 . LEU A 1 21  ? 0.642   -5.811  -1.549  1.00 0.00 ? 21  LEU A HD12 3  
ATOM 3444  H HD13 . LEU A 1 21  ? -0.478  -6.169  -0.235  1.00 0.00 ? 21  LEU A HD13 3  
ATOM 3445  H HD21 . LEU A 1 21  ? 2.395   -7.774  -2.042  1.00 0.00 ? 21  LEU A HD21 3  
ATOM 3446  H HD22 . LEU A 1 21  ? 1.242   -9.042  -1.625  1.00 0.00 ? 21  LEU A HD22 3  
ATOM 3447  H HD23 . LEU A 1 21  ? 2.745   -8.881  -0.714  1.00 0.00 ? 21  LEU A HD23 3  
ATOM 3448  N N    . TYR A 1 22  ? 3.922   -5.858  3.058   1.00 0.00 ? 22  TYR A N    3  
ATOM 3449  C CA   . TYR A 1 22  ? 4.609   -4.894  3.910   1.00 0.00 ? 22  TYR A CA   3  
ATOM 3450  C C    . TYR A 1 22  ? 6.001   -5.393  4.284   1.00 0.00 ? 22  TYR A C    3  
ATOM 3451  O O    . TYR A 1 22  ? 6.984   -4.660  4.178   1.00 0.00 ? 22  TYR A O    3  
ATOM 3452  C CB   . TYR A 1 22  ? 3.793   -4.628  5.176   1.00 0.00 ? 22  TYR A CB   3  
ATOM 3453  C CG   . TYR A 1 22  ? 2.513   -3.864  4.922   1.00 0.00 ? 22  TYR A CG   3  
ATOM 3454  C CD1  . TYR A 1 22  ? 2.515   -2.477  4.833   1.00 0.00 ? 22  TYR A CD1  3  
ATOM 3455  C CD2  . TYR A 1 22  ? 1.302   -4.528  4.772   1.00 0.00 ? 22  TYR A CD2  3  
ATOM 3456  C CE1  . TYR A 1 22  ? 1.348   -1.775  4.602   1.00 0.00 ? 22  TYR A CE1  3  
ATOM 3457  C CE2  . TYR A 1 22  ? 0.131   -3.834  4.540   1.00 0.00 ? 22  TYR A CE2  3  
ATOM 3458  C CZ   . TYR A 1 22  ? 0.159   -2.457  4.455   1.00 0.00 ? 22  TYR A CZ   3  
ATOM 3459  O OH   . TYR A 1 22  ? -1.006  -1.762  4.225   1.00 0.00 ? 22  TYR A OH   3  
ATOM 3460  H H    . TYR A 1 22  ? 3.149   -6.344  3.414   1.00 0.00 ? 22  TYR A H    3  
ATOM 3461  H HA   . TYR A 1 22  ? 4.706   -3.972  3.356   1.00 0.00 ? 22  TYR A HA   3  
ATOM 3462  H HB2  . TYR A 1 22  ? 3.530   -5.571  5.632   1.00 0.00 ? 22  TYR A HB2  3  
ATOM 3463  H HB3  . TYR A 1 22  ? 4.391   -4.053  5.868   1.00 0.00 ? 22  TYR A HB3  3  
ATOM 3464  H HD1  . TYR A 1 22  ? 3.448   -1.945  4.948   1.00 0.00 ? 22  TYR A HD1  3  
ATOM 3465  H HD2  . TYR A 1 22  ? 1.283   -5.606  4.839   1.00 0.00 ? 22  TYR A HD2  3  
ATOM 3466  H HE1  . TYR A 1 22  ? 1.370   -0.697  4.536   1.00 0.00 ? 22  TYR A HE1  3  
ATOM 3467  H HE2  . TYR A 1 22  ? -0.801  -4.368  4.425   1.00 0.00 ? 22  TYR A HE2  3  
ATOM 3468  H HH   . TYR A 1 22  ? -0.835  -1.046  3.609   1.00 0.00 ? 22  TYR A HH   3  
ATOM 3469  N N    . GLN A 1 23  ? 6.075   -6.646  4.723   1.00 0.00 ? 23  GLN A N    3  
ATOM 3470  C CA   . GLN A 1 23  ? 7.347   -7.244  5.113   1.00 0.00 ? 23  GLN A CA   3  
ATOM 3471  C C    . GLN A 1 23  ? 8.369   -7.133  3.987   1.00 0.00 ? 23  GLN A C    3  
ATOM 3472  O O    . GLN A 1 23  ? 9.550   -6.888  4.230   1.00 0.00 ? 23  GLN A O    3  
ATOM 3473  C CB   . GLN A 1 23  ? 7.148   -8.712  5.495   1.00 0.00 ? 23  GLN A CB   3  
ATOM 3474  C CG   . GLN A 1 23  ? 6.844   -8.921  6.969   1.00 0.00 ? 23  GLN A CG   3  
ATOM 3475  C CD   . GLN A 1 23  ? 8.071   -8.764  7.846   1.00 0.00 ? 23  GLN A CD   3  
ATOM 3476  O OE1  . GLN A 1 23  ? 9.169   -9.184  7.479   1.00 0.00 ? 23  GLN A OE1  3  
ATOM 3477  N NE2  . GLN A 1 23  ? 7.891   -8.157  9.013   1.00 0.00 ? 23  GLN A NE2  3  
ATOM 3478  H H    . GLN A 1 23  ? 5.257   -7.180  4.785   1.00 0.00 ? 23  GLN A H    3  
ATOM 3479  H HA   . GLN A 1 23  ? 7.716   -6.705  5.972   1.00 0.00 ? 23  GLN A HA   3  
ATOM 3480  H HB2  . GLN A 1 23  ? 6.327   -9.113  4.919   1.00 0.00 ? 23  GLN A HB2  3  
ATOM 3481  H HB3  . GLN A 1 23  ? 8.048   -9.259  5.254   1.00 0.00 ? 23  GLN A HB3  3  
ATOM 3482  H HG2  . GLN A 1 23  ? 6.106   -8.196  7.278   1.00 0.00 ? 23  GLN A HG2  3  
ATOM 3483  H HG3  . GLN A 1 23  ? 6.448   -9.916  7.104   1.00 0.00 ? 23  GLN A HG3  3  
ATOM 3484  H HE21 . GLN A 1 23  ? 6.988   -7.850  9.240   1.00 0.00 ? 23  GLN A HE21 3  
ATOM 3485  H HE22 . GLN A 1 23  ? 8.667   -8.043  9.600   1.00 0.00 ? 23  GLN A HE22 3  
ATOM 3486  N N    . ALA A 1 24  ? 7.907   -7.315  2.754   1.00 0.00 ? 24  ALA A N    3  
ATOM 3487  C CA   . ALA A 1 24  ? 8.780   -7.234  1.590   1.00 0.00 ? 24  ALA A CA   3  
ATOM 3488  C C    . ALA A 1 24  ? 9.116   -5.784  1.256   1.00 0.00 ? 24  ALA A C    3  
ATOM 3489  O O    . ALA A 1 24  ? 10.274  -5.445  1.012   1.00 0.00 ? 24  ALA A O    3  
ATOM 3490  C CB   . ALA A 1 24  ? 8.132   -7.916  0.395   1.00 0.00 ? 24  ALA A CB   3  
ATOM 3491  H H    . ALA A 1 24  ? 6.955   -7.507  2.625   1.00 0.00 ? 24  ALA A H    3  
ATOM 3492  H HA   . ALA A 1 24  ? 9.695   -7.760  1.823   1.00 0.00 ? 24  ALA A HA   3  
ATOM 3493  H HB1  . ALA A 1 24  ? 8.726   -8.771  0.105   1.00 0.00 ? 24  ALA A HB1  3  
ATOM 3494  H HB2  . ALA A 1 24  ? 7.138   -8.242  0.662   1.00 0.00 ? 24  ALA A HB2  3  
ATOM 3495  H HB3  . ALA A 1 24  ? 8.075   -7.221  -0.429  1.00 0.00 ? 24  ALA A HB3  3  
ATOM 3496  N N    . TYR A 1 25  ? 8.096   -4.933  1.247   1.00 0.00 ? 25  TYR A N    3  
ATOM 3497  C CA   . TYR A 1 25  ? 8.283   -3.520  0.939   1.00 0.00 ? 25  TYR A CA   3  
ATOM 3498  C C    . TYR A 1 25  ? 9.213   -2.860  1.953   1.00 0.00 ? 25  TYR A C    3  
ATOM 3499  O O    . TYR A 1 25  ? 9.924   -1.908  1.631   1.00 0.00 ? 25  TYR A O    3  
ATOM 3500  C CB   . TYR A 1 25  ? 6.935   -2.798  0.921   1.00 0.00 ? 25  TYR A CB   3  
ATOM 3501  C CG   . TYR A 1 25  ? 7.010   -1.389  0.378   1.00 0.00 ? 25  TYR A CG   3  
ATOM 3502  C CD1  . TYR A 1 25  ? 7.631   -0.377  1.100   1.00 0.00 ? 25  TYR A CD1  3  
ATOM 3503  C CD2  . TYR A 1 25  ? 6.460   -1.069  -0.857  1.00 0.00 ? 25  TYR A CD2  3  
ATOM 3504  C CE1  . TYR A 1 25  ? 7.701   0.912   0.608   1.00 0.00 ? 25  TYR A CE1  3  
ATOM 3505  C CE2  . TYR A 1 25  ? 6.527   0.217   -1.358  1.00 0.00 ? 25  TYR A CE2  3  
ATOM 3506  C CZ   . TYR A 1 25  ? 7.148   1.204   -0.621  1.00 0.00 ? 25  TYR A CZ   3  
ATOM 3507  O OH   . TYR A 1 25  ? 7.216   2.486   -1.116  1.00 0.00 ? 25  TYR A OH   3  
ATOM 3508  H H    . TYR A 1 25  ? 7.196   -5.262  1.449   1.00 0.00 ? 25  TYR A H    3  
ATOM 3509  H HA   . TYR A 1 25  ? 8.731   -3.450  -0.042  1.00 0.00 ? 25  TYR A HA   3  
ATOM 3510  H HB2  . TYR A 1 25  ? 6.245   -3.353  0.306   1.00 0.00 ? 25  TYR A HB2  3  
ATOM 3511  H HB3  . TYR A 1 25  ? 6.550   -2.745  1.929   1.00 0.00 ? 25  TYR A HB3  3  
ATOM 3512  H HD1  . TYR A 1 25  ? 8.063   -0.608  2.063   1.00 0.00 ? 25  TYR A HD1  3  
ATOM 3513  H HD2  . TYR A 1 25  ? 5.974   -1.844  -1.431  1.00 0.00 ? 25  TYR A HD2  3  
ATOM 3514  H HE1  . TYR A 1 25  ? 8.188   1.686   1.185   1.00 0.00 ? 25  TYR A HE1  3  
ATOM 3515  H HE2  . TYR A 1 25  ? 6.094   0.446   -2.320  1.00 0.00 ? 25  TYR A HE2  3  
ATOM 3516  H HH   . TYR A 1 25  ? 6.355   2.746   -1.451  1.00 0.00 ? 25  TYR A HH   3  
ATOM 3517  N N    . ASP A 1 26  ? 9.202   -3.374  3.177   1.00 0.00 ? 26  ASP A N    3  
ATOM 3518  C CA   . ASP A 1 26  ? 10.045  -2.837  4.239   1.00 0.00 ? 26  ASP A CA   3  
ATOM 3519  C C    . ASP A 1 26  ? 11.520  -3.095  3.946   1.00 0.00 ? 26  ASP A C    3  
ATOM 3520  O O    . ASP A 1 26  ? 12.385  -2.303  4.319   1.00 0.00 ? 26  ASP A O    3  
ATOM 3521  C CB   . ASP A 1 26  ? 9.665   -3.457  5.585   1.00 0.00 ? 26  ASP A CB   3  
ATOM 3522  C CG   . ASP A 1 26  ? 9.916   -2.517  6.747   1.00 0.00 ? 26  ASP A CG   3  
ATOM 3523  O OD1  . ASP A 1 26  ? 9.368   -1.395  6.733   1.00 0.00 ? 26  ASP A OD1  3  
ATOM 3524  O OD2  . ASP A 1 26  ? 10.661  -2.904  7.672   1.00 0.00 ? 26  ASP A OD2  3  
ATOM 3525  H H    . ASP A 1 26  ? 8.614   -4.133  3.372   1.00 0.00 ? 26  ASP A H    3  
ATOM 3526  H HA   . ASP A 1 26  ? 9.882   -1.771  4.286   1.00 0.00 ? 26  ASP A HA   3  
ATOM 3527  H HB2  . ASP A 1 26  ? 8.614   -3.711  5.572   1.00 0.00 ? 26  ASP A HB2  3  
ATOM 3528  H HB3  . ASP A 1 26  ? 10.246  -4.354  5.738   1.00 0.00 ? 26  ASP A HB3  3  
ATOM 3529  N N    . ARG A 1 27  ? 11.798  -4.209  3.276   1.00 0.00 ? 27  ARG A N    3  
ATOM 3530  C CA   . ARG A 1 27  ? 13.168  -4.573  2.934   1.00 0.00 ? 27  ARG A CA   3  
ATOM 3531  C C    . ARG A 1 27  ? 13.604  -3.894  1.639   1.00 0.00 ? 27  ARG A C    3  
ATOM 3532  O O    . ARG A 1 27  ? 14.683  -3.307  1.568   1.00 0.00 ? 27  ARG A O    3  
ATOM 3533  C CB   . ARG A 1 27  ? 13.296  -6.091  2.795   1.00 0.00 ? 27  ARG A CB   3  
ATOM 3534  C CG   . ARG A 1 27  ? 12.803  -6.857  4.011   1.00 0.00 ? 27  ARG A CG   3  
ATOM 3535  C CD   . ARG A 1 27  ? 13.076  -8.347  3.879   1.00 0.00 ? 27  ARG A CD   3  
ATOM 3536  N NE   . ARG A 1 27  ? 13.084  -9.020  5.175   1.00 0.00 ? 27  ARG A NE   3  
ATOM 3537  C CZ   . ARG A 1 27  ? 13.204  -10.335 5.320   1.00 0.00 ? 27  ARG A CZ   3  
ATOM 3538  N NH1  . ARG A 1 27  ? 13.325  -11.114 4.255   1.00 0.00 ? 27  ARG A NH1  3  
ATOM 3539  N NH2  . ARG A 1 27  ? 13.203  -10.872 6.534   1.00 0.00 ? 27  ARG A NH2  3  
ATOM 3540  H H    . ARG A 1 27  ? 11.065  -4.800  3.005   1.00 0.00 ? 27  ARG A H    3  
ATOM 3541  H HA   . ARG A 1 27  ? 13.810  -4.238  3.735   1.00 0.00 ? 27  ARG A HA   3  
ATOM 3542  H HB2  . ARG A 1 27  ? 12.722  -6.412  1.938   1.00 0.00 ? 27  ARG A HB2  3  
ATOM 3543  H HB3  . ARG A 1 27  ? 14.334  -6.339  2.636   1.00 0.00 ? 27  ARG A HB3  3  
ATOM 3544  H HG2  . ARG A 1 27  ? 13.311  -6.486  4.889   1.00 0.00 ? 27  ARG A HG2  3  
ATOM 3545  H HG3  . ARG A 1 27  ? 11.740  -6.702  4.116   1.00 0.00 ? 27  ARG A HG3  3  
ATOM 3546  H HD2  . ARG A 1 27  ? 12.307  -8.787  3.261   1.00 0.00 ? 27  ARG A HD2  3  
ATOM 3547  H HD3  . ARG A 1 27  ? 14.037  -8.483  3.407   1.00 0.00 ? 27  ARG A HD3  3  
ATOM 3548  H HE   . ARG A 1 27  ? 12.996  -8.462  5.976   1.00 0.00 ? 27  ARG A HE   3  
ATOM 3549  H HH11 . ARG A 1 27  ? 13.327  -10.712 3.340   1.00 0.00 ? 27  ARG A HH11 3  
ATOM 3550  H HH12 . ARG A 1 27  ? 13.416  -12.104 4.367   1.00 0.00 ? 27  ARG A HH12 3  
ATOM 3551  H HH21 . ARG A 1 27  ? 13.113  -10.288 7.339   1.00 0.00 ? 27  ARG A HH21 3  
ATOM 3552  H HH22 . ARG A 1 27  ? 13.293  -11.862 6.642   1.00 0.00 ? 27  ARG A HH22 3  
ATOM 3553  N N    . GLN A 1 28  ? 12.757  -3.980  0.618   1.00 0.00 ? 28  GLN A N    3  
ATOM 3554  C CA   . GLN A 1 28  ? 13.056  -3.375  -0.675  1.00 0.00 ? 28  GLN A CA   3  
ATOM 3555  C C    . GLN A 1 28  ? 11.852  -2.606  -1.207  1.00 0.00 ? 28  GLN A C    3  
ATOM 3556  O O    . GLN A 1 28  ? 10.738  -3.129  -1.254  1.00 0.00 ? 28  GLN A O    3  
ATOM 3557  C CB   . GLN A 1 28  ? 13.475  -4.450  -1.680  1.00 0.00 ? 28  GLN A CB   3  
ATOM 3558  C CG   . GLN A 1 28  ? 13.599  -3.935  -3.105  1.00 0.00 ? 28  GLN A CG   3  
ATOM 3559  C CD   . GLN A 1 28  ? 14.948  -3.299  -3.379  1.00 0.00 ? 28  GLN A CD   3  
ATOM 3560  O OE1  . GLN A 1 28  ? 15.578  -2.739  -2.481  1.00 0.00 ? 28  GLN A OE1  3  
ATOM 3561  N NE2  . GLN A 1 28  ? 15.399  -3.382  -4.626  1.00 0.00 ? 28  GLN A NE2  3  
ATOM 3562  H H    . GLN A 1 28  ? 11.912  -4.461  0.737   1.00 0.00 ? 28  GLN A H    3  
ATOM 3563  H HA   . GLN A 1 28  ? 13.875  -2.686  -0.537  1.00 0.00 ? 28  GLN A HA   3  
ATOM 3564  H HB2  . GLN A 1 28  ? 14.430  -4.853  -1.380  1.00 0.00 ? 28  GLN A HB2  3  
ATOM 3565  H HB3  . GLN A 1 28  ? 12.740  -5.241  -1.670  1.00 0.00 ? 28  GLN A HB3  3  
ATOM 3566  H HG2  . GLN A 1 28  ? 13.464  -4.761  -3.786  1.00 0.00 ? 28  GLN A HG2  3  
ATOM 3567  H HG3  . GLN A 1 28  ? 12.828  -3.198  -3.276  1.00 0.00 ? 28  GLN A HG3  3  
ATOM 3568  H HE21 . GLN A 1 28  ? 14.842  -3.842  -5.289  1.00 0.00 ? 28  GLN A HE21 3  
ATOM 3569  H HE22 . GLN A 1 28  ? 16.267  -2.979  -4.831  1.00 0.00 ? 28  GLN A HE22 3  
ATOM 3570  N N    . LYS A 1 29  ? 12.082  -1.360  -1.608  1.00 0.00 ? 29  LYS A N    3  
ATOM 3571  C CA   . LYS A 1 29  ? 11.016  -0.517  -2.139  1.00 0.00 ? 29  LYS A CA   3  
ATOM 3572  C C    . LYS A 1 29  ? 10.688  -0.898  -3.579  1.00 0.00 ? 29  LYS A C    3  
ATOM 3573  O O    . LYS A 1 29  ? 9.533   -0.837  -3.998  1.00 0.00 ? 29  LYS A O    3  
ATOM 3574  C CB   . LYS A 1 29  ? 11.422  0.957   -2.070  1.00 0.00 ? 29  LYS A CB   3  
ATOM 3575  C CG   . LYS A 1 29  ? 11.953  1.379   -0.711  1.00 0.00 ? 29  LYS A CG   3  
ATOM 3576  C CD   . LYS A 1 29  ? 10.831  1.823   0.213   1.00 0.00 ? 29  LYS A CD   3  
ATOM 3577  C CE   . LYS A 1 29  ? 11.192  1.606   1.674   1.00 0.00 ? 29  LYS A CE   3  
ATOM 3578  N NZ   . LYS A 1 29  ? 11.873  2.794   2.260   1.00 0.00 ? 29  LYS A NZ   3  
ATOM 3579  H H    . LYS A 1 29  ? 12.991  -0.998  -1.547  1.00 0.00 ? 29  LYS A H    3  
ATOM 3580  H HA   . LYS A 1 29  ? 10.139  -0.669  -1.529  1.00 0.00 ? 29  LYS A HA   3  
ATOM 3581  H HB2  . LYS A 1 29  ? 12.190  1.141   -2.806  1.00 0.00 ? 29  LYS A HB2  3  
ATOM 3582  H HB3  . LYS A 1 29  ? 10.560  1.566   -2.301  1.00 0.00 ? 29  LYS A HB3  3  
ATOM 3583  H HG2  . LYS A 1 29  ? 12.466  0.543   -0.259  1.00 0.00 ? 29  LYS A HG2  3  
ATOM 3584  H HG3  . LYS A 1 29  ? 12.644  2.199   -0.843  1.00 0.00 ? 29  LYS A HG3  3  
ATOM 3585  H HD2  . LYS A 1 29  ? 10.639  2.874   0.053   1.00 0.00 ? 29  LYS A HD2  3  
ATOM 3586  H HD3  . LYS A 1 29  ? 9.940   1.254   -0.017  1.00 0.00 ? 29  LYS A HD3  3  
ATOM 3587  H HE2  . LYS A 1 29  ? 10.288  1.409   2.230   1.00 0.00 ? 29  LYS A HE2  3  
ATOM 3588  H HE3  . LYS A 1 29  ? 11.851  0.753   1.745   1.00 0.00 ? 29  LYS A HE3  3  
ATOM 3589  H HZ1  . LYS A 1 29  ? 11.821  3.596   1.599   1.00 0.00 ? 29  LYS A HZ1  3  
ATOM 3590  H HZ2  . LYS A 1 29  ? 12.872  2.577   2.446   1.00 0.00 ? 29  LYS A HZ2  3  
ATOM 3591  H HZ3  . LYS A 1 29  ? 11.414  3.064   3.153   1.00 0.00 ? 29  LYS A HZ3  3  
ATOM 3592  N N    . ASN A 1 30  ? 11.710  -1.292  -4.330  1.00 0.00 ? 30  ASN A N    3  
ATOM 3593  C CA   . ASN A 1 30  ? 11.529  -1.684  -5.723  1.00 0.00 ? 30  ASN A CA   3  
ATOM 3594  C C    . ASN A 1 30  ? 11.795  -3.175  -5.908  1.00 0.00 ? 30  ASN A C    3  
ATOM 3595  O O    . ASN A 1 30  ? 12.885  -3.593  -6.300  1.00 0.00 ? 30  ASN A O    3  
ATOM 3596  C CB   . ASN A 1 30  ? 12.459  -0.873  -6.628  1.00 0.00 ? 30  ASN A CB   3  
ATOM 3597  C CG   . ASN A 1 30  ? 12.731  0.515   -6.081  1.00 0.00 ? 30  ASN A CG   3  
ATOM 3598  O OD1  . ASN A 1 30  ? 13.851  1.019   -6.167  1.00 0.00 ? 30  ASN A OD1  3  
ATOM 3599  N ND2  . ASN A 1 30  ? 11.705  1.140   -5.516  1.00 0.00 ? 30  ASN A ND2  3  
ATOM 3600  H H    . ASN A 1 30  ? 12.609  -1.320  -3.939  1.00 0.00 ? 30  ASN A H    3  
ATOM 3601  H HA   . ASN A 1 30  ? 10.505  -1.477  -5.995  1.00 0.00 ? 30  ASN A HA   3  
ATOM 3602  H HB2  . ASN A 1 30  ? 13.401  -1.392  -6.724  1.00 0.00 ? 30  ASN A HB2  3  
ATOM 3603  H HB3  . ASN A 1 30  ? 12.006  -0.774  -7.603  1.00 0.00 ? 30  ASN A HB3  3  
ATOM 3604  H HD21 . ASN A 1 30  ? 10.842  0.677   -5.483  1.00 0.00 ? 30  ASN A HD21 3  
ATOM 3605  H HD22 . ASN A 1 30  ? 11.853  2.039   -5.155  1.00 0.00 ? 30  ASN A HD22 3  
ATOM 3606  N N    . PRO A 1 31  ? 10.776  -3.998  -5.620  1.00 0.00 ? 31  PRO A N    3  
ATOM 3607  C CA   . PRO A 1 31  ? 10.874  -5.455  -5.748  1.00 0.00 ? 31  PRO A CA   3  
ATOM 3608  C C    . PRO A 1 31  ? 10.955  -5.905  -7.203  1.00 0.00 ? 31  PRO A C    3  
ATOM 3609  O O    . PRO A 1 31  ? 10.144  -5.499  -8.034  1.00 0.00 ? 31  PRO A O    3  
ATOM 3610  C CB   . PRO A 1 31  ? 9.579   -5.956  -5.105  1.00 0.00 ? 31  PRO A CB   3  
ATOM 3611  C CG   . PRO A 1 31  ? 8.622   -4.822  -5.246  1.00 0.00 ? 31  PRO A CG   3  
ATOM 3612  C CD   . PRO A 1 31  ? 9.448   -3.570  -5.148  1.00 0.00 ? 31  PRO A CD   3  
ATOM 3613  H HA   . PRO A 1 31  ? 11.722  -5.845  -5.204  1.00 0.00 ? 31  PRO A HA   3  
ATOM 3614  H HB2  . PRO A 1 31  ? 9.230   -6.835  -5.628  1.00 0.00 ? 31  PRO A HB2  3  
ATOM 3615  H HB3  . PRO A 1 31  ? 9.757   -6.195  -4.067  1.00 0.00 ? 31  PRO A HB3  3  
ATOM 3616  H HG2  . PRO A 1 31  ? 8.131   -4.874  -6.206  1.00 0.00 ? 31  PRO A HG2  3  
ATOM 3617  H HG3  . PRO A 1 31  ? 7.895   -4.854  -4.449  1.00 0.00 ? 31  PRO A HG3  3  
ATOM 3618  H HD2  . PRO A 1 31  ? 9.042   -2.799  -5.787  1.00 0.00 ? 31  PRO A HD2  3  
ATOM 3619  H HD3  . PRO A 1 31  ? 9.495   -3.228  -4.125  1.00 0.00 ? 31  PRO A HD3  3  
ATOM 3620  N N    . SER A 1 32  ? 11.940  -6.746  -7.503  1.00 0.00 ? 32  SER A N    3  
ATOM 3621  C CA   . SER A 1 32  ? 12.128  -7.249  -8.859  1.00 0.00 ? 32  SER A CA   3  
ATOM 3622  C C    . SER A 1 32  ? 11.441  -8.599  -9.038  1.00 0.00 ? 32  SER A C    3  
ATOM 3623  O O    . SER A 1 32  ? 10.861  -9.144  -8.099  1.00 0.00 ? 32  SER A O    3  
ATOM 3624  C CB   . SER A 1 32  ? 13.620  -7.378  -9.175  1.00 0.00 ? 32  SER A CB   3  
ATOM 3625  O OG   . SER A 1 32  ? 14.157  -6.142  -9.613  1.00 0.00 ? 32  SER A OG   3  
ATOM 3626  H H    . SER A 1 32  ? 12.555  -7.034  -6.796  1.00 0.00 ? 32  SER A H    3  
ATOM 3627  H HA   . SER A 1 32  ? 11.685  -6.539  -9.541  1.00 0.00 ? 32  SER A HA   3  
ATOM 3628  H HB2  . SER A 1 32  ? 14.148  -7.691  -8.286  1.00 0.00 ? 32  SER A HB2  3  
ATOM 3629  H HB3  . SER A 1 32  ? 13.758  -8.114  -9.954  1.00 0.00 ? 32  SER A HB3  3  
ATOM 3630  H HG   . SER A 1 32  ? 13.761  -5.901  -10.454 1.00 0.00 ? 32  SER A HG   3  
ATOM 3631  N N    . LYS A 1 33  ? 11.509  -9.134  -10.253 1.00 0.00 ? 33  LYS A N    3  
ATOM 3632  C CA   . LYS A 1 33  ? 10.895  -10.421 -10.558 1.00 0.00 ? 33  LYS A CA   3  
ATOM 3633  C C    . LYS A 1 33  ? 11.016  -11.376 -9.375  1.00 0.00 ? 33  LYS A C    3  
ATOM 3634  O O    . LYS A 1 33  ? 10.051  -12.042 -9.003  1.00 0.00 ? 33  LYS A O    3  
ATOM 3635  C CB   . LYS A 1 33  ? 11.548  -11.039 -11.796 1.00 0.00 ? 33  LYS A CB   3  
ATOM 3636  C CG   . LYS A 1 33  ? 10.964  -12.387 -12.183 1.00 0.00 ? 33  LYS A CG   3  
ATOM 3637  C CD   . LYS A 1 33  ? 9.559   -12.246 -12.743 1.00 0.00 ? 33  LYS A CD   3  
ATOM 3638  C CE   . LYS A 1 33  ? 9.015   -13.581 -13.227 1.00 0.00 ? 33  LYS A CE   3  
ATOM 3639  N NZ   . LYS A 1 33  ? 7.656   -13.444 -13.821 1.00 0.00 ? 33  LYS A NZ   3  
ATOM 3640  H H    . LYS A 1 33  ? 11.985  -8.651  -10.961 1.00 0.00 ? 33  LYS A H    3  
ATOM 3641  H HA   . LYS A 1 33  ? 9.849   -10.249 -10.762 1.00 0.00 ? 33  LYS A HA   3  
ATOM 3642  H HB2  . LYS A 1 33  ? 11.424  -10.364 -12.630 1.00 0.00 ? 33  LYS A HB2  3  
ATOM 3643  H HB3  . LYS A 1 33  ? 12.604  -11.170 -11.604 1.00 0.00 ? 33  LYS A HB3  3  
ATOM 3644  H HG2  . LYS A 1 33  ? 11.595  -12.841 -12.933 1.00 0.00 ? 33  LYS A HG2  3  
ATOM 3645  H HG3  . LYS A 1 33  ? 10.931  -13.019 -11.307 1.00 0.00 ? 33  LYS A HG3  3  
ATOM 3646  H HD2  . LYS A 1 33  ? 8.909   -11.864 -11.969 1.00 0.00 ? 33  LYS A HD2  3  
ATOM 3647  H HD3  . LYS A 1 33  ? 9.579   -11.553 -13.572 1.00 0.00 ? 33  LYS A HD3  3  
ATOM 3648  H HE2  . LYS A 1 33  ? 9.686   -13.980 -13.972 1.00 0.00 ? 33  LYS A HE2  3  
ATOM 3649  H HE3  . LYS A 1 33  ? 8.964   -14.259 -12.388 1.00 0.00 ? 33  LYS A HE3  3  
ATOM 3650  H HZ1  . LYS A 1 33  ? 7.456   -12.444 -14.028 1.00 0.00 ? 33  LYS A HZ1  3  
ATOM 3651  H HZ2  . LYS A 1 33  ? 6.938   -13.799 -13.159 1.00 0.00 ? 33  LYS A HZ2  3  
ATOM 3652  H HZ3  . LYS A 1 33  ? 7.596   -13.988 -14.705 1.00 0.00 ? 33  LYS A HZ3  3  
ATOM 3653  N N    . GLU A 1 34  ? 12.208  -11.436 -8.789  1.00 0.00 ? 34  GLU A N    3  
ATOM 3654  C CA   . GLU A 1 34  ? 12.453  -12.310 -7.648  1.00 0.00 ? 34  GLU A CA   3  
ATOM 3655  C C    . GLU A 1 34  ? 11.653  -11.854 -6.431  1.00 0.00 ? 34  GLU A C    3  
ATOM 3656  O O    . GLU A 1 34  ? 10.805  -12.586 -5.924  1.00 0.00 ? 34  GLU A O    3  
ATOM 3657  C CB   . GLU A 1 34  ? 13.945  -12.338 -7.310  1.00 0.00 ? 34  GLU A CB   3  
ATOM 3658  C CG   . GLU A 1 34  ? 14.810  -12.918 -8.416  1.00 0.00 ? 34  GLU A CG   3  
ATOM 3659  C CD   . GLU A 1 34  ? 15.223  -11.878 -9.440  1.00 0.00 ? 34  GLU A CD   3  
ATOM 3660  O OE1  . GLU A 1 34  ? 16.155  -11.099 -9.152  1.00 0.00 ? 34  GLU A OE1  3  
ATOM 3661  O OE2  . GLU A 1 34  ? 14.613  -11.845 -10.530 1.00 0.00 ? 34  GLU A OE2  3  
ATOM 3662  H H    . GLU A 1 34  ? 12.939  -10.881 -9.132  1.00 0.00 ? 34  GLU A H    3  
ATOM 3663  H HA   . GLU A 1 34  ? 12.137  -13.306 -7.918  1.00 0.00 ? 34  GLU A HA   3  
ATOM 3664  H HB2  . GLU A 1 34  ? 14.277  -11.329 -7.114  1.00 0.00 ? 34  GLU A HB2  3  
ATOM 3665  H HB3  . GLU A 1 34  ? 14.089  -12.933 -6.420  1.00 0.00 ? 34  GLU A HB3  3  
ATOM 3666  H HG2  . GLU A 1 34  ? 15.700  -13.341 -7.976  1.00 0.00 ? 34  GLU A HG2  3  
ATOM 3667  H HG3  . GLU A 1 34  ? 14.254  -13.696 -8.919  1.00 0.00 ? 34  GLU A HG3  3  
ATOM 3668  N N    . GLU A 1 35  ? 11.932  -10.639 -5.969  1.00 0.00 ? 35  GLU A N    3  
ATOM 3669  C CA   . GLU A 1 35  ? 11.239  -10.086 -4.811  1.00 0.00 ? 35  GLU A CA   3  
ATOM 3670  C C    . GLU A 1 35  ? 9.726   -10.185 -4.983  1.00 0.00 ? 35  GLU A C    3  
ATOM 3671  O O    . GLU A 1 35  ? 9.051   -10.893 -4.235  1.00 0.00 ? 35  GLU A O    3  
ATOM 3672  C CB   . GLU A 1 35  ? 11.644  -8.626  -4.596  1.00 0.00 ? 35  GLU A CB   3  
ATOM 3673  C CG   . GLU A 1 35  ? 13.143  -8.425  -4.451  1.00 0.00 ? 35  GLU A CG   3  
ATOM 3674  C CD   . GLU A 1 35  ? 13.614  -8.562  -3.016  1.00 0.00 ? 35  GLU A CD   3  
ATOM 3675  O OE1  . GLU A 1 35  ? 13.176  -7.755  -2.170  1.00 0.00 ? 35  GLU A OE1  3  
ATOM 3676  O OE2  . GLU A 1 35  ? 14.420  -9.474  -2.740  1.00 0.00 ? 35  GLU A OE2  3  
ATOM 3677  H H    . GLU A 1 35  ? 12.619  -10.103 -6.416  1.00 0.00 ? 35  GLU A H    3  
ATOM 3678  H HA   . GLU A 1 35  ? 11.530  -10.661 -3.945  1.00 0.00 ? 35  GLU A HA   3  
ATOM 3679  H HB2  . GLU A 1 35  ? 11.303  -8.042  -5.439  1.00 0.00 ? 35  GLU A HB2  3  
ATOM 3680  H HB3  . GLU A 1 35  ? 11.165  -8.261  -3.700  1.00 0.00 ? 35  GLU A HB3  3  
ATOM 3681  H HG2  . GLU A 1 35  ? 13.652  -9.163  -5.053  1.00 0.00 ? 35  GLU A HG2  3  
ATOM 3682  H HG3  . GLU A 1 35  ? 13.397  -7.437  -4.805  1.00 0.00 ? 35  GLU A HG3  3  
ATOM 3683  N N    . ARG A 1 36  ? 9.201   -9.471  -5.973  1.00 0.00 ? 36  ARG A N    3  
ATOM 3684  C CA   . ARG A 1 36  ? 7.769   -9.477  -6.243  1.00 0.00 ? 36  ARG A CA   3  
ATOM 3685  C C    . ARG A 1 36  ? 7.218   -10.900 -6.227  1.00 0.00 ? 36  ARG A C    3  
ATOM 3686  O O    . ARG A 1 36  ? 6.257   -11.196 -5.518  1.00 0.00 ? 36  ARG A O    3  
ATOM 3687  C CB   . ARG A 1 36  ? 7.480   -8.822  -7.595  1.00 0.00 ? 36  ARG A CB   3  
ATOM 3688  C CG   . ARG A 1 36  ? 7.327   -7.312  -7.520  1.00 0.00 ? 36  ARG A CG   3  
ATOM 3689  C CD   . ARG A 1 36  ? 6.555   -6.770  -8.713  1.00 0.00 ? 36  ARG A CD   3  
ATOM 3690  N NE   . ARG A 1 36  ? 7.437   -6.426  -9.825  1.00 0.00 ? 36  ARG A NE   3  
ATOM 3691  C CZ   . ARG A 1 36  ? 7.040   -6.384  -11.092 1.00 0.00 ? 36  ARG A CZ   3  
ATOM 3692  N NH1  . ARG A 1 36  ? 5.782   -6.663  -11.405 1.00 0.00 ? 36  ARG A NH1  3  
ATOM 3693  N NH2  . ARG A 1 36  ? 7.902   -6.063  -12.048 1.00 0.00 ? 36  ARG A NH2  3  
ATOM 3694  H H    . ARG A 1 36  ? 9.791   -8.926  -6.535  1.00 0.00 ? 36  ARG A H    3  
ATOM 3695  H HA   . ARG A 1 36  ? 7.282   -8.907  -5.466  1.00 0.00 ? 36  ARG A HA   3  
ATOM 3696  H HB2  . ARG A 1 36  ? 8.292   -9.046  -8.271  1.00 0.00 ? 36  ARG A HB2  3  
ATOM 3697  H HB3  . ARG A 1 36  ? 6.566   -9.235  -7.993  1.00 0.00 ? 36  ARG A HB3  3  
ATOM 3698  H HG2  . ARG A 1 36  ? 6.795   -7.057  -6.615  1.00 0.00 ? 36  ARG A HG2  3  
ATOM 3699  H HG3  . ARG A 1 36  ? 8.308   -6.861  -7.501  1.00 0.00 ? 36  ARG A HG3  3  
ATOM 3700  H HD2  . ARG A 1 36  ? 5.853   -7.521  -9.042  1.00 0.00 ? 36  ARG A HD2  3  
ATOM 3701  H HD3  . ARG A 1 36  ? 6.018   -5.885  -8.405  1.00 0.00 ? 36  ARG A HD3  3  
ATOM 3702  H HE   . ARG A 1 36  ? 8.371   -6.217  -9.616  1.00 0.00 ? 36  ARG A HE   3  
ATOM 3703  H HH11 . ARG A 1 36  ? 5.131   -6.904  -10.687 1.00 0.00 ? 36  ARG A HH11 3  
ATOM 3704  H HH12 . ARG A 1 36  ? 5.486   -6.629  -12.360 1.00 0.00 ? 36  ARG A HH12 3  
ATOM 3705  H HH21 . ARG A 1 36  ? 8.851   -5.852  -11.816 1.00 0.00 ? 36  ARG A HH21 3  
ATOM 3706  H HH22 . ARG A 1 36  ? 7.602   -6.032  -13.001 1.00 0.00 ? 36  ARG A HH22 3  
ATOM 3707  N N    . GLU A 1 37  ? 7.835   -11.776 -7.015  1.00 0.00 ? 37  GLU A N    3  
ATOM 3708  C CA   . GLU A 1 37  ? 7.405   -13.167 -7.092  1.00 0.00 ? 37  GLU A CA   3  
ATOM 3709  C C    . GLU A 1 37  ? 7.226   -13.760 -5.697  1.00 0.00 ? 37  GLU A C    3  
ATOM 3710  O O    . GLU A 1 37  ? 6.188   -14.343 -5.387  1.00 0.00 ? 37  GLU A O    3  
ATOM 3711  C CB   . GLU A 1 37  ? 8.420   -13.995 -7.883  1.00 0.00 ? 37  GLU A CB   3  
ATOM 3712  C CG   . GLU A 1 37  ? 8.234   -13.908 -9.389  1.00 0.00 ? 37  GLU A CG   3  
ATOM 3713  C CD   . GLU A 1 37  ? 7.212   -14.900 -9.909  1.00 0.00 ? 37  GLU A CD   3  
ATOM 3714  O OE1  . GLU A 1 37  ? 7.426   -16.118 -9.733  1.00 0.00 ? 37  GLU A OE1  3  
ATOM 3715  O OE2  . GLU A 1 37  ? 6.199   -14.460 -10.491 1.00 0.00 ? 37  GLU A OE2  3  
ATOM 3716  H H    . GLU A 1 37  ? 8.595   -11.480 -7.557  1.00 0.00 ? 37  GLU A H    3  
ATOM 3717  H HA   . GLU A 1 37  ? 6.455   -13.193 -7.605  1.00 0.00 ? 37  GLU A HA   3  
ATOM 3718  H HB2  . GLU A 1 37  ? 9.414   -13.649 -7.643  1.00 0.00 ? 37  GLU A HB2  3  
ATOM 3719  H HB3  . GLU A 1 37  ? 8.329   -15.030 -7.590  1.00 0.00 ? 37  GLU A HB3  3  
ATOM 3720  H HG2  . GLU A 1 37  ? 7.906   -12.911 -9.642  1.00 0.00 ? 37  GLU A HG2  3  
ATOM 3721  H HG3  . GLU A 1 37  ? 9.182   -14.106 -9.867  1.00 0.00 ? 37  GLU A HG3  3  
ATOM 3722  N N    . ALA A 1 38  ? 8.247   -13.605 -4.860  1.00 0.00 ? 38  ALA A N    3  
ATOM 3723  C CA   . ALA A 1 38  ? 8.203   -14.122 -3.498  1.00 0.00 ? 38  ALA A CA   3  
ATOM 3724  C C    . ALA A 1 38  ? 6.903   -13.730 -2.803  1.00 0.00 ? 38  ALA A C    3  
ATOM 3725  O O    . ALA A 1 38  ? 6.486   -14.370 -1.837  1.00 0.00 ? 38  ALA A O    3  
ATOM 3726  C CB   . ALA A 1 38  ? 9.400   -13.621 -2.704  1.00 0.00 ? 38  ALA A CB   3  
ATOM 3727  H H    . ALA A 1 38  ? 9.047   -13.130 -5.165  1.00 0.00 ? 38  ALA A H    3  
ATOM 3728  H HA   . ALA A 1 38  ? 8.261   -15.200 -3.548  1.00 0.00 ? 38  ALA A HA   3  
ATOM 3729  H HB1  . ALA A 1 38  ? 9.120   -13.506 -1.667  1.00 0.00 ? 38  ALA A HB1  3  
ATOM 3730  H HB2  . ALA A 1 38  ? 10.207  -14.334 -2.782  1.00 0.00 ? 38  ALA A HB2  3  
ATOM 3731  H HB3  . ALA A 1 38  ? 9.721   -12.669 -3.099  1.00 0.00 ? 38  ALA A HB3  3  
ATOM 3732  N N    . LEU A 1 39  ? 6.268   -12.674 -3.300  1.00 0.00 ? 39  LEU A N    3  
ATOM 3733  C CA   . LEU A 1 39  ? 5.015   -12.195 -2.726  1.00 0.00 ? 39  LEU A CA   3  
ATOM 3734  C C    . LEU A 1 39  ? 3.818   -12.793 -3.457  1.00 0.00 ? 39  LEU A C    3  
ATOM 3735  O O    . LEU A 1 39  ? 2.747   -12.971 -2.876  1.00 0.00 ? 39  LEU A O    3  
ATOM 3736  C CB   . LEU A 1 39  ? 4.954   -10.668 -2.787  1.00 0.00 ? 39  LEU A CB   3  
ATOM 3737  C CG   . LEU A 1 39  ? 6.249   -9.930  -2.446  1.00 0.00 ? 39  LEU A CG   3  
ATOM 3738  C CD1  . LEU A 1 39  ? 6.018   -8.427  -2.429  1.00 0.00 ? 39  LEU A CD1  3  
ATOM 3739  C CD2  . LEU A 1 39  ? 6.795   -10.403 -1.106  1.00 0.00 ? 39  LEU A CD2  3  
ATOM 3740  H H    . LEU A 1 39  ? 6.649   -12.205 -4.071  1.00 0.00 ? 39  LEU A H    3  
ATOM 3741  H HA   . LEU A 1 39  ? 4.983   -12.508 -1.693  1.00 0.00 ? 39  LEU A HA   3  
ATOM 3742  H HB2  . LEU A 1 39  ? 4.669   -10.389 -3.790  1.00 0.00 ? 39  LEU A HB2  3  
ATOM 3743  H HB3  . LEU A 1 39  ? 4.192   -10.341 -2.094  1.00 0.00 ? 39  LEU A HB3  3  
ATOM 3744  H HG   . LEU A 1 39  ? 6.989   -10.145 -3.204  1.00 0.00 ? 39  LEU A HG   3  
ATOM 3745  H HD11 . LEU A 1 39  ? 6.300   -8.009  -3.383  1.00 0.00 ? 39  LEU A HD11 3  
ATOM 3746  H HD12 . LEU A 1 39  ? 6.617   -7.980  -1.649  1.00 0.00 ? 39  LEU A HD12 3  
ATOM 3747  H HD13 . LEU A 1 39  ? 4.974   -8.226  -2.241  1.00 0.00 ? 39  LEU A HD13 3  
ATOM 3748  H HD21 . LEU A 1 39  ? 7.867   -10.275 -1.089  1.00 0.00 ? 39  LEU A HD21 3  
ATOM 3749  H HD22 . LEU A 1 39  ? 6.555   -11.448 -0.968  1.00 0.00 ? 39  LEU A HD22 3  
ATOM 3750  H HD23 . LEU A 1 39  ? 6.350   -9.823  -0.311  1.00 0.00 ? 39  LEU A HD23 3  
ATOM 3751  N N    . VAL A 1 40  ? 4.006   -13.104 -4.736  1.00 0.00 ? 40  VAL A N    3  
ATOM 3752  C CA   . VAL A 1 40  ? 2.943   -13.685 -5.546  1.00 0.00 ? 40  VAL A CA   3  
ATOM 3753  C C    . VAL A 1 40  ? 2.616   -15.103 -5.090  1.00 0.00 ? 40  VAL A C    3  
ATOM 3754  O O    . VAL A 1 40  ? 1.451   -15.494 -5.032  1.00 0.00 ? 40  VAL A O    3  
ATOM 3755  C CB   . VAL A 1 40  ? 3.325   -13.714 -7.038  1.00 0.00 ? 40  VAL A CB   3  
ATOM 3756  C CG1  . VAL A 1 40  ? 2.351   -14.578 -7.823  1.00 0.00 ? 40  VAL A CG1  3  
ATOM 3757  C CG2  . VAL A 1 40  ? 3.373   -12.302 -7.602  1.00 0.00 ? 40  VAL A CG2  3  
ATOM 3758  H H    . VAL A 1 40  ? 4.882   -12.939 -5.144  1.00 0.00 ? 40  VAL A H    3  
ATOM 3759  H HA   . VAL A 1 40  ? 2.062   -13.069 -5.434  1.00 0.00 ? 40  VAL A HA   3  
ATOM 3760  H HB   . VAL A 1 40  ? 4.310   -14.148 -7.128  1.00 0.00 ? 40  VAL A HB   3  
ATOM 3761  H HG11 . VAL A 1 40  ? 2.504   -15.616 -7.567  1.00 0.00 ? 40  VAL A HG11 3  
ATOM 3762  H HG12 . VAL A 1 40  ? 1.338   -14.291 -7.580  1.00 0.00 ? 40  VAL A HG12 3  
ATOM 3763  H HG13 . VAL A 1 40  ? 2.520   -14.440 -8.881  1.00 0.00 ? 40  VAL A HG13 3  
ATOM 3764  H HG21 . VAL A 1 40  ? 3.992   -12.289 -8.486  1.00 0.00 ? 40  VAL A HG21 3  
ATOM 3765  H HG22 . VAL A 1 40  ? 2.373   -11.982 -7.859  1.00 0.00 ? 40  VAL A HG22 3  
ATOM 3766  H HG23 . VAL A 1 40  ? 3.785   -11.632 -6.863  1.00 0.00 ? 40  VAL A HG23 3  
ATOM 3767  N N    . GLU A 1 41  ? 3.654   -15.868 -4.766  1.00 0.00 ? 41  GLU A N    3  
ATOM 3768  C CA   . GLU A 1 41  ? 3.477   -17.243 -4.314  1.00 0.00 ? 41  GLU A CA   3  
ATOM 3769  C C    . GLU A 1 41  ? 3.160   -17.289 -2.822  1.00 0.00 ? 41  GLU A C    3  
ATOM 3770  O O    . GLU A 1 41  ? 2.263   -18.012 -2.390  1.00 0.00 ? 41  GLU A O    3  
ATOM 3771  C CB   . GLU A 1 41  ? 4.734   -18.065 -4.605  1.00 0.00 ? 41  GLU A CB   3  
ATOM 3772  C CG   . GLU A 1 41  ? 5.987   -17.517 -3.942  1.00 0.00 ? 41  GLU A CG   3  
ATOM 3773  C CD   . GLU A 1 41  ? 7.221   -18.338 -4.259  1.00 0.00 ? 41  GLU A CD   3  
ATOM 3774  O OE1  . GLU A 1 41  ? 7.173   -19.574 -4.083  1.00 0.00 ? 41  GLU A OE1  3  
ATOM 3775  O OE2  . GLU A 1 41  ? 8.236   -17.746 -4.682  1.00 0.00 ? 41  GLU A OE2  3  
ATOM 3776  H H    . GLU A 1 41  ? 4.560   -15.499 -4.832  1.00 0.00 ? 41  GLU A H    3  
ATOM 3777  H HA   . GLU A 1 41  ? 2.647   -17.667 -4.859  1.00 0.00 ? 41  GLU A HA   3  
ATOM 3778  H HB2  . GLU A 1 41  ? 4.579   -19.075 -4.256  1.00 0.00 ? 41  GLU A HB2  3  
ATOM 3779  H HB3  . GLU A 1 41  ? 4.897   -18.085 -5.673  1.00 0.00 ? 41  GLU A HB3  3  
ATOM 3780  H HG2  . GLU A 1 41  ? 6.148   -16.506 -4.285  1.00 0.00 ? 41  GLU A HG2  3  
ATOM 3781  H HG3  . GLU A 1 41  ? 5.840   -17.513 -2.872  1.00 0.00 ? 41  GLU A HG3  3  
ATOM 3782  N N    . GLU A 1 42  ? 3.904   -16.513 -2.041  1.00 0.00 ? 42  GLU A N    3  
ATOM 3783  C CA   . GLU A 1 42  ? 3.703   -16.466 -0.597  1.00 0.00 ? 42  GLU A CA   3  
ATOM 3784  C C    . GLU A 1 42  ? 2.276   -16.041 -0.260  1.00 0.00 ? 42  GLU A C    3  
ATOM 3785  O O    . GLU A 1 42  ? 1.615   -16.659 0.576   1.00 0.00 ? 42  GLU A O    3  
ATOM 3786  C CB   . GLU A 1 42  ? 4.700   -15.502 0.048   1.00 0.00 ? 42  GLU A CB   3  
ATOM 3787  C CG   . GLU A 1 42  ? 4.654   -15.505 1.567   1.00 0.00 ? 42  GLU A CG   3  
ATOM 3788  C CD   . GLU A 1 42  ? 5.544   -16.572 2.175   1.00 0.00 ? 42  GLU A CD   3  
ATOM 3789  O OE1  . GLU A 1 42  ? 5.458   -17.738 1.737   1.00 0.00 ? 42  GLU A OE1  3  
ATOM 3790  O OE2  . GLU A 1 42  ? 6.326   -16.240 3.090   1.00 0.00 ? 42  GLU A OE2  3  
ATOM 3791  H H    . GLU A 1 42  ? 4.604   -15.959 -2.444  1.00 0.00 ? 42  GLU A H    3  
ATOM 3792  H HA   . GLU A 1 42  ? 3.872   -17.458 -0.207  1.00 0.00 ? 42  GLU A HA   3  
ATOM 3793  H HB2  . GLU A 1 42  ? 5.698   -15.774 -0.262  1.00 0.00 ? 42  GLU A HB2  3  
ATOM 3794  H HB3  . GLU A 1 42  ? 4.487   -14.500 -0.295  1.00 0.00 ? 42  GLU A HB3  3  
ATOM 3795  H HG2  . GLU A 1 42  ? 4.979   -14.540 1.926   1.00 0.00 ? 42  GLU A HG2  3  
ATOM 3796  H HG3  . GLU A 1 42  ? 3.637   -15.682 1.883   1.00 0.00 ? 42  GLU A HG3  3  
ATOM 3797  N N    . CYS A 1 43  ? 1.810   -14.984 -0.915  1.00 0.00 ? 43  CYS A N    3  
ATOM 3798  C CA   . CYS A 1 43  ? 0.463   -14.475 -0.684  1.00 0.00 ? 43  CYS A CA   3  
ATOM 3799  C C    . CYS A 1 43  ? -0.583  -15.532 -1.023  1.00 0.00 ? 43  CYS A C    3  
ATOM 3800  O O    . CYS A 1 43  ? -1.274  -16.041 -0.141  1.00 0.00 ? 43  CYS A O    3  
ATOM 3801  C CB   . CYS A 1 43  ? 0.221   -13.216 -1.517  1.00 0.00 ? 43  CYS A CB   3  
ATOM 3802  S SG   . CYS A 1 43  ? 1.047   -11.739 -0.879  1.00 0.00 ? 43  CYS A SG   3  
ATOM 3803  H H    . CYS A 1 43  ? 2.385   -14.534 -1.569  1.00 0.00 ? 43  CYS A H    3  
ATOM 3804  H HA   . CYS A 1 43  ? 0.378   -14.225 0.363   1.00 0.00 ? 43  CYS A HA   3  
ATOM 3805  H HB2  . CYS A 1 43  ? 0.580   -13.384 -2.522  1.00 0.00 ? 43  CYS A HB2  3  
ATOM 3806  H HB3  . CYS A 1 43  ? -0.839  -13.013 -1.551  1.00 0.00 ? 43  CYS A HB3  3  
ATOM 3807  H HG   . CYS A 1 43  ? 2.146   -11.546 -1.592  1.00 0.00 ? 43  CYS A HG   3  
ATOM 3808  N N    . ASN A 1 44  ? -0.696  -15.856 -2.307  1.00 0.00 ? 44  ASN A N    3  
ATOM 3809  C CA   . ASN A 1 44  ? -1.660  -16.851 -2.763  1.00 0.00 ? 44  ASN A CA   3  
ATOM 3810  C C    . ASN A 1 44  ? -1.662  -18.068 -1.843  1.00 0.00 ? 44  ASN A C    3  
ATOM 3811  O O    . ASN A 1 44  ? -2.695  -18.706 -1.643  1.00 0.00 ? 44  ASN A O    3  
ATOM 3812  C CB   . ASN A 1 44  ? -1.340  -17.282 -4.196  1.00 0.00 ? 44  ASN A CB   3  
ATOM 3813  C CG   . ASN A 1 44  ? -1.972  -16.368 -5.228  1.00 0.00 ? 44  ASN A CG   3  
ATOM 3814  O OD1  . ASN A 1 44  ? -3.160  -16.053 -5.150  1.00 0.00 ? 44  ASN A OD1  3  
ATOM 3815  N ND2  . ASN A 1 44  ? -1.179  -15.939 -6.203  1.00 0.00 ? 44  ASN A ND2  3  
ATOM 3816  H H    . ASN A 1 44  ? -0.117  -15.415 -2.964  1.00 0.00 ? 44  ASN A H    3  
ATOM 3817  H HA   . ASN A 1 44  ? -2.639  -16.397 -2.742  1.00 0.00 ? 44  ASN A HA   3  
ATOM 3818  H HB2  . ASN A 1 44  ? -0.269  -17.268 -4.339  1.00 0.00 ? 44  ASN A HB2  3  
ATOM 3819  H HB3  . ASN A 1 44  ? -1.708  -18.284 -4.355  1.00 0.00 ? 44  ASN A HB3  3  
ATOM 3820  H HD21 . ASN A 1 44  ? -0.243  -16.231 -6.201  1.00 0.00 ? 44  ASN A HD21 3  
ATOM 3821  H HD22 . ASN A 1 44  ? -1.562  -15.347 -6.883  1.00 0.00 ? 44  ASN A HD22 3  
ATOM 3822  N N    . ARG A 1 45  ? -0.497  -18.383 -1.284  1.00 0.00 ? 45  ARG A N    3  
ATOM 3823  C CA   . ARG A 1 45  ? -0.364  -19.523 -0.386  1.00 0.00 ? 45  ARG A CA   3  
ATOM 3824  C C    . ARG A 1 45  ? -1.058  -19.250 0.945   1.00 0.00 ? 45  ARG A C    3  
ATOM 3825  O O    . ARG A 1 45  ? -1.973  -19.974 1.340   1.00 0.00 ? 45  ARG A O    3  
ATOM 3826  C CB   . ARG A 1 45  ? 1.113   -19.842 -0.147  1.00 0.00 ? 45  ARG A CB   3  
ATOM 3827  C CG   . ARG A 1 45  ? 1.346   -20.847 0.969   1.00 0.00 ? 45  ARG A CG   3  
ATOM 3828  C CD   . ARG A 1 45  ? 2.748   -20.723 1.545   1.00 0.00 ? 45  ARG A CD   3  
ATOM 3829  N NE   . ARG A 1 45  ? 2.796   -21.102 2.955   1.00 0.00 ? 45  ARG A NE   3  
ATOM 3830  C CZ   . ARG A 1 45  ? 2.864   -22.359 3.377   1.00 0.00 ? 45  ARG A CZ   3  
ATOM 3831  N NH1  . ARG A 1 45  ? 2.893   -23.355 2.501   1.00 0.00 ? 45  ARG A NH1  3  
ATOM 3832  N NH2  . ARG A 1 45  ? 2.904   -22.624 4.677   1.00 0.00 ? 45  ARG A NH2  3  
ATOM 3833  H H    . ARG A 1 45  ? 0.292   -17.836 -1.482  1.00 0.00 ? 45  ARG A H    3  
ATOM 3834  H HA   . ARG A 1 45  ? -0.835  -20.373 -0.856  1.00 0.00 ? 45  ARG A HA   3  
ATOM 3835  H HB2  . ARG A 1 45  ? 1.534   -20.244 -1.057  1.00 0.00 ? 45  ARG A HB2  3  
ATOM 3836  H HB3  . ARG A 1 45  ? 1.629   -18.929 0.106   1.00 0.00 ? 45  ARG A HB3  3  
ATOM 3837  H HG2  . ARG A 1 45  ? 0.629   -20.669 1.757   1.00 0.00 ? 45  ARG A HG2  3  
ATOM 3838  H HG3  . ARG A 1 45  ? 1.214   -21.844 0.577   1.00 0.00 ? 45  ARG A HG3  3  
ATOM 3839  H HD2  . ARG A 1 45  ? 3.410   -21.368 0.987   1.00 0.00 ? 45  ARG A HD2  3  
ATOM 3840  H HD3  . ARG A 1 45  ? 3.075   -19.699 1.446   1.00 0.00 ? 45  ARG A HD3  3  
ATOM 3841  H HE   . ARG A 1 45  ? 2.775   -20.382 3.619   1.00 0.00 ? 45  ARG A HE   3  
ATOM 3842  H HH11 . ARG A 1 45  ? 2.864   -23.159 1.522   1.00 0.00 ? 45  ARG A HH11 3  
ATOM 3843  H HH12 . ARG A 1 45  ? 2.946   -24.301 2.822   1.00 0.00 ? 45  ARG A HH12 3  
ATOM 3844  H HH21 . ARG A 1 45  ? 2.883   -21.876 5.339   1.00 0.00 ? 45  ARG A HH21 3  
ATOM 3845  H HH22 . ARG A 1 45  ? 2.955   -23.570 4.993   1.00 0.00 ? 45  ARG A HH22 3  
ATOM 3846  N N    . ALA A 1 46  ? -0.617  -18.202 1.633   1.00 0.00 ? 46  ALA A N    3  
ATOM 3847  C CA   . ALA A 1 46  ? -1.196  -17.833 2.919   1.00 0.00 ? 46  ALA A CA   3  
ATOM 3848  C C    . ALA A 1 46  ? -2.704  -17.638 2.805   1.00 0.00 ? 46  ALA A C    3  
ATOM 3849  O O    . ALA A 1 46  ? -3.461  -18.057 3.681   1.00 0.00 ? 46  ALA A O    3  
ATOM 3850  C CB   . ALA A 1 46  ? -0.537  -16.570 3.451   1.00 0.00 ? 46  ALA A CB   3  
ATOM 3851  H H    . ALA A 1 46  ? 0.115   -17.664 1.266   1.00 0.00 ? 46  ALA A H    3  
ATOM 3852  H HA   . ALA A 1 46  ? -0.999  -18.634 3.616   1.00 0.00 ? 46  ALA A HA   3  
ATOM 3853  H HB1  . ALA A 1 46  ? -1.296  -15.903 3.835   1.00 0.00 ? 46  ALA A HB1  3  
ATOM 3854  H HB2  . ALA A 1 46  ? 0.150   -16.828 4.243   1.00 0.00 ? 46  ALA A HB2  3  
ATOM 3855  H HB3  . ALA A 1 46  ? 0.001   -16.081 2.653   1.00 0.00 ? 46  ALA A HB3  3  
ATOM 3856  N N    . GLU A 1 47  ? -3.134  -16.999 1.721   1.00 0.00 ? 47  GLU A N    3  
ATOM 3857  C CA   . GLU A 1 47  ? -4.553  -16.748 1.496   1.00 0.00 ? 47  GLU A CA   3  
ATOM 3858  C C    . GLU A 1 47  ? -5.352  -18.046 1.556   1.00 0.00 ? 47  GLU A C    3  
ATOM 3859  O O    . GLU A 1 47  ? -6.427  -18.099 2.155   1.00 0.00 ? 47  GLU A O    3  
ATOM 3860  C CB   . GLU A 1 47  ? -4.764  -16.069 0.141   1.00 0.00 ? 47  GLU A CB   3  
ATOM 3861  C CG   . GLU A 1 47  ? -4.151  -14.681 0.054   1.00 0.00 ? 47  GLU A CG   3  
ATOM 3862  C CD   . GLU A 1 47  ? -4.896  -13.774 -0.906  1.00 0.00 ? 47  GLU A CD   3  
ATOM 3863  O OE1  . GLU A 1 47  ? -4.792  -13.991 -2.131  1.00 0.00 ? 47  GLU A OE1  3  
ATOM 3864  O OE2  . GLU A 1 47  ? -5.583  -12.846 -0.431  1.00 0.00 ? 47  GLU A OE2  3  
ATOM 3865  H H    . GLU A 1 47  ? -2.482  -16.689 1.059   1.00 0.00 ? 47  GLU A H    3  
ATOM 3866  H HA   . GLU A 1 47  ? -4.901  -16.088 2.277   1.00 0.00 ? 47  GLU A HA   3  
ATOM 3867  H HB2  . GLU A 1 47  ? -4.323  -16.684 -0.629  1.00 0.00 ? 47  GLU A HB2  3  
ATOM 3868  H HB3  . GLU A 1 47  ? -5.825  -15.983 -0.043  1.00 0.00 ? 47  GLU A HB3  3  
ATOM 3869  H HG2  . GLU A 1 47  ? -4.167  -14.232 1.035   1.00 0.00 ? 47  GLU A HG2  3  
ATOM 3870  H HG3  . GLU A 1 47  ? -3.128  -14.774 -0.282  1.00 0.00 ? 47  GLU A HG3  3  
ATOM 3871  N N    . CYS A 1 48  ? -4.819  -19.091 0.932   1.00 0.00 ? 48  CYS A N    3  
ATOM 3872  C CA   . CYS A 1 48  ? -5.483  -20.390 0.913   1.00 0.00 ? 48  CYS A CA   3  
ATOM 3873  C C    . CYS A 1 48  ? -5.531  -20.996 2.312   1.00 0.00 ? 48  CYS A C    3  
ATOM 3874  O O    . CYS A 1 48  ? -6.532  -21.596 2.706   1.00 0.00 ? 48  CYS A O    3  
ATOM 3875  C CB   . CYS A 1 48  ? -4.761  -21.341 -0.043  1.00 0.00 ? 48  CYS A CB   3  
ATOM 3876  S SG   . CYS A 1 48  ? -5.154  -21.072 -1.787  1.00 0.00 ? 48  CYS A SG   3  
ATOM 3877  H H    . CYS A 1 48  ? -3.960  -18.987 0.473   1.00 0.00 ? 48  CYS A H    3  
ATOM 3878  H HA   . CYS A 1 48  ? -6.493  -20.240 0.564   1.00 0.00 ? 48  CYS A HA   3  
ATOM 3879  H HB2  . CYS A 1 48  ? -3.694  -21.217 0.076   1.00 0.00 ? 48  CYS A HB2  3  
ATOM 3880  H HB3  . CYS A 1 48  ? -5.028  -22.358 0.203   1.00 0.00 ? 48  CYS A HB3  3  
ATOM 3881  H HG   . CYS A 1 48  ? -4.013  -20.974 -2.453  1.00 0.00 ? 48  CYS A HG   3  
ATOM 3882  N N    . LEU A 1 49  ? -4.444  -20.837 3.058   1.00 0.00 ? 49  LEU A N    3  
ATOM 3883  C CA   . LEU A 1 49  ? -4.361  -21.370 4.414   1.00 0.00 ? 49  LEU A CA   3  
ATOM 3884  C C    . LEU A 1 49  ? -5.412  -20.731 5.315   1.00 0.00 ? 49  LEU A C    3  
ATOM 3885  O O    . LEU A 1 49  ? -6.213  -21.426 5.940   1.00 0.00 ? 49  LEU A O    3  
ATOM 3886  C CB   . LEU A 1 49  ? -2.965  -21.133 4.992   1.00 0.00 ? 49  LEU A CB   3  
ATOM 3887  C CG   . LEU A 1 49  ? -1.791  -21.508 4.086   1.00 0.00 ? 49  LEU A CG   3  
ATOM 3888  C CD1  . LEU A 1 49  ? -0.524  -21.699 4.905   1.00 0.00 ? 49  LEU A CD1  3  
ATOM 3889  C CD2  . LEU A 1 49  ? -2.110  -22.766 3.292   1.00 0.00 ? 49  LEU A CD2  3  
ATOM 3890  H H    . LEU A 1 49  ? -3.678  -20.350 2.690   1.00 0.00 ? 49  LEU A H    3  
ATOM 3891  H HA   . LEU A 1 49  ? -4.546  -22.433 4.363   1.00 0.00 ? 49  LEU A HA   3  
ATOM 3892  H HB2  . LEU A 1 49  ? -2.878  -20.084 5.228   1.00 0.00 ? 49  LEU A HB2  3  
ATOM 3893  H HB3  . LEU A 1 49  ? -2.881  -21.713 5.900   1.00 0.00 ? 49  LEU A HB3  3  
ATOM 3894  H HG   . LEU A 1 49  ? -1.616  -20.704 3.384   1.00 0.00 ? 49  LEU A HG   3  
ATOM 3895  H HD11 . LEU A 1 49  ? 0.212   -20.969 4.604   1.00 0.00 ? 49  LEU A HD11 3  
ATOM 3896  H HD12 . LEU A 1 49  ? -0.135  -22.693 4.739   1.00 0.00 ? 49  LEU A HD12 3  
ATOM 3897  H HD13 . LEU A 1 49  ? -0.751  -21.572 5.953   1.00 0.00 ? 49  LEU A HD13 3  
ATOM 3898  H HD21 . LEU A 1 49  ? -2.353  -23.569 3.973   1.00 0.00 ? 49  LEU A HD21 3  
ATOM 3899  H HD22 . LEU A 1 49  ? -1.251  -23.046 2.699   1.00 0.00 ? 49  LEU A HD22 3  
ATOM 3900  H HD23 . LEU A 1 49  ? -2.951  -22.578 2.642   1.00 0.00 ? 49  LEU A HD23 3  
ATOM 3901  N N    . GLN A 1 50  ? -5.404  -19.403 5.376   1.00 0.00 ? 50  GLN A N    3  
ATOM 3902  C CA   . GLN A 1 50  ? -6.358  -18.670 6.200   1.00 0.00 ? 50  GLN A CA   3  
ATOM 3903  C C    . GLN A 1 50  ? -7.791  -18.984 5.783   1.00 0.00 ? 50  GLN A C    3  
ATOM 3904  O O    . GLN A 1 50  ? -8.644  -19.269 6.624   1.00 0.00 ? 50  GLN A O    3  
ATOM 3905  C CB   . GLN A 1 50  ? -6.102  -17.165 6.097   1.00 0.00 ? 50  GLN A CB   3  
ATOM 3906  C CG   . GLN A 1 50  ? -6.252  -16.618 4.687   1.00 0.00 ? 50  GLN A CG   3  
ATOM 3907  C CD   . GLN A 1 50  ? -5.972  -15.130 4.606   1.00 0.00 ? 50  GLN A CD   3  
ATOM 3908  O OE1  . GLN A 1 50  ? -6.881  -14.308 4.727   1.00 0.00 ? 50  GLN A OE1  3  
ATOM 3909  N NE2  . GLN A 1 50  ? -4.709  -14.775 4.400   1.00 0.00 ? 50  GLN A NE2  3  
ATOM 3910  H H    . GLN A 1 50  ? -4.741  -18.905 4.854   1.00 0.00 ? 50  GLN A H    3  
ATOM 3911  H HA   . GLN A 1 50  ? -6.218  -18.981 7.224   1.00 0.00 ? 50  GLN A HA   3  
ATOM 3912  H HB2  . GLN A 1 50  ? -6.802  -16.649 6.737   1.00 0.00 ? 50  GLN A HB2  3  
ATOM 3913  H HB3  . GLN A 1 50  ? -5.098  -16.959 6.435   1.00 0.00 ? 50  GLN A HB3  3  
ATOM 3914  H HG2  . GLN A 1 50  ? -5.559  -17.134 4.038   1.00 0.00 ? 50  GLN A HG2  3  
ATOM 3915  H HG3  . GLN A 1 50  ? -7.262  -16.798 4.350   1.00 0.00 ? 50  GLN A HG3  3  
ATOM 3916  H HE21 . GLN A 1 50  ? -4.038  -15.485 4.312   1.00 0.00 ? 50  GLN A HE21 3  
ATOM 3917  H HE22 . GLN A 1 50  ? -4.500  -13.821 4.342   1.00 0.00 ? 50  GLN A HE22 3  
ATOM 3918  N N    . ARG A 1 51  ? -8.049  -18.930 4.481   1.00 0.00 ? 51  ARG A N    3  
ATOM 3919  C CA   . ARG A 1 51  ? -9.379  -19.207 3.953   1.00 0.00 ? 51  ARG A CA   3  
ATOM 3920  C C    . ARG A 1 51  ? -9.691  -20.699 4.021   1.00 0.00 ? 51  ARG A C    3  
ATOM 3921  O O    . ARG A 1 51  ? -10.751 -21.143 3.582   1.00 0.00 ? 51  ARG A O    3  
ATOM 3922  C CB   . ARG A 1 51  ? -9.490  -18.717 2.508   1.00 0.00 ? 51  ARG A CB   3  
ATOM 3923  C CG   . ARG A 1 51  ? -9.800  -17.234 2.389   1.00 0.00 ? 51  ARG A CG   3  
ATOM 3924  C CD   . ARG A 1 51  ? -9.526  -16.718 0.985   1.00 0.00 ? 51  ARG A CD   3  
ATOM 3925  N NE   . ARG A 1 51  ? -10.138 -15.412 0.753   1.00 0.00 ? 51  ARG A NE   3  
ATOM 3926  C CZ   . ARG A 1 51  ? -11.447 -15.226 0.628   1.00 0.00 ? 51  ARG A CZ   3  
ATOM 3927  N NH1  . ARG A 1 51  ? -12.278 -16.256 0.714   1.00 0.00 ? 51  ARG A NH1  3  
ATOM 3928  N NH2  . ARG A 1 51  ? -11.928 -14.007 0.418   1.00 0.00 ? 51  ARG A NH2  3  
ATOM 3929  H H    . ARG A 1 51  ? -7.327  -18.697 3.859   1.00 0.00 ? 51  ARG A H    3  
ATOM 3930  H HA   . ARG A 1 51  ? -10.095 -18.673 4.560   1.00 0.00 ? 51  ARG A HA   3  
ATOM 3931  H HB2  . ARG A 1 51  ? -8.555  -18.908 2.002   1.00 0.00 ? 51  ARG A HB2  3  
ATOM 3932  H HB3  . ARG A 1 51  ? -10.276 -19.267 2.013   1.00 0.00 ? 51  ARG A HB3  3  
ATOM 3933  H HG2  . ARG A 1 51  ? -10.842 -17.073 2.623   1.00 0.00 ? 51  ARG A HG2  3  
ATOM 3934  H HG3  . ARG A 1 51  ? -9.184  -16.690 3.090   1.00 0.00 ? 51  ARG A HG3  3  
ATOM 3935  H HD2  . ARG A 1 51  ? -8.458  -16.634 0.849   1.00 0.00 ? 51  ARG A HD2  3  
ATOM 3936  H HD3  . ARG A 1 51  ? -9.925  -17.424 0.273   1.00 0.00 ? 51  ARG A HD3  3  
ATOM 3937  H HE   . ARG A 1 51  ? -9.542  -14.637 0.686   1.00 0.00 ? 51  ARG A HE   3  
ATOM 3938  H HH11 . ARG A 1 51  ? -11.918 -17.175 0.874   1.00 0.00 ? 51  ARG A HH11 3  
ATOM 3939  H HH12 . ARG A 1 51  ? -13.263 -16.113 0.622   1.00 0.00 ? 51  ARG A HH12 3  
ATOM 3940  H HH21 . ARG A 1 51  ? -11.305 -13.229 0.353   1.00 0.00 ? 51  ARG A HH21 3  
ATOM 3941  H HH22 . ARG A 1 51  ? -12.914 -13.868 0.325   1.00 0.00 ? 51  ARG A HH22 3  
ATOM 3942  N N    . GLY A 1 52  ? -8.759  -21.469 4.575   1.00 0.00 ? 52  GLY A N    3  
ATOM 3943  C CA   . GLY A 1 52  ? -8.953  -22.902 4.690   1.00 0.00 ? 52  GLY A CA   3  
ATOM 3944  C C    . GLY A 1 52  ? -8.541  -23.645 3.434   1.00 0.00 ? 52  GLY A C    3  
ATOM 3945  O O    . GLY A 1 52  ? -8.231  -24.836 3.482   1.00 0.00 ? 52  GLY A O    3  
ATOM 3946  H H    . GLY A 1 52  ? -7.933  -21.060 4.908   1.00 0.00 ? 52  GLY A H    3  
ATOM 3947  H HA2  . GLY A 1 52  ? -8.369  -23.268 5.520   1.00 0.00 ? 52  GLY A HA2  3  
ATOM 3948  H HA3  . GLY A 1 52  ? -9.997  -23.098 4.883   1.00 0.00 ? 52  GLY A HA3  3  
ATOM 3949  N N    . VAL A 1 53  ? -8.538  -22.942 2.306   1.00 0.00 ? 53  VAL A N    3  
ATOM 3950  C CA   . VAL A 1 53  ? -8.161  -23.543 1.032   1.00 0.00 ? 53  VAL A CA   3  
ATOM 3951  C C    . VAL A 1 53  ? -6.730  -24.068 1.073   1.00 0.00 ? 53  VAL A C    3  
ATOM 3952  O O    . VAL A 1 53  ? -6.015  -23.873 2.056   1.00 0.00 ? 53  VAL A O    3  
ATOM 3953  C CB   . VAL A 1 53  ? -8.293  -22.535 -0.125  1.00 0.00 ? 53  VAL A CB   3  
ATOM 3954  C CG1  . VAL A 1 53  ? -8.437  -23.261 -1.453  1.00 0.00 ? 53  VAL A CG1  3  
ATOM 3955  C CG2  . VAL A 1 53  ? -9.472  -21.603 0.113   1.00 0.00 ? 53  VAL A CG2  3  
ATOM 3956  H H    . VAL A 1 53  ? -8.794  -21.997 2.332   1.00 0.00 ? 53  VAL A H    3  
ATOM 3957  H HA   . VAL A 1 53  ? -8.832  -24.368 0.841   1.00 0.00 ? 53  VAL A HA   3  
ATOM 3958  H HB   . VAL A 1 53  ? -7.393  -21.940 -0.161  1.00 0.00 ? 53  VAL A HB   3  
ATOM 3959  H HG11 . VAL A 1 53  ? -8.692  -24.295 -1.271  1.00 0.00 ? 53  VAL A HG11 3  
ATOM 3960  H HG12 . VAL A 1 53  ? -9.217  -22.794 -2.037  1.00 0.00 ? 53  VAL A HG12 3  
ATOM 3961  H HG13 . VAL A 1 53  ? -7.503  -23.211 -1.994  1.00 0.00 ? 53  VAL A HG13 3  
ATOM 3962  H HG21 . VAL A 1 53  ? -9.143  -20.745 0.680   1.00 0.00 ? 53  VAL A HG21 3  
ATOM 3963  H HG22 . VAL A 1 53  ? -9.871  -21.276 -0.836  1.00 0.00 ? 53  VAL A HG22 3  
ATOM 3964  H HG23 . VAL A 1 53  ? -10.239 -22.126 0.665   1.00 0.00 ? 53  VAL A HG23 3  
ATOM 3965  N N    . SER A 1 54  ? -6.319  -24.734 -0.001  1.00 0.00 ? 54  SER A N    3  
ATOM 3966  C CA   . SER A 1 54  ? -4.974  -25.290 -0.086  1.00 0.00 ? 54  SER A CA   3  
ATOM 3967  C C    . SER A 1 54  ? -4.057  -24.374 -0.892  1.00 0.00 ? 54  SER A C    3  
ATOM 3968  O O    . SER A 1 54  ? -4.455  -23.781 -1.895  1.00 0.00 ? 54  SER A O    3  
ATOM 3969  C CB   . SER A 1 54  ? -5.013  -26.680 -0.725  1.00 0.00 ? 54  SER A CB   3  
ATOM 3970  O OG   . SER A 1 54  ? -3.963  -27.496 -0.236  1.00 0.00 ? 54  SER A OG   3  
ATOM 3971  H H    . SER A 1 54  ? -6.936  -24.856 -0.753  1.00 0.00 ? 54  SER A H    3  
ATOM 3972  H HA   . SER A 1 54  ? -4.586  -25.375 0.918   1.00 0.00 ? 54  SER A HA   3  
ATOM 3973  H HB2  . SER A 1 54  ? -5.956  -27.152 -0.495  1.00 0.00 ? 54  SER A HB2  3  
ATOM 3974  H HB3  . SER A 1 54  ? -4.910  -26.584 -1.796  1.00 0.00 ? 54  SER A HB3  3  
ATOM 3975  H HG   . SER A 1 54  ? -3.982  -28.345 -0.683  1.00 0.00 ? 54  SER A HG   3  
ATOM 3976  N N    . PRO A 1 55  ? -2.799  -24.254 -0.443  1.00 0.00 ? 55  PRO A N    3  
ATOM 3977  C CA   . PRO A 1 55  ? -1.798  -23.413 -1.106  1.00 0.00 ? 55  PRO A CA   3  
ATOM 3978  C C    . PRO A 1 55  ? -1.368  -23.979 -2.455  1.00 0.00 ? 55  PRO A C    3  
ATOM 3979  O O    . PRO A 1 55  ? -0.646  -23.328 -3.210  1.00 0.00 ? 55  PRO A O    3  
ATOM 3980  C CB   . PRO A 1 55  ? -0.624  -23.418 -0.125  1.00 0.00 ? 55  PRO A CB   3  
ATOM 3981  C CG   . PRO A 1 55  ? -0.776  -24.686 0.642   1.00 0.00 ? 55  PRO A CG   3  
ATOM 3982  C CD   . PRO A 1 55  ? -2.255  -24.932 0.746   1.00 0.00 ? 55  PRO A CD   3  
ATOM 3983  H HA   . PRO A 1 55  ? -2.155  -22.402 -1.239  1.00 0.00 ? 55  PRO A HA   3  
ATOM 3984  H HB2  . PRO A 1 55  ? 0.307   -23.396 -0.674  1.00 0.00 ? 55  PRO A HB2  3  
ATOM 3985  H HB3  . PRO A 1 55  ? -0.687  -22.556 0.522   1.00 0.00 ? 55  PRO A HB3  3  
ATOM 3986  H HG2  . PRO A 1 55  ? -0.298  -25.495 0.111   1.00 0.00 ? 55  PRO A HG2  3  
ATOM 3987  H HG3  . PRO A 1 55  ? -0.344  -24.574 1.625   1.00 0.00 ? 55  PRO A HG3  3  
ATOM 3988  H HD2  . PRO A 1 55  ? -2.465  -25.991 0.716   1.00 0.00 ? 55  PRO A HD2  3  
ATOM 3989  H HD3  . PRO A 1 55  ? -2.648  -24.493 1.652   1.00 0.00 ? 55  PRO A HD3  3  
ATOM 3990  N N    . SER A 1 56  ? -1.816  -25.195 -2.752  1.00 0.00 ? 56  SER A N    3  
ATOM 3991  C CA   . SER A 1 56  ? -1.473  -25.849 -4.010  1.00 0.00 ? 56  SER A CA   3  
ATOM 3992  C C    . SER A 1 56  ? -2.585  -25.665 -5.038  1.00 0.00 ? 56  SER A C    3  
ATOM 3993  O O    . SER A 1 56  ? -2.424  -26.003 -6.211  1.00 0.00 ? 56  SER A O    3  
ATOM 3994  C CB   . SER A 1 56  ? -1.218  -27.340 -3.780  1.00 0.00 ? 56  SER A CB   3  
ATOM 3995  O OG   . SER A 1 56  ? -0.581  -27.927 -4.901  1.00 0.00 ? 56  SER A OG   3  
ATOM 3996  H H    . SER A 1 56  ? -2.388  -25.663 -2.109  1.00 0.00 ? 56  SER A H    3  
ATOM 3997  H HA   . SER A 1 56  ? -0.571  -25.392 -4.387  1.00 0.00 ? 56  SER A HA   3  
ATOM 3998  H HB2  . SER A 1 56  ? -0.584  -27.465 -2.915  1.00 0.00 ? 56  SER A HB2  3  
ATOM 3999  H HB3  . SER A 1 56  ? -2.159  -27.842 -3.612  1.00 0.00 ? 56  SER A HB3  3  
ATOM 4000  H HG   . SER A 1 56  ? -1.222  -28.434 -5.405  1.00 0.00 ? 56  SER A HG   3  
ATOM 4001  N N    . LYS A 1 57  ? -3.714  -25.127 -4.590  1.00 0.00 ? 57  LYS A N    3  
ATOM 4002  C CA   . LYS A 1 57  ? -4.854  -24.895 -5.469  1.00 0.00 ? 57  LYS A CA   3  
ATOM 4003  C C    . LYS A 1 57  ? -5.202  -23.412 -5.529  1.00 0.00 ? 57  LYS A C    3  
ATOM 4004  O O    . LYS A 1 57  ? -6.329  -23.042 -5.855  1.00 0.00 ? 57  LYS A O    3  
ATOM 4005  C CB   . LYS A 1 57  ? -6.067  -25.695 -4.987  1.00 0.00 ? 57  LYS A CB   3  
ATOM 4006  C CG   . LYS A 1 57  ? -5.723  -27.098 -4.518  1.00 0.00 ? 57  LYS A CG   3  
ATOM 4007  C CD   . LYS A 1 57  ? -5.698  -28.083 -5.675  1.00 0.00 ? 57  LYS A CD   3  
ATOM 4008  C CE   . LYS A 1 57  ? -7.104  -28.496 -6.085  1.00 0.00 ? 57  LYS A CE   3  
ATOM 4009  N NZ   . LYS A 1 57  ? -7.104  -29.766 -6.863  1.00 0.00 ? 57  LYS A NZ   3  
ATOM 4010  H H    . LYS A 1 57  ? -3.782  -24.878 -3.643  1.00 0.00 ? 57  LYS A H    3  
ATOM 4011  H HA   . LYS A 1 57  ? -4.583  -25.230 -6.459  1.00 0.00 ? 57  LYS A HA   3  
ATOM 4012  H HB2  . LYS A 1 57  ? -6.528  -25.167 -4.166  1.00 0.00 ? 57  LYS A HB2  3  
ATOM 4013  H HB3  . LYS A 1 57  ? -6.776  -25.773 -5.798  1.00 0.00 ? 57  LYS A HB3  3  
ATOM 4014  H HG2  . LYS A 1 57  ? -4.749  -27.084 -4.052  1.00 0.00 ? 57  LYS A HG2  3  
ATOM 4015  H HG3  . LYS A 1 57  ? -6.463  -27.420 -3.799  1.00 0.00 ? 57  LYS A HG3  3  
ATOM 4016  H HD2  . LYS A 1 57  ? -5.211  -27.620 -6.520  1.00 0.00 ? 57  LYS A HD2  3  
ATOM 4017  H HD3  . LYS A 1 57  ? -5.147  -28.963 -5.376  1.00 0.00 ? 57  LYS A HD3  3  
ATOM 4018  H HE2  . LYS A 1 57  ? -7.700  -28.628 -5.196  1.00 0.00 ? 57  LYS A HE2  3  
ATOM 4019  H HE3  . LYS A 1 57  ? -7.532  -27.712 -6.692  1.00 0.00 ? 57  LYS A HE3  3  
ATOM 4020  H HZ1  . LYS A 1 57  ? -7.155  -29.561 -7.881  1.00 0.00 ? 57  LYS A HZ1  3  
ATOM 4021  H HZ2  . LYS A 1 57  ? -7.924  -30.348 -6.596  1.00 0.00 ? 57  LYS A HZ2  3  
ATOM 4022  H HZ3  . LYS A 1 57  ? -6.234  -30.302 -6.671  1.00 0.00 ? 57  LYS A HZ3  3  
ATOM 4023  N N    . ALA A 1 58  ? -4.226  -22.566 -5.215  1.00 0.00 ? 58  ALA A N    3  
ATOM 4024  C CA   . ALA A 1 58  ? -4.428  -21.123 -5.237  1.00 0.00 ? 58  ALA A CA   3  
ATOM 4025  C C    . ALA A 1 58  ? -5.052  -20.676 -6.555  1.00 0.00 ? 58  ALA A C    3  
ATOM 4026  O O    . ALA A 1 58  ? -5.774  -19.680 -6.606  1.00 0.00 ? 58  ALA A O    3  
ATOM 4027  C CB   . ALA A 1 58  ? -3.109  -20.401 -5.004  1.00 0.00 ? 58  ALA A CB   3  
ATOM 4028  H H    . ALA A 1 58  ? -3.348  -22.922 -4.963  1.00 0.00 ? 58  ALA A H    3  
ATOM 4029  H HA   . ALA A 1 58  ? -5.098  -20.867 -4.429  1.00 0.00 ? 58  ALA A HA   3  
ATOM 4030  H HB1  . ALA A 1 58  ? -3.285  -19.515 -4.412  1.00 0.00 ? 58  ALA A HB1  3  
ATOM 4031  H HB2  . ALA A 1 58  ? -2.429  -21.056 -4.481  1.00 0.00 ? 58  ALA A HB2  3  
ATOM 4032  H HB3  . ALA A 1 58  ? -2.680  -20.120 -5.954  1.00 0.00 ? 58  ALA A HB3  3  
ATOM 4033  N N    . HIS A 1 59  ? -4.769  -21.420 -7.620  1.00 0.00 ? 59  HIS A N    3  
ATOM 4034  C CA   . HIS A 1 59  ? -5.303  -21.100 -8.939  1.00 0.00 ? 59  HIS A CA   3  
ATOM 4035  C C    . HIS A 1 59  ? -6.804  -20.838 -8.869  1.00 0.00 ? 59  HIS A C    3  
ATOM 4036  O O    . HIS A 1 59  ? -7.342  -20.040 -9.636  1.00 0.00 ? 59  HIS A O    3  
ATOM 4037  C CB   . HIS A 1 59  ? -5.018  -22.239 -9.918  1.00 0.00 ? 59  HIS A CB   3  
ATOM 4038  C CG   . HIS A 1 59  ? -5.496  -23.575 -9.439  1.00 0.00 ? 59  HIS A CG   3  
ATOM 4039  N ND1  . HIS A 1 59  ? -6.767  -24.050 -9.681  1.00 0.00 ? 59  HIS A ND1  3  
ATOM 4040  C CD2  . HIS A 1 59  ? -4.864  -24.538 -8.729  1.00 0.00 ? 59  HIS A CD2  3  
ATOM 4041  C CE1  . HIS A 1 59  ? -6.898  -25.248 -9.139  1.00 0.00 ? 59  HIS A CE1  3  
ATOM 4042  N NE2  . HIS A 1 59  ? -5.757  -25.568 -8.556  1.00 0.00 ? 59  HIS A NE2  3  
ATOM 4043  H H    . HIS A 1 59  ? -4.188  -22.202 -7.516  1.00 0.00 ? 59  HIS A H    3  
ATOM 4044  H HA   . HIS A 1 59  ? -4.810  -20.205 -9.288  1.00 0.00 ? 59  HIS A HA   3  
ATOM 4045  H HB2  . HIS A 1 59  ? -5.508  -22.029 -10.858 1.00 0.00 ? 59  HIS A HB2  3  
ATOM 4046  H HB3  . HIS A 1 59  ? -3.951  -22.306 -10.082 1.00 0.00 ? 59  HIS A HB3  3  
ATOM 4047  H HD1  . HIS A 1 59  ? -7.470  -23.579 -10.175 1.00 0.00 ? 59  HIS A HD1  3  
ATOM 4048  H HD2  . HIS A 1 59  ? -3.847  -24.505 -8.365  1.00 0.00 ? 59  HIS A HD2  3  
ATOM 4049  H HE1  . HIS A 1 59  ? -7.786  -25.862 -9.169  1.00 0.00 ? 59  HIS A HE1  3  
ATOM 4050  H HE2  . HIS A 1 59  ? -5.609  -26.365 -8.006  1.00 0.00 ? 59  HIS A HE2  3  
ATOM 4051  N N    . GLY A 1 60  ? -7.476  -21.516 -7.944  1.00 0.00 ? 60  GLY A N    3  
ATOM 4052  C CA   . GLY A 1 60  ? -8.909  -21.344 -7.791  1.00 0.00 ? 60  GLY A CA   3  
ATOM 4053  C C    . GLY A 1 60  ? -9.277  -19.957 -7.303  1.00 0.00 ? 60  GLY A C    3  
ATOM 4054  O O    . GLY A 1 60  ? -10.351 -19.444 -7.620  1.00 0.00 ? 60  GLY A O    3  
ATOM 4055  H H    . GLY A 1 60  ? -6.995  -22.140 -7.360  1.00 0.00 ? 60  GLY A H    3  
ATOM 4056  H HA2  . GLY A 1 60  ? -9.385  -21.517 -8.745  1.00 0.00 ? 60  GLY A HA2  3  
ATOM 4057  H HA3  . GLY A 1 60  ? -9.274  -22.071 -7.081  1.00 0.00 ? 60  GLY A HA3  3  
ATOM 4058  N N    . LEU A 1 61  ? -8.386  -19.348 -6.528  1.00 0.00 ? 61  LEU A N    3  
ATOM 4059  C CA   . LEU A 1 61  ? -8.623  -18.012 -5.994  1.00 0.00 ? 61  LEU A CA   3  
ATOM 4060  C C    . LEU A 1 61  ? -9.306  -17.124 -7.029  1.00 0.00 ? 61  LEU A C    3  
ATOM 4061  O O    . LEU A 1 61  ? -10.128 -16.275 -6.688  1.00 0.00 ? 61  LEU A O    3  
ATOM 4062  C CB   . LEU A 1 61  ? -7.304  -17.377 -5.551  1.00 0.00 ? 61  LEU A CB   3  
ATOM 4063  C CG   . LEU A 1 61  ? -6.646  -17.989 -4.313  1.00 0.00 ? 61  LEU A CG   3  
ATOM 4064  C CD1  . LEU A 1 61  ? -5.154  -17.699 -4.303  1.00 0.00 ? 61  LEU A CD1  3  
ATOM 4065  C CD2  . LEU A 1 61  ? -7.302  -17.461 -3.045  1.00 0.00 ? 61  LEU A CD2  3  
ATOM 4066  H H    . LEU A 1 61  ? -7.549  -19.807 -6.310  1.00 0.00 ? 61  LEU A H    3  
ATOM 4067  H HA   . LEU A 1 61  ? -9.272  -18.109 -5.136  1.00 0.00 ? 61  LEU A HA   3  
ATOM 4068  H HB2  . LEU A 1 61  ? -6.606  -17.459 -6.370  1.00 0.00 ? 61  LEU A HB2  3  
ATOM 4069  H HB3  . LEU A 1 61  ? -7.493  -16.333 -5.345  1.00 0.00 ? 61  LEU A HB3  3  
ATOM 4070  H HG   . LEU A 1 61  ? -6.777  -19.062 -4.337  1.00 0.00 ? 61  LEU A HG   3  
ATOM 4071  H HD11 . LEU A 1 61  ? -4.991  -16.654 -4.089  1.00 0.00 ? 61  LEU A HD11 3  
ATOM 4072  H HD12 . LEU A 1 61  ? -4.734  -17.937 -5.270  1.00 0.00 ? 61  LEU A HD12 3  
ATOM 4073  H HD13 . LEU A 1 61  ? -4.675  -18.301 -3.545  1.00 0.00 ? 61  LEU A HD13 3  
ATOM 4074  H HD21 . LEU A 1 61  ? -7.490  -18.282 -2.369  1.00 0.00 ? 61  LEU A HD21 3  
ATOM 4075  H HD22 . LEU A 1 61  ? -8.237  -16.981 -3.297  1.00 0.00 ? 61  LEU A HD22 3  
ATOM 4076  H HD23 . LEU A 1 61  ? -6.646  -16.747 -2.571  1.00 0.00 ? 61  LEU A HD23 3  
ATOM 4077  N N    . GLY A 1 62  ? -8.960  -17.329 -8.297  1.00 0.00 ? 62  GLY A N    3  
ATOM 4078  C CA   . GLY A 1 62  ? -9.550  -16.541 -9.363  1.00 0.00 ? 62  GLY A CA   3  
ATOM 4079  C C    . GLY A 1 62  ? -9.386  -15.050 -9.141  1.00 0.00 ? 62  GLY A C    3  
ATOM 4080  O O    . GLY A 1 62  ? -8.328  -14.487 -9.421  1.00 0.00 ? 62  GLY A O    3  
ATOM 4081  H H    . GLY A 1 62  ? -8.299  -18.020 -8.509  1.00 0.00 ? 62  GLY A H    3  
ATOM 4082  H HA2  . GLY A 1 62  ? -9.080  -16.809 -10.297 1.00 0.00 ? 62  GLY A HA2  3  
ATOM 4083  H HA3  . GLY A 1 62  ? -10.604 -16.770 -9.423  1.00 0.00 ? 62  GLY A HA3  3  
ATOM 4084  N N    . SER A 1 63  ? -10.437 -14.409 -8.639  1.00 0.00 ? 63  SER A N    3  
ATOM 4085  C CA   . SER A 1 63  ? -10.406 -12.973 -8.386  1.00 0.00 ? 63  SER A CA   3  
ATOM 4086  C C    . SER A 1 63  ? -9.502  -12.650 -7.200  1.00 0.00 ? 63  SER A C    3  
ATOM 4087  O O    . SER A 1 63  ? -8.915  -11.571 -7.129  1.00 0.00 ? 63  SER A O    3  
ATOM 4088  C CB   . SER A 1 63  ? -11.820 -12.450 -8.121  1.00 0.00 ? 63  SER A CB   3  
ATOM 4089  O OG   . SER A 1 63  ? -11.795 -11.090 -7.727  1.00 0.00 ? 63  SER A OG   3  
ATOM 4090  H H    . SER A 1 63  ? -11.253 -14.913 -8.437  1.00 0.00 ? 63  SER A H    3  
ATOM 4091  H HA   . SER A 1 63  ? -10.012 -12.489 -9.267  1.00 0.00 ? 63  SER A HA   3  
ATOM 4092  H HB2  . SER A 1 63  ? -12.408 -12.541 -9.021  1.00 0.00 ? 63  SER A HB2  3  
ATOM 4093  H HB3  . SER A 1 63  ? -12.274 -13.033 -7.333  1.00 0.00 ? 63  SER A HB3  3  
ATOM 4094  H HG   . SER A 1 63  ? -12.057 -11.018 -6.806  1.00 0.00 ? 63  SER A HG   3  
ATOM 4095  N N    . ASN A 1 64  ? -9.396  -13.594 -6.271  1.00 0.00 ? 64  ASN A N    3  
ATOM 4096  C CA   . ASN A 1 64  ? -8.564  -13.411 -5.087  1.00 0.00 ? 64  ASN A CA   3  
ATOM 4097  C C    . ASN A 1 64  ? -7.146  -13.916 -5.335  1.00 0.00 ? 64  ASN A C    3  
ATOM 4098  O O    . ASN A 1 64  ? -6.344  -14.029 -4.407  1.00 0.00 ? 64  ASN A O    3  
ATOM 4099  C CB   . ASN A 1 64  ? -9.176  -14.141 -3.890  1.00 0.00 ? 64  ASN A CB   3  
ATOM 4100  C CG   . ASN A 1 64  ? -10.316 -13.365 -3.260  1.00 0.00 ? 64  ASN A CG   3  
ATOM 4101  O OD1  . ASN A 1 64  ? -10.329 -12.134 -3.280  1.00 0.00 ? 64  ASN A OD1  3  
ATOM 4102  N ND2  . ASN A 1 64  ? -11.280 -14.083 -2.696  1.00 0.00 ? 64  ASN A ND2  3  
ATOM 4103  H H    . ASN A 1 64  ? -9.888  -14.434 -6.383  1.00 0.00 ? 64  ASN A H    3  
ATOM 4104  H HA   . ASN A 1 64  ? -8.524  -12.354 -4.870  1.00 0.00 ? 64  ASN A HA   3  
ATOM 4105  H HB2  . ASN A 1 64  ? -9.555  -15.099 -4.216  1.00 0.00 ? 64  ASN A HB2  3  
ATOM 4106  H HB3  . ASN A 1 64  ? -8.413  -14.296 -3.142  1.00 0.00 ? 64  ASN A HB3  3  
ATOM 4107  H HD21 . ASN A 1 64  ? -11.203 -15.060 -2.718  1.00 0.00 ? 64  ASN A HD21 3  
ATOM 4108  H HD22 . ASN A 1 64  ? -12.030 -13.607 -2.282  1.00 0.00 ? 64  ASN A HD22 3  
ATOM 4109  N N    . LEU A 1 65  ? -6.843  -14.219 -6.593  1.00 0.00 ? 65  LEU A N    3  
ATOM 4110  C CA   . LEU A 1 65  ? -5.521  -14.712 -6.964  1.00 0.00 ? 65  LEU A CA   3  
ATOM 4111  C C    . LEU A 1 65  ? -4.535  -13.559 -7.124  1.00 0.00 ? 65  LEU A C    3  
ATOM 4112  O O    . LEU A 1 65  ? -4.880  -12.502 -7.653  1.00 0.00 ? 65  LEU A O    3  
ATOM 4113  C CB   . LEU A 1 65  ? -5.601  -15.514 -8.264  1.00 0.00 ? 65  LEU A CB   3  
ATOM 4114  C CG   . LEU A 1 65  ? -4.321  -16.235 -8.688  1.00 0.00 ? 65  LEU A CG   3  
ATOM 4115  C CD1  . LEU A 1 65  ? -4.263  -17.624 -8.073  1.00 0.00 ? 65  LEU A CD1  3  
ATOM 4116  C CD2  . LEU A 1 65  ? -4.232  -16.317 -10.205 1.00 0.00 ? 65  LEU A CD2  3  
ATOM 4117  H H    . LEU A 1 65  ? -7.524  -14.108 -7.288  1.00 0.00 ? 65  LEU A H    3  
ATOM 4118  H HA   . LEU A 1 65  ? -5.175  -15.359 -6.172  1.00 0.00 ? 65  LEU A HA   3  
ATOM 4119  H HB2  . LEU A 1 65  ? -6.375  -16.256 -8.147  1.00 0.00 ? 65  LEU A HB2  3  
ATOM 4120  H HB3  . LEU A 1 65  ? -5.876  -14.831 -9.056  1.00 0.00 ? 65  LEU A HB3  3  
ATOM 4121  H HG   . LEU A 1 65  ? -3.466  -15.676 -8.331  1.00 0.00 ? 65  LEU A HG   3  
ATOM 4122  H HD11 . LEU A 1 65  ? -5.265  -18.005 -7.948  1.00 0.00 ? 65  LEU A HD11 3  
ATOM 4123  H HD12 . LEU A 1 65  ? -3.774  -17.572 -7.111  1.00 0.00 ? 65  LEU A HD12 3  
ATOM 4124  H HD13 . LEU A 1 65  ? -3.705  -18.283 -8.723  1.00 0.00 ? 65  LEU A HD13 3  
ATOM 4125  H HD21 . LEU A 1 65  ? -3.207  -16.175 -10.513 1.00 0.00 ? 65  LEU A HD21 3  
ATOM 4126  H HD22 . LEU A 1 65  ? -4.849  -15.546 -10.643 1.00 0.00 ? 65  LEU A HD22 3  
ATOM 4127  H HD23 . LEU A 1 65  ? -4.577  -17.285 -10.534 1.00 0.00 ? 65  LEU A HD23 3  
ATOM 4128  N N    . VAL A 1 66  ? -3.306  -13.771 -6.665  1.00 0.00 ? 66  VAL A N    3  
ATOM 4129  C CA   . VAL A 1 66  ? -2.268  -12.751 -6.760  1.00 0.00 ? 66  VAL A CA   3  
ATOM 4130  C C    . VAL A 1 66  ? -1.342  -13.018 -7.942  1.00 0.00 ? 66  VAL A C    3  
ATOM 4131  O O    . VAL A 1 66  ? -1.052  -14.168 -8.270  1.00 0.00 ? 66  VAL A O    3  
ATOM 4132  C CB   . VAL A 1 66  ? -1.430  -12.681 -5.470  1.00 0.00 ? 66  VAL A CB   3  
ATOM 4133  C CG1  . VAL A 1 66  ? -0.478  -11.496 -5.515  1.00 0.00 ? 66  VAL A CG1  3  
ATOM 4134  C CG2  . VAL A 1 66  ? -2.335  -12.603 -4.250  1.00 0.00 ? 66  VAL A CG2  3  
ATOM 4135  H H    . VAL A 1 66  ? -3.091  -14.634 -6.254  1.00 0.00 ? 66  VAL A H    3  
ATOM 4136  H HA   . VAL A 1 66  ? -2.751  -11.795 -6.903  1.00 0.00 ? 66  VAL A HA   3  
ATOM 4137  H HB   . VAL A 1 66  ? -0.841  -13.584 -5.398  1.00 0.00 ? 66  VAL A HB   3  
ATOM 4138  H HG11 . VAL A 1 66  ? 0.239   -11.640 -6.310  1.00 0.00 ? 66  VAL A HG11 3  
ATOM 4139  H HG12 . VAL A 1 66  ? -1.038  -10.590 -5.694  1.00 0.00 ? 66  VAL A HG12 3  
ATOM 4140  H HG13 . VAL A 1 66  ? 0.043   -11.417 -4.572  1.00 0.00 ? 66  VAL A HG13 3  
ATOM 4141  H HG21 . VAL A 1 66  ? -3.139  -13.316 -4.353  1.00 0.00 ? 66  VAL A HG21 3  
ATOM 4142  H HG22 . VAL A 1 66  ? -1.764  -12.831 -3.362  1.00 0.00 ? 66  VAL A HG22 3  
ATOM 4143  H HG23 . VAL A 1 66  ? -2.744  -11.607 -4.169  1.00 0.00 ? 66  VAL A HG23 3  
ATOM 4144  N N    . THR A 1 67  ? -0.880  -11.946 -8.578  1.00 0.00 ? 67  THR A N    3  
ATOM 4145  C CA   . THR A 1 67  ? 0.014   -12.063 -9.723  1.00 0.00 ? 67  THR A CA   3  
ATOM 4146  C C    . THR A 1 67  ? 1.034   -10.931 -9.744  1.00 0.00 ? 67  THR A C    3  
ATOM 4147  O O    . THR A 1 67  ? 0.805   -9.867  -9.169  1.00 0.00 ? 67  THR A O    3  
ATOM 4148  C CB   . THR A 1 67  ? -0.770  -12.057 -11.050 1.00 0.00 ? 67  THR A CB   3  
ATOM 4149  O OG1  . THR A 1 67  ? -1.450  -10.807 -11.210 1.00 0.00 ? 67  THR A OG1  3  
ATOM 4150  C CG2  . THR A 1 67  ? -1.777  -13.196 -11.089 1.00 0.00 ? 67  THR A CG2  3  
ATOM 4151  H H    . THR A 1 67  ? -1.147  -11.055 -8.268  1.00 0.00 ? 67  THR A H    3  
ATOM 4152  H HA   . THR A 1 67  ? 0.537   -13.005 -9.643  1.00 0.00 ? 67  THR A HA   3  
ATOM 4153  H HB   . THR A 1 67  ? -0.071  -12.185 -11.864 1.00 0.00 ? 67  THR A HB   3  
ATOM 4154  H HG1  . THR A 1 67  ? -1.751  -10.721 -12.118 1.00 0.00 ? 67  THR A HG1  3  
ATOM 4155  H HG21 . THR A 1 67  ? -1.256  -14.140 -11.020 1.00 0.00 ? 67  THR A HG21 3  
ATOM 4156  H HG22 . THR A 1 67  ? -2.329  -13.157 -12.016 1.00 0.00 ? 67  THR A HG22 3  
ATOM 4157  H HG23 . THR A 1 67  ? -2.460  -13.102 -10.258 1.00 0.00 ? 67  THR A HG23 3  
ATOM 4158  N N    . GLU A 1 68  ? 2.160   -11.167 -10.409 1.00 0.00 ? 68  GLU A N    3  
ATOM 4159  C CA   . GLU A 1 68  ? 3.216   -10.165 -10.503 1.00 0.00 ? 68  GLU A CA   3  
ATOM 4160  C C    . GLU A 1 68  ? 2.627   -8.759  -10.567 1.00 0.00 ? 68  GLU A C    3  
ATOM 4161  O O    . GLU A 1 68  ? 3.123   -7.836  -9.922  1.00 0.00 ? 68  GLU A O    3  
ATOM 4162  C CB   . GLU A 1 68  ? 4.085   -10.422 -11.735 1.00 0.00 ? 68  GLU A CB   3  
ATOM 4163  C CG   . GLU A 1 68  ? 5.476   -9.819  -11.635 1.00 0.00 ? 68  GLU A CG   3  
ATOM 4164  C CD   . GLU A 1 68  ? 6.070   -9.494  -12.992 1.00 0.00 ? 68  GLU A CD   3  
ATOM 4165  O OE1  . GLU A 1 68  ? 5.301   -9.407  -13.971 1.00 0.00 ? 68  GLU A OE1  3  
ATOM 4166  O OE2  . GLU A 1 68  ? 7.305   -9.325  -13.073 1.00 0.00 ? 68  GLU A OE2  3  
ATOM 4167  H H    . GLU A 1 68  ? 2.285   -12.035 -10.846 1.00 0.00 ? 68  GLU A H    3  
ATOM 4168  H HA   . GLU A 1 68  ? 3.829   -10.245 -9.618  1.00 0.00 ? 68  GLU A HA   3  
ATOM 4169  H HB2  . GLU A 1 68  ? 4.187   -11.489 -11.873 1.00 0.00 ? 68  GLU A HB2  3  
ATOM 4170  H HB3  . GLU A 1 68  ? 3.595   -10.002 -12.601 1.00 0.00 ? 68  GLU A HB3  3  
ATOM 4171  H HG2  . GLU A 1 68  ? 5.419   -8.909  -11.057 1.00 0.00 ? 68  GLU A HG2  3  
ATOM 4172  H HG3  . GLU A 1 68  ? 6.125   -10.523 -11.134 1.00 0.00 ? 68  GLU A HG3  3  
ATOM 4173  N N    . VAL A 1 69  ? 1.564   -8.604  -11.351 1.00 0.00 ? 69  VAL A N    3  
ATOM 4174  C CA   . VAL A 1 69  ? 0.906   -7.311  -11.500 1.00 0.00 ? 69  VAL A CA   3  
ATOM 4175  C C    . VAL A 1 69  ? 0.338   -6.827  -10.171 1.00 0.00 ? 69  VAL A C    3  
ATOM 4176  O O    . VAL A 1 69  ? 0.675   -5.741  -9.699  1.00 0.00 ? 69  VAL A O    3  
ATOM 4177  C CB   . VAL A 1 69  ? -0.229  -7.376  -12.539 1.00 0.00 ? 69  VAL A CB   3  
ATOM 4178  C CG1  . VAL A 1 69  ? -1.182  -6.204  -12.362 1.00 0.00 ? 69  VAL A CG1  3  
ATOM 4179  C CG2  . VAL A 1 69  ? 0.340   -7.403  -13.949 1.00 0.00 ? 69  VAL A CG2  3  
ATOM 4180  H H    . VAL A 1 69  ? 1.214   -9.378  -11.840 1.00 0.00 ? 69  VAL A H    3  
ATOM 4181  H HA   . VAL A 1 69  ? 1.642   -6.600  -11.846 1.00 0.00 ? 69  VAL A HA   3  
ATOM 4182  H HB   . VAL A 1 69  ? -0.784  -8.289  -12.379 1.00 0.00 ? 69  VAL A HB   3  
ATOM 4183  H HG11 . VAL A 1 69  ? -1.828  -6.132  -13.225 1.00 0.00 ? 69  VAL A HG11 3  
ATOM 4184  H HG12 . VAL A 1 69  ? -1.780  -6.355  -11.475 1.00 0.00 ? 69  VAL A HG12 3  
ATOM 4185  H HG13 . VAL A 1 69  ? -0.614  -5.290  -12.262 1.00 0.00 ? 69  VAL A HG13 3  
ATOM 4186  H HG21 . VAL A 1 69  ? 0.994   -6.556  -14.089 1.00 0.00 ? 69  VAL A HG21 3  
ATOM 4187  H HG22 . VAL A 1 69  ? 0.898   -8.317  -14.095 1.00 0.00 ? 69  VAL A HG22 3  
ATOM 4188  H HG23 . VAL A 1 69  ? -0.467  -7.357  -14.664 1.00 0.00 ? 69  VAL A HG23 3  
ATOM 4189  N N    . ARG A 1 70  ? -0.526  -7.641  -9.572  1.00 0.00 ? 70  ARG A N    3  
ATOM 4190  C CA   . ARG A 1 70  ? -1.142  -7.295  -8.296  1.00 0.00 ? 70  ARG A CA   3  
ATOM 4191  C C    . ARG A 1 70  ? -0.127  -6.644  -7.361  1.00 0.00 ? 70  ARG A C    3  
ATOM 4192  O O    . ARG A 1 70  ? -0.377  -5.573  -6.807  1.00 0.00 ? 70  ARG A O    3  
ATOM 4193  C CB   . ARG A 1 70  ? -1.732  -8.543  -7.637  1.00 0.00 ? 70  ARG A CB   3  
ATOM 4194  C CG   . ARG A 1 70  ? -2.822  -9.209  -8.460  1.00 0.00 ? 70  ARG A CG   3  
ATOM 4195  C CD   . ARG A 1 70  ? -4.163  -8.517  -8.274  1.00 0.00 ? 70  ARG A CD   3  
ATOM 4196  N NE   . ARG A 1 70  ? -4.161  -7.164  -8.823  1.00 0.00 ? 70  ARG A NE   3  
ATOM 4197  C CZ   . ARG A 1 70  ? -4.303  -6.895  -10.116 1.00 0.00 ? 70  ARG A CZ   3  
ATOM 4198  N NH1  . ARG A 1 70  ? -4.457  -7.882  -10.988 1.00 0.00 ? 70  ARG A NH1  3  
ATOM 4199  N NH2  . ARG A 1 70  ? -4.291  -5.638  -10.539 1.00 0.00 ? 70  ARG A NH2  3  
ATOM 4200  H H    . ARG A 1 70  ? -0.754  -8.493  -9.998  1.00 0.00 ? 70  ARG A H    3  
ATOM 4201  H HA   . ARG A 1 70  ? -1.937  -6.592  -8.492  1.00 0.00 ? 70  ARG A HA   3  
ATOM 4202  H HB2  . ARG A 1 70  ? -0.941  -9.261  -7.479  1.00 0.00 ? 70  ARG A HB2  3  
ATOM 4203  H HB3  . ARG A 1 70  ? -2.151  -8.266  -6.681  1.00 0.00 ? 70  ARG A HB3  3  
ATOM 4204  H HG2  . ARG A 1 70  ? -2.549  -9.166  -9.504  1.00 0.00 ? 70  ARG A HG2  3  
ATOM 4205  H HG3  . ARG A 1 70  ? -2.913  -10.240 -8.152  1.00 0.00 ? 70  ARG A HG3  3  
ATOM 4206  H HD2  . ARG A 1 70  ? -4.925  -9.097  -8.773  1.00 0.00 ? 70  ARG A HD2  3  
ATOM 4207  H HD3  . ARG A 1 70  ? -4.383  -8.467  -7.218  1.00 0.00 ? 70  ARG A HD3  3  
ATOM 4208  H HE   . ARG A 1 70  ? -4.048  -6.419  -8.196  1.00 0.00 ? 70  ARG A HE   3  
ATOM 4209  H HH11 . ARG A 1 70  ? -4.468  -8.830  -10.672 1.00 0.00 ? 70  ARG A HH11 3  
ATOM 4210  H HH12 . ARG A 1 70  ? -4.565  -7.677  -11.962 1.00 0.00 ? 70  ARG A HH12 3  
ATOM 4211  H HH21 . ARG A 1 70  ? -4.175  -4.891  -9.885  1.00 0.00 ? 70  ARG A HH21 3  
ATOM 4212  H HH22 . ARG A 1 70  ? -4.397  -5.437  -11.513 1.00 0.00 ? 70  ARG A HH22 3  
ATOM 4213  N N    . VAL A 1 71  ? 1.017   -7.297  -7.190  1.00 0.00 ? 71  VAL A N    3  
ATOM 4214  C CA   . VAL A 1 71  ? 2.070   -6.782  -6.323  1.00 0.00 ? 71  VAL A CA   3  
ATOM 4215  C C    . VAL A 1 71  ? 2.656   -5.489  -6.879  1.00 0.00 ? 71  VAL A C    3  
ATOM 4216  O O    . VAL A 1 71  ? 2.979   -4.568  -6.128  1.00 0.00 ? 71  VAL A O    3  
ATOM 4217  C CB   . VAL A 1 71  ? 3.202   -7.811  -6.142  1.00 0.00 ? 71  VAL A CB   3  
ATOM 4218  C CG1  . VAL A 1 71  ? 4.111   -7.407  -4.991  1.00 0.00 ? 71  VAL A CG1  3  
ATOM 4219  C CG2  . VAL A 1 71  ? 2.627   -9.201  -5.916  1.00 0.00 ? 71  VAL A CG2  3  
ATOM 4220  H H    . VAL A 1 71  ? 1.157   -8.146  -7.659  1.00 0.00 ? 71  VAL A H    3  
ATOM 4221  H HA   . VAL A 1 71  ? 1.636   -6.582  -5.354  1.00 0.00 ? 71  VAL A HA   3  
ATOM 4222  H HB   . VAL A 1 71  ? 3.791   -7.830  -7.047  1.00 0.00 ? 71  VAL A HB   3  
ATOM 4223  H HG11 . VAL A 1 71  ? 3.919   -8.045  -4.141  1.00 0.00 ? 71  VAL A HG11 3  
ATOM 4224  H HG12 . VAL A 1 71  ? 5.143   -7.510  -5.294  1.00 0.00 ? 71  VAL A HG12 3  
ATOM 4225  H HG13 . VAL A 1 71  ? 3.915   -6.380  -4.721  1.00 0.00 ? 71  VAL A HG13 3  
ATOM 4226  H HG21 . VAL A 1 71  ? 1.578   -9.121  -5.676  1.00 0.00 ? 71  VAL A HG21 3  
ATOM 4227  H HG22 . VAL A 1 71  ? 2.747   -9.790  -6.814  1.00 0.00 ? 71  VAL A HG22 3  
ATOM 4228  H HG23 . VAL A 1 71  ? 3.149   -9.679  -5.101  1.00 0.00 ? 71  VAL A HG23 3  
ATOM 4229  N N    . TYR A 1 72  ? 2.792   -5.428  -8.199  1.00 0.00 ? 72  TYR A N    3  
ATOM 4230  C CA   . TYR A 1 72  ? 3.342   -4.248  -8.856  1.00 0.00 ? 72  TYR A CA   3  
ATOM 4231  C C    . TYR A 1 72  ? 2.470   -3.024  -8.597  1.00 0.00 ? 72  TYR A C    3  
ATOM 4232  O O    . TYR A 1 72  ? 2.975   -1.922  -8.383  1.00 0.00 ? 72  TYR A O    3  
ATOM 4233  C CB   . TYR A 1 72  ? 3.467   -4.489  -10.362 1.00 0.00 ? 72  TYR A CB   3  
ATOM 4234  C CG   . TYR A 1 72  ? 3.578   -3.218  -11.172 1.00 0.00 ? 72  TYR A CG   3  
ATOM 4235  C CD1  . TYR A 1 72  ? 2.504   -2.343  -11.279 1.00 0.00 ? 72  TYR A CD1  3  
ATOM 4236  C CD2  . TYR A 1 72  ? 4.757   -2.891  -11.830 1.00 0.00 ? 72  TYR A CD2  3  
ATOM 4237  C CE1  . TYR A 1 72  ? 2.600   -1.180  -12.018 1.00 0.00 ? 72  TYR A CE1  3  
ATOM 4238  C CE2  . TYR A 1 72  ? 4.863   -1.729  -12.571 1.00 0.00 ? 72  TYR A CE2  3  
ATOM 4239  C CZ   . TYR A 1 72  ? 3.782   -0.877  -12.662 1.00 0.00 ? 72  TYR A CZ   3  
ATOM 4240  O OH   . TYR A 1 72  ? 3.883   0.280   -13.399 1.00 0.00 ? 72  TYR A OH   3  
ATOM 4241  H H    . TYR A 1 72  ? 2.517   -6.194  -8.744  1.00 0.00 ? 72  TYR A H    3  
ATOM 4242  H HA   . TYR A 1 72  ? 4.325   -4.069  -8.448  1.00 0.00 ? 72  TYR A HA   3  
ATOM 4243  H HB2  . TYR A 1 72  ? 4.348   -5.081  -10.553 1.00 0.00 ? 72  TYR A HB2  3  
ATOM 4244  H HB3  . TYR A 1 72  ? 2.596   -5.028  -10.707 1.00 0.00 ? 72  TYR A HB3  3  
ATOM 4245  H HD1  . TYR A 1 72  ? 1.579   -2.583  -10.773 1.00 0.00 ? 72  TYR A HD1  3  
ATOM 4246  H HD2  . TYR A 1 72  ? 5.601   -3.560  -11.757 1.00 0.00 ? 72  TYR A HD2  3  
ATOM 4247  H HE1  . TYR A 1 72  ? 1.754   -0.512  -12.090 1.00 0.00 ? 72  TYR A HE1  3  
ATOM 4248  H HE2  . TYR A 1 72  ? 5.788   -1.492  -13.075 1.00 0.00 ? 72  TYR A HE2  3  
ATOM 4249  H HH   . TYR A 1 72  ? 3.516   0.135   -14.274 1.00 0.00 ? 72  TYR A HH   3  
ATOM 4250  N N    . ASN A 1 73  ? 1.156   -3.226  -8.617  1.00 0.00 ? 73  ASN A N    3  
ATOM 4251  C CA   . ASN A 1 73  ? 0.212   -2.139  -8.384  1.00 0.00 ? 73  ASN A CA   3  
ATOM 4252  C C    . ASN A 1 73  ? 0.224   -1.713  -6.919  1.00 0.00 ? 73  ASN A C    3  
ATOM 4253  O O    . ASN A 1 73  ? 0.198   -0.522  -6.609  1.00 0.00 ? 73  ASN A O    3  
ATOM 4254  C CB   . ASN A 1 73  ? -1.200  -2.566  -8.791  1.00 0.00 ? 73  ASN A CB   3  
ATOM 4255  C CG   . ASN A 1 73  ? -1.472  -2.334  -10.264 1.00 0.00 ? 73  ASN A CG   3  
ATOM 4256  O OD1  . ASN A 1 73  ? -1.741  -1.210  -10.688 1.00 0.00 ? 73  ASN A OD1  3  
ATOM 4257  N ND2  . ASN A 1 73  ? -1.403  -3.400  -11.054 1.00 0.00 ? 73  ASN A ND2  3  
ATOM 4258  H H    . ASN A 1 73  ? 0.813   -4.127  -8.793  1.00 0.00 ? 73  ASN A H    3  
ATOM 4259  H HA   . ASN A 1 73  ? 0.515   -1.301  -8.993  1.00 0.00 ? 73  ASN A HA   3  
ATOM 4260  H HB2  . ASN A 1 73  ? -1.325  -3.619  -8.583  1.00 0.00 ? 73  ASN A HB2  3  
ATOM 4261  H HB3  . ASN A 1 73  ? -1.920  -2.002  -8.217  1.00 0.00 ? 73  ASN A HB3  3  
ATOM 4262  H HD21 . ASN A 1 73  ? -1.183  -4.264  -10.647 1.00 0.00 ? 73  ASN A HD21 3  
ATOM 4263  H HD22 . ASN A 1 73  ? -1.573  -3.278  -12.011 1.00 0.00 ? 73  ASN A HD22 3  
ATOM 4264  N N    . TRP A 1 74  ? 0.265   -2.693  -6.024  1.00 0.00 ? 74  TRP A N    3  
ATOM 4265  C CA   . TRP A 1 74  ? 0.281   -2.419  -4.591  1.00 0.00 ? 74  TRP A CA   3  
ATOM 4266  C C    . TRP A 1 74  ? 1.517   -1.614  -4.205  1.00 0.00 ? 74  TRP A C    3  
ATOM 4267  O O    . TRP A 1 74  ? 1.444   -0.703  -3.380  1.00 0.00 ? 74  TRP A O    3  
ATOM 4268  C CB   . TRP A 1 74  ? 0.242   -3.728  -3.801  1.00 0.00 ? 74  TRP A CB   3  
ATOM 4269  C CG   . TRP A 1 74  ? 0.137   -3.524  -2.320  1.00 0.00 ? 74  TRP A CG   3  
ATOM 4270  C CD1  . TRP A 1 74  ? -1.006  -3.524  -1.571  1.00 0.00 ? 74  TRP A CD1  3  
ATOM 4271  C CD2  . TRP A 1 74  ? 1.216   -3.289  -1.408  1.00 0.00 ? 74  TRP A CD2  3  
ATOM 4272  N NE1  . TRP A 1 74  ? -0.702  -3.303  -0.250  1.00 0.00 ? 74  TRP A NE1  3  
ATOM 4273  C CE2  . TRP A 1 74  ? 0.654   -3.157  -0.123  1.00 0.00 ? 74  TRP A CE2  3  
ATOM 4274  C CE3  . TRP A 1 74  ? 2.601   -3.180  -1.552  1.00 0.00 ? 74  TRP A CE3  3  
ATOM 4275  C CZ2  . TRP A 1 74  ? 1.431   -2.919  1.007   1.00 0.00 ? 74  TRP A CZ2  3  
ATOM 4276  C CZ3  . TRP A 1 74  ? 3.371   -2.943  -0.429  1.00 0.00 ? 74  TRP A CZ3  3  
ATOM 4277  C CH2  . TRP A 1 74  ? 2.785   -2.816  0.837   1.00 0.00 ? 74  TRP A CH2  3  
ATOM 4278  H H    . TRP A 1 74  ? 0.285   -3.623  -6.333  1.00 0.00 ? 74  TRP A H    3  
ATOM 4279  H HA   . TRP A 1 74  ? -0.599  -1.840  -4.355  1.00 0.00 ? 74  TRP A HA   3  
ATOM 4280  H HB2  . TRP A 1 74  ? -0.611  -4.308  -4.119  1.00 0.00 ? 74  TRP A HB2  3  
ATOM 4281  H HB3  . TRP A 1 74  ? 1.146   -4.286  -3.998  1.00 0.00 ? 74  TRP A HB3  3  
ATOM 4282  H HD1  . TRP A 1 74  ? -1.996  -3.675  -1.973  1.00 0.00 ? 74  TRP A HD1  3  
ATOM 4283  H HE1  . TRP A 1 74  ? -1.351  -3.260  0.484   1.00 0.00 ? 74  TRP A HE1  3  
ATOM 4284  H HE3  . TRP A 1 74  ? 3.072   -3.275  -2.520  1.00 0.00 ? 74  TRP A HE3  3  
ATOM 4285  H HZ2  . TRP A 1 74  ? 0.995   -2.819  1.990   1.00 0.00 ? 74  TRP A HZ2  3  
ATOM 4286  H HZ3  . TRP A 1 74  ? 4.444   -2.855  -0.521  1.00 0.00 ? 74  TRP A HZ3  3  
ATOM 4287  H HH2  . TRP A 1 74  ? 3.425   -2.632  1.686   1.00 0.00 ? 74  TRP A HH2  3  
ATOM 4288  N N    . PHE A 1 75  ? 2.652   -1.956  -4.806  1.00 0.00 ? 75  PHE A N    3  
ATOM 4289  C CA   . PHE A 1 75  ? 3.905   -1.265  -4.523  1.00 0.00 ? 75  PHE A CA   3  
ATOM 4290  C C    . PHE A 1 75  ? 3.920   0.118   -5.167  1.00 0.00 ? 75  PHE A C    3  
ATOM 4291  O O    . PHE A 1 75  ? 4.486   1.064   -4.619  1.00 0.00 ? 75  PHE A O    3  
ATOM 4292  C CB   . PHE A 1 75  ? 5.091   -2.088  -5.028  1.00 0.00 ? 75  PHE A CB   3  
ATOM 4293  C CG   . PHE A 1 75  ? 5.620   -3.062  -4.014  1.00 0.00 ? 75  PHE A CG   3  
ATOM 4294  C CD1  . PHE A 1 75  ? 4.897   -4.195  -3.679  1.00 0.00 ? 75  PHE A CD1  3  
ATOM 4295  C CD2  . PHE A 1 75  ? 6.841   -2.843  -3.396  1.00 0.00 ? 75  PHE A CD2  3  
ATOM 4296  C CE1  . PHE A 1 75  ? 5.382   -5.092  -2.746  1.00 0.00 ? 75  PHE A CE1  3  
ATOM 4297  C CE2  . PHE A 1 75  ? 7.331   -3.737  -2.462  1.00 0.00 ? 75  PHE A CE2  3  
ATOM 4298  C CZ   . PHE A 1 75  ? 6.600   -4.863  -2.137  1.00 0.00 ? 75  PHE A CZ   3  
ATOM 4299  H H    . PHE A 1 75  ? 2.647   -2.691  -5.454  1.00 0.00 ? 75  PHE A H    3  
ATOM 4300  H HA   . PHE A 1 75  ? 3.986   -1.151  -3.453  1.00 0.00 ? 75  PHE A HA   3  
ATOM 4301  H HB2  . PHE A 1 75  ? 4.786   -2.650  -5.898  1.00 0.00 ? 75  PHE A HB2  3  
ATOM 4302  H HB3  . PHE A 1 75  ? 5.895   -1.420  -5.299  1.00 0.00 ? 75  PHE A HB3  3  
ATOM 4303  H HD1  . PHE A 1 75  ? 3.945   -4.376  -4.155  1.00 0.00 ? 75  PHE A HD1  3  
ATOM 4304  H HD2  . PHE A 1 75  ? 7.414   -1.962  -3.649  1.00 0.00 ? 75  PHE A HD2  3  
ATOM 4305  H HE1  . PHE A 1 75  ? 4.809   -5.972  -2.494  1.00 0.00 ? 75  PHE A HE1  3  
ATOM 4306  H HE2  . PHE A 1 75  ? 8.284   -3.555  -1.988  1.00 0.00 ? 75  PHE A HE2  3  
ATOM 4307  H HZ   . PHE A 1 75  ? 6.981   -5.562  -1.407  1.00 0.00 ? 75  PHE A HZ   3  
ATOM 4308  N N    . ALA A 1 76  ? 3.295   0.227   -6.335  1.00 0.00 ? 76  ALA A N    3  
ATOM 4309  C CA   . ALA A 1 76  ? 3.235   1.494   -7.054  1.00 0.00 ? 76  ALA A CA   3  
ATOM 4310  C C    . ALA A 1 76  ? 2.464   2.541   -6.258  1.00 0.00 ? 76  ALA A C    3  
ATOM 4311  O O    . ALA A 1 76  ? 2.816   3.720   -6.261  1.00 0.00 ? 76  ALA A O    3  
ATOM 4312  C CB   . ALA A 1 76  ? 2.599   1.295   -8.422  1.00 0.00 ? 76  ALA A CB   3  
ATOM 4313  H H    . ALA A 1 76  ? 2.862   -0.562  -6.721  1.00 0.00 ? 76  ALA A H    3  
ATOM 4314  H HA   . ALA A 1 76  ? 4.247   1.842   -7.202  1.00 0.00 ? 76  ALA A HA   3  
ATOM 4315  H HB1  . ALA A 1 76  ? 2.059   0.359   -8.434  1.00 0.00 ? 76  ALA A HB1  3  
ATOM 4316  H HB2  . ALA A 1 76  ? 1.918   2.107   -8.624  1.00 0.00 ? 76  ALA A HB2  3  
ATOM 4317  H HB3  . ALA A 1 76  ? 3.371   1.275   -9.177  1.00 0.00 ? 76  ALA A HB3  3  
ATOM 4318  N N    . ASN A 1 77  ? 1.410   2.102   -5.577  1.00 0.00 ? 77  ASN A N    3  
ATOM 4319  C CA   . ASN A 1 77  ? 0.588   3.003   -4.777  1.00 0.00 ? 77  ASN A CA   3  
ATOM 4320  C C    . ASN A 1 77  ? 1.295   3.376   -3.478  1.00 0.00 ? 77  ASN A C    3  
ATOM 4321  O O    . ASN A 1 77  ? 1.186   4.506   -3.002  1.00 0.00 ? 77  ASN A O    3  
ATOM 4322  C CB   . ASN A 1 77  ? -0.763  2.355   -4.468  1.00 0.00 ? 77  ASN A CB   3  
ATOM 4323  C CG   . ASN A 1 77  ? -1.453  2.995   -3.279  1.00 0.00 ? 77  ASN A CG   3  
ATOM 4324  O OD1  . ASN A 1 77  ? -2.232  3.936   -3.432  1.00 0.00 ? 77  ASN A OD1  3  
ATOM 4325  N ND2  . ASN A 1 77  ? -1.169  2.487   -2.085  1.00 0.00 ? 77  ASN A ND2  3  
ATOM 4326  H H    . ASN A 1 77  ? 1.179   1.151   -5.614  1.00 0.00 ? 77  ASN A H    3  
ATOM 4327  H HA   . ASN A 1 77  ? 0.422   3.901   -5.354  1.00 0.00 ? 77  ASN A HA   3  
ATOM 4328  H HB2  . ASN A 1 77  ? -1.408  2.452   -5.329  1.00 0.00 ? 77  ASN A HB2  3  
ATOM 4329  H HB3  . ASN A 1 77  ? -0.612  1.308   -4.252  1.00 0.00 ? 77  ASN A HB3  3  
ATOM 4330  H HD21 . ASN A 1 77  ? -0.539  1.738   -2.039  1.00 0.00 ? 77  ASN A HD21 3  
ATOM 4331  H HD22 . ASN A 1 77  ? -1.602  2.882   -1.300  1.00 0.00 ? 77  ASN A HD22 3  
ATOM 4332  N N    . ARG A 1 78  ? 2.021   2.418   -2.910  1.00 0.00 ? 78  ARG A N    3  
ATOM 4333  C CA   . ARG A 1 78  ? 2.747   2.645   -1.666  1.00 0.00 ? 78  ARG A CA   3  
ATOM 4334  C C    . ARG A 1 78  ? 3.831   3.702   -1.854  1.00 0.00 ? 78  ARG A C    3  
ATOM 4335  O O    . ARG A 1 78  ? 4.239   4.363   -0.899  1.00 0.00 ? 78  ARG A O    3  
ATOM 4336  C CB   . ARG A 1 78  ? 3.372   1.340   -1.170  1.00 0.00 ? 78  ARG A CB   3  
ATOM 4337  C CG   . ARG A 1 78  ? 2.350   0.299   -0.742  1.00 0.00 ? 78  ARG A CG   3  
ATOM 4338  C CD   . ARG A 1 78  ? 1.991   0.444   0.729   1.00 0.00 ? 78  ARG A CD   3  
ATOM 4339  N NE   . ARG A 1 78  ? 0.908   1.402   0.936   1.00 0.00 ? 78  ARG A NE   3  
ATOM 4340  C CZ   . ARG A 1 78  ? -0.345  1.191   0.550   1.00 0.00 ? 78  ARG A CZ   3  
ATOM 4341  N NH1  . ARG A 1 78  ? -0.672  0.060   -0.060  1.00 0.00 ? 78  ARG A NH1  3  
ATOM 4342  N NH2  . ARG A 1 78  ? -1.274  2.111   0.774   1.00 0.00 ? 78  ARG A NH2  3  
ATOM 4343  H H    . ARG A 1 78  ? 2.070   1.538   -3.338  1.00 0.00 ? 78  ARG A H    3  
ATOM 4344  H HA   . ARG A 1 78  ? 2.040   2.998   -0.930  1.00 0.00 ? 78  ARG A HA   3  
ATOM 4345  H HB2  . ARG A 1 78  ? 3.972   0.918   -1.962  1.00 0.00 ? 78  ARG A HB2  3  
ATOM 4346  H HB3  . ARG A 1 78  ? 4.007   1.558   -0.325  1.00 0.00 ? 78  ARG A HB3  3  
ATOM 4347  H HG2  . ARG A 1 78  ? 1.455   0.422   -1.334  1.00 0.00 ? 78  ARG A HG2  3  
ATOM 4348  H HG3  . ARG A 1 78  ? 2.762   -0.685  -0.908  1.00 0.00 ? 78  ARG A HG3  3  
ATOM 4349  H HD2  . ARG A 1 78  ? 1.682   -0.520  1.106   1.00 0.00 ? 78  ARG A HD2  3  
ATOM 4350  H HD3  . ARG A 1 78  ? 2.864   0.779   1.268   1.00 0.00 ? 78  ARG A HD3  3  
ATOM 4351  H HE   . ARG A 1 78  ? 1.128   2.245   1.385   1.00 0.00 ? 78  ARG A HE   3  
ATOM 4352  H HH11 . ARG A 1 78  ? 0.026   -0.636  -0.229  1.00 0.00 ? 78  ARG A HH11 3  
ATOM 4353  H HH12 . ARG A 1 78  ? -1.617  -0.098  -0.349  1.00 0.00 ? 78  ARG A HH12 3  
ATOM 4354  H HH21 . ARG A 1 78  ? -1.031  2.965   1.234   1.00 0.00 ? 78  ARG A HH21 3  
ATOM 4355  H HH22 . ARG A 1 78  ? -2.216  1.951   0.483   1.00 0.00 ? 78  ARG A HH22 3  
ATOM 4356  N N    . ARG A 1 79  ? 4.293   3.855   -3.091  1.00 0.00 ? 79  ARG A N    3  
ATOM 4357  C CA   . ARG A 1 79  ? 5.331   4.830   -3.403  1.00 0.00 ? 79  ARG A CA   3  
ATOM 4358  C C    . ARG A 1 79  ? 4.717   6.142   -3.884  1.00 0.00 ? 79  ARG A C    3  
ATOM 4359  O O    . ARG A 1 79  ? 5.300   7.213   -3.712  1.00 0.00 ? 79  ARG A O    3  
ATOM 4360  C CB   . ARG A 1 79  ? 6.276   4.276   -4.470  1.00 0.00 ? 79  ARG A CB   3  
ATOM 4361  C CG   . ARG A 1 79  ? 7.425   3.459   -3.901  1.00 0.00 ? 79  ARG A CG   3  
ATOM 4362  C CD   . ARG A 1 79  ? 8.596   3.395   -4.869  1.00 0.00 ? 79  ARG A CD   3  
ATOM 4363  N NE   . ARG A 1 79  ? 9.492   4.539   -4.721  1.00 0.00 ? 79  ARG A NE   3  
ATOM 4364  C CZ   . ARG A 1 79  ? 10.527  4.770   -5.521  1.00 0.00 ? 79  ARG A CZ   3  
ATOM 4365  N NH1  . ARG A 1 79  ? 10.795  3.941   -6.520  1.00 0.00 ? 79  ARG A NH1  3  
ATOM 4366  N NH2  . ARG A 1 79  ? 11.297  5.833   -5.322  1.00 0.00 ? 79  ARG A NH2  3  
ATOM 4367  H H    . ARG A 1 79  ? 3.927   3.299   -3.810  1.00 0.00 ? 79  ARG A H    3  
ATOM 4368  H HA   . ARG A 1 79  ? 5.892   5.019   -2.500  1.00 0.00 ? 79  ARG A HA   3  
ATOM 4369  H HB2  . ARG A 1 79  ? 5.713   3.644   -5.141  1.00 0.00 ? 79  ARG A HB2  3  
ATOM 4370  H HB3  . ARG A 1 79  ? 6.692   5.101   -5.029  1.00 0.00 ? 79  ARG A HB3  3  
ATOM 4371  H HG2  . ARG A 1 79  ? 7.758   3.916   -2.981  1.00 0.00 ? 79  ARG A HG2  3  
ATOM 4372  H HG3  . ARG A 1 79  ? 7.078   2.457   -3.703  1.00 0.00 ? 79  ARG A HG3  3  
ATOM 4373  H HD2  . ARG A 1 79  ? 9.151   2.488   -4.682  1.00 0.00 ? 79  ARG A HD2  3  
ATOM 4374  H HD3  . ARG A 1 79  ? 8.211   3.380   -5.878  1.00 0.00 ? 79  ARG A HD3  3  
ATOM 4375  H HE   . ARG A 1 79  ? 9.313   5.164   -3.988  1.00 0.00 ? 79  ARG A HE   3  
ATOM 4376  H HH11 . ARG A 1 79  ? 10.216  3.141   -6.673  1.00 0.00 ? 79  ARG A HH11 3  
ATOM 4377  H HH12 . ARG A 1 79  ? 11.574  4.119   -7.122  1.00 0.00 ? 79  ARG A HH12 3  
ATOM 4378  H HH21 . ARG A 1 79  ? 11.098  6.460   -4.569  1.00 0.00 ? 79  ARG A HH21 3  
ATOM 4379  H HH22 . ARG A 1 79  ? 12.075  6.006   -5.924  1.00 0.00 ? 79  ARG A HH22 3  
ATOM 4380  N N    . LYS A 1 80  ? 3.537   6.051   -4.488  1.00 0.00 ? 80  LYS A N    3  
ATOM 4381  C CA   . LYS A 1 80  ? 2.843   7.230   -4.993  1.00 0.00 ? 80  LYS A CA   3  
ATOM 4382  C C    . LYS A 1 80  ? 2.203   8.015   -3.853  1.00 0.00 ? 80  LYS A C    3  
ATOM 4383  O O    . LYS A 1 80  ? 2.123   9.242   -3.901  1.00 0.00 ? 80  LYS A O    3  
ATOM 4384  C CB   . LYS A 1 80  ? 1.773   6.820   -6.009  1.00 0.00 ? 80  LYS A CB   3  
ATOM 4385  C CG   . LYS A 1 80  ? 2.329   6.517   -7.389  1.00 0.00 ? 80  LYS A CG   3  
ATOM 4386  C CD   . LYS A 1 80  ? 1.255   5.973   -8.316  1.00 0.00 ? 80  LYS A CD   3  
ATOM 4387  C CE   . LYS A 1 80  ? 1.858   5.156   -9.449  1.00 0.00 ? 80  LYS A CE   3  
ATOM 4388  N NZ   . LYS A 1 80  ? 0.847   4.819   -10.488 1.00 0.00 ? 80  LYS A NZ   3  
ATOM 4389  H H    . LYS A 1 80  ? 3.122   5.169   -4.595  1.00 0.00 ? 80  LYS A H    3  
ATOM 4390  H HA   . LYS A 1 80  ? 3.571   7.858   -5.484  1.00 0.00 ? 80  LYS A HA   3  
ATOM 4391  H HB2  . LYS A 1 80  ? 1.268   5.938   -5.645  1.00 0.00 ? 80  LYS A HB2  3  
ATOM 4392  H HB3  . LYS A 1 80  ? 1.056   7.623   -6.101  1.00 0.00 ? 80  LYS A HB3  3  
ATOM 4393  H HG2  . LYS A 1 80  ? 2.729   7.426   -7.814  1.00 0.00 ? 80  LYS A HG2  3  
ATOM 4394  H HG3  . LYS A 1 80  ? 3.118   5.784   -7.297  1.00 0.00 ? 80  LYS A HG3  3  
ATOM 4395  H HD2  . LYS A 1 80  ? 0.588   5.342   -7.748  1.00 0.00 ? 80  LYS A HD2  3  
ATOM 4396  H HD3  . LYS A 1 80  ? 0.701   6.801   -8.736  1.00 0.00 ? 80  LYS A HD3  3  
ATOM 4397  H HE2  . LYS A 1 80  ? 2.653   5.727   -9.904  1.00 0.00 ? 80  LYS A HE2  3  
ATOM 4398  H HE3  . LYS A 1 80  ? 2.261   4.241   -9.040  1.00 0.00 ? 80  LYS A HE3  3  
ATOM 4399  H HZ1  . LYS A 1 80  ? 0.434   5.689   -10.880 1.00 0.00 ? 80  LYS A HZ1  3  
ATOM 4400  H HZ2  . LYS A 1 80  ? 0.086   4.244   -10.074 1.00 0.00 ? 80  LYS A HZ2  3  
ATOM 4401  H HZ3  . LYS A 1 80  ? 1.292   4.281   -11.259 1.00 0.00 ? 80  LYS A HZ3  3  
ATOM 4402  N N    . GLU A 1 81  ? 1.749   7.299   -2.829  1.00 0.00 ? 81  GLU A N    3  
ATOM 4403  C CA   . GLU A 1 81  ? 1.117   7.930   -1.677  1.00 0.00 ? 81  GLU A CA   3  
ATOM 4404  C C    . GLU A 1 81  ? 2.141   8.698   -0.847  1.00 0.00 ? 81  GLU A C    3  
ATOM 4405  O O    . GLU A 1 81  ? 1.901   9.835   -0.442  1.00 0.00 ? 81  GLU A O    3  
ATOM 4406  C CB   . GLU A 1 81  ? 0.424   6.879   -0.807  1.00 0.00 ? 81  GLU A CB   3  
ATOM 4407  C CG   . GLU A 1 81  ? 1.374   6.125   0.108   1.00 0.00 ? 81  GLU A CG   3  
ATOM 4408  C CD   . GLU A 1 81  ? 0.656   5.134   1.004   1.00 0.00 ? 81  GLU A CD   3  
ATOM 4409  O OE1  . GLU A 1 81  ? -0.590  5.071   0.943   1.00 0.00 ? 81  GLU A OE1  3  
ATOM 4410  O OE2  . GLU A 1 81  ? 1.341   4.419   1.765   1.00 0.00 ? 81  GLU A OE2  3  
ATOM 4411  H H    . GLU A 1 81  ? 1.842   6.323   -2.849  1.00 0.00 ? 81  GLU A H    3  
ATOM 4412  H HA   . GLU A 1 81  ? 0.376   8.625   -2.044  1.00 0.00 ? 81  GLU A HA   3  
ATOM 4413  H HB2  . GLU A 1 81  ? -0.320  7.368   -0.196  1.00 0.00 ? 81  GLU A HB2  3  
ATOM 4414  H HB3  . GLU A 1 81  ? -0.066  6.164   -1.451  1.00 0.00 ? 81  GLU A HB3  3  
ATOM 4415  H HG2  . GLU A 1 81  ? 2.087   5.587   -0.499  1.00 0.00 ? 81  GLU A HG2  3  
ATOM 4416  H HG3  . GLU A 1 81  ? 1.896   6.837   0.730   1.00 0.00 ? 81  GLU A HG3  3  
ATOM 4417  N N    . GLU A 1 82  ? 3.285   8.067   -0.597  1.00 0.00 ? 82  GLU A N    3  
ATOM 4418  C CA   . GLU A 1 82  ? 4.345   8.690   0.186   1.00 0.00 ? 82  GLU A CA   3  
ATOM 4419  C C    . GLU A 1 82  ? 4.841   9.967   -0.488  1.00 0.00 ? 82  GLU A C    3  
ATOM 4420  O O    . GLU A 1 82  ? 5.132   10.960  0.178   1.00 0.00 ? 82  GLU A O    3  
ATOM 4421  C CB   . GLU A 1 82  ? 5.510   7.716   0.375   1.00 0.00 ? 82  GLU A CB   3  
ATOM 4422  C CG   . GLU A 1 82  ? 6.226   7.365   -0.918  1.00 0.00 ? 82  GLU A CG   3  
ATOM 4423  C CD   . GLU A 1 82  ? 7.473   6.534   -0.686  1.00 0.00 ? 82  GLU A CD   3  
ATOM 4424  O OE1  . GLU A 1 82  ? 7.345   5.299   -0.545  1.00 0.00 ? 82  GLU A OE1  3  
ATOM 4425  O OE2  . GLU A 1 82  ? 8.577   7.117   -0.646  1.00 0.00 ? 82  GLU A OE2  3  
ATOM 4426  H H    . GLU A 1 82  ? 3.418   7.162   -0.947  1.00 0.00 ? 82  GLU A H    3  
ATOM 4427  H HA   . GLU A 1 82  ? 3.939   8.943   1.153   1.00 0.00 ? 82  GLU A HA   3  
ATOM 4428  H HB2  . GLU A 1 82  ? 6.226   8.157   1.052   1.00 0.00 ? 82  GLU A HB2  3  
ATOM 4429  H HB3  . GLU A 1 82  ? 5.131   6.803   0.811   1.00 0.00 ? 82  GLU A HB3  3  
ATOM 4430  H HG2  . GLU A 1 82  ? 5.551   6.805   -1.548  1.00 0.00 ? 82  GLU A HG2  3  
ATOM 4431  H HG3  . GLU A 1 82  ? 6.509   8.280   -1.418  1.00 0.00 ? 82  GLU A HG3  3  
ATOM 4432  N N    . ALA A 1 83  ? 4.934   9.932   -1.813  1.00 0.00 ? 83  ALA A N    3  
ATOM 4433  C CA   . ALA A 1 83  ? 5.392   11.085  -2.578  1.00 0.00 ? 83  ALA A CA   3  
ATOM 4434  C C    . ALA A 1 83  ? 4.253   12.068  -2.825  1.00 0.00 ? 83  ALA A C    3  
ATOM 4435  O O    . ALA A 1 83  ? 4.482   13.217  -3.203  1.00 0.00 ? 83  ALA A O    3  
ATOM 4436  C CB   . ALA A 1 83  ? 6.000   10.635  -3.898  1.00 0.00 ? 83  ALA A CB   3  
ATOM 4437  H H    . ALA A 1 83  ? 4.687   9.111   -2.288  1.00 0.00 ? 83  ALA A H    3  
ATOM 4438  H HA   . ALA A 1 83  ? 6.163   11.580  -2.005  1.00 0.00 ? 83  ALA A HA   3  
ATOM 4439  H HB1  . ALA A 1 83  ? 7.012   11.007  -3.973  1.00 0.00 ? 83  ALA A HB1  3  
ATOM 4440  H HB2  . ALA A 1 83  ? 6.009   9.556   -3.941  1.00 0.00 ? 83  ALA A HB2  3  
ATOM 4441  H HB3  . ALA A 1 83  ? 5.412   11.024  -4.716  1.00 0.00 ? 83  ALA A HB3  3  
ATOM 4442  N N    . PHE A 1 84  ? 3.024   11.608  -2.610  1.00 0.00 ? 84  PHE A N    3  
ATOM 4443  C CA   . PHE A 1 84  ? 1.849   12.447  -2.812  1.00 0.00 ? 84  PHE A CA   3  
ATOM 4444  C C    . PHE A 1 84  ? 1.935   13.716  -1.969  1.00 0.00 ? 84  PHE A C    3  
ATOM 4445  O O    . PHE A 1 84  ? 2.033   14.822  -2.502  1.00 0.00 ? 84  PHE A O    3  
ATOM 4446  C CB   . PHE A 1 84  ? 0.577   11.672  -2.459  1.00 0.00 ? 84  PHE A CB   3  
ATOM 4447  C CG   . PHE A 1 84  ? -0.673  12.282  -3.026  1.00 0.00 ? 84  PHE A CG   3  
ATOM 4448  C CD1  . PHE A 1 84  ? -1.142  13.498  -2.555  1.00 0.00 ? 84  PHE A CD1  3  
ATOM 4449  C CD2  . PHE A 1 84  ? -1.379  11.640  -4.030  1.00 0.00 ? 84  PHE A CD2  3  
ATOM 4450  C CE1  . PHE A 1 84  ? -2.292  14.061  -3.075  1.00 0.00 ? 84  PHE A CE1  3  
ATOM 4451  C CE2  . PHE A 1 84  ? -2.530  12.198  -4.554  1.00 0.00 ? 84  PHE A CE2  3  
ATOM 4452  C CZ   . PHE A 1 84  ? -2.987  13.411  -4.076  1.00 0.00 ? 84  PHE A CZ   3  
ATOM 4453  H H    . PHE A 1 84  ? 2.906   10.683  -2.309  1.00 0.00 ? 84  PHE A H    3  
ATOM 4454  H HA   . PHE A 1 84  ? 1.814   12.723  -3.854  1.00 0.00 ? 84  PHE A HA   3  
ATOM 4455  H HB2  . PHE A 1 84  ? 0.658   10.667  -2.843  1.00 0.00 ? 84  PHE A HB2  3  
ATOM 4456  H HB3  . PHE A 1 84  ? 0.473   11.636  -1.385  1.00 0.00 ? 84  PHE A HB3  3  
ATOM 4457  H HD1  . PHE A 1 84  ? -0.599  14.008  -1.773  1.00 0.00 ? 84  PHE A HD1  3  
ATOM 4458  H HD2  . PHE A 1 84  ? -1.023  10.691  -4.405  1.00 0.00 ? 84  PHE A HD2  3  
ATOM 4459  H HE1  . PHE A 1 84  ? -2.647  15.010  -2.699  1.00 0.00 ? 84  PHE A HE1  3  
ATOM 4460  H HE2  . PHE A 1 84  ? -3.071  11.687  -5.337  1.00 0.00 ? 84  PHE A HE2  3  
ATOM 4461  H HZ   . PHE A 1 84  ? -3.886  13.848  -4.483  1.00 0.00 ? 84  PHE A HZ   3  
ATOM 4462  N N    . ARG A 1 85  ? 1.897   13.548  -0.652  1.00 0.00 ? 85  ARG A N    3  
ATOM 4463  C CA   . ARG A 1 85  ? 1.969   14.679  0.265   1.00 0.00 ? 85  ARG A CA   3  
ATOM 4464  C C    . ARG A 1 85  ? 3.043   15.669  -0.175  1.00 0.00 ? 85  ARG A C    3  
ATOM 4465  O O    . ARG A 1 85  ? 2.993   16.849  0.171   1.00 0.00 ? 85  ARG A O    3  
ATOM 4466  C CB   . ARG A 1 85  ? 2.260   14.194  1.686   1.00 0.00 ? 85  ARG A CB   3  
ATOM 4467  C CG   . ARG A 1 85  ? 1.030   13.681  2.419   1.00 0.00 ? 85  ARG A CG   3  
ATOM 4468  C CD   . ARG A 1 85  ? 1.399   13.047  3.751   1.00 0.00 ? 85  ARG A CD   3  
ATOM 4469  N NE   . ARG A 1 85  ? 0.442   12.019  4.152   1.00 0.00 ? 85  ARG A NE   3  
ATOM 4470  C CZ   . ARG A 1 85  ? -0.792  12.285  4.564   1.00 0.00 ? 85  ARG A CZ   3  
ATOM 4471  N NH1  . ARG A 1 85  ? -1.217  13.539  4.629   1.00 0.00 ? 85  ARG A NH1  3  
ATOM 4472  N NH2  . ARG A 1 85  ? -1.605  11.295  4.912   1.00 0.00 ? 85  ARG A NH2  3  
ATOM 4473  H H    . ARG A 1 85  ? 1.818   12.642  -0.287  1.00 0.00 ? 85  ARG A H    3  
ATOM 4474  H HA   . ARG A 1 85  ? 1.011   15.177  0.254   1.00 0.00 ? 85  ARG A HA   3  
ATOM 4475  H HB2  . ARG A 1 85  ? 2.983   13.393  1.640   1.00 0.00 ? 85  ARG A HB2  3  
ATOM 4476  H HB3  . ARG A 1 85  ? 2.675   15.012  2.255   1.00 0.00 ? 85  ARG A HB3  3  
ATOM 4477  H HG2  . ARG A 1 85  ? 0.359   14.508  2.600   1.00 0.00 ? 85  ARG A HG2  3  
ATOM 4478  H HG3  . ARG A 1 85  ? 0.538   12.943  1.803   1.00 0.00 ? 85  ARG A HG3  3  
ATOM 4479  H HD2  . ARG A 1 85  ? 2.378   12.599  3.663   1.00 0.00 ? 85  ARG A HD2  3  
ATOM 4480  H HD3  . ARG A 1 85  ? 1.423   13.818  4.506   1.00 0.00 ? 85  ARG A HD3  3  
ATOM 4481  H HE   . ARG A 1 85  ? 0.736   11.086  4.111   1.00 0.00 ? 85  ARG A HE   3  
ATOM 4482  H HH11 . ARG A 1 85  ? -0.608  14.287  4.366   1.00 0.00 ? 85  ARG A HH11 3  
ATOM 4483  H HH12 . ARG A 1 85  ? -2.148  13.737  4.939   1.00 0.00 ? 85  ARG A HH12 3  
ATOM 4484  H HH21 . ARG A 1 85  ? -1.288  10.348  4.864   1.00 0.00 ? 85  ARG A HH21 3  
ATOM 4485  H HH22 . ARG A 1 85  ? -2.533  11.496  5.222   1.00 0.00 ? 85  ARG A HH22 3  
ATOM 4486  N N    . GLN A 1 86  ? 4.014   15.179  -0.940  1.00 0.00 ? 86  GLN A N    3  
ATOM 4487  C CA   . GLN A 1 86  ? 5.101   16.021  -1.427  1.00 0.00 ? 86  GLN A CA   3  
ATOM 4488  C C    . GLN A 1 86  ? 4.756   16.625  -2.784  1.00 0.00 ? 86  GLN A C    3  
ATOM 4489  O O    . GLN A 1 86  ? 5.080   17.780  -3.062  1.00 0.00 ? 86  GLN A O    3  
ATOM 4490  C CB   . GLN A 1 86  ? 6.394   15.210  -1.530  1.00 0.00 ? 86  GLN A CB   3  
ATOM 4491  C CG   . GLN A 1 86  ? 6.864   14.642  -0.201  1.00 0.00 ? 86  GLN A CG   3  
ATOM 4492  C CD   . GLN A 1 86  ? 8.369   14.469  -0.139  1.00 0.00 ? 86  GLN A CD   3  
ATOM 4493  O OE1  . GLN A 1 86  ? 9.097   15.396  0.216   1.00 0.00 ? 86  GLN A OE1  3  
ATOM 4494  N NE2  . GLN A 1 86  ? 8.843   13.278  -0.485  1.00 0.00 ? 86  GLN A NE2  3  
ATOM 4495  H H    . GLN A 1 86  ? 3.999   14.230  -1.182  1.00 0.00 ? 86  GLN A H    3  
ATOM 4496  H HA   . GLN A 1 86  ? 5.244   16.821  -0.716  1.00 0.00 ? 86  GLN A HA   3  
ATOM 4497  H HB2  . GLN A 1 86  ? 6.237   14.389  -2.213  1.00 0.00 ? 86  GLN A HB2  3  
ATOM 4498  H HB3  . GLN A 1 86  ? 7.174   15.848  -1.919  1.00 0.00 ? 86  GLN A HB3  3  
ATOM 4499  H HG2  . GLN A 1 86  ? 6.561   15.312  0.590   1.00 0.00 ? 86  GLN A HG2  3  
ATOM 4500  H HG3  . GLN A 1 86  ? 6.399   13.678  -0.052  1.00 0.00 ? 86  GLN A HG3  3  
ATOM 4501  H HE21 . GLN A 1 86  ? 8.203   12.587  -0.759  1.00 0.00 ? 86  GLN A HE21 3  
ATOM 4502  H HE22 . GLN A 1 86  ? 9.811   13.139  -0.455  1.00 0.00 ? 86  GLN A HE22 3  
ATOM 4503  N N    . LYS A 1 87  ? 4.096   15.837  -3.626  1.00 0.00 ? 87  LYS A N    3  
ATOM 4504  C CA   . LYS A 1 87  ? 3.705   16.294  -4.955  1.00 0.00 ? 87  LYS A CA   3  
ATOM 4505  C C    . LYS A 1 87  ? 2.742   17.473  -4.863  1.00 0.00 ? 87  LYS A C    3  
ATOM 4506  O O    . LYS A 1 87  ? 2.908   18.479  -5.555  1.00 0.00 ? 87  LYS A O    3  
ATOM 4507  C CB   . LYS A 1 87  ? 3.056   15.151  -5.739  1.00 0.00 ? 87  LYS A CB   3  
ATOM 4508  C CG   . LYS A 1 87  ? 2.416   15.595  -7.043  1.00 0.00 ? 87  LYS A CG   3  
ATOM 4509  C CD   . LYS A 1 87  ? 1.374   14.597  -7.520  1.00 0.00 ? 87  LYS A CD   3  
ATOM 4510  C CE   . LYS A 1 87  ? 0.325   14.332  -6.451  1.00 0.00 ? 87  LYS A CE   3  
ATOM 4511  N NZ   . LYS A 1 87  ? -0.989  13.959  -7.044  1.00 0.00 ? 87  LYS A NZ   3  
ATOM 4512  H H    . LYS A 1 87  ? 3.865   14.926  -3.347  1.00 0.00 ? 87  LYS A H    3  
ATOM 4513  H HA   . LYS A 1 87  ? 4.598   16.613  -5.472  1.00 0.00 ? 87  LYS A HA   3  
ATOM 4514  H HB2  . LYS A 1 87  ? 3.811   14.412  -5.965  1.00 0.00 ? 87  LYS A HB2  3  
ATOM 4515  H HB3  . LYS A 1 87  ? 2.293   14.697  -5.124  1.00 0.00 ? 87  LYS A HB3  3  
ATOM 4516  H HG2  . LYS A 1 87  ? 1.940   16.552  -6.892  1.00 0.00 ? 87  LYS A HG2  3  
ATOM 4517  H HG3  . LYS A 1 87  ? 3.185   15.688  -7.797  1.00 0.00 ? 87  LYS A HG3  3  
ATOM 4518  H HD2  . LYS A 1 87  ? 0.885   14.993  -8.398  1.00 0.00 ? 87  LYS A HD2  3  
ATOM 4519  H HD3  . LYS A 1 87  ? 1.866   13.667  -7.768  1.00 0.00 ? 87  LYS A HD3  3  
ATOM 4520  H HE2  . LYS A 1 87  ? 0.668   13.526  -5.821  1.00 0.00 ? 87  LYS A HE2  3  
ATOM 4521  H HE3  . LYS A 1 87  ? 0.202   15.226  -5.857  1.00 0.00 ? 87  LYS A HE3  3  
ATOM 4522  H HZ1  . LYS A 1 87  ? -1.761  14.402  -6.507  1.00 0.00 ? 87  LYS A HZ1  3  
ATOM 4523  H HZ2  . LYS A 1 87  ? -1.112  12.927  -7.019  1.00 0.00 ? 87  LYS A HZ2  3  
ATOM 4524  H HZ3  . LYS A 1 87  ? -1.039  14.280  -8.032  1.00 0.00 ? 87  LYS A HZ3  3  
ATOM 4525  N N    . LEU A 1 88  ? 1.736   17.344  -4.005  1.00 0.00 ? 88  LEU A N    3  
ATOM 4526  C CA   . LEU A 1 88  ? 0.747   18.400  -3.822  1.00 0.00 ? 88  LEU A CA   3  
ATOM 4527  C C    . LEU A 1 88  ? 1.382   19.640  -3.200  1.00 0.00 ? 88  LEU A C    3  
ATOM 4528  O O    . LEU A 1 88  ? 0.759   20.698  -3.126  1.00 0.00 ? 88  LEU A O    3  
ATOM 4529  C CB   . LEU A 1 88  ? -0.401  17.904  -2.940  1.00 0.00 ? 88  LEU A CB   3  
ATOM 4530  C CG   . LEU A 1 88  ? 0.002   17.272  -1.607  1.00 0.00 ? 88  LEU A CG   3  
ATOM 4531  C CD1  . LEU A 1 88  ? 0.636   18.310  -0.695  1.00 0.00 ? 88  LEU A CD1  3  
ATOM 4532  C CD2  . LEU A 1 88  ? -1.204  16.633  -0.935  1.00 0.00 ? 88  LEU A CD2  3  
ATOM 4533  H H    . LEU A 1 88  ? 1.656   16.520  -3.482  1.00 0.00 ? 88  LEU A H    3  
ATOM 4534  H HA   . LEU A 1 88  ? 0.356   18.661  -4.794  1.00 0.00 ? 88  LEU A HA   3  
ATOM 4535  H HB2  . LEU A 1 88  ? -1.042  18.746  -2.727  1.00 0.00 ? 88  LEU A HB2  3  
ATOM 4536  H HB3  . LEU A 1 88  ? -0.954  17.166  -3.504  1.00 0.00 ? 88  LEU A HB3  3  
ATOM 4537  H HG   . LEU A 1 88  ? 0.734   16.498  -1.790  1.00 0.00 ? 88  LEU A HG   3  
ATOM 4538  H HD11 . LEU A 1 88  ? 0.455   18.042  0.335   1.00 0.00 ? 88  LEU A HD11 3  
ATOM 4539  H HD12 . LEU A 1 88  ? 0.202   19.279  -0.895  1.00 0.00 ? 88  LEU A HD12 3  
ATOM 4540  H HD13 . LEU A 1 88  ? 1.700   18.348  -0.877  1.00 0.00 ? 88  LEU A HD13 3  
ATOM 4541  H HD21 . LEU A 1 88  ? -0.953  15.629  -0.626  1.00 0.00 ? 88  LEU A HD21 3  
ATOM 4542  H HD22 . LEU A 1 88  ? -2.029  16.599  -1.632  1.00 0.00 ? 88  LEU A HD22 3  
ATOM 4543  H HD23 . LEU A 1 88  ? -1.485  17.216  -0.071  1.00 0.00 ? 88  LEU A HD23 3  
ATOM 4544  N N    . ALA A 1 89  ? 2.626   19.500  -2.755  1.00 0.00 ? 89  ALA A N    3  
ATOM 4545  C CA   . ALA A 1 89  ? 3.348   20.609  -2.143  1.00 0.00 ? 89  ALA A CA   3  
ATOM 4546  C C    . ALA A 1 89  ? 4.165   21.371  -3.180  1.00 0.00 ? 89  ALA A C    3  
ATOM 4547  O O    . ALA A 1 89  ? 4.339   22.585  -3.077  1.00 0.00 ? 89  ALA A O    3  
ATOM 4548  C CB   . ALA A 1 89  ? 4.249   20.101  -1.027  1.00 0.00 ? 89  ALA A CB   3  
ATOM 4549  H H    . ALA A 1 89  ? 3.070   18.631  -2.842  1.00 0.00 ? 89  ALA A H    3  
ATOM 4550  H HA   . ALA A 1 89  ? 2.621   21.281  -1.708  1.00 0.00 ? 89  ALA A HA   3  
ATOM 4551  H HB1  . ALA A 1 89  ? 5.255   20.460  -1.187  1.00 0.00 ? 89  ALA A HB1  3  
ATOM 4552  H HB2  . ALA A 1 89  ? 3.884   20.463  -0.077  1.00 0.00 ? 89  ALA A HB2  3  
ATOM 4553  H HB3  . ALA A 1 89  ? 4.247   19.022  -1.027  1.00 0.00 ? 89  ALA A HB3  3  
ATOM 4554  N N    . MET A 1 90  ? 4.666   20.651  -4.178  1.00 0.00 ? 90  MET A N    3  
ATOM 4555  C CA   . MET A 1 90  ? 5.465   21.260  -5.235  1.00 0.00 ? 90  MET A CA   3  
ATOM 4556  C C    . MET A 1 90  ? 4.692   22.380  -5.924  1.00 0.00 ? 90  MET A C    3  
ATOM 4557  O O    . MET A 1 90  ? 5.262   23.411  -6.282  1.00 0.00 ? 90  MET A O    3  
ATOM 4558  C CB   . MET A 1 90  ? 5.882   20.206  -6.262  1.00 0.00 ? 90  MET A CB   3  
ATOM 4559  C CG   . MET A 1 90  ? 6.566   18.996  -5.646  1.00 0.00 ? 90  MET A CG   3  
ATOM 4560  S SD   . MET A 1 90  ? 8.354   19.196  -5.524  1.00 0.00 ? 90  MET A SD   3  
ATOM 4561  C CE   . MET A 1 90  ? 8.817   17.643  -4.761  1.00 0.00 ? 90  MET A CE   3  
ATOM 4562  H H    . MET A 1 90  ? 4.493   19.686  -4.206  1.00 0.00 ? 90  MET A H    3  
ATOM 4563  H HA   . MET A 1 90  ? 6.351   21.677  -4.780  1.00 0.00 ? 90  MET A HA   3  
ATOM 4564  H HB2  . MET A 1 90  ? 5.003   19.866  -6.788  1.00 0.00 ? 90  MET A HB2  3  
ATOM 4565  H HB3  . MET A 1 90  ? 6.563   20.657  -6.968  1.00 0.00 ? 90  MET A HB3  3  
ATOM 4566  H HG2  . MET A 1 90  ? 6.168   18.838  -4.655  1.00 0.00 ? 90  MET A HG2  3  
ATOM 4567  H HG3  . MET A 1 90  ? 6.355   18.131  -6.258  1.00 0.00 ? 90  MET A HG3  3  
ATOM 4568  H HE1  . MET A 1 90  ? 9.666   17.800  -4.112  1.00 0.00 ? 90  MET A HE1  3  
ATOM 4569  H HE2  . MET A 1 90  ? 7.987   17.264  -4.184  1.00 0.00 ? 90  MET A HE2  3  
ATOM 4570  H HE3  . MET A 1 90  ? 9.079   16.929  -5.529  1.00 0.00 ? 90  MET A HE3  3  
ATOM 4571  N N    . ASP A 1 91  ? 3.393   22.171  -6.106  1.00 0.00 ? 91  ASP A N    3  
ATOM 4572  C CA   . ASP A 1 91  ? 2.542   23.163  -6.752  1.00 0.00 ? 91  ASP A CA   3  
ATOM 4573  C C    . ASP A 1 91  ? 2.304   24.357  -5.832  1.00 0.00 ? 91  ASP A C    3  
ATOM 4574  O O    . ASP A 1 91  ? 2.738   24.361  -4.680  1.00 0.00 ? 91  ASP A O    3  
ATOM 4575  C CB   . ASP A 1 91  ? 1.205   22.537  -7.151  1.00 0.00 ? 91  ASP A CB   3  
ATOM 4576  C CG   . ASP A 1 91  ? 1.256   21.884  -8.518  1.00 0.00 ? 91  ASP A CG   3  
ATOM 4577  O OD1  . ASP A 1 91  ? 1.636   20.697  -8.595  1.00 0.00 ? 91  ASP A OD1  3  
ATOM 4578  O OD2  . ASP A 1 91  ? 0.916   22.560  -9.512  1.00 0.00 ? 91  ASP A OD2  3  
ATOM 4579  H H    . ASP A 1 91  ? 2.997   21.329  -5.798  1.00 0.00 ? 91  ASP A H    3  
ATOM 4580  H HA   . ASP A 1 91  ? 3.048   23.506  -7.642  1.00 0.00 ? 91  ASP A HA   3  
ATOM 4581  H HB2  . ASP A 1 91  ? 0.935   21.786  -6.424  1.00 0.00 ? 91  ASP A HB2  3  
ATOM 4582  H HB3  . ASP A 1 91  ? 0.446   23.305  -7.167  1.00 0.00 ? 91  ASP A HB3  3  
ATOM 4583  N N    . ALA A 1 92  ? 1.614   25.368  -6.349  1.00 0.00 ? 92  ALA A N    3  
ATOM 4584  C CA   . ALA A 1 92  ? 1.319   26.567  -5.574  1.00 0.00 ? 92  ALA A CA   3  
ATOM 4585  C C    . ALA A 1 92  ? 0.180   27.362  -6.205  1.00 0.00 ? 92  ALA A C    3  
ATOM 4586  O O    . ALA A 1 92  ? -0.191  27.127  -7.355  1.00 0.00 ? 92  ALA A O    3  
ATOM 4587  C CB   . ALA A 1 92  ? 2.563   27.433  -5.446  1.00 0.00 ? 92  ALA A CB   3  
ATOM 4588  H H    . ALA A 1 92  ? 1.295   25.306  -7.273  1.00 0.00 ? 92  ALA A H    3  
ATOM 4589  H HA   . ALA A 1 92  ? 1.022   26.258  -4.582  1.00 0.00 ? 92  ALA A HA   3  
ATOM 4590  H HB1  . ALA A 1 92  ? 2.693   28.010  -6.350  1.00 0.00 ? 92  ALA A HB1  3  
ATOM 4591  H HB2  . ALA A 1 92  ? 2.452   28.101  -4.605  1.00 0.00 ? 92  ALA A HB2  3  
ATOM 4592  H HB3  . ALA A 1 92  ? 3.426   26.802  -5.295  1.00 0.00 ? 92  ALA A HB3  3  
ATOM 4593  N N    . TYR A 1 93  ? -0.370  28.302  -5.445  1.00 0.00 ? 93  TYR A N    3  
ATOM 4594  C CA   . TYR A 1 93  ? -1.469  29.129  -5.929  1.00 0.00 ? 93  TYR A CA   3  
ATOM 4595  C C    . TYR A 1 93  ? -2.553  28.272  -6.575  1.00 0.00 ? 93  TYR A C    3  
ATOM 4596  O O    . TYR A 1 93  ? -3.079  28.611  -7.635  1.00 0.00 ? 93  TYR A O    3  
ATOM 4597  C CB   . TYR A 1 93  ? -0.953  30.161  -6.934  1.00 0.00 ? 93  TYR A CB   3  
ATOM 4598  C CG   . TYR A 1 93  ? -0.119  31.254  -6.305  1.00 0.00 ? 93  TYR A CG   3  
ATOM 4599  C CD1  . TYR A 1 93  ? 1.257   31.114  -6.170  1.00 0.00 ? 93  TYR A CD1  3  
ATOM 4600  C CD2  . TYR A 1 93  ? -0.706  32.426  -5.845  1.00 0.00 ? 93  TYR A CD2  3  
ATOM 4601  C CE1  . TYR A 1 93  ? 2.024   32.109  -5.595  1.00 0.00 ? 93  TYR A CE1  3  
ATOM 4602  C CE2  . TYR A 1 93  ? 0.053   33.428  -5.271  1.00 0.00 ? 93  TYR A CE2  3  
ATOM 4603  C CZ   . TYR A 1 93  ? 1.417   33.264  -5.148  1.00 0.00 ? 93  TYR A CZ   3  
ATOM 4604  O OH   . TYR A 1 93  ? 2.177   34.259  -4.575  1.00 0.00 ? 93  TYR A OH   3  
ATOM 4605  H H    . TYR A 1 93  ? -0.031  28.442  -4.536  1.00 0.00 ? 93  TYR A H    3  
ATOM 4606  H HA   . TYR A 1 93  ? -1.892  29.647  -5.081  1.00 0.00 ? 93  TYR A HA   3  
ATOM 4607  H HB2  . TYR A 1 93  ? -0.344  29.663  -7.671  1.00 0.00 ? 93  TYR A HB2  3  
ATOM 4608  H HB3  . TYR A 1 93  ? -1.795  30.627  -7.425  1.00 0.00 ? 93  TYR A HB3  3  
ATOM 4609  H HD1  . TYR A 1 93  ? 1.730   30.208  -6.521  1.00 0.00 ? 93  TYR A HD1  3  
ATOM 4610  H HD2  . TYR A 1 93  ? -1.775  32.551  -5.942  1.00 0.00 ? 93  TYR A HD2  3  
ATOM 4611  H HE1  . TYR A 1 93  ? 3.092   31.982  -5.499  1.00 0.00 ? 93  TYR A HE1  3  
ATOM 4612  H HE2  . TYR A 1 93  ? -0.422  34.332  -4.920  1.00 0.00 ? 93  TYR A HE2  3  
ATOM 4613  H HH   . TYR A 1 93  ? 1.664   35.070  -4.536  1.00 0.00 ? 93  TYR A HH   3  
ATOM 4614  N N    . SER A 1 94  ? -2.883  27.160  -5.927  1.00 0.00 ? 94  SER A N    3  
ATOM 4615  C CA   . SER A 1 94  ? -3.902  26.251  -6.438  1.00 0.00 ? 94  SER A CA   3  
ATOM 4616  C C    . SER A 1 94  ? -4.894  25.874  -5.341  1.00 0.00 ? 94  SER A C    3  
ATOM 4617  O O    . SER A 1 94  ? -4.617  26.044  -4.153  1.00 0.00 ? 94  SER A O    3  
ATOM 4618  C CB   . SER A 1 94  ? -3.251  24.989  -7.007  1.00 0.00 ? 94  SER A CB   3  
ATOM 4619  O OG   . SER A 1 94  ? -2.679  25.240  -8.279  1.00 0.00 ? 94  SER A OG   3  
ATOM 4620  H H    . SER A 1 94  ? -2.428  26.944  -5.086  1.00 0.00 ? 94  SER A H    3  
ATOM 4621  H HA   . SER A 1 94  ? -4.434  26.760  -7.228  1.00 0.00 ? 94  SER A HA   3  
ATOM 4622  H HB2  . SER A 1 94  ? -2.475  24.653  -6.337  1.00 0.00 ? 94  SER A HB2  3  
ATOM 4623  H HB3  . SER A 1 94  ? -3.999  24.216  -7.109  1.00 0.00 ? 94  SER A HB3  3  
ATOM 4624  H HG   . SER A 1 94  ? -2.471  24.406  -8.707  1.00 0.00 ? 94  SER A HG   3  
ATOM 4625  N N    . SER A 1 95  ? -6.051  25.362  -5.748  1.00 0.00 ? 95  SER A N    3  
ATOM 4626  C CA   . SER A 1 95  ? -7.086  24.965  -4.801  1.00 0.00 ? 95  SER A CA   3  
ATOM 4627  C C    . SER A 1 95  ? -7.208  23.446  -4.736  1.00 0.00 ? 95  SER A C    3  
ATOM 4628  O O    . SER A 1 95  ? -8.311  22.901  -4.728  1.00 0.00 ? 95  SER A O    3  
ATOM 4629  C CB   . SER A 1 95  ? -8.431  25.580  -5.196  1.00 0.00 ? 95  SER A CB   3  
ATOM 4630  O OG   . SER A 1 95  ? -8.964  24.945  -6.345  1.00 0.00 ? 95  SER A OG   3  
ATOM 4631  H H    . SER A 1 95  ? -6.213  25.252  -6.708  1.00 0.00 ? 95  SER A H    3  
ATOM 4632  H HA   . SER A 1 95  ? -6.803  25.334  -3.827  1.00 0.00 ? 95  SER A HA   3  
ATOM 4633  H HB2  . SER A 1 95  ? -9.128  25.466  -4.380  1.00 0.00 ? 95  SER A HB2  3  
ATOM 4634  H HB3  . SER A 1 95  ? -8.294  26.630  -5.409  1.00 0.00 ? 95  SER A HB3  3  
ATOM 4635  H HG   . SER A 1 95  ? -8.544  25.301  -7.131  1.00 0.00 ? 95  SER A HG   3  
ATOM 4636  N N    . ASN A 1 96  ? -6.066  22.768  -4.689  1.00 0.00 ? 96  ASN A N    3  
ATOM 4637  C CA   . ASN A 1 96  ? -6.044  21.311  -4.625  1.00 0.00 ? 96  ASN A CA   3  
ATOM 4638  C C    . ASN A 1 96  ? -6.533  20.819  -3.267  1.00 0.00 ? 96  ASN A C    3  
ATOM 4639  O O    . ASN A 1 96  ? -6.829  21.615  -2.376  1.00 0.00 ? 96  ASN A O    3  
ATOM 4640  C CB   . ASN A 1 96  ? -4.630  20.790  -4.890  1.00 0.00 ? 96  ASN A CB   3  
ATOM 4641  C CG   . ASN A 1 96  ? -4.619  19.329  -5.296  1.00 0.00 ? 96  ASN A CG   3  
ATOM 4642  O OD1  . ASN A 1 96  ? -5.600  18.815  -5.834  1.00 0.00 ? 96  ASN A OD1  3  
ATOM 4643  N ND2  . ASN A 1 96  ? -3.506  18.652  -5.039  1.00 0.00 ? 96  ASN A ND2  3  
ATOM 4644  H H    . ASN A 1 96  ? -5.218  23.259  -4.699  1.00 0.00 ? 96  ASN A H    3  
ATOM 4645  H HA   . ASN A 1 96  ? -6.705  20.936  -5.391  1.00 0.00 ? 96  ASN A HA   3  
ATOM 4646  H HB2  . ASN A 1 96  ? -4.183  21.368  -5.686  1.00 0.00 ? 96  ASN A HB2  3  
ATOM 4647  H HB3  . ASN A 1 96  ? -4.038  20.900  -3.994  1.00 0.00 ? 96  ASN A HB3  3  
ATOM 4648  H HD21 . ASN A 1 96  ? -2.764  19.126  -4.608  1.00 0.00 ? 96  ASN A HD21 3  
ATOM 4649  H HD22 . ASN A 1 96  ? -3.471  17.706  -5.292  1.00 0.00 ? 96  ASN A HD22 3  
ATOM 4650  N N    . SER A 1 97  ? -6.615  19.501  -3.116  1.00 0.00 ? 97  SER A N    3  
ATOM 4651  C CA   . SER A 1 97  ? -7.072  18.901  -1.867  1.00 0.00 ? 97  SER A CA   3  
ATOM 4652  C C    . SER A 1 97  ? -6.405  19.570  -0.668  1.00 0.00 ? 97  SER A C    3  
ATOM 4653  O O    . SER A 1 97  ? -5.182  19.691  -0.611  1.00 0.00 ? 97  SER A O    3  
ATOM 4654  C CB   . SER A 1 97  ? -6.775  17.401  -1.859  1.00 0.00 ? 97  SER A CB   3  
ATOM 4655  O OG   . SER A 1 97  ? -7.567  16.719  -2.816  1.00 0.00 ? 97  SER A OG   3  
ATOM 4656  H H    . SER A 1 97  ? -6.365  18.918  -3.863  1.00 0.00 ? 97  SER A H    3  
ATOM 4657  H HA   . SER A 1 97  ? -8.139  19.049  -1.799  1.00 0.00 ? 97  SER A HA   3  
ATOM 4658  H HB2  . SER A 1 97  ? -5.734  17.241  -2.092  1.00 0.00 ? 97  SER A HB2  3  
ATOM 4659  H HB3  . SER A 1 97  ? -6.991  16.999  -0.879  1.00 0.00 ? 97  SER A HB3  3  
ATOM 4660  H HG   . SER A 1 97  ? -7.776  17.313  -3.540  1.00 0.00 ? 97  SER A HG   3  
ATOM 4661  N N    . GLY A 1 98  ? -7.220  20.001  0.290   1.00 0.00 ? 98  GLY A N    3  
ATOM 4662  C CA   . GLY A 1 98  ? -6.693  20.652  1.475   1.00 0.00 ? 98  GLY A CA   3  
ATOM 4663  C C    . GLY A 1 98  ? -5.484  19.934  2.041   1.00 0.00 ? 98  GLY A C    3  
ATOM 4664  O O    . GLY A 1 98  ? -5.418  18.705  2.059   1.00 0.00 ? 98  GLY A O    3  
ATOM 4665  H H    . GLY A 1 98  ? -8.188  19.877  0.190   1.00 0.00 ? 98  GLY A H    3  
ATOM 4666  H HA2  . GLY A 1 98  ? -6.413  21.664  1.222   1.00 0.00 ? 98  GLY A HA2  3  
ATOM 4667  H HA3  . GLY A 1 98  ? -7.466  20.682  2.229   1.00 0.00 ? 98  GLY A HA3  3  
ATOM 4668  N N    . PRO A 1 99  ? -4.499  20.711  2.516   1.00 0.00 ? 99  PRO A N    3  
ATOM 4669  C CA   . PRO A 1 99  ? -3.268  20.163  3.093   1.00 0.00 ? 99  PRO A CA   3  
ATOM 4670  C C    . PRO A 1 99  ? -3.510  19.481  4.435   1.00 0.00 ? 99  PRO A C    3  
ATOM 4671  O O    . PRO A 1 99  ? -3.969  20.111  5.388   1.00 0.00 ? 99  PRO A O    3  
ATOM 4672  C CB   . PRO A 1 99  ? -2.380  21.397  3.272   1.00 0.00 ? 99  PRO A CB   3  
ATOM 4673  C CG   . PRO A 1 99  ? -3.334  22.535  3.393   1.00 0.00 ? 99  PRO A CG   3  
ATOM 4674  C CD   . PRO A 1 99  ? -4.511  22.183  2.526   1.00 0.00 ? 99  PRO A CD   3  
ATOM 4675  H HA   . PRO A 1 99  ? -2.789  19.468  2.419   1.00 0.00 ? 99  PRO A HA   3  
ATOM 4676  H HB2  . PRO A 1 99  ? -1.781  21.286  4.165   1.00 0.00 ? 99  PRO A HB2  3  
ATOM 4677  H HB3  . PRO A 1 99  ? -1.737  21.511  2.412   1.00 0.00 ? 99  PRO A HB3  3  
ATOM 4678  H HG2  . PRO A 1 99  ? -3.645  22.646  4.421   1.00 0.00 ? 99  PRO A HG2  3  
ATOM 4679  H HG3  . PRO A 1 99  ? -2.868  23.443  3.041   1.00 0.00 ? 99  PRO A HG3  3  
ATOM 4680  H HD2  . PRO A 1 99  ? -5.425  22.559  2.960   1.00 0.00 ? 99  PRO A HD2  3  
ATOM 4681  H HD3  . PRO A 1 99  ? -4.375  22.576  1.529   1.00 0.00 ? 99  PRO A HD3  3  
ATOM 4682  N N    . SER A 1 100 ? -3.199  18.191  4.503   1.00 0.00 ? 100 SER A N    3  
ATOM 4683  C CA   . SER A 1 100 ? -3.386  17.423  5.729   1.00 0.00 ? 100 SER A CA   3  
ATOM 4684  C C    . SER A 1 100 ? -2.156  17.522  6.625   1.00 0.00 ? 100 SER A C    3  
ATOM 4685  O O    . SER A 1 100 ? -2.265  17.803  7.819   1.00 0.00 ? 100 SER A O    3  
ATOM 4686  C CB   . SER A 1 100 ? -3.674  15.957  5.398   1.00 0.00 ? 100 SER A CB   3  
ATOM 4687  O OG   . SER A 1 100 ? -5.064  15.734  5.237   1.00 0.00 ? 100 SER A OG   3  
ATOM 4688  H H    . SER A 1 100 ? -2.837  17.744  3.709   1.00 0.00 ? 100 SER A H    3  
ATOM 4689  H HA   . SER A 1 100 ? -4.234  17.838  6.253   1.00 0.00 ? 100 SER A HA   3  
ATOM 4690  H HB2  . SER A 1 100 ? -3.170  15.692  4.481   1.00 0.00 ? 100 SER A HB2  3  
ATOM 4691  H HB3  . SER A 1 100 ? -3.311  15.332  6.202   1.00 0.00 ? 100 SER A HB3  3  
ATOM 4692  H HG   . SER A 1 100 ? -5.207  15.099  4.532   1.00 0.00 ? 100 SER A HG   3  
ATOM 4693  N N    . SER A 1 101 ? -0.985  17.288  6.041   1.00 0.00 ? 101 SER A N    3  
ATOM 4694  C CA   . SER A 1 101 ? 0.267   17.347  6.786   1.00 0.00 ? 101 SER A CA   3  
ATOM 4695  C C    . SER A 1 101 ? 0.078   16.822  8.207   1.00 0.00 ? 101 SER A C    3  
ATOM 4696  O O    . SER A 1 101 ? 0.526   17.439  9.173   1.00 0.00 ? 101 SER A O    3  
ATOM 4697  C CB   . SER A 1 101 ? 0.794   18.783  6.827   1.00 0.00 ? 101 SER A CB   3  
ATOM 4698  O OG   . SER A 1 101 ? -0.127  19.646  7.472   1.00 0.00 ? 101 SER A OG   3  
ATOM 4699  H H    . SER A 1 101 ? -0.963  17.069  5.086   1.00 0.00 ? 101 SER A H    3  
ATOM 4700  H HA   . SER A 1 101 ? 0.986   16.723  6.277   1.00 0.00 ? 101 SER A HA   3  
ATOM 4701  H HB2  . SER A 1 101 ? 1.728   18.805  7.366   1.00 0.00 ? 101 SER A HB2  3  
ATOM 4702  H HB3  . SER A 1 101 ? 0.952   19.134  5.817   1.00 0.00 ? 101 SER A HB3  3  
ATOM 4703  H HG   . SER A 1 101 ? -0.563  20.196  6.817   1.00 0.00 ? 101 SER A HG   3  
ATOM 4704  N N    . GLY A 1 102 ? -0.588  15.678  8.324   1.00 0.00 ? 102 GLY A N    3  
ATOM 4705  C CA   . GLY A 1 102 ? -0.825  15.088  9.629   1.00 0.00 ? 102 GLY A CA   3  
ATOM 4706  C C    . GLY A 1 102 ? -2.301  14.927  9.933   1.00 0.00 ? 102 GLY A C    3  
ATOM 4707  O O    . GLY A 1 102 ? -2.918  13.937  9.541   1.00 0.00 ? 102 GLY A O    3  
ATOM 4708  H H    . GLY A 1 102 ? -0.922  15.230  7.519   1.00 0.00 ? 102 GLY A H    3  
ATOM 4709  H HA2  . GLY A 1 102 ? -0.353  14.118  9.664   1.00 0.00 ? 102 GLY A HA2  3  
ATOM 4710  H HA3  . GLY A 1 102 ? -0.381  15.721  10.383  1.00 0.00 ? 102 GLY A HA3  3  
ATOM 4711  N N    . GLY A 1 1   ? -22.589 -12.691 -12.044 1.00 0.00 ? 1   GLY A N    4  
ATOM 4712  C CA   . GLY A 1 1   ? -21.703 -13.103 -13.117 1.00 0.00 ? 1   GLY A CA   4  
ATOM 4713  C C    . GLY A 1 1   ? -20.388 -13.654 -12.604 1.00 0.00 ? 1   GLY A C    4  
ATOM 4714  O O    . GLY A 1 1   ? -19.404 -12.924 -12.487 1.00 0.00 ? 1   GLY A O    4  
ATOM 4715  H H1   . GLY A 1 1   ? -23.457 -12.287 -12.255 1.00 0.00 ? 1   GLY A H1   4  
ATOM 4716  H HA2  . GLY A 1 1   ? -22.196 -13.864 -13.704 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 4717  H HA3  . GLY A 1 1   ? -21.501 -12.251 -13.749 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 4718  N N    . SER A 1 2   ? -20.369 -14.947 -12.296 1.00 0.00 ? 2   SER A N    4  
ATOM 4719  C CA   . SER A 1 2   ? -19.166 -15.595 -11.787 1.00 0.00 ? 2   SER A CA   4  
ATOM 4720  C C    . SER A 1 2   ? -17.946 -15.203 -12.615 1.00 0.00 ? 2   SER A C    4  
ATOM 4721  O O    . SER A 1 2   ? -16.821 -15.191 -12.116 1.00 0.00 ? 2   SER A O    4  
ATOM 4722  C CB   . SER A 1 2   ? -19.336 -17.115 -11.797 1.00 0.00 ? 2   SER A CB   4  
ATOM 4723  O OG   . SER A 1 2   ? -19.356 -17.617 -13.122 1.00 0.00 ? 2   SER A OG   4  
ATOM 4724  H H    . SER A 1 2   ? -21.186 -15.477 -12.411 1.00 0.00 ? 2   SER A H    4  
ATOM 4725  H HA   . SER A 1 2   ? -19.017 -15.265 -10.769 1.00 0.00 ? 2   SER A HA   4  
ATOM 4726  H HB2  . SER A 1 2   ? -18.515 -17.570 -11.264 1.00 0.00 ? 2   SER A HB2  4  
ATOM 4727  H HB3  . SER A 1 2   ? -20.267 -17.373 -11.312 1.00 0.00 ? 2   SER A HB3  4  
ATOM 4728  H HG   . SER A 1 2   ? -19.988 -17.118 -13.644 1.00 0.00 ? 2   SER A HG   4  
ATOM 4729  N N    . SER A 1 3   ? -18.179 -14.882 -13.884 1.00 0.00 ? 3   SER A N    4  
ATOM 4730  C CA   . SER A 1 3   ? -17.100 -14.493 -14.784 1.00 0.00 ? 3   SER A CA   4  
ATOM 4731  C C    . SER A 1 3   ? -16.671 -13.052 -14.527 1.00 0.00 ? 3   SER A C    4  
ATOM 4732  O O    . SER A 1 3   ? -17.495 -12.194 -14.211 1.00 0.00 ? 3   SER A O    4  
ATOM 4733  C CB   . SER A 1 3   ? -17.539 -14.655 -16.241 1.00 0.00 ? 3   SER A CB   4  
ATOM 4734  O OG   . SER A 1 3   ? -16.482 -14.337 -17.130 1.00 0.00 ? 3   SER A OG   4  
ATOM 4735  H H    . SER A 1 3   ? -19.098 -14.911 -14.223 1.00 0.00 ? 3   SER A H    4  
ATOM 4736  H HA   . SER A 1 3   ? -16.260 -15.145 -14.596 1.00 0.00 ? 3   SER A HA   4  
ATOM 4737  H HB2  . SER A 1 3   ? -17.841 -15.677 -16.412 1.00 0.00 ? 3   SER A HB2  4  
ATOM 4738  H HB3  . SER A 1 3   ? -18.371 -13.995 -16.438 1.00 0.00 ? 3   SER A HB3  4  
ATOM 4739  H HG   . SER A 1 3   ? -16.819 -14.304 -18.029 1.00 0.00 ? 3   SER A HG   4  
ATOM 4740  N N    . GLY A 1 4   ? -15.374 -12.793 -14.666 1.00 0.00 ? 4   GLY A N    4  
ATOM 4741  C CA   . GLY A 1 4   ? -14.857 -11.455 -14.445 1.00 0.00 ? 4   GLY A CA   4  
ATOM 4742  C C    . GLY A 1 4   ? -13.772 -11.082 -15.436 1.00 0.00 ? 4   GLY A C    4  
ATOM 4743  O O    . GLY A 1 4   ? -13.003 -11.936 -15.875 1.00 0.00 ? 4   GLY A O    4  
ATOM 4744  H H    . GLY A 1 4   ? -14.763 -13.517 -14.919 1.00 0.00 ? 4   GLY A H    4  
ATOM 4745  H HA2  . GLY A 1 4   ? -15.669 -10.748 -14.532 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 4746  H HA3  . GLY A 1 4   ? -14.450 -11.399 -13.446 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 4747  N N    . SER A 1 5   ? -13.712 -9.802  -15.791 1.00 0.00 ? 5   SER A N    4  
ATOM 4748  C CA   . SER A 1 5   ? -12.717 -9.319  -16.741 1.00 0.00 ? 5   SER A CA   4  
ATOM 4749  C C    . SER A 1 5   ? -11.748 -8.353  -16.068 1.00 0.00 ? 5   SER A C    4  
ATOM 4750  O O    . SER A 1 5   ? -12.007 -7.860  -14.970 1.00 0.00 ? 5   SER A O    4  
ATOM 4751  C CB   . SER A 1 5   ? -13.403 -8.630  -17.923 1.00 0.00 ? 5   SER A CB   4  
ATOM 4752  O OG   . SER A 1 5   ? -13.800 -9.574  -18.903 1.00 0.00 ? 5   SER A OG   4  
ATOM 4753  H H    . SER A 1 5   ? -14.354 -9.169  -15.406 1.00 0.00 ? 5   SER A H    4  
ATOM 4754  H HA   . SER A 1 5   ? -12.164 -10.172 -17.104 1.00 0.00 ? 5   SER A HA   4  
ATOM 4755  H HB2  . SER A 1 5   ? -14.278 -8.104  -17.572 1.00 0.00 ? 5   SER A HB2  4  
ATOM 4756  H HB3  . SER A 1 5   ? -12.717 -7.928  -18.374 1.00 0.00 ? 5   SER A HB3  4  
ATOM 4757  H HG   . SER A 1 5   ? -14.074 -10.387 -18.472 1.00 0.00 ? 5   SER A HG   4  
ATOM 4758  N N    . SER A 1 6   ? -10.629 -8.086  -16.735 1.00 0.00 ? 6   SER A N    4  
ATOM 4759  C CA   . SER A 1 6   ? -9.617  -7.182  -16.200 1.00 0.00 ? 6   SER A CA   4  
ATOM 4760  C C    . SER A 1 6   ? -9.900  -5.742  -16.618 1.00 0.00 ? 6   SER A C    4  
ATOM 4761  O O    . SER A 1 6   ? -9.670  -5.360  -17.764 1.00 0.00 ? 6   SER A O    4  
ATOM 4762  C CB   . SER A 1 6   ? -8.226  -7.600  -16.679 1.00 0.00 ? 6   SER A CB   4  
ATOM 4763  O OG   . SER A 1 6   ? -8.193  -7.745  -18.088 1.00 0.00 ? 6   SER A OG   4  
ATOM 4764  H H    . SER A 1 6   ? -10.480 -8.510  -17.606 1.00 0.00 ? 6   SER A H    4  
ATOM 4765  H HA   . SER A 1 6   ? -9.652  -7.246  -15.123 1.00 0.00 ? 6   SER A HA   4  
ATOM 4766  H HB2  . SER A 1 6   ? -7.508  -6.848  -16.390 1.00 0.00 ? 6   SER A HB2  4  
ATOM 4767  H HB3  . SER A 1 6   ? -7.960  -8.544  -16.225 1.00 0.00 ? 6   SER A HB3  4  
ATOM 4768  H HG   . SER A 1 6   ? -8.577  -6.967  -18.499 1.00 0.00 ? 6   SER A HG   4  
ATOM 4769  N N    . GLY A 1 7   ? -10.402 -4.947  -15.677 1.00 0.00 ? 7   GLY A N    4  
ATOM 4770  C CA   . GLY A 1 7   ? -10.709 -3.559  -15.965 1.00 0.00 ? 7   GLY A CA   4  
ATOM 4771  C C    . GLY A 1 7   ? -11.419 -2.871  -14.816 1.00 0.00 ? 7   GLY A C    4  
ATOM 4772  O O    . GLY A 1 7   ? -11.033 -1.776  -14.406 1.00 0.00 ? 7   GLY A O    4  
ATOM 4773  H H    . GLY A 1 7   ? -10.565 -5.307  -14.780 1.00 0.00 ? 7   GLY A H    4  
ATOM 4774  H HA2  . GLY A 1 7   ? -9.788  -3.034  -16.172 1.00 0.00 ? 7   GLY A HA2  4  
ATOM 4775  H HA3  . GLY A 1 7   ? -11.340 -3.516  -16.841 1.00 0.00 ? 7   GLY A HA3  4  
ATOM 4776  N N    . ARG A 1 8   ? -12.460 -3.513  -14.296 1.00 0.00 ? 8   ARG A N    4  
ATOM 4777  C CA   . ARG A 1 8   ? -13.227 -2.955  -13.190 1.00 0.00 ? 8   ARG A CA   4  
ATOM 4778  C C    . ARG A 1 8   ? -12.971 -3.734  -11.903 1.00 0.00 ? 8   ARG A C    4  
ATOM 4779  O O    . ARG A 1 8   ? -12.750 -3.148  -10.844 1.00 0.00 ? 8   ARG A O    4  
ATOM 4780  C CB   . ARG A 1 8   ? -14.721 -2.969  -13.518 1.00 0.00 ? 8   ARG A CB   4  
ATOM 4781  C CG   . ARG A 1 8   ? -15.263 -4.355  -13.828 1.00 0.00 ? 8   ARG A CG   4  
ATOM 4782  C CD   . ARG A 1 8   ? -16.655 -4.285  -14.437 1.00 0.00 ? 8   ARG A CD   4  
ATOM 4783  N NE   . ARG A 1 8   ? -17.619 -3.666  -13.530 1.00 0.00 ? 8   ARG A NE   4  
ATOM 4784  C CZ   . ARG A 1 8   ? -18.784 -3.165  -13.926 1.00 0.00 ? 8   ARG A CZ   4  
ATOM 4785  N NH1  . ARG A 1 8   ? -19.128 -3.211  -15.206 1.00 0.00 ? 8   ARG A NH1  4  
ATOM 4786  N NH2  . ARG A 1 8   ? -19.607 -2.619  -13.041 1.00 0.00 ? 8   ARG A NH2  4  
ATOM 4787  H H    . ARG A 1 8   ? -12.719 -4.383  -14.667 1.00 0.00 ? 8   ARG A H    4  
ATOM 4788  H HA   . ARG A 1 8   ? -12.908 -1.933  -13.047 1.00 0.00 ? 8   ARG A HA   4  
ATOM 4789  H HB2  . ARG A 1 8   ? -15.267 -2.573  -12.675 1.00 0.00 ? 8   ARG A HB2  4  
ATOM 4790  H HB3  . ARG A 1 8   ? -14.894 -2.338  -14.377 1.00 0.00 ? 8   ARG A HB3  4  
ATOM 4791  H HG2  . ARG A 1 8   ? -14.601 -4.842  -14.528 1.00 0.00 ? 8   ARG A HG2  4  
ATOM 4792  H HG3  . ARG A 1 8   ? -15.308 -4.926  -12.913 1.00 0.00 ? 8   ARG A HG3  4  
ATOM 4793  H HD2  . ARG A 1 8   ? -16.607 -3.704  -15.346 1.00 0.00 ? 8   ARG A HD2  4  
ATOM 4794  H HD3  . ARG A 1 8   ? -16.983 -5.287  -14.667 1.00 0.00 ? 8   ARG A HD3  4  
ATOM 4795  H HE   . ARG A 1 8   ? -17.384 -3.622  -12.580 1.00 0.00 ? 8   ARG A HE   4  
ATOM 4796  H HH11 . ARG A 1 8   ? -18.510 -3.623  -15.875 1.00 0.00 ? 8   ARG A HH11 4  
ATOM 4797  H HH12 . ARG A 1 8   ? -20.006 -2.834  -15.501 1.00 0.00 ? 8   ARG A HH12 4  
ATOM 4798  H HH21 . ARG A 1 8   ? -19.351 -2.583  -12.076 1.00 0.00 ? 8   ARG A HH21 4  
ATOM 4799  H HH22 . ARG A 1 8   ? -20.483 -2.242  -13.340 1.00 0.00 ? 8   ARG A HH22 4  
ATOM 4800  N N    . ASN A 1 9   ? -13.003 -5.059  -12.004 1.00 0.00 ? 9   ASN A N    4  
ATOM 4801  C CA   . ASN A 1 9   ? -12.776 -5.919  -10.848 1.00 0.00 ? 9   ASN A CA   4  
ATOM 4802  C C    . ASN A 1 9   ? -11.635 -5.384  -9.987  1.00 0.00 ? 9   ASN A C    4  
ATOM 4803  O O    . ASN A 1 9   ? -10.475 -5.393  -10.401 1.00 0.00 ? 9   ASN A O    4  
ATOM 4804  C CB   . ASN A 1 9   ? -12.461 -7.346  -11.301 1.00 0.00 ? 9   ASN A CB   4  
ATOM 4805  C CG   . ASN A 1 9   ? -13.713 -8.181  -11.493 1.00 0.00 ? 9   ASN A CG   4  
ATOM 4806  O OD1  . ASN A 1 9   ? -14.486 -7.956  -12.424 1.00 0.00 ? 9   ASN A OD1  4  
ATOM 4807  N ND2  . ASN A 1 9   ? -13.917 -9.151  -10.610 1.00 0.00 ? 9   ASN A ND2  4  
ATOM 4808  H H    . ASN A 1 9   ? -13.184 -5.469  -12.875 1.00 0.00 ? 9   ASN A H    4  
ATOM 4809  H HA   . ASN A 1 9   ? -13.681 -5.929  -10.259 1.00 0.00 ? 9   ASN A HA   4  
ATOM 4810  H HB2  . ASN A 1 9   ? -11.929 -7.309  -12.241 1.00 0.00 ? 9   ASN A HB2  4  
ATOM 4811  H HB3  . ASN A 1 9   ? -11.840 -7.825  -10.559 1.00 0.00 ? 9   ASN A HB3  4  
ATOM 4812  H HD21 . ASN A 1 9   ? -13.259 -9.272  -9.894  1.00 0.00 ? 9   ASN A HD21 4  
ATOM 4813  H HD22 . ASN A 1 9   ? -14.718 -9.706  -10.710 1.00 0.00 ? 9   ASN A HD22 4  
ATOM 4814  N N    . ARG A 1 10  ? -11.973 -4.918  -8.789  1.00 0.00 ? 10  ARG A N    4  
ATOM 4815  C CA   . ARG A 1 10  ? -10.977 -4.379  -7.871  1.00 0.00 ? 10  ARG A CA   4  
ATOM 4816  C C    . ARG A 1 10  ? -10.551 -5.431  -6.852  1.00 0.00 ? 10  ARG A C    4  
ATOM 4817  O O    . ARG A 1 10  ? -11.110 -5.514  -5.758  1.00 0.00 ? 10  ARG A O    4  
ATOM 4818  C CB   . ARG A 1 10  ? -11.532 -3.150  -7.149  1.00 0.00 ? 10  ARG A CB   4  
ATOM 4819  C CG   . ARG A 1 10  ? -10.467 -2.135  -6.767  1.00 0.00 ? 10  ARG A CG   4  
ATOM 4820  C CD   . ARG A 1 10  ? -10.069 -1.272  -7.954  1.00 0.00 ? 10  ARG A CD   4  
ATOM 4821  N NE   . ARG A 1 10  ? -9.208  -1.992  -8.889  1.00 0.00 ? 10  ARG A NE   4  
ATOM 4822  C CZ   . ARG A 1 10  ? -7.952  -2.331  -8.620  1.00 0.00 ? 10  ARG A CZ   4  
ATOM 4823  N NH1  . ARG A 1 10  ? -7.414  -2.018  -7.449  1.00 0.00 ? 10  ARG A NH1  4  
ATOM 4824  N NH2  . ARG A 1 10  ? -7.232  -2.985  -9.522  1.00 0.00 ? 10  ARG A NH2  4  
ATOM 4825  H H    . ARG A 1 10  ? -12.914 -4.938  -8.517  1.00 0.00 ? 10  ARG A H    4  
ATOM 4826  H HA   . ARG A 1 10  ? -10.115 -4.086  -8.451  1.00 0.00 ? 10  ARG A HA   4  
ATOM 4827  H HB2  . ARG A 1 10  ? -12.249 -2.661  -7.792  1.00 0.00 ? 10  ARG A HB2  4  
ATOM 4828  H HB3  . ARG A 1 10  ? -12.031 -3.472  -6.247  1.00 0.00 ? 10  ARG A HB3  4  
ATOM 4829  H HG2  . ARG A 1 10  ? -10.854 -1.497  -5.987  1.00 0.00 ? 10  ARG A HG2  4  
ATOM 4830  H HG3  . ARG A 1 10  ? -9.595  -2.661  -6.406  1.00 0.00 ? 10  ARG A HG3  4  
ATOM 4831  H HD2  . ARG A 1 10  ? -10.963 -0.960  -8.472  1.00 0.00 ? 10  ARG A HD2  4  
ATOM 4832  H HD3  . ARG A 1 10  ? -9.542  -0.403  -7.590  1.00 0.00 ? 10  ARG A HD3  4  
ATOM 4833  H HE   . ARG A 1 10  ? -9.585  -2.233  -9.760  1.00 0.00 ? 10  ARG A HE   4  
ATOM 4834  H HH11 . ARG A 1 10  ? -7.954  -1.526  -6.767  1.00 0.00 ? 10  ARG A HH11 4  
ATOM 4835  H HH12 . ARG A 1 10  ? -6.468  -2.275  -7.248  1.00 0.00 ? 10  ARG A HH12 4  
ATOM 4836  H HH21 . ARG A 1 10  ? -7.634  -3.223  -10.406 1.00 0.00 ? 10  ARG A HH21 4  
ATOM 4837  H HH22 . ARG A 1 10  ? -6.287  -3.240  -9.319  1.00 0.00 ? 10  ARG A HH22 4  
ATOM 4838  N N    . PHE A 1 11  ? -9.557  -6.234  -7.219  1.00 0.00 ? 11  PHE A N    4  
ATOM 4839  C CA   . PHE A 1 11  ? -9.056  -7.282  -6.337  1.00 0.00 ? 11  PHE A CA   4  
ATOM 4840  C C    . PHE A 1 11  ? -8.595  -6.699  -5.005  1.00 0.00 ? 11  PHE A C    4  
ATOM 4841  O O    . PHE A 1 11  ? -7.681  -5.874  -4.958  1.00 0.00 ? 11  PHE A O    4  
ATOM 4842  C CB   . PHE A 1 11  ? -7.902  -8.032  -7.006  1.00 0.00 ? 11  PHE A CB   4  
ATOM 4843  C CG   . PHE A 1 11  ? -6.949  -8.660  -6.029  1.00 0.00 ? 11  PHE A CG   4  
ATOM 4844  C CD1  . PHE A 1 11  ? -7.183  -9.933  -5.535  1.00 0.00 ? 11  PHE A CD1  4  
ATOM 4845  C CD2  . PHE A 1 11  ? -5.820  -7.977  -5.607  1.00 0.00 ? 11  PHE A CD2  4  
ATOM 4846  C CE1  . PHE A 1 11  ? -6.308  -10.513 -4.635  1.00 0.00 ? 11  PHE A CE1  4  
ATOM 4847  C CE2  . PHE A 1 11  ? -4.941  -8.552  -4.708  1.00 0.00 ? 11  PHE A CE2  4  
ATOM 4848  C CZ   . PHE A 1 11  ? -5.185  -9.822  -4.222  1.00 0.00 ? 11  PHE A CZ   4  
ATOM 4849  H H    . PHE A 1 11  ? -9.151  -6.119  -8.104  1.00 0.00 ? 11  PHE A H    4  
ATOM 4850  H HA   . PHE A 1 11  ? -9.864  -7.973  -6.153  1.00 0.00 ? 11  PHE A HA   4  
ATOM 4851  H HB2  . PHE A 1 11  ? -8.304  -8.817  -7.628  1.00 0.00 ? 11  PHE A HB2  4  
ATOM 4852  H HB3  . PHE A 1 11  ? -7.343  -7.342  -7.621  1.00 0.00 ? 11  PHE A HB3  4  
ATOM 4853  H HD1  . PHE A 1 11  ? -8.060  -10.475 -5.858  1.00 0.00 ? 11  PHE A HD1  4  
ATOM 4854  H HD2  . PHE A 1 11  ? -5.628  -6.984  -5.986  1.00 0.00 ? 11  PHE A HD2  4  
ATOM 4855  H HE1  . PHE A 1 11  ? -6.501  -11.506 -4.258  1.00 0.00 ? 11  PHE A HE1  4  
ATOM 4856  H HE2  . PHE A 1 11  ? -4.065  -8.009  -4.387  1.00 0.00 ? 11  PHE A HE2  4  
ATOM 4857  H HZ   . PHE A 1 11  ? -4.501  -10.273 -3.519  1.00 0.00 ? 11  PHE A HZ   4  
ATOM 4858  N N    . LYS A 1 12  ? -9.233  -7.132  -3.924  1.00 0.00 ? 12  LYS A N    4  
ATOM 4859  C CA   . LYS A 1 12  ? -8.889  -6.655  -2.589  1.00 0.00 ? 12  LYS A CA   4  
ATOM 4860  C C    . LYS A 1 12  ? -7.958  -7.635  -1.884  1.00 0.00 ? 12  LYS A C    4  
ATOM 4861  O O    . LYS A 1 12  ? -8.207  -8.840  -1.868  1.00 0.00 ? 12  LYS A O    4  
ATOM 4862  C CB   . LYS A 1 12  ? -10.157 -6.450  -1.756  1.00 0.00 ? 12  LYS A CB   4  
ATOM 4863  C CG   . LYS A 1 12  ? -9.953  -5.549  -0.550  1.00 0.00 ? 12  LYS A CG   4  
ATOM 4864  C CD   . LYS A 1 12  ? -10.218 -4.092  -0.891  1.00 0.00 ? 12  LYS A CD   4  
ATOM 4865  C CE   . LYS A 1 12  ? -8.954  -3.392  -1.366  1.00 0.00 ? 12  LYS A CE   4  
ATOM 4866  N NZ   . LYS A 1 12  ? -7.809  -3.627  -0.443  1.00 0.00 ? 12  LYS A NZ   4  
ATOM 4867  H H    . LYS A 1 12  ? -9.953  -7.790  -4.025  1.00 0.00 ? 12  LYS A H    4  
ATOM 4868  H HA   . LYS A 1 12  ? -8.382  -5.708  -2.696  1.00 0.00 ? 12  LYS A HA   4  
ATOM 4869  H HB2  . LYS A 1 12  ? -10.918 -6.010  -2.384  1.00 0.00 ? 12  LYS A HB2  4  
ATOM 4870  H HB3  . LYS A 1 12  ? -10.503 -7.412  -1.407  1.00 0.00 ? 12  LYS A HB3  4  
ATOM 4871  H HG2  . LYS A 1 12  ? -10.631 -5.853  0.233   1.00 0.00 ? 12  LYS A HG2  4  
ATOM 4872  H HG3  . LYS A 1 12  ? -8.933  -5.650  -0.206  1.00 0.00 ? 12  LYS A HG3  4  
ATOM 4873  H HD2  . LYS A 1 12  ? -10.959 -4.044  -1.675  1.00 0.00 ? 12  LYS A HD2  4  
ATOM 4874  H HD3  . LYS A 1 12  ? -10.589 -3.588  -0.010  1.00 0.00 ? 12  LYS A HD3  4  
ATOM 4875  H HE2  . LYS A 1 12  ? -8.697  -3.766  -2.346  1.00 0.00 ? 12  LYS A HE2  4  
ATOM 4876  H HE3  . LYS A 1 12  ? -9.146  -2.331  -1.425  1.00 0.00 ? 12  LYS A HE3  4  
ATOM 4877  H HZ1  . LYS A 1 12  ? -8.158  -3.950  0.483   1.00 0.00 ? 12  LYS A HZ1  4  
ATOM 4878  H HZ2  . LYS A 1 12  ? -7.271  -2.747  -0.310  1.00 0.00 ? 12  LYS A HZ2  4  
ATOM 4879  H HZ3  . LYS A 1 12  ? -7.176  -4.352  -0.835  1.00 0.00 ? 12  LYS A HZ3  4  
ATOM 4880  N N    . TRP A 1 13  ? -6.886  -7.110  -1.301  1.00 0.00 ? 13  TRP A N    4  
ATOM 4881  C CA   . TRP A 1 13  ? -5.918  -7.940  -0.592  1.00 0.00 ? 13  TRP A CA   4  
ATOM 4882  C C    . TRP A 1 13  ? -6.536  -8.546  0.663   1.00 0.00 ? 13  TRP A C    4  
ATOM 4883  O O    . TRP A 1 13  ? -7.542  -8.052  1.172   1.00 0.00 ? 13  TRP A O    4  
ATOM 4884  C CB   . TRP A 1 13  ? -4.684  -7.117  -0.222  1.00 0.00 ? 13  TRP A CB   4  
ATOM 4885  C CG   . TRP A 1 13  ? -3.891  -6.667  -1.411  1.00 0.00 ? 13  TRP A CG   4  
ATOM 4886  C CD1  . TRP A 1 13  ? -3.869  -5.415  -1.956  1.00 0.00 ? 13  TRP A CD1  4  
ATOM 4887  C CD2  . TRP A 1 13  ? -3.007  -7.467  -2.204  1.00 0.00 ? 13  TRP A CD2  4  
ATOM 4888  N NE1  . TRP A 1 13  ? -3.025  -5.388  -3.040  1.00 0.00 ? 13  TRP A NE1  4  
ATOM 4889  C CE2  . TRP A 1 13  ? -2.483  -6.634  -3.212  1.00 0.00 ? 13  TRP A CE2  4  
ATOM 4890  C CE3  . TRP A 1 13  ? -2.605  -8.804  -2.159  1.00 0.00 ? 13  TRP A CE3  4  
ATOM 4891  C CZ2  . TRP A 1 13  ? -1.580  -7.097  -4.165  1.00 0.00 ? 13  TRP A CZ2  4  
ATOM 4892  C CZ3  . TRP A 1 13  ? -1.709  -9.263  -3.107  1.00 0.00 ? 13  TRP A CZ3  4  
ATOM 4893  C CH2  . TRP A 1 13  ? -1.204  -8.411  -4.098  1.00 0.00 ? 13  TRP A CH2  4  
ATOM 4894  H H    . TRP A 1 13  ? -6.742  -6.142  -1.348  1.00 0.00 ? 13  TRP A H    4  
ATOM 4895  H HA   . TRP A 1 13  ? -5.621  -8.740  -1.255  1.00 0.00 ? 13  TRP A HA   4  
ATOM 4896  H HB2  . TRP A 1 13  ? -4.995  -6.238  0.323   1.00 0.00 ? 13  TRP A HB2  4  
ATOM 4897  H HB3  . TRP A 1 13  ? -4.037  -7.714  0.405   1.00 0.00 ? 13  TRP A HB3  4  
ATOM 4898  H HD1  . TRP A 1 13  ? -4.439  -4.579  -1.581  1.00 0.00 ? 13  TRP A HD1  4  
ATOM 4899  H HE1  . TRP A 1 13  ? -2.840  -4.603  -3.597  1.00 0.00 ? 13  TRP A HE1  4  
ATOM 4900  H HE3  . TRP A 1 13  ? -2.983  -9.476  -1.403  1.00 0.00 ? 13  TRP A HE3  4  
ATOM 4901  H HZ2  . TRP A 1 13  ? -1.181  -6.453  -4.936  1.00 0.00 ? 13  TRP A HZ2  4  
ATOM 4902  H HZ3  . TRP A 1 13  ? -1.388  -10.294 -3.088  1.00 0.00 ? 13  TRP A HZ3  4  
ATOM 4903  H HH2  . TRP A 1 13  ? -0.507  -8.812  -4.817  1.00 0.00 ? 13  TRP A HH2  4  
ATOM 4904  N N    . GLY A 1 14  ? -5.928  -9.619  1.159   1.00 0.00 ? 14  GLY A N    4  
ATOM 4905  C CA   . GLY A 1 14  ? -6.433  -10.274 2.351   1.00 0.00 ? 14  GLY A CA   4  
ATOM 4906  C C    . GLY A 1 14  ? -5.702  -9.839  3.606   1.00 0.00 ? 14  GLY A C    4  
ATOM 4907  O O    . GLY A 1 14  ? -4.863  -8.938  3.580   1.00 0.00 ? 14  GLY A O    4  
ATOM 4908  H H    . GLY A 1 14  ? -5.129  -9.969  0.711   1.00 0.00 ? 14  GLY A H    4  
ATOM 4909  H HA2  . GLY A 1 14  ? -7.482  -10.041 2.460   1.00 0.00 ? 14  GLY A HA2  4  
ATOM 4910  H HA3  . GLY A 1 14  ? -6.322  -11.342 2.236   1.00 0.00 ? 14  GLY A HA3  4  
ATOM 4911  N N    . PRO A 1 15  ? -6.021  -10.486 4.736   1.00 0.00 ? 15  PRO A N    4  
ATOM 4912  C CA   . PRO A 1 15  ? -5.400  -10.177 6.028   1.00 0.00 ? 15  PRO A CA   4  
ATOM 4913  C C    . PRO A 1 15  ? -3.936  -10.600 6.083   1.00 0.00 ? 15  PRO A C    4  
ATOM 4914  O O    . PRO A 1 15  ? -3.080  -9.848  6.547   1.00 0.00 ? 15  PRO A O    4  
ATOM 4915  C CB   . PRO A 1 15  ? -6.230  -10.991 7.024   1.00 0.00 ? 15  PRO A CB   4  
ATOM 4916  C CG   . PRO A 1 15  ? -6.786  -12.117 6.223   1.00 0.00 ? 15  PRO A CG   4  
ATOM 4917  C CD   . PRO A 1 15  ? -7.012  -11.570 4.841   1.00 0.00 ? 15  PRO A CD   4  
ATOM 4918  H HA   . PRO A 1 15  ? -5.479  -9.126  6.265   1.00 0.00 ? 15  PRO A HA   4  
ATOM 4919  H HB2  . PRO A 1 15  ? -5.592  -11.349 7.820   1.00 0.00 ? 15  PRO A HB2  4  
ATOM 4920  H HB3  . PRO A 1 15  ? -7.015  -10.373 7.434   1.00 0.00 ? 15  PRO A HB3  4  
ATOM 4921  H HG2  . PRO A 1 15  ? -6.078  -12.931 6.193   1.00 0.00 ? 15  PRO A HG2  4  
ATOM 4922  H HG3  . PRO A 1 15  ? -7.720  -12.447 6.652   1.00 0.00 ? 15  PRO A HG3  4  
ATOM 4923  H HD2  . PRO A 1 15  ? -6.829  -12.333 4.098   1.00 0.00 ? 15  PRO A HD2  4  
ATOM 4924  H HD3  . PRO A 1 15  ? -8.016  -11.184 4.748   1.00 0.00 ? 15  PRO A HD3  4  
ATOM 4925  N N    . ALA A 1 16  ? -3.656  -11.809 5.607   1.00 0.00 ? 16  ALA A N    4  
ATOM 4926  C CA   . ALA A 1 16  ? -2.295  -12.331 5.600   1.00 0.00 ? 16  ALA A CA   4  
ATOM 4927  C C    . ALA A 1 16  ? -1.493  -11.758 4.436   1.00 0.00 ? 16  ALA A C    4  
ATOM 4928  O O    . ALA A 1 16  ? -0.412  -11.203 4.628   1.00 0.00 ? 16  ALA A O    4  
ATOM 4929  C CB   . ALA A 1 16  ? -2.312  -13.851 5.535   1.00 0.00 ? 16  ALA A CB   4  
ATOM 4930  H H    . ALA A 1 16  ? -4.381  -12.362 5.251   1.00 0.00 ? 16  ALA A H    4  
ATOM 4931  H HA   . ALA A 1 16  ? -1.821  -12.040 6.527   1.00 0.00 ? 16  ALA A HA   4  
ATOM 4932  H HB1  . ALA A 1 16  ? -3.244  -14.217 5.942   1.00 0.00 ? 16  ALA A HB1  4  
ATOM 4933  H HB2  . ALA A 1 16  ? -2.219  -14.168 4.507   1.00 0.00 ? 16  ALA A HB2  4  
ATOM 4934  H HB3  . ALA A 1 16  ? -1.488  -14.245 6.110   1.00 0.00 ? 16  ALA A HB3  4  
ATOM 4935  N N    . SER A 1 17  ? -2.031  -11.898 3.228   1.00 0.00 ? 17  SER A N    4  
ATOM 4936  C CA   . SER A 1 17  ? -1.363  -11.399 2.032   1.00 0.00 ? 17  SER A CA   4  
ATOM 4937  C C    . SER A 1 17  ? -0.805  -9.998  2.266   1.00 0.00 ? 17  SER A C    4  
ATOM 4938  O O    . SER A 1 17  ? 0.395   -9.765  2.122   1.00 0.00 ? 17  SER A O    4  
ATOM 4939  C CB   . SER A 1 17  ? -2.333  -11.383 0.850   1.00 0.00 ? 17  SER A CB   4  
ATOM 4940  O OG   . SER A 1 17  ? -2.496  -12.682 0.306   1.00 0.00 ? 17  SER A OG   4  
ATOM 4941  H H    . SER A 1 17  ? -2.896  -12.351 3.140   1.00 0.00 ? 17  SER A H    4  
ATOM 4942  H HA   . SER A 1 17  ? -0.544  -12.066 1.806   1.00 0.00 ? 17  SER A HA   4  
ATOM 4943  H HB2  . SER A 1 17  ? -3.295  -11.022 1.181   1.00 0.00 ? 17  SER A HB2  4  
ATOM 4944  H HB3  . SER A 1 17  ? -1.948  -10.729 0.080   1.00 0.00 ? 17  SER A HB3  4  
ATOM 4945  H HG   . SER A 1 17  ? -1.728  -13.216 0.518   1.00 0.00 ? 17  SER A HG   4  
ATOM 4946  N N    . GLN A 1 18  ? -1.686  -9.070  2.627   1.00 0.00 ? 18  GLN A N    4  
ATOM 4947  C CA   . GLN A 1 18  ? -1.282  -7.692  2.880   1.00 0.00 ? 18  GLN A CA   4  
ATOM 4948  C C    . GLN A 1 18  ? -0.023  -7.643  3.739   1.00 0.00 ? 18  GLN A C    4  
ATOM 4949  O O    . GLN A 1 18  ? 0.988   -7.065  3.341   1.00 0.00 ? 18  GLN A O    4  
ATOM 4950  C CB   . GLN A 1 18  ? -2.413  -6.925  3.567   1.00 0.00 ? 18  GLN A CB   4  
ATOM 4951  C CG   . GLN A 1 18  ? -3.466  -6.402  2.604   1.00 0.00 ? 18  GLN A CG   4  
ATOM 4952  C CD   . GLN A 1 18  ? -4.233  -5.220  3.163   1.00 0.00 ? 18  GLN A CD   4  
ATOM 4953  O OE1  . GLN A 1 18  ? -3.713  -4.457  3.977   1.00 0.00 ? 18  GLN A OE1  4  
ATOM 4954  N NE2  . GLN A 1 18  ? -5.477  -5.061  2.727   1.00 0.00 ? 18  GLN A NE2  4  
ATOM 4955  H H    . GLN A 1 18  ? -2.628  -9.318  2.725   1.00 0.00 ? 18  GLN A H    4  
ATOM 4956  H HA   . GLN A 1 18  ? -1.071  -7.229  1.928   1.00 0.00 ? 18  GLN A HA   4  
ATOM 4957  H HB2  . GLN A 1 18  ? -2.898  -7.580  4.276   1.00 0.00 ? 18  GLN A HB2  4  
ATOM 4958  H HB3  . GLN A 1 18  ? -1.992  -6.083  4.096   1.00 0.00 ? 18  GLN A HB3  4  
ATOM 4959  H HG2  . GLN A 1 18  ? -2.980  -6.096  1.690   1.00 0.00 ? 18  GLN A HG2  4  
ATOM 4960  H HG3  . GLN A 1 18  ? -4.165  -7.197  2.389   1.00 0.00 ? 18  GLN A HG3  4  
ATOM 4961  H HE21 . GLN A 1 18  ? -5.826  -5.709  2.079   1.00 0.00 ? 18  GLN A HE21 4  
ATOM 4962  H HE22 . GLN A 1 18  ? -5.996  -4.306  3.072   1.00 0.00 ? 18  GLN A HE22 4  
ATOM 4963  N N    . GLN A 1 19  ? -0.093  -8.252  4.918   1.00 0.00 ? 19  GLN A N    4  
ATOM 4964  C CA   . GLN A 1 19  ? 1.041   -8.275  5.834   1.00 0.00 ? 19  GLN A CA   4  
ATOM 4965  C C    . GLN A 1 19  ? 2.324   -8.657  5.102   1.00 0.00 ? 19  GLN A C    4  
ATOM 4966  O O    . GLN A 1 19  ? 3.369   -8.036  5.296   1.00 0.00 ? 19  GLN A O    4  
ATOM 4967  C CB   . GLN A 1 19  ? 0.781   -9.258  6.977   1.00 0.00 ? 19  GLN A CB   4  
ATOM 4968  C CG   . GLN A 1 19  ? -0.405  -8.876  7.849   1.00 0.00 ? 19  GLN A CG   4  
ATOM 4969  C CD   . GLN A 1 19  ? -0.171  -7.594  8.623   1.00 0.00 ? 19  GLN A CD   4  
ATOM 4970  O OE1  . GLN A 1 19  ? -0.311  -6.496  8.084   1.00 0.00 ? 19  GLN A OE1  4  
ATOM 4971  N NE2  . GLN A 1 19  ? 0.187   -7.727  9.895   1.00 0.00 ? 19  GLN A NE2  4  
ATOM 4972  H H    . GLN A 1 19  ? -0.927  -8.694  5.179   1.00 0.00 ? 19  GLN A H    4  
ATOM 4973  H HA   . GLN A 1 19  ? 1.157   -7.284  6.244   1.00 0.00 ? 19  GLN A HA   4  
ATOM 4974  H HB2  . GLN A 1 19  ? 0.594   -10.236 6.560   1.00 0.00 ? 19  GLN A HB2  4  
ATOM 4975  H HB3  . GLN A 1 19  ? 1.660   -9.305  7.603   1.00 0.00 ? 19  GLN A HB3  4  
ATOM 4976  H HG2  . GLN A 1 19  ? -1.271  -8.745  7.218   1.00 0.00 ? 19  GLN A HG2  4  
ATOM 4977  H HG3  . GLN A 1 19  ? -0.590  -9.676  8.551   1.00 0.00 ? 19  GLN A HG3  4  
ATOM 4978  H HE21 . GLN A 1 19  ? 0.280   -8.634  10.257  1.00 0.00 ? 19  GLN A HE21 4  
ATOM 4979  H HE22 . GLN A 1 19  ? 0.345   -6.915  10.419  1.00 0.00 ? 19  GLN A HE22 4  
ATOM 4980  N N    . ILE A 1 20  ? 2.236   -9.682  4.261   1.00 0.00 ? 20  ILE A N    4  
ATOM 4981  C CA   . ILE A 1 20  ? 3.390   -10.146 3.500   1.00 0.00 ? 20  ILE A CA   4  
ATOM 4982  C C    . ILE A 1 20  ? 3.960   -9.029  2.632   1.00 0.00 ? 20  ILE A C    4  
ATOM 4983  O O    . ILE A 1 20  ? 5.177   -8.882  2.511   1.00 0.00 ? 20  ILE A O    4  
ATOM 4984  C CB   . ILE A 1 20  ? 3.027   -11.344 2.602   1.00 0.00 ? 20  ILE A CB   4  
ATOM 4985  C CG1  . ILE A 1 20  ? 2.488   -12.498 3.449   1.00 0.00 ? 20  ILE A CG1  4  
ATOM 4986  C CG2  . ILE A 1 20  ? 4.240   -11.790 1.800   1.00 0.00 ? 20  ILE A CG2  4  
ATOM 4987  C CD1  . ILE A 1 20  ? 1.489   -13.368 2.719   1.00 0.00 ? 20  ILE A CD1  4  
ATOM 4988  H H    . ILE A 1 20  ? 1.376   -10.137 4.149   1.00 0.00 ? 20  ILE A H    4  
ATOM 4989  H HA   . ILE A 1 20  ? 4.146   -10.464 4.202   1.00 0.00 ? 20  ILE A HA   4  
ATOM 4990  H HB   . ILE A 1 20  ? 2.263   -11.028 1.909   1.00 0.00 ? 20  ILE A HB   4  
ATOM 4991  H HG12 . ILE A 1 20  ? 3.309   -13.125 3.757   1.00 0.00 ? 20  ILE A HG12 4  
ATOM 4992  H HG13 . ILE A 1 20  ? 2.000   -12.095 4.325   1.00 0.00 ? 20  ILE A HG13 4  
ATOM 4993  H HG21 . ILE A 1 20  ? 3.980   -12.652 1.204   1.00 0.00 ? 20  ILE A HG21 4  
ATOM 4994  H HG22 . ILE A 1 20  ? 4.557   -10.988 1.151   1.00 0.00 ? 20  ILE A HG22 4  
ATOM 4995  H HG23 . ILE A 1 20  ? 5.043   -12.048 2.474   1.00 0.00 ? 20  ILE A HG23 4  
ATOM 4996  H HD11 . ILE A 1 20  ? 1.793   -14.402 2.787   1.00 0.00 ? 20  ILE A HD11 4  
ATOM 4997  H HD12 . ILE A 1 20  ? 0.513   -13.249 3.165   1.00 0.00 ? 20  ILE A HD12 4  
ATOM 4998  H HD13 . ILE A 1 20  ? 1.448   -13.074 1.680   1.00 0.00 ? 20  ILE A HD13 4  
ATOM 4999  N N    . LEU A 1 21  ? 3.074   -8.243  2.031   1.00 0.00 ? 21  LEU A N    4  
ATOM 5000  C CA   . LEU A 1 21  ? 3.489   -7.137  1.175   1.00 0.00 ? 21  LEU A CA   4  
ATOM 5001  C C    . LEU A 1 21  ? 4.302   -6.115  1.962   1.00 0.00 ? 21  LEU A C    4  
ATOM 5002  O O    . LEU A 1 21  ? 5.284   -5.569  1.460   1.00 0.00 ? 21  LEU A O    4  
ATOM 5003  C CB   . LEU A 1 21  ? 2.266   -6.463  0.551   1.00 0.00 ? 21  LEU A CB   4  
ATOM 5004  C CG   . LEU A 1 21  ? 1.245   -7.395  -0.103  1.00 0.00 ? 21  LEU A CG   4  
ATOM 5005  C CD1  . LEU A 1 21  ? 0.103   -6.595  -0.709  1.00 0.00 ? 21  LEU A CD1  4  
ATOM 5006  C CD2  . LEU A 1 21  ? 1.914   -8.260  -1.161  1.00 0.00 ? 21  LEU A CD2  4  
ATOM 5007  H H    . LEU A 1 21  ? 2.118   -8.410  2.165   1.00 0.00 ? 21  LEU A H    4  
ATOM 5008  H HA   . LEU A 1 21  ? 4.107   -7.542  0.387   1.00 0.00 ? 21  LEU A HA   4  
ATOM 5009  H HB2  . LEU A 1 21  ? 1.759   -5.912  1.329   1.00 0.00 ? 21  LEU A HB2  4  
ATOM 5010  H HB3  . LEU A 1 21  ? 2.618   -5.774  -0.204  1.00 0.00 ? 21  LEU A HB3  4  
ATOM 5011  H HG   . LEU A 1 21  ? 0.830   -8.049  0.652   1.00 0.00 ? 21  LEU A HG   4  
ATOM 5012  H HD11 . LEU A 1 21  ? 0.502   -5.847  -1.377  1.00 0.00 ? 21  LEU A HD11 4  
ATOM 5013  H HD12 . LEU A 1 21  ? -0.456  -6.112  0.078   1.00 0.00 ? 21  LEU A HD12 4  
ATOM 5014  H HD13 . LEU A 1 21  ? -0.549  -7.258  -1.258  1.00 0.00 ? 21  LEU A HD13 4  
ATOM 5015  H HD21 . LEU A 1 21  ? 1.299   -9.125  -1.359  1.00 0.00 ? 21  LEU A HD21 4  
ATOM 5016  H HD22 . LEU A 1 21  ? 2.882   -8.580  -0.804  1.00 0.00 ? 21  LEU A HD22 4  
ATOM 5017  H HD23 . LEU A 1 21  ? 2.035   -7.688  -2.069  1.00 0.00 ? 21  LEU A HD23 4  
ATOM 5018  N N    . TYR A 1 22  ? 3.887   -5.862  3.198   1.00 0.00 ? 22  TYR A N    4  
ATOM 5019  C CA   . TYR A 1 22  ? 4.576   -4.905  4.055   1.00 0.00 ? 22  TYR A CA   4  
ATOM 5020  C C    . TYR A 1 22  ? 5.968   -5.409  4.426   1.00 0.00 ? 22  TYR A C    4  
ATOM 5021  O O    . TYR A 1 22  ? 6.952   -4.679  4.319   1.00 0.00 ? 22  TYR A O    4  
ATOM 5022  C CB   . TYR A 1 22  ? 3.761   -4.645  5.323   1.00 0.00 ? 22  TYR A CB   4  
ATOM 5023  C CG   . TYR A 1 22  ? 2.463   -3.913  5.069   1.00 0.00 ? 22  TYR A CG   4  
ATOM 5024  C CD1  . TYR A 1 22  ? 2.434   -2.528  4.955   1.00 0.00 ? 22  TYR A CD1  4  
ATOM 5025  C CD2  . TYR A 1 22  ? 1.265   -4.605  4.945   1.00 0.00 ? 22  TYR A CD2  4  
ATOM 5026  C CE1  . TYR A 1 22  ? 1.250   -1.855  4.723   1.00 0.00 ? 22  TYR A CE1  4  
ATOM 5027  C CE2  . TYR A 1 22  ? 0.076   -3.941  4.712   1.00 0.00 ? 22  TYR A CE2  4  
ATOM 5028  C CZ   . TYR A 1 22  ? 0.074   -2.566  4.602   1.00 0.00 ? 22  TYR A CZ   4  
ATOM 5029  O OH   . TYR A 1 22  ? -1.108  -1.900  4.372   1.00 0.00 ? 22  TYR A OH   4  
ATOM 5030  H H    . TYR A 1 22  ? 3.097   -6.329  3.542   1.00 0.00 ? 22  TYR A H    4  
ATOM 5031  H HA   . TYR A 1 22  ? 4.675   -3.980  3.507   1.00 0.00 ? 22  TYR A HA   4  
ATOM 5032  H HB2  . TYR A 1 22  ? 3.524   -5.588  5.790   1.00 0.00 ? 22  TYR A HB2  4  
ATOM 5033  H HB3  . TYR A 1 22  ? 4.350   -4.049  6.006   1.00 0.00 ? 22  TYR A HB3  4  
ATOM 5034  H HD1  . TYR A 1 22  ? 3.357   -1.975  5.050   1.00 0.00 ? 22  TYR A HD1  4  
ATOM 5035  H HD2  . TYR A 1 22  ? 1.270   -5.682  5.032   1.00 0.00 ? 22  TYR A HD2  4  
ATOM 5036  H HE1  . TYR A 1 22  ? 1.248   -0.779  4.637   1.00 0.00 ? 22  TYR A HE1  4  
ATOM 5037  H HE2  . TYR A 1 22  ? -0.845  -4.497  4.618   1.00 0.00 ? 22  TYR A HE2  4  
ATOM 5038  H HH   . TYR A 1 22  ? -1.821  -2.537  4.279   1.00 0.00 ? 22  TYR A HH   4  
ATOM 5039  N N    . GLN A 1 23  ? 6.039   -6.663  4.861   1.00 0.00 ? 23  GLN A N    4  
ATOM 5040  C CA   . GLN A 1 23  ? 7.309   -7.265  5.248   1.00 0.00 ? 23  GLN A CA   4  
ATOM 5041  C C    . GLN A 1 23  ? 8.315   -7.198  4.103   1.00 0.00 ? 23  GLN A C    4  
ATOM 5042  O O    . GLN A 1 23  ? 9.517   -7.058  4.327   1.00 0.00 ? 23  GLN A O    4  
ATOM 5043  C CB   . GLN A 1 23  ? 7.099   -8.720  5.672   1.00 0.00 ? 23  GLN A CB   4  
ATOM 5044  C CG   . GLN A 1 23  ? 6.812   -8.885  7.156   1.00 0.00 ? 23  GLN A CG   4  
ATOM 5045  C CD   . GLN A 1 23  ? 8.074   -8.903  7.996   1.00 0.00 ? 23  GLN A CD   4  
ATOM 5046  O OE1  . GLN A 1 23  ? 9.170   -8.648  7.496   1.00 0.00 ? 23  GLN A OE1  4  
ATOM 5047  N NE2  . GLN A 1 23  ? 7.926   -9.206  9.281   1.00 0.00 ? 23  GLN A NE2  4  
ATOM 5048  H H    . GLN A 1 23  ? 5.219   -7.194  4.924   1.00 0.00 ? 23  GLN A H    4  
ATOM 5049  H HA   . GLN A 1 23  ? 7.699   -6.708  6.086   1.00 0.00 ? 23  GLN A HA   4  
ATOM 5050  H HB2  . GLN A 1 23  ? 6.267   -9.128  5.119   1.00 0.00 ? 23  GLN A HB2  4  
ATOM 5051  H HB3  . GLN A 1 23  ? 7.990   -9.284  5.436   1.00 0.00 ? 23  GLN A HB3  4  
ATOM 5052  H HG2  . GLN A 1 23  ? 6.193   -8.063  7.484   1.00 0.00 ? 23  GLN A HG2  4  
ATOM 5053  H HG3  . GLN A 1 23  ? 6.284   -9.815  7.306   1.00 0.00 ? 23  GLN A HG3  4  
ATOM 5054  H HE21 . GLN A 1 23  ? 7.023   -9.399  9.609   1.00 0.00 ? 23  GLN A HE21 4  
ATOM 5055  H HE22 . GLN A 1 23  ? 8.725   -9.226  9.847   1.00 0.00 ? 23  GLN A HE22 4  
ATOM 5056  N N    . ALA A 1 24  ? 7.814   -7.298  2.876   1.00 0.00 ? 24  ALA A N    4  
ATOM 5057  C CA   . ALA A 1 24  ? 8.669   -7.247  1.696   1.00 0.00 ? 24  ALA A CA   4  
ATOM 5058  C C    . ALA A 1 24  ? 9.033   -5.808  1.345   1.00 0.00 ? 24  ALA A C    4  
ATOM 5059  O O    . ALA A 1 24  ? 10.183  -5.511  1.021   1.00 0.00 ? 24  ALA A O    4  
ATOM 5060  C CB   . ALA A 1 24  ? 7.983   -7.922  0.518   1.00 0.00 ? 24  ALA A CB   4  
ATOM 5061  H H    . ALA A 1 24  ? 6.847   -7.408  2.761   1.00 0.00 ? 24  ALA A H    4  
ATOM 5062  H HA   . ALA A 1 24  ? 9.574   -7.794  1.916   1.00 0.00 ? 24  ALA A HA   4  
ATOM 5063  H HB1  . ALA A 1 24  ? 8.501   -8.840  0.279   1.00 0.00 ? 24  ALA A HB1  4  
ATOM 5064  H HB2  . ALA A 1 24  ? 6.958   -8.144  0.777   1.00 0.00 ? 24  ALA A HB2  4  
ATOM 5065  H HB3  . ALA A 1 24  ? 8.004   -7.263  -0.337  1.00 0.00 ? 24  ALA A HB3  4  
ATOM 5066  N N    . TYR A 1 25  ? 8.047   -4.921  1.410   1.00 0.00 ? 25  TYR A N    4  
ATOM 5067  C CA   . TYR A 1 25  ? 8.264   -3.513  1.095   1.00 0.00 ? 25  TYR A CA   4  
ATOM 5068  C C    . TYR A 1 25  ? 9.231   -2.876  2.088   1.00 0.00 ? 25  TYR A C    4  
ATOM 5069  O O    . TYR A 1 25  ? 10.026  -2.007  1.727   1.00 0.00 ? 25  TYR A O    4  
ATOM 5070  C CB   . TYR A 1 25  ? 6.935   -2.757  1.104   1.00 0.00 ? 25  TYR A CB   4  
ATOM 5071  C CG   . TYR A 1 25  ? 7.033   -1.354  0.547   1.00 0.00 ? 25  TYR A CG   4  
ATOM 5072  C CD1  . TYR A 1 25  ? 7.729   -0.363  1.227   1.00 0.00 ? 25  TYR A CD1  4  
ATOM 5073  C CD2  . TYR A 1 25  ? 6.429   -1.021  -0.659  1.00 0.00 ? 25  TYR A CD2  4  
ATOM 5074  C CE1  . TYR A 1 25  ? 7.821   0.920   0.722   1.00 0.00 ? 25  TYR A CE1  4  
ATOM 5075  C CE2  . TYR A 1 25  ? 6.516   0.259   -1.172  1.00 0.00 ? 25  TYR A CE2  4  
ATOM 5076  C CZ   . TYR A 1 25  ? 7.213   1.226   -0.478  1.00 0.00 ? 25  TYR A CZ   4  
ATOM 5077  O OH   . TYR A 1 25  ? 7.302   2.502   -0.984  1.00 0.00 ? 25  TYR A OH   4  
ATOM 5078  H H    . TYR A 1 25  ? 7.152   -5.218  1.674   1.00 0.00 ? 25  TYR A H    4  
ATOM 5079  H HA   . TYR A 1 25  ? 8.693   -3.457  0.105   1.00 0.00 ? 25  TYR A HA   4  
ATOM 5080  H HB2  . TYR A 1 25  ? 6.216   -3.299  0.510   1.00 0.00 ? 25  TYR A HB2  4  
ATOM 5081  H HB3  . TYR A 1 25  ? 6.575   -2.686  2.120   1.00 0.00 ? 25  TYR A HB3  4  
ATOM 5082  H HD1  . TYR A 1 25  ? 8.204   -0.605  2.167   1.00 0.00 ? 25  TYR A HD1  4  
ATOM 5083  H HD2  . TYR A 1 25  ? 5.883   -1.780  -1.200  1.00 0.00 ? 25  TYR A HD2  4  
ATOM 5084  H HE1  . TYR A 1 25  ? 8.366   1.677   1.266   1.00 0.00 ? 25  TYR A HE1  4  
ATOM 5085  H HE2  . TYR A 1 25  ? 6.040   0.499   -2.111  1.00 0.00 ? 25  TYR A HE2  4  
ATOM 5086  H HH   . TYR A 1 25  ? 6.698   3.078   -0.508  1.00 0.00 ? 25  TYR A HH   4  
ATOM 5087  N N    . ASP A 1 26  ? 9.158   -3.315  3.340   1.00 0.00 ? 26  ASP A N    4  
ATOM 5088  C CA   . ASP A 1 26  ? 10.028  -2.789  4.386   1.00 0.00 ? 26  ASP A CA   4  
ATOM 5089  C C    . ASP A 1 26  ? 11.496  -2.988  4.023   1.00 0.00 ? 26  ASP A C    4  
ATOM 5090  O O    . ASP A 1 26  ? 12.328  -2.113  4.260   1.00 0.00 ? 26  ASP A O    4  
ATOM 5091  C CB   . ASP A 1 26  ? 9.723   -3.470  5.721   1.00 0.00 ? 26  ASP A CB   4  
ATOM 5092  C CG   . ASP A 1 26  ? 10.014  -2.573  6.908   1.00 0.00 ? 26  ASP A CG   4  
ATOM 5093  O OD1  . ASP A 1 26  ? 9.714   -1.363  6.826   1.00 0.00 ? 26  ASP A OD1  4  
ATOM 5094  O OD2  . ASP A 1 26  ? 10.541  -3.080  7.920   1.00 0.00 ? 26  ASP A OD2  4  
ATOM 5095  H H    . ASP A 1 26  ? 8.504   -4.009  3.565   1.00 0.00 ? 26  ASP A H    4  
ATOM 5096  H HA   . ASP A 1 26  ? 9.833   -1.732  4.479   1.00 0.00 ? 26  ASP A HA   4  
ATOM 5097  H HB2  . ASP A 1 26  ? 8.678   -3.743  5.749   1.00 0.00 ? 26  ASP A HB2  4  
ATOM 5098  H HB3  . ASP A 1 26  ? 10.326  -4.361  5.810   1.00 0.00 ? 26  ASP A HB3  4  
ATOM 5099  N N    . ARG A 1 27  ? 11.807  -4.146  3.448   1.00 0.00 ? 27  ARG A N    4  
ATOM 5100  C CA   . ARG A 1 27  ? 13.175  -4.460  3.055   1.00 0.00 ? 27  ARG A CA   4  
ATOM 5101  C C    . ARG A 1 27  ? 13.560  -3.713  1.781   1.00 0.00 ? 27  ARG A C    4  
ATOM 5102  O O    . ARG A 1 27  ? 14.614  -3.082  1.716   1.00 0.00 ? 27  ARG A O    4  
ATOM 5103  C CB   . ARG A 1 27  ? 13.333  -5.967  2.843   1.00 0.00 ? 27  ARG A CB   4  
ATOM 5104  C CG   . ARG A 1 27  ? 12.859  -6.801  4.022   1.00 0.00 ? 27  ARG A CG   4  
ATOM 5105  C CD   . ARG A 1 27  ? 13.173  -8.276  3.822   1.00 0.00 ? 27  ARG A CD   4  
ATOM 5106  N NE   . ARG A 1 27  ? 13.301  -8.985  5.093   1.00 0.00 ? 27  ARG A NE   4  
ATOM 5107  C CZ   . ARG A 1 27  ? 13.580  -10.280 5.187   1.00 0.00 ? 27  ARG A CZ   4  
ATOM 5108  N NH1  . ARG A 1 27  ? 13.761  -11.004 4.091   1.00 0.00 ? 27  ARG A NH1  4  
ATOM 5109  N NH2  . ARG A 1 27  ? 13.681  -10.853 6.379   1.00 0.00 ? 27  ARG A NH2  4  
ATOM 5110  H H    . ARG A 1 27  ? 11.099  -4.804  3.285   1.00 0.00 ? 27  ARG A H    4  
ATOM 5111  H HA   . ARG A 1 27  ? 13.830  -4.147  3.854   1.00 0.00 ? 27  ARG A HA   4  
ATOM 5112  H HB2  . ARG A 1 27  ? 12.764  -6.258  1.972   1.00 0.00 ? 27  ARG A HB2  4  
ATOM 5113  H HB3  . ARG A 1 27  ? 14.376  -6.186  2.671   1.00 0.00 ? 27  ARG A HB3  4  
ATOM 5114  H HG2  . ARG A 1 27  ? 13.356  -6.457  4.917   1.00 0.00 ? 27  ARG A HG2  4  
ATOM 5115  H HG3  . ARG A 1 27  ? 11.792  -6.680  4.130   1.00 0.00 ? 27  ARG A HG3  4  
ATOM 5116  H HD2  . ARG A 1 27  ? 12.375  -8.725  3.250   1.00 0.00 ? 27  ARG A HD2  4  
ATOM 5117  H HD3  . ARG A 1 27  ? 14.100  -8.362  3.277   1.00 0.00 ? 27  ARG A HD3  4  
ATOM 5118  H HE   . ARG A 1 27  ? 13.172  -8.469  5.916   1.00 0.00 ? 27  ARG A HE   4  
ATOM 5119  H HH11 . ARG A 1 27  ? 13.686  -10.574 3.191   1.00 0.00 ? 27  ARG A HH11 4  
ATOM 5120  H HH12 . ARG A 1 27  ? 13.972  -11.979 4.164   1.00 0.00 ? 27  ARG A HH12 4  
ATOM 5121  H HH21 . ARG A 1 27  ? 13.546  -10.311 7.208   1.00 0.00 ? 27  ARG A HH21 4  
ATOM 5122  H HH22 . ARG A 1 27  ? 13.891  -11.828 6.449   1.00 0.00 ? 27  ARG A HH22 4  
ATOM 5123  N N    . GLN A 1 28  ? 12.698  -3.791  0.772   1.00 0.00 ? 28  GLN A N    4  
ATOM 5124  C CA   . GLN A 1 28  ? 12.949  -3.123  -0.499  1.00 0.00 ? 28  GLN A CA   4  
ATOM 5125  C C    . GLN A 1 28  ? 11.736  -2.309  -0.936  1.00 0.00 ? 28  GLN A C    4  
ATOM 5126  O O    . GLN A 1 28  ? 10.593  -2.711  -0.715  1.00 0.00 ? 28  GLN A O    4  
ATOM 5127  C CB   . GLN A 1 28  ? 13.305  -4.149  -1.577  1.00 0.00 ? 28  GLN A CB   4  
ATOM 5128  C CG   . GLN A 1 28  ? 13.474  -3.544  -2.961  1.00 0.00 ? 28  GLN A CG   4  
ATOM 5129  C CD   . GLN A 1 28  ? 14.746  -2.731  -3.091  1.00 0.00 ? 28  GLN A CD   4  
ATOM 5130  O OE1  . GLN A 1 28  ? 14.969  -1.780  -2.341  1.00 0.00 ? 28  GLN A OE1  4  
ATOM 5131  N NE2  . GLN A 1 28  ? 15.591  -3.101  -4.047  1.00 0.00 ? 28  GLN A NE2  4  
ATOM 5132  H H    . GLN A 1 28  ? 11.875  -4.310  0.885   1.00 0.00 ? 28  GLN A H    4  
ATOM 5133  H HA   . GLN A 1 28  ? 13.785  -2.454  -0.363  1.00 0.00 ? 28  GLN A HA   4  
ATOM 5134  H HB2  . GLN A 1 28  ? 14.230  -4.635  -1.304  1.00 0.00 ? 28  GLN A HB2  4  
ATOM 5135  H HB3  . GLN A 1 28  ? 12.520  -4.889  -1.625  1.00 0.00 ? 28  GLN A HB3  4  
ATOM 5136  H HG2  . GLN A 1 28  ? 13.499  -4.342  -3.688  1.00 0.00 ? 28  GLN A HG2  4  
ATOM 5137  H HG3  . GLN A 1 28  ? 12.630  -2.901  -3.164  1.00 0.00 ? 28  GLN A HG3  4  
ATOM 5138  H HE21 . GLN A 1 28  ? 15.347  -3.867  -4.608  1.00 0.00 ? 28  GLN A HE21 4  
ATOM 5139  H HE22 . GLN A 1 28  ? 16.421  -2.593  -4.154  1.00 0.00 ? 28  GLN A HE22 4  
ATOM 5140  N N    . LYS A 1 29  ? 11.991  -1.163  -1.557  1.00 0.00 ? 29  LYS A N    4  
ATOM 5141  C CA   . LYS A 1 29  ? 10.920  -0.292  -2.026  1.00 0.00 ? 29  LYS A CA   4  
ATOM 5142  C C    . LYS A 1 29  ? 10.501  -0.660  -3.445  1.00 0.00 ? 29  LYS A C    4  
ATOM 5143  O O    . LYS A 1 29  ? 9.325   -0.579  -3.796  1.00 0.00 ? 29  LYS A O    4  
ATOM 5144  C CB   . LYS A 1 29  ? 11.367  1.171   -1.979  1.00 0.00 ? 29  LYS A CB   4  
ATOM 5145  C CG   . LYS A 1 29  ? 12.004  1.570   -0.659  1.00 0.00 ? 29  LYS A CG   4  
ATOM 5146  C CD   . LYS A 1 29  ? 10.959  2.006   0.355   1.00 0.00 ? 29  LYS A CD   4  
ATOM 5147  C CE   . LYS A 1 29  ? 11.452  1.812   1.781   1.00 0.00 ? 29  LYS A CE   4  
ATOM 5148  N NZ   . LYS A 1 29  ? 10.325  1.652   2.741   1.00 0.00 ? 29  LYS A NZ   4  
ATOM 5149  H H    . LYS A 1 29  ? 12.923  -0.896  -1.704  1.00 0.00 ? 29  LYS A H    4  
ATOM 5150  H HA   . LYS A 1 29  ? 10.074  -0.422  -1.368  1.00 0.00 ? 29  LYS A HA   4  
ATOM 5151  H HB2  . LYS A 1 29  ? 12.085  1.341   -2.767  1.00 0.00 ? 29  LYS A HB2  4  
ATOM 5152  H HB3  . LYS A 1 29  ? 10.507  1.804   -2.145  1.00 0.00 ? 29  LYS A HB3  4  
ATOM 5153  H HG2  . LYS A 1 29  ? 12.546  0.725   -0.261  1.00 0.00 ? 29  LYS A HG2  4  
ATOM 5154  H HG3  . LYS A 1 29  ? 12.687  2.389   -0.832  1.00 0.00 ? 29  LYS A HG3  4  
ATOM 5155  H HD2  . LYS A 1 29  ? 10.735  3.051   0.203   1.00 0.00 ? 29  LYS A HD2  4  
ATOM 5156  H HD3  . LYS A 1 29  ? 10.063  1.419   0.210   1.00 0.00 ? 29  LYS A HD3  4  
ATOM 5157  H HE2  . LYS A 1 29  ? 12.072  0.929   1.817   1.00 0.00 ? 29  LYS A HE2  4  
ATOM 5158  H HE3  . LYS A 1 29  ? 12.036  2.674   2.066   1.00 0.00 ? 29  LYS A HE3  4  
ATOM 5159  H HZ1  . LYS A 1 29  ? 10.689  1.390   3.679   1.00 0.00 ? 29  LYS A HZ1  4  
ATOM 5160  H HZ2  . LYS A 1 29  ? 9.679   0.906   2.412   1.00 0.00 ? 29  LYS A HZ2  4  
ATOM 5161  H HZ3  . LYS A 1 29  ? 9.795   2.543   2.823   1.00 0.00 ? 29  LYS A HZ3  4  
ATOM 5162  N N    . ASN A 1 30  ? 11.471  -1.067  -4.257  1.00 0.00 ? 30  ASN A N    4  
ATOM 5163  C CA   . ASN A 1 30  ? 11.202  -1.450  -5.639  1.00 0.00 ? 30  ASN A CA   4  
ATOM 5164  C C    . ASN A 1 30  ? 11.539  -2.919  -5.872  1.00 0.00 ? 30  ASN A C    4  
ATOM 5165  O O    . ASN A 1 30  ? 12.631  -3.268  -6.323  1.00 0.00 ? 30  ASN A O    4  
ATOM 5166  C CB   . ASN A 1 30  ? 12.007  -0.572  -6.599  1.00 0.00 ? 30  ASN A CB   4  
ATOM 5167  C CG   . ASN A 1 30  ? 13.476  -0.506  -6.228  1.00 0.00 ? 30  ASN A CG   4  
ATOM 5168  O OD1  . ASN A 1 30  ? 14.314  -1.164  -6.846  1.00 0.00 ? 30  ASN A OD1  4  
ATOM 5169  N ND2  . ASN A 1 30  ? 13.795  0.291   -5.215  1.00 0.00 ? 30  ASN A ND2  4  
ATOM 5170  H H    . ASN A 1 30  ? 12.390  -1.111  -3.920  1.00 0.00 ? 30  ASN A H    4  
ATOM 5171  H HA   . ASN A 1 30  ? 10.149  -1.300  -5.825  1.00 0.00 ? 30  ASN A HA   4  
ATOM 5172  H HB2  . ASN A 1 30  ? 11.926  -0.973  -7.598  1.00 0.00 ? 30  ASN A HB2  4  
ATOM 5173  H HB3  . ASN A 1 30  ? 11.605  0.430   -6.584  1.00 0.00 ? 30  ASN A HB3  4  
ATOM 5174  H HD21 . ASN A 1 30  ? 13.076  0.784   -4.769  1.00 0.00 ? 30  ASN A HD21 4  
ATOM 5175  H HD22 . ASN A 1 30  ? 14.738  0.353   -4.955  1.00 0.00 ? 30  ASN A HD22 4  
ATOM 5176  N N    . PRO A 1 31  ? 10.580  -3.803  -5.559  1.00 0.00 ? 31  PRO A N    4  
ATOM 5177  C CA   . PRO A 1 31  ? 10.751  -5.249  -5.727  1.00 0.00 ? 31  PRO A CA   4  
ATOM 5178  C C    . PRO A 1 31  ? 10.789  -5.662  -7.194  1.00 0.00 ? 31  PRO A C    4  
ATOM 5179  O O    . PRO A 1 31  ? 9.933   -5.262  -7.983  1.00 0.00 ? 31  PRO A O    4  
ATOM 5180  C CB   . PRO A 1 31  ? 9.516   -5.835  -5.038  1.00 0.00 ? 31  PRO A CB   4  
ATOM 5181  C CG   . PRO A 1 31  ? 8.495   -4.753  -5.108  1.00 0.00 ? 31  PRO A CG   4  
ATOM 5182  C CD   . PRO A 1 31  ? 9.255   -3.459  -5.017  1.00 0.00 ? 31  PRO A CD   4  
ATOM 5183  H HA   . PRO A 1 31  ? 11.643  -5.604  -5.231  1.00 0.00 ? 31  PRO A HA   4  
ATOM 5184  H HB2  . PRO A 1 31  ? 9.192   -6.720  -5.566  1.00 0.00 ? 31  PRO A HB2  4  
ATOM 5185  H HB3  . PRO A 1 31  ? 9.755   -6.086  -4.015  1.00 0.00 ? 31  PRO A HB3  4  
ATOM 5186  H HG2  . PRO A 1 31  ? 7.963   -4.810  -6.045  1.00 0.00 ? 31  PRO A HG2  4  
ATOM 5187  H HG3  . PRO A 1 31  ? 7.808   -4.842  -4.279  1.00 0.00 ? 31  PRO A HG3  4  
ATOM 5188  H HD2  . PRO A 1 31  ? 8.779   -2.698  -5.617  1.00 0.00 ? 31  PRO A HD2  4  
ATOM 5189  H HD3  . PRO A 1 31  ? 9.331   -3.138  -3.988  1.00 0.00 ? 31  PRO A HD3  4  
ATOM 5190  N N    . SER A 1 32  ? 11.786  -6.465  -7.553  1.00 0.00 ? 32  SER A N    4  
ATOM 5191  C CA   . SER A 1 32  ? 11.936  -6.929  -8.927  1.00 0.00 ? 32  SER A CA   4  
ATOM 5192  C C    . SER A 1 32  ? 11.219  -8.260  -9.133  1.00 0.00 ? 32  SER A C    4  
ATOM 5193  O O    . SER A 1 32  ? 10.617  -8.804  -8.207  1.00 0.00 ? 32  SER A O    4  
ATOM 5194  C CB   . SER A 1 32  ? 13.418  -7.075  -9.279  1.00 0.00 ? 32  SER A CB   4  
ATOM 5195  O OG   . SER A 1 32  ? 13.978  -5.828  -9.653  1.00 0.00 ? 32  SER A OG   4  
ATOM 5196  H H    . SER A 1 32  ? 12.437  -6.749  -6.878  1.00 0.00 ? 32  SER A H    4  
ATOM 5197  H HA   . SER A 1 32  ? 11.492  -6.190  -9.577  1.00 0.00 ? 32  SER A HA   4  
ATOM 5198  H HB2  . SER A 1 32  ? 13.953  -7.454  -8.422  1.00 0.00 ? 32  SER A HB2  4  
ATOM 5199  H HB3  . SER A 1 32  ? 13.523  -7.765  -10.104 1.00 0.00 ? 32  SER A HB3  4  
ATOM 5200  H HG   . SER A 1 32  ? 13.673  -5.146  -9.051  1.00 0.00 ? 32  SER A HG   4  
ATOM 5201  N N    . LYS A 1 33  ? 11.289  -8.780  -10.353 1.00 0.00 ? 33  LYS A N    4  
ATOM 5202  C CA   . LYS A 1 33  ? 10.649  -10.048 -10.683 1.00 0.00 ? 33  LYS A CA   4  
ATOM 5203  C C    . LYS A 1 33  ? 10.780  -11.039 -9.531  1.00 0.00 ? 33  LYS A C    4  
ATOM 5204  O O    . LYS A 1 33  ? 9.803   -11.669 -9.129  1.00 0.00 ? 33  LYS A O    4  
ATOM 5205  C CB   . LYS A 1 33  ? 11.266  -10.639 -11.952 1.00 0.00 ? 33  LYS A CB   4  
ATOM 5206  C CG   . LYS A 1 33  ? 10.759  -12.032 -12.283 1.00 0.00 ? 33  LYS A CG   4  
ATOM 5207  C CD   . LYS A 1 33  ? 9.294   -12.012 -12.685 1.00 0.00 ? 33  LYS A CD   4  
ATOM 5208  C CE   . LYS A 1 33  ? 8.922   -13.241 -13.500 1.00 0.00 ? 33  LYS A CE   4  
ATOM 5209  N NZ   . LYS A 1 33  ? 8.755   -14.446 -12.641 1.00 0.00 ? 33  LYS A NZ   4  
ATOM 5210  H H    . LYS A 1 33  ? 11.784  -8.299  -11.050 1.00 0.00 ? 33  LYS A H    4  
ATOM 5211  H HA   . LYS A 1 33  ? 9.601   -9.855  -10.858 1.00 0.00 ? 33  LYS A HA   4  
ATOM 5212  H HB2  . LYS A 1 33  ? 11.039  -9.989  -12.785 1.00 0.00 ? 33  LYS A HB2  4  
ATOM 5213  H HB3  . LYS A 1 33  ? 12.338  -10.689 -11.827 1.00 0.00 ? 33  LYS A HB3  4  
ATOM 5214  H HG2  . LYS A 1 33  ? 11.340  -12.432 -13.101 1.00 0.00 ? 33  LYS A HG2  4  
ATOM 5215  H HG3  . LYS A 1 33  ? 10.875  -12.664 -11.413 1.00 0.00 ? 33  LYS A HG3  4  
ATOM 5216  H HD2  . LYS A 1 33  ? 8.685   -11.988 -11.793 1.00 0.00 ? 33  LYS A HD2  4  
ATOM 5217  H HD3  . LYS A 1 33  ? 9.104   -11.127 -13.277 1.00 0.00 ? 33  LYS A HD3  4  
ATOM 5218  H HE2  . LYS A 1 33  ? 7.995   -13.047 -14.017 1.00 0.00 ? 33  LYS A HE2  4  
ATOM 5219  H HE3  . LYS A 1 33  ? 9.704   -13.429 -14.221 1.00 0.00 ? 33  LYS A HE3  4  
ATOM 5220  H HZ1  . LYS A 1 33  ? 8.766   -15.306 -13.226 1.00 0.00 ? 33  LYS A HZ1  4  
ATOM 5221  H HZ2  . LYS A 1 33  ? 7.850   -14.399 -12.132 1.00 0.00 ? 33  LYS A HZ2  4  
ATOM 5222  H HZ3  . LYS A 1 33  ? 9.528   -14.501 -11.948 1.00 0.00 ? 33  LYS A HZ3  4  
ATOM 5223  N N    . GLU A 1 34  ? 11.994  -11.171 -9.005  1.00 0.00 ? 34  GLU A N    4  
ATOM 5224  C CA   . GLU A 1 34  ? 12.251  -12.086 -7.899  1.00 0.00 ? 34  GLU A CA   4  
ATOM 5225  C C    . GLU A 1 34  ? 11.476  -11.665 -6.654  1.00 0.00 ? 34  GLU A C    4  
ATOM 5226  O O    . GLU A 1 34  ? 10.621  -12.402 -6.165  1.00 0.00 ? 34  GLU A O    4  
ATOM 5227  C CB   . GLU A 1 34  ? 13.748  -12.137 -7.589  1.00 0.00 ? 34  GLU A CB   4  
ATOM 5228  C CG   . GLU A 1 34  ? 14.557  -12.913 -8.615  1.00 0.00 ? 34  GLU A CG   4  
ATOM 5229  C CD   . GLU A 1 34  ? 14.601  -14.400 -8.320  1.00 0.00 ? 34  GLU A CD   4  
ATOM 5230  O OE1  . GLU A 1 34  ? 15.034  -14.770 -7.208  1.00 0.00 ? 34  GLU A OE1  4  
ATOM 5231  O OE2  . GLU A 1 34  ? 14.204  -15.192 -9.199  1.00 0.00 ? 34  GLU A OE2  4  
ATOM 5232  H H    . GLU A 1 34  ? 12.733  -10.641 -9.370  1.00 0.00 ? 34  GLU A H    4  
ATOM 5233  H HA   . GLU A 1 34  ? 11.921  -13.069 -8.199  1.00 0.00 ? 34  GLU A HA   4  
ATOM 5234  H HB2  . GLU A 1 34  ? 14.130  -11.128 -7.548  1.00 0.00 ? 34  GLU A HB2  4  
ATOM 5235  H HB3  . GLU A 1 34  ? 13.888  -12.604 -6.625  1.00 0.00 ? 34  GLU A HB3  4  
ATOM 5236  H HG2  . GLU A 1 34  ? 14.112  -12.769 -9.588  1.00 0.00 ? 34  GLU A HG2  4  
ATOM 5237  H HG3  . GLU A 1 34  ? 15.567  -12.532 -8.622  1.00 0.00 ? 34  GLU A HG3  4  
ATOM 5238  N N    . GLU A 1 35  ? 11.784  -10.475 -6.146  1.00 0.00 ? 35  GLU A N    4  
ATOM 5239  C CA   . GLU A 1 35  ? 11.117  -9.957  -4.957  1.00 0.00 ? 35  GLU A CA   4  
ATOM 5240  C C    . GLU A 1 35  ? 9.601   -10.059 -5.096  1.00 0.00 ? 35  GLU A C    4  
ATOM 5241  O O    . GLU A 1 35  ? 8.955   -10.845 -4.402  1.00 0.00 ? 35  GLU A O    4  
ATOM 5242  C CB   . GLU A 1 35  ? 11.522  -8.502  -4.712  1.00 0.00 ? 35  GLU A CB   4  
ATOM 5243  C CG   . GLU A 1 35  ? 13.025  -8.293  -4.636  1.00 0.00 ? 35  GLU A CG   4  
ATOM 5244  C CD   . GLU A 1 35  ? 13.407  -7.127  -3.745  1.00 0.00 ? 35  GLU A CD   4  
ATOM 5245  O OE1  . GLU A 1 35  ? 12.644  -6.824  -2.804  1.00 0.00 ? 35  GLU A OE1  4  
ATOM 5246  O OE2  . GLU A 1 35  ? 14.469  -6.518  -3.989  1.00 0.00 ? 35  GLU A OE2  4  
ATOM 5247  H H    . GLU A 1 35  ? 12.475  -9.934  -6.581  1.00 0.00 ? 35  GLU A H    4  
ATOM 5248  H HA   . GLU A 1 35  ? 11.431  -10.555 -4.115  1.00 0.00 ? 35  GLU A HA   4  
ATOM 5249  H HB2  . GLU A 1 35  ? 11.134  -7.893  -5.515  1.00 0.00 ? 35  GLU A HB2  4  
ATOM 5250  H HB3  . GLU A 1 35  ? 11.086  -8.173  -3.780  1.00 0.00 ? 35  GLU A HB3  4  
ATOM 5251  H HG2  . GLU A 1 35  ? 13.481  -9.189  -4.245  1.00 0.00 ? 35  GLU A HG2  4  
ATOM 5252  H HG3  . GLU A 1 35  ? 13.400  -8.104  -5.631  1.00 0.00 ? 35  GLU A HG3  4  
ATOM 5253  N N    . ARG A 1 36  ? 9.040   -9.258  -5.996  1.00 0.00 ? 36  ARG A N    4  
ATOM 5254  C CA   . ARG A 1 36  ? 7.600   -9.256  -6.224  1.00 0.00 ? 36  ARG A CA   4  
ATOM 5255  C C    . ARG A 1 36  ? 7.057   -10.681 -6.283  1.00 0.00 ? 36  ARG A C    4  
ATOM 5256  O O    . ARG A 1 36  ? 6.023   -10.986 -5.689  1.00 0.00 ? 36  ARG A O    4  
ATOM 5257  C CB   . ARG A 1 36  ? 7.269   -8.519  -7.523  1.00 0.00 ? 36  ARG A CB   4  
ATOM 5258  C CG   . ARG A 1 36  ? 7.136   -7.015  -7.353  1.00 0.00 ? 36  ARG A CG   4  
ATOM 5259  C CD   . ARG A 1 36  ? 6.180   -6.421  -8.376  1.00 0.00 ? 36  ARG A CD   4  
ATOM 5260  N NE   . ARG A 1 36  ? 6.837   -6.164  -9.654  1.00 0.00 ? 36  ARG A NE   4  
ATOM 5261  C CZ   . ARG A 1 36  ? 7.519   -5.055  -9.921  1.00 0.00 ? 36  ARG A CZ   4  
ATOM 5262  N NH1  . ARG A 1 36  ? 7.633   -4.106  -9.002  1.00 0.00 ? 36  ARG A NH1  4  
ATOM 5263  N NH2  . ARG A 1 36  ? 8.089   -4.895  -11.108 1.00 0.00 ? 36  ARG A NH2  4  
ATOM 5264  H H    . ARG A 1 36  ? 9.607   -8.654  -6.518  1.00 0.00 ? 36  ARG A H    4  
ATOM 5265  H HA   . ARG A 1 36  ? 7.134   -8.740  -5.399  1.00 0.00 ? 36  ARG A HA   4  
ATOM 5266  H HB2  . ARG A 1 36  ? 8.054   -8.709  -8.241  1.00 0.00 ? 36  ARG A HB2  4  
ATOM 5267  H HB3  . ARG A 1 36  ? 6.337   -8.900  -7.912  1.00 0.00 ? 36  ARG A HB3  4  
ATOM 5268  H HG2  . ARG A 1 36  ? 6.760   -6.806  -6.362  1.00 0.00 ? 36  ARG A HG2  4  
ATOM 5269  H HG3  . ARG A 1 36  ? 8.108   -6.560  -7.475  1.00 0.00 ? 36  ARG A HG3  4  
ATOM 5270  H HD2  . ARG A 1 36  ? 5.366   -7.113  -8.533  1.00 0.00 ? 36  ARG A HD2  4  
ATOM 5271  H HD3  . ARG A 1 36  ? 5.791   -5.491  -7.988  1.00 0.00 ? 36  ARG A HD3  4  
ATOM 5272  H HE   . ARG A 1 36  ? 6.765   -6.852  -10.348 1.00 0.00 ? 36  ARG A HE   4  
ATOM 5273  H HH11 . ARG A 1 36  ? 7.205   -4.225  -8.106  1.00 0.00 ? 36  ARG A HH11 4  
ATOM 5274  H HH12 . ARG A 1 36  ? 8.147   -3.273  -9.205  1.00 0.00 ? 36  ARG A HH12 4  
ATOM 5275  H HH21 . ARG A 1 36  ? 8.005   -5.608  -11.803 1.00 0.00 ? 36  ARG A HH21 4  
ATOM 5276  H HH22 . ARG A 1 36  ? 8.601   -4.060  -11.308 1.00 0.00 ? 36  ARG A HH22 4  
ATOM 5277  N N    . GLU A 1 37  ? 7.761   -11.548 -7.004  1.00 0.00 ? 37  GLU A N    4  
ATOM 5278  C CA   . GLU A 1 37  ? 7.347   -12.940 -7.141  1.00 0.00 ? 37  GLU A CA   4  
ATOM 5279  C C    . GLU A 1 37  ? 7.178   -13.594 -5.773  1.00 0.00 ? 37  GLU A C    4  
ATOM 5280  O O    . GLU A 1 37  ? 6.165   -14.239 -5.503  1.00 0.00 ? 37  GLU A O    4  
ATOM 5281  C CB   . GLU A 1 37  ? 8.372   -13.720 -7.968  1.00 0.00 ? 37  GLU A CB   4  
ATOM 5282  C CG   . GLU A 1 37  ? 8.133   -13.638 -9.466  1.00 0.00 ? 37  GLU A CG   4  
ATOM 5283  C CD   . GLU A 1 37  ? 7.211   -14.730 -9.971  1.00 0.00 ? 37  GLU A CD   4  
ATOM 5284  O OE1  . GLU A 1 37  ? 7.369   -15.889 -9.533  1.00 0.00 ? 37  GLU A OE1  4  
ATOM 5285  O OE2  . GLU A 1 37  ? 6.331   -14.427 -10.804 1.00 0.00 ? 37  GLU A OE2  4  
ATOM 5286  H H    . GLU A 1 37  ? 8.576   -11.245 -7.455  1.00 0.00 ? 37  GLU A H    4  
ATOM 5287  H HA   . GLU A 1 37  ? 6.398   -12.955 -7.654  1.00 0.00 ? 37  GLU A HA   4  
ATOM 5288  H HB2  . GLU A 1 37  ? 9.357   -13.331 -7.759  1.00 0.00 ? 37  GLU A HB2  4  
ATOM 5289  H HB3  . GLU A 1 37  ? 8.335   -14.759 -7.676  1.00 0.00 ? 37  GLU A HB3  4  
ATOM 5290  H HG2  . GLU A 1 37  ? 7.691   -12.680 -9.696  1.00 0.00 ? 37  GLU A HG2  4  
ATOM 5291  H HG3  . GLU A 1 37  ? 9.083   -13.726 -9.974  1.00 0.00 ? 37  GLU A HG3  4  
ATOM 5292  N N    . ALA A 1 38  ? 8.177   -13.423 -4.914  1.00 0.00 ? 38  ALA A N    4  
ATOM 5293  C CA   . ALA A 1 38  ? 8.138   -13.995 -3.573  1.00 0.00 ? 38  ALA A CA   4  
ATOM 5294  C C    . ALA A 1 38  ? 6.855   -13.605 -2.847  1.00 0.00 ? 38  ALA A C    4  
ATOM 5295  O O    . ALA A 1 38  ? 6.462   -14.247 -1.872  1.00 0.00 ? 38  ALA A O    4  
ATOM 5296  C CB   . ALA A 1 38  ? 9.354   -13.550 -2.775  1.00 0.00 ? 38  ALA A CB   4  
ATOM 5297  H H    . ALA A 1 38  ? 8.958   -12.898 -5.187  1.00 0.00 ? 38  ALA A H    4  
ATOM 5298  H HA   . ALA A 1 38  ? 8.173   -15.070 -3.668  1.00 0.00 ? 38  ALA A HA   4  
ATOM 5299  H HB1  . ALA A 1 38  ? 10.185  -14.206 -2.992  1.00 0.00 ? 38  ALA A HB1  4  
ATOM 5300  H HB2  . ALA A 1 38  ? 9.613   -12.538 -3.046  1.00 0.00 ? 38  ALA A HB2  4  
ATOM 5301  H HB3  . ALA A 1 38  ? 9.128   -13.594 -1.720  1.00 0.00 ? 38  ALA A HB3  4  
ATOM 5302  N N    . LEU A 1 39  ? 6.206   -12.549 -3.327  1.00 0.00 ? 39  LEU A N    4  
ATOM 5303  C CA   . LEU A 1 39  ? 4.967   -12.073 -2.722  1.00 0.00 ? 39  LEU A CA   4  
ATOM 5304  C C    . LEU A 1 39  ? 3.753   -12.653 -3.441  1.00 0.00 ? 39  LEU A C    4  
ATOM 5305  O O    . LEU A 1 39  ? 2.676   -12.779 -2.859  1.00 0.00 ? 39  LEU A O    4  
ATOM 5306  C CB   . LEU A 1 39  ? 4.913   -10.545 -2.758  1.00 0.00 ? 39  LEU A CB   4  
ATOM 5307  C CG   . LEU A 1 39  ? 6.224   -9.820  -2.448  1.00 0.00 ? 39  LEU A CG   4  
ATOM 5308  C CD1  . LEU A 1 39  ? 6.005   -8.315  -2.412  1.00 0.00 ? 39  LEU A CD1  4  
ATOM 5309  C CD2  . LEU A 1 39  ? 6.805   -10.309 -1.130  1.00 0.00 ? 39  LEU A CD2  4  
ATOM 5310  H H    . LEU A 1 39  ? 6.569   -12.078 -4.105  1.00 0.00 ? 39  LEU A H    4  
ATOM 5311  H HA   . LEU A 1 39  ? 4.952   -12.402 -1.694  1.00 0.00 ? 39  LEU A HA   4  
ATOM 5312  H HB2  . LEU A 1 39  ? 4.597   -10.248 -3.746  1.00 0.00 ? 39  LEU A HB2  4  
ATOM 5313  H HB3  . LEU A 1 39  ? 4.177   -10.224 -2.034  1.00 0.00 ? 39  LEU A HB3  4  
ATOM 5314  H HG   . LEU A 1 39  ? 6.940   -10.034 -3.230  1.00 0.00 ? 39  LEU A HG   4  
ATOM 5315  H HD11 . LEU A 1 39  ? 6.314   -7.884  -3.352  1.00 0.00 ? 39  LEU A HD11 4  
ATOM 5316  H HD12 . LEU A 1 39  ? 6.588   -7.886  -1.610  1.00 0.00 ? 39  LEU A HD12 4  
ATOM 5317  H HD13 . LEU A 1 39  ? 4.958   -8.107  -2.246  1.00 0.00 ? 39  LEU A HD13 4  
ATOM 5318  H HD21 . LEU A 1 39  ? 6.398   -9.723  -0.319  1.00 0.00 ? 39  LEU A HD21 4  
ATOM 5319  H HD22 . LEU A 1 39  ? 7.880   -10.200 -1.148  1.00 0.00 ? 39  LEU A HD22 4  
ATOM 5320  H HD23 . LEU A 1 39  ? 6.550   -11.348 -0.987  1.00 0.00 ? 39  LEU A HD23 4  
ATOM 5321  N N    . VAL A 1 40  ? 3.935   -13.006 -4.709  1.00 0.00 ? 40  VAL A N    4  
ATOM 5322  C CA   . VAL A 1 40  ? 2.856   -13.575 -5.507  1.00 0.00 ? 40  VAL A CA   4  
ATOM 5323  C C    . VAL A 1 40  ? 2.509   -14.983 -5.037  1.00 0.00 ? 40  VAL A C    4  
ATOM 5324  O O    . VAL A 1 40  ? 1.339   -15.360 -4.985  1.00 0.00 ? 40  VAL A O    4  
ATOM 5325  C CB   . VAL A 1 40  ? 3.227   -13.622 -7.001  1.00 0.00 ? 40  VAL A CB   4  
ATOM 5326  C CG1  . VAL A 1 40  ? 2.188   -14.409 -7.785  1.00 0.00 ? 40  VAL A CG1  4  
ATOM 5327  C CG2  . VAL A 1 40  ? 3.374   -12.214 -7.558  1.00 0.00 ? 40  VAL A CG2  4  
ATOM 5328  H H    . VAL A 1 40  ? 4.817   -12.881 -5.118  1.00 0.00 ? 40  VAL A H    4  
ATOM 5329  H HA   . VAL A 1 40  ? 1.987   -12.944 -5.393  1.00 0.00 ? 40  VAL A HA   4  
ATOM 5330  H HB   . VAL A 1 40  ? 4.177   -14.127 -7.100  1.00 0.00 ? 40  VAL A HB   4  
ATOM 5331  H HG11 . VAL A 1 40  ? 2.333   -14.243 -8.843  1.00 0.00 ? 40  VAL A HG11 4  
ATOM 5332  H HG12 . VAL A 1 40  ? 2.292   -15.462 -7.567  1.00 0.00 ? 40  VAL A HG12 4  
ATOM 5333  H HG13 . VAL A 1 40  ? 1.199   -14.079 -7.503  1.00 0.00 ? 40  VAL A HG13 4  
ATOM 5334  H HG21 . VAL A 1 40  ? 4.075   -12.224 -8.379  1.00 0.00 ? 40  VAL A HG21 4  
ATOM 5335  H HG22 . VAL A 1 40  ? 2.414   -11.864 -7.909  1.00 0.00 ? 40  VAL A HG22 4  
ATOM 5336  H HG23 . VAL A 1 40  ? 3.735   -11.556 -6.782  1.00 0.00 ? 40  VAL A HG23 4  
ATOM 5337  N N    . GLU A 1 41  ? 3.535   -15.757 -4.694  1.00 0.00 ? 41  GLU A N    4  
ATOM 5338  C CA   . GLU A 1 41  ? 3.337   -17.124 -4.227  1.00 0.00 ? 41  GLU A CA   4  
ATOM 5339  C C    . GLU A 1 41  ? 3.025   -17.150 -2.734  1.00 0.00 ? 41  GLU A C    4  
ATOM 5340  O O    . GLU A 1 41  ? 2.121   -17.857 -2.291  1.00 0.00 ? 41  GLU A O    4  
ATOM 5341  C CB   . GLU A 1 41  ? 4.580   -17.969 -4.515  1.00 0.00 ? 41  GLU A CB   4  
ATOM 5342  C CG   . GLU A 1 41  ? 5.852   -17.409 -3.901  1.00 0.00 ? 41  GLU A CG   4  
ATOM 5343  C CD   . GLU A 1 41  ? 7.075   -18.241 -4.232  1.00 0.00 ? 41  GLU A CD   4  
ATOM 5344  O OE1  . GLU A 1 41  ? 6.933   -19.475 -4.369  1.00 0.00 ? 41  GLU A OE1  4  
ATOM 5345  O OE2  . GLU A 1 41  ? 8.174   -17.661 -4.353  1.00 0.00 ? 41  GLU A OE2  4  
ATOM 5346  H H    . GLU A 1 41  ? 4.445   -15.399 -4.757  1.00 0.00 ? 41  GLU A H    4  
ATOM 5347  H HA   . GLU A 1 41  ? 2.499   -17.540 -4.765  1.00 0.00 ? 41  GLU A HA   4  
ATOM 5348  H HB2  . GLU A 1 41  ? 4.423   -18.963 -4.123  1.00 0.00 ? 41  GLU A HB2  4  
ATOM 5349  H HB3  . GLU A 1 41  ? 4.718   -18.031 -5.584  1.00 0.00 ? 41  GLU A HB3  4  
ATOM 5350  H HG2  . GLU A 1 41  ? 6.006   -16.407 -4.275  1.00 0.00 ? 41  GLU A HG2  4  
ATOM 5351  H HG3  . GLU A 1 41  ? 5.736   -17.377 -2.828  1.00 0.00 ? 41  GLU A HG3  4  
ATOM 5352  N N    . GLU A 1 42  ? 3.782   -16.373 -1.964  1.00 0.00 ? 42  GLU A N    4  
ATOM 5353  C CA   . GLU A 1 42  ? 3.587   -16.308 -0.520  1.00 0.00 ? 42  GLU A CA   4  
ATOM 5354  C C    . GLU A 1 42  ? 2.154   -15.906 -0.182  1.00 0.00 ? 42  GLU A C    4  
ATOM 5355  O O    . GLU A 1 42  ? 1.507   -16.526 0.662   1.00 0.00 ? 42  GLU A O    4  
ATOM 5356  C CB   . GLU A 1 42  ? 4.569   -15.315 0.105   1.00 0.00 ? 42  GLU A CB   4  
ATOM 5357  C CG   . GLU A 1 42  ? 4.503   -15.268 1.622   1.00 0.00 ? 42  GLU A CG   4  
ATOM 5358  C CD   . GLU A 1 42  ? 4.986   -16.553 2.267   1.00 0.00 ? 42  GLU A CD   4  
ATOM 5359  O OE1  . GLU A 1 42  ? 6.217   -16.741 2.365   1.00 0.00 ? 42  GLU A OE1  4  
ATOM 5360  O OE2  . GLU A 1 42  ? 4.134   -17.370 2.673   1.00 0.00 ? 42  GLU A OE2  4  
ATOM 5361  H H    . GLU A 1 42  ? 4.487   -15.833 -2.376  1.00 0.00 ? 42  GLU A H    4  
ATOM 5362  H HA   . GLU A 1 42  ? 3.777   -17.291 -0.115  1.00 0.00 ? 42  GLU A HA   4  
ATOM 5363  H HB2  . GLU A 1 42  ? 5.573   -15.590 -0.184  1.00 0.00 ? 42  GLU A HB2  4  
ATOM 5364  H HB3  . GLU A 1 42  ? 4.353   -14.327 -0.274  1.00 0.00 ? 42  GLU A HB3  4  
ATOM 5365  H HG2  . GLU A 1 42  ? 5.121   -14.455 1.972   1.00 0.00 ? 42  GLU A HG2  4  
ATOM 5366  H HG3  . GLU A 1 42  ? 3.480   -15.095 1.921   1.00 0.00 ? 42  GLU A HG3  4  
ATOM 5367  N N    . CYS A 1 43  ? 1.667   -14.863 -0.846  1.00 0.00 ? 43  CYS A N    4  
ATOM 5368  C CA   . CYS A 1 43  ? 0.312   -14.376 -0.615  1.00 0.00 ? 43  CYS A CA   4  
ATOM 5369  C C    . CYS A 1 43  ? -0.717  -15.453 -0.943  1.00 0.00 ? 43  CYS A C    4  
ATOM 5370  O O    . CYS A 1 43  ? -1.417  -15.946 -0.059  1.00 0.00 ? 43  CYS A O    4  
ATOM 5371  C CB   . CYS A 1 43  ? 0.047   -13.127 -1.458  1.00 0.00 ? 43  CYS A CB   4  
ATOM 5372  S SG   . CYS A 1 43  ? 0.842   -11.630 -0.831  1.00 0.00 ? 43  CYS A SG   4  
ATOM 5373  H H    . CYS A 1 43  ? 2.232   -14.410 -1.506  1.00 0.00 ? 43  CYS A H    4  
ATOM 5374  H HA   . CYS A 1 43  ? 0.226   -14.119 0.429   1.00 0.00 ? 43  CYS A HA   4  
ATOM 5375  H HB2  . CYS A 1 43  ? 0.410   -13.296 -2.461  1.00 0.00 ? 43  CYS A HB2  4  
ATOM 5376  H HB3  . CYS A 1 43  ? -1.017  -12.946 -1.494  1.00 0.00 ? 43  CYS A HB3  4  
ATOM 5377  H HG   . CYS A 1 43  ? 2.014   -11.505 -1.436  1.00 0.00 ? 43  CYS A HG   4  
ATOM 5378  N N    . ASN A 1 44  ? -0.803  -15.814 -2.219  1.00 0.00 ? 44  ASN A N    4  
ATOM 5379  C CA   . ASN A 1 44  ? -1.747  -16.832 -2.664  1.00 0.00 ? 44  ASN A CA   4  
ATOM 5380  C C    . ASN A 1 44  ? -1.692  -18.058 -1.758  1.00 0.00 ? 44  ASN A C    4  
ATOM 5381  O O    . ASN A 1 44  ? -2.710  -18.703 -1.508  1.00 0.00 ? 44  ASN A O    4  
ATOM 5382  C CB   . ASN A 1 44  ? -1.449  -17.237 -4.109  1.00 0.00 ? 44  ASN A CB   4  
ATOM 5383  C CG   . ASN A 1 44  ? -2.106  -16.313 -5.116  1.00 0.00 ? 44  ASN A CG   4  
ATOM 5384  O OD1  . ASN A 1 44  ? -3.261  -15.919 -4.953  1.00 0.00 ? 44  ASN A OD1  4  
ATOM 5385  N ND2  . ASN A 1 44  ? -1.370  -15.962 -6.165  1.00 0.00 ? 44  ASN A ND2  4  
ATOM 5386  H H    . ASN A 1 44  ? -0.217  -15.385 -2.878  1.00 0.00 ? 44  ASN A H    4  
ATOM 5387  H HA   . ASN A 1 44  ? -2.739  -16.407 -2.616  1.00 0.00 ? 44  ASN A HA   4  
ATOM 5388  H HB2  . ASN A 1 44  ? -0.381  -17.213 -4.270  1.00 0.00 ? 44  ASN A HB2  4  
ATOM 5389  H HB3  . ASN A 1 44  ? -1.812  -18.240 -4.278  1.00 0.00 ? 44  ASN A HB3  4  
ATOM 5390  H HD21 . ASN A 1 44  ? -0.458  -16.315 -6.229  1.00 0.00 ? 44  ASN A HD21 4  
ATOM 5391  H HD22 . ASN A 1 44  ? -1.769  -15.365 -6.831  1.00 0.00 ? 44  ASN A HD22 4  
ATOM 5392  N N    . ARG A 1 45  ? -0.497  -18.373 -1.270  1.00 0.00 ? 45  ARG A N    4  
ATOM 5393  C CA   . ARG A 1 45  ? -0.309  -19.521 -0.392  1.00 0.00 ? 45  ARG A CA   4  
ATOM 5394  C C    . ARG A 1 45  ? -0.996  -19.297 0.952   1.00 0.00 ? 45  ARG A C    4  
ATOM 5395  O O    . ARG A 1 45  ? -1.840  -20.089 1.368   1.00 0.00 ? 45  ARG A O    4  
ATOM 5396  C CB   . ARG A 1 45  ? 1.182   -19.787 -0.177  1.00 0.00 ? 45  ARG A CB   4  
ATOM 5397  C CG   . ARG A 1 45  ? 1.469   -20.790 0.928   1.00 0.00 ? 45  ARG A CG   4  
ATOM 5398  C CD   . ARG A 1 45  ? 2.904   -20.683 1.419   1.00 0.00 ? 45  ARG A CD   4  
ATOM 5399  N NE   . ARG A 1 45  ? 3.808   -21.544 0.660   1.00 0.00 ? 45  ARG A NE   4  
ATOM 5400  C CZ   . ARG A 1 45  ? 5.029   -21.870 1.069   1.00 0.00 ? 45  ARG A CZ   4  
ATOM 5401  N NH1  . ARG A 1 45  ? 5.489   -21.411 2.225   1.00 0.00 ? 45  ARG A NH1  4  
ATOM 5402  N NH2  . ARG A 1 45  ? 5.792   -22.658 0.322   1.00 0.00 ? 45  ARG A NH2  4  
ATOM 5403  H H    . ARG A 1 45  ? 0.277   -17.820 -1.505  1.00 0.00 ? 45  ARG A H    4  
ATOM 5404  H HA   . ARG A 1 45  ? -0.753  -20.381 -0.871  1.00 0.00 ? 45  ARG A HA   4  
ATOM 5405  H HB2  . ARG A 1 45  ? 1.605   -20.166 -1.096  1.00 0.00 ? 45  ARG A HB2  4  
ATOM 5406  H HB3  . ARG A 1 45  ? 1.668   -18.857 0.076   1.00 0.00 ? 45  ARG A HB3  4  
ATOM 5407  H HG2  . ARG A 1 45  ? 0.802   -20.600 1.756   1.00 0.00 ? 45  ARG A HG2  4  
ATOM 5408  H HG3  . ARG A 1 45  ? 1.300   -21.787 0.549   1.00 0.00 ? 45  ARG A HG3  4  
ATOM 5409  H HD2  . ARG A 1 45  ? 3.229   -19.659 1.319   1.00 0.00 ? 45  ARG A HD2  4  
ATOM 5410  H HD3  . ARG A 1 45  ? 2.937   -20.971 2.459   1.00 0.00 ? 45  ARG A HD3  4  
ATOM 5411  H HE   . ARG A 1 45  ? 3.488   -21.894 -0.197  1.00 0.00 ? 45  ARG A HE   4  
ATOM 5412  H HH11 . ARG A 1 45  ? 4.916   -20.818 2.790   1.00 0.00 ? 45  ARG A HH11 4  
ATOM 5413  H HH12 . ARG A 1 45  ? 6.408   -21.660 2.532   1.00 0.00 ? 45  ARG A HH12 4  
ATOM 5414  H HH21 . ARG A 1 45  ? 5.448   -23.006 -0.549  1.00 0.00 ? 45  ARG A HH21 4  
ATOM 5415  H HH22 . ARG A 1 45  ? 6.710   -22.903 0.631   1.00 0.00 ? 45  ARG A HH22 4  
ATOM 5416  N N    . ALA A 1 46  ? -0.627  -18.213 1.626   1.00 0.00 ? 46  ALA A N    4  
ATOM 5417  C CA   . ALA A 1 46  ? -1.208  -17.884 2.921   1.00 0.00 ? 46  ALA A CA   4  
ATOM 5418  C C    . ALA A 1 46  ? -2.724  -17.750 2.825   1.00 0.00 ? 46  ALA A C    4  
ATOM 5419  O O    . ALA A 1 46  ? -3.453  -18.200 3.708   1.00 0.00 ? 46  ALA A O    4  
ATOM 5420  C CB   . ALA A 1 46  ? -0.596  -16.600 3.463   1.00 0.00 ? 46  ALA A CB   4  
ATOM 5421  H H    . ALA A 1 46  ? 0.052   -17.619 1.242   1.00 0.00 ? 46  ALA A H    4  
ATOM 5422  H HA   . ALA A 1 46  ? -0.970  -18.684 3.607   1.00 0.00 ? 46  ALA A HA   4  
ATOM 5423  H HB1  . ALA A 1 46  ? -1.382  -15.950 3.819   1.00 0.00 ? 46  ALA A HB1  4  
ATOM 5424  H HB2  . ALA A 1 46  ? 0.072   -16.836 4.278   1.00 0.00 ? 46  ALA A HB2  4  
ATOM 5425  H HB3  . ALA A 1 46  ? -0.046  -16.104 2.678   1.00 0.00 ? 46  ALA A HB3  4  
ATOM 5426  N N    . GLU A 1 47  ? -3.191  -17.127 1.747   1.00 0.00 ? 47  GLU A N    4  
ATOM 5427  C CA   . GLU A 1 47  ? -4.621  -16.934 1.537   1.00 0.00 ? 47  GLU A CA   4  
ATOM 5428  C C    . GLU A 1 47  ? -5.367  -18.263 1.611   1.00 0.00 ? 47  GLU A C    4  
ATOM 5429  O O    . GLU A 1 47  ? -6.426  -18.359 2.232   1.00 0.00 ? 47  GLU A O    4  
ATOM 5430  C CB   . GLU A 1 47  ? -4.875  -16.268 0.183   1.00 0.00 ? 47  GLU A CB   4  
ATOM 5431  C CG   . GLU A 1 47  ? -4.350  -14.845 0.097   1.00 0.00 ? 47  GLU A CG   4  
ATOM 5432  C CD   . GLU A 1 47  ? -5.165  -13.978 -0.843  1.00 0.00 ? 47  GLU A CD   4  
ATOM 5433  O OE1  . GLU A 1 47  ? -6.337  -13.692 -0.518  1.00 0.00 ? 47  GLU A OE1  4  
ATOM 5434  O OE2  . GLU A 1 47  ? -4.633  -13.586 -1.902  1.00 0.00 ? 47  GLU A OE2  4  
ATOM 5435  H H    . GLU A 1 47  ? -2.560  -16.791 1.078   1.00 0.00 ? 47  GLU A H    4  
ATOM 5436  H HA   . GLU A 1 47  ? -4.986  -16.286 2.320   1.00 0.00 ? 47  GLU A HA   4  
ATOM 5437  H HB2  . GLU A 1 47  ? -4.397  -16.854 -0.588  1.00 0.00 ? 47  GLU A HB2  4  
ATOM 5438  H HB3  . GLU A 1 47  ? -5.939  -16.248 0.000   1.00 0.00 ? 47  GLU A HB3  4  
ATOM 5439  H HG2  . GLU A 1 47  ? -4.377  -14.404 1.082   1.00 0.00 ? 47  GLU A HG2  4  
ATOM 5440  H HG3  . GLU A 1 47  ? -3.329  -14.872 -0.256  1.00 0.00 ? 47  GLU A HG3  4  
ATOM 5441  N N    . CYS A 1 48  ? -4.807  -19.284 0.972   1.00 0.00 ? 48  CYS A N    4  
ATOM 5442  C CA   . CYS A 1 48  ? -5.419  -20.608 0.963   1.00 0.00 ? 48  CYS A CA   4  
ATOM 5443  C C    . CYS A 1 48  ? -5.453  -21.202 2.367   1.00 0.00 ? 48  CYS A C    4  
ATOM 5444  O O    . CYS A 1 48  ? -6.434  -21.831 2.764   1.00 0.00 ? 48  CYS A O    4  
ATOM 5445  C CB   . CYS A 1 48  ? -4.654  -21.540 0.021   1.00 0.00 ? 48  CYS A CB   4  
ATOM 5446  S SG   . CYS A 1 48  ? -5.033  -21.293 -1.730  1.00 0.00 ? 48  CYS A SG   4  
ATOM 5447  H H    . CYS A 1 48  ? -3.962  -19.145 0.494   1.00 0.00 ? 48  CYS A H    4  
ATOM 5448  H HA   . CYS A 1 48  ? -6.432  -20.502 0.606   1.00 0.00 ? 48  CYS A HA   4  
ATOM 5449  H HB2  . CYS A 1 48  ? -3.594  -21.381 0.152   1.00 0.00 ? 48  CYS A HB2  4  
ATOM 5450  H HB3  . CYS A 1 48  ? -4.892  -22.564 0.269   1.00 0.00 ? 48  CYS A HB3  4  
ATOM 5451  H HG   . CYS A 1 48  ? -3.897  -21.038 -2.361  1.00 0.00 ? 48  CYS A HG   4  
ATOM 5452  N N    . LEU A 1 49  ? -4.374  -20.998 3.116   1.00 0.00 ? 49  LEU A N    4  
ATOM 5453  C CA   . LEU A 1 49  ? -4.279  -21.514 4.477   1.00 0.00 ? 49  LEU A CA   4  
ATOM 5454  C C    . LEU A 1 49  ? -5.369  -20.918 5.363   1.00 0.00 ? 49  LEU A C    4  
ATOM 5455  O O    . LEU A 1 49  ? -6.201  -21.641 5.909   1.00 0.00 ? 49  LEU A O    4  
ATOM 5456  C CB   . LEU A 1 49  ? -2.901  -21.204 5.066   1.00 0.00 ? 49  LEU A CB   4  
ATOM 5457  C CG   . LEU A 1 49  ? -1.702  -21.521 4.171   1.00 0.00 ? 49  LEU A CG   4  
ATOM 5458  C CD1  . LEU A 1 49  ? -0.431  -21.625 4.999   1.00 0.00 ? 49  LEU A CD1  4  
ATOM 5459  C CD2  . LEU A 1 49  ? -1.942  -22.808 3.395   1.00 0.00 ? 49  LEU A CD2  4  
ATOM 5460  H H    . LEU A 1 49  ? -3.624  -20.489 2.745   1.00 0.00 ? 49  LEU A H    4  
ATOM 5461  H HA   . LEU A 1 49  ? -4.411  -22.585 4.435   1.00 0.00 ? 49  LEU A HA   4  
ATOM 5462  H HB2  . LEU A 1 49  ? -2.871  -20.151 5.298   1.00 0.00 ? 49  LEU A HB2  4  
ATOM 5463  H HB3  . LEU A 1 49  ? -2.796  -21.775 5.977   1.00 0.00 ? 49  LEU A HB3  4  
ATOM 5464  H HG   . LEU A 1 49  ? -1.571  -20.719 3.458   1.00 0.00 ? 49  LEU A HG   4  
ATOM 5465  H HD11 . LEU A 1 49  ? 0.056   -22.566 4.794   1.00 0.00 ? 49  LEU A HD11 4  
ATOM 5466  H HD12 . LEU A 1 49  ? -0.680  -21.570 6.049   1.00 0.00 ? 49  LEU A HD12 4  
ATOM 5467  H HD13 . LEU A 1 49  ? 0.232   -20.811 4.744   1.00 0.00 ? 49  LEU A HD13 4  
ATOM 5468  H HD21 . LEU A 1 49  ? -1.145  -22.950 2.680   1.00 0.00 ? 49  LEU A HD21 4  
ATOM 5469  H HD22 . LEU A 1 49  ? -2.886  -22.742 2.872   1.00 0.00 ? 49  LEU A HD22 4  
ATOM 5470  H HD23 . LEU A 1 49  ? -1.965  -23.642 4.079   1.00 0.00 ? 49  LEU A HD23 4  
ATOM 5471  N N    . GLN A 1 50  ? -5.357  -19.596 5.498   1.00 0.00 ? 50  GLN A N    4  
ATOM 5472  C CA   . GLN A 1 50  ? -6.346  -18.904 6.316   1.00 0.00 ? 50  GLN A CA   4  
ATOM 5473  C C    . GLN A 1 50  ? -7.762  -19.256 5.872   1.00 0.00 ? 50  GLN A C    4  
ATOM 5474  O O    . GLN A 1 50  ? -8.641  -19.496 6.700   1.00 0.00 ? 50  GLN A O    4  
ATOM 5475  C CB   . GLN A 1 50  ? -6.135  -17.391 6.237   1.00 0.00 ? 50  GLN A CB   4  
ATOM 5476  C CG   . GLN A 1 50  ? -6.399  -16.811 4.857   1.00 0.00 ? 50  GLN A CG   4  
ATOM 5477  C CD   . GLN A 1 50  ? -6.190  -15.310 4.804   1.00 0.00 ? 50  GLN A CD   4  
ATOM 5478  O OE1  . GLN A 1 50  ? -7.120  -14.534 5.023   1.00 0.00 ? 50  GLN A OE1  4  
ATOM 5479  N NE2  . GLN A 1 50  ? -4.963  -14.894 4.514   1.00 0.00 ? 50  GLN A NE2  4  
ATOM 5480  H H    . GLN A 1 50  ? -4.668  -19.074 5.037   1.00 0.00 ? 50  GLN A H    4  
ATOM 5481  H HA   . GLN A 1 50  ? -6.213  -19.224 7.338   1.00 0.00 ? 50  GLN A HA   4  
ATOM 5482  H HB2  . GLN A 1 50  ? -6.799  -16.910 6.939   1.00 0.00 ? 50  GLN A HB2  4  
ATOM 5483  H HB3  . GLN A 1 50  ? -5.114  -17.167 6.508   1.00 0.00 ? 50  GLN A HB3  4  
ATOM 5484  H HG2  . GLN A 1 50  ? -5.729  -17.277 4.150   1.00 0.00 ? 50  GLN A HG2  4  
ATOM 5485  H HG3  . GLN A 1 50  ? -7.420  -17.027 4.579   1.00 0.00 ? 50  GLN A HG3  4  
ATOM 5486  H HE21 . GLN A 1 50  ? -4.271  -15.570 4.350   1.00 0.00 ? 50  GLN A HE21 4  
ATOM 5487  H HE22 . GLN A 1 50  ? -4.799  -13.929 4.472   1.00 0.00 ? 50  GLN A HE22 4  
ATOM 5488  N N    . ARG A 1 51  ? -7.976  -19.283 4.561   1.00 0.00 ? 51  ARG A N    4  
ATOM 5489  C CA   . ARG A 1 51  ? -9.286  -19.604 4.008   1.00 0.00 ? 51  ARG A CA   4  
ATOM 5490  C C    . ARG A 1 51  ? -9.546  -21.107 4.061   1.00 0.00 ? 51  ARG A C    4  
ATOM 5491  O O    . ARG A 1 51  ? -10.556 -21.591 3.552   1.00 0.00 ? 51  ARG A O    4  
ATOM 5492  C CB   . ARG A 1 51  ? -9.389  -19.110 2.564   1.00 0.00 ? 51  ARG A CB   4  
ATOM 5493  C CG   . ARG A 1 51  ? -9.528  -17.601 2.445   1.00 0.00 ? 51  ARG A CG   4  
ATOM 5494  C CD   . ARG A 1 51  ? -9.391  -17.140 1.002   1.00 0.00 ? 51  ARG A CD   4  
ATOM 5495  N NE   . ARG A 1 51  ? -9.551  -15.695 0.871   1.00 0.00 ? 51  ARG A NE   4  
ATOM 5496  C CZ   . ARG A 1 51  ? -9.731  -15.077 -0.291  1.00 0.00 ? 51  ARG A CZ   4  
ATOM 5497  N NH1  . ARG A 1 51  ? -9.774  -15.776 -1.417  1.00 0.00 ? 51  ARG A NH1  4  
ATOM 5498  N NH2  . ARG A 1 51  ? -9.869  -13.758 -0.329  1.00 0.00 ? 51  ARG A NH2  4  
ATOM 5499  H H    . ARG A 1 51  ? -7.236  -19.083 3.951   1.00 0.00 ? 51  ARG A H    4  
ATOM 5500  H HA   . ARG A 1 51  ? -10.032 -19.100 4.605   1.00 0.00 ? 51  ARG A HA   4  
ATOM 5501  H HB2  . ARG A 1 51  ? -8.500  -19.410 2.028   1.00 0.00 ? 51  ARG A HB2  4  
ATOM 5502  H HB3  . ARG A 1 51  ? -10.250 -19.566 2.100   1.00 0.00 ? 51  ARG A HB3  4  
ATOM 5503  H HG2  . ARG A 1 51  ? -10.500 -17.308 2.814   1.00 0.00 ? 51  ARG A HG2  4  
ATOM 5504  H HG3  . ARG A 1 51  ? -8.758  -17.130 3.039   1.00 0.00 ? 51  ARG A HG3  4  
ATOM 5505  H HD2  . ARG A 1 51  ? -8.413  -17.419 0.640   1.00 0.00 ? 51  ARG A HD2  4  
ATOM 5506  H HD3  . ARG A 1 51  ? -10.147 -17.632 0.409   1.00 0.00 ? 51  ARG A HD3  4  
ATOM 5507  H HE   . ARG A 1 51  ? -9.523  -15.159 1.691   1.00 0.00 ? 51  ARG A HE   4  
ATOM 5508  H HH11 . ARG A 1 51  ? -9.672  -16.770 -1.391  1.00 0.00 ? 51  ARG A HH11 4  
ATOM 5509  H HH12 . ARG A 1 51  ? -9.911  -15.309 -2.291  1.00 0.00 ? 51  ARG A HH12 4  
ATOM 5510  H HH21 . ARG A 1 51  ? -9.838  -13.228 0.518   1.00 0.00 ? 51  ARG A HH21 4  
ATOM 5511  H HH22 . ARG A 1 51  ? -10.004 -13.294 -1.204  1.00 0.00 ? 51  ARG A HH22 4  
ATOM 5512  N N    . GLY A 1 52  ? -8.627  -21.840 4.682   1.00 0.00 ? 52  GLY A N    4  
ATOM 5513  C CA   . GLY A 1 52  ? -8.774  -23.279 4.790   1.00 0.00 ? 52  GLY A CA   4  
ATOM 5514  C C    . GLY A 1 52  ? -8.321  -24.004 3.539   1.00 0.00 ? 52  GLY A C    4  
ATOM 5515  O O    . GLY A 1 52  ? -7.948  -25.176 3.592   1.00 0.00 ? 52  GLY A O    4  
ATOM 5516  H H    . GLY A 1 52  ? -7.841  -21.399 5.069   1.00 0.00 ? 52  GLY A H    4  
ATOM 5517  H HA2  . GLY A 1 52  ? -8.189  -23.628 5.628   1.00 0.00 ? 52  GLY A HA2  4  
ATOM 5518  H HA3  . GLY A 1 52  ? -9.814  -23.510 4.970   1.00 0.00 ? 52  GLY A HA3  4  
ATOM 5519  N N    . VAL A 1 53  ? -8.355  -23.307 2.408   1.00 0.00 ? 53  VAL A N    4  
ATOM 5520  C CA   . VAL A 1 53  ? -7.945  -23.891 1.136   1.00 0.00 ? 53  VAL A CA   4  
ATOM 5521  C C    . VAL A 1 53  ? -6.490  -24.343 1.183   1.00 0.00 ? 53  VAL A C    4  
ATOM 5522  O O    . VAL A 1 53  ? -5.779  -24.085 2.155   1.00 0.00 ? 53  VAL A O    4  
ATOM 5523  C CB   . VAL A 1 53  ? -8.125  -22.894 -0.024  1.00 0.00 ? 53  VAL A CB   4  
ATOM 5524  C CG1  . VAL A 1 53  ? -8.252  -23.633 -1.347  1.00 0.00 ? 53  VAL A CG1  4  
ATOM 5525  C CG2  . VAL A 1 53  ? -9.336  -22.007 0.220   1.00 0.00 ? 53  VAL A CG2  4  
ATOM 5526  H H    . VAL A 1 53  ? -8.661  -22.376 2.429   1.00 0.00 ? 53  VAL A H    4  
ATOM 5527  H HA   . VAL A 1 53  ? -8.572  -24.750 0.946   1.00 0.00 ? 53  VAL A HA   4  
ATOM 5528  H HB   . VAL A 1 53  ? -7.247  -22.266 -0.071  1.00 0.00 ? 53  VAL A HB   4  
ATOM 5529  H HG11 . VAL A 1 53  ? -7.295  -23.640 -1.849  1.00 0.00 ? 53  VAL A HG11 4  
ATOM 5530  H HG12 . VAL A 1 53  ? -8.572  -24.648 -1.165  1.00 0.00 ? 53  VAL A HG12 4  
ATOM 5531  H HG13 . VAL A 1 53  ? -8.979  -23.132 -1.970  1.00 0.00 ? 53  VAL A HG13 4  
ATOM 5532  H HG21 . VAL A 1 53  ? -9.055  -21.184 0.861   1.00 0.00 ? 53  VAL A HG21 4  
ATOM 5533  H HG22 . VAL A 1 53  ? -9.696  -21.622 -0.723  1.00 0.00 ? 53  VAL A HG22 4  
ATOM 5534  H HG23 . VAL A 1 53  ? -10.116 -22.584 0.694   1.00 0.00 ? 53  VAL A HG23 4  
ATOM 5535  N N    . SER A 1 54  ? -6.051  -25.020 0.126   1.00 0.00 ? 54  SER A N    4  
ATOM 5536  C CA   . SER A 1 54  ? -4.681  -25.511 0.047   1.00 0.00 ? 54  SER A CA   4  
ATOM 5537  C C    . SER A 1 54  ? -3.803  -24.548 -0.747  1.00 0.00 ? 54  SER A C    4  
ATOM 5538  O O    . SER A 1 54  ? -4.222  -23.970 -1.750  1.00 0.00 ? 54  SER A O    4  
ATOM 5539  C CB   . SER A 1 54  ? -4.650  -26.897 -0.599  1.00 0.00 ? 54  SER A CB   4  
ATOM 5540  O OG   . SER A 1 54  ? -3.553  -27.657 -0.122  1.00 0.00 ? 54  SER A OG   4  
ATOM 5541  H H    . SER A 1 54  ? -6.666  -25.194 -0.618  1.00 0.00 ? 54  SER A H    4  
ATOM 5542  H HA   . SER A 1 54  ? -4.296  -25.583 1.053   1.00 0.00 ? 54  SER A HA   4  
ATOM 5543  H HB2  . SER A 1 54  ? -5.564  -27.421 -0.364  1.00 0.00 ? 54  SER A HB2  4  
ATOM 5544  H HB3  . SER A 1 54  ? -4.561  -26.791 -1.670  1.00 0.00 ? 54  SER A HB3  4  
ATOM 5545  H HG   . SER A 1 54  ? -3.877  -28.443 0.324   1.00 0.00 ? 54  SER A HG   4  
ATOM 5546  N N    . PRO A 1 55  ? -2.556  -24.370 -0.289  1.00 0.00 ? 55  PRO A N    4  
ATOM 5547  C CA   . PRO A 1 55  ? -1.592  -23.479 -0.941  1.00 0.00 ? 55  PRO A CA   4  
ATOM 5548  C C    . PRO A 1 55  ? -1.125  -24.017 -2.289  1.00 0.00 ? 55  PRO A C    4  
ATOM 5549  O O    . PRO A 1 55  ? -0.334  -23.378 -2.982  1.00 0.00 ? 55  PRO A O    4  
ATOM 5550  C CB   . PRO A 1 55  ? -0.425  -23.432 0.050   1.00 0.00 ? 55  PRO A CB   4  
ATOM 5551  C CG   . PRO A 1 55  ? -0.522  -24.710 0.809   1.00 0.00 ? 55  PRO A CG   4  
ATOM 5552  C CD   . PRO A 1 55  ? -1.989  -25.027 0.902   1.00 0.00 ? 55  PRO A CD   4  
ATOM 5553  H HA   . PRO A 1 55  ? -1.996  -22.485 -1.071  1.00 0.00 ? 55  PRO A HA   4  
ATOM 5554  H HB2  . PRO A 1 55  ? 0.507   -23.363 -0.492  1.00 0.00 ? 55  PRO A HB2  4  
ATOM 5555  H HB3  . PRO A 1 55  ? -0.535  -22.577 0.700   1.00 0.00 ? 55  PRO A HB3  4  
ATOM 5556  H HG2  . PRO A 1 55  ? -0.002  -25.493 0.279   1.00 0.00 ? 55  PRO A HG2  4  
ATOM 5557  H HG3  . PRO A 1 55  ? -0.104  -24.582 1.797   1.00 0.00 ? 55  PRO A HG3  4  
ATOM 5558  H HD2  . PRO A 1 55  ? -2.148  -26.095 0.865   1.00 0.00 ? 55  PRO A HD2  4  
ATOM 5559  H HD3  . PRO A 1 55  ? -2.409  -24.612 1.806   1.00 0.00 ? 55  PRO A HD3  4  
ATOM 5560  N N    . SER A 1 56  ? -1.620  -25.195 -2.655  1.00 0.00 ? 56  SER A N    4  
ATOM 5561  C CA   . SER A 1 56  ? -1.250  -25.820 -3.919  1.00 0.00 ? 56  SER A CA   4  
ATOM 5562  C C    . SER A 1 56  ? -2.339  -25.611 -4.967  1.00 0.00 ? 56  SER A C    4  
ATOM 5563  O O    . SER A 1 56  ? -2.088  -25.711 -6.168  1.00 0.00 ? 56  SER A O    4  
ATOM 5564  C CB   . SER A 1 56  ? -1.000  -27.316 -3.718  1.00 0.00 ? 56  SER A CB   4  
ATOM 5565  O OG   . SER A 1 56  ? 0.287   -27.549 -3.173  1.00 0.00 ? 56  SER A OG   4  
ATOM 5566  H H    . SER A 1 56  ? -2.247  -25.656 -2.058  1.00 0.00 ? 56  SER A H    4  
ATOM 5567  H HA   . SER A 1 56  ? -0.339  -25.355 -4.265  1.00 0.00 ? 56  SER A HA   4  
ATOM 5568  H HB2  . SER A 1 56  ? -1.741  -27.715 -3.044  1.00 0.00 ? 56  SER A HB2  4  
ATOM 5569  H HB3  . SER A 1 56  ? -1.071  -27.821 -4.671  1.00 0.00 ? 56  SER A HB3  4  
ATOM 5570  H HG   . SER A 1 56  ? 0.199   -27.911 -2.288  1.00 0.00 ? 56  SER A HG   4  
ATOM 5571  N N    . LYS A 1 57  ? -3.549  -25.320 -4.503  1.00 0.00 ? 57  LYS A N    4  
ATOM 5572  C CA   . LYS A 1 57  ? -4.678  -25.095 -5.398  1.00 0.00 ? 57  LYS A CA   4  
ATOM 5573  C C    . LYS A 1 57  ? -5.063  -23.619 -5.428  1.00 0.00 ? 57  LYS A C    4  
ATOM 5574  O O    . LYS A 1 57  ? -6.244  -23.277 -5.473  1.00 0.00 ? 57  LYS A O    4  
ATOM 5575  C CB   . LYS A 1 57  ? -5.878  -25.937 -4.961  1.00 0.00 ? 57  LYS A CB   4  
ATOM 5576  C CG   . LYS A 1 57  ? -5.545  -27.402 -4.737  1.00 0.00 ? 57  LYS A CG   4  
ATOM 5577  C CD   . LYS A 1 57  ? -5.170  -28.093 -6.037  1.00 0.00 ? 57  LYS A CD   4  
ATOM 5578  C CE   . LYS A 1 57  ? -4.786  -29.547 -5.805  1.00 0.00 ? 57  LYS A CE   4  
ATOM 5579  N NZ   . LYS A 1 57  ? -5.965  -30.452 -5.893  1.00 0.00 ? 57  LYS A NZ   4  
ATOM 5580  H H    . LYS A 1 57  ? -3.687  -25.254 -3.535  1.00 0.00 ? 57  LYS A H    4  
ATOM 5581  H HA   . LYS A 1 57  ? -4.380  -25.397 -6.391  1.00 0.00 ? 57  LYS A HA   4  
ATOM 5582  H HB2  . LYS A 1 57  ? -6.269  -25.533 -4.038  1.00 0.00 ? 57  LYS A HB2  4  
ATOM 5583  H HB3  . LYS A 1 57  ? -6.643  -25.876 -5.722  1.00 0.00 ? 57  LYS A HB3  4  
ATOM 5584  H HG2  . LYS A 1 57  ? -4.712  -27.472 -4.052  1.00 0.00 ? 57  LYS A HG2  4  
ATOM 5585  H HG3  . LYS A 1 57  ? -6.406  -27.897 -4.312  1.00 0.00 ? 57  LYS A HG3  4  
ATOM 5586  H HD2  . LYS A 1 57  ? -6.014  -28.058 -6.710  1.00 0.00 ? 57  LYS A HD2  4  
ATOM 5587  H HD3  . LYS A 1 57  ? -4.332  -27.575 -6.482  1.00 0.00 ? 57  LYS A HD3  4  
ATOM 5588  H HE2  . LYS A 1 57  ? -4.063  -29.838 -6.552  1.00 0.00 ? 57  LYS A HE2  4  
ATOM 5589  H HE3  . LYS A 1 57  ? -4.346  -29.636 -4.823  1.00 0.00 ? 57  LYS A HE3  4  
ATOM 5590  H HZ1  . LYS A 1 57  ? -5.789  -31.201 -6.593  1.00 0.00 ? 57  LYS A HZ1  4  
ATOM 5591  H HZ2  . LYS A 1 57  ? -6.808  -29.915 -6.182  1.00 0.00 ? 57  LYS A HZ2  4  
ATOM 5592  H HZ3  . LYS A 1 57  ? -6.148  -30.892 -4.969  1.00 0.00 ? 57  LYS A HZ3  4  
ATOM 5593  N N    . ALA A 1 58  ? -4.058  -22.749 -5.404  1.00 0.00 ? 58  ALA A N    4  
ATOM 5594  C CA   . ALA A 1 58  ? -4.292  -21.311 -5.432  1.00 0.00 ? 58  ALA A CA   4  
ATOM 5595  C C    . ALA A 1 58  ? -4.967  -20.890 -6.733  1.00 0.00 ? 58  ALA A C    4  
ATOM 5596  O O    . ALA A 1 58  ? -5.734  -19.926 -6.763  1.00 0.00 ? 58  ALA A O    4  
ATOM 5597  C CB   . ALA A 1 58  ? -2.982  -20.560 -5.248  1.00 0.00 ? 58  ALA A CB   4  
ATOM 5598  H H    . ALA A 1 58  ? -3.138  -23.083 -5.369  1.00 0.00 ? 58  ALA A H    4  
ATOM 5599  H HA   . ALA A 1 58  ? -4.941  -21.062 -4.605  1.00 0.00 ? 58  ALA A HA   4  
ATOM 5600  H HB1  . ALA A 1 58  ? -2.593  -20.274 -6.215  1.00 0.00 ? 58  ALA A HB1  4  
ATOM 5601  H HB2  . ALA A 1 58  ? -3.155  -19.675 -4.654  1.00 0.00 ? 58  ALA A HB2  4  
ATOM 5602  H HB3  . ALA A 1 58  ? -2.269  -21.197 -4.746  1.00 0.00 ? 58  ALA A HB3  4  
ATOM 5603  N N    . HIS A 1 59  ? -4.677  -21.617 -7.808  1.00 0.00 ? 59  HIS A N    4  
ATOM 5604  C CA   . HIS A 1 59  ? -5.257  -21.318 -9.112  1.00 0.00 ? 59  HIS A CA   4  
ATOM 5605  C C    . HIS A 1 59  ? -6.760  -21.086 -8.999  1.00 0.00 ? 59  HIS A C    4  
ATOM 5606  O O    . HIS A 1 59  ? -7.358  -20.405 -9.830  1.00 0.00 ? 59  HIS A O    4  
ATOM 5607  C CB   . HIS A 1 59  ? -4.977  -22.458 -10.092 1.00 0.00 ? 59  HIS A CB   4  
ATOM 5608  C CG   . HIS A 1 59  ? -5.309  -23.812 -9.545  1.00 0.00 ? 59  HIS A CG   4  
ATOM 5609  N ND1  . HIS A 1 59  ? -6.486  -24.471 -9.830  1.00 0.00 ? 59  HIS A ND1  4  
ATOM 5610  C CD2  . HIS A 1 59  ? -4.609  -24.633 -8.726  1.00 0.00 ? 59  HIS A CD2  4  
ATOM 5611  C CE1  . HIS A 1 59  ? -6.497  -25.637 -9.209  1.00 0.00 ? 59  HIS A CE1  4  
ATOM 5612  N NE2  . HIS A 1 59  ? -5.369  -25.760 -8.533  1.00 0.00 ? 59  HIS A NE2  4  
ATOM 5613  H H    . HIS A 1 59  ? -4.059  -22.372 -7.721  1.00 0.00 ? 59  HIS A H    4  
ATOM 5614  H HA   . HIS A 1 59  ? -4.793  -20.416 -9.482  1.00 0.00 ? 59  HIS A HA   4  
ATOM 5615  H HB2  . HIS A 1 59  ? -5.565  -22.309 -10.985 1.00 0.00 ? 59  HIS A HB2  4  
ATOM 5616  H HB3  . HIS A 1 59  ? -3.928  -22.452 -10.351 1.00 0.00 ? 59  HIS A HB3  4  
ATOM 5617  H HD1  . HIS A 1 59  ? -7.207  -24.134 -10.401 1.00 0.00 ? 59  HIS A HD1  4  
ATOM 5618  H HD2  . HIS A 1 59  ? -3.634  -24.437 -8.303  1.00 0.00 ? 59  HIS A HD2  4  
ATOM 5619  H HE1  . HIS A 1 59  ? -7.292  -26.367 -9.248  1.00 0.00 ? 59  HIS A HE1  4  
ATOM 5620  H HE2  . HIS A 1 59  ? -5.157  -26.492 -7.917  1.00 0.00 ? 59  HIS A HE2  4  
ATOM 5621  N N    . GLY A 1 60  ? -7.366  -21.660 -7.963  1.00 0.00 ? 60  GLY A N    4  
ATOM 5622  C CA   . GLY A 1 60  ? -8.795  -21.505 -7.761  1.00 0.00 ? 60  GLY A CA   4  
ATOM 5623  C C    . GLY A 1 60  ? -9.168  -20.107 -7.309  1.00 0.00 ? 60  GLY A C    4  
ATOM 5624  O O    . GLY A 1 60  ? -10.229 -19.593 -7.667  1.00 0.00 ? 60  GLY A O    4  
ATOM 5625  H H    . GLY A 1 60  ? -6.839  -22.193 -7.332  1.00 0.00 ? 60  GLY A H    4  
ATOM 5626  H HA2  . GLY A 1 60  ? -9.304  -21.721 -8.688  1.00 0.00 ? 60  GLY A HA2  4  
ATOM 5627  H HA3  . GLY A 1 60  ? -9.119  -22.211 -7.010  1.00 0.00 ? 60  GLY A HA3  4  
ATOM 5628  N N    . LEU A 1 61  ? -8.296  -19.489 -6.520  1.00 0.00 ? 61  LEU A N    4  
ATOM 5629  C CA   . LEU A 1 61  ? -8.540  -18.142 -6.017  1.00 0.00 ? 61  LEU A CA   4  
ATOM 5630  C C    . LEU A 1 61  ? -9.227  -17.282 -7.073  1.00 0.00 ? 61  LEU A C    4  
ATOM 5631  O O    . LEU A 1 61  ? -10.065 -16.440 -6.754  1.00 0.00 ? 61  LEU A O    4  
ATOM 5632  C CB   . LEU A 1 61  ? -7.224  -17.490 -5.589  1.00 0.00 ? 61  LEU A CB   4  
ATOM 5633  C CG   . LEU A 1 61  ? -6.572  -18.059 -4.328  1.00 0.00 ? 61  LEU A CG   4  
ATOM 5634  C CD1  . LEU A 1 61  ? -5.092  -17.713 -4.290  1.00 0.00 ? 61  LEU A CD1  4  
ATOM 5635  C CD2  . LEU A 1 61  ? -7.276  -17.538 -3.083  1.00 0.00 ? 61  LEU A CD2  4  
ATOM 5636  H H    . LEU A 1 61  ? -7.469  -19.949 -6.269  1.00 0.00 ? 61  LEU A H    4  
ATOM 5637  H HA   . LEU A 1 61  ? -9.189  -18.222 -5.157  1.00 0.00 ? 61  LEU A HA   4  
ATOM 5638  H HB2  . LEU A 1 61  ? -6.522  -17.598 -6.401  1.00 0.00 ? 61  LEU A HB2  4  
ATOM 5639  H HB3  . LEU A 1 61  ? -7.417  -16.440 -5.419  1.00 0.00 ? 61  LEU A HB3  4  
ATOM 5640  H HG   . LEU A 1 61  ? -6.663  -19.136 -4.338  1.00 0.00 ? 61  LEU A HG   4  
ATOM 5641  H HD11 . LEU A 1 61  ? -4.952  -16.787 -3.753  1.00 0.00 ? 61  LEU A HD11 4  
ATOM 5642  H HD12 . LEU A 1 61  ? -4.722  -17.604 -5.299  1.00 0.00 ? 61  LEU A HD12 4  
ATOM 5643  H HD13 . LEU A 1 61  ? -4.550  -18.504 -3.792  1.00 0.00 ? 61  LEU A HD13 4  
ATOM 5644  H HD21 . LEU A 1 61  ? -8.263  -17.189 -3.347  1.00 0.00 ? 61  LEU A HD21 4  
ATOM 5645  H HD22 . LEU A 1 61  ? -6.706  -16.721 -2.663  1.00 0.00 ? 61  LEU A HD22 4  
ATOM 5646  H HD23 . LEU A 1 61  ? -7.356  -18.333 -2.356  1.00 0.00 ? 61  LEU A HD23 4  
ATOM 5647  N N    . GLY A 1 62  ? -8.867  -17.503 -8.334  1.00 0.00 ? 62  GLY A N    4  
ATOM 5648  C CA   . GLY A 1 62  ? -9.460  -16.742 -9.419  1.00 0.00 ? 62  GLY A CA   4  
ATOM 5649  C C    . GLY A 1 62  ? -9.318  -15.246 -9.222  1.00 0.00 ? 62  GLY A C    4  
ATOM 5650  O O    . GLY A 1 62  ? -8.222  -14.699 -9.338  1.00 0.00 ? 62  GLY A O    4  
ATOM 5651  H H    . GLY A 1 62  ? -8.193  -18.188 -8.529  1.00 0.00 ? 62  GLY A H    4  
ATOM 5652  H HA2  . GLY A 1 62  ? -8.978  -17.021 -10.344 1.00 0.00 ? 62  GLY A HA2  4  
ATOM 5653  H HA3  . GLY A 1 62  ? -10.510 -16.987 -9.483  1.00 0.00 ? 62  GLY A HA3  4  
ATOM 5654  N N    . SER A 1 63  ? -10.431 -14.582 -8.925  1.00 0.00 ? 63  SER A N    4  
ATOM 5655  C CA   . SER A 1 63  ? -10.427 -13.139 -8.718  1.00 0.00 ? 63  SER A CA   4  
ATOM 5656  C C    . SER A 1 63  ? -9.549  -12.763 -7.528  1.00 0.00 ? 63  SER A C    4  
ATOM 5657  O O    . SER A 1 63  ? -8.975  -11.676 -7.485  1.00 0.00 ? 63  SER A O    4  
ATOM 5658  C CB   . SER A 1 63  ? -11.853 -12.631 -8.495  1.00 0.00 ? 63  SER A CB   4  
ATOM 5659  O OG   . SER A 1 63  ? -12.603 -12.672 -9.696  1.00 0.00 ? 63  SER A OG   4  
ATOM 5660  H H    . SER A 1 63  ? -11.275 -15.075 -8.846  1.00 0.00 ? 63  SER A H    4  
ATOM 5661  H HA   . SER A 1 63  ? -10.025 -12.677 -9.607  1.00 0.00 ? 63  SER A HA   4  
ATOM 5662  H HB2  . SER A 1 63  ? -12.342 -13.249 -7.758  1.00 0.00 ? 63  SER A HB2  4  
ATOM 5663  H HB3  . SER A 1 63  ? -11.817 -11.610 -8.141  1.00 0.00 ? 63  SER A HB3  4  
ATOM 5664  H HG   . SER A 1 63  ? -13.540 -12.633 -9.490  1.00 0.00 ? 63  SER A HG   4  
ATOM 5665  N N    . ASN A 1 64  ? -9.450  -13.672 -6.563  1.00 0.00 ? 64  ASN A N    4  
ATOM 5666  C CA   . ASN A 1 64  ? -8.643  -13.437 -5.372  1.00 0.00 ? 64  ASN A CA   4  
ATOM 5667  C C    . ASN A 1 64  ? -7.221  -13.954 -5.567  1.00 0.00 ? 64  ASN A C    4  
ATOM 5668  O O    . ASN A 1 64  ? -6.442  -14.037 -4.617  1.00 0.00 ? 64  ASN A O    4  
ATOM 5669  C CB   . ASN A 1 64  ? -9.281  -14.113 -4.157  1.00 0.00 ? 64  ASN A CB   4  
ATOM 5670  C CG   . ASN A 1 64  ? -10.646 -13.541 -3.828  1.00 0.00 ? 64  ASN A CG   4  
ATOM 5671  O OD1  . ASN A 1 64  ? -10.783 -12.704 -2.935  1.00 0.00 ? 64  ASN A OD1  4  
ATOM 5672  N ND2  . ASN A 1 64  ? -11.666 -13.992 -4.549  1.00 0.00 ? 64  ASN A ND2  4  
ATOM 5673  H H    . ASN A 1 64  ? -9.931  -14.520 -6.655  1.00 0.00 ? 64  ASN A H    4  
ATOM 5674  H HA   . ASN A 1 64  ? -8.606  -12.371 -5.202  1.00 0.00 ? 64  ASN A HA   4  
ATOM 5675  H HB2  . ASN A 1 64  ? -9.393  -15.169 -4.357  1.00 0.00 ? 64  ASN A HB2  4  
ATOM 5676  H HB3  . ASN A 1 64  ? -8.639  -13.980 -3.299  1.00 0.00 ? 64  ASN A HB3  4  
ATOM 5677  H HD21 . ASN A 1 64  ? -11.483 -14.659 -5.244  1.00 0.00 ? 64  ASN A HD21 4  
ATOM 5678  H HD22 . ASN A 1 64  ? -12.560 -13.639 -4.358  1.00 0.00 ? 64  ASN A HD22 4  
ATOM 5679  N N    . LEU A 1 65  ? -6.888  -14.300 -6.806  1.00 0.00 ? 65  LEU A N    4  
ATOM 5680  C CA   . LEU A 1 65  ? -5.559  -14.809 -7.128  1.00 0.00 ? 65  LEU A CA   4  
ATOM 5681  C C    . LEU A 1 65  ? -4.572  -13.664 -7.331  1.00 0.00 ? 65  LEU A C    4  
ATOM 5682  O O    . LEU A 1 65  ? -4.861  -12.700 -8.040  1.00 0.00 ? 65  LEU A O    4  
ATOM 5683  C CB   . LEU A 1 65  ? -5.615  -15.678 -8.385  1.00 0.00 ? 65  LEU A CB   4  
ATOM 5684  C CG   . LEU A 1 65  ? -4.302  -16.340 -8.802  1.00 0.00 ? 65  LEU A CG   4  
ATOM 5685  C CD1  . LEU A 1 65  ? -4.163  -17.708 -8.151  1.00 0.00 ? 65  LEU A CD1  4  
ATOM 5686  C CD2  . LEU A 1 65  ? -4.221  -16.458 -10.317 1.00 0.00 ? 65  LEU A CD2  4  
ATOM 5687  H H    . LEU A 1 65  ? -7.551  -14.212 -7.522  1.00 0.00 ? 65  LEU A H    4  
ATOM 5688  H HA   . LEU A 1 65  ? -5.226  -15.413 -6.297  1.00 0.00 ? 65  LEU A HA   4  
ATOM 5689  H HB2  . LEU A 1 65  ? -6.340  -16.459 -8.215  1.00 0.00 ? 65  LEU A HB2  4  
ATOM 5690  H HB3  . LEU A 1 65  ? -5.947  -15.054 -9.203  1.00 0.00 ? 65  LEU A HB3  4  
ATOM 5691  H HG   . LEU A 1 65  ? -3.475  -15.727 -8.469  1.00 0.00 ? 65  LEU A HG   4  
ATOM 5692  H HD11 . LEU A 1 65  ? -5.120  -18.020 -7.762  1.00 0.00 ? 65  LEU A HD11 4  
ATOM 5693  H HD12 . LEU A 1 65  ? -3.447  -17.651 -7.345  1.00 0.00 ? 65  LEU A HD12 4  
ATOM 5694  H HD13 . LEU A 1 65  ? -3.821  -18.423 -8.886  1.00 0.00 ? 65  LEU A HD13 4  
ATOM 5695  H HD21 . LEU A 1 65  ? -4.554  -17.440 -10.620 1.00 0.00 ? 65  LEU A HD21 4  
ATOM 5696  H HD22 . LEU A 1 65  ? -3.199  -16.311 -10.636 1.00 0.00 ? 65  LEU A HD22 4  
ATOM 5697  H HD23 . LEU A 1 65  ? -4.852  -15.708 -10.771 1.00 0.00 ? 65  LEU A HD23 4  
ATOM 5698  N N    . VAL A 1 66  ? -3.406  -13.777 -6.704  1.00 0.00 ? 66  VAL A N    4  
ATOM 5699  C CA   . VAL A 1 66  ? -2.374  -12.753 -6.818  1.00 0.00 ? 66  VAL A CA   4  
ATOM 5700  C C    . VAL A 1 66  ? -1.492  -12.995 -8.038  1.00 0.00 ? 66  VAL A C    4  
ATOM 5701  O O    . VAL A 1 66  ? -1.370  -14.123 -8.517  1.00 0.00 ? 66  VAL A O    4  
ATOM 5702  C CB   . VAL A 1 66  ? -1.488  -12.706 -5.559  1.00 0.00 ? 66  VAL A CB   4  
ATOM 5703  C CG1  . VAL A 1 66  ? -0.590  -11.478 -5.583  1.00 0.00 ? 66  VAL A CG1  4  
ATOM 5704  C CG2  . VAL A 1 66  ? -2.346  -12.726 -4.303  1.00 0.00 ? 66  VAL A CG2  4  
ATOM 5705  H H    . VAL A 1 66  ? -3.234  -14.568 -6.152  1.00 0.00 ? 66  VAL A H    4  
ATOM 5706  H HA   . VAL A 1 66  ? -2.864  -11.796 -6.924  1.00 0.00 ? 66  VAL A HA   4  
ATOM 5707  H HB   . VAL A 1 66  ? -0.859  -13.584 -5.554  1.00 0.00 ? 66  VAL A HB   4  
ATOM 5708  H HG11 . VAL A 1 66  ? -0.239  -11.270 -4.583  1.00 0.00 ? 66  VAL A HG11 4  
ATOM 5709  H HG12 . VAL A 1 66  ? 0.254   -11.661 -6.232  1.00 0.00 ? 66  VAL A HG12 4  
ATOM 5710  H HG13 . VAL A 1 66  ? -1.150  -10.631 -5.951  1.00 0.00 ? 66  VAL A HG13 4  
ATOM 5711  H HG21 . VAL A 1 66  ? -1.716  -12.885 -3.441  1.00 0.00 ? 66  VAL A HG21 4  
ATOM 5712  H HG22 . VAL A 1 66  ? -2.860  -11.781 -4.204  1.00 0.00 ? 66  VAL A HG22 4  
ATOM 5713  H HG23 . VAL A 1 66  ? -3.069  -13.524 -4.374  1.00 0.00 ? 66  VAL A HG23 4  
ATOM 5714  N N    . THR A 1 67  ? -0.878  -11.927 -8.539  1.00 0.00 ? 67  THR A N    4  
ATOM 5715  C CA   . THR A 1 67  ? -0.008  -12.022 -9.704  1.00 0.00 ? 67  THR A CA   4  
ATOM 5716  C C    . THR A 1 67  ? 1.013   -10.890 -9.722  1.00 0.00 ? 67  THR A C    4  
ATOM 5717  O O    . THR A 1 67  ? 0.774   -9.819  -9.165  1.00 0.00 ? 67  THR A O    4  
ATOM 5718  C CB   . THR A 1 67  ? -0.818  -11.989 -11.014 1.00 0.00 ? 67  THR A CB   4  
ATOM 5719  O OG1  . THR A 1 67  ? -1.326  -10.670 -11.243 1.00 0.00 ? 67  THR A OG1  4  
ATOM 5720  C CG2  . THR A 1 67  ? -1.971  -12.980 -10.963 1.00 0.00 ? 67  THR A CG2  4  
ATOM 5721  H H    . THR A 1 67  ? -1.016  -11.055 -8.114  1.00 0.00 ? 67  THR A H    4  
ATOM 5722  H HA   . THR A 1 67  ? 0.516   -12.966 -9.653  1.00 0.00 ? 67  THR A HA   4  
ATOM 5723  H HB   . THR A 1 67  ? -0.164  -12.262 -11.831 1.00 0.00 ? 67  THR A HB   4  
ATOM 5724  H HG1  . THR A 1 67  ? -0.596  -10.073 -11.425 1.00 0.00 ? 67  THR A HG1  4  
ATOM 5725  H HG21 . THR A 1 67  ? -2.510  -12.954 -11.899 1.00 0.00 ? 67  THR A HG21 4  
ATOM 5726  H HG22 . THR A 1 67  ? -2.637  -12.716 -10.156 1.00 0.00 ? 67  THR A HG22 4  
ATOM 5727  H HG23 . THR A 1 67  ? -1.583  -13.974 -10.800 1.00 0.00 ? 67  THR A HG23 4  
ATOM 5728  N N    . GLU A 1 68  ? 2.150   -11.135 -10.366 1.00 0.00 ? 68  GLU A N    4  
ATOM 5729  C CA   . GLU A 1 68  ? 3.206   -10.134 -10.455 1.00 0.00 ? 68  GLU A CA   4  
ATOM 5730  C C    . GLU A 1 68  ? 2.619   -8.729  -10.545 1.00 0.00 ? 68  GLU A C    4  
ATOM 5731  O O    . GLU A 1 68  ? 3.124   -7.792  -9.925  1.00 0.00 ? 68  GLU A O    4  
ATOM 5732  C CB   . GLU A 1 68  ? 4.095   -10.405 -11.671 1.00 0.00 ? 68  GLU A CB   4  
ATOM 5733  C CG   . GLU A 1 68  ? 5.451   -9.725  -11.598 1.00 0.00 ? 68  GLU A CG   4  
ATOM 5734  C CD   . GLU A 1 68  ? 6.109   -9.588  -12.957 1.00 0.00 ? 68  GLU A CD   4  
ATOM 5735  O OE1  . GLU A 1 68  ? 6.552   -10.617 -13.508 1.00 0.00 ? 68  GLU A OE1  4  
ATOM 5736  O OE2  . GLU A 1 68  ? 6.182   -8.451  -13.469 1.00 0.00 ? 68  GLU A OE2  4  
ATOM 5737  H H    . GLU A 1 68  ? 2.281   -12.008 -10.790 1.00 0.00 ? 68  GLU A H    4  
ATOM 5738  H HA   . GLU A 1 68  ? 3.806   -10.204 -9.561  1.00 0.00 ? 68  GLU A HA   4  
ATOM 5739  H HB2  . GLU A 1 68  ? 4.253   -11.470 -11.756 1.00 0.00 ? 68  GLU A HB2  4  
ATOM 5740  H HB3  . GLU A 1 68  ? 3.587   -10.054 -12.558 1.00 0.00 ? 68  GLU A HB3  4  
ATOM 5741  H HG2  . GLU A 1 68  ? 5.324   -8.740  -11.176 1.00 0.00 ? 68  GLU A HG2  4  
ATOM 5742  H HG3  . GLU A 1 68  ? 6.098   -10.308 -10.959 1.00 0.00 ? 68  GLU A HG3  4  
ATOM 5743  N N    . VAL A 1 69  ? 1.549   -8.589  -11.321 1.00 0.00 ? 69  VAL A N    4  
ATOM 5744  C CA   . VAL A 1 69  ? 0.891   -7.299  -11.491 1.00 0.00 ? 69  VAL A CA   4  
ATOM 5745  C C    . VAL A 1 69  ? 0.269   -6.822  -10.184 1.00 0.00 ? 69  VAL A C    4  
ATOM 5746  O O    . VAL A 1 69  ? 0.530   -5.708  -9.731  1.00 0.00 ? 69  VAL A O    4  
ATOM 5747  C CB   . VAL A 1 69  ? -0.203  -7.366  -12.574 1.00 0.00 ? 69  VAL A CB   4  
ATOM 5748  C CG1  . VAL A 1 69  ? -1.171  -6.202  -12.427 1.00 0.00 ? 69  VAL A CG1  4  
ATOM 5749  C CG2  . VAL A 1 69  ? 0.421   -7.380  -13.961 1.00 0.00 ? 69  VAL A CG2  4  
ATOM 5750  H H    . VAL A 1 69  ? 1.192   -9.373  -11.789 1.00 0.00 ? 69  VAL A H    4  
ATOM 5751  H HA   . VAL A 1 69  ? 1.636   -6.583  -11.806 1.00 0.00 ? 69  VAL A HA   4  
ATOM 5752  H HB   . VAL A 1 69  ? -0.756  -8.284  -12.441 1.00 0.00 ? 69  VAL A HB   4  
ATOM 5753  H HG11 . VAL A 1 69  ? -1.791  -6.136  -13.309 1.00 0.00 ? 69  VAL A HG11 4  
ATOM 5754  H HG12 . VAL A 1 69  ? -1.793  -6.358  -11.558 1.00 0.00 ? 69  VAL A HG12 4  
ATOM 5755  H HG13 . VAL A 1 69  ? -0.614  -5.283  -12.311 1.00 0.00 ? 69  VAL A HG13 4  
ATOM 5756  H HG21 . VAL A 1 69  ? 0.725   -6.379  -14.228 1.00 0.00 ? 69  VAL A HG21 4  
ATOM 5757  H HG22 . VAL A 1 69  ? 1.283   -8.031  -13.962 1.00 0.00 ? 69  VAL A HG22 4  
ATOM 5758  H HG23 . VAL A 1 69  ? -0.302  -7.740  -14.678 1.00 0.00 ? 69  VAL A HG23 4  
ATOM 5759  N N    . ARG A 1 70  ? -0.555  -7.673  -9.582  1.00 0.00 ? 70  ARG A N    4  
ATOM 5760  C CA   . ARG A 1 70  ? -1.215  -7.339  -8.326  1.00 0.00 ? 70  ARG A CA   4  
ATOM 5761  C C    . ARG A 1 70  ? -0.243  -6.663  -7.364  1.00 0.00 ? 70  ARG A C    4  
ATOM 5762  O O    . ARG A 1 70  ? -0.519  -5.581  -6.844  1.00 0.00 ? 70  ARG A O    4  
ATOM 5763  C CB   . ARG A 1 70  ? -1.797  -8.597  -7.680  1.00 0.00 ? 70  ARG A CB   4  
ATOM 5764  C CG   . ARG A 1 70  ? -2.802  -9.324  -8.558  1.00 0.00 ? 70  ARG A CG   4  
ATOM 5765  C CD   . ARG A 1 70  ? -4.216  -8.814  -8.327  1.00 0.00 ? 70  ARG A CD   4  
ATOM 5766  N NE   . ARG A 1 70  ? -5.061  -8.992  -9.505  1.00 0.00 ? 70  ARG A NE   4  
ATOM 5767  C CZ   . ARG A 1 70  ? -5.000  -8.212  -10.578 1.00 0.00 ? 70  ARG A CZ   4  
ATOM 5768  N NH1  . ARG A 1 70  ? -4.138  -7.206  -10.622 1.00 0.00 ? 70  ARG A NH1  4  
ATOM 5769  N NH2  . ARG A 1 70  ? -5.803  -8.437  -11.610 1.00 0.00 ? 70  ARG A NH2  4  
ATOM 5770  H H    . ARG A 1 70  ? -0.724  -8.547  -9.992  1.00 0.00 ? 70  ARG A H    4  
ATOM 5771  H HA   . ARG A 1 70  ? -2.020  -6.653  -8.546  1.00 0.00 ? 70  ARG A HA   4  
ATOM 5772  H HB2  . ARG A 1 70  ? -0.990  -9.279  -7.455  1.00 0.00 ? 70  ARG A HB2  4  
ATOM 5773  H HB3  . ARG A 1 70  ? -2.290  -8.320  -6.760  1.00 0.00 ? 70  ARG A HB3  4  
ATOM 5774  H HG2  . ARG A 1 70  ? -2.540  -9.168  -9.594  1.00 0.00 ? 70  ARG A HG2  4  
ATOM 5775  H HG3  . ARG A 1 70  ? -2.768  -10.379 -8.331  1.00 0.00 ? 70  ARG A HG3  4  
ATOM 5776  H HD2  . ARG A 1 70  ? -4.649  -9.356  -7.500  1.00 0.00 ? 70  ARG A HD2  4  
ATOM 5777  H HD3  . ARG A 1 70  ? -4.169  -7.763  -8.084  1.00 0.00 ? 70  ARG A HD3  4  
ATOM 5778  H HE   . ARG A 1 70  ? -5.706  -9.729  -9.493  1.00 0.00 ? 70  ARG A HE   4  
ATOM 5779  H HH11 . ARG A 1 70  ? -3.531  -7.034  -9.846  1.00 0.00 ? 70  ARG A HH11 4  
ATOM 5780  H HH12 . ARG A 1 70  ? -4.093  -6.620  -11.432 1.00 0.00 ? 70  ARG A HH12 4  
ATOM 5781  H HH21 . ARG A 1 70  ? -6.454  -9.195  -11.581 1.00 0.00 ? 70  ARG A HH21 4  
ATOM 5782  H HH22 . ARG A 1 70  ? -5.756  -7.850  -12.418 1.00 0.00 ? 70  ARG A HH22 4  
ATOM 5783  N N    . VAL A 1 71  ? 0.895   -7.308  -7.131  1.00 0.00 ? 71  VAL A N    4  
ATOM 5784  C CA   . VAL A 1 71  ? 1.909   -6.770  -6.231  1.00 0.00 ? 71  VAL A CA   4  
ATOM 5785  C C    . VAL A 1 71  ? 2.487   -5.466  -6.772  1.00 0.00 ? 71  VAL A C    4  
ATOM 5786  O O    . VAL A 1 71  ? 2.670   -4.501  -6.029  1.00 0.00 ? 71  VAL A O    4  
ATOM 5787  C CB   . VAL A 1 71  ? 3.056   -7.775  -6.012  1.00 0.00 ? 71  VAL A CB   4  
ATOM 5788  C CG1  . VAL A 1 71  ? 3.907   -7.362  -4.821  1.00 0.00 ? 71  VAL A CG1  4  
ATOM 5789  C CG2  . VAL A 1 71  ? 2.504   -9.179  -5.822  1.00 0.00 ? 71  VAL A CG2  4  
ATOM 5790  H H    . VAL A 1 71  ? 1.058   -8.166  -7.575  1.00 0.00 ? 71  VAL A H    4  
ATOM 5791  H HA   . VAL A 1 71  ? 1.441   -6.576  -5.277  1.00 0.00 ? 71  VAL A HA   4  
ATOM 5792  H HB   . VAL A 1 71  ? 3.682   -7.773  -6.892  1.00 0.00 ? 71  VAL A HB   4  
ATOM 5793  H HG11 . VAL A 1 71  ? 3.725   -6.322  -4.592  1.00 0.00 ? 71  VAL A HG11 4  
ATOM 5794  H HG12 . VAL A 1 71  ? 3.650   -7.971  -3.967  1.00 0.00 ? 71  VAL A HG12 4  
ATOM 5795  H HG13 . VAL A 1 71  ? 4.951   -7.499  -5.061  1.00 0.00 ? 71  VAL A HG13 4  
ATOM 5796  H HG21 . VAL A 1 71  ? 1.426   -9.137  -5.762  1.00 0.00 ? 71  VAL A HG21 4  
ATOM 5797  H HG22 . VAL A 1 71  ? 2.793   -9.797  -6.661  1.00 0.00 ? 71  VAL A HG22 4  
ATOM 5798  H HG23 . VAL A 1 71  ? 2.899   -9.602  -4.911  1.00 0.00 ? 71  VAL A HG23 4  
ATOM 5799  N N    . TYR A 1 72  ? 2.771   -5.445  -8.069  1.00 0.00 ? 72  TYR A N    4  
ATOM 5800  C CA   . TYR A 1 72  ? 3.330   -4.260  -8.709  1.00 0.00 ? 72  TYR A CA   4  
ATOM 5801  C C    . TYR A 1 72  ? 2.484   -3.027  -8.407  1.00 0.00 ? 72  TYR A C    4  
ATOM 5802  O O    . TYR A 1 72  ? 3.009   -1.973  -8.052  1.00 0.00 ? 72  TYR A O    4  
ATOM 5803  C CB   . TYR A 1 72  ? 3.425   -4.469  -10.222 1.00 0.00 ? 72  TYR A CB   4  
ATOM 5804  C CG   . TYR A 1 72  ? 3.556   -3.182  -11.004 1.00 0.00 ? 72  TYR A CG   4  
ATOM 5805  C CD1  . TYR A 1 72  ? 2.457   -2.355  -11.207 1.00 0.00 ? 72  TYR A CD1  4  
ATOM 5806  C CD2  . TYR A 1 72  ? 4.777   -2.792  -11.540 1.00 0.00 ? 72  TYR A CD2  4  
ATOM 5807  C CE1  . TYR A 1 72  ? 2.571   -1.178  -11.922 1.00 0.00 ? 72  TYR A CE1  4  
ATOM 5808  C CE2  . TYR A 1 72  ? 4.900   -1.616  -12.254 1.00 0.00 ? 72  TYR A CE2  4  
ATOM 5809  C CZ   . TYR A 1 72  ? 3.795   -0.813  -12.443 1.00 0.00 ? 72  TYR A CZ   4  
ATOM 5810  O OH   . TYR A 1 72  ? 3.914   0.358   -13.155 1.00 0.00 ? 72  TYR A OH   4  
ATOM 5811  H H    . TYR A 1 72  ? 2.603   -6.245  -8.609  1.00 0.00 ? 72  TYR A H    4  
ATOM 5812  H HA   . TYR A 1 72  ? 4.324   -4.107  -8.314  1.00 0.00 ? 72  TYR A HA   4  
ATOM 5813  H HB2  . TYR A 1 72  ? 4.288   -5.078  -10.441 1.00 0.00 ? 72  TYR A HB2  4  
ATOM 5814  H HB3  . TYR A 1 72  ? 2.536   -4.977  -10.565 1.00 0.00 ? 72  TYR A HB3  4  
ATOM 5815  H HD1  . TYR A 1 72  ? 1.500   -2.644  -10.798 1.00 0.00 ? 72  TYR A HD1  4  
ATOM 5816  H HD2  . TYR A 1 72  ? 5.640   -3.424  -11.391 1.00 0.00 ? 72  TYR A HD2  4  
ATOM 5817  H HE1  . TYR A 1 72  ? 1.706   -0.549  -12.069 1.00 0.00 ? 72  TYR A HE1  4  
ATOM 5818  H HE2  . TYR A 1 72  ? 5.858   -1.330  -12.663 1.00 0.00 ? 72  TYR A HE2  4  
ATOM 5819  H HH   . TYR A 1 72  ? 4.772   0.386   -13.584 1.00 0.00 ? 72  TYR A HH   4  
ATOM 5820  N N    . ASN A 1 73  ? 1.170   -3.169  -8.551  1.00 0.00 ? 73  ASN A N    4  
ATOM 5821  C CA   . ASN A 1 73  ? 0.250   -2.068  -8.294  1.00 0.00 ? 73  ASN A CA   4  
ATOM 5822  C C    . ASN A 1 73  ? 0.307   -1.642  -6.830  1.00 0.00 ? 73  ASN A C    4  
ATOM 5823  O O    . ASN A 1 73  ? 0.518   -0.469  -6.522  1.00 0.00 ? 73  ASN A O    4  
ATOM 5824  C CB   . ASN A 1 73  ? -1.179  -2.473  -8.664  1.00 0.00 ? 73  ASN A CB   4  
ATOM 5825  C CG   . ASN A 1 73  ? -1.468  -2.287  -10.141 1.00 0.00 ? 73  ASN A CG   4  
ATOM 5826  O OD1  . ASN A 1 73  ? -1.718  -1.173  -10.600 1.00 0.00 ? 73  ASN A OD1  4  
ATOM 5827  N ND2  . ASN A 1 73  ? -1.436  -3.382  -10.892 1.00 0.00 ? 73  ASN A ND2  4  
ATOM 5828  H H    . ASN A 1 73  ? 0.811   -4.035  -8.837  1.00 0.00 ? 73  ASN A H    4  
ATOM 5829  H HA   . ASN A 1 73  ? 0.550   -1.234  -8.911  1.00 0.00 ? 73  ASN A HA   4  
ATOM 5830  H HB2  . ASN A 1 73  ? -1.327  -3.514  -8.416  1.00 0.00 ? 73  ASN A HB2  4  
ATOM 5831  H HB3  . ASN A 1 73  ? -1.875  -1.870  -8.100  1.00 0.00 ? 73  ASN A HB3  4  
ATOM 5832  H HD21 . ASN A 1 73  ? -1.230  -4.236  -10.457 1.00 0.00 ? 73  ASN A HD21 4  
ATOM 5833  H HD22 . ASN A 1 73  ? -1.618  -3.290  -11.850 1.00 0.00 ? 73  ASN A HD22 4  
ATOM 5834  N N    . TRP A 1 74  ? 0.118   -2.603  -5.932  1.00 0.00 ? 74  TRP A N    4  
ATOM 5835  C CA   . TRP A 1 74  ? 0.148   -2.328  -4.500  1.00 0.00 ? 74  TRP A CA   4  
ATOM 5836  C C    . TRP A 1 74  ? 1.369   -1.492  -4.132  1.00 0.00 ? 74  TRP A C    4  
ATOM 5837  O O    . TRP A 1 74  ? 1.260   -0.499  -3.413  1.00 0.00 ? 74  TRP A O    4  
ATOM 5838  C CB   . TRP A 1 74  ? 0.153   -3.636  -3.709  1.00 0.00 ? 74  TRP A CB   4  
ATOM 5839  C CG   . TRP A 1 74  ? 0.039   -3.435  -2.228  1.00 0.00 ? 74  TRP A CG   4  
ATOM 5840  C CD1  . TRP A 1 74  ? -1.109  -3.429  -1.488  1.00 0.00 ? 74  TRP A CD1  4  
ATOM 5841  C CD2  . TRP A 1 74  ? 1.113   -3.209  -1.309  1.00 0.00 ? 74  TRP A CD2  4  
ATOM 5842  N NE1  . TRP A 1 74  ? -0.813  -3.213  -0.163  1.00 0.00 ? 74  TRP A NE1  4  
ATOM 5843  C CE2  . TRP A 1 74  ? 0.543   -3.076  -0.027  1.00 0.00 ? 74  TRP A CE2  4  
ATOM 5844  C CE3  . TRP A 1 74  ? 2.500   -3.108  -1.443  1.00 0.00 ? 74  TRP A CE3  4  
ATOM 5845  C CZ2  . TRP A 1 74  ? 1.314   -2.846  1.109   1.00 0.00 ? 74  TRP A CZ2  4  
ATOM 5846  C CZ3  . TRP A 1 74  ? 3.264   -2.880  -0.314  1.00 0.00 ? 74  TRP A CZ3  4  
ATOM 5847  C CH2  . TRP A 1 74  ? 2.670   -2.751  0.949   1.00 0.00 ? 74  TRP A CH2  4  
ATOM 5848  H H    . TRP A 1 74  ? -0.046  -3.519  -6.240  1.00 0.00 ? 74  TRP A H    4  
ATOM 5849  H HA   . TRP A 1 74  ? -0.743  -1.771  -4.252  1.00 0.00 ? 74  TRP A HA   4  
ATOM 5850  H HB2  . TRP A 1 74  ? -0.679  -4.246  -4.027  1.00 0.00 ? 74  TRP A HB2  4  
ATOM 5851  H HB3  . TRP A 1 74  ? 1.076   -4.163  -3.904  1.00 0.00 ? 74  TRP A HB3  4  
ATOM 5852  H HD1  . TRP A 1 74  ? -2.097  -3.573  -1.897  1.00 0.00 ? 74  TRP A HD1  4  
ATOM 5853  H HE1  . TRP A 1 74  ? -1.467  -3.166  0.565   1.00 0.00 ? 74  TRP A HE1  4  
ATOM 5854  H HE3  . TRP A 1 74  ? 2.977   -3.205  -2.407  1.00 0.00 ? 74  TRP A HE3  4  
ATOM 5855  H HZ2  . TRP A 1 74  ? 0.871   -2.745  2.090   1.00 0.00 ? 74  TRP A HZ2  4  
ATOM 5856  H HZ3  . TRP A 1 74  ? 4.338   -2.799  -0.398  1.00 0.00 ? 74  TRP A HZ3  4  
ATOM 5857  H HH2  . TRP A 1 74  ? 3.305   -2.573  1.803   1.00 0.00 ? 74  TRP A HH2  4  
ATOM 5858  N N    . PHE A 1 75  ? 2.532   -1.900  -4.630  1.00 0.00 ? 75  PHE A N    4  
ATOM 5859  C CA   . PHE A 1 75  ? 3.774   -1.188  -4.353  1.00 0.00 ? 75  PHE A CA   4  
ATOM 5860  C C    . PHE A 1 75  ? 3.761   0.198   -4.991  1.00 0.00 ? 75  PHE A C    4  
ATOM 5861  O O    . PHE A 1 75  ? 4.178   1.180   -4.377  1.00 0.00 ? 75  PHE A O    4  
ATOM 5862  C CB   . PHE A 1 75  ? 4.971   -1.988  -4.870  1.00 0.00 ? 75  PHE A CB   4  
ATOM 5863  C CG   . PHE A 1 75  ? 5.488   -2.998  -3.885  1.00 0.00 ? 75  PHE A CG   4  
ATOM 5864  C CD1  . PHE A 1 75  ? 4.774   -4.156  -3.621  1.00 0.00 ? 75  PHE A CD1  4  
ATOM 5865  C CD2  . PHE A 1 75  ? 6.687   -2.789  -3.224  1.00 0.00 ? 75  PHE A CD2  4  
ATOM 5866  C CE1  . PHE A 1 75  ? 5.247   -5.086  -2.714  1.00 0.00 ? 75  PHE A CE1  4  
ATOM 5867  C CE2  . PHE A 1 75  ? 7.165   -3.716  -2.316  1.00 0.00 ? 75  PHE A CE2  4  
ATOM 5868  C CZ   . PHE A 1 75  ? 6.444   -4.866  -2.062  1.00 0.00 ? 75  PHE A CZ   4  
ATOM 5869  H H    . PHE A 1 75  ? 2.555   -2.699  -5.198  1.00 0.00 ? 75  PHE A H    4  
ATOM 5870  H HA   . PHE A 1 75  ? 3.860   -1.078  -3.283  1.00 0.00 ? 75  PHE A HA   4  
ATOM 5871  H HB2  . PHE A 1 75  ? 4.682   -2.517  -5.765  1.00 0.00 ? 75  PHE A HB2  4  
ATOM 5872  H HB3  . PHE A 1 75  ? 5.776   -1.307  -5.103  1.00 0.00 ? 75  PHE A HB3  4  
ATOM 5873  H HD1  . PHE A 1 75  ? 3.838   -4.329  -4.131  1.00 0.00 ? 75  PHE A HD1  4  
ATOM 5874  H HD2  . PHE A 1 75  ? 7.253   -1.889  -3.422  1.00 0.00 ? 75  PHE A HD2  4  
ATOM 5875  H HE1  . PHE A 1 75  ? 4.681   -5.984  -2.518  1.00 0.00 ? 75  PHE A HE1  4  
ATOM 5876  H HE2  . PHE A 1 75  ? 8.102   -3.541  -1.808  1.00 0.00 ? 75  PHE A HE2  4  
ATOM 5877  H HZ   . PHE A 1 75  ? 6.815   -5.591  -1.354  1.00 0.00 ? 75  PHE A HZ   4  
ATOM 5878  N N    . ALA A 1 76  ? 3.279   0.269   -6.227  1.00 0.00 ? 76  ALA A N    4  
ATOM 5879  C CA   . ALA A 1 76  ? 3.210   1.534   -6.948  1.00 0.00 ? 76  ALA A CA   4  
ATOM 5880  C C    . ALA A 1 76  ? 2.416   2.572   -6.162  1.00 0.00 ? 76  ALA A C    4  
ATOM 5881  O O    . ALA A 1 76  ? 2.829   3.724   -6.044  1.00 0.00 ? 76  ALA A O    4  
ATOM 5882  C CB   . ALA A 1 76  ? 2.592   1.325   -8.323  1.00 0.00 ? 76  ALA A CB   4  
ATOM 5883  H H    . ALA A 1 76  ? 2.961   -0.548  -6.664  1.00 0.00 ? 76  ALA A H    4  
ATOM 5884  H HA   . ALA A 1 76  ? 4.219   1.896   -7.086  1.00 0.00 ? 76  ALA A HA   4  
ATOM 5885  H HB1  . ALA A 1 76  ? 1.816   0.576   -8.258  1.00 0.00 ? 76  ALA A HB1  4  
ATOM 5886  H HB2  . ALA A 1 76  ? 2.167   2.254   -8.672  1.00 0.00 ? 76  ALA A HB2  4  
ATOM 5887  H HB3  . ALA A 1 76  ? 3.354   0.995   -9.013  1.00 0.00 ? 76  ALA A HB3  4  
ATOM 5888  N N    . ASN A 1 77  ? 1.273   2.155   -5.627  1.00 0.00 ? 77  ASN A N    4  
ATOM 5889  C CA   . ASN A 1 77  ? 0.420   3.049   -4.852  1.00 0.00 ? 77  ASN A CA   4  
ATOM 5890  C C    . ASN A 1 77  ? 1.115   3.483   -3.565  1.00 0.00 ? 77  ASN A C    4  
ATOM 5891  O O    . ASN A 1 77  ? 0.981   4.627   -3.131  1.00 0.00 ? 77  ASN A O    4  
ATOM 5892  C CB   . ASN A 1 77  ? -0.907  2.364   -4.523  1.00 0.00 ? 77  ASN A CB   4  
ATOM 5893  C CG   . ASN A 1 77  ? -2.025  3.358   -4.273  1.00 0.00 ? 77  ASN A CG   4  
ATOM 5894  O OD1  . ASN A 1 77  ? -2.211  3.830   -3.151  1.00 0.00 ? 77  ASN A OD1  4  
ATOM 5895  N ND2  . ASN A 1 77  ? -2.775  3.680   -5.320  1.00 0.00 ? 77  ASN A ND2  4  
ATOM 5896  H H    . ASN A 1 77  ? 0.996   1.223   -5.755  1.00 0.00 ? 77  ASN A H    4  
ATOM 5897  H HA   . ASN A 1 77  ? 0.224   3.923   -5.454  1.00 0.00 ? 77  ASN A HA   4  
ATOM 5898  H HB2  . ASN A 1 77  ? -1.193  1.730   -5.350  1.00 0.00 ? 77  ASN A HB2  4  
ATOM 5899  H HB3  . ASN A 1 77  ? -0.783  1.758   -3.638  1.00 0.00 ? 77  ASN A HB3  4  
ATOM 5900  H HD21 . ASN A 1 77  ? -2.568  3.264   -6.183  1.00 0.00 ? 77  ASN A HD21 4  
ATOM 5901  H HD22 . ASN A 1 77  ? -3.504  4.321   -5.187  1.00 0.00 ? 77  ASN A HD22 4  
ATOM 5902  N N    . ARG A 1 78  ? 1.857   2.562   -2.960  1.00 0.00 ? 78  ARG A N    4  
ATOM 5903  C CA   . ARG A 1 78  ? 2.571   2.849   -1.722  1.00 0.00 ? 78  ARG A CA   4  
ATOM 5904  C C    . ARG A 1 78  ? 3.690   3.858   -1.961  1.00 0.00 ? 78  ARG A C    4  
ATOM 5905  O O    . ARG A 1 78  ? 3.988   4.686   -1.100  1.00 0.00 ? 78  ARG A O    4  
ATOM 5906  C CB   . ARG A 1 78  ? 3.150   1.561   -1.131  1.00 0.00 ? 78  ARG A CB   4  
ATOM 5907  C CG   . ARG A 1 78  ? 2.095   0.524   -0.782  1.00 0.00 ? 78  ARG A CG   4  
ATOM 5908  C CD   . ARG A 1 78  ? 1.570   0.717   0.632   1.00 0.00 ? 78  ARG A CD   4  
ATOM 5909  N NE   . ARG A 1 78  ? 0.460   1.665   0.679   1.00 0.00 ? 78  ARG A NE   4  
ATOM 5910  C CZ   . ARG A 1 78  ? -0.391  1.750   1.696   1.00 0.00 ? 78  ARG A CZ   4  
ATOM 5911  N NH1  . ARG A 1 78  ? -0.259  0.949   2.744   1.00 0.00 ? 78  ARG A NH1  4  
ATOM 5912  N NH2  . ARG A 1 78  ? -1.376  2.638   1.666   1.00 0.00 ? 78  ARG A NH2  4  
ATOM 5913  H H    . ARG A 1 78  ? 1.925   1.667   -3.354  1.00 0.00 ? 78  ARG A H    4  
ATOM 5914  H HA   . ARG A 1 78  ? 1.866   3.270   -1.021  1.00 0.00 ? 78  ARG A HA   4  
ATOM 5915  H HB2  . ARG A 1 78  ? 3.829   1.124   -1.848  1.00 0.00 ? 78  ARG A HB2  4  
ATOM 5916  H HB3  . ARG A 1 78  ? 3.695   1.805   -0.232  1.00 0.00 ? 78  ARG A HB3  4  
ATOM 5917  H HG2  . ARG A 1 78  ? 1.271   0.614   -1.475  1.00 0.00 ? 78  ARG A HG2  4  
ATOM 5918  H HG3  . ARG A 1 78  ? 2.531   -0.461  -0.864  1.00 0.00 ? 78  ARG A HG3  4  
ATOM 5919  H HD2  . ARG A 1 78  ? 1.233   -0.236  1.010   1.00 0.00 ? 78  ARG A HD2  4  
ATOM 5920  H HD3  . ARG A 1 78  ? 2.374   1.086   1.252   1.00 0.00 ? 78  ARG A HD3  4  
ATOM 5921  H HE   . ARG A 1 78  ? 0.344   2.267   -0.085  1.00 0.00 ? 78  ARG A HE   4  
ATOM 5922  H HH11 . ARG A 1 78  ? 0.483   0.279   2.770   1.00 0.00 ? 78  ARG A HH11 4  
ATOM 5923  H HH12 . ARG A 1 78  ? -0.900  1.016   3.509   1.00 0.00 ? 78  ARG A HH12 4  
ATOM 5924  H HH21 . ARG A 1 78  ? -1.478  3.244   0.877   1.00 0.00 ? 78  ARG A HH21 4  
ATOM 5925  H HH22 . ARG A 1 78  ? -2.015  2.702   2.431   1.00 0.00 ? 78  ARG A HH22 4  
ATOM 5926  N N    . ARG A 1 79  ? 4.307   3.782   -3.136  1.00 0.00 ? 79  ARG A N    4  
ATOM 5927  C CA   . ARG A 1 79  ? 5.394   4.688   -3.489  1.00 0.00 ? 79  ARG A CA   4  
ATOM 5928  C C    . ARG A 1 79  ? 4.850   5.997   -4.053  1.00 0.00 ? 79  ARG A C    4  
ATOM 5929  O O    . ARG A 1 79  ? 5.522   7.028   -4.018  1.00 0.00 ? 79  ARG A O    4  
ATOM 5930  C CB   . ARG A 1 79  ? 6.325   4.029   -4.508  1.00 0.00 ? 79  ARG A CB   4  
ATOM 5931  C CG   . ARG A 1 79  ? 7.452   3.229   -3.875  1.00 0.00 ? 79  ARG A CG   4  
ATOM 5932  C CD   . ARG A 1 79  ? 8.302   2.535   -4.928  1.00 0.00 ? 79  ARG A CD   4  
ATOM 5933  N NE   . ARG A 1 79  ? 7.487   1.944   -5.986  1.00 0.00 ? 79  ARG A NE   4  
ATOM 5934  C CZ   . ARG A 1 79  ? 7.077   2.612   -7.059  1.00 0.00 ? 79  ARG A CZ   4  
ATOM 5935  N NH1  . ARG A 1 79  ? 7.405   3.888   -7.214  1.00 0.00 ? 79  ARG A NH1  4  
ATOM 5936  N NH2  . ARG A 1 79  ? 6.338   2.005   -7.978  1.00 0.00 ? 79  ARG A NH2  4  
ATOM 5937  H H    . ARG A 1 79  ? 4.025   3.101   -3.782  1.00 0.00 ? 79  ARG A H    4  
ATOM 5938  H HA   . ARG A 1 79  ? 5.952   4.901   -2.590  1.00 0.00 ? 79  ARG A HA   4  
ATOM 5939  H HB2  . ARG A 1 79  ? 5.745   3.362   -5.130  1.00 0.00 ? 79  ARG A HB2  4  
ATOM 5940  H HB3  . ARG A 1 79  ? 6.762   4.797   -5.128  1.00 0.00 ? 79  ARG A HB3  4  
ATOM 5941  H HG2  . ARG A 1 79  ? 8.080   3.898   -3.306  1.00 0.00 ? 79  ARG A HG2  4  
ATOM 5942  H HG3  . ARG A 1 79  ? 7.028   2.484   -3.219  1.00 0.00 ? 79  ARG A HG3  4  
ATOM 5943  H HD2  . ARG A 1 79  ? 8.972   3.259   -5.366  1.00 0.00 ? 79  ARG A HD2  4  
ATOM 5944  H HD3  . ARG A 1 79  ? 8.876   1.755   -4.451  1.00 0.00 ? 79  ARG A HD3  4  
ATOM 5945  H HE   . ARG A 1 79  ? 7.233   1.002   -5.892  1.00 0.00 ? 79  ARG A HE   4  
ATOM 5946  H HH11 . ARG A 1 79  ? 7.962   4.348   -6.523  1.00 0.00 ? 79  ARG A HH11 4  
ATOM 5947  H HH12 . ARG A 1 79  ? 7.096   4.388   -8.023  1.00 0.00 ? 79  ARG A HH12 4  
ATOM 5948  H HH21 . ARG A 1 79  ? 6.089   1.044   -7.865  1.00 0.00 ? 79  ARG A HH21 4  
ATOM 5949  H HH22 . ARG A 1 79  ? 6.030   2.509   -8.785  1.00 0.00 ? 79  ARG A HH22 4  
ATOM 5950  N N    . LYS A 1 80  ? 3.628   5.949   -4.572  1.00 0.00 ? 80  LYS A N    4  
ATOM 5951  C CA   . LYS A 1 80  ? 2.991   7.130   -5.144  1.00 0.00 ? 80  LYS A CA   4  
ATOM 5952  C C    . LYS A 1 80  ? 2.404   8.014   -4.049  1.00 0.00 ? 80  LYS A C    4  
ATOM 5953  O O    . LYS A 1 80  ? 2.374   9.238   -4.177  1.00 0.00 ? 80  LYS A O    4  
ATOM 5954  C CB   . LYS A 1 80  ? 1.892   6.717   -6.125  1.00 0.00 ? 80  LYS A CB   4  
ATOM 5955  C CG   . LYS A 1 80  ? 2.406   6.418   -7.523  1.00 0.00 ? 80  LYS A CG   4  
ATOM 5956  C CD   . LYS A 1 80  ? 1.298   5.905   -8.427  1.00 0.00 ? 80  LYS A CD   4  
ATOM 5957  C CE   . LYS A 1 80  ? 0.450   7.045   -8.972  1.00 0.00 ? 80  LYS A CE   4  
ATOM 5958  N NZ   . LYS A 1 80  ? -0.536  6.570   -9.980  1.00 0.00 ? 80  LYS A NZ   4  
ATOM 5959  H H    . LYS A 1 80  ? 3.141   5.097   -4.571  1.00 0.00 ? 80  LYS A H    4  
ATOM 5960  H HA   . LYS A 1 80  ? 3.746   7.689   -5.675  1.00 0.00 ? 80  LYS A HA   4  
ATOM 5961  H HB2  . LYS A 1 80  ? 1.402   5.833   -5.747  1.00 0.00 ? 80  LYS A HB2  4  
ATOM 5962  H HB3  . LYS A 1 80  ? 1.169   7.518   -6.194  1.00 0.00 ? 80  LYS A HB3  4  
ATOM 5963  H HG2  . LYS A 1 80  ? 2.813   7.323   -7.949  1.00 0.00 ? 80  LYS A HG2  4  
ATOM 5964  H HG3  . LYS A 1 80  ? 3.182   5.668   -7.459  1.00 0.00 ? 80  LYS A HG3  4  
ATOM 5965  H HD2  . LYS A 1 80  ? 1.738   5.372   -9.256  1.00 0.00 ? 80  LYS A HD2  4  
ATOM 5966  H HD3  . LYS A 1 80  ? 0.665   5.236   -7.861  1.00 0.00 ? 80  LYS A HD3  4  
ATOM 5967  H HE2  . LYS A 1 80  ? -0.079  7.506   -8.152  1.00 0.00 ? 80  LYS A HE2  4  
ATOM 5968  H HE3  . LYS A 1 80  ? 1.102   7.772   -9.433  1.00 0.00 ? 80  LYS A HE3  4  
ATOM 5969  H HZ1  . LYS A 1 80  ? -0.618  7.261   -10.753 1.00 0.00 ? 80  LYS A HZ1  4  
ATOM 5970  H HZ2  . LYS A 1 80  ? -1.470  6.450   -9.538  1.00 0.00 ? 80  LYS A HZ2  4  
ATOM 5971  H HZ3  . LYS A 1 80  ? -0.232  5.657   -10.376 1.00 0.00 ? 80  LYS A HZ3  4  
ATOM 5972  N N    . GLU A 1 81  ? 1.940   7.387   -2.972  1.00 0.00 ? 81  GLU A N    4  
ATOM 5973  C CA   . GLU A 1 81  ? 1.354   8.119   -1.856  1.00 0.00 ? 81  GLU A CA   4  
ATOM 5974  C C    . GLU A 1 81  ? 2.436   8.816   -1.035  1.00 0.00 ? 81  GLU A C    4  
ATOM 5975  O O    . GLU A 1 81  ? 2.276   9.966   -0.628  1.00 0.00 ? 81  GLU A O    4  
ATOM 5976  C CB   . GLU A 1 81  ? 0.550   7.173   -0.962  1.00 0.00 ? 81  GLU A CB   4  
ATOM 5977  C CG   . GLU A 1 81  ? 1.415   6.271   -0.097  1.00 0.00 ? 81  GLU A CG   4  
ATOM 5978  C CD   . GLU A 1 81  ? 0.597   5.321   0.756   1.00 0.00 ? 81  GLU A CD   4  
ATOM 5979  O OE1  . GLU A 1 81  ? -0.451  5.751   1.283   1.00 0.00 ? 81  GLU A OE1  4  
ATOM 5980  O OE2  . GLU A 1 81  ? 1.003   4.150   0.898   1.00 0.00 ? 81  GLU A OE2  4  
ATOM 5981  H H    . GLU A 1 81  ? 1.992   6.410   -2.929  1.00 0.00 ? 81  GLU A H    4  
ATOM 5982  H HA   . GLU A 1 81  ? 0.690   8.867   -2.261  1.00 0.00 ? 81  GLU A HA   4  
ATOM 5983  H HB2  . GLU A 1 81  ? -0.083  7.760   -0.313  1.00 0.00 ? 81  GLU A HB2  4  
ATOM 5984  H HB3  . GLU A 1 81  ? -0.071  6.548   -1.587  1.00 0.00 ? 81  GLU A HB3  4  
ATOM 5985  H HG2  . GLU A 1 81  ? 2.060   5.689   -0.738  1.00 0.00 ? 81  GLU A HG2  4  
ATOM 5986  H HG3  . GLU A 1 81  ? 2.018   6.887   0.553   1.00 0.00 ? 81  GLU A HG3  4  
ATOM 5987  N N    . GLU A 1 82  ? 3.536   8.108   -0.794  1.00 0.00 ? 82  GLU A N    4  
ATOM 5988  C CA   . GLU A 1 82  ? 4.643   8.658   -0.021  1.00 0.00 ? 82  GLU A CA   4  
ATOM 5989  C C    . GLU A 1 82  ? 5.247   9.871   -0.722  1.00 0.00 ? 82  GLU A C    4  
ATOM 5990  O O    . GLU A 1 82  ? 5.606   10.858  -0.080  1.00 0.00 ? 82  GLU A O    4  
ATOM 5991  C CB   . GLU A 1 82  ? 5.719   7.593   0.199   1.00 0.00 ? 82  GLU A CB   4  
ATOM 5992  C CG   . GLU A 1 82  ? 6.368   7.109   -1.087  1.00 0.00 ? 82  GLU A CG   4  
ATOM 5993  C CD   . GLU A 1 82  ? 7.446   6.071   -0.843  1.00 0.00 ? 82  GLU A CD   4  
ATOM 5994  O OE1  . GLU A 1 82  ? 7.134   5.024   -0.238  1.00 0.00 ? 82  GLU A OE1  4  
ATOM 5995  O OE2  . GLU A 1 82  ? 8.601   6.306   -1.255  1.00 0.00 ? 82  GLU A OE2  4  
ATOM 5996  H H    . GLU A 1 82  ? 3.604   7.196   -1.145  1.00 0.00 ? 82  GLU A H    4  
ATOM 5997  H HA   . GLU A 1 82  ? 4.256   8.968   0.938   1.00 0.00 ? 82  GLU A HA   4  
ATOM 5998  H HB2  . GLU A 1 82  ? 6.490   8.003   0.835   1.00 0.00 ? 82  GLU A HB2  4  
ATOM 5999  H HB3  . GLU A 1 82  ? 5.272   6.743   0.693   1.00 0.00 ? 82  GLU A HB3  4  
ATOM 6000  H HG2  . GLU A 1 82  ? 5.607   6.673   -1.718  1.00 0.00 ? 82  GLU A HG2  4  
ATOM 6001  H HG3  . GLU A 1 82  ? 6.810   7.955   -1.593  1.00 0.00 ? 82  GLU A HG3  4  
ATOM 6002  N N    . ALA A 1 83  ? 5.357   9.789   -2.044  1.00 0.00 ? 83  ALA A N    4  
ATOM 6003  C CA   . ALA A 1 83  ? 5.917   10.879  -2.833  1.00 0.00 ? 83  ALA A CA   4  
ATOM 6004  C C    . ALA A 1 83  ? 4.892   11.988  -3.041  1.00 0.00 ? 83  ALA A C    4  
ATOM 6005  O O    . ALA A 1 83  ? 5.244   13.117  -3.384  1.00 0.00 ? 83  ALA A O    4  
ATOM 6006  C CB   . ALA A 1 83  ? 6.414   10.359  -4.174  1.00 0.00 ? 83  ALA A CB   4  
ATOM 6007  H H    . ALA A 1 83  ? 5.054   8.976   -2.499  1.00 0.00 ? 83  ALA A H    4  
ATOM 6008  H HA   . ALA A 1 83  ? 6.763   11.281  -2.295  1.00 0.00 ? 83  ALA A HA   4  
ATOM 6009  H HB1  . ALA A 1 83  ? 5.820   10.788  -4.968  1.00 0.00 ? 83  ALA A HB1  4  
ATOM 6010  H HB2  . ALA A 1 83  ? 7.449   10.637  -4.307  1.00 0.00 ? 83  ALA A HB2  4  
ATOM 6011  H HB3  . ALA A 1 83  ? 6.324   9.283   -4.198  1.00 0.00 ? 83  ALA A HB3  4  
ATOM 6012  N N    . PHE A 1 84  ? 3.621   11.660  -2.833  1.00 0.00 ? 84  PHE A N    4  
ATOM 6013  C CA   . PHE A 1 84  ? 2.544   12.629  -2.999  1.00 0.00 ? 84  PHE A CA   4  
ATOM 6014  C C    . PHE A 1 84  ? 2.799   13.876  -2.157  1.00 0.00 ? 84  PHE A C    4  
ATOM 6015  O O    . PHE A 1 84  ? 3.018   14.963  -2.691  1.00 0.00 ? 84  PHE A O    4  
ATOM 6016  C CB   . PHE A 1 84  ? 1.202   12.003  -2.611  1.00 0.00 ? 84  PHE A CB   4  
ATOM 6017  C CG   . PHE A 1 84  ? 0.015   12.752  -3.146  1.00 0.00 ? 84  PHE A CG   4  
ATOM 6018  C CD1  . PHE A 1 84  ? -0.272  14.032  -2.700  1.00 0.00 ? 84  PHE A CD1  4  
ATOM 6019  C CD2  . PHE A 1 84  ? -0.814  12.176  -4.095  1.00 0.00 ? 84  PHE A CD2  4  
ATOM 6020  C CE1  . PHE A 1 84  ? -1.364  14.723  -3.190  1.00 0.00 ? 84  PHE A CE1  4  
ATOM 6021  C CE2  . PHE A 1 84  ? -1.908  12.861  -4.589  1.00 0.00 ? 84  PHE A CE2  4  
ATOM 6022  C CZ   . PHE A 1 84  ? -2.182  14.137  -4.137  1.00 0.00 ? 84  PHE A CZ   4  
ATOM 6023  H H    . PHE A 1 84  ? 3.402   10.744  -2.561  1.00 0.00 ? 84  PHE A H    4  
ATOM 6024  H HA   . PHE A 1 84  ? 2.512   12.912  -4.040  1.00 0.00 ? 84  PHE A HA   4  
ATOM 6025  H HB2  . PHE A 1 84  ? 1.159   10.995  -2.996  1.00 0.00 ? 84  PHE A HB2  4  
ATOM 6026  H HB3  . PHE A 1 84  ? 1.123   11.978  -1.535  1.00 0.00 ? 84  PHE A HB3  4  
ATOM 6027  H HD1  . PHE A 1 84  ? 0.368   14.492  -1.961  1.00 0.00 ? 84  PHE A HD1  4  
ATOM 6028  H HD2  . PHE A 1 84  ? -0.600  11.177  -4.450  1.00 0.00 ? 84  PHE A HD2  4  
ATOM 6029  H HE1  . PHE A 1 84  ? -1.576  15.720  -2.835  1.00 0.00 ? 84  PHE A HE1  4  
ATOM 6030  H HE2  . PHE A 1 84  ? -2.546  12.401  -5.329  1.00 0.00 ? 84  PHE A HE2  4  
ATOM 6031  H HZ   . PHE A 1 84  ? -3.037  14.675  -4.521  1.00 0.00 ? 84  PHE A HZ   4  
ATOM 6032  N N    . ARG A 1 85  ? 2.767   13.709  -0.839  1.00 0.00 ? 85  ARG A N    4  
ATOM 6033  C CA   . ARG A 1 85  ? 2.993   14.820  0.077   1.00 0.00 ? 85  ARG A CA   4  
ATOM 6034  C C    . ARG A 1 85  ? 4.172   15.673  -0.383  1.00 0.00 ? 85  ARG A C    4  
ATOM 6035  O O    . ARG A 1 85  ? 4.265   16.853  -0.046  1.00 0.00 ? 85  ARG A O    4  
ATOM 6036  C CB   . ARG A 1 85  ? 3.248   14.298  1.492   1.00 0.00 ? 85  ARG A CB   4  
ATOM 6037  C CG   . ARG A 1 85  ? 1.984   13.873  2.221   1.00 0.00 ? 85  ARG A CG   4  
ATOM 6038  C CD   . ARG A 1 85  ? 2.276   13.490  3.664   1.00 0.00 ? 85  ARG A CD   4  
ATOM 6039  N NE   . ARG A 1 85  ? 2.929   12.188  3.764   1.00 0.00 ? 85  ARG A NE   4  
ATOM 6040  C CZ   . ARG A 1 85  ? 4.241   12.013  3.646   1.00 0.00 ? 85  ARG A CZ   4  
ATOM 6041  N NH1  . ARG A 1 85  ? 5.034   13.051  3.425   1.00 0.00 ? 85  ARG A NH1  4  
ATOM 6042  N NH2  . ARG A 1 85  ? 4.760   10.796  3.749   1.00 0.00 ? 85  ARG A NH2  4  
ATOM 6043  H H    . ARG A 1 85  ? 2.587   12.817  -0.474  1.00 0.00 ? 85  ARG A H    4  
ATOM 6044  H HA   . ARG A 1 85  ? 2.103   15.431  0.083   1.00 0.00 ? 85  ARG A HA   4  
ATOM 6045  H HB2  . ARG A 1 85  ? 3.909   13.445  1.436   1.00 0.00 ? 85  ARG A HB2  4  
ATOM 6046  H HB3  . ARG A 1 85  ? 3.726   15.076  2.069   1.00 0.00 ? 85  ARG A HB3  4  
ATOM 6047  H HG2  . ARG A 1 85  ? 1.282   14.692  2.213   1.00 0.00 ? 85  ARG A HG2  4  
ATOM 6048  H HG3  . ARG A 1 85  ? 1.555   13.023  1.712   1.00 0.00 ? 85  ARG A HG3  4  
ATOM 6049  H HD2  . ARG A 1 85  ? 2.921   14.240  4.098   1.00 0.00 ? 85  ARG A HD2  4  
ATOM 6050  H HD3  . ARG A 1 85  ? 1.344   13.458  4.209   1.00 0.00 ? 85  ARG A HD3  4  
ATOM 6051  H HE   . ARG A 1 85  ? 2.361   11.407  3.927   1.00 0.00 ? 85  ARG A HE   4  
ATOM 6052  H HH11 . ARG A 1 85  ? 4.645   13.969  3.347   1.00 0.00 ? 85  ARG A HH11 4  
ATOM 6053  H HH12 . ARG A 1 85  ? 6.022   12.917  3.337   1.00 0.00 ? 85  ARG A HH12 4  
ATOM 6054  H HH21 . ARG A 1 85  ? 4.165   10.011  3.915   1.00 0.00 ? 85  ARG A HH21 4  
ATOM 6055  H HH22 . ARG A 1 85  ? 5.747   10.665  3.659   1.00 0.00 ? 85  ARG A HH22 4  
ATOM 6056  N N    . GLN A 1 86  ? 5.070   15.066  -1.152  1.00 0.00 ? 86  GLN A N    4  
ATOM 6057  C CA   . GLN A 1 86  ? 6.243   15.770  -1.656  1.00 0.00 ? 86  GLN A CA   4  
ATOM 6058  C C    . GLN A 1 86  ? 5.946   16.435  -2.996  1.00 0.00 ? 86  GLN A C    4  
ATOM 6059  O O    . GLN A 1 86  ? 6.419   17.537  -3.273  1.00 0.00 ? 86  GLN A O    4  
ATOM 6060  C CB   . GLN A 1 86  ? 7.420   14.803  -1.804  1.00 0.00 ? 86  GLN A CB   4  
ATOM 6061  C CG   . GLN A 1 86  ? 7.594   13.871  -0.616  1.00 0.00 ? 86  GLN A CG   4  
ATOM 6062  C CD   . GLN A 1 86  ? 8.496   14.452  0.455   1.00 0.00 ? 86  GLN A CD   4  
ATOM 6063  O OE1  . GLN A 1 86  ? 9.392   15.245  0.165   1.00 0.00 ? 86  GLN A OE1  4  
ATOM 6064  N NE2  . GLN A 1 86  ? 8.262   14.061  1.703   1.00 0.00 ? 86  GLN A NE2  4  
ATOM 6065  H H    . GLN A 1 86  ? 4.941   14.124  -1.386  1.00 0.00 ? 86  GLN A H    4  
ATOM 6066  H HA   . GLN A 1 86  ? 6.505   16.534  -0.940  1.00 0.00 ? 86  GLN A HA   4  
ATOM 6067  H HB2  . GLN A 1 86  ? 7.267   14.201  -2.687  1.00 0.00 ? 86  GLN A HB2  4  
ATOM 6068  H HB3  . GLN A 1 86  ? 8.328   15.376  -1.920  1.00 0.00 ? 86  GLN A HB3  4  
ATOM 6069  H HG2  . GLN A 1 86  ? 6.624   13.677  -0.181  1.00 0.00 ? 86  GLN A HG2  4  
ATOM 6070  H HG3  . GLN A 1 86  ? 8.024   12.943  -0.963  1.00 0.00 ? 86  GLN A HG3  4  
ATOM 6071  H HE21 . GLN A 1 86  ? 7.531   13.426  1.859   1.00 0.00 ? 86  GLN A HE21 4  
ATOM 6072  H HE22 . GLN A 1 86  ? 8.830   14.421  2.414   1.00 0.00 ? 86  GLN A HE22 4  
ATOM 6073  N N    . LYS A 1 87  ? 5.158   15.758  -3.824  1.00 0.00 ? 87  LYS A N    4  
ATOM 6074  C CA   . LYS A 1 87  ? 4.795   16.283  -5.136  1.00 0.00 ? 87  LYS A CA   4  
ATOM 6075  C C    . LYS A 1 87  ? 4.008   17.582  -5.003  1.00 0.00 ? 87  LYS A C    4  
ATOM 6076  O O    . LYS A 1 87  ? 4.349   18.593  -5.619  1.00 0.00 ? 87  LYS A O    4  
ATOM 6077  C CB   . LYS A 1 87  ? 3.971   15.251  -5.910  1.00 0.00 ? 87  LYS A CB   4  
ATOM 6078  C CG   . LYS A 1 87  ? 3.272   15.824  -7.131  1.00 0.00 ? 87  LYS A CG   4  
ATOM 6079  C CD   . LYS A 1 87  ? 2.181   14.895  -7.636  1.00 0.00 ? 87  LYS A CD   4  
ATOM 6080  C CE   . LYS A 1 87  ? 1.009   14.834  -6.668  1.00 0.00 ? 87  LYS A CE   4  
ATOM 6081  N NZ   . LYS A 1 87  ? -0.277  14.565  -7.370  1.00 0.00 ? 87  LYS A NZ   4  
ATOM 6082  H H    . LYS A 1 87  ? 4.811   14.884  -3.547  1.00 0.00 ? 87  LYS A H    4  
ATOM 6083  H HA   . LYS A 1 87  ? 5.707   16.482  -5.677  1.00 0.00 ? 87  LYS A HA   4  
ATOM 6084  H HB2  . LYS A 1 87  ? 4.626   14.457  -6.236  1.00 0.00 ? 87  LYS A HB2  4  
ATOM 6085  H HB3  . LYS A 1 87  ? 3.220   14.840  -5.251  1.00 0.00 ? 87  LYS A HB3  4  
ATOM 6086  H HG2  . LYS A 1 87  ? 2.828   16.773  -6.868  1.00 0.00 ? 87  LYS A HG2  4  
ATOM 6087  H HG3  . LYS A 1 87  ? 4.000   15.971  -7.916  1.00 0.00 ? 87  LYS A HG3  4  
ATOM 6088  H HD2  . LYS A 1 87  ? 1.826   15.255  -8.590  1.00 0.00 ? 87  LYS A HD2  4  
ATOM 6089  H HD3  . LYS A 1 87  ? 2.592   13.902  -7.754  1.00 0.00 ? 87  LYS A HD3  4  
ATOM 6090  H HE2  . LYS A 1 87  ? 1.190   14.045  -5.953  1.00 0.00 ? 87  LYS A HE2  4  
ATOM 6091  H HE3  . LYS A 1 87  ? 0.936   15.779  -6.151  1.00 0.00 ? 87  LYS A HE3  4  
ATOM 6092  H HZ1  . LYS A 1 87  ? -0.137  14.610  -8.400  1.00 0.00 ? 87  LYS A HZ1  4  
ATOM 6093  H HZ2  . LYS A 1 87  ? -0.988  15.273  -7.097  1.00 0.00 ? 87  LYS A HZ2  4  
ATOM 6094  H HZ3  . LYS A 1 87  ? -0.630  13.620  -7.120  1.00 0.00 ? 87  LYS A HZ3  4  
ATOM 6095  N N    . LEU A 1 88  ? 2.954   17.550  -4.195  1.00 0.00 ? 88  LEU A N    4  
ATOM 6096  C CA   . LEU A 1 88  ? 2.118   18.726  -3.980  1.00 0.00 ? 88  LEU A CA   4  
ATOM 6097  C C    . LEU A 1 88  ? 2.943   19.887  -3.433  1.00 0.00 ? 88  LEU A C    4  
ATOM 6098  O O    . LEU A 1 88  ? 2.502   21.036  -3.448  1.00 0.00 ? 88  LEU A O    4  
ATOM 6099  C CB   . LEU A 1 88  ? 0.978   18.397  -3.015  1.00 0.00 ? 88  LEU A CB   4  
ATOM 6100  C CG   . LEU A 1 88  ? 1.374   17.666  -1.732  1.00 0.00 ? 88  LEU A CG   4  
ATOM 6101  C CD1  . LEU A 1 88  ? 2.194   18.576  -0.831  1.00 0.00 ? 88  LEU A CD1  4  
ATOM 6102  C CD2  . LEU A 1 88  ? 0.138   17.162  -1.001  1.00 0.00 ? 88  LEU A CD2  4  
ATOM 6103  H H    . LEU A 1 88  ? 2.731   16.716  -3.732  1.00 0.00 ? 88  LEU A H    4  
ATOM 6104  H HA   . LEU A 1 88  ? 1.700   19.015  -4.933  1.00 0.00 ? 88  LEU A HA   4  
ATOM 6105  H HB2  . LEU A 1 88  ? 0.504   19.325  -2.734  1.00 0.00 ? 88  LEU A HB2  4  
ATOM 6106  H HB3  . LEU A 1 88  ? 0.267   17.777  -3.544  1.00 0.00 ? 88  LEU A HB3  4  
ATOM 6107  H HG   . LEU A 1 88  ? 1.985   16.811  -1.986  1.00 0.00 ? 88  LEU A HG   4  
ATOM 6108  H HD11 . LEU A 1 88  ? 1.843   19.592  -0.929  1.00 0.00 ? 88  LEU A HD11 4  
ATOM 6109  H HD12 . LEU A 1 88  ? 3.234   18.526  -1.119  1.00 0.00 ? 88  LEU A HD12 4  
ATOM 6110  H HD13 . LEU A 1 88  ? 2.090   18.255  0.196   1.00 0.00 ? 88  LEU A HD13 4  
ATOM 6111  H HD21 . LEU A 1 88  ? 0.264   16.117  -0.760  1.00 0.00 ? 88  LEU A HD21 4  
ATOM 6112  H HD22 . LEU A 1 88  ? -0.729  17.284  -1.634  1.00 0.00 ? 88  LEU A HD22 4  
ATOM 6113  H HD23 . LEU A 1 88  ? 0.002   17.728  -0.091  1.00 0.00 ? 88  LEU A HD23 4  
ATOM 6114  N N    . ALA A 1 89  ? 4.143   19.579  -2.952  1.00 0.00 ? 89  ALA A N    4  
ATOM 6115  C CA   . ALA A 1 89  ? 5.031   20.597  -2.404  1.00 0.00 ? 89  ALA A CA   4  
ATOM 6116  C C    . ALA A 1 89  ? 5.837   21.273  -3.508  1.00 0.00 ? 89  ALA A C    4  
ATOM 6117  O O    . ALA A 1 89  ? 6.079   22.479  -3.462  1.00 0.00 ? 89  ALA A O    4  
ATOM 6118  C CB   . ALA A 1 89  ? 5.961   19.984  -1.369  1.00 0.00 ? 89  ALA A CB   4  
ATOM 6119  H H    . ALA A 1 89  ? 4.438   18.645  -2.967  1.00 0.00 ? 89  ALA A H    4  
ATOM 6120  H HA   . ALA A 1 89  ? 4.422   21.340  -1.910  1.00 0.00 ? 89  ALA A HA   4  
ATOM 6121  H HB1  . ALA A 1 89  ? 6.986   20.197  -1.636  1.00 0.00 ? 89  ALA A HB1  4  
ATOM 6122  H HB2  . ALA A 1 89  ? 5.747   20.405  -0.398  1.00 0.00 ? 89  ALA A HB2  4  
ATOM 6123  H HB3  . ALA A 1 89  ? 5.812   18.915  -1.339  1.00 0.00 ? 89  ALA A HB3  4  
ATOM 6124  N N    . MET A 1 90  ? 6.250   20.489  -4.498  1.00 0.00 ? 90  MET A N    4  
ATOM 6125  C CA   . MET A 1 90  ? 7.028   21.014  -5.614  1.00 0.00 ? 90  MET A CA   4  
ATOM 6126  C C    . MET A 1 90  ? 6.212   22.017  -6.423  1.00 0.00 ? 90  MET A C    4  
ATOM 6127  O O    . MET A 1 90  ? 6.725   23.055  -6.842  1.00 0.00 ? 90  MET A O    4  
ATOM 6128  C CB   . MET A 1 90  ? 7.497   19.872  -6.519  1.00 0.00 ? 90  MET A CB   4  
ATOM 6129  C CG   . MET A 1 90  ? 8.152   18.728  -5.763  1.00 0.00 ? 90  MET A CG   4  
ATOM 6130  S SD   . MET A 1 90  ? 8.770   17.436  -6.858  1.00 0.00 ? 90  MET A SD   4  
ATOM 6131  C CE   . MET A 1 90  ? 8.931   16.069  -5.712  1.00 0.00 ? 90  MET A CE   4  
ATOM 6132  H H    . MET A 1 90  ? 6.025   19.535  -4.480  1.00 0.00 ? 90  MET A H    4  
ATOM 6133  H HA   . MET A 1 90  ? 7.893   21.516  -5.207  1.00 0.00 ? 90  MET A HA   4  
ATOM 6134  H HB2  . MET A 1 90  ? 6.645   19.480  -7.054  1.00 0.00 ? 90  MET A HB2  4  
ATOM 6135  H HB3  . MET A 1 90  ? 8.211   20.261  -7.229  1.00 0.00 ? 90  MET A HB3  4  
ATOM 6136  H HG2  . MET A 1 90  ? 8.980   19.120  -5.189  1.00 0.00 ? 90  MET A HG2  4  
ATOM 6137  H HG3  . MET A 1 90  ? 7.425   18.295  -5.092  1.00 0.00 ? 90  MET A HG3  4  
ATOM 6138  H HE1  . MET A 1 90  ? 8.743   16.417  -4.707  1.00 0.00 ? 90  MET A HE1  4  
ATOM 6139  H HE2  . MET A 1 90  ? 8.215   15.301  -5.966  1.00 0.00 ? 90  MET A HE2  4  
ATOM 6140  H HE3  . MET A 1 90  ? 9.931   15.665  -5.772  1.00 0.00 ? 90  MET A HE3  4  
ATOM 6141  N N    . ASP A 1 91  ? 4.940   21.700  -6.639  1.00 0.00 ? 91  ASP A N    4  
ATOM 6142  C CA   . ASP A 1 91  ? 4.052   22.574  -7.397  1.00 0.00 ? 91  ASP A CA   4  
ATOM 6143  C C    . ASP A 1 91  ? 3.833   23.894  -6.664  1.00 0.00 ? 91  ASP A C    4  
ATOM 6144  O O    . ASP A 1 91  ? 4.272   24.064  -5.527  1.00 0.00 ? 91  ASP A O    4  
ATOM 6145  C CB   . ASP A 1 91  ? 2.710   21.884  -7.643  1.00 0.00 ? 91  ASP A CB   4  
ATOM 6146  C CG   . ASP A 1 91  ? 2.738   20.982  -8.862  1.00 0.00 ? 91  ASP A CG   4  
ATOM 6147  O OD1  . ASP A 1 91  ? 3.547   21.245  -9.776  1.00 0.00 ? 91  ASP A OD1  4  
ATOM 6148  O OD2  . ASP A 1 91  ? 1.951   20.013  -8.901  1.00 0.00 ? 91  ASP A OD2  4  
ATOM 6149  H H    . ASP A 1 91  ? 4.589   20.859  -6.279  1.00 0.00 ? 91  ASP A H    4  
ATOM 6150  H HA   . ASP A 1 91  ? 4.521   22.779  -8.348  1.00 0.00 ? 91  ASP A HA   4  
ATOM 6151  H HB2  . ASP A 1 91  ? 2.457   21.284  -6.781  1.00 0.00 ? 91  ASP A HB2  4  
ATOM 6152  H HB3  . ASP A 1 91  ? 1.948   22.635  -7.791  1.00 0.00 ? 91  ASP A HB3  4  
ATOM 6153  N N    . ALA A 1 92  ? 3.151   24.825  -7.323  1.00 0.00 ? 92  ALA A N    4  
ATOM 6154  C CA   . ALA A 1 92  ? 2.873   26.129  -6.734  1.00 0.00 ? 92  ALA A CA   4  
ATOM 6155  C C    . ALA A 1 92  ? 1.686   26.057  -5.779  1.00 0.00 ? 92  ALA A C    4  
ATOM 6156  O O    . ALA A 1 92  ? 0.961   25.062  -5.747  1.00 0.00 ? 92  ALA A O    4  
ATOM 6157  C CB   . ALA A 1 92  ? 2.613   27.156  -7.826  1.00 0.00 ? 92  ALA A CB   4  
ATOM 6158  H H    . ALA A 1 92  ? 2.827   24.630  -8.227  1.00 0.00 ? 92  ALA A H    4  
ATOM 6159  H HA   . ALA A 1 92  ? 3.748   26.439  -6.182  1.00 0.00 ? 92  ALA A HA   4  
ATOM 6160  H HB1  . ALA A 1 92  ? 2.056   27.985  -7.413  1.00 0.00 ? 92  ALA A HB1  4  
ATOM 6161  H HB2  . ALA A 1 92  ? 3.554   27.513  -8.215  1.00 0.00 ? 92  ALA A HB2  4  
ATOM 6162  H HB3  . ALA A 1 92  ? 2.043   26.700  -8.621  1.00 0.00 ? 92  ALA A HB3  4  
ATOM 6163  N N    . TYR A 1 93  ? 1.494   27.117  -5.002  1.00 0.00 ? 93  TYR A N    4  
ATOM 6164  C CA   . TYR A 1 93  ? 0.396   27.173  -4.043  1.00 0.00 ? 93  TYR A CA   4  
ATOM 6165  C C    . TYR A 1 93  ? -0.933  26.849  -4.717  1.00 0.00 ? 93  TYR A C    4  
ATOM 6166  O O    . TYR A 1 93  ? -1.254  27.390  -5.776  1.00 0.00 ? 93  TYR A O    4  
ATOM 6167  C CB   . TYR A 1 93  ? 0.328   28.556  -3.394  1.00 0.00 ? 93  TYR A CB   4  
ATOM 6168  C CG   . TYR A 1 93  ? 0.398   29.695  -4.387  1.00 0.00 ? 93  TYR A CG   4  
ATOM 6169  C CD1  . TYR A 1 93  ? 1.622   30.179  -4.833  1.00 0.00 ? 93  TYR A CD1  4  
ATOM 6170  C CD2  . TYR A 1 93  ? -0.759  30.285  -4.879  1.00 0.00 ? 93  TYR A CD2  4  
ATOM 6171  C CE1  . TYR A 1 93  ? 1.691   31.220  -5.739  1.00 0.00 ? 93  TYR A CE1  4  
ATOM 6172  C CE2  . TYR A 1 93  ? -0.700  31.325  -5.787  1.00 0.00 ? 93  TYR A CE2  4  
ATOM 6173  C CZ   . TYR A 1 93  ? 0.527   31.789  -6.213  1.00 0.00 ? 93  TYR A CZ   4  
ATOM 6174  O OH   . TYR A 1 93  ? 0.591   32.825  -7.117  1.00 0.00 ? 93  TYR A OH   4  
ATOM 6175  H H    . TYR A 1 93  ? 2.105   27.880  -5.073  1.00 0.00 ? 93  TYR A H    4  
ATOM 6176  H HA   . TYR A 1 93  ? 0.588   26.436  -3.277  1.00 0.00 ? 93  TYR A HA   4  
ATOM 6177  H HB2  . TYR A 1 93  ? -0.600  28.647  -2.852  1.00 0.00 ? 93  TYR A HB2  4  
ATOM 6178  H HB3  . TYR A 1 93  ? 1.153   28.665  -2.706  1.00 0.00 ? 93  TYR A HB3  4  
ATOM 6179  H HD1  . TYR A 1 93  ? 2.531   29.731  -4.460  1.00 0.00 ? 93  TYR A HD1  4  
ATOM 6180  H HD2  . TYR A 1 93  ? -1.719  29.920  -4.543  1.00 0.00 ? 93  TYR A HD2  4  
ATOM 6181  H HE1  . TYR A 1 93  ? 2.651   31.583  -6.074  1.00 0.00 ? 93  TYR A HE1  4  
ATOM 6182  H HE2  . TYR A 1 93  ? -1.610  31.772  -6.158  1.00 0.00 ? 93  TYR A HE2  4  
ATOM 6183  H HH   . TYR A 1 93  ? 1.510   33.007  -7.330  1.00 0.00 ? 93  TYR A HH   4  
ATOM 6184  N N    . SER A 1 94  ? -1.704  25.962  -4.096  1.00 0.00 ? 94  SER A N    4  
ATOM 6185  C CA   . SER A 1 94  ? -2.998  25.562  -4.636  1.00 0.00 ? 94  SER A CA   4  
ATOM 6186  C C    . SER A 1 94  ? -4.135  26.257  -3.893  1.00 0.00 ? 94  SER A C    4  
ATOM 6187  O O    . SER A 1 94  ? -4.297  26.087  -2.685  1.00 0.00 ? 94  SER A O    4  
ATOM 6188  C CB   . SER A 1 94  ? -3.166  24.044  -4.544  1.00 0.00 ? 94  SER A CB   4  
ATOM 6189  O OG   . SER A 1 94  ? -4.248  23.601  -5.344  1.00 0.00 ? 94  SER A OG   4  
ATOM 6190  H H    . SER A 1 94  ? -1.393  25.565  -3.255  1.00 0.00 ? 94  SER A H    4  
ATOM 6191  H HA   . SER A 1 94  ? -3.029  25.857  -5.674  1.00 0.00 ? 94  SER A HA   4  
ATOM 6192  H HB2  . SER A 1 94  ? -2.262  23.563  -4.884  1.00 0.00 ? 94  SER A HB2  4  
ATOM 6193  H HB3  . SER A 1 94  ? -3.356  23.768  -3.517  1.00 0.00 ? 94  SER A HB3  4  
ATOM 6194  H HG   . SER A 1 94  ? -5.024  24.136  -5.158  1.00 0.00 ? 94  SER A HG   4  
ATOM 6195  N N    . SER A 1 95  ? -4.920  27.041  -4.626  1.00 0.00 ? 95  SER A N    4  
ATOM 6196  C CA   . SER A 1 95  ? -6.040  27.766  -4.037  1.00 0.00 ? 95  SER A CA   4  
ATOM 6197  C C    . SER A 1 95  ? -7.062  26.799  -3.446  1.00 0.00 ? 95  SER A C    4  
ATOM 6198  O O    . SER A 1 95  ? -7.319  25.733  -4.004  1.00 0.00 ? 95  SER A O    4  
ATOM 6199  C CB   . SER A 1 95  ? -6.709  28.654  -5.088  1.00 0.00 ? 95  SER A CB   4  
ATOM 6200  O OG   . SER A 1 95  ? -7.321  29.782  -4.487  1.00 0.00 ? 95  SER A OG   4  
ATOM 6201  H H    . SER A 1 95  ? -4.739  27.136  -5.584  1.00 0.00 ? 95  SER A H    4  
ATOM 6202  H HA   . SER A 1 95  ? -5.652  28.389  -3.245  1.00 0.00 ? 95  SER A HA   4  
ATOM 6203  H HB2  . SER A 1 95  ? -5.966  28.995  -5.792  1.00 0.00 ? 95  SER A HB2  4  
ATOM 6204  H HB3  . SER A 1 95  ? -7.464  28.084  -5.609  1.00 0.00 ? 95  SER A HB3  4  
ATOM 6205  H HG   . SER A 1 95  ? -6.657  30.454  -4.318  1.00 0.00 ? 95  SER A HG   4  
ATOM 6206  N N    . ASN A 1 96  ? -7.642  27.181  -2.313  1.00 0.00 ? 96  ASN A N    4  
ATOM 6207  C CA   . ASN A 1 96  ? -8.636  26.349  -1.645  1.00 0.00 ? 96  ASN A CA   4  
ATOM 6208  C C    . ASN A 1 96  ? -9.873  26.172  -2.519  1.00 0.00 ? 96  ASN A C    4  
ATOM 6209  O O    . ASN A 1 96  ? -10.231 27.059  -3.294  1.00 0.00 ? 96  ASN A O    4  
ATOM 6210  C CB   . ASN A 1 96  ? -9.030  26.968  -0.302  1.00 0.00 ? 96  ASN A CB   4  
ATOM 6211  C CG   . ASN A 1 96  ? -7.825  27.330  0.544   1.00 0.00 ? 96  ASN A CG   4  
ATOM 6212  O OD1  . ASN A 1 96  ? -7.261  26.482  1.236   1.00 0.00 ? 96  ASN A OD1  4  
ATOM 6213  N ND2  . ASN A 1 96  ? -7.425  28.595  0.493   1.00 0.00 ? 96  ASN A ND2  4  
ATOM 6214  H H    . ASN A 1 96  ? -7.395  28.043  -1.916  1.00 0.00 ? 96  ASN A H    4  
ATOM 6215  H HA   . ASN A 1 96  ? -8.192  25.380  -1.468  1.00 0.00 ? 96  ASN A HA   4  
ATOM 6216  H HB2  . ASN A 1 96  ? -9.603  27.866  -0.481  1.00 0.00 ? 96  ASN A HB2  4  
ATOM 6217  H HB3  . ASN A 1 96  ? -9.636  26.264  0.248   1.00 0.00 ? 96  ASN A HB3  4  
ATOM 6218  H HD21 . ASN A 1 96  ? -7.923  29.215  -0.080  1.00 0.00 ? 96  ASN A HD21 4  
ATOM 6219  H HD22 . ASN A 1 96  ? -6.648  28.856  1.030   1.00 0.00 ? 96  ASN A HD22 4  
ATOM 6220  N N    . SER A 1 97  ? -10.523 25.020  -2.389  1.00 0.00 ? 97  SER A N    4  
ATOM 6221  C CA   . SER A 1 97  ? -11.719 24.724  -3.169  1.00 0.00 ? 97  SER A CA   4  
ATOM 6222  C C    . SER A 1 97  ? -12.925 24.517  -2.257  1.00 0.00 ? 97  SER A C    4  
ATOM 6223  O O    . SER A 1 97  ? -12.782 24.133  -1.097  1.00 0.00 ? 97  SER A O    4  
ATOM 6224  C CB   . SER A 1 97  ? -11.497 23.480  -4.031  1.00 0.00 ? 97  SER A CB   4  
ATOM 6225  O OG   . SER A 1 97  ? -10.630 23.760  -5.116  1.00 0.00 ? 97  SER A OG   4  
ATOM 6226  H H    . SER A 1 97  ? -10.189 24.352  -1.754  1.00 0.00 ? 97  SER A H    4  
ATOM 6227  H HA   . SER A 1 97  ? -11.912 25.569  -3.814  1.00 0.00 ? 97  SER A HA   4  
ATOM 6228  H HB2  . SER A 1 97  ? -11.059 22.701  -3.427  1.00 0.00 ? 97  SER A HB2  4  
ATOM 6229  H HB3  . SER A 1 97  ? -12.446 23.142  -4.422  1.00 0.00 ? 97  SER A HB3  4  
ATOM 6230  H HG   . SER A 1 97  ? -10.748 24.671  -5.394  1.00 0.00 ? 97  SER A HG   4  
ATOM 6231  N N    . GLY A 1 98  ? -14.115 24.774  -2.792  1.00 0.00 ? 98  GLY A N    4  
ATOM 6232  C CA   . GLY A 1 98  ? -15.329 24.610  -2.015  1.00 0.00 ? 98  GLY A CA   4  
ATOM 6233  C C    . GLY A 1 98  ? -16.395 23.833  -2.761  1.00 0.00 ? 98  GLY A C    4  
ATOM 6234  O O    . GLY A 1 98  ? -17.465 24.353  -3.078  1.00 0.00 ? 98  GLY A O    4  
ATOM 6235  H H    . GLY A 1 98  ? -14.169 25.078  -3.723  1.00 0.00 ? 98  GLY A H    4  
ATOM 6236  H HA2  . GLY A 1 98  ? -15.090 24.087  -1.101  1.00 0.00 ? 98  GLY A HA2  4  
ATOM 6237  H HA3  . GLY A 1 98  ? -15.719 25.587  -1.767  1.00 0.00 ? 98  GLY A HA3  4  
ATOM 6238  N N    . PRO A 1 99  ? -16.106 22.556  -3.054  1.00 0.00 ? 99  PRO A N    4  
ATOM 6239  C CA   . PRO A 1 99  ? -17.036 21.679  -3.772  1.00 0.00 ? 99  PRO A CA   4  
ATOM 6240  C C    . PRO A 1 99  ? -18.254 21.313  -2.931  1.00 0.00 ? 99  PRO A C    4  
ATOM 6241  O O    . PRO A 1 99  ? -18.123 20.769  -1.835  1.00 0.00 ? 99  PRO A O    4  
ATOM 6242  C CB   . PRO A 1 99  ? -16.194 20.434  -4.064  1.00 0.00 ? 99  PRO A CB   4  
ATOM 6243  C CG   . PRO A 1 99  ? -15.148 20.427  -3.004  1.00 0.00 ? 99  PRO A CG   4  
ATOM 6244  C CD   . PRO A 1 99  ? -14.851 21.871  -2.706  1.00 0.00 ? 99  PRO A CD   4  
ATOM 6245  H HA   . PRO A 1 99  ? -17.361 22.122  -4.702  1.00 0.00 ? 99  PRO A HA   4  
ATOM 6246  H HB2  . PRO A 1 99  ? -16.819 19.554  -4.010  1.00 0.00 ? 99  PRO A HB2  4  
ATOM 6247  H HB3  . PRO A 1 99  ? -15.758 20.513  -5.048  1.00 0.00 ? 99  PRO A HB3  4  
ATOM 6248  H HG2  . PRO A 1 99  ? -15.522 19.931  -2.122  1.00 0.00 ? 99  PRO A HG2  4  
ATOM 6249  H HG3  . PRO A 1 99  ? -14.260 19.930  -3.368  1.00 0.00 ? 99  PRO A HG3  4  
ATOM 6250  H HD2  . PRO A 1 99  ? -14.618 21.999  -1.659  1.00 0.00 ? 99  PRO A HD2  4  
ATOM 6251  H HD3  . PRO A 1 99  ? -14.036 22.223  -3.321  1.00 0.00 ? 99  PRO A HD3  4  
ATOM 6252  N N    . SER A 1 100 ? -19.439 21.615  -3.452  1.00 0.00 ? 100 SER A N    4  
ATOM 6253  C CA   . SER A 1 100 ? -20.681 21.320  -2.748  1.00 0.00 ? 100 SER A CA   4  
ATOM 6254  C C    . SER A 1 100 ? -20.844 19.818  -2.538  1.00 0.00 ? 100 SER A C    4  
ATOM 6255  O O    . SER A 1 100 ? -20.638 19.025  -3.457  1.00 0.00 ? 100 SER A O    4  
ATOM 6256  C CB   . SER A 1 100 ? -21.877 21.869  -3.528  1.00 0.00 ? 100 SER A CB   4  
ATOM 6257  O OG   . SER A 1 100 ? -22.062 21.163  -4.743  1.00 0.00 ? 100 SER A OG   4  
ATOM 6258  H H    . SER A 1 100 ? -19.478 22.048  -4.331  1.00 0.00 ? 100 SER A H    4  
ATOM 6259  H HA   . SER A 1 100 ? -20.638 21.804  -1.784  1.00 0.00 ? 100 SER A HA   4  
ATOM 6260  H HB2  . SER A 1 100 ? -22.770 21.771  -2.930  1.00 0.00 ? 100 SER A HB2  4  
ATOM 6261  H HB3  . SER A 1 100 ? -21.708 22.912  -3.754  1.00 0.00 ? 100 SER A HB3  4  
ATOM 6262  H HG   . SER A 1 100 ? -22.328 20.261  -4.552  1.00 0.00 ? 100 SER A HG   4  
ATOM 6263  N N    . SER A 1 101 ? -21.214 19.434  -1.320  1.00 0.00 ? 101 SER A N    4  
ATOM 6264  C CA   . SER A 1 101 ? -21.401 18.026  -0.986  1.00 0.00 ? 101 SER A CA   4  
ATOM 6265  C C    . SER A 1 101 ? -22.850 17.604  -1.205  1.00 0.00 ? 101 SER A C    4  
ATOM 6266  O O    . SER A 1 101 ? -23.759 18.433  -1.193  1.00 0.00 ? 101 SER A O    4  
ATOM 6267  C CB   . SER A 1 101 ? -20.995 17.767  0.466   1.00 0.00 ? 101 SER A CB   4  
ATOM 6268  O OG   . SER A 1 101 ? -19.621 18.049  0.670   1.00 0.00 ? 101 SER A OG   4  
ATOM 6269  H H    . SER A 1 101 ? -21.363 20.113  -0.630  1.00 0.00 ? 101 SER A H    4  
ATOM 6270  H HA   . SER A 1 101 ? -20.766 17.444  -1.638  1.00 0.00 ? 101 SER A HA   4  
ATOM 6271  H HB2  . SER A 1 101 ? -21.580 18.397  1.118   1.00 0.00 ? 101 SER A HB2  4  
ATOM 6272  H HB3  . SER A 1 101 ? -21.178 16.730  0.708   1.00 0.00 ? 101 SER A HB3  4  
ATOM 6273  H HG   . SER A 1 101 ? -19.322 17.617  1.473   1.00 0.00 ? 101 SER A HG   4  
ATOM 6274  N N    . GLY A 1 102 ? -23.058 16.306  -1.404  1.00 0.00 ? 102 GLY A N    4  
ATOM 6275  C CA   . GLY A 1 102 ? -24.398 15.794  -1.623  1.00 0.00 ? 102 GLY A CA   4  
ATOM 6276  C C    . GLY A 1 102 ? -25.437 16.510  -0.782  1.00 0.00 ? 102 GLY A C    4  
ATOM 6277  O O    . GLY A 1 102 ? -25.893 15.985  0.233   1.00 0.00 ? 102 GLY A O    4  
ATOM 6278  H H    . GLY A 1 102 ? -22.295 15.690  -1.403  1.00 0.00 ? 102 GLY A H    4  
ATOM 6279  H HA2  . GLY A 1 102 ? -24.651 15.912  -2.666  1.00 0.00 ? 102 GLY A HA2  4  
ATOM 6280  H HA3  . GLY A 1 102 ? -24.415 14.743  -1.375  1.00 0.00 ? 102 GLY A HA3  4  
ATOM 6281  N N    . GLY A 1 1   ? 7.322   -1.493  -27.472 1.00 0.00 ? 1   GLY A N    5  
ATOM 6282  C CA   . GLY A 1 1   ? 7.969   -1.469  -26.174 1.00 0.00 ? 1   GLY A CA   5  
ATOM 6283  C C    . GLY A 1 1   ? 7.332   -2.430  -25.190 1.00 0.00 ? 1   GLY A C    5  
ATOM 6284  O O    . GLY A 1 1   ? 7.800   -3.556  -25.020 1.00 0.00 ? 1   GLY A O    5  
ATOM 6285  H H1   . GLY A 1 1   ? 7.833   -1.754  -28.267 1.00 0.00 ? 1   GLY A H1   5  
ATOM 6286  H HA2  . GLY A 1 1   ? 9.009   -1.733  -26.297 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 6287  H HA3  . GLY A 1 1   ? 7.908   -0.468  -25.772 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 6288  N N    . SER A 1 2   ? 6.261   -1.986  -24.540 1.00 0.00 ? 2   SER A N    5  
ATOM 6289  C CA   . SER A 1 2   ? 5.562   -2.813  -23.564 1.00 0.00 ? 2   SER A CA   5  
ATOM 6290  C C    . SER A 1 2   ? 4.226   -2.186  -23.178 1.00 0.00 ? 2   SER A C    5  
ATOM 6291  O O    . SER A 1 2   ? 4.152   -0.997  -22.869 1.00 0.00 ? 2   SER A O    5  
ATOM 6292  C CB   . SER A 1 2   ? 6.426   -3.008  -22.316 1.00 0.00 ? 2   SER A CB   5  
ATOM 6293  O OG   . SER A 1 2   ? 6.621   -1.781  -21.635 1.00 0.00 ? 2   SER A OG   5  
ATOM 6294  H H    . SER A 1 2   ? 5.936   -1.079  -24.719 1.00 0.00 ? 2   SER A H    5  
ATOM 6295  H HA   . SER A 1 2   ? 5.377   -3.776  -24.017 1.00 0.00 ? 2   SER A HA   5  
ATOM 6296  H HB2  . SER A 1 2   ? 5.938   -3.703  -21.649 1.00 0.00 ? 2   SER A HB2  5  
ATOM 6297  H HB3  . SER A 1 2   ? 7.388   -3.403  -22.607 1.00 0.00 ? 2   SER A HB3  5  
ATOM 6298  H HG   . SER A 1 2   ? 6.368   -1.882  -20.714 1.00 0.00 ? 2   SER A HG   5  
ATOM 6299  N N    . SER A 1 3   ? 3.171   -2.995  -23.199 1.00 0.00 ? 3   SER A N    5  
ATOM 6300  C CA   . SER A 1 3   ? 1.836   -2.520  -22.855 1.00 0.00 ? 3   SER A CA   5  
ATOM 6301  C C    . SER A 1 3   ? 1.405   -3.050  -21.491 1.00 0.00 ? 3   SER A C    5  
ATOM 6302  O O    . SER A 1 3   ? 1.814   -4.133  -21.076 1.00 0.00 ? 3   SER A O    5  
ATOM 6303  C CB   . SER A 1 3   ? 0.828   -2.949  -23.923 1.00 0.00 ? 3   SER A CB   5  
ATOM 6304  O OG   . SER A 1 3   ? 1.086   -2.301  -25.157 1.00 0.00 ? 3   SER A OG   5  
ATOM 6305  H H    . SER A 1 3   ? 3.294   -3.934  -23.454 1.00 0.00 ? 3   SER A H    5  
ATOM 6306  H HA   . SER A 1 3   ? 1.868   -1.441  -22.816 1.00 0.00 ? 3   SER A HA   5  
ATOM 6307  H HB2  . SER A 1 3   ? 0.896   -4.016  -24.070 1.00 0.00 ? 3   SER A HB2  5  
ATOM 6308  H HB3  . SER A 1 3   ? -0.169  -2.692  -23.597 1.00 0.00 ? 3   SER A HB3  5  
ATOM 6309  H HG   . SER A 1 3   ? 1.001   -1.352  -25.044 1.00 0.00 ? 3   SER A HG   5  
ATOM 6310  N N    . GLY A 1 4   ? 0.575   -2.276  -20.798 1.00 0.00 ? 4   GLY A N    5  
ATOM 6311  C CA   . GLY A 1 4   ? 0.101   -2.683  -19.488 1.00 0.00 ? 4   GLY A CA   5  
ATOM 6312  C C    . GLY A 1 4   ? -1.107  -3.595  -19.566 1.00 0.00 ? 4   GLY A C    5  
ATOM 6313  O O    . GLY A 1 4   ? -1.428  -4.122  -20.631 1.00 0.00 ? 4   GLY A O    5  
ATOM 6314  H H    . GLY A 1 4   ? 0.282   -1.422  -21.179 1.00 0.00 ? 4   GLY A H    5  
ATOM 6315  H HA2  . GLY A 1 4   ? 0.898   -3.201  -18.974 1.00 0.00 ? 4   GLY A HA2  5  
ATOM 6316  H HA3  . GLY A 1 4   ? -0.164  -1.801  -18.923 1.00 0.00 ? 4   GLY A HA3  5  
ATOM 6317  N N    . SER A 1 5   ? -1.779  -3.783  -18.434 1.00 0.00 ? 5   SER A N    5  
ATOM 6318  C CA   . SER A 1 5   ? -2.956  -4.642  -18.377 1.00 0.00 ? 5   SER A CA   5  
ATOM 6319  C C    . SER A 1 5   ? -4.235  -3.820  -18.507 1.00 0.00 ? 5   SER A C    5  
ATOM 6320  O O    . SER A 1 5   ? -4.848  -3.445  -17.508 1.00 0.00 ? 5   SER A O    5  
ATOM 6321  C CB   . SER A 1 5   ? -2.974  -5.431  -17.067 1.00 0.00 ? 5   SER A CB   5  
ATOM 6322  O OG   . SER A 1 5   ? -2.100  -6.545  -17.130 1.00 0.00 ? 5   SER A OG   5  
ATOM 6323  H H    . SER A 1 5   ? -1.473  -3.335  -17.617 1.00 0.00 ? 5   SER A H    5  
ATOM 6324  H HA   . SER A 1 5   ? -2.901  -5.334  -19.204 1.00 0.00 ? 5   SER A HA   5  
ATOM 6325  H HB2  . SER A 1 5   ? -2.661  -4.789  -16.258 1.00 0.00 ? 5   SER A HB2  5  
ATOM 6326  H HB3  . SER A 1 5   ? -3.977  -5.786  -16.878 1.00 0.00 ? 5   SER A HB3  5  
ATOM 6327  H HG   . SER A 1 5   ? -1.384  -6.356  -17.742 1.00 0.00 ? 5   SER A HG   5  
ATOM 6328  N N    . SER A 1 6   ? -4.630  -3.545  -19.746 1.00 0.00 ? 6   SER A N    5  
ATOM 6329  C CA   . SER A 1 6   ? -5.834  -2.765  -20.008 1.00 0.00 ? 6   SER A CA   5  
ATOM 6330  C C    . SER A 1 6   ? -7.083  -3.537  -19.594 1.00 0.00 ? 6   SER A C    5  
ATOM 6331  O O    . SER A 1 6   ? -7.549  -4.418  -20.315 1.00 0.00 ? 6   SER A O    5  
ATOM 6332  C CB   . SER A 1 6   ? -5.916  -2.398  -21.491 1.00 0.00 ? 6   SER A CB   5  
ATOM 6333  O OG   . SER A 1 6   ? -4.992  -1.373  -21.815 1.00 0.00 ? 6   SER A OG   5  
ATOM 6334  H H    . SER A 1 6   ? -4.098  -3.873  -20.501 1.00 0.00 ? 6   SER A H    5  
ATOM 6335  H HA   . SER A 1 6   ? -5.775  -1.858  -19.424 1.00 0.00 ? 6   SER A HA   5  
ATOM 6336  H HB2  . SER A 1 6   ? -5.693  -3.269  -22.088 1.00 0.00 ? 6   SER A HB2  5  
ATOM 6337  H HB3  . SER A 1 6   ? -6.914  -2.051  -21.718 1.00 0.00 ? 6   SER A HB3  5  
ATOM 6338  H HG   . SER A 1 6   ? -4.172  -1.518  -21.337 1.00 0.00 ? 6   SER A HG   5  
ATOM 6339  N N    . GLY A 1 7   ? -7.620  -3.199  -18.425 1.00 0.00 ? 7   GLY A N    5  
ATOM 6340  C CA   . GLY A 1 7   ? -8.809  -3.869  -17.934 1.00 0.00 ? 7   GLY A CA   5  
ATOM 6341  C C    . GLY A 1 7   ? -9.238  -3.364  -16.570 1.00 0.00 ? 7   GLY A C    5  
ATOM 6342  O O    . GLY A 1 7   ? -8.719  -2.360  -16.081 1.00 0.00 ? 7   GLY A O    5  
ATOM 6343  H H    . GLY A 1 7   ? -7.204  -2.488  -17.893 1.00 0.00 ? 7   GLY A H    5  
ATOM 6344  H HA2  . GLY A 1 7   ? -9.615  -3.709  -18.635 1.00 0.00 ? 7   GLY A HA2  5  
ATOM 6345  H HA3  . GLY A 1 7   ? -8.610  -4.928  -17.866 1.00 0.00 ? 7   GLY A HA3  5  
ATOM 6346  N N    . ARG A 1 8   ? -10.188 -4.060  -15.955 1.00 0.00 ? 8   ARG A N    5  
ATOM 6347  C CA   . ARG A 1 8   ? -10.688 -3.674  -14.641 1.00 0.00 ? 8   ARG A CA   5  
ATOM 6348  C C    . ARG A 1 8   ? -10.382 -4.752  -13.605 1.00 0.00 ? 8   ARG A C    5  
ATOM 6349  O O    . ARG A 1 8   ? -11.188 -5.653  -13.375 1.00 0.00 ? 8   ARG A O    5  
ATOM 6350  C CB   . ARG A 1 8   ? -12.196 -3.422  -14.699 1.00 0.00 ? 8   ARG A CB   5  
ATOM 6351  C CG   . ARG A 1 8   ? -12.809 -3.081  -13.351 1.00 0.00 ? 8   ARG A CG   5  
ATOM 6352  C CD   . ARG A 1 8   ? -14.313 -3.304  -13.350 1.00 0.00 ? 8   ARG A CD   5  
ATOM 6353  N NE   . ARG A 1 8   ? -15.041 -2.126  -13.812 1.00 0.00 ? 8   ARG A NE   5  
ATOM 6354  C CZ   . ARG A 1 8   ? -16.312 -2.153  -14.198 1.00 0.00 ? 8   ARG A CZ   5  
ATOM 6355  N NH1  . ARG A 1 8   ? -16.992 -3.291  -14.176 1.00 0.00 ? 8   ARG A NH1  5  
ATOM 6356  N NH2  . ARG A 1 8   ? -16.907 -1.039  -14.606 1.00 0.00 ? 8   ARG A NH2  5  
ATOM 6357  H H    . ARG A 1 8   ? -10.563 -4.851  -16.396 1.00 0.00 ? 8   ARG A H    5  
ATOM 6358  H HA   . ARG A 1 8   ? -10.190 -2.761  -14.351 1.00 0.00 ? 8   ARG A HA   5  
ATOM 6359  H HB2  . ARG A 1 8   ? -12.385 -2.600  -15.374 1.00 0.00 ? 8   ARG A HB2  5  
ATOM 6360  H HB3  . ARG A 1 8   ? -12.682 -4.308  -15.078 1.00 0.00 ? 8   ARG A HB3  5  
ATOM 6361  H HG2  . ARG A 1 8   ? -12.362 -3.709  -12.594 1.00 0.00 ? 8   ARG A HG2  5  
ATOM 6362  H HG3  . ARG A 1 8   ? -12.607 -2.044  -13.126 1.00 0.00 ? 8   ARG A HG3  5  
ATOM 6363  H HD2  . ARG A 1 8   ? -14.540 -4.135  -14.001 1.00 0.00 ? 8   ARG A HD2  5  
ATOM 6364  H HD3  . ARG A 1 8   ? -14.627 -3.539  -12.344 1.00 0.00 ? 8   ARG A HD3  5  
ATOM 6365  H HE   . ARG A 1 8   ? -14.558 -1.275  -13.837 1.00 0.00 ? 8   ARG A HE   5  
ATOM 6366  H HH11 . ARG A 1 8   ? -16.547 -4.132  -13.868 1.00 0.00 ? 8   ARG A HH11 5  
ATOM 6367  H HH12 . ARG A 1 8   ? -17.949 -3.308  -14.465 1.00 0.00 ? 8   ARG A HH12 5  
ATOM 6368  H HH21 . ARG A 1 8   ? -16.398 -0.179  -14.624 1.00 0.00 ? 8   ARG A HH21 5  
ATOM 6369  H HH22 . ARG A 1 8   ? -17.863 -1.060  -14.896 1.00 0.00 ? 8   ARG A HH22 5  
ATOM 6370  N N    . ASN A 1 9   ? -9.211  -4.653  -12.984 1.00 0.00 ? 9   ASN A N    5  
ATOM 6371  C CA   . ASN A 1 9   ? -8.798  -5.620  -11.973 1.00 0.00 ? 9   ASN A CA   5  
ATOM 6372  C C    . ASN A 1 9   ? -9.682  -5.523  -10.734 1.00 0.00 ? 9   ASN A C    5  
ATOM 6373  O O    . ASN A 1 9   ? -9.641  -4.531  -10.006 1.00 0.00 ? 9   ASN A O    5  
ATOM 6374  C CB   . ASN A 1 9   ? -7.334  -5.393  -11.589 1.00 0.00 ? 9   ASN A CB   5  
ATOM 6375  C CG   . ASN A 1 9   ? -6.391  -5.597  -12.758 1.00 0.00 ? 9   ASN A CG   5  
ATOM 6376  O OD1  . ASN A 1 9   ? -6.252  -6.707  -13.272 1.00 0.00 ? 9   ASN A OD1  5  
ATOM 6377  N ND2  . ASN A 1 9   ? -5.737  -4.522  -13.184 1.00 0.00 ? 9   ASN A ND2  5  
ATOM 6378  H H    . ASN A 1 9   ? -8.611  -3.913  -13.210 1.00 0.00 ? 9   ASN A H    5  
ATOM 6379  H HA   . ASN A 1 9   ? -8.900  -6.607  -12.398 1.00 0.00 ? 9   ASN A HA   5  
ATOM 6380  H HB2  . ASN A 1 9   ? -7.216  -4.382  -11.227 1.00 0.00 ? 9   ASN A HB2  5  
ATOM 6381  H HB3  . ASN A 1 9   ? -7.063  -6.085  -10.805 1.00 0.00 ? 9   ASN A HB3  5  
ATOM 6382  H HD21 . ASN A 1 9   ? -5.898  -3.671  -12.727 1.00 0.00 ? 9   ASN A HD21 5  
ATOM 6383  H HD22 . ASN A 1 9   ? -5.121  -4.625  -13.940 1.00 0.00 ? 9   ASN A HD22 5  
ATOM 6384  N N    . ARG A 1 10  ? -10.480 -6.560  -10.500 1.00 0.00 ? 10  ARG A N    5  
ATOM 6385  C CA   . ARG A 1 10  ? -11.374 -6.592  -9.349  1.00 0.00 ? 10  ARG A CA   5  
ATOM 6386  C C    . ARG A 1 10  ? -10.842 -7.533  -8.273  1.00 0.00 ? 10  ARG A C    5  
ATOM 6387  O O    . ARG A 1 10  ? -11.572 -8.381  -7.758  1.00 0.00 ? 10  ARG A O    5  
ATOM 6388  C CB   . ARG A 1 10  ? -12.776 -7.030  -9.777  1.00 0.00 ? 10  ARG A CB   5  
ATOM 6389  C CG   . ARG A 1 10  ? -13.837 -6.802  -8.714  1.00 0.00 ? 10  ARG A CG   5  
ATOM 6390  C CD   . ARG A 1 10  ? -14.475 -5.428  -8.849  1.00 0.00 ? 10  ARG A CD   5  
ATOM 6391  N NE   . ARG A 1 10  ? -15.649 -5.453  -9.716  1.00 0.00 ? 10  ARG A NE   5  
ATOM 6392  C CZ   . ARG A 1 10  ? -16.488 -4.431  -9.847  1.00 0.00 ? 10  ARG A CZ   5  
ATOM 6393  N NH1  . ARG A 1 10  ? -16.283 -3.309  -9.170  1.00 0.00 ? 10  ARG A NH1  5  
ATOM 6394  N NH2  . ARG A 1 10  ? -17.535 -4.529  -10.656 1.00 0.00 ? 10  ARG A NH2  5  
ATOM 6395  H H    . ARG A 1 10  ? -10.467 -7.322  -11.116 1.00 0.00 ? 10  ARG A H    5  
ATOM 6396  H HA   . ARG A 1 10  ? -11.428 -5.593  -8.942  1.00 0.00 ? 10  ARG A HA   5  
ATOM 6397  H HB2  . ARG A 1 10  ? -13.059 -6.477  -10.661 1.00 0.00 ? 10  ARG A HB2  5  
ATOM 6398  H HB3  . ARG A 1 10  ? -12.754 -8.083  -10.013 1.00 0.00 ? 10  ARG A HB3  5  
ATOM 6399  H HG2  . ARG A 1 10  ? -14.605 -7.554  -8.817  1.00 0.00 ? 10  ARG A HG2  5  
ATOM 6400  H HG3  . ARG A 1 10  ? -13.380 -6.883  -7.739  1.00 0.00 ? 10  ARG A HG3  5  
ATOM 6401  H HD2  . ARG A 1 10  ? -14.771 -5.085  -7.868  1.00 0.00 ? 10  ARG A HD2  5  
ATOM 6402  H HD3  . ARG A 1 10  ? -13.746 -4.747  -9.263  1.00 0.00 ? 10  ARG A HD3  5  
ATOM 6403  H HE   . ARG A 1 10  ? -15.820 -6.272  -10.226 1.00 0.00 ? 10  ARG A HE   5  
ATOM 6404  H HH11 . ARG A 1 10  ? -15.494 -3.232  -8.560  1.00 0.00 ? 10  ARG A HH11 5  
ATOM 6405  H HH12 . ARG A 1 10  ? -16.915 -2.541  -9.271  1.00 0.00 ? 10  ARG A HH12 5  
ATOM 6406  H HH21 . ARG A 1 10  ? -17.693 -5.373  -11.168 1.00 0.00 ? 10  ARG A HH21 5  
ATOM 6407  H HH22 . ARG A 1 10  ? -18.166 -3.760  -10.754 1.00 0.00 ? 10  ARG A HH22 5  
ATOM 6408  N N    . PHE A 1 11  ? -9.566  -7.379  -7.937  1.00 0.00 ? 11  PHE A N    5  
ATOM 6409  C CA   . PHE A 1 11  ? -8.935  -8.216  -6.923  1.00 0.00 ? 11  PHE A CA   5  
ATOM 6410  C C    . PHE A 1 11  ? -8.586  -7.398  -5.683  1.00 0.00 ? 11  PHE A C    5  
ATOM 6411  O O    . PHE A 1 11  ? -8.035  -6.302  -5.782  1.00 0.00 ? 11  PHE A O    5  
ATOM 6412  C CB   . PHE A 1 11  ? -7.672  -8.872  -7.486  1.00 0.00 ? 11  PHE A CB   5  
ATOM 6413  C CG   . PHE A 1 11  ? -6.670  -9.246  -6.432  1.00 0.00 ? 11  PHE A CG   5  
ATOM 6414  C CD1  . PHE A 1 11  ? -5.906  -8.273  -5.808  1.00 0.00 ? 11  PHE A CD1  5  
ATOM 6415  C CD2  . PHE A 1 11  ? -6.492  -10.570 -6.065  1.00 0.00 ? 11  PHE A CD2  5  
ATOM 6416  C CE1  . PHE A 1 11  ? -4.982  -8.614  -4.838  1.00 0.00 ? 11  PHE A CE1  5  
ATOM 6417  C CE2  . PHE A 1 11  ? -5.570  -10.917 -5.095  1.00 0.00 ? 11  PHE A CE2  5  
ATOM 6418  C CZ   . PHE A 1 11  ? -4.814  -9.937  -4.481  1.00 0.00 ? 11  PHE A CZ   5  
ATOM 6419  H H    . PHE A 1 11  ? -9.035  -6.685  -8.383  1.00 0.00 ? 11  PHE A H    5  
ATOM 6420  H HA   . PHE A 1 11  ? -9.638  -8.986  -6.646  1.00 0.00 ? 11  PHE A HA   5  
ATOM 6421  H HB2  . PHE A 1 11  ? -7.948  -9.772  -8.015  1.00 0.00 ? 11  PHE A HB2  5  
ATOM 6422  H HB3  . PHE A 1 11  ? -7.196  -8.188  -8.172  1.00 0.00 ? 11  PHE A HB3  5  
ATOM 6423  H HD1  . PHE A 1 11  ? -6.036  -7.237  -6.087  1.00 0.00 ? 11  PHE A HD1  5  
ATOM 6424  H HD2  . PHE A 1 11  ? -7.082  -11.337 -6.545  1.00 0.00 ? 11  PHE A HD2  5  
ATOM 6425  H HE1  . PHE A 1 11  ? -4.393  -7.845  -4.360  1.00 0.00 ? 11  PHE A HE1  5  
ATOM 6426  H HE2  . PHE A 1 11  ? -5.440  -11.952 -4.819  1.00 0.00 ? 11  PHE A HE2  5  
ATOM 6427  H HZ   . PHE A 1 11  ? -4.094  -10.206 -3.723  1.00 0.00 ? 11  PHE A HZ   5  
ATOM 6428  N N    . LYS A 1 12  ? -8.913  -7.940  -4.514  1.00 0.00 ? 12  LYS A N    5  
ATOM 6429  C CA   . LYS A 1 12  ? -8.635  -7.263  -3.253  1.00 0.00 ? 12  LYS A CA   5  
ATOM 6430  C C    . LYS A 1 12  ? -7.682  -8.086  -2.392  1.00 0.00 ? 12  LYS A C    5  
ATOM 6431  O O    . LYS A 1 12  ? -7.751  -9.315  -2.375  1.00 0.00 ? 12  LYS A O    5  
ATOM 6432  C CB   . LYS A 1 12  ? -9.937  -7.009  -2.489  1.00 0.00 ? 12  LYS A CB   5  
ATOM 6433  C CG   . LYS A 1 12  ? -9.851  -5.852  -1.509  1.00 0.00 ? 12  LYS A CG   5  
ATOM 6434  C CD   . LYS A 1 12  ? -11.214 -5.225  -1.265  1.00 0.00 ? 12  LYS A CD   5  
ATOM 6435  C CE   . LYS A 1 12  ? -11.528 -4.156  -2.301  1.00 0.00 ? 12  LYS A CE   5  
ATOM 6436  N NZ   . LYS A 1 12  ? -12.973 -3.795  -2.305  1.00 0.00 ? 12  LYS A NZ   5  
ATOM 6437  H H    . LYS A 1 12  ? -9.351  -8.817  -4.499  1.00 0.00 ? 12  LYS A H    5  
ATOM 6438  H HA   . LYS A 1 12  ? -8.170  -6.316  -3.480  1.00 0.00 ? 12  LYS A HA   5  
ATOM 6439  H HB2  . LYS A 1 12  ? -10.721 -6.793  -3.200  1.00 0.00 ? 12  LYS A HB2  5  
ATOM 6440  H HB3  . LYS A 1 12  ? -10.198 -7.901  -1.939  1.00 0.00 ? 12  LYS A HB3  5  
ATOM 6441  H HG2  . LYS A 1 12  ? -9.462  -6.216  -0.569  1.00 0.00 ? 12  LYS A HG2  5  
ATOM 6442  H HG3  . LYS A 1 12  ? -9.185  -5.101  -1.910  1.00 0.00 ? 12  LYS A HG3  5  
ATOM 6443  H HD2  . LYS A 1 12  ? -11.969 -5.994  -1.318  1.00 0.00 ? 12  LYS A HD2  5  
ATOM 6444  H HD3  . LYS A 1 12  ? -11.223 -4.775  -0.282  1.00 0.00 ? 12  LYS A HD3  5  
ATOM 6445  H HE2  . LYS A 1 12  ? -10.946 -3.275  -2.077  1.00 0.00 ? 12  LYS A HE2  5  
ATOM 6446  H HE3  . LYS A 1 12  ? -11.256 -4.529  -3.277  1.00 0.00 ? 12  LYS A HE3  5  
ATOM 6447  H HZ1  . LYS A 1 12  ? -13.105 -2.854  -2.728  1.00 0.00 ? 12  LYS A HZ1  5  
ATOM 6448  H HZ2  . LYS A 1 12  ? -13.340 -3.780  -1.332  1.00 0.00 ? 12  LYS A HZ2  5  
ATOM 6449  H HZ3  . LYS A 1 12  ? -13.514 -4.491  -2.857  1.00 0.00 ? 12  LYS A HZ3  5  
ATOM 6450  N N    . TRP A 1 13  ? -6.795  -7.401  -1.680  1.00 0.00 ? 13  TRP A N    5  
ATOM 6451  C CA   . TRP A 1 13  ? -5.828  -8.069  -0.816  1.00 0.00 ? 13  TRP A CA   5  
ATOM 6452  C C    . TRP A 1 13  ? -6.496  -8.579  0.456   1.00 0.00 ? 13  TRP A C    5  
ATOM 6453  O O    . TRP A 1 13  ? -7.556  -8.095  0.849   1.00 0.00 ? 13  TRP A O    5  
ATOM 6454  C CB   . TRP A 1 13  ? -4.686  -7.115  -0.460  1.00 0.00 ? 13  TRP A CB   5  
ATOM 6455  C CG   . TRP A 1 13  ? -3.880  -6.684  -1.648  1.00 0.00 ? 13  TRP A CG   5  
ATOM 6456  C CD1  . TRP A 1 13  ? -3.929  -5.471  -2.274  1.00 0.00 ? 13  TRP A CD1  5  
ATOM 6457  C CD2  . TRP A 1 13  ? -2.907  -7.463  -2.352  1.00 0.00 ? 13  TRP A CD2  5  
ATOM 6458  N NE1  . TRP A 1 13  ? -3.045  -5.450  -3.326  1.00 0.00 ? 13  TRP A NE1  5  
ATOM 6459  C CE2  . TRP A 1 13  ? -2.405  -6.659  -3.394  1.00 0.00 ? 13  TRP A CE2  5  
ATOM 6460  C CE3  . TRP A 1 13  ? -2.410  -8.760  -2.202  1.00 0.00 ? 13  TRP A CE3  5  
ATOM 6461  C CZ2  . TRP A 1 13  ? -1.432  -7.113  -4.280  1.00 0.00 ? 13  TRP A CZ2  5  
ATOM 6462  C CZ3  . TRP A 1 13  ? -1.444  -9.209  -3.083  1.00 0.00 ? 13  TRP A CZ3  5  
ATOM 6463  C CH2  . TRP A 1 13  ? -0.963  -8.387  -4.111  1.00 0.00 ? 13  TRP A CH2  5  
ATOM 6464  H H    . TRP A 1 13  ? -6.789  -6.422  -1.736  1.00 0.00 ? 13  TRP A H    5  
ATOM 6465  H HA   . TRP A 1 13  ? -5.425  -8.911  -1.360  1.00 0.00 ? 13  TRP A HA   5  
ATOM 6466  H HB2  . TRP A 1 13  ? -5.096  -6.231  0.004   1.00 0.00 ? 13  TRP A HB2  5  
ATOM 6467  H HB3  . TRP A 1 13  ? -4.021  -7.607  0.235   1.00 0.00 ? 13  TRP A HB3  5  
ATOM 6468  H HD1  . TRP A 1 13  ? -4.574  -4.659  -1.977  1.00 0.00 ? 13  TRP A HD1  5  
ATOM 6469  H HE1  . TRP A 1 13  ? -2.895  -4.691  -3.928  1.00 0.00 ? 13  TRP A HE1  5  
ATOM 6470  H HE3  . TRP A 1 13  ? -2.768  -9.409  -1.417  1.00 0.00 ? 13  TRP A HE3  5  
ATOM 6471  H HZ2  . TRP A 1 13  ? -1.050  -6.491  -5.077  1.00 0.00 ? 13  TRP A HZ2  5  
ATOM 6472  H HZ3  . TRP A 1 13  ? -1.048  -10.209 -2.983  1.00 0.00 ? 13  TRP A HZ3  5  
ATOM 6473  H HH2  . TRP A 1 13  ? -0.209  -8.779  -4.775  1.00 0.00 ? 13  TRP A HH2  5  
ATOM 6474  N N    . GLY A 1 14  ? -5.869  -9.562  1.096   1.00 0.00 ? 14  GLY A N    5  
ATOM 6475  C CA   . GLY A 1 14  ? -6.418  -10.121 2.317   1.00 0.00 ? 14  GLY A CA   5  
ATOM 6476  C C    . GLY A 1 14  ? -5.675  -9.655  3.553   1.00 0.00 ? 14  GLY A C    5  
ATOM 6477  O O    . GLY A 1 14  ? -4.825  -8.766  3.495   1.00 0.00 ? 14  GLY A O    5  
ATOM 6478  H H    . GLY A 1 14  ? -5.026  -9.909  0.736   1.00 0.00 ? 14  GLY A H    5  
ATOM 6479  H HA2  . GLY A 1 14  ? -7.454  -9.828  2.400   1.00 0.00 ? 14  GLY A HA2  5  
ATOM 6480  H HA3  . GLY A 1 14  ? -6.362  -11.198 2.263   1.00 0.00 ? 14  GLY A HA3  5  
ATOM 6481  N N    . PRO A 1 15  ? -5.998  -10.261 4.706   1.00 0.00 ? 15  PRO A N    5  
ATOM 6482  C CA   . PRO A 1 15  ? -5.367  -9.918  5.984   1.00 0.00 ? 15  PRO A CA   5  
ATOM 6483  C C    . PRO A 1 15  ? -3.909  -10.358 6.047   1.00 0.00 ? 15  PRO A C    5  
ATOM 6484  O O    . PRO A 1 15  ? -3.047  -9.617  6.519   1.00 0.00 ? 15  PRO A O    5  
ATOM 6485  C CB   . PRO A 1 15  ? -6.203  -10.688 7.009   1.00 0.00 ? 15  PRO A CB   5  
ATOM 6486  C CG   . PRO A 1 15  ? -6.777  -11.833 6.248   1.00 0.00 ? 15  PRO A CG   5  
ATOM 6487  C CD   . PRO A 1 15  ? -7.002  -11.328 4.849   1.00 0.00 ? 15  PRO A CD   5  
ATOM 6488  H HA   . PRO A 1 15  ? -5.432  -8.859  6.187   1.00 0.00 ? 15  PRO A HA   5  
ATOM 6489  H HB2  . PRO A 1 15  ? -5.566  -11.028 7.814   1.00 0.00 ? 15  PRO A HB2  5  
ATOM 6490  H HB3  . PRO A 1 15  ? -6.978  -10.047 7.402   1.00 0.00 ? 15  PRO A HB3  5  
ATOM 6491  H HG2  . PRO A 1 15  ? -6.079  -12.656 6.241   1.00 0.00 ? 15  PRO A HG2  5  
ATOM 6492  H HG3  . PRO A 1 15  ? -7.713  -12.136 6.692   1.00 0.00 ? 15  PRO A HG3  5  
ATOM 6493  H HD2  . PRO A 1 15  ? -6.833  -12.117 4.132   1.00 0.00 ? 15  PRO A HD2  5  
ATOM 6494  H HD3  . PRO A 1 15  ? -8.002  -10.932 4.748   1.00 0.00 ? 15  PRO A HD3  5  
ATOM 6495  N N    . ALA A 1 16  ? -3.639  -11.568 5.568   1.00 0.00 ? 16  ALA A N    5  
ATOM 6496  C CA   . ALA A 1 16  ? -2.284  -12.105 5.568   1.00 0.00 ? 16  ALA A CA   5  
ATOM 6497  C C    . ALA A 1 16  ? -1.481  -11.569 4.388   1.00 0.00 ? 16  ALA A C    5  
ATOM 6498  O O    . ALA A 1 16  ? -0.388  -11.030 4.562   1.00 0.00 ? 16  ALA A O    5  
ATOM 6499  C CB   . ALA A 1 16  ? -2.319  -13.626 5.539   1.00 0.00 ? 16  ALA A CB   5  
ATOM 6500  H H    . ALA A 1 16  ? -4.369  -12.112 5.205   1.00 0.00 ? 16  ALA A H    5  
ATOM 6501  H HA   . ALA A 1 16  ? -1.803  -11.799 6.486   1.00 0.00 ? 16  ALA A HA   5  
ATOM 6502  H HB1  . ALA A 1 16  ? -2.244  -13.967 4.516   1.00 0.00 ? 16  ALA A HB1  5  
ATOM 6503  H HB2  . ALA A 1 16  ? -1.490  -14.016 6.110   1.00 0.00 ? 16  ALA A HB2  5  
ATOM 6504  H HB3  . ALA A 1 16  ? -3.247  -13.973 5.967   1.00 0.00 ? 16  ALA A HB3  5  
ATOM 6505  N N    . SER A 1 17  ? -2.030  -11.722 3.187   1.00 0.00 ? 17  SER A N    5  
ATOM 6506  C CA   . SER A 1 17  ? -1.362  -11.258 1.977   1.00 0.00 ? 17  SER A CA   5  
ATOM 6507  C C    . SER A 1 17  ? -0.782  -9.861  2.179   1.00 0.00 ? 17  SER A C    5  
ATOM 6508  O O    . SER A 1 17  ? 0.420   -9.648  2.019   1.00 0.00 ? 17  SER A O    5  
ATOM 6509  C CB   . SER A 1 17  ? -2.339  -11.251 0.800   1.00 0.00 ? 17  SER A CB   5  
ATOM 6510  O OG   . SER A 1 17  ? -2.718  -12.570 0.444   1.00 0.00 ? 17  SER A OG   5  
ATOM 6511  H H    . SER A 1 17  ? -2.903  -12.160 3.113   1.00 0.00 ? 17  SER A H    5  
ATOM 6512  H HA   . SER A 1 17  ? -0.555  -11.942 1.760   1.00 0.00 ? 17  SER A HA   5  
ATOM 6513  H HB2  . SER A 1 17  ? -3.224  -10.697 1.073   1.00 0.00 ? 17  SER A HB2  5  
ATOM 6514  H HB3  . SER A 1 17  ? -1.869  -10.782 -0.052  1.00 0.00 ? 17  SER A HB3  5  
ATOM 6515  H HG   . SER A 1 17  ? -2.069  -13.191 0.782   1.00 0.00 ? 17  SER A HG   5  
ATOM 6516  N N    . GLN A 1 18  ? -1.645  -8.914  2.530   1.00 0.00 ? 18  GLN A N    5  
ATOM 6517  C CA   . GLN A 1 18  ? -1.219  -7.537  2.753   1.00 0.00 ? 18  GLN A CA   5  
ATOM 6518  C C    . GLN A 1 18  ? 0.065   -7.491  3.575   1.00 0.00 ? 18  GLN A C    5  
ATOM 6519  O O    . GLN A 1 18  ? 1.082   -6.967  3.123   1.00 0.00 ? 18  GLN A O    5  
ATOM 6520  C CB   . GLN A 1 18  ? -2.321  -6.748  3.462   1.00 0.00 ? 18  GLN A CB   5  
ATOM 6521  C CG   . GLN A 1 18  ? -3.393  -6.221  2.522   1.00 0.00 ? 18  GLN A CG   5  
ATOM 6522  C CD   . GLN A 1 18  ? -4.081  -4.981  3.058   1.00 0.00 ? 18  GLN A CD   5  
ATOM 6523  O OE1  . GLN A 1 18  ? -3.518  -4.247  3.870   1.00 0.00 ? 18  GLN A OE1  5  
ATOM 6524  N NE2  . GLN A 1 18  ? -5.306  -4.740  2.605   1.00 0.00 ? 18  GLN A NE2  5  
ATOM 6525  H H    . GLN A 1 18  ? -2.590  -9.146  2.642   1.00 0.00 ? 18  GLN A H    5  
ATOM 6526  H HA   . GLN A 1 18  ? -1.031  -7.088  1.789   1.00 0.00 ? 18  GLN A HA   5  
ATOM 6527  H HB2  . GLN A 1 18  ? -2.795  -7.390  4.190   1.00 0.00 ? 18  GLN A HB2  5  
ATOM 6528  H HB3  . GLN A 1 18  ? -1.875  -5.907  3.972   1.00 0.00 ? 18  GLN A HB3  5  
ATOM 6529  H HG2  . GLN A 1 18  ? -2.935  -5.978  1.574   1.00 0.00 ? 18  GLN A HG2  5  
ATOM 6530  H HG3  . GLN A 1 18  ? -4.135  -6.991  2.375   1.00 0.00 ? 18  GLN A HG3  5  
ATOM 6531  H HE21 . GLN A 1 18  ? -5.692  -5.370  1.960   1.00 0.00 ? 18  GLN A HE21 5  
ATOM 6532  H HE22 . GLN A 1 18  ? -5.774  -3.946  2.935   1.00 0.00 ? 18  GLN A HE22 5  
ATOM 6533  N N    . GLN A 1 19  ? 0.008   -8.042  4.783   1.00 0.00 ? 19  GLN A N    5  
ATOM 6534  C CA   . GLN A 1 19  ? 1.167   -8.062  5.668   1.00 0.00 ? 19  GLN A CA   5  
ATOM 6535  C C    . GLN A 1 19  ? 2.423   -8.478  4.910   1.00 0.00 ? 19  GLN A C    5  
ATOM 6536  O O    . GLN A 1 19  ? 3.469   -7.838  5.024   1.00 0.00 ? 19  GLN A O    5  
ATOM 6537  C CB   . GLN A 1 19  ? 0.924   -9.015  6.839   1.00 0.00 ? 19  GLN A CB   5  
ATOM 6538  C CG   . GLN A 1 19  ? -0.222  -8.589  7.743   1.00 0.00 ? 19  GLN A CG   5  
ATOM 6539  C CD   . GLN A 1 19  ? -0.132  -7.133  8.152   1.00 0.00 ? 19  GLN A CD   5  
ATOM 6540  O OE1  . GLN A 1 19  ? 0.827   -6.716  8.802   1.00 0.00 ? 19  GLN A OE1  5  
ATOM 6541  N NE2  . GLN A 1 19  ? -1.134  -6.348  7.772   1.00 0.00 ? 19  GLN A NE2  5  
ATOM 6542  H H    . GLN A 1 19  ? -0.832  -8.444  5.086   1.00 0.00 ? 19  GLN A H    5  
ATOM 6543  H HA   . GLN A 1 19  ? 1.308   -7.063  6.052   1.00 0.00 ? 19  GLN A HA   5  
ATOM 6544  H HB2  . GLN A 1 19  ? 0.701   -9.997  6.449   1.00 0.00 ? 19  GLN A HB2  5  
ATOM 6545  H HB3  . GLN A 1 19  ? 1.823   -9.070  7.436   1.00 0.00 ? 19  GLN A HB3  5  
ATOM 6546  H HG2  . GLN A 1 19  ? -1.153  -8.743  7.218   1.00 0.00 ? 19  GLN A HG2  5  
ATOM 6547  H HG3  . GLN A 1 19  ? -0.207  -9.200  8.633   1.00 0.00 ? 19  GLN A HG3  5  
ATOM 6548  H HE21 . GLN A 1 19  ? -1.866  -6.749  7.257   1.00 0.00 ? 19  GLN A HE21 5  
ATOM 6549  H HE22 . GLN A 1 19  ? -1.102  -5.402  8.024   1.00 0.00 ? 19  GLN A HE22 5  
ATOM 6550  N N    . ILE A 1 20  ? 2.313   -9.554  4.138   1.00 0.00 ? 20  ILE A N    5  
ATOM 6551  C CA   . ILE A 1 20  ? 3.441   -10.055 3.361   1.00 0.00 ? 20  ILE A CA   5  
ATOM 6552  C C    . ILE A 1 20  ? 4.026   -8.961  2.474   1.00 0.00 ? 20  ILE A C    5  
ATOM 6553  O O    . ILE A 1 20  ? 5.244   -8.827  2.356   1.00 0.00 ? 20  ILE A O    5  
ATOM 6554  C CB   . ILE A 1 20  ? 3.031   -11.250 2.481   1.00 0.00 ? 20  ILE A CB   5  
ATOM 6555  C CG1  . ILE A 1 20  ? 2.453   -12.373 3.345   1.00 0.00 ? 20  ILE A CG1  5  
ATOM 6556  C CG2  . ILE A 1 20  ? 4.224   -11.751 1.680   1.00 0.00 ? 20  ILE A CG2  5  
ATOM 6557  C CD1  . ILE A 1 20  ? 1.428   -13.222 2.627   1.00 0.00 ? 20  ILE A CD1  5  
ATOM 6558  H H    . ILE A 1 20  ? 1.454   -10.021 4.089   1.00 0.00 ? 20  ILE A H    5  
ATOM 6559  H HA   . ILE A 1 20  ? 4.201   -10.387 4.054   1.00 0.00 ? 20  ILE A HA   5  
ATOM 6560  H HB   . ILE A 1 20  ? 2.276   -10.916 1.786   1.00 0.00 ? 20  ILE A HB   5  
ATOM 6561  H HG12 . ILE A 1 20  ? 3.254   -13.021 3.665   1.00 0.00 ? 20  ILE A HG12 5  
ATOM 6562  H HG13 . ILE A 1 20  ? 1.978   -11.941 4.213   1.00 0.00 ? 20  ILE A HG13 5  
ATOM 6563  H HG21 . ILE A 1 20  ? 3.962   -12.676 1.186   1.00 0.00 ? 20  ILE A HG21 5  
ATOM 6564  H HG22 . ILE A 1 20  ? 4.495   -11.013 0.940   1.00 0.00 ? 20  ILE A HG22 5  
ATOM 6565  H HG23 . ILE A 1 20  ? 5.058   -11.921 2.344   1.00 0.00 ? 20  ILE A HG23 5  
ATOM 6566  H HD11 . ILE A 1 20  ? 0.497   -13.202 3.173   1.00 0.00 ? 20  ILE A HD11 5  
ATOM 6567  H HD12 . ILE A 1 20  ? 1.271   -12.833 1.632   1.00 0.00 ? 20  ILE A HD12 5  
ATOM 6568  H HD13 . ILE A 1 20  ? 1.785   -14.240 2.563   1.00 0.00 ? 20  ILE A HD13 5  
ATOM 6569  N N    . LEU A 1 21  ? 3.149   -8.180  1.852   1.00 0.00 ? 21  LEU A N    5  
ATOM 6570  C CA   . LEU A 1 21  ? 3.578   -7.096  0.975   1.00 0.00 ? 21  LEU A CA   5  
ATOM 6571  C C    . LEU A 1 21  ? 4.385   -6.058  1.748   1.00 0.00 ? 21  LEU A C    5  
ATOM 6572  O O    . LEU A 1 21  ? 5.363   -5.511  1.238   1.00 0.00 ? 21  LEU A O    5  
ATOM 6573  C CB   . LEU A 1 21  ? 2.365   -6.432  0.322   1.00 0.00 ? 21  LEU A CB   5  
ATOM 6574  C CG   . LEU A 1 21  ? 1.339   -7.377  -0.304  1.00 0.00 ? 21  LEU A CG   5  
ATOM 6575  C CD1  . LEU A 1 21  ? 0.233   -6.587  -0.987  1.00 0.00 ? 21  LEU A CD1  5  
ATOM 6576  C CD2  . LEU A 1 21  ? 2.013   -8.318  -1.292  1.00 0.00 ? 21  LEU A CD2  5  
ATOM 6577  H H    . LEU A 1 21  ? 2.191   -8.336  1.984   1.00 0.00 ? 21  LEU A H    5  
ATOM 6578  H HA   . LEU A 1 21  ? 4.205   -7.520  0.205   1.00 0.00 ? 21  LEU A HA   5  
ATOM 6579  H HB2  . LEU A 1 21  ? 1.860   -5.849  1.077   1.00 0.00 ? 21  LEU A HB2  5  
ATOM 6580  H HB3  . LEU A 1 21  ? 2.728   -5.774  -0.455  1.00 0.00 ? 21  LEU A HB3  5  
ATOM 6581  H HG   . LEU A 1 21  ? 0.888   -7.976  0.475   1.00 0.00 ? 21  LEU A HG   5  
ATOM 6582  H HD11 . LEU A 1 21  ? 0.550   -5.563  -1.118  1.00 0.00 ? 21  LEU A HD11 5  
ATOM 6583  H HD12 . LEU A 1 21  ? -0.658  -6.613  -0.377  1.00 0.00 ? 21  LEU A HD12 5  
ATOM 6584  H HD13 . LEU A 1 21  ? 0.021   -7.025  -1.952  1.00 0.00 ? 21  LEU A HD13 5  
ATOM 6585  H HD21 . LEU A 1 21  ? 1.369   -9.164  -1.479  1.00 0.00 ? 21  LEU A HD21 5  
ATOM 6586  H HD22 . LEU A 1 21  ? 2.950   -8.663  -0.878  1.00 0.00 ? 21  LEU A HD22 5  
ATOM 6587  H HD23 . LEU A 1 21  ? 2.199   -7.795  -2.218  1.00 0.00 ? 21  LEU A HD23 5  
ATOM 6588  N N    . TYR A 1 22  ? 3.971   -5.793  2.982   1.00 0.00 ? 22  TYR A N    5  
ATOM 6589  C CA   . TYR A 1 22  ? 4.655   -4.820  3.826   1.00 0.00 ? 22  TYR A CA   5  
ATOM 6590  C C    . TYR A 1 22  ? 6.045   -5.317  4.213   1.00 0.00 ? 22  TYR A C    5  
ATOM 6591  O O    . TYR A 1 22  ? 7.023   -4.575  4.139   1.00 0.00 ? 22  TYR A O    5  
ATOM 6592  C CB   . TYR A 1 22  ? 3.833   -4.538  5.085   1.00 0.00 ? 22  TYR A CB   5  
ATOM 6593  C CG   . TYR A 1 22  ? 2.555   -3.776  4.815   1.00 0.00 ? 22  TYR A CG   5  
ATOM 6594  C CD1  . TYR A 1 22  ? 2.560   -2.391  4.702   1.00 0.00 ? 22  TYR A CD1  5  
ATOM 6595  C CD2  . TYR A 1 22  ? 1.343   -4.441  4.675   1.00 0.00 ? 22  TYR A CD2  5  
ATOM 6596  C CE1  . TYR A 1 22  ? 1.395   -1.691  4.457   1.00 0.00 ? 22  TYR A CE1  5  
ATOM 6597  C CE2  . TYR A 1 22  ? 0.173   -3.749  4.428   1.00 0.00 ? 22  TYR A CE2  5  
ATOM 6598  C CZ   . TYR A 1 22  ? 0.204   -2.374  4.320   1.00 0.00 ? 22  TYR A CZ   5  
ATOM 6599  O OH   . TYR A 1 22  ? -0.959  -1.681  4.075   1.00 0.00 ? 22  TYR A OH   5  
ATOM 6600  H H    . TYR A 1 22  ? 3.185   -6.261  3.334   1.00 0.00 ? 22  TYR A H    5  
ATOM 6601  H HA   . TYR A 1 22  ? 4.757   -3.905  3.262   1.00 0.00 ? 22  TYR A HA   5  
ATOM 6602  H HB2  . TYR A 1 22  ? 3.568   -5.475  5.551   1.00 0.00 ? 22  TYR A HB2  5  
ATOM 6603  H HB3  . TYR A 1 22  ? 4.428   -3.955  5.772   1.00 0.00 ? 22  TYR A HB3  5  
ATOM 6604  H HD1  . TYR A 1 22  ? 3.494   -1.859  4.810   1.00 0.00 ? 22  TYR A HD1  5  
ATOM 6605  H HD2  . TYR A 1 22  ? 1.322   -5.518  4.761   1.00 0.00 ? 22  TYR A HD2  5  
ATOM 6606  H HE1  . TYR A 1 22  ? 1.418   -0.614  4.372   1.00 0.00 ? 22  TYR A HE1  5  
ATOM 6607  H HE2  . TYR A 1 22  ? -0.759  -4.283  4.321   1.00 0.00 ? 22  TYR A HE2  5  
ATOM 6608  H HH   . TYR A 1 22  ? -1.691  -2.298  4.004   1.00 0.00 ? 22  TYR A HH   5  
ATOM 6609  N N    . GLN A 1 23  ? 6.121   -6.578  4.627   1.00 0.00 ? 23  GLN A N    5  
ATOM 6610  C CA   . GLN A 1 23  ? 7.390   -7.175  5.026   1.00 0.00 ? 23  GLN A CA   5  
ATOM 6611  C C    . GLN A 1 23  ? 8.403   -7.113  3.888   1.00 0.00 ? 23  GLN A C    5  
ATOM 6612  O O    . GLN A 1 23  ? 9.602   -6.958  4.118   1.00 0.00 ? 23  GLN A O    5  
ATOM 6613  C CB   . GLN A 1 23  ? 7.181   -8.627  5.459   1.00 0.00 ? 23  GLN A CB   5  
ATOM 6614  C CG   . GLN A 1 23  ? 6.888   -8.783  6.943   1.00 0.00 ? 23  GLN A CG   5  
ATOM 6615  C CD   . GLN A 1 23  ? 8.148   -8.918  7.775   1.00 0.00 ? 23  GLN A CD   5  
ATOM 6616  O OE1  . GLN A 1 23  ? 8.514   -10.016 8.195   1.00 0.00 ? 23  GLN A OE1  5  
ATOM 6617  N NE2  . GLN A 1 23  ? 8.819   -7.798  8.019   1.00 0.00 ? 23  GLN A NE2  5  
ATOM 6618  H H    . GLN A 1 23  ? 5.305   -7.119  4.665   1.00 0.00 ? 23  GLN A H    5  
ATOM 6619  H HA   . GLN A 1 23  ? 7.773   -6.611  5.863   1.00 0.00 ? 23  GLN A HA   5  
ATOM 6620  H HB2  . GLN A 1 23  ? 6.351   -9.040  4.905   1.00 0.00 ? 23  GLN A HB2  5  
ATOM 6621  H HB3  . GLN A 1 23  ? 8.073   -9.191  5.230   1.00 0.00 ? 23  GLN A HB3  5  
ATOM 6622  H HG2  . GLN A 1 23  ? 6.342   -7.915  7.282   1.00 0.00 ? 23  GLN A HG2  5  
ATOM 6623  H HG3  . GLN A 1 23  ? 6.283   -9.666  7.086   1.00 0.00 ? 23  GLN A HG3  5  
ATOM 6624  H HE21 . GLN A 1 23  ? 8.467   -6.959  7.653   1.00 0.00 ? 23  GLN A HE21 5  
ATOM 6625  H HE22 . GLN A 1 23  ? 9.636   -7.856  8.555   1.00 0.00 ? 23  GLN A HE22 5  
ATOM 6626  N N    . ALA A 1 24  ? 7.913   -7.235  2.658   1.00 0.00 ? 24  ALA A N    5  
ATOM 6627  C CA   . ALA A 1 24  ? 8.775   -7.191  1.484   1.00 0.00 ? 24  ALA A CA   5  
ATOM 6628  C C    . ALA A 1 24  ? 9.084   -5.752  1.084   1.00 0.00 ? 24  ALA A C    5  
ATOM 6629  O O    . ALA A 1 24  ? 10.212  -5.431  0.708   1.00 0.00 ? 24  ALA A O    5  
ATOM 6630  C CB   . ALA A 1 24  ? 8.128   -7.935  0.326   1.00 0.00 ? 24  ALA A CB   5  
ATOM 6631  H H    . ALA A 1 24  ? 6.948   -7.356  2.539   1.00 0.00 ? 24  ALA A H    5  
ATOM 6632  H HA   . ALA A 1 24  ? 9.700   -7.692  1.730   1.00 0.00 ? 24  ALA A HA   5  
ATOM 6633  H HB1  . ALA A 1 24  ? 8.686   -8.837  0.122   1.00 0.00 ? 24  ALA A HB1  5  
ATOM 6634  H HB2  . ALA A 1 24  ? 7.112   -8.192  0.586   1.00 0.00 ? 24  ALA A HB2  5  
ATOM 6635  H HB3  . ALA A 1 24  ? 8.128   -7.306  -0.551  1.00 0.00 ? 24  ALA A HB3  5  
ATOM 6636  N N    . TYR A 1 25  ? 8.077   -4.890  1.167   1.00 0.00 ? 25  TYR A N    5  
ATOM 6637  C CA   . TYR A 1 25  ? 8.241   -3.486  0.810   1.00 0.00 ? 25  TYR A CA   5  
ATOM 6638  C C    . TYR A 1 25  ? 9.141   -2.771  1.813   1.00 0.00 ? 25  TYR A C    5  
ATOM 6639  O O    . TYR A 1 25  ? 9.872   -1.846  1.458   1.00 0.00 ? 25  TYR A O    5  
ATOM 6640  C CB   . TYR A 1 25  ? 6.879   -2.792  0.746   1.00 0.00 ? 25  TYR A CB   5  
ATOM 6641  C CG   . TYR A 1 25  ? 6.945   -1.377  0.219   1.00 0.00 ? 25  TYR A CG   5  
ATOM 6642  C CD1  . TYR A 1 25  ? 7.553   -0.368  0.957   1.00 0.00 ? 25  TYR A CD1  5  
ATOM 6643  C CD2  . TYR A 1 25  ? 6.399   -1.047  -1.015  1.00 0.00 ? 25  TYR A CD2  5  
ATOM 6644  C CE1  . TYR A 1 25  ? 7.616   0.927   0.480   1.00 0.00 ? 25  TYR A CE1  5  
ATOM 6645  C CE2  . TYR A 1 25  ? 6.458   0.245   -1.500  1.00 0.00 ? 25  TYR A CE2  5  
ATOM 6646  C CZ   . TYR A 1 25  ? 7.067   1.229   -0.749  1.00 0.00 ? 25  TYR A CZ   5  
ATOM 6647  O OH   . TYR A 1 25  ? 7.126   2.517   -1.228  1.00 0.00 ? 25  TYR A OH   5  
ATOM 6648  H H    . TYR A 1 25  ? 7.201   -5.206  1.474   1.00 0.00 ? 25  TYR A H    5  
ATOM 6649  H HA   . TYR A 1 25  ? 8.702   -3.443  -0.165  1.00 0.00 ? 25  TYR A HA   5  
ATOM 6650  H HB2  . TYR A 1 25  ? 6.226   -3.356  0.098   1.00 0.00 ? 25  TYR A HB2  5  
ATOM 6651  H HB3  . TYR A 1 25  ? 6.452   -2.758  1.738   1.00 0.00 ? 25  TYR A HB3  5  
ATOM 6652  H HD1  . TYR A 1 25  ? 7.983   -0.608  1.919   1.00 0.00 ? 25  TYR A HD1  5  
ATOM 6653  H HD2  . TYR A 1 25  ? 5.922   -1.820  -1.600  1.00 0.00 ? 25  TYR A HD2  5  
ATOM 6654  H HE1  . TYR A 1 25  ? 8.093   1.697   1.068   1.00 0.00 ? 25  TYR A HE1  5  
ATOM 6655  H HE2  . TYR A 1 25  ? 6.027   0.482   -2.462  1.00 0.00 ? 25  TYR A HE2  5  
ATOM 6656  H HH   . TYR A 1 25  ? 6.392   2.670   -1.827  1.00 0.00 ? 25  TYR A HH   5  
ATOM 6657  N N    . ASP A 1 26  ? 9.083   -3.207  3.067   1.00 0.00 ? 26  ASP A N    5  
ATOM 6658  C CA   . ASP A 1 26  ? 9.893   -2.611  4.122   1.00 0.00 ? 26  ASP A CA   5  
ATOM 6659  C C    . ASP A 1 26  ? 11.380  -2.804  3.840   1.00 0.00 ? 26  ASP A C    5  
ATOM 6660  O O    . ASP A 1 26  ? 12.201  -1.949  4.172   1.00 0.00 ? 26  ASP A O    5  
ATOM 6661  C CB   . ASP A 1 26  ? 9.535   -3.223  5.477   1.00 0.00 ? 26  ASP A CB   5  
ATOM 6662  C CG   . ASP A 1 26  ? 9.735   -2.250  6.623   1.00 0.00 ? 26  ASP A CG   5  
ATOM 6663  O OD1  . ASP A 1 26  ? 9.197   -1.125  6.547   1.00 0.00 ? 26  ASP A OD1  5  
ATOM 6664  O OD2  . ASP A 1 26  ? 10.428  -2.614  7.595   1.00 0.00 ? 26  ASP A OD2  5  
ATOM 6665  H H    . ASP A 1 26  ? 8.480   -3.948  3.287   1.00 0.00 ? 26  ASP A H    5  
ATOM 6666  H HA   . ASP A 1 26  ? 9.679   -1.553  4.147   1.00 0.00 ? 26  ASP A HA   5  
ATOM 6667  H HB2  . ASP A 1 26  ? 8.498   -3.527  5.465   1.00 0.00 ? 26  ASP A HB2  5  
ATOM 6668  H HB3  . ASP A 1 26  ? 10.158  -4.088  5.650   1.00 0.00 ? 26  ASP A HB3  5  
ATOM 6669  N N    . ARG A 1 27  ? 11.719  -3.933  3.226   1.00 0.00 ? 27  ARG A N    5  
ATOM 6670  C CA   . ARG A 1 27  ? 13.107  -4.240  2.902   1.00 0.00 ? 27  ARG A CA   5  
ATOM 6671  C C    . ARG A 1 27  ? 13.529  -3.544  1.611   1.00 0.00 ? 27  ARG A C    5  
ATOM 6672  O O    . ARG A 1 27  ? 14.564  -2.880  1.563   1.00 0.00 ? 27  ARG A O    5  
ATOM 6673  C CB   . ARG A 1 27  ? 13.299  -5.751  2.766   1.00 0.00 ? 27  ARG A CB   5  
ATOM 6674  C CG   . ARG A 1 27  ? 12.793  -6.539  3.963   1.00 0.00 ? 27  ARG A CG   5  
ATOM 6675  C CD   . ARG A 1 27  ? 13.083  -8.025  3.815   1.00 0.00 ? 27  ARG A CD   5  
ATOM 6676  N NE   . ARG A 1 27  ? 13.217  -8.688  5.109   1.00 0.00 ? 27  ARG A NE   5  
ATOM 6677  C CZ   . ARG A 1 27  ? 13.272  -10.007 5.257   1.00 0.00 ? 27  ARG A CZ   5  
ATOM 6678  N NH1  . ARG A 1 27  ? 13.203  -10.799 4.196   1.00 0.00 ? 27  ARG A NH1  5  
ATOM 6679  N NH2  . ARG A 1 27  ? 13.394  -10.536 6.468   1.00 0.00 ? 27  ARG A NH2  5  
ATOM 6680  H H    . ARG A 1 27  ? 11.019  -4.576  2.987   1.00 0.00 ? 27  ARG A H    5  
ATOM 6681  H HA   . ARG A 1 27  ? 13.724  -3.878  3.710   1.00 0.00 ? 27  ARG A HA   5  
ATOM 6682  H HB2  . ARG A 1 27  ? 12.770  -6.093  1.888   1.00 0.00 ? 27  ARG A HB2  5  
ATOM 6683  H HB3  . ARG A 1 27  ? 14.352  -5.958  2.645   1.00 0.00 ? 27  ARG A HB3  5  
ATOM 6684  H HG2  . ARG A 1 27  ? 13.282  -6.176  4.855   1.00 0.00 ? 27  ARG A HG2  5  
ATOM 6685  H HG3  . ARG A 1 27  ? 11.727  -6.396  4.051   1.00 0.00 ? 27  ARG A HG3  5  
ATOM 6686  H HD2  . ARG A 1 27  ? 12.272  -8.483  3.269   1.00 0.00 ? 27  ARG A HD2  5  
ATOM 6687  H HD3  . ARG A 1 27  ? 14.003  -8.145  3.262   1.00 0.00 ? 27  ARG A HD3  5  
ATOM 6688  H HE   . ARG A 1 27  ? 13.270  -8.121  5.906   1.00 0.00 ? 27  ARG A HE   5  
ATOM 6689  H HH11 . ARG A 1 27  ? 13.112  -10.404 3.283   1.00 0.00 ? 27  ARG A HH11 5  
ATOM 6690  H HH12 . ARG A 1 27  ? 13.246  -11.792 4.310   1.00 0.00 ? 27  ARG A HH12 5  
ATOM 6691  H HH21 . ARG A 1 27  ? 13.446  -9.941  7.270   1.00 0.00 ? 27  ARG A HH21 5  
ATOM 6692  H HH22 . ARG A 1 27  ? 13.435  -11.528 6.578   1.00 0.00 ? 27  ARG A HH22 5  
ATOM 6693  N N    . GLN A 1 28  ? 12.722  -3.704  0.567   1.00 0.00 ? 28  GLN A N    5  
ATOM 6694  C CA   . GLN A 1 28  ? 13.014  -3.093  -0.724  1.00 0.00 ? 28  GLN A CA   5  
ATOM 6695  C C    . GLN A 1 28  ? 11.784  -2.383  -1.281  1.00 0.00 ? 28  GLN A C    5  
ATOM 6696  O O    . GLN A 1 28  ? 10.678  -2.923  -1.257  1.00 0.00 ? 28  GLN A O    5  
ATOM 6697  C CB   . GLN A 1 28  ? 13.498  -4.152  -1.716  1.00 0.00 ? 28  GLN A CB   5  
ATOM 6698  C CG   . GLN A 1 28  ? 13.714  -3.615  -3.122  1.00 0.00 ? 28  GLN A CG   5  
ATOM 6699  C CD   . GLN A 1 28  ? 14.951  -2.746  -3.231  1.00 0.00 ? 28  GLN A CD   5  
ATOM 6700  O OE1  . GLN A 1 28  ? 15.147  -1.822  -2.441  1.00 0.00 ? 28  GLN A OE1  5  
ATOM 6701  N NE2  . GLN A 1 28  ? 15.795  -3.038  -4.214  1.00 0.00 ? 28  GLN A NE2  5  
ATOM 6702  H H    . GLN A 1 28  ? 11.912  -4.246  0.667   1.00 0.00 ? 28  GLN A H    5  
ATOM 6703  H HA   . GLN A 1 28  ? 13.798  -2.366  -0.577  1.00 0.00 ? 28  GLN A HA   5  
ATOM 6704  H HB2  . GLN A 1 28  ? 14.433  -4.560  -1.361  1.00 0.00 ? 28  GLN A HB2  5  
ATOM 6705  H HB3  . GLN A 1 28  ? 12.765  -4.944  -1.765  1.00 0.00 ? 28  GLN A HB3  5  
ATOM 6706  H HG2  . GLN A 1 28  ? 13.819  -4.450  -3.800  1.00 0.00 ? 28  GLN A HG2  5  
ATOM 6707  H HG3  . GLN A 1 28  ? 12.853  -3.029  -3.405  1.00 0.00 ? 28  GLN A HG3  5  
ATOM 6708  H HE21 . GLN A 1 28  ? 15.574  -3.787  -4.806  1.00 0.00 ? 28  GLN A HE21 5  
ATOM 6709  H HE22 . GLN A 1 28  ? 16.602  -2.492  -4.308  1.00 0.00 ? 28  GLN A HE22 5  
ATOM 6710  N N    . LYS A 1 29  ? 11.984  -1.168  -1.781  1.00 0.00 ? 29  LYS A N    5  
ATOM 6711  C CA   . LYS A 1 29  ? 10.893  -0.383  -2.345  1.00 0.00 ? 29  LYS A CA   5  
ATOM 6712  C C    . LYS A 1 29  ? 10.556  -0.854  -3.756  1.00 0.00 ? 29  LYS A C    5  
ATOM 6713  O O    . LYS A 1 29  ? 9.387   -0.944  -4.128  1.00 0.00 ? 29  LYS A O    5  
ATOM 6714  C CB   . LYS A 1 29  ? 11.263  1.102   -2.366  1.00 0.00 ? 29  LYS A CB   5  
ATOM 6715  C CG   . LYS A 1 29  ? 11.767  1.622   -1.031  1.00 0.00 ? 29  LYS A CG   5  
ATOM 6716  C CD   . LYS A 1 29  ? 10.621  2.040   -0.126  1.00 0.00 ? 29  LYS A CD   5  
ATOM 6717  C CE   . LYS A 1 29  ? 10.987  1.892   1.343   1.00 0.00 ? 29  LYS A CE   5  
ATOM 6718  N NZ   . LYS A 1 29  ? 11.656  3.112   1.874   1.00 0.00 ? 29  LYS A NZ   5  
ATOM 6719  H H    . LYS A 1 29  ? 12.889  -0.791  -1.772  1.00 0.00 ? 29  LYS A H    5  
ATOM 6720  H HA   . LYS A 1 29  ? 10.026  -0.520  -1.716  1.00 0.00 ? 29  LYS A HA   5  
ATOM 6721  H HB2  . LYS A 1 29  ? 12.035  1.257   -3.105  1.00 0.00 ? 29  LYS A HB2  5  
ATOM 6722  H HB3  . LYS A 1 29  ? 10.390  1.674   -2.644  1.00 0.00 ? 29  LYS A HB3  5  
ATOM 6723  H HG2  . LYS A 1 29  ? 12.332  0.842   -0.541  1.00 0.00 ? 29  LYS A HG2  5  
ATOM 6724  H HG3  . LYS A 1 29  ? 12.406  2.476   -1.206  1.00 0.00 ? 29  LYS A HG3  5  
ATOM 6725  H HD2  . LYS A 1 29  ? 10.378  3.074   -0.322  1.00 0.00 ? 29  LYS A HD2  5  
ATOM 6726  H HD3  . LYS A 1 29  ? 9.761   1.420   -0.338  1.00 0.00 ? 29  LYS A HD3  5  
ATOM 6727  H HE2  . LYS A 1 29  ? 10.086  1.711   1.909   1.00 0.00 ? 29  LYS A HE2  5  
ATOM 6728  H HE3  . LYS A 1 29  ? 11.655  1.050   1.450   1.00 0.00 ? 29  LYS A HE3  5  
ATOM 6729  H HZ1  . LYS A 1 29  ? 12.683  3.050   1.722   1.00 0.00 ? 29  LYS A HZ1  5  
ATOM 6730  H HZ2  . LYS A 1 29  ? 11.472  3.205   2.893   1.00 0.00 ? 29  LYS A HZ2  5  
ATOM 6731  H HZ3  . LYS A 1 29  ? 11.295  3.957   1.388   1.00 0.00 ? 29  LYS A HZ3  5  
ATOM 6732  N N    . ASN A 1 30  ? 11.589  -1.154  -4.537  1.00 0.00 ? 30  ASN A N    5  
ATOM 6733  C CA   . ASN A 1 30  ? 11.402  -1.617  -5.907  1.00 0.00 ? 30  ASN A CA   5  
ATOM 6734  C C    . ASN A 1 30  ? 11.736  -3.100  -6.031  1.00 0.00 ? 30  ASN A C    5  
ATOM 6735  O O    . ASN A 1 30  ? 12.851  -3.483  -6.386  1.00 0.00 ? 30  ASN A O    5  
ATOM 6736  C CB   . ASN A 1 30  ? 12.274  -0.804  -6.866  1.00 0.00 ? 30  ASN A CB   5  
ATOM 6737  C CG   . ASN A 1 30  ? 12.121  0.691   -6.661  1.00 0.00 ? 30  ASN A CG   5  
ATOM 6738  O OD1  . ASN A 1 30  ? 11.224  1.317   -7.227  1.00 0.00 ? 30  ASN A OD1  5  
ATOM 6739  N ND2  . ASN A 1 30  ? 12.998  1.270   -5.850  1.00 0.00 ? 30  ASN A ND2  5  
ATOM 6740  H H    . ASN A 1 30  ? 12.498  -1.062  -4.184  1.00 0.00 ? 30  ASN A H    5  
ATOM 6741  H HA   . ASN A 1 30  ? 10.364  -1.471  -6.168  1.00 0.00 ? 30  ASN A HA   5  
ATOM 6742  H HB2  . ASN A 1 30  ? 13.311  -1.065  -6.708  1.00 0.00 ? 30  ASN A HB2  5  
ATOM 6743  H HB3  . ASN A 1 30  ? 11.999  -1.040  -7.883  1.00 0.00 ? 30  ASN A HB3  5  
ATOM 6744  H HD21 . ASN A 1 30  ? 13.686  0.709   -5.435  1.00 0.00 ? 30  ASN A HD21 5  
ATOM 6745  H HD22 . ASN A 1 30  ? 12.921  2.235   -5.700  1.00 0.00 ? 30  ASN A HD22 5  
ATOM 6746  N N    . PRO A 1 31  ? 10.748  -3.957  -5.732  1.00 0.00 ? 31  PRO A N    5  
ATOM 6747  C CA   . PRO A 1 31  ? 10.912  -5.411  -5.804  1.00 0.00 ? 31  PRO A CA   5  
ATOM 6748  C C    . PRO A 1 31  ? 11.043  -5.910  -7.239  1.00 0.00 ? 31  PRO A C    5  
ATOM 6749  O O    . PRO A 1 31  ? 10.248  -5.549  -8.106  1.00 0.00 ? 31  PRO A O    5  
ATOM 6750  C CB   . PRO A 1 31  ? 9.627   -5.945  -5.167  1.00 0.00 ? 31  PRO A CB   5  
ATOM 6751  C CG   . PRO A 1 31  ? 8.625   -4.861  -5.369  1.00 0.00 ? 31  PRO A CG   5  
ATOM 6752  C CD   . PRO A 1 31  ? 9.394   -3.570  -5.302  1.00 0.00 ? 31  PRO A CD   5  
ATOM 6753  H HA   . PRO A 1 31  ? 11.765  -5.743  -5.229  1.00 0.00 ? 31  PRO A HA   5  
ATOM 6754  H HB2  . PRO A 1 31  ? 9.328   -6.858  -5.664  1.00 0.00 ? 31  PRO A HB2  5  
ATOM 6755  H HB3  . PRO A 1 31  ? 9.794   -6.138  -4.118  1.00 0.00 ? 31  PRO A HB3  5  
ATOM 6756  H HG2  . PRO A 1 31  ? 8.157   -4.969  -6.335  1.00 0.00 ? 31  PRO A HG2  5  
ATOM 6757  H HG3  . PRO A 1 31  ? 7.884   -4.896  -4.584  1.00 0.00 ? 31  PRO A HG3  5  
ATOM 6758  H HD2  . PRO A 1 31  ? 8.968   -2.842  -5.977  1.00 0.00 ? 31  PRO A HD2  5  
ATOM 6759  H HD3  . PRO A 1 31  ? 9.405   -3.190  -4.291  1.00 0.00 ? 31  PRO A HD3  5  
ATOM 6760  N N    . SER A 1 32  ? 12.051  -6.742  -7.482  1.00 0.00 ? 32  SER A N    5  
ATOM 6761  C CA   . SER A 1 32  ? 12.287  -7.288  -8.813  1.00 0.00 ? 32  SER A CA   5  
ATOM 6762  C C    . SER A 1 32  ? 11.552  -8.612  -8.996  1.00 0.00 ? 32  SER A C    5  
ATOM 6763  O O    . SER A 1 32  ? 11.006  -9.170  -8.043  1.00 0.00 ? 32  SER A O    5  
ATOM 6764  C CB   . SER A 1 32  ? 13.786  -7.488  -9.046  1.00 0.00 ? 32  SER A CB   5  
ATOM 6765  O OG   . SER A 1 32  ? 14.429  -6.254  -9.316  1.00 0.00 ? 32  SER A OG   5  
ATOM 6766  H H    . SER A 1 32  ? 12.651  -6.993  -6.748  1.00 0.00 ? 32  SER A H    5  
ATOM 6767  H HA   . SER A 1 32  ? 11.911  -6.578  -9.534  1.00 0.00 ? 32  SER A HA   5  
ATOM 6768  H HB2  . SER A 1 32  ? 14.230  -7.926  -8.166  1.00 0.00 ? 32  SER A HB2  5  
ATOM 6769  H HB3  . SER A 1 32  ? 13.931  -8.148  -9.890  1.00 0.00 ? 32  SER A HB3  5  
ATOM 6770  H HG   . SER A 1 32  ? 14.045  -5.566  -8.767  1.00 0.00 ? 32  SER A HG   5  
ATOM 6771  N N    . LYS A 1 33  ? 11.541  -9.111  -10.227 1.00 0.00 ? 33  LYS A N    5  
ATOM 6772  C CA   . LYS A 1 33  ? 10.874  -10.369 -10.538 1.00 0.00 ? 33  LYS A CA   5  
ATOM 6773  C C    . LYS A 1 33  ? 11.014  -11.358 -9.384  1.00 0.00 ? 33  LYS A C    5  
ATOM 6774  O O    . LYS A 1 33  ? 10.068  -12.069 -9.048  1.00 0.00 ? 33  LYS A O    5  
ATOM 6775  C CB   . LYS A 1 33  ? 11.456  -10.976 -11.817 1.00 0.00 ? 33  LYS A CB   5  
ATOM 6776  C CG   . LYS A 1 33  ? 11.011  -12.407 -12.068 1.00 0.00 ? 33  LYS A CG   5  
ATOM 6777  C CD   . LYS A 1 33  ? 10.956  -12.721 -13.554 1.00 0.00 ? 33  LYS A CD   5  
ATOM 6778  C CE   . LYS A 1 33  ? 10.414  -14.119 -13.809 1.00 0.00 ? 33  LYS A CE   5  
ATOM 6779  N NZ   . LYS A 1 33  ? 11.500  -15.137 -13.841 1.00 0.00 ? 33  LYS A NZ   5  
ATOM 6780  H H    . LYS A 1 33  ? 11.994  -8.619  -10.945 1.00 0.00 ? 33  LYS A H    5  
ATOM 6781  H HA   . LYS A 1 33  ? 9.827   -10.161 -10.693 1.00 0.00 ? 33  LYS A HA   5  
ATOM 6782  H HB2  . LYS A 1 33  ? 11.150  -10.373 -12.659 1.00 0.00 ? 33  LYS A HB2  5  
ATOM 6783  H HB3  . LYS A 1 33  ? 12.534  -10.964 -11.749 1.00 0.00 ? 33  LYS A HB3  5  
ATOM 6784  H HG2  . LYS A 1 33  ? 11.710  -13.080 -11.595 1.00 0.00 ? 33  LYS A HG2  5  
ATOM 6785  H HG3  . LYS A 1 33  ? 10.027  -12.548 -11.643 1.00 0.00 ? 33  LYS A HG3  5  
ATOM 6786  H HD2  . LYS A 1 33  ? 10.313  -12.003 -14.041 1.00 0.00 ? 33  LYS A HD2  5  
ATOM 6787  H HD3  . LYS A 1 33  ? 11.954  -12.650 -13.965 1.00 0.00 ? 33  LYS A HD3  5  
ATOM 6788  H HE2  . LYS A 1 33  ? 9.720   -14.370 -13.022 1.00 0.00 ? 33  LYS A HE2  5  
ATOM 6789  H HE3  . LYS A 1 33  ? 9.900   -14.123 -14.758 1.00 0.00 ? 33  LYS A HE3  5  
ATOM 6790  H HZ1  . LYS A 1 33  ? 11.092  -16.091 -13.922 1.00 0.00 ? 33  LYS A HZ1  5  
ATOM 6791  H HZ2  . LYS A 1 33  ? 12.063  -15.087 -12.968 1.00 0.00 ? 33  LYS A HZ2  5  
ATOM 6792  H HZ3  . LYS A 1 33  ? 12.125  -14.969 -14.655 1.00 0.00 ? 33  LYS A HZ3  5  
ATOM 6793  N N    . GLU A 1 34  ? 12.198  -11.395 -8.783  1.00 0.00 ? 34  GLU A N    5  
ATOM 6794  C CA   . GLU A 1 34  ? 12.459  -12.296 -7.666  1.00 0.00 ? 34  GLU A CA   5  
ATOM 6795  C C    . GLU A 1 34  ? 11.662  -11.880 -6.433  1.00 0.00 ? 34  GLU A C    5  
ATOM 6796  O O    . GLU A 1 34  ? 10.888  -12.666 -5.889  1.00 0.00 ? 34  GLU A O    5  
ATOM 6797  C CB   . GLU A 1 34  ? 13.954  -12.318 -7.338  1.00 0.00 ? 34  GLU A CB   5  
ATOM 6798  C CG   . GLU A 1 34  ? 14.783  -13.117 -8.329  1.00 0.00 ? 34  GLU A CG   5  
ATOM 6799  C CD   . GLU A 1 34  ? 14.692  -14.612 -8.094  1.00 0.00 ? 34  GLU A CD   5  
ATOM 6800  O OE1  . GLU A 1 34  ? 13.632  -15.076 -7.626  1.00 0.00 ? 34  GLU A OE1  5  
ATOM 6801  O OE2  . GLU A 1 34  ? 15.682  -15.318 -8.380  1.00 0.00 ? 34  GLU A OE2  5  
ATOM 6802  H H    . GLU A 1 34  ? 12.913  -10.803 -9.097  1.00 0.00 ? 34  GLU A H    5  
ATOM 6803  H HA   . GLU A 1 34  ? 12.151  -13.288 -7.962  1.00 0.00 ? 34  GLU A HA   5  
ATOM 6804  H HB2  . GLU A 1 34  ? 14.322  -11.303 -7.327  1.00 0.00 ? 34  GLU A HB2  5  
ATOM 6805  H HB3  . GLU A 1 34  ? 14.088  -12.751 -6.358  1.00 0.00 ? 34  GLU A HB3  5  
ATOM 6806  H HG2  . GLU A 1 34  ? 14.432  -12.903 -9.328  1.00 0.00 ? 34  GLU A HG2  5  
ATOM 6807  H HG3  . GLU A 1 34  ? 15.816  -12.815 -8.240  1.00 0.00 ? 34  GLU A HG3  5  
ATOM 6808  N N    . GLU A 1 35  ? 11.860  -10.639 -5.999  1.00 0.00 ? 35  GLU A N    5  
ATOM 6809  C CA   . GLU A 1 35  ? 11.161  -10.119 -4.830  1.00 0.00 ? 35  GLU A CA   5  
ATOM 6810  C C    . GLU A 1 35  ? 9.649   -10.230 -5.006  1.00 0.00 ? 35  GLU A C    5  
ATOM 6811  O O    . GLU A 1 35  ? 8.978   -10.946 -4.263  1.00 0.00 ? 35  GLU A O    5  
ATOM 6812  C CB   . GLU A 1 35  ? 11.552  -8.661  -4.581  1.00 0.00 ? 35  GLU A CB   5  
ATOM 6813  C CG   . GLU A 1 35  ? 13.034  -8.465  -4.313  1.00 0.00 ? 35  GLU A CG   5  
ATOM 6814  C CD   . GLU A 1 35  ? 13.314  -7.264  -3.430  1.00 0.00 ? 35  GLU A CD   5  
ATOM 6815  O OE1  . GLU A 1 35  ? 12.511  -7.004  -2.510  1.00 0.00 ? 35  GLU A OE1  5  
ATOM 6816  O OE2  . GLU A 1 35  ? 14.336  -6.585  -3.660  1.00 0.00 ? 35  GLU A OE2  5  
ATOM 6817  H H    . GLU A 1 35  ? 12.491  -10.060 -6.476  1.00 0.00 ? 35  GLU A H    5  
ATOM 6818  H HA   . GLU A 1 35  ? 11.456  -10.712 -3.977  1.00 0.00 ? 35  GLU A HA   5  
ATOM 6819  H HB2  . GLU A 1 35  ? 11.283  -8.076  -5.448  1.00 0.00 ? 35  GLU A HB2  5  
ATOM 6820  H HB3  . GLU A 1 35  ? 11.001  -8.295  -3.727  1.00 0.00 ? 35  GLU A HB3  5  
ATOM 6821  H HG2  . GLU A 1 35  ? 13.418  -9.348  -3.824  1.00 0.00 ? 35  GLU A HG2  5  
ATOM 6822  H HG3  . GLU A 1 35  ? 13.543  -8.327  -5.255  1.00 0.00 ? 35  GLU A HG3  5  
ATOM 6823  N N    . ARG A 1 36  ? 9.121   -9.514  -5.994  1.00 0.00 ? 36  ARG A N    5  
ATOM 6824  C CA   . ARG A 1 36  ? 7.689   -9.530  -6.267  1.00 0.00 ? 36  ARG A CA   5  
ATOM 6825  C C    . ARG A 1 36  ? 7.155   -10.959 -6.289  1.00 0.00 ? 36  ARG A C    5  
ATOM 6826  O O    . ARG A 1 36  ? 6.125   -11.256 -5.684  1.00 0.00 ? 36  ARG A O    5  
ATOM 6827  C CB   . ARG A 1 36  ? 7.395   -8.843  -7.602  1.00 0.00 ? 36  ARG A CB   5  
ATOM 6828  C CG   . ARG A 1 36  ? 7.359   -7.327  -7.512  1.00 0.00 ? 36  ARG A CG   5  
ATOM 6829  C CD   . ARG A 1 36  ? 6.486   -6.725  -8.602  1.00 0.00 ? 36  ARG A CD   5  
ATOM 6830  N NE   . ARG A 1 36  ? 7.225   -6.522  -9.846  1.00 0.00 ? 36  ARG A NE   5  
ATOM 6831  C CZ   . ARG A 1 36  ? 7.983   -5.458  -10.085 1.00 0.00 ? 36  ARG A CZ   5  
ATOM 6832  N NH1  . ARG A 1 36  ? 8.102   -4.505  -9.171  1.00 0.00 ? 36  ARG A NH1  5  
ATOM 6833  N NH2  . ARG A 1 36  ? 8.624   -5.345  -11.241 1.00 0.00 ? 36  ARG A NH2  5  
ATOM 6834  H H    . ARG A 1 36  ? 9.708   -8.962  -6.551  1.00 0.00 ? 36  ARG A H    5  
ATOM 6835  H HA   . ARG A 1 36  ? 7.194   -8.986  -5.476  1.00 0.00 ? 36  ARG A HA   5  
ATOM 6836  H HB2  . ARG A 1 36  ? 8.160   -9.121  -8.312  1.00 0.00 ? 36  ARG A HB2  5  
ATOM 6837  H HB3  . ARG A 1 36  ? 6.437   -9.184  -7.965  1.00 0.00 ? 36  ARG A HB3  5  
ATOM 6838  H HG2  . ARG A 1 36  ? 6.961   -7.041  -6.550  1.00 0.00 ? 36  ARG A HG2  5  
ATOM 6839  H HG3  . ARG A 1 36  ? 8.364   -6.945  -7.616  1.00 0.00 ? 36  ARG A HG3  5  
ATOM 6840  H HD2  . ARG A 1 36  ? 5.658   -7.392  -8.791  1.00 0.00 ? 36  ARG A HD2  5  
ATOM 6841  H HD3  . ARG A 1 36  ? 6.110   -5.773  -8.259  1.00 0.00 ? 36  ARG A HD3  5  
ATOM 6842  H HE   . ARG A 1 36  ? 7.151   -7.214  -10.535 1.00 0.00 ? 36  ARG A HE   5  
ATOM 6843  H HH11 . ARG A 1 36  ? 7.621   -4.588  -8.298  1.00 0.00 ? 36  ARG A HH11 5  
ATOM 6844  H HH12 . ARG A 1 36  ? 8.675   -3.706  -9.353  1.00 0.00 ? 36  ARG A HH12 5  
ATOM 6845  H HH21 . ARG A 1 36  ? 8.537   -6.062  -11.933 1.00 0.00 ? 36  ARG A HH21 5  
ATOM 6846  H HH22 . ARG A 1 36  ? 9.194   -4.544  -11.420 1.00 0.00 ? 36  ARG A HH22 5  
ATOM 6847  N N    . GLU A 1 37  ? 7.863   -11.839 -6.991  1.00 0.00 ? 37  GLU A N    5  
ATOM 6848  C CA   . GLU A 1 37  ? 7.459   -13.236 -7.092  1.00 0.00 ? 37  GLU A CA   5  
ATOM 6849  C C    . GLU A 1 37  ? 7.255   -13.846 -5.708  1.00 0.00 ? 37  GLU A C    5  
ATOM 6850  O O    . GLU A 1 37  ? 6.220   -14.452 -5.432  1.00 0.00 ? 37  GLU A O    5  
ATOM 6851  C CB   . GLU A 1 37  ? 8.507   -14.038 -7.866  1.00 0.00 ? 37  GLU A CB   5  
ATOM 6852  C CG   . GLU A 1 37  ? 8.321   -13.990 -9.373  1.00 0.00 ? 37  GLU A CG   5  
ATOM 6853  C CD   . GLU A 1 37  ? 7.360   -15.049 -9.877  1.00 0.00 ? 37  GLU A CD   5  
ATOM 6854  O OE1  . GLU A 1 37  ? 6.136   -14.807 -9.838  1.00 0.00 ? 37  GLU A OE1  5  
ATOM 6855  O OE2  . GLU A 1 37  ? 7.833   -16.120 -10.311 1.00 0.00 ? 37  GLU A OE2  5  
ATOM 6856  H H    . GLU A 1 37  ? 8.675   -11.541 -7.451  1.00 0.00 ? 37  GLU A H    5  
ATOM 6857  H HA   . GLU A 1 37  ? 6.523   -13.272 -7.630  1.00 0.00 ? 37  GLU A HA   5  
ATOM 6858  H HB2  . GLU A 1 37  ? 9.486   -13.648 -7.631  1.00 0.00 ? 37  GLU A HB2  5  
ATOM 6859  H HB3  . GLU A 1 37  ? 8.456   -15.071 -7.551  1.00 0.00 ? 37  GLU A HB3  5  
ATOM 6860  H HG2  . GLU A 1 37  ? 7.936   -13.018 -9.644  1.00 0.00 ? 37  GLU A HG2  5  
ATOM 6861  H HG3  . GLU A 1 37  ? 9.280   -14.140 -9.846  1.00 0.00 ? 37  GLU A HG3  5  
ATOM 6862  N N    . ALA A 1 38  ? 8.250   -13.680 -4.843  1.00 0.00 ? 38  ALA A N    5  
ATOM 6863  C CA   . ALA A 1 38  ? 8.180   -14.212 -3.488  1.00 0.00 ? 38  ALA A CA   5  
ATOM 6864  C C    . ALA A 1 38  ? 6.887   -13.789 -2.798  1.00 0.00 ? 38  ALA A C    5  
ATOM 6865  O O    . ALA A 1 38  ? 6.465   -14.403 -1.818  1.00 0.00 ? 38  ALA A O    5  
ATOM 6866  C CB   . ALA A 1 38  ? 9.385   -13.756 -2.679  1.00 0.00 ? 38  ALA A CB   5  
ATOM 6867  H H    . ALA A 1 38  ? 9.049   -13.187 -5.122  1.00 0.00 ? 38  ALA A H    5  
ATOM 6868  H HA   . ALA A 1 38  ? 8.206   -15.290 -3.551  1.00 0.00 ? 38  ALA A HA   5  
ATOM 6869  H HB1  . ALA A 1 38  ? 9.866   -12.931 -3.185  1.00 0.00 ? 38  ALA A HB1  5  
ATOM 6870  H HB2  . ALA A 1 38  ? 9.062   -13.440 -1.699  1.00 0.00 ? 38  ALA A HB2  5  
ATOM 6871  H HB3  . ALA A 1 38  ? 10.083  -14.574 -2.582  1.00 0.00 ? 38  ALA A HB3  5  
ATOM 6872  N N    . LEU A 1 39  ? 6.264   -12.735 -3.314  1.00 0.00 ? 39  LEU A N    5  
ATOM 6873  C CA   . LEU A 1 39  ? 5.019   -12.229 -2.747  1.00 0.00 ? 39  LEU A CA   5  
ATOM 6874  C C    . LEU A 1 39  ? 3.812   -12.818 -3.471  1.00 0.00 ? 39  LEU A C    5  
ATOM 6875  O O    . LEU A 1 39  ? 2.729   -12.937 -2.898  1.00 0.00 ? 39  LEU A O    5  
ATOM 6876  C CB   . LEU A 1 39  ? 4.982   -10.702 -2.829  1.00 0.00 ? 39  LEU A CB   5  
ATOM 6877  C CG   . LEU A 1 39  ? 6.288   -9.980  -2.494  1.00 0.00 ? 39  LEU A CG   5  
ATOM 6878  C CD1  . LEU A 1 39  ? 6.085   -8.473  -2.515  1.00 0.00 ? 39  LEU A CD1  5  
ATOM 6879  C CD2  . LEU A 1 39  ? 6.814   -10.431 -1.139  1.00 0.00 ? 39  LEU A CD2  5  
ATOM 6880  H H    . LEU A 1 39  ? 6.649   -12.287 -4.096  1.00 0.00 ? 39  LEU A H    5  
ATOM 6881  H HA   . LEU A 1 39  ? 4.982   -12.527 -1.710  1.00 0.00 ? 39  LEU A HA   5  
ATOM 6882  H HB2  . LEU A 1 39  ? 4.704   -10.432 -3.836  1.00 0.00 ? 39  LEU A HB2  5  
ATOM 6883  H HB3  . LEU A 1 39  ? 4.224   -10.353 -2.142  1.00 0.00 ? 39  LEU A HB3  5  
ATOM 6884  H HG   . LEU A 1 39  ? 7.030   -10.227 -3.241  1.00 0.00 ? 39  LEU A HG   5  
ATOM 6885  H HD11 . LEU A 1 39  ? 6.382   -8.084  -3.477  1.00 0.00 ? 39  LEU A HD11 5  
ATOM 6886  H HD12 . LEU A 1 39  ? 6.687   -8.019  -1.742  1.00 0.00 ? 39  LEU A HD12 5  
ATOM 6887  H HD13 . LEU A 1 39  ? 5.044   -8.248  -2.340  1.00 0.00 ? 39  LEU A HD13 5  
ATOM 6888  H HD21 . LEU A 1 39  ? 6.555   -11.467 -0.980  1.00 0.00 ? 39  LEU A HD21 5  
ATOM 6889  H HD22 . LEU A 1 39  ? 6.371   -9.826  -0.362  1.00 0.00 ? 39  LEU A HD22 5  
ATOM 6890  H HD23 . LEU A 1 39  ? 7.888   -10.320 -1.115  1.00 0.00 ? 39  LEU A HD23 5  
ATOM 6891  N N    . VAL A 1 40  ? 4.007   -13.186 -4.733  1.00 0.00 ? 40  VAL A N    5  
ATOM 6892  C CA   . VAL A 1 40  ? 2.936   -13.766 -5.535  1.00 0.00 ? 40  VAL A CA   5  
ATOM 6893  C C    . VAL A 1 40  ? 2.574   -15.162 -5.041  1.00 0.00 ? 40  VAL A C    5  
ATOM 6894  O O    . VAL A 1 40  ? 1.398   -15.516 -4.957  1.00 0.00 ? 40  VAL A O    5  
ATOM 6895  C CB   . VAL A 1 40  ? 3.328   -13.845 -7.022  1.00 0.00 ? 40  VAL A CB   5  
ATOM 6896  C CG1  . VAL A 1 40  ? 2.310   -14.666 -7.800  1.00 0.00 ? 40  VAL A CG1  5  
ATOM 6897  C CG2  . VAL A 1 40  ? 3.462   -12.449 -7.612  1.00 0.00 ? 40  VAL A CG2  5  
ATOM 6898  H H    . VAL A 1 40  ? 4.893   -13.066 -5.135  1.00 0.00 ? 40  VAL A H    5  
ATOM 6899  H HA   . VAL A 1 40  ? 2.069   -13.127 -5.446  1.00 0.00 ? 40  VAL A HA   5  
ATOM 6900  H HB   . VAL A 1 40  ? 4.286   -14.338 -7.096  1.00 0.00 ? 40  VAL A HB   5  
ATOM 6901  H HG11 . VAL A 1 40  ? 2.458   -14.512 -8.859  1.00 0.00 ? 40  VAL A HG11 5  
ATOM 6902  H HG12 . VAL A 1 40  ? 2.436   -15.712 -7.565  1.00 0.00 ? 40  VAL A HG12 5  
ATOM 6903  H HG13 . VAL A 1 40  ? 1.312   -14.353 -7.528  1.00 0.00 ? 40  VAL A HG13 5  
ATOM 6904  H HG21 . VAL A 1 40  ? 2.633   -12.259 -8.278  1.00 0.00 ? 40  VAL A HG21 5  
ATOM 6905  H HG22 . VAL A 1 40  ? 3.458   -11.719 -6.816  1.00 0.00 ? 40  VAL A HG22 5  
ATOM 6906  H HG23 . VAL A 1 40  ? 4.389   -12.377 -8.161  1.00 0.00 ? 40  VAL A HG23 5  
ATOM 6907  N N    . GLU A 1 41  ? 3.593   -15.951 -4.715  1.00 0.00 ? 41  GLU A N    5  
ATOM 6908  C CA   . GLU A 1 41  ? 3.381   -17.310 -4.229  1.00 0.00 ? 41  GLU A CA   5  
ATOM 6909  C C    . GLU A 1 41  ? 3.035   -17.309 -2.743  1.00 0.00 ? 41  GLU A C    5  
ATOM 6910  O O    . GLU A 1 41  ? 2.113   -17.999 -2.310  1.00 0.00 ? 41  GLU A O    5  
ATOM 6911  C CB   . GLU A 1 41  ? 4.628   -18.162 -4.473  1.00 0.00 ? 41  GLU A CB   5  
ATOM 6912  C CG   . GLU A 1 41  ? 5.879   -17.616 -3.805  1.00 0.00 ? 41  GLU A CG   5  
ATOM 6913  C CD   . GLU A 1 41  ? 7.098   -18.483 -4.053  1.00 0.00 ? 41  GLU A CD   5  
ATOM 6914  O OE1  . GLU A 1 41  ? 7.627   -18.455 -5.183  1.00 0.00 ? 41  GLU A OE1  5  
ATOM 6915  O OE2  . GLU A 1 41  ? 7.523   -19.189 -3.114  1.00 0.00 ? 41  GLU A OE2  5  
ATOM 6916  H H    . GLU A 1 41  ? 4.508   -15.612 -4.803  1.00 0.00 ? 41  GLU A H    5  
ATOM 6917  H HA   . GLU A 1 41  ? 2.554   -17.733 -4.779  1.00 0.00 ? 41  GLU A HA   5  
ATOM 6918  H HB2  . GLU A 1 41  ? 4.448   -19.158 -4.095  1.00 0.00 ? 41  GLU A HB2  5  
ATOM 6919  H HB3  . GLU A 1 41  ? 4.808   -18.218 -5.536  1.00 0.00 ? 41  GLU A HB3  5  
ATOM 6920  H HG2  . GLU A 1 41  ? 6.075   -16.627 -4.192  1.00 0.00 ? 41  GLU A HG2  5  
ATOM 6921  H HG3  . GLU A 1 41  ? 5.707   -17.557 -2.741  1.00 0.00 ? 41  GLU A HG3  5  
ATOM 6922  N N    . GLU A 1 42  ? 3.782   -16.529 -1.968  1.00 0.00 ? 42  GLU A N    5  
ATOM 6923  C CA   . GLU A 1 42  ? 3.554   -16.439 -0.530  1.00 0.00 ? 42  GLU A CA   5  
ATOM 6924  C C    . GLU A 1 42  ? 2.123   -16.000 -0.232  1.00 0.00 ? 42  GLU A C    5  
ATOM 6925  O O    . GLU A 1 42  ? 1.447   -16.586 0.614   1.00 0.00 ? 42  GLU A O    5  
ATOM 6926  C CB   . GLU A 1 42  ? 4.543   -15.458 0.104   1.00 0.00 ? 42  GLU A CB   5  
ATOM 6927  C CG   . GLU A 1 42  ? 4.436   -15.381 1.618   1.00 0.00 ? 42  GLU A CG   5  
ATOM 6928  C CD   . GLU A 1 42  ? 4.939   -16.637 2.303   1.00 0.00 ? 42  GLU A CD   5  
ATOM 6929  O OE1  . GLU A 1 42  ? 6.156   -16.909 2.223   1.00 0.00 ? 42  GLU A OE1  5  
ATOM 6930  O OE2  . GLU A 1 42  ? 4.117   -17.347 2.919   1.00 0.00 ? 42  GLU A OE2  5  
ATOM 6931  H H    . GLU A 1 42  ? 4.502   -16.002 -2.372  1.00 0.00 ? 42  GLU A H    5  
ATOM 6932  H HA   . GLU A 1 42  ? 3.713   -17.419 -0.108  1.00 0.00 ? 42  GLU A HA   5  
ATOM 6933  H HB2  . GLU A 1 42  ? 5.547   -15.763 -0.150  1.00 0.00 ? 42  GLU A HB2  5  
ATOM 6934  H HB3  . GLU A 1 42  ? 4.362   -14.473 -0.299  1.00 0.00 ? 42  GLU A HB3  5  
ATOM 6935  H HG2  . GLU A 1 42  ? 5.020   -14.542 1.965   1.00 0.00 ? 42  GLU A HG2  5  
ATOM 6936  H HG3  . GLU A 1 42  ? 3.400   -15.233 1.886   1.00 0.00 ? 42  GLU A HG3  5  
ATOM 6937  N N    . CYS A 1 43  ? 1.670   -14.966 -0.932  1.00 0.00 ? 43  CYS A N    5  
ATOM 6938  C CA   . CYS A 1 43  ? 0.320   -14.448 -0.742  1.00 0.00 ? 43  CYS A CA   5  
ATOM 6939  C C    . CYS A 1 43  ? -0.723  -15.512 -1.067  1.00 0.00 ? 43  CYS A C    5  
ATOM 6940  O O    . CYS A 1 43  ? -1.419  -16.004 -0.180  1.00 0.00 ? 43  CYS A O    5  
ATOM 6941  C CB   . CYS A 1 43  ? 0.097   -13.214 -1.618  1.00 0.00 ? 43  CYS A CB   5  
ATOM 6942  S SG   . CYS A 1 43  ? 0.865   -11.707 -0.980  1.00 0.00 ? 43  CYS A SG   5  
ATOM 6943  H H    . CYS A 1 43  ? 2.256   -14.541 -1.592  1.00 0.00 ? 43  CYS A H    5  
ATOM 6944  H HA   . CYS A 1 43  ? 0.217   -14.165 0.295   1.00 0.00 ? 43  CYS A HA   5  
ATOM 6945  H HB2  . CYS A 1 43  ? 0.507   -13.400 -2.600  1.00 0.00 ? 43  CYS A HB2  5  
ATOM 6946  H HB3  . CYS A 1 43  ? -0.963  -13.032 -1.707  1.00 0.00 ? 43  CYS A HB3  5  
ATOM 6947  H HG   . CYS A 1 43  ? 2.078   -11.613 -1.503  1.00 0.00 ? 43  CYS A HG   5  
ATOM 6948  N N    . ASN A 1 44  ? -0.824  -15.862 -2.345  1.00 0.00 ? 44  ASN A N    5  
ATOM 6949  C CA   . ASN A 1 44  ? -1.784  -16.868 -2.788  1.00 0.00 ? 44  ASN A CA   5  
ATOM 6950  C C    . ASN A 1 44  ? -1.767  -18.081 -1.863  1.00 0.00 ? 44  ASN A C    5  
ATOM 6951  O O    . ASN A 1 44  ? -2.789  -18.738 -1.666  1.00 0.00 ? 44  ASN A O    5  
ATOM 6952  C CB   . ASN A 1 44  ? -1.474  -17.301 -4.222  1.00 0.00 ? 44  ASN A CB   5  
ATOM 6953  C CG   . ASN A 1 44  ? -2.028  -16.334 -5.251  1.00 0.00 ? 44  ASN A CG   5  
ATOM 6954  O OD1  . ASN A 1 44  ? -3.183  -15.915 -5.166  1.00 0.00 ? 44  ASN A OD1  5  
ATOM 6955  N ND2  . ASN A 1 44  ? -1.205  -15.977 -6.230  1.00 0.00 ? 44  ASN A ND2  5  
ATOM 6956  H H    . ASN A 1 44  ? -0.241  -15.435 -3.006  1.00 0.00 ? 44  ASN A H    5  
ATOM 6957  H HA   . ASN A 1 44  ? -2.767  -16.422 -2.761  1.00 0.00 ? 44  ASN A HA   5  
ATOM 6958  H HB2  . ASN A 1 44  ? -0.403  -17.359 -4.351  1.00 0.00 ? 44  ASN A HB2  5  
ATOM 6959  H HB3  . ASN A 1 44  ? -1.907  -18.274 -4.400  1.00 0.00 ? 44  ASN A HB3  5  
ATOM 6960  H HD21 . ASN A 1 44  ? -0.300  -16.351 -6.234  1.00 0.00 ? 44  ASN A HD21 5  
ATOM 6961  H HD22 . ASN A 1 44  ? -1.538  -15.352 -6.908  1.00 0.00 ? 44  ASN A HD22 5  
ATOM 6962  N N    . ARG A 1 45  ? -0.599  -18.371 -1.299  1.00 0.00 ? 45  ARG A N    5  
ATOM 6963  C CA   . ARG A 1 45  ? -0.449  -19.505 -0.395  1.00 0.00 ? 45  ARG A CA   5  
ATOM 6964  C C    . ARG A 1 45  ? -1.116  -19.223 0.948   1.00 0.00 ? 45  ARG A C    5  
ATOM 6965  O O    . ARG A 1 45  ? -2.002  -19.960 1.379   1.00 0.00 ? 45  ARG A O    5  
ATOM 6966  C CB   . ARG A 1 45  ? 1.033   -19.823 -0.184  1.00 0.00 ? 45  ARG A CB   5  
ATOM 6967  C CG   . ARG A 1 45  ? 1.288   -20.820 0.935   1.00 0.00 ? 45  ARG A CG   5  
ATOM 6968  C CD   . ARG A 1 45  ? 2.731   -20.764 1.412   1.00 0.00 ? 45  ARG A CD   5  
ATOM 6969  N NE   . ARG A 1 45  ? 3.613   -21.585 0.586   1.00 0.00 ? 45  ARG A NE   5  
ATOM 6970  C CZ   . ARG A 1 45  ? 3.510   -22.905 0.488   1.00 0.00 ? 45  ARG A CZ   5  
ATOM 6971  N NH1  . ARG A 1 45  ? 2.567   -23.551 1.160   1.00 0.00 ? 45  ARG A NH1  5  
ATOM 6972  N NH2  . ARG A 1 45  ? 4.350   -23.582 -0.284  1.00 0.00 ? 45  ARG A NH2  5  
ATOM 6973  H H    . ARG A 1 45  ? 0.180   -17.810 -1.495  1.00 0.00 ? 45  ARG A H    5  
ATOM 6974  H HA   . ARG A 1 45  ? -0.929  -20.358 -0.850  1.00 0.00 ? 45  ARG A HA   5  
ATOM 6975  H HB2  . ARG A 1 45  ? 1.436   -20.231 -1.099  1.00 0.00 ? 45  ARG A HB2  5  
ATOM 6976  H HB3  . ARG A 1 45  ? 1.554   -18.908 0.053   1.00 0.00 ? 45  ARG A HB3  5  
ATOM 6977  H HG2  . ARG A 1 45  ? 0.637   -20.590 1.765   1.00 0.00 ? 45  ARG A HG2  5  
ATOM 6978  H HG3  . ARG A 1 45  ? 1.076   -21.815 0.572   1.00 0.00 ? 45  ARG A HG3  5  
ATOM 6979  H HD2  . ARG A 1 45  ? 3.069   -19.739 1.374   1.00 0.00 ? 45  ARG A HD2  5  
ATOM 6980  H HD3  . ARG A 1 45  ? 2.773   -21.120 2.431   1.00 0.00 ? 45  ARG A HD3  5  
ATOM 6981  H HE   . ARG A 1 45  ? 4.317   -21.127 0.081   1.00 0.00 ? 45  ARG A HE   5  
ATOM 6982  H HH11 . ARG A 1 45  ? 1.932   -23.044 1.742   1.00 0.00 ? 45  ARG A HH11 5  
ATOM 6983  H HH12 . ARG A 1 45  ? 2.490   -24.546 1.084   1.00 0.00 ? 45  ARG A HH12 5  
ATOM 6984  H HH21 . ARG A 1 45  ? 5.061   -23.099 -0.793  1.00 0.00 ? 45  ARG A HH21 5  
ATOM 6985  H HH22 . ARG A 1 45  ? 4.271   -24.576 -0.357  1.00 0.00 ? 45  ARG A HH22 5  
ATOM 6986  N N    . ALA A 1 46  ? -0.684  -18.151 1.604   1.00 0.00 ? 46  ALA A N    5  
ATOM 6987  C CA   . ALA A 1 46  ? -1.240  -17.771 2.896   1.00 0.00 ? 46  ALA A CA   5  
ATOM 6988  C C    . ALA A 1 46  ? -2.751  -17.583 2.810   1.00 0.00 ? 46  ALA A C    5  
ATOM 6989  O O    . ALA A 1 46  ? -3.488  -17.991 3.706   1.00 0.00 ? 46  ALA A O    5  
ATOM 6990  C CB   . ALA A 1 46  ? -0.576  -16.499 3.403   1.00 0.00 ? 46  ALA A CB   5  
ATOM 6991  H H    . ALA A 1 46  ? 0.025   -17.603 1.208   1.00 0.00 ? 46  ALA A H    5  
ATOM 6992  H HA   . ALA A 1 46  ? -1.025  -18.564 3.598   1.00 0.00 ? 46  ALA A HA   5  
ATOM 6993  H HB1  . ALA A 1 46  ? 0.097   -16.743 4.212   1.00 0.00 ? 46  ALA A HB1  5  
ATOM 6994  H HB2  . ALA A 1 46  ? -0.022  -16.038 2.599   1.00 0.00 ? 46  ALA A HB2  5  
ATOM 6995  H HB3  . ALA A 1 46  ? -1.333  -15.815 3.757   1.00 0.00 ? 46  ALA A HB3  5  
ATOM 6996  N N    . GLU A 1 47  ? -3.204  -16.962 1.725   1.00 0.00 ? 47  GLU A N    5  
ATOM 6997  C CA   . GLU A 1 47  ? -4.628  -16.719 1.524   1.00 0.00 ? 47  GLU A CA   5  
ATOM 6998  C C    . GLU A 1 47  ? -5.421  -18.019 1.625   1.00 0.00 ? 47  GLU A C    5  
ATOM 6999  O O    . GLU A 1 47  ? -6.493  -18.059 2.231   1.00 0.00 ? 47  GLU A O    5  
ATOM 7000  C CB   . GLU A 1 47  ? -4.869  -16.067 0.161   1.00 0.00 ? 47  GLU A CB   5  
ATOM 7001  C CG   . GLU A 1 47  ? -4.280  -14.671 0.042   1.00 0.00 ? 47  GLU A CG   5  
ATOM 7002  C CD   . GLU A 1 47  ? -5.067  -13.785 -0.904  1.00 0.00 ? 47  GLU A CD   5  
ATOM 7003  O OE1  . GLU A 1 47  ? -6.185  -13.368 -0.533  1.00 0.00 ? 47  GLU A OE1  5  
ATOM 7004  O OE2  . GLU A 1 47  ? -4.566  -13.508 -2.014  1.00 0.00 ? 47  GLU A OE2  5  
ATOM 7005  H H    . GLU A 1 47  ? -2.567  -16.660 1.045   1.00 0.00 ? 47  GLU A H    5  
ATOM 7006  H HA   . GLU A 1 47  ? -4.962  -16.046 2.299   1.00 0.00 ? 47  GLU A HA   5  
ATOM 7007  H HB2  . GLU A 1 47  ? -4.429  -16.688 -0.605  1.00 0.00 ? 47  GLU A HB2  5  
ATOM 7008  H HB3  . GLU A 1 47  ? -5.934  -16.001 -0.009  1.00 0.00 ? 47  GLU A HB3  5  
ATOM 7009  H HG2  . GLU A 1 47  ? -4.274  -14.212 1.019   1.00 0.00 ? 47  GLU A HG2  5  
ATOM 7010  H HG3  . GLU A 1 47  ? -3.267  -14.752 -0.323  1.00 0.00 ? 47  GLU A HG3  5  
ATOM 7011  N N    . CYS A 1 48  ? -4.888  -19.079 1.028   1.00 0.00 ? 48  CYS A N    5  
ATOM 7012  C CA   . CYS A 1 48  ? -5.545  -20.380 1.049   1.00 0.00 ? 48  CYS A CA   5  
ATOM 7013  C C    . CYS A 1 48  ? -5.583  -20.948 2.464   1.00 0.00 ? 48  CYS A C    5  
ATOM 7014  O O    . CYS A 1 48  ? -6.594  -21.503 2.895   1.00 0.00 ? 48  CYS A O    5  
ATOM 7015  C CB   . CYS A 1 48  ? -4.825  -21.354 0.115   1.00 0.00 ? 48  CYS A CB   5  
ATOM 7016  S SG   . CYS A 1 48  ? -5.198  -21.109 -1.637  1.00 0.00 ? 48  CYS A SG   5  
ATOM 7017  H H    . CYS A 1 48  ? -4.031  -18.984 0.561   1.00 0.00 ? 48  CYS A H    5  
ATOM 7018  H HA   . CYS A 1 48  ? -6.558  -20.244 0.702   1.00 0.00 ? 48  CYS A HA   5  
ATOM 7019  H HB2  . CYS A 1 48  ? -3.759  -21.241 0.243   1.00 0.00 ? 48  CYS A HB2  5  
ATOM 7020  H HB3  . CYS A 1 48  ? -5.106  -22.364 0.375   1.00 0.00 ? 48  CYS A HB3  5  
ATOM 7021  H HG   . CYS A 1 48  ? -4.059  -21.171 -2.309  1.00 0.00 ? 48  CYS A HG   5  
ATOM 7022  N N    . LEU A 1 49  ? -4.475  -20.805 3.183   1.00 0.00 ? 49  LEU A N    5  
ATOM 7023  C CA   . LEU A 1 49  ? -4.380  -21.305 4.550   1.00 0.00 ? 49  LEU A CA   5  
ATOM 7024  C C    . LEU A 1 49  ? -5.422  -20.642 5.446   1.00 0.00 ? 49  LEU A C    5  
ATOM 7025  O O    . LEU A 1 49  ? -6.263  -21.317 6.039   1.00 0.00 ? 49  LEU A O    5  
ATOM 7026  C CB   . LEU A 1 49  ? -2.978  -21.056 5.109   1.00 0.00 ? 49  LEU A CB   5  
ATOM 7027  C CG   . LEU A 1 49  ? -1.813  -21.440 4.196   1.00 0.00 ? 49  LEU A CG   5  
ATOM 7028  C CD1  . LEU A 1 49  ? -0.531  -21.587 5.000   1.00 0.00 ? 49  LEU A CD1  5  
ATOM 7029  C CD2  . LEU A 1 49  ? -2.125  -22.728 3.447   1.00 0.00 ? 49  LEU A CD2  5  
ATOM 7030  H H    . LEU A 1 49  ? -3.702  -20.354 2.785   1.00 0.00 ? 49  LEU A H    5  
ATOM 7031  H HA   . LEU A 1 49  ? -4.566  -22.368 4.528   1.00 0.00 ? 49  LEU A HA   5  
ATOM 7032  H HB2  . LEU A 1 49  ? -2.892  -20.002 5.328   1.00 0.00 ? 49  LEU A HB2  5  
ATOM 7033  H HB3  . LEU A 1 49  ? -2.883  -21.621 6.025   1.00 0.00 ? 49  LEU A HB3  5  
ATOM 7034  H HG   . LEU A 1 49  ? -1.662  -20.657 3.467   1.00 0.00 ? 49  LEU A HG   5  
ATOM 7035  H HD11 . LEU A 1 49  ? 0.174   -20.829 4.694   1.00 0.00 ? 49  LEU A HD11 5  
ATOM 7036  H HD12 . LEU A 1 49  ? -0.106  -22.565 4.826   1.00 0.00 ? 49  LEU A HD12 5  
ATOM 7037  H HD13 . LEU A 1 49  ? -0.750  -21.472 6.052   1.00 0.00 ? 49  LEU A HD13 5  
ATOM 7038  H HD21 . LEU A 1 49  ? -1.291  -22.986 2.812   1.00 0.00 ? 49  LEU A HD21 5  
ATOM 7039  H HD22 . LEU A 1 49  ? -3.009  -22.587 2.842   1.00 0.00 ? 49  LEU A HD22 5  
ATOM 7040  H HD23 . LEU A 1 49  ? -2.298  -23.524 4.156   1.00 0.00 ? 49  LEU A HD23 5  
ATOM 7041  N N    . GLN A 1 50  ? -5.361  -19.318 5.536   1.00 0.00 ? 50  GLN A N    5  
ATOM 7042  C CA   . GLN A 1 50  ? -6.300  -18.565 6.358   1.00 0.00 ? 50  GLN A CA   5  
ATOM 7043  C C    . GLN A 1 50  ? -7.740  -18.887 5.973   1.00 0.00 ? 50  GLN A C    5  
ATOM 7044  O O    . GLN A 1 50  ? -8.585  -19.127 6.835   1.00 0.00 ? 50  GLN A O    5  
ATOM 7045  C CB   . GLN A 1 50  ? -6.045  -17.063 6.216   1.00 0.00 ? 50  GLN A CB   5  
ATOM 7046  C CG   . GLN A 1 50  ? -6.290  -16.535 4.812   1.00 0.00 ? 50  GLN A CG   5  
ATOM 7047  C CD   . GLN A 1 50  ? -6.059  -15.041 4.702   1.00 0.00 ? 50  GLN A CD   5  
ATOM 7048  O OE1  . GLN A 1 50  ? -6.990  -14.245 4.832   1.00 0.00 ? 50  GLN A OE1  5  
ATOM 7049  N NE2  . GLN A 1 50  ? -4.813  -14.651 4.461   1.00 0.00 ? 50  GLN A NE2  5  
ATOM 7050  H H    . GLN A 1 50  ? -4.667  -18.836 5.040   1.00 0.00 ? 50  GLN A H    5  
ATOM 7051  H HA   . GLN A 1 50  ? -6.144  -18.851 7.387   1.00 0.00 ? 50  GLN A HA   5  
ATOM 7052  H HB2  . GLN A 1 50  ? -6.696  -16.533 6.896   1.00 0.00 ? 50  GLN A HB2  5  
ATOM 7053  H HB3  . GLN A 1 50  ? -5.018  -16.858 6.480   1.00 0.00 ? 50  GLN A HB3  5  
ATOM 7054  H HG2  . GLN A 1 50  ? -5.621  -17.038 4.130   1.00 0.00 ? 50  GLN A HG2  5  
ATOM 7055  H HG3  . GLN A 1 50  ? -7.312  -16.748 4.534   1.00 0.00 ? 50  GLN A HG3  5  
ATOM 7056  H HE21 . GLN A 1 50  ? -4.122  -15.340 4.367   1.00 0.00 ? 50  GLN A HE21 5  
ATOM 7057  H HE22 . GLN A 1 50  ? -4.635  -13.691 4.384   1.00 0.00 ? 50  GLN A HE22 5  
ATOM 7058  N N    . ARG A 1 51  ? -8.013  -18.889 4.672   1.00 0.00 ? 51  ARG A N    5  
ATOM 7059  C CA   . ARG A 1 51  ? -9.351  -19.180 4.172   1.00 0.00 ? 51  ARG A CA   5  
ATOM 7060  C C    . ARG A 1 51  ? -9.656  -20.672 4.270   1.00 0.00 ? 51  ARG A C    5  
ATOM 7061  O O    . ARG A 1 51  ? -10.713 -21.130 3.838   1.00 0.00 ? 51  ARG A O    5  
ATOM 7062  C CB   . ARG A 1 51  ? -9.490  -18.715 2.722   1.00 0.00 ? 51  ARG A CB   5  
ATOM 7063  C CG   . ARG A 1 51  ? -9.720  -17.219 2.581   1.00 0.00 ? 51  ARG A CG   5  
ATOM 7064  C CD   . ARG A 1 51  ? -9.471  -16.748 1.157   1.00 0.00 ? 51  ARG A CD   5  
ATOM 7065  N NE   . ARG A 1 51  ? -10.018 -15.415 0.918   1.00 0.00 ? 51  ARG A NE   5  
ATOM 7066  C CZ   . ARG A 1 51  ? -11.305 -15.180 0.688   1.00 0.00 ? 51  ARG A CZ   5  
ATOM 7067  N NH1  . ARG A 1 51  ? -12.173 -16.183 0.668   1.00 0.00 ? 51  ARG A NH1  5  
ATOM 7068  N NH2  . ARG A 1 51  ? -11.727 -13.939 0.479   1.00 0.00 ? 51  ARG A NH2  5  
ATOM 7069  H H    . ARG A 1 51  ? -7.297  -18.690 4.033   1.00 0.00 ? 51  ARG A H    5  
ATOM 7070  H HA   . ARG A 1 51  ? -10.058 -18.640 4.784   1.00 0.00 ? 51  ARG A HA   5  
ATOM 7071  H HB2  . ARG A 1 51  ? -8.586  -18.969 2.186   1.00 0.00 ? 51  ARG A HB2  5  
ATOM 7072  H HB3  . ARG A 1 51  ? -10.324 -19.230 2.269   1.00 0.00 ? 51  ARG A HB3  5  
ATOM 7073  H HG2  . ARG A 1 51  ? -10.742 -16.995 2.849   1.00 0.00 ? 51  ARG A HG2  5  
ATOM 7074  H HG3  . ARG A 1 51  ? -9.049  -16.697 3.247   1.00 0.00 ? 51  ARG A HG3  5  
ATOM 7075  H HD2  . ARG A 1 51  ? -8.406  -16.726 0.981   1.00 0.00 ? 51  ARG A HD2  5  
ATOM 7076  H HD3  . ARG A 1 51  ? -9.934  -17.446 0.476   1.00 0.00 ? 51  ARG A HD3  5  
ATOM 7077  H HE   . ARG A 1 51  ? -9.395  -14.660 0.928   1.00 0.00 ? 51  ARG A HE   5  
ATOM 7078  H HH11 . ARG A 1 51  ? -11.858 -17.118 0.826   1.00 0.00 ? 51  ARG A HH11 5  
ATOM 7079  H HH12 . ARG A 1 51  ? -13.141 -16.002 0.496   1.00 0.00 ? 51  ARG A HH12 5  
ATOM 7080  H HH21 . ARG A 1 51  ? -11.076 -13.181 0.494   1.00 0.00 ? 51  ARG A HH21 5  
ATOM 7081  H HH22 . ARG A 1 51  ? -12.696 -13.763 0.306   1.00 0.00 ? 51  ARG A HH22 5  
ATOM 7082  N N    . GLY A 1 52  ? -8.721  -21.426 4.841   1.00 0.00 ? 52  GLY A N    5  
ATOM 7083  C CA   . GLY A 1 52  ? -8.908  -22.858 4.985   1.00 0.00 ? 52  GLY A CA   5  
ATOM 7084  C C    . GLY A 1 52  ? -8.518  -23.621 3.735   1.00 0.00 ? 52  GLY A C    5  
ATOM 7085  O O    . GLY A 1 52  ? -8.193  -24.807 3.799   1.00 0.00 ? 52  GLY A O    5  
ATOM 7086  H H    . GLY A 1 52  ? -7.897  -21.006 5.167   1.00 0.00 ? 52  GLY A H    5  
ATOM 7087  H HA2  . GLY A 1 52  ? -8.305  -23.207 5.810   1.00 0.00 ? 52  GLY A HA2  5  
ATOM 7088  H HA3  . GLY A 1 52  ? -9.947  -23.053 5.203   1.00 0.00 ? 52  GLY A HA3  5  
ATOM 7089  N N    . VAL A 1 53  ? -8.553  -22.942 2.593   1.00 0.00 ? 53  VAL A N    5  
ATOM 7090  C CA   . VAL A 1 53  ? -8.201  -23.564 1.322   1.00 0.00 ? 53  VAL A CA   5  
ATOM 7091  C C    . VAL A 1 53  ? -6.771  -24.091 1.345   1.00 0.00 ? 53  VAL A C    5  
ATOM 7092  O O    . VAL A 1 53  ? -6.036  -23.879 2.310   1.00 0.00 ? 53  VAL A O    5  
ATOM 7093  C CB   . VAL A 1 53  ? -8.353  -22.574 0.152   1.00 0.00 ? 53  VAL A CB   5  
ATOM 7094  C CG1  . VAL A 1 53  ? -8.520  -23.322 -1.162  1.00 0.00 ? 53  VAL A CG1  5  
ATOM 7095  C CG2  . VAL A 1 53  ? -9.528  -21.639 0.395   1.00 0.00 ? 53  VAL A CG2  5  
ATOM 7096  H H    . VAL A 1 53  ? -8.820  -21.999 2.606   1.00 0.00 ? 53  VAL A H    5  
ATOM 7097  H HA   . VAL A 1 53  ? -8.876  -24.391 1.157   1.00 0.00 ? 53  VAL A HA   5  
ATOM 7098  H HB   . VAL A 1 53  ? -7.454  -21.980 0.090   1.00 0.00 ? 53  VAL A HB   5  
ATOM 7099  H HG11 . VAL A 1 53  ? -9.220  -22.792 -1.791  1.00 0.00 ? 53  VAL A HG11 5  
ATOM 7100  H HG12 . VAL A 1 53  ? -7.565  -23.390 -1.662  1.00 0.00 ? 53  VAL A HG12 5  
ATOM 7101  H HG13 . VAL A 1 53  ? -8.895  -24.316 -0.965  1.00 0.00 ? 53  VAL A HG13 5  
ATOM 7102  H HG21 . VAL A 1 53  ? -9.166  -20.704 0.796   1.00 0.00 ? 53  VAL A HG21 5  
ATOM 7103  H HG22 . VAL A 1 53  ? -10.042 -21.455 -0.538  1.00 0.00 ? 53  VAL A HG22 5  
ATOM 7104  H HG23 . VAL A 1 53  ? -10.210 -22.092 1.098   1.00 0.00 ? 53  VAL A HG23 5  
ATOM 7105  N N    . SER A 1 54  ? -6.381  -24.777 0.276   1.00 0.00 ? 54  SER A N    5  
ATOM 7106  C CA   . SER A 1 54  ? -5.039  -25.338 0.174   1.00 0.00 ? 54  SER A CA   5  
ATOM 7107  C C    . SER A 1 54  ? -4.127  -24.420 -0.634  1.00 0.00 ? 54  SER A C    5  
ATOM 7108  O O    . SER A 1 54  ? -4.530  -23.826 -1.635  1.00 0.00 ? 54  SER A O    5  
ATOM 7109  C CB   . SER A 1 54  ? -5.090  -26.724 -0.472  1.00 0.00 ? 54  SER A CB   5  
ATOM 7110  O OG   . SER A 1 54  ? -4.009  -27.530 -0.036  1.00 0.00 ? 54  SER A OG   5  
ATOM 7111  H H    . SER A 1 54  ? -7.013  -24.912 -0.461  1.00 0.00 ? 54  SER A H    5  
ATOM 7112  H HA   . SER A 1 54  ? -4.642  -25.431 1.174   1.00 0.00 ? 54  SER A HA   5  
ATOM 7113  H HB2  . SER A 1 54  ? -6.016  -27.209 -0.205  1.00 0.00 ? 54  SER A HB2  5  
ATOM 7114  H HB3  . SER A 1 54  ? -5.035  -26.619 -1.546  1.00 0.00 ? 54  SER A HB3  5  
ATOM 7115  H HG   . SER A 1 54  ? -4.228  -28.456 -0.164  1.00 0.00 ? 54  SER A HG   5  
ATOM 7116  N N    . PRO A 1 55  ? -2.867  -24.300 -0.191  1.00 0.00 ? 55  PRO A N    5  
ATOM 7117  C CA   . PRO A 1 55  ? -1.870  -23.457 -0.858  1.00 0.00 ? 55  PRO A CA   5  
ATOM 7118  C C    . PRO A 1 55  ? -1.445  -24.021 -2.210  1.00 0.00 ? 55  PRO A C    5  
ATOM 7119  O O    . PRO A 1 55  ? -0.693  -23.386 -2.949  1.00 0.00 ? 55  PRO A O    5  
ATOM 7120  C CB   . PRO A 1 55  ? -0.691  -23.462 0.118   1.00 0.00 ? 55  PRO A CB   5  
ATOM 7121  C CG   . PRO A 1 55  ? -0.838  -24.732 0.884   1.00 0.00 ? 55  PRO A CG   5  
ATOM 7122  C CD   . PRO A 1 55  ? -2.318  -24.979 0.995   1.00 0.00 ? 55  PRO A CD   5  
ATOM 7123  H HA   . PRO A 1 55  ? -2.228  -22.446 -0.988  1.00 0.00 ? 55  PRO A HA   5  
ATOM 7124  H HB2  . PRO A 1 55  ? 0.238   -23.439 -0.435  1.00 0.00 ? 55  PRO A HB2  5  
ATOM 7125  H HB3  . PRO A 1 55  ? -0.752  -22.601 0.766   1.00 0.00 ? 55  PRO A HB3  5  
ATOM 7126  H HG2  . PRO A 1 55  ? -0.362  -25.540 0.350   1.00 0.00 ? 55  PRO A HG2  5  
ATOM 7127  H HG3  . PRO A 1 55  ? -0.403  -24.620 1.866   1.00 0.00 ? 55  PRO A HG3  5  
ATOM 7128  H HD2  . PRO A 1 55  ? -2.527  -26.038 0.964   1.00 0.00 ? 55  PRO A HD2  5  
ATOM 7129  H HD3  . PRO A 1 55  ? -2.706  -24.541 1.903   1.00 0.00 ? 55  PRO A HD3  5  
ATOM 7130  N N    . SER A 1 56  ? -1.931  -25.217 -2.526  1.00 0.00 ? 56  SER A N    5  
ATOM 7131  C CA   . SER A 1 56  ? -1.598  -25.868 -3.788  1.00 0.00 ? 56  SER A CA   5  
ATOM 7132  C C    . SER A 1 56  ? -2.694  -25.637 -4.824  1.00 0.00 ? 56  SER A C    5  
ATOM 7133  O O    . SER A 1 56  ? -2.467  -25.769 -6.027  1.00 0.00 ? 56  SER A O    5  
ATOM 7134  C CB   . SER A 1 56  ? -1.392  -27.368 -3.574  1.00 0.00 ? 56  SER A CB   5  
ATOM 7135  O OG   . SER A 1 56  ? -0.862  -27.982 -4.736  1.00 0.00 ? 56  SER A OG   5  
ATOM 7136  H H    . SER A 1 56  ? -2.526  -25.673 -1.895  1.00 0.00 ? 56  SER A H    5  
ATOM 7137  H HA   . SER A 1 56  ? -0.679  -25.435 -4.152  1.00 0.00 ? 56  SER A HA   5  
ATOM 7138  H HB2  . SER A 1 56  ? -0.705  -27.521 -2.755  1.00 0.00 ? 56  SER A HB2  5  
ATOM 7139  H HB3  . SER A 1 56  ? -2.341  -27.829 -3.338  1.00 0.00 ? 56  SER A HB3  5  
ATOM 7140  H HG   . SER A 1 56  ? -1.548  -28.048 -5.404  1.00 0.00 ? 56  SER A HG   5  
ATOM 7141  N N    . LYS A 1 57  ? -3.886  -25.290 -4.348  1.00 0.00 ? 57  LYS A N    5  
ATOM 7142  C CA   . LYS A 1 57  ? -5.019  -25.039 -5.231  1.00 0.00 ? 57  LYS A CA   5  
ATOM 7143  C C    . LYS A 1 57  ? -5.333  -23.548 -5.302  1.00 0.00 ? 57  LYS A C    5  
ATOM 7144  O O    . LYS A 1 57  ? -6.492  -23.153 -5.419  1.00 0.00 ? 57  LYS A O    5  
ATOM 7145  C CB   . LYS A 1 57  ? -6.250  -25.807 -4.745  1.00 0.00 ? 57  LYS A CB   5  
ATOM 7146  C CG   . LYS A 1 57  ? -5.948  -27.232 -4.316  1.00 0.00 ? 57  LYS A CG   5  
ATOM 7147  C CD   . LYS A 1 57  ? -6.015  -28.194 -5.490  1.00 0.00 ? 57  LYS A CD   5  
ATOM 7148  C CE   . LYS A 1 57  ? -7.433  -28.692 -5.723  1.00 0.00 ? 57  LYS A CE   5  
ATOM 7149  N NZ   . LYS A 1 57  ? -7.452  -29.991 -6.451  1.00 0.00 ? 57  LYS A NZ   5  
ATOM 7150  H H    . LYS A 1 57  ? -4.005  -25.200 -3.379  1.00 0.00 ? 57  LYS A H    5  
ATOM 7151  H HA   . LYS A 1 57  ? -4.754  -25.386 -6.218  1.00 0.00 ? 57  LYS A HA   5  
ATOM 7152  H HB2  . LYS A 1 57  ? -6.678  -25.283 -3.903  1.00 0.00 ? 57  LYS A HB2  5  
ATOM 7153  H HB3  . LYS A 1 57  ? -6.977  -25.840 -5.544  1.00 0.00 ? 57  LYS A HB3  5  
ATOM 7154  H HG2  . LYS A 1 57  ? -4.955  -27.268 -3.892  1.00 0.00 ? 57  LYS A HG2  5  
ATOM 7155  H HG3  . LYS A 1 57  ? -6.670  -27.536 -3.572  1.00 0.00 ? 57  LYS A HG3  5  
ATOM 7156  H HD2  . LYS A 1 57  ? -5.673  -27.687 -6.380  1.00 0.00 ? 57  LYS A HD2  5  
ATOM 7157  H HD3  . LYS A 1 57  ? -5.374  -29.041 -5.288  1.00 0.00 ? 57  LYS A HD3  5  
ATOM 7158  H HE2  . LYS A 1 57  ? -7.917  -28.819 -4.767  1.00 0.00 ? 57  LYS A HE2  5  
ATOM 7159  H HE3  . LYS A 1 57  ? -7.969  -27.955 -6.303  1.00 0.00 ? 57  LYS A HE3  5  
ATOM 7160  H HZ1  . LYS A 1 57  ? -7.449  -30.780 -5.774  1.00 0.00 ? 57  LYS A HZ1  5  
ATOM 7161  H HZ2  . LYS A 1 57  ? -6.615  -30.070 -7.063  1.00 0.00 ? 57  LYS A HZ2  5  
ATOM 7162  H HZ3  . LYS A 1 57  ? -8.306  -30.057 -7.041  1.00 0.00 ? 57  LYS A HZ3  5  
ATOM 7163  N N    . ALA A 1 58  ? -4.291  -22.724 -5.232  1.00 0.00 ? 58  ALA A N    5  
ATOM 7164  C CA   . ALA A 1 58  ? -4.456  -21.277 -5.292  1.00 0.00 ? 58  ALA A CA   5  
ATOM 7165  C C    . ALA A 1 58  ? -5.055  -20.848 -6.627  1.00 0.00 ? 58  ALA A C    5  
ATOM 7166  O O    . ALA A 1 58  ? -5.792  -19.864 -6.701  1.00 0.00 ? 58  ALA A O    5  
ATOM 7167  C CB   . ALA A 1 58  ? -3.121  -20.584 -5.063  1.00 0.00 ? 58  ALA A CB   5  
ATOM 7168  H H    . ALA A 1 58  ? -3.391  -23.099 -5.139  1.00 0.00 ? 58  ALA A H    5  
ATOM 7169  H HA   . ALA A 1 58  ? -5.127  -20.984 -4.497  1.00 0.00 ? 58  ALA A HA   5  
ATOM 7170  H HB1  . ALA A 1 58  ? -2.763  -20.178 -5.998  1.00 0.00 ? 58  ALA A HB1  5  
ATOM 7171  H HB2  . ALA A 1 58  ? -3.249  -19.785 -4.348  1.00 0.00 ? 58  ALA A HB2  5  
ATOM 7172  H HB3  . ALA A 1 58  ? -2.406  -21.298 -4.683  1.00 0.00 ? 58  ALA A HB3  5  
ATOM 7173  N N    . HIS A 1 59  ? -4.735  -21.592 -7.681  1.00 0.00 ? 59  HIS A N    5  
ATOM 7174  C CA   . HIS A 1 59  ? -5.242  -21.288 -9.014  1.00 0.00 ? 59  HIS A CA   5  
ATOM 7175  C C    . HIS A 1 59  ? -6.751  -21.067 -8.984  1.00 0.00 ? 59  HIS A C    5  
ATOM 7176  O O    . HIS A 1 59  ? -7.320  -20.470 -9.897  1.00 0.00 ? 59  HIS A O    5  
ATOM 7177  C CB   . HIS A 1 59  ? -4.900  -22.420 -9.983  1.00 0.00 ? 59  HIS A CB   5  
ATOM 7178  C CG   . HIS A 1 59  ? -5.113  -23.786 -9.408  1.00 0.00 ? 59  HIS A CG   5  
ATOM 7179  N ND1  . HIS A 1 59  ? -6.343  -24.409 -9.382  1.00 0.00 ? 59  HIS A ND1  5  
ATOM 7180  C CD2  . HIS A 1 59  ? -4.243  -24.651 -8.835  1.00 0.00 ? 59  HIS A CD2  5  
ATOM 7181  C CE1  . HIS A 1 59  ? -6.221  -25.597 -8.817  1.00 0.00 ? 59  HIS A CE1  5  
ATOM 7182  N NE2  . HIS A 1 59  ? -4.956  -25.768 -8.477  1.00 0.00 ? 59  HIS A NE2  5  
ATOM 7183  H H    . HIS A 1 59  ? -4.144  -22.364 -7.559  1.00 0.00 ? 59  HIS A H    5  
ATOM 7184  H HA   . HIS A 1 59  ? -4.764  -20.381 -9.352  1.00 0.00 ? 59  HIS A HA   5  
ATOM 7185  H HB2  . HIS A 1 59  ? -5.521  -22.331 -10.863 1.00 0.00 ? 59  HIS A HB2  5  
ATOM 7186  H HB3  . HIS A 1 59  ? -3.862  -22.338 -10.271 1.00 0.00 ? 59  HIS A HB3  5  
ATOM 7187  H HD1  . HIS A 1 59  ? -7.181  -24.035 -9.725  1.00 0.00 ? 59  HIS A HD1  5  
ATOM 7188  H HD2  . HIS A 1 59  ? -3.184  -24.492 -8.687  1.00 0.00 ? 59  HIS A HD2  5  
ATOM 7189  H HE1  . HIS A 1 59  ? -7.018  -26.308 -8.660  1.00 0.00 ? 59  HIS A HE1  5  
ATOM 7190  H HE2  . HIS A 1 59  ? -4.608  -26.527 -7.964  1.00 0.00 ? 59  HIS A HE2  5  
ATOM 7191  N N    . GLY A 1 60  ? -7.395  -21.553 -7.927  1.00 0.00 ? 60  GLY A N    5  
ATOM 7192  C CA   . GLY A 1 60  ? -8.832  -21.398 -7.798  1.00 0.00 ? 60  GLY A CA   5  
ATOM 7193  C C    . GLY A 1 60  ? -9.228  -20.008 -7.341  1.00 0.00 ? 60  GLY A C    5  
ATOM 7194  O O    . GLY A 1 60  ? -10.279 -19.495 -7.727  1.00 0.00 ? 60  GLY A O    5  
ATOM 7195  H H    . GLY A 1 60  ? -6.890  -22.020 -7.229  1.00 0.00 ? 60  GLY A H    5  
ATOM 7196  H HA2  . GLY A 1 60  ? -9.292  -21.596 -8.755  1.00 0.00 ? 60  GLY A HA2  5  
ATOM 7197  H HA3  . GLY A 1 60  ? -9.197  -22.118 -7.080  1.00 0.00 ? 60  GLY A HA3  5  
ATOM 7198  N N    . LEU A 1 61  ? -8.386  -19.397 -6.515  1.00 0.00 ? 61  LEU A N    5  
ATOM 7199  C CA   . LEU A 1 61  ? -8.653  -18.058 -6.003  1.00 0.00 ? 61  LEU A CA   5  
ATOM 7200  C C    . LEU A 1 61  ? -9.342  -17.199 -7.059  1.00 0.00 ? 61  LEU A C    5  
ATOM 7201  O O    . LEU A 1 61  ? -10.250 -16.428 -6.750  1.00 0.00 ? 61  LEU A O    5  
ATOM 7202  C CB   . LEU A 1 61  ? -7.350  -17.391 -5.558  1.00 0.00 ? 61  LEU A CB   5  
ATOM 7203  C CG   . LEU A 1 61  ? -6.673  -17.997 -4.328  1.00 0.00 ? 61  LEU A CG   5  
ATOM 7204  C CD1  . LEU A 1 61  ? -5.188  -17.667 -4.320  1.00 0.00 ? 61  LEU A CD1  5  
ATOM 7205  C CD2  . LEU A 1 61  ? -7.338  -17.500 -3.053  1.00 0.00 ? 61  LEU A CD2  5  
ATOM 7206  H H    . LEU A 1 61  ? -7.564  -19.856 -6.243  1.00 0.00 ? 61  LEU A H    5  
ATOM 7207  H HA   . LEU A 1 61  ? -9.309  -18.154 -5.151  1.00 0.00 ? 61  LEU A HA   5  
ATOM 7208  H HB2  . LEU A 1 61  ? -6.653  -17.445 -6.380  1.00 0.00 ? 61  LEU A HB2  5  
ATOM 7209  H HB3  . LEU A 1 61  ? -7.568  -16.355 -5.340  1.00 0.00 ? 61  LEU A HB3  5  
ATOM 7210  H HG   . LEU A 1 61  ? -6.774  -19.073 -4.363  1.00 0.00 ? 61  LEU A HG   5  
ATOM 7211  H HD11 . LEU A 1 61  ? -5.056  -16.608 -4.156  1.00 0.00 ? 61  LEU A HD11 5  
ATOM 7212  H HD12 . LEU A 1 61  ? -4.753  -17.941 -5.270  1.00 0.00 ? 61  LEU A HD12 5  
ATOM 7213  H HD13 . LEU A 1 61  ? -4.701  -18.218 -3.529  1.00 0.00 ? 61  LEU A HD13 5  
ATOM 7214  H HD21 . LEU A 1 61  ? -7.441  -18.321 -2.358  1.00 0.00 ? 61  LEU A HD21 5  
ATOM 7215  H HD22 . LEU A 1 61  ? -8.315  -17.103 -3.288  1.00 0.00 ? 61  LEU A HD22 5  
ATOM 7216  H HD23 . LEU A 1 61  ? -6.732  -16.726 -2.609  1.00 0.00 ? 61  LEU A HD23 5  
ATOM 7217  N N    . GLY A 1 62  ? -8.905  -17.339 -8.307  1.00 0.00 ? 62  GLY A N    5  
ATOM 7218  C CA   . GLY A 1 62  ? -9.492  -16.571 -9.389  1.00 0.00 ? 62  GLY A CA   5  
ATOM 7219  C C    . GLY A 1 62  ? -9.422  -15.077 -9.145  1.00 0.00 ? 62  GLY A C    5  
ATOM 7220  O O    . GLY A 1 62  ? -8.393  -14.448 -9.392  1.00 0.00 ? 62  GLY A O    5  
ATOM 7221  H H    . GLY A 1 62  ? -8.178  -17.969 -8.493  1.00 0.00 ? 62  GLY A H    5  
ATOM 7222  H HA2  . GLY A 1 62  ? -8.968  -16.801 -10.305 1.00 0.00 ? 62  GLY A HA2  5  
ATOM 7223  H HA3  . GLY A 1 62  ? -10.528 -16.858 -9.498  1.00 0.00 ? 62  GLY A HA3  5  
ATOM 7224  N N    . SER A 1 63  ? -10.520 -14.506 -8.659  1.00 0.00 ? 63  SER A N    5  
ATOM 7225  C CA   . SER A 1 63  ? -10.580 -13.075 -8.387  1.00 0.00 ? 63  SER A CA   5  
ATOM 7226  C C    . SER A 1 63  ? -9.686  -12.708 -7.206  1.00 0.00 ? 63  SER A C    5  
ATOM 7227  O O    . SER A 1 63  ? -9.216  -11.576 -7.097  1.00 0.00 ? 63  SER A O    5  
ATOM 7228  C CB   . SER A 1 63  ? -12.021 -12.649 -8.101  1.00 0.00 ? 63  SER A CB   5  
ATOM 7229  O OG   . SER A 1 63  ? -12.184 -11.252 -8.271  1.00 0.00 ? 63  SER A OG   5  
ATOM 7230  H H    . SER A 1 63  ? -11.308 -15.060 -8.483  1.00 0.00 ? 63  SER A H    5  
ATOM 7231  H HA   . SER A 1 63  ? -10.228 -12.555 -9.265  1.00 0.00 ? 63  SER A HA   5  
ATOM 7232  H HB2  . SER A 1 63  ? -12.687 -13.162 -8.778  1.00 0.00 ? 63  SER A HB2  5  
ATOM 7233  H HB3  . SER A 1 63  ? -12.275 -12.908 -7.083  1.00 0.00 ? 63  SER A HB3  5  
ATOM 7234  H HG   . SER A 1 63  ? -12.148 -11.037 -9.206  1.00 0.00 ? 63  SER A HG   5  
ATOM 7235  N N    . ASN A 1 64  ? -9.455  -13.675 -6.324  1.00 0.00 ? 64  ASN A N    5  
ATOM 7236  C CA   . ASN A 1 64  ? -8.618  -13.455 -5.150  1.00 0.00 ? 64  ASN A CA   5  
ATOM 7237  C C    . ASN A 1 64  ? -7.201  -13.970 -5.388  1.00 0.00 ? 64  ASN A C    5  
ATOM 7238  O O    . ASN A 1 64  ? -6.432  -14.162 -4.446  1.00 0.00 ? 64  ASN A O    5  
ATOM 7239  C CB   . ASN A 1 64  ? -9.225  -14.147 -3.928  1.00 0.00 ? 64  ASN A CB   5  
ATOM 7240  C CG   . ASN A 1 64  ? -10.684 -13.786 -3.725  1.00 0.00 ? 64  ASN A CG   5  
ATOM 7241  O OD1  . ASN A 1 64  ? -11.123 -12.698 -4.095  1.00 0.00 ? 64  ASN A OD1  5  
ATOM 7242  N ND2  . ASN A 1 64  ? -11.443 -14.702 -3.133  1.00 0.00 ? 64  ASN A ND2  5  
ATOM 7243  H H    . ASN A 1 64  ? -9.858  -14.557 -6.465  1.00 0.00 ? 64  ASN A H    5  
ATOM 7244  H HA   . ASN A 1 64  ? -8.576  -12.392 -4.967  1.00 0.00 ? 64  ASN A HA   5  
ATOM 7245  H HB2  . ASN A 1 64  ? -9.154  -15.218 -4.056  1.00 0.00 ? 64  ASN A HB2  5  
ATOM 7246  H HB3  . ASN A 1 64  ? -8.674  -13.856 -3.046  1.00 0.00 ? 64  ASN A HB3  5  
ATOM 7247  H HD21 . ASN A 1 64  ? -11.025 -15.547 -2.864  1.00 0.00 ? 64  ASN A HD21 5  
ATOM 7248  H HD22 . ASN A 1 64  ? -12.390 -14.495 -2.989  1.00 0.00 ? 64  ASN A HD22 5  
ATOM 7249  N N    . LEU A 1 65  ? -6.863  -14.190 -6.654  1.00 0.00 ? 65  LEU A N    5  
ATOM 7250  C CA   . LEU A 1 65  ? -5.539  -14.682 -7.017  1.00 0.00 ? 65  LEU A CA   5  
ATOM 7251  C C    . LEU A 1 65  ? -4.562  -13.526 -7.209  1.00 0.00 ? 65  LEU A C    5  
ATOM 7252  O O    . LEU A 1 65  ? -4.928  -12.470 -7.725  1.00 0.00 ? 65  LEU A O    5  
ATOM 7253  C CB   . LEU A 1 65  ? -5.616  -15.516 -8.297  1.00 0.00 ? 65  LEU A CB   5  
ATOM 7254  C CG   . LEU A 1 65  ? -4.362  -16.315 -8.655  1.00 0.00 ? 65  LEU A CG   5  
ATOM 7255  C CD1  . LEU A 1 65  ? -4.414  -17.699 -8.026  1.00 0.00 ? 65  LEU A CD1  5  
ATOM 7256  C CD2  . LEU A 1 65  ? -4.209  -16.419 -10.165 1.00 0.00 ? 65  LEU A CD2  5  
ATOM 7257  H H    . LEU A 1 65  ? -7.519  -14.019 -7.362  1.00 0.00 ? 65  LEU A H    5  
ATOM 7258  H HA   . LEU A 1 65  ? -5.185  -15.307 -6.211  1.00 0.00 ? 65  LEU A HA   5  
ATOM 7259  H HB2  . LEU A 1 65  ? -6.433  -16.213 -8.189  1.00 0.00 ? 65  LEU A HB2  5  
ATOM 7260  H HB3  . LEU A 1 65  ? -5.826  -14.844 -9.117  1.00 0.00 ? 65  LEU A HB3  5  
ATOM 7261  H HG   . LEU A 1 65  ? -3.494  -15.804 -8.264  1.00 0.00 ? 65  LEU A HG   5  
ATOM 7262  H HD11 . LEU A 1 65  ? -5.443  -17.988 -7.876  1.00 0.00 ? 65  LEU A HD11 5  
ATOM 7263  H HD12 . LEU A 1 65  ? -3.903  -17.681 -7.074  1.00 0.00 ? 65  LEU A HD12 5  
ATOM 7264  H HD13 . LEU A 1 65  ? -3.931  -18.410 -8.680  1.00 0.00 ? 65  LEU A HD13 5  
ATOM 7265  H HD21 . LEU A 1 65  ? -3.182  -16.225 -10.436 1.00 0.00 ? 65  LEU A HD21 5  
ATOM 7266  H HD22 . LEU A 1 65  ? -4.851  -15.694 -10.643 1.00 0.00 ? 65  LEU A HD22 5  
ATOM 7267  H HD23 . LEU A 1 65  ? -4.485  -17.413 -10.487 1.00 0.00 ? 65  LEU A HD23 5  
ATOM 7268  N N    . VAL A 1 66  ? -3.318  -13.734 -6.791  1.00 0.00 ? 66  VAL A N    5  
ATOM 7269  C CA   . VAL A 1 66  ? -2.287  -12.711 -6.919  1.00 0.00 ? 66  VAL A CA   5  
ATOM 7270  C C    . VAL A 1 66  ? -1.372  -12.998 -8.104  1.00 0.00 ? 66  VAL A C    5  
ATOM 7271  O O    . VAL A 1 66  ? -1.109  -14.155 -8.434  1.00 0.00 ? 66  VAL A O    5  
ATOM 7272  C CB   . VAL A 1 66  ? -1.436  -12.608 -5.640  1.00 0.00 ? 66  VAL A CB   5  
ATOM 7273  C CG1  . VAL A 1 66  ? -0.506  -11.406 -5.712  1.00 0.00 ? 66  VAL A CG1  5  
ATOM 7274  C CG2  . VAL A 1 66  ? -2.329  -12.529 -4.411  1.00 0.00 ? 66  VAL A CG2  5  
ATOM 7275  H H    . VAL A 1 66  ? -3.087  -14.597 -6.388  1.00 0.00 ? 66  VAL A H    5  
ATOM 7276  H HA   . VAL A 1 66  ? -2.777  -11.761 -7.077  1.00 0.00 ? 66  VAL A HA   5  
ATOM 7277  H HB   . VAL A 1 66  ? -0.830  -13.499 -5.562  1.00 0.00 ? 66  VAL A HB   5  
ATOM 7278  H HG11 . VAL A 1 66  ? 0.138   -11.398 -4.845  1.00 0.00 ? 66  VAL A HG11 5  
ATOM 7279  H HG12 . VAL A 1 66  ? 0.094   -11.468 -6.607  1.00 0.00 ? 66  VAL A HG12 5  
ATOM 7280  H HG13 . VAL A 1 66  ? -1.092  -10.499 -5.732  1.00 0.00 ? 66  VAL A HG13 5  
ATOM 7281  H HG21 . VAL A 1 66  ? -1.774  -12.850 -3.542  1.00 0.00 ? 66  VAL A HG21 5  
ATOM 7282  H HG22 . VAL A 1 66  ? -2.659  -11.510 -4.270  1.00 0.00 ? 66  VAL A HG22 5  
ATOM 7283  H HG23 . VAL A 1 66  ? -3.188  -13.169 -4.548  1.00 0.00 ? 66  VAL A HG23 5  
ATOM 7284  N N    . THR A 1 67  ? -0.887  -11.937 -8.741  1.00 0.00 ? 67  THR A N    5  
ATOM 7285  C CA   . THR A 1 67  ? -0.001  -12.074 -9.890  1.00 0.00 ? 67  THR A CA   5  
ATOM 7286  C C    . THR A 1 67  ? 1.062   -10.981 -9.898  1.00 0.00 ? 67  THR A C    5  
ATOM 7287  O O    . THR A 1 67  ? 0.855   -9.897  -9.354  1.00 0.00 ? 67  THR A O    5  
ATOM 7288  C CB   . THR A 1 67  ? -0.786  -12.021 -11.215 1.00 0.00 ? 67  THR A CB   5  
ATOM 7289  O OG1  . THR A 1 67  ? -1.189  -10.675 -11.491 1.00 0.00 ? 67  THR A OG1  5  
ATOM 7290  C CG2  . THR A 1 67  ? -2.011  -12.920 -11.154 1.00 0.00 ? 67  THR A CG2  5  
ATOM 7291  H H    . THR A 1 67  ? -1.133  -11.040 -8.431  1.00 0.00 ? 67  THR A H    5  
ATOM 7292  H HA   . THR A 1 67  ? 0.486   -13.036 -9.823  1.00 0.00 ? 67  THR A HA   5  
ATOM 7293  H HB   . THR A 1 67  ? -0.142  -12.366 -12.011 1.00 0.00 ? 67  THR A HB   5  
ATOM 7294  H HG1  . THR A 1 67  ? -0.877  -10.420 -12.363 1.00 0.00 ? 67  THR A HG1  5  
ATOM 7295  H HG21 . THR A 1 67  ? -1.713  -13.915 -10.858 1.00 0.00 ? 67  THR A HG21 5  
ATOM 7296  H HG22 . THR A 1 67  ? -2.478  -12.959 -12.127 1.00 0.00 ? 67  THR A HG22 5  
ATOM 7297  H HG23 . THR A 1 67  ? -2.712  -12.525 -10.434 1.00 0.00 ? 67  THR A HG23 5  
ATOM 7298  N N    . GLU A 1 68  ? 2.200   -11.274 -10.520 1.00 0.00 ? 68  GLU A N    5  
ATOM 7299  C CA   . GLU A 1 68  ? 3.296   -10.315 -10.598 1.00 0.00 ? 68  GLU A CA   5  
ATOM 7300  C C    . GLU A 1 68  ? 2.763   -8.888  -10.704 1.00 0.00 ? 68  GLU A C    5  
ATOM 7301  O O    . GLU A 1 68  ? 3.327   -7.959  -10.127 1.00 0.00 ? 68  GLU A O    5  
ATOM 7302  C CB   . GLU A 1 68  ? 4.192   -10.627 -11.798 1.00 0.00 ? 68  GLU A CB   5  
ATOM 7303  C CG   . GLU A 1 68  ? 5.566   -9.985  -11.715 1.00 0.00 ? 68  GLU A CG   5  
ATOM 7304  C CD   . GLU A 1 68  ? 6.185   -9.752  -13.080 1.00 0.00 ? 68  GLU A CD   5  
ATOM 7305  O OE1  . GLU A 1 68  ? 5.425   -9.573  -14.054 1.00 0.00 ? 68  GLU A OE1  5  
ATOM 7306  O OE2  . GLU A 1 68  ? 7.431   -9.750  -13.173 1.00 0.00 ? 68  GLU A OE2  5  
ATOM 7307  H H    . GLU A 1 68  ? 2.306   -12.155 -10.935 1.00 0.00 ? 68  GLU A H    5  
ATOM 7308  H HA   . GLU A 1 68  ? 3.878   -10.402 -9.694  1.00 0.00 ? 68  GLU A HA   5  
ATOM 7309  H HB2  . GLU A 1 68  ? 4.320   -11.697 -11.868 1.00 0.00 ? 68  GLU A HB2  5  
ATOM 7310  H HB3  . GLU A 1 68  ? 3.706   -10.273 -12.696 1.00 0.00 ? 68  GLU A HB3  5  
ATOM 7311  H HG2  . GLU A 1 68  ? 5.476   -9.034  -11.212 1.00 0.00 ? 68  GLU A HG2  5  
ATOM 7312  H HG3  . GLU A 1 68  ? 6.218   -10.631 -11.146 1.00 0.00 ? 68  GLU A HG3  5  
ATOM 7313  N N    . VAL A 1 69  ? 1.673   -8.724  -11.447 1.00 0.00 ? 69  VAL A N    5  
ATOM 7314  C CA   . VAL A 1 69  ? 1.064   -7.412  -11.629 1.00 0.00 ? 69  VAL A CA   5  
ATOM 7315  C C    . VAL A 1 69  ? 0.463   -6.899  -10.325 1.00 0.00 ? 69  VAL A C    5  
ATOM 7316  O O    . VAL A 1 69  ? 0.803   -5.812  -9.858  1.00 0.00 ? 69  VAL A O    5  
ATOM 7317  C CB   . VAL A 1 69  ? -0.034  -7.448  -12.708 1.00 0.00 ? 69  VAL A CB   5  
ATOM 7318  C CG1  . VAL A 1 69  ? -0.977  -6.265  -12.551 1.00 0.00 ? 69  VAL A CG1  5  
ATOM 7319  C CG2  . VAL A 1 69  ? 0.585   -7.466  -14.098 1.00 0.00 ? 69  VAL A CG2  5  
ATOM 7320  H H    . VAL A 1 69  ? 1.269   -9.503  -11.882 1.00 0.00 ? 69  VAL A H    5  
ATOM 7321  H HA   . VAL A 1 69  ? 1.835   -6.727  -11.952 1.00 0.00 ? 69  VAL A HA   5  
ATOM 7322  H HB   . VAL A 1 69  ? -0.607  -8.355  -12.581 1.00 0.00 ? 69  VAL A HB   5  
ATOM 7323  H HG11 . VAL A 1 69  ? -1.531  -6.366  -11.630 1.00 0.00 ? 69  VAL A HG11 5  
ATOM 7324  H HG12 . VAL A 1 69  ? -0.405  -5.349  -12.530 1.00 0.00 ? 69  VAL A HG12 5  
ATOM 7325  H HG13 . VAL A 1 69  ? -1.666  -6.241  -13.383 1.00 0.00 ? 69  VAL A HG13 5  
ATOM 7326  H HG21 . VAL A 1 69  ? 1.066   -6.518  -14.289 1.00 0.00 ? 69  VAL A HG21 5  
ATOM 7327  H HG22 . VAL A 1 69  ? 1.317   -8.259  -14.156 1.00 0.00 ? 69  VAL A HG22 5  
ATOM 7328  H HG23 . VAL A 1 69  ? -0.186  -7.634  -14.834 1.00 0.00 ? 69  VAL A HG23 5  
ATOM 7329  N N    . ARG A 1 70  ? -0.433  -7.689  -9.742  1.00 0.00 ? 70  ARG A N    5  
ATOM 7330  C CA   . ARG A 1 70  ? -1.083  -7.315  -8.492  1.00 0.00 ? 70  ARG A CA   5  
ATOM 7331  C C    . ARG A 1 70  ? -0.083  -6.684  -7.527  1.00 0.00 ? 70  ARG A C    5  
ATOM 7332  O O    . ARG A 1 70  ? -0.334  -5.617  -6.967  1.00 0.00 ? 70  ARG A O    5  
ATOM 7333  C CB   . ARG A 1 70  ? -1.730  -8.540  -7.843  1.00 0.00 ? 70  ARG A CB   5  
ATOM 7334  C CG   . ARG A 1 70  ? -2.749  -9.234  -8.732  1.00 0.00 ? 70  ARG A CG   5  
ATOM 7335  C CD   . ARG A 1 70  ? -4.071  -8.483  -8.756  1.00 0.00 ? 70  ARG A CD   5  
ATOM 7336  N NE   . ARG A 1 70  ? -4.774  -8.652  -10.025 1.00 0.00 ? 70  ARG A NE   5  
ATOM 7337  C CZ   . ARG A 1 70  ? -5.390  -9.775  -10.379 1.00 0.00 ? 70  ARG A CZ   5  
ATOM 7338  N NH1  . ARG A 1 70  ? -5.389  -10.821 -9.565  1.00 0.00 ? 70  ARG A NH1  5  
ATOM 7339  N NH2  . ARG A 1 70  ? -6.008  -9.852  -11.551 1.00 0.00 ? 70  ARG A NH2  5  
ATOM 7340  H H    . ARG A 1 70  ? -0.663  -8.544  -10.163 1.00 0.00 ? 70  ARG A H    5  
ATOM 7341  H HA   . ARG A 1 70  ? -1.851  -6.592  -8.720  1.00 0.00 ? 70  ARG A HA   5  
ATOM 7342  H HB2  . ARG A 1 70  ? -0.958  -9.252  -7.595  1.00 0.00 ? 70  ARG A HB2  5  
ATOM 7343  H HB3  . ARG A 1 70  ? -2.228  -8.230  -6.936  1.00 0.00 ? 70  ARG A HB3  5  
ATOM 7344  H HG2  . ARG A 1 70  ? -2.359  -9.285  -9.738  1.00 0.00 ? 70  ARG A HG2  5  
ATOM 7345  H HG3  . ARG A 1 70  ? -2.919  -10.232 -8.358  1.00 0.00 ? 70  ARG A HG3  5  
ATOM 7346  H HD2  . ARG A 1 70  ? -4.695  -8.854  -7.957  1.00 0.00 ? 70  ARG A HD2  5  
ATOM 7347  H HD3  . ARG A 1 70  ? -3.875  -7.432  -8.601  1.00 0.00 ? 70  ARG A HD3  5  
ATOM 7348  H HE   . ARG A 1 70  ? -4.787  -7.892  -10.642 1.00 0.00 ? 70  ARG A HE   5  
ATOM 7349  H HH11 . ARG A 1 70  ? -4.925  -10.765 -8.681  1.00 0.00 ? 70  ARG A HH11 5  
ATOM 7350  H HH12 . ARG A 1 70  ? -5.854  -11.665 -9.834  1.00 0.00 ? 70  ARG A HH12 5  
ATOM 7351  H HH21 . ARG A 1 70  ? -6.011  -9.066  -12.167 1.00 0.00 ? 70  ARG A HH21 5  
ATOM 7352  H HH22 . ARG A 1 70  ? -6.471  -10.698 -11.817 1.00 0.00 ? 70  ARG A HH22 5  
ATOM 7353  N N    . VAL A 1 71  ? 1.051   -7.351  -7.338  1.00 0.00 ? 71  VAL A N    5  
ATOM 7354  C CA   . VAL A 1 71  ? 2.089   -6.855  -6.442  1.00 0.00 ? 71  VAL A CA   5  
ATOM 7355  C C    . VAL A 1 71  ? 2.738   -5.593  -6.998  1.00 0.00 ? 71  VAL A C    5  
ATOM 7356  O O    . VAL A 1 71  ? 3.129   -4.700  -6.246  1.00 0.00 ? 71  VAL A O    5  
ATOM 7357  C CB   . VAL A 1 71  ? 3.179   -7.918  -6.204  1.00 0.00 ? 71  VAL A CB   5  
ATOM 7358  C CG1  . VAL A 1 71  ? 4.063   -7.521  -5.031  1.00 0.00 ? 71  VAL A CG1  5  
ATOM 7359  C CG2  . VAL A 1 71  ? 2.549   -9.283  -5.970  1.00 0.00 ? 71  VAL A CG2  5  
ATOM 7360  H H    . VAL A 1 71  ? 1.193   -8.196  -7.813  1.00 0.00 ? 71  VAL A H    5  
ATOM 7361  H HA   . VAL A 1 71  ? 1.628   -6.623  -5.493  1.00 0.00 ? 71  VAL A HA   5  
ATOM 7362  H HB   . VAL A 1 71  ? 3.796   -7.976  -7.088  1.00 0.00 ? 71  VAL A HB   5  
ATOM 7363  H HG11 . VAL A 1 71  ? 5.101   -7.600  -5.321  1.00 0.00 ? 71  VAL A HG11 5  
ATOM 7364  H HG12 . VAL A 1 71  ? 3.845   -6.504  -4.743  1.00 0.00 ? 71  VAL A HG12 5  
ATOM 7365  H HG13 . VAL A 1 71  ? 3.873   -8.181  -4.198  1.00 0.00 ? 71  VAL A HG13 5  
ATOM 7366  H HG21 . VAL A 1 71  ? 3.042   -9.768  -5.141  1.00 0.00 ? 71  VAL A HG21 5  
ATOM 7367  H HG22 . VAL A 1 71  ? 1.500   -9.162  -5.743  1.00 0.00 ? 71  VAL A HG22 5  
ATOM 7368  H HG23 . VAL A 1 71  ? 2.658   -9.887  -6.858  1.00 0.00 ? 71  VAL A HG23 5  
ATOM 7369  N N    . TYR A 1 72  ? 2.850   -5.525  -8.320  1.00 0.00 ? 72  TYR A N    5  
ATOM 7370  C CA   . TYR A 1 72  ? 3.454   -4.373  -8.978  1.00 0.00 ? 72  TYR A CA   5  
ATOM 7371  C C    . TYR A 1 72  ? 2.628   -3.113  -8.737  1.00 0.00 ? 72  TYR A C    5  
ATOM 7372  O O    . TYR A 1 72  ? 3.172   -2.020  -8.587  1.00 0.00 ? 72  TYR A O    5  
ATOM 7373  C CB   . TYR A 1 72  ? 3.589   -4.629  -10.480 1.00 0.00 ? 72  TYR A CB   5  
ATOM 7374  C CG   . TYR A 1 72  ? 3.713   -3.365  -11.301 1.00 0.00 ? 72  TYR A CG   5  
ATOM 7375  C CD1  . TYR A 1 72  ? 2.652   -2.475  -11.407 1.00 0.00 ? 72  TYR A CD1  5  
ATOM 7376  C CD2  . TYR A 1 72  ? 4.892   -3.062  -11.971 1.00 0.00 ? 72  TYR A CD2  5  
ATOM 7377  C CE1  . TYR A 1 72  ? 2.761   -1.319  -12.156 1.00 0.00 ? 72  TYR A CE1  5  
ATOM 7378  C CE2  . TYR A 1 72  ? 5.010   -1.908  -12.722 1.00 0.00 ? 72  TYR A CE2  5  
ATOM 7379  C CZ   . TYR A 1 72  ? 3.942   -1.040  -12.811 1.00 0.00 ? 72  TYR A CZ   5  
ATOM 7380  O OH   . TYR A 1 72  ? 4.056   0.109   -13.559 1.00 0.00 ? 72  TYR A OH   5  
ATOM 7381  H H    . TYR A 1 72  ? 2.520   -6.269  -8.867  1.00 0.00 ? 72  TYR A H    5  
ATOM 7382  H HA   . TYR A 1 72  ? 4.439   -4.229  -8.558  1.00 0.00 ? 72  TYR A HA   5  
ATOM 7383  H HB2  . TYR A 1 72  ? 4.468   -5.228  -10.659 1.00 0.00 ? 72  TYR A HB2  5  
ATOM 7384  H HB3  . TYR A 1 72  ? 2.717   -5.165  -10.826 1.00 0.00 ? 72  TYR A HB3  5  
ATOM 7385  H HD1  . TYR A 1 72  ? 1.728   -2.696  -10.892 1.00 0.00 ? 72  TYR A HD1  5  
ATOM 7386  H HD2  . TYR A 1 72  ? 5.726   -3.745  -11.899 1.00 0.00 ? 72  TYR A HD2  5  
ATOM 7387  H HE1  . TYR A 1 72  ? 1.925   -0.639  -12.226 1.00 0.00 ? 72  TYR A HE1  5  
ATOM 7388  H HE2  . TYR A 1 72  ? 5.935   -1.690  -13.235 1.00 0.00 ? 72  TYR A HE2  5  
ATOM 7389  H HH   . TYR A 1 72  ? 4.041   0.872   -12.977 1.00 0.00 ? 72  TYR A HH   5  
ATOM 7390  N N    . ASN A 1 73  ? 1.309   -3.276  -8.701  1.00 0.00 ? 73  ASN A N    5  
ATOM 7391  C CA   . ASN A 1 73  ? 0.406   -2.153  -8.479  1.00 0.00 ? 73  ASN A CA   5  
ATOM 7392  C C    . ASN A 1 73  ? 0.435   -1.712  -7.019  1.00 0.00 ? 73  ASN A C    5  
ATOM 7393  O O    . ASN A 1 73  ? 0.626   -0.534  -6.719  1.00 0.00 ? 73  ASN A O    5  
ATOM 7394  C CB   . ASN A 1 73  ? -1.021  -2.533  -8.880  1.00 0.00 ? 73  ASN A CB   5  
ATOM 7395  C CG   . ASN A 1 73  ? -1.300  -2.266  -10.347 1.00 0.00 ? 73  ASN A CG   5  
ATOM 7396  O OD1  . ASN A 1 73  ? -1.479  -1.119  -10.757 1.00 0.00 ? 73  ASN A OD1  5  
ATOM 7397  N ND2  . ASN A 1 73  ? -1.338  -3.327  -11.144 1.00 0.00 ? 73  ASN A ND2  5  
ATOM 7398  H H    . ASN A 1 73  ? 0.935   -4.173  -8.828  1.00 0.00 ? 73  ASN A H    5  
ATOM 7399  H HA   . ASN A 1 73  ? 0.738   -1.333  -9.097  1.00 0.00 ? 73  ASN A HA   5  
ATOM 7400  H HB2  . ASN A 1 73  ? -1.174  -3.585  -8.691  1.00 0.00 ? 73  ASN A HB2  5  
ATOM 7401  H HB3  . ASN A 1 73  ? -1.720  -1.959  -8.289  1.00 0.00 ? 73  ASN A HB3  5  
ATOM 7402  H HD21 . ASN A 1 73  ? -1.186  -4.210  -10.748 1.00 0.00 ? 73  ASN A HD21 5  
ATOM 7403  H HD22 . ASN A 1 73  ? -1.515  -3.183  -12.097 1.00 0.00 ? 73  ASN A HD22 5  
ATOM 7404  N N    . TRP A 1 74  ? 0.246   -2.667  -6.115  1.00 0.00 ? 74  TRP A N    5  
ATOM 7405  C CA   . TRP A 1 74  ? 0.251   -2.377  -4.685  1.00 0.00 ? 74  TRP A CA   5  
ATOM 7406  C C    . TRP A 1 74  ? 1.472   -1.548  -4.302  1.00 0.00 ? 74  TRP A C    5  
ATOM 7407  O O    . TRP A 1 74  ? 1.359   -0.553  -3.586  1.00 0.00 ? 74  TRP A O    5  
ATOM 7408  C CB   . TRP A 1 74  ? 0.229   -3.677  -3.880  1.00 0.00 ? 74  TRP A CB   5  
ATOM 7409  C CG   . TRP A 1 74  ? 0.106   -3.459  -2.403  1.00 0.00 ? 74  TRP A CG   5  
ATOM 7410  C CD1  . TRP A 1 74  ? -1.047  -3.434  -1.672  1.00 0.00 ? 74  TRP A CD1  5  
ATOM 7411  C CD2  . TRP A 1 74  ? 1.175   -3.234  -1.477  1.00 0.00 ? 74  TRP A CD2  5  
ATOM 7412  N NE1  . TRP A 1 74  ? -0.760  -3.207  -0.347  1.00 0.00 ? 74  TRP A NE1  5  
ATOM 7413  C CE2  . TRP A 1 74  ? 0.597   -3.081  -0.202  1.00 0.00 ? 74  TRP A CE2  5  
ATOM 7414  C CE3  . TRP A 1 74  ? 2.564   -3.149  -1.601  1.00 0.00 ? 74  TRP A CE3  5  
ATOM 7415  C CZ2  . TRP A 1 74  ? 1.360   -2.847  0.938   1.00 0.00 ? 74  TRP A CZ2  5  
ATOM 7416  C CZ3  . TRP A 1 74  ? 3.321   -2.916  -0.469  1.00 0.00 ? 74  TRP A CZ3  5  
ATOM 7417  C CH2  . TRP A 1 74  ? 2.718   -2.768  0.788   1.00 0.00 ? 74  TRP A CH2  5  
ATOM 7418  H H    . TRP A 1 74  ? 0.098   -3.588  -6.415  1.00 0.00 ? 74  TRP A H    5  
ATOM 7419  H HA   . TRP A 1 74  ? -0.640  -1.810  -4.459  1.00 0.00 ? 74  TRP A HA   5  
ATOM 7420  H HB2  . TRP A 1 74  ? -0.609  -4.277  -4.200  1.00 0.00 ? 74  TRP A HB2  5  
ATOM 7421  H HB3  . TRP A 1 74  ? 1.146   -4.220  -4.062  1.00 0.00 ? 74  TRP A HB3  5  
ATOM 7422  H HD1  . TRP A 1 74  ? -2.034  -3.572  -2.087  1.00 0.00 ? 74  TRP A HD1  5  
ATOM 7423  H HE1  . TRP A 1 74  ? -1.419  -3.146  0.376   1.00 0.00 ? 74  TRP A HE1  5  
ATOM 7424  H HE3  . TRP A 1 74  ? 3.047   -3.260  -2.561  1.00 0.00 ? 74  TRP A HE3  5  
ATOM 7425  H HZ2  . TRP A 1 74  ? 0.911   -2.732  1.914   1.00 0.00 ? 74  TRP A HZ2  5  
ATOM 7426  H HZ3  . TRP A 1 74  ? 4.396   -2.846  -0.545  1.00 0.00 ? 74  TRP A HZ3  5  
ATOM 7427  H HH2  . TRP A 1 74  ? 3.348   -2.587  1.645   1.00 0.00 ? 74  TRP A HH2  5  
ATOM 7428  N N    . PHE A 1 75  ? 2.639   -1.963  -4.784  1.00 0.00 ? 75  PHE A N    5  
ATOM 7429  C CA   . PHE A 1 75  ? 3.881   -1.259  -4.491  1.00 0.00 ? 75  PHE A CA   5  
ATOM 7430  C C    . PHE A 1 75  ? 3.866   0.144   -5.092  1.00 0.00 ? 75  PHE A C    5  
ATOM 7431  O O    . PHE A 1 75  ? 4.351   1.097   -4.483  1.00 0.00 ? 75  PHE A O    5  
ATOM 7432  C CB   . PHE A 1 75  ? 5.078   -2.044  -5.032  1.00 0.00 ? 75  PHE A CB   5  
ATOM 7433  C CG   . PHE A 1 75  ? 5.631   -3.042  -4.055  1.00 0.00 ? 75  PHE A CG   5  
ATOM 7434  C CD1  . PHE A 1 75  ? 4.904   -4.169  -3.708  1.00 0.00 ? 75  PHE A CD1  5  
ATOM 7435  C CD2  . PHE A 1 75  ? 6.879   -2.852  -3.484  1.00 0.00 ? 75  PHE A CD2  5  
ATOM 7436  C CE1  . PHE A 1 75  ? 5.411   -5.087  -2.808  1.00 0.00 ? 75  PHE A CE1  5  
ATOM 7437  C CE2  . PHE A 1 75  ? 7.392   -3.768  -2.584  1.00 0.00 ? 75  PHE A CE2  5  
ATOM 7438  C CZ   . PHE A 1 75  ? 6.657   -4.887  -2.247  1.00 0.00 ? 75  PHE A CZ   5  
ATOM 7439  H H    . PHE A 1 75  ? 2.664   -2.764  -5.350  1.00 0.00 ? 75  PHE A H    5  
ATOM 7440  H HA   . PHE A 1 75  ? 3.970   -1.177  -3.419  1.00 0.00 ? 75  PHE A HA   5  
ATOM 7441  H HB2  . PHE A 1 75  ? 4.775   -2.582  -5.918  1.00 0.00 ? 75  PHE A HB2  5  
ATOM 7442  H HB3  . PHE A 1 75  ? 5.867   -1.354  -5.287  1.00 0.00 ? 75  PHE A HB3  5  
ATOM 7443  H HD1  . PHE A 1 75  ? 3.930   -4.327  -4.147  1.00 0.00 ? 75  PHE A HD1  5  
ATOM 7444  H HD2  . PHE A 1 75  ? 7.455   -1.976  -3.747  1.00 0.00 ? 75  PHE A HD2  5  
ATOM 7445  H HE1  . PHE A 1 75  ? 4.834   -5.962  -2.547  1.00 0.00 ? 75  PHE A HE1  5  
ATOM 7446  H HE2  . PHE A 1 75  ? 8.366   -3.608  -2.146  1.00 0.00 ? 75  PHE A HE2  5  
ATOM 7447  H HZ   . PHE A 1 75  ? 7.054   -5.603  -1.543  1.00 0.00 ? 75  PHE A HZ   5  
ATOM 7448  N N    . ALA A 1 76  ? 3.306   0.261   -6.292  1.00 0.00 ? 76  ALA A N    5  
ATOM 7449  C CA   . ALA A 1 76  ? 3.225   1.546   -6.975  1.00 0.00 ? 76  ALA A CA   5  
ATOM 7450  C C    . ALA A 1 76  ? 2.458   2.565   -6.140  1.00 0.00 ? 76  ALA A C    5  
ATOM 7451  O O    . ALA A 1 76  ? 2.865   3.720   -6.024  1.00 0.00 ? 76  ALA A O    5  
ATOM 7452  C CB   . ALA A 1 76  ? 2.571   1.378   -8.339  1.00 0.00 ? 76  ALA A CB   5  
ATOM 7453  H H    . ALA A 1 76  ? 2.936   -0.536  -6.727  1.00 0.00 ? 76  ALA A H    5  
ATOM 7454  H HA   . ALA A 1 76  ? 4.232   1.906   -7.128  1.00 0.00 ? 76  ALA A HA   5  
ATOM 7455  H HB1  . ALA A 1 76  ? 1.992   2.260   -8.570  1.00 0.00 ? 76  ALA A HB1  5  
ATOM 7456  H HB2  . ALA A 1 76  ? 3.335   1.242   -9.090  1.00 0.00 ? 76  ALA A HB2  5  
ATOM 7457  H HB3  . ALA A 1 76  ? 1.923   0.515   -8.323  1.00 0.00 ? 76  ALA A HB3  5  
ATOM 7458  N N    . ASN A 1 77  ? 1.344   2.129   -5.560  1.00 0.00 ? 77  ASN A N    5  
ATOM 7459  C CA   . ASN A 1 77  ? 0.519   3.005   -4.736  1.00 0.00 ? 77  ASN A CA   5  
ATOM 7460  C C    . ASN A 1 77  ? 1.230   3.355   -3.432  1.00 0.00 ? 77  ASN A C    5  
ATOM 7461  O O    . ASN A 1 77  ? 0.988   4.410   -2.845  1.00 0.00 ? 77  ASN A O    5  
ATOM 7462  C CB   . ASN A 1 77  ? -0.824  2.338   -4.433  1.00 0.00 ? 77  ASN A CB   5  
ATOM 7463  C CG   . ASN A 1 77  ? -1.466  2.878   -3.170  1.00 0.00 ? 77  ASN A CG   5  
ATOM 7464  O OD1  . ASN A 1 77  ? -2.202  3.864   -3.207  1.00 0.00 ? 77  ASN A OD1  5  
ATOM 7465  N ND2  . ASN A 1 77  ? -1.190  2.232   -2.043  1.00 0.00 ? 77  ASN A ND2  5  
ATOM 7466  H H    . ASN A 1 77  ? 1.071   1.197   -5.689  1.00 0.00 ? 77  ASN A H    5  
ATOM 7467  H HA   . ASN A 1 77  ? 0.342   3.913   -5.291  1.00 0.00 ? 77  ASN A HA   5  
ATOM 7468  H HB2  . ASN A 1 77  ? -1.499  2.511   -5.259  1.00 0.00 ? 77  ASN A HB2  5  
ATOM 7469  H HB3  . ASN A 1 77  ? -0.674  1.276   -4.313  1.00 0.00 ? 77  ASN A HB3  5  
ATOM 7470  H HD21 . ASN A 1 77  ? -0.596  1.454   -2.089  1.00 0.00 ? 77  ASN A HD21 5  
ATOM 7471  H HD22 . ASN A 1 77  ? -1.592  2.559   -1.212  1.00 0.00 ? 77  ASN A HD22 5  
ATOM 7472  N N    . ARG A 1 78  ? 2.110   2.464   -2.986  1.00 0.00 ? 78  ARG A N    5  
ATOM 7473  C CA   . ARG A 1 78  ? 2.856   2.678   -1.753  1.00 0.00 ? 78  ARG A CA   5  
ATOM 7474  C C    . ARG A 1 78  ? 3.876   3.800   -1.922  1.00 0.00 ? 78  ARG A C    5  
ATOM 7475  O O    . ARG A 1 78  ? 4.148   4.552   -0.987  1.00 0.00 ? 78  ARG A O    5  
ATOM 7476  C CB   . ARG A 1 78  ? 3.564   1.390   -1.330  1.00 0.00 ? 78  ARG A CB   5  
ATOM 7477  C CG   . ARG A 1 78  ? 2.619   0.315   -0.819  1.00 0.00 ? 78  ARG A CG   5  
ATOM 7478  C CD   . ARG A 1 78  ? 2.407   0.426   0.682   1.00 0.00 ? 78  ARG A CD   5  
ATOM 7479  N NE   . ARG A 1 78  ? 3.672   0.482   1.411   1.00 0.00 ? 78  ARG A NE   5  
ATOM 7480  C CZ   . ARG A 1 78  ? 3.778   0.899   2.668   1.00 0.00 ? 78  ARG A CZ   5  
ATOM 7481  N NH1  . ARG A 1 78  ? 2.701   1.295   3.332   1.00 0.00 ? 78  ARG A NH1  5  
ATOM 7482  N NH2  . ARG A 1 78  ? 4.964   0.921   3.262   1.00 0.00 ? 78  ARG A NH2  5  
ATOM 7483  H H    . ARG A 1 78  ? 2.259   1.642   -3.499  1.00 0.00 ? 78  ARG A H    5  
ATOM 7484  H HA   . ARG A 1 78  ? 2.153   2.961   -0.984  1.00 0.00 ? 78  ARG A HA   5  
ATOM 7485  H HB2  . ARG A 1 78  ? 4.101   0.992   -2.179  1.00 0.00 ? 78  ARG A HB2  5  
ATOM 7486  H HB3  . ARG A 1 78  ? 4.269   1.622   -0.545  1.00 0.00 ? 78  ARG A HB3  5  
ATOM 7487  H HG2  . ARG A 1 78  ? 1.666   0.422   -1.315  1.00 0.00 ? 78  ARG A HG2  5  
ATOM 7488  H HG3  . ARG A 1 78  ? 3.037   -0.655  -1.044  1.00 0.00 ? 78  ARG A HG3  5  
ATOM 7489  H HD2  . ARG A 1 78  ? 1.845   1.325   0.887   1.00 0.00 ? 78  ARG A HD2  5  
ATOM 7490  H HD3  . ARG A 1 78  ? 1.847   -0.433  1.018   1.00 0.00 ? 78  ARG A HD3  5  
ATOM 7491  H HE   . ARG A 1 78  ? 4.481   0.194   0.939   1.00 0.00 ? 78  ARG A HE   5  
ATOM 7492  H HH11 . ARG A 1 78  ? 1.806   1.278   2.886   1.00 0.00 ? 78  ARG A HH11 5  
ATOM 7493  H HH12 . ARG A 1 78  ? 2.784   1.607   4.278   1.00 0.00 ? 78  ARG A HH12 5  
ATOM 7494  H HH21 . ARG A 1 78  ? 5.779   0.623   2.765   1.00 0.00 ? 78  ARG A HH21 5  
ATOM 7495  H HH22 . ARG A 1 78  ? 5.044   1.235   4.208   1.00 0.00 ? 78  ARG A HH22 5  
ATOM 7496  N N    . ARG A 1 79  ? 4.438   3.905   -3.122  1.00 0.00 ? 79  ARG A N    5  
ATOM 7497  C CA   . ARG A 1 79  ? 5.430   4.933   -3.414  1.00 0.00 ? 79  ARG A CA   5  
ATOM 7498  C C    . ARG A 1 79  ? 4.757   6.218   -3.888  1.00 0.00 ? 79  ARG A C    5  
ATOM 7499  O O    . ARG A 1 79  ? 5.285   7.314   -3.701  1.00 0.00 ? 79  ARG A O    5  
ATOM 7500  C CB   . ARG A 1 79  ? 6.413   4.438   -4.476  1.00 0.00 ? 79  ARG A CB   5  
ATOM 7501  C CG   . ARG A 1 79  ? 7.587   3.661   -3.904  1.00 0.00 ? 79  ARG A CG   5  
ATOM 7502  C CD   . ARG A 1 79  ? 8.764   3.640   -4.867  1.00 0.00 ? 79  ARG A CD   5  
ATOM 7503  N NE   . ARG A 1 79  ? 9.544   4.873   -4.804  1.00 0.00 ? 79  ARG A NE   5  
ATOM 7504  C CZ   . ARG A 1 79  ? 10.497  5.185   -5.675  1.00 0.00 ? 79  ARG A CZ   5  
ATOM 7505  N NH1  . ARG A 1 79  ? 10.787  4.359   -6.671  1.00 0.00 ? 79  ARG A NH1  5  
ATOM 7506  N NH2  . ARG A 1 79  ? 11.163  6.326   -5.552  1.00 0.00 ? 79  ARG A NH2  5  
ATOM 7507  H H    . ARG A 1 79  ? 4.181   3.276   -3.828  1.00 0.00 ? 79  ARG A H    5  
ATOM 7508  H HA   . ARG A 1 79  ? 5.972   5.140   -2.503  1.00 0.00 ? 79  ARG A HA   5  
ATOM 7509  H HB2  . ARG A 1 79  ? 5.886   3.794   -5.166  1.00 0.00 ? 79  ARG A HB2  5  
ATOM 7510  H HB3  . ARG A 1 79  ? 6.800   5.289   -5.016  1.00 0.00 ? 79  ARG A HB3  5  
ATOM 7511  H HG2  . ARG A 1 79  ? 7.900   4.127   -2.982  1.00 0.00 ? 79  ARG A HG2  5  
ATOM 7512  H HG3  . ARG A 1 79  ? 7.274   2.646   -3.710  1.00 0.00 ? 79  ARG A HG3  5  
ATOM 7513  H HD2  . ARG A 1 79  ? 9.404   2.808   -4.616  1.00 0.00 ? 79  ARG A HD2  5  
ATOM 7514  H HD3  . ARG A 1 79  ? 8.387   3.514   -5.872  1.00 0.00 ? 79  ARG A HD3  5  
ATOM 7515  H HE   . ARG A 1 79  ? 9.347   5.499   -4.077  1.00 0.00 ? 79  ARG A HE   5  
ATOM 7516  H HH11 . ARG A 1 79  ? 10.285  3.499   -6.767  1.00 0.00 ? 79  ARG A HH11 5  
ATOM 7517  H HH12 . ARG A 1 79  ? 11.504  4.596   -7.326  1.00 0.00 ? 79  ARG A HH12 5  
ATOM 7518  H HH21 . ARG A 1 79  ? 10.948  6.952   -4.802  1.00 0.00 ? 79  ARG A HH21 5  
ATOM 7519  H HH22 . ARG A 1 79  ? 11.881  6.560   -6.207  1.00 0.00 ? 79  ARG A HH22 5  
ATOM 7520  N N    . LYS A 1 80  ? 3.589   6.075   -4.505  1.00 0.00 ? 80  LYS A N    5  
ATOM 7521  C CA   . LYS A 1 80  ? 2.842   7.223   -5.006  1.00 0.00 ? 80  LYS A CA   5  
ATOM 7522  C C    . LYS A 1 80  ? 2.173   7.978   -3.862  1.00 0.00 ? 80  LYS A C    5  
ATOM 7523  O O    . LYS A 1 80  ? 1.977   9.191   -3.939  1.00 0.00 ? 80  LYS A O    5  
ATOM 7524  C CB   . LYS A 1 80  ? 1.787   6.769   -6.018  1.00 0.00 ? 80  LYS A CB   5  
ATOM 7525  C CG   . LYS A 1 80  ? 2.341   6.543   -7.414  1.00 0.00 ? 80  LYS A CG   5  
ATOM 7526  C CD   . LYS A 1 80  ? 1.443   5.626   -8.228  1.00 0.00 ? 80  LYS A CD   5  
ATOM 7527  C CE   . LYS A 1 80  ? 0.093   6.269   -8.505  1.00 0.00 ? 80  LYS A CE   5  
ATOM 7528  N NZ   . LYS A 1 80  ? 0.183   7.314   -9.562  1.00 0.00 ? 80  LYS A NZ   5  
ATOM 7529  H H    . LYS A 1 80  ? 3.219   5.175   -4.625  1.00 0.00 ? 80  LYS A H    5  
ATOM 7530  H HA   . LYS A 1 80  ? 3.540   7.883   -5.498  1.00 0.00 ? 80  LYS A HA   5  
ATOM 7531  H HB2  . LYS A 1 80  ? 1.349   5.844   -5.673  1.00 0.00 ? 80  LYS A HB2  5  
ATOM 7532  H HB3  . LYS A 1 80  ? 1.015   7.522   -6.077  1.00 0.00 ? 80  LYS A HB3  5  
ATOM 7533  H HG2  . LYS A 1 80  ? 2.418   7.495   -7.919  1.00 0.00 ? 80  LYS A HG2  5  
ATOM 7534  H HG3  . LYS A 1 80  ? 3.321   6.095   -7.334  1.00 0.00 ? 80  LYS A HG3  5  
ATOM 7535  H HD2  . LYS A 1 80  ? 1.925   5.408   -9.170  1.00 0.00 ? 80  LYS A HD2  5  
ATOM 7536  H HD3  . LYS A 1 80  ? 1.289   4.708   -7.679  1.00 0.00 ? 80  LYS A HD3  5  
ATOM 7537  H HE2  . LYS A 1 80  ? -0.597  5.504   -8.825  1.00 0.00 ? 80  LYS A HE2  5  
ATOM 7538  H HE3  . LYS A 1 80  ? -0.269  6.722   -7.593  1.00 0.00 ? 80  LYS A HE3  5  
ATOM 7539  H HZ1  . LYS A 1 80  ? 0.649   6.927   -10.408 1.00 0.00 ? 80  LYS A HZ1  5  
ATOM 7540  H HZ2  . LYS A 1 80  ? 0.735   8.125   -9.217  1.00 0.00 ? 80  LYS A HZ2  5  
ATOM 7541  H HZ3  . LYS A 1 80  ? -0.769  7.642   -9.823  1.00 0.00 ? 80  LYS A HZ3  5  
ATOM 7542  N N    . GLU A 1 81  ? 1.826   7.254   -2.803  1.00 0.00 ? 81  GLU A N    5  
ATOM 7543  C CA   . GLU A 1 81  ? 1.179   7.857   -1.644  1.00 0.00 ? 81  GLU A CA   5  
ATOM 7544  C C    . GLU A 1 81  ? 2.202   8.556   -0.753  1.00 0.00 ? 81  GLU A C    5  
ATOM 7545  O O    . GLU A 1 81  ? 2.024   9.714   -0.378  1.00 0.00 ? 81  GLU A O    5  
ATOM 7546  C CB   . GLU A 1 81  ? 0.428   6.794   -0.840  1.00 0.00 ? 81  GLU A CB   5  
ATOM 7547  C CG   . GLU A 1 81  ? 1.327   5.968   0.066   1.00 0.00 ? 81  GLU A CG   5  
ATOM 7548  C CD   . GLU A 1 81  ? 0.565   4.902   0.829   1.00 0.00 ? 81  GLU A CD   5  
ATOM 7549  O OE1  . GLU A 1 81  ? -0.496  5.228   1.401   1.00 0.00 ? 81  GLU A OE1  5  
ATOM 7550  O OE2  . GLU A 1 81  ? 1.030   3.744   0.854   1.00 0.00 ? 81  GLU A OE2  5  
ATOM 7551  H H    . GLU A 1 81  ? 2.008   6.291   -2.802  1.00 0.00 ? 81  GLU A H    5  
ATOM 7552  H HA   . GLU A 1 81  ? 0.472   8.590   -2.003  1.00 0.00 ? 81  GLU A HA   5  
ATOM 7553  H HB2  . GLU A 1 81  ? -0.316  7.282   -0.227  1.00 0.00 ? 81  GLU A HB2  5  
ATOM 7554  H HB3  . GLU A 1 81  ? -0.067  6.124   -1.527  1.00 0.00 ? 81  GLU A HB3  5  
ATOM 7555  H HG2  . GLU A 1 81  ? 2.081   5.487   -0.539  1.00 0.00 ? 81  GLU A HG2  5  
ATOM 7556  H HG3  . GLU A 1 81  ? 1.804   6.628   0.776   1.00 0.00 ? 81  GLU A HG3  5  
ATOM 7557  N N    . GLU A 1 82  ? 3.273   7.843   -0.419  1.00 0.00 ? 82  GLU A N    5  
ATOM 7558  C CA   . GLU A 1 82  ? 4.323   8.394   0.428   1.00 0.00 ? 82  GLU A CA   5  
ATOM 7559  C C    . GLU A 1 82  ? 4.871   9.692   -0.159  1.00 0.00 ? 82  GLU A C    5  
ATOM 7560  O O    . GLU A 1 82  ? 5.306   10.581  0.572   1.00 0.00 ? 82  GLU A O    5  
ATOM 7561  C CB   . GLU A 1 82  ? 5.457   7.380   0.599   1.00 0.00 ? 82  GLU A CB   5  
ATOM 7562  C CG   . GLU A 1 82  ? 6.292   7.185   -0.655  1.00 0.00 ? 82  GLU A CG   5  
ATOM 7563  C CD   . GLU A 1 82  ? 7.429   6.203   -0.451  1.00 0.00 ? 82  GLU A CD   5  
ATOM 7564  O OE1  . GLU A 1 82  ? 7.162   5.075   0.014   1.00 0.00 ? 82  GLU A OE1  5  
ATOM 7565  O OE2  . GLU A 1 82  ? 8.586   6.561   -0.757  1.00 0.00 ? 82  GLU A OE2  5  
ATOM 7566  H H    . GLU A 1 82  ? 3.358   6.924   -0.750  1.00 0.00 ? 82  GLU A H    5  
ATOM 7567  H HA   . GLU A 1 82  ? 3.893   8.604   1.396   1.00 0.00 ? 82  GLU A HA   5  
ATOM 7568  H HB2  . GLU A 1 82  ? 6.108   7.716   1.392   1.00 0.00 ? 82  GLU A HB2  5  
ATOM 7569  H HB3  . GLU A 1 82  ? 5.031   6.427   0.874   1.00 0.00 ? 82  GLU A HB3  5  
ATOM 7570  H HG2  . GLU A 1 82  ? 5.654   6.815   -1.444  1.00 0.00 ? 82  GLU A HG2  5  
ATOM 7571  H HG3  . GLU A 1 82  ? 6.708   8.138   -0.947  1.00 0.00 ? 82  GLU A HG3  5  
ATOM 7572  N N    . ALA A 1 83  ? 4.846   9.792   -1.484  1.00 0.00 ? 83  ALA A N    5  
ATOM 7573  C CA   . ALA A 1 83  ? 5.338   10.980  -2.169  1.00 0.00 ? 83  ALA A CA   5  
ATOM 7574  C C    . ALA A 1 83  ? 4.229   12.012  -2.344  1.00 0.00 ? 83  ALA A C    5  
ATOM 7575  O O    . ALA A 1 83  ? 4.492   13.172  -2.661  1.00 0.00 ? 83  ALA A O    5  
ATOM 7576  C CB   . ALA A 1 83  ? 5.929   10.603  -3.520  1.00 0.00 ? 83  ALA A CB   5  
ATOM 7577  H H    . ALA A 1 83  ? 4.487   9.049   -2.012  1.00 0.00 ? 83  ALA A H    5  
ATOM 7578  H HA   . ALA A 1 83  ? 6.126   11.411  -1.567  1.00 0.00 ? 83  ALA A HA   5  
ATOM 7579  H HB1  . ALA A 1 83  ? 6.155   9.547   -3.531  1.00 0.00 ? 83  ALA A HB1  5  
ATOM 7580  H HB2  . ALA A 1 83  ? 5.217   10.827  -4.300  1.00 0.00 ? 83  ALA A HB2  5  
ATOM 7581  H HB3  . ALA A 1 83  ? 6.835   11.167  -3.686  1.00 0.00 ? 83  ALA A HB3  5  
ATOM 7582  N N    . PHE A 1 84  ? 2.989   11.582  -2.136  1.00 0.00 ? 84  PHE A N    5  
ATOM 7583  C CA   . PHE A 1 84  ? 1.840   12.468  -2.273  1.00 0.00 ? 84  PHE A CA   5  
ATOM 7584  C C    . PHE A 1 84  ? 1.964   13.669  -1.339  1.00 0.00 ? 84  PHE A C    5  
ATOM 7585  O O    . PHE A 1 84  ? 2.062   14.811  -1.788  1.00 0.00 ? 84  PHE A O    5  
ATOM 7586  C CB   . PHE A 1 84  ? 0.545   11.709  -1.976  1.00 0.00 ? 84  PHE A CB   5  
ATOM 7587  C CG   . PHE A 1 84  ? -0.688  12.407  -2.475  1.00 0.00 ? 84  PHE A CG   5  
ATOM 7588  C CD1  . PHE A 1 84  ? -1.028  13.664  -2.001  1.00 0.00 ? 84  PHE A CD1  5  
ATOM 7589  C CD2  . PHE A 1 84  ? -1.506  11.807  -3.418  1.00 0.00 ? 84  PHE A CD2  5  
ATOM 7590  C CE1  . PHE A 1 84  ? -2.162  14.308  -2.459  1.00 0.00 ? 84  PHE A CE1  5  
ATOM 7591  C CE2  . PHE A 1 84  ? -2.641  12.447  -3.880  1.00 0.00 ? 84  PHE A CE2  5  
ATOM 7592  C CZ   . PHE A 1 84  ? -2.969  13.699  -3.400  1.00 0.00 ? 84  PHE A CZ   5  
ATOM 7593  H H    . PHE A 1 84  ? 2.844   10.645  -1.886  1.00 0.00 ? 84  PHE A H    5  
ATOM 7594  H HA   . PHE A 1 84  ? 1.814   12.822  -3.292  1.00 0.00 ? 84  PHE A HA   5  
ATOM 7595  H HB2  . PHE A 1 84  ? 0.589   10.738  -2.446  1.00 0.00 ? 84  PHE A HB2  5  
ATOM 7596  H HB3  . PHE A 1 84  ? 0.447   11.583  -0.908  1.00 0.00 ? 84  PHE A HB3  5  
ATOM 7597  H HD1  . PHE A 1 84  ? -0.397  14.142  -1.266  1.00 0.00 ? 84  PHE A HD1  5  
ATOM 7598  H HD2  . PHE A 1 84  ? -1.250  10.826  -3.795  1.00 0.00 ? 84  PHE A HD2  5  
ATOM 7599  H HE1  . PHE A 1 84  ? -2.416  15.288  -2.082  1.00 0.00 ? 84  PHE A HE1  5  
ATOM 7600  H HE2  . PHE A 1 84  ? -3.269  11.967  -4.616  1.00 0.00 ? 84  PHE A HE2  5  
ATOM 7601  H HZ   . PHE A 1 84  ? -3.855  14.200  -3.758  1.00 0.00 ? 84  PHE A HZ   5  
ATOM 7602  N N    . ARG A 1 85  ? 1.959   13.401  -0.037  1.00 0.00 ? 85  ARG A N    5  
ATOM 7603  C CA   . ARG A 1 85  ? 2.070   14.457  0.961   1.00 0.00 ? 85  ARG A CA   5  
ATOM 7604  C C    . ARG A 1 85  ? 3.163   15.452  0.581   1.00 0.00 ? 85  ARG A C    5  
ATOM 7605  O O    . ARG A 1 85  ? 3.161   16.595  1.038   1.00 0.00 ? 85  ARG A O    5  
ATOM 7606  C CB   . ARG A 1 85  ? 2.365   13.859  2.338   1.00 0.00 ? 85  ARG A CB   5  
ATOM 7607  C CG   . ARG A 1 85  ? 1.133   13.315  3.042   1.00 0.00 ? 85  ARG A CG   5  
ATOM 7608  C CD   . ARG A 1 85  ? 1.423   12.990  4.499   1.00 0.00 ? 85  ARG A CD   5  
ATOM 7609  N NE   . ARG A 1 85  ? 2.365   11.882  4.636   1.00 0.00 ? 85  ARG A NE   5  
ATOM 7610  C CZ   . ARG A 1 85  ? 2.730   11.368  5.806   1.00 0.00 ? 85  ARG A CZ   5  
ATOM 7611  N NH1  . ARG A 1 85  ? 2.235   11.860  6.933   1.00 0.00 ? 85  ARG A NH1  5  
ATOM 7612  N NH2  . ARG A 1 85  ? 3.592   10.360  5.848   1.00 0.00 ? 85  ARG A NH2  5  
ATOM 7613  H H    . ARG A 1 85  ? 1.878   12.470  0.260   1.00 0.00 ? 85  ARG A H    5  
ATOM 7614  H HA   . ARG A 1 85  ? 1.124   14.978  1.000   1.00 0.00 ? 85  ARG A HA   5  
ATOM 7615  H HB2  . ARG A 1 85  ? 3.073   13.052  2.222   1.00 0.00 ? 85  ARG A HB2  5  
ATOM 7616  H HB3  . ARG A 1 85  ? 2.802   14.623  2.963   1.00 0.00 ? 85  ARG A HB3  5  
ATOM 7617  H HG2  . ARG A 1 85  ? 0.349   14.056  3.000   1.00 0.00 ? 85  ARG A HG2  5  
ATOM 7618  H HG3  . ARG A 1 85  ? 0.810   12.416  2.539   1.00 0.00 ? 85  ARG A HG3  5  
ATOM 7619  H HD2  . ARG A 1 85  ? 1.841   13.865  4.974   1.00 0.00 ? 85  ARG A HD2  5  
ATOM 7620  H HD3  . ARG A 1 85  ? 0.496   12.725  4.986   1.00 0.00 ? 85  ARG A HD3  5  
ATOM 7621  H HE   . ARG A 1 85  ? 2.743   11.503  3.816   1.00 0.00 ? 85  ARG A HE   5  
ATOM 7622  H HH11 . ARG A 1 85  ? 1.585   12.619  6.904   1.00 0.00 ? 85  ARG A HH11 5  
ATOM 7623  H HH12 . ARG A 1 85  ? 2.512   11.471  7.812   1.00 0.00 ? 85  ARG A HH12 5  
ATOM 7624  H HH21 . ARG A 1 85  ? 3.967   9.987   5.000   1.00 0.00 ? 85  ARG A HH21 5  
ATOM 7625  H HH22 . ARG A 1 85  ? 3.867   9.975   6.729   1.00 0.00 ? 85  ARG A HH22 5  
ATOM 7626  N N    . GLN A 1 86  ? 4.095   15.007  -0.255  1.00 0.00 ? 86  GLN A N    5  
ATOM 7627  C CA   . GLN A 1 86  ? 5.195   15.858  -0.695  1.00 0.00 ? 86  GLN A CA   5  
ATOM 7628  C C    . GLN A 1 86  ? 4.861   16.538  -2.018  1.00 0.00 ? 86  GLN A C    5  
ATOM 7629  O O    . GLN A 1 86  ? 5.218   17.695  -2.241  1.00 0.00 ? 86  GLN A O    5  
ATOM 7630  C CB   . GLN A 1 86  ? 6.477   15.036  -0.839  1.00 0.00 ? 86  GLN A CB   5  
ATOM 7631  C CG   . GLN A 1 86  ? 6.867   14.289  0.426   1.00 0.00 ? 86  GLN A CG   5  
ATOM 7632  C CD   . GLN A 1 86  ? 8.262   13.701  0.351   1.00 0.00 ? 86  GLN A CD   5  
ATOM 7633  O OE1  . GLN A 1 86  ? 8.968   13.873  -0.644  1.00 0.00 ? 86  GLN A OE1  5  
ATOM 7634  N NE2  . GLN A 1 86  ? 8.669   13.003  1.404   1.00 0.00 ? 86  GLN A NE2  5  
ATOM 7635  H H    . GLN A 1 86  ? 4.042   14.086  -0.584  1.00 0.00 ? 86  GLN A H    5  
ATOM 7636  H HA   . GLN A 1 86  ? 5.348   16.617  0.057   1.00 0.00 ? 86  GLN A HA   5  
ATOM 7637  H HB2  . GLN A 1 86  ? 6.340   14.314  -1.630  1.00 0.00 ? 86  GLN A HB2  5  
ATOM 7638  H HB3  . GLN A 1 86  ? 7.288   15.699  -1.104  1.00 0.00 ? 86  GLN A HB3  5  
ATOM 7639  H HG2  . GLN A 1 86  ? 6.827   14.974  1.260   1.00 0.00 ? 86  GLN A HG2  5  
ATOM 7640  H HG3  . GLN A 1 86  ? 6.162   13.487  0.587   1.00 0.00 ? 86  GLN A HG3  5  
ATOM 7641  H HE21 . GLN A 1 86  ? 8.052   12.907  2.161   1.00 0.00 ? 86  GLN A HE21 5  
ATOM 7642  H HE22 . GLN A 1 86  ? 9.566   12.611  1.382   1.00 0.00 ? 86  GLN A HE22 5  
ATOM 7643  N N    . LYS A 1 87  ? 4.175   15.813  -2.895  1.00 0.00 ? 87  LYS A N    5  
ATOM 7644  C CA   . LYS A 1 87  ? 3.792   16.345  -4.197  1.00 0.00 ? 87  LYS A CA   5  
ATOM 7645  C C    . LYS A 1 87  ? 2.810   17.502  -4.043  1.00 0.00 ? 87  LYS A C    5  
ATOM 7646  O O    . LYS A 1 87  ? 2.918   18.517  -4.733  1.00 0.00 ? 87  LYS A O    5  
ATOM 7647  C CB   . LYS A 1 87  ? 3.169   15.245  -5.058  1.00 0.00 ? 87  LYS A CB   5  
ATOM 7648  C CG   . LYS A 1 87  ? 2.565   15.755  -6.354  1.00 0.00 ? 87  LYS A CG   5  
ATOM 7649  C CD   . LYS A 1 87  ? 1.099   16.117  -6.182  1.00 0.00 ? 87  LYS A CD   5  
ATOM 7650  C CE   . LYS A 1 87  ? 0.228   14.875  -6.073  1.00 0.00 ? 87  LYS A CE   5  
ATOM 7651  N NZ   . LYS A 1 87  ? -0.122  14.323  -7.411  1.00 0.00 ? 87  LYS A NZ   5  
ATOM 7652  H H    . LYS A 1 87  ? 3.919   14.896  -2.659  1.00 0.00 ? 87  LYS A H    5  
ATOM 7653  H HA   . LYS A 1 87  ? 4.685   16.709  -4.682  1.00 0.00 ? 87  LYS A HA   5  
ATOM 7654  H HB2  . LYS A 1 87  ? 3.932   14.520  -5.301  1.00 0.00 ? 87  LYS A HB2  5  
ATOM 7655  H HB3  . LYS A 1 87  ? 2.390   14.757  -4.490  1.00 0.00 ? 87  LYS A HB3  5  
ATOM 7656  H HG2  . LYS A 1 87  ? 3.106   16.634  -6.672  1.00 0.00 ? 87  LYS A HG2  5  
ATOM 7657  H HG3  . LYS A 1 87  ? 2.650   14.985  -7.108  1.00 0.00 ? 87  LYS A HG3  5  
ATOM 7658  H HD2  . LYS A 1 87  ? 0.985   16.703  -5.282  1.00 0.00 ? 87  LYS A HD2  5  
ATOM 7659  H HD3  . LYS A 1 87  ? 0.778   16.698  -7.035  1.00 0.00 ? 87  LYS A HD3  5  
ATOM 7660  H HE2  . LYS A 1 87  ? 0.762   14.124  -5.511  1.00 0.00 ? 87  LYS A HE2  5  
ATOM 7661  H HE3  . LYS A 1 87  ? -0.682  15.135  -5.551  1.00 0.00 ? 87  LYS A HE3  5  
ATOM 7662  H HZ1  . LYS A 1 87  ? -1.044  14.693  -7.720  1.00 0.00 ? 87  LYS A HZ1  5  
ATOM 7663  H HZ2  . LYS A 1 87  ? -0.174  13.286  -7.367  1.00 0.00 ? 87  LYS A HZ2  5  
ATOM 7664  H HZ3  . LYS A 1 87  ? 0.600   14.594  -8.109  1.00 0.00 ? 87  LYS A HZ3  5  
ATOM 7665  N N    . LEU A 1 88  ? 1.854   17.344  -3.135  1.00 0.00 ? 88  LEU A N    5  
ATOM 7666  C CA   . LEU A 1 88  ? 0.853   18.377  -2.889  1.00 0.00 ? 88  LEU A CA   5  
ATOM 7667  C C    . LEU A 1 88  ? 1.493   19.622  -2.282  1.00 0.00 ? 88  LEU A C    5  
ATOM 7668  O O    . LEU A 1 88  ? 0.831   20.641  -2.092  1.00 0.00 ? 88  LEU A O    5  
ATOM 7669  C CB   . LEU A 1 88  ? -0.239  17.846  -1.960  1.00 0.00 ? 88  LEU A CB   5  
ATOM 7670  C CG   . LEU A 1 88  ? 0.238   17.248  -0.636  1.00 0.00 ? 88  LEU A CG   5  
ATOM 7671  C CD1  . LEU A 1 88  ? 1.119   18.237  0.110   1.00 0.00 ? 88  LEU A CD1  5  
ATOM 7672  C CD2  . LEU A 1 88  ? -0.950  16.837  0.222   1.00 0.00 ? 88  LEU A CD2  5  
ATOM 7673  H H    . LEU A 1 88  ? 1.819   16.514  -2.616  1.00 0.00 ? 88  LEU A H    5  
ATOM 7674  H HA   . LEU A 1 88  ? 0.410   18.641  -3.838  1.00 0.00 ? 88  LEU A HA   5  
ATOM 7675  H HB2  . LEU A 1 88  ? -0.906  18.663  -1.732  1.00 0.00 ? 88  LEU A HB2  5  
ATOM 7676  H HB3  . LEU A 1 88  ? -0.783  17.079  -2.494  1.00 0.00 ? 88  LEU A HB3  5  
ATOM 7677  H HG   . LEU A 1 88  ? 0.827   16.364  -0.839  1.00 0.00 ? 88  LEU A HG   5  
ATOM 7678  H HD11 . LEU A 1 88  ? 0.747   19.239  -0.045  1.00 0.00 ? 88  LEU A HD11 5  
ATOM 7679  H HD12 . LEU A 1 88  ? 2.131   18.169  -0.262  1.00 0.00 ? 88  LEU A HD12 5  
ATOM 7680  H HD13 . LEU A 1 88  ? 1.107   18.006  1.165   1.00 0.00 ? 88  LEU A HD13 5  
ATOM 7681  H HD21 . LEU A 1 88  ? -1.858  16.926  -0.355  1.00 0.00 ? 88  LEU A HD21 5  
ATOM 7682  H HD22 . LEU A 1 88  ? -1.009  17.481  1.087   1.00 0.00 ? 88  LEU A HD22 5  
ATOM 7683  H HD23 . LEU A 1 88  ? -0.825  15.813  0.542   1.00 0.00 ? 88  LEU A HD23 5  
ATOM 7684  N N    . ALA A 1 89  ? 2.784   19.530  -1.981  1.00 0.00 ? 89  ALA A N    5  
ATOM 7685  C CA   . ALA A 1 89  ? 3.514   20.650  -1.400  1.00 0.00 ? 89  ALA A CA   5  
ATOM 7686  C C    . ALA A 1 89  ? 4.288   21.415  -2.468  1.00 0.00 ? 89  ALA A C    5  
ATOM 7687  O O    . ALA A 1 89  ? 4.404   22.639  -2.406  1.00 0.00 ? 89  ALA A O    5  
ATOM 7688  C CB   . ALA A 1 89  ? 4.457   20.157  -0.312  1.00 0.00 ? 89  ALA A CB   5  
ATOM 7689  H H    . ALA A 1 89  ? 3.257   18.691  -2.156  1.00 0.00 ? 89  ALA A H    5  
ATOM 7690  H HA   . ALA A 1 89  ? 2.795   21.316  -0.944  1.00 0.00 ? 89  ALA A HA   5  
ATOM 7691  H HB1  . ALA A 1 89  ? 5.425   20.620  -0.440  1.00 0.00 ? 89  ALA A HB1  5  
ATOM 7692  H HB2  . ALA A 1 89  ? 4.058   20.418  0.656   1.00 0.00 ? 89  ALA A HB2  5  
ATOM 7693  H HB3  . ALA A 1 89  ? 4.559   19.085  -0.384  1.00 0.00 ? 89  ALA A HB3  5  
ATOM 7694  N N    . MET A 1 90  ? 4.817   20.686  -3.445  1.00 0.00 ? 90  MET A N    5  
ATOM 7695  C CA   . MET A 1 90  ? 5.580   21.297  -4.527  1.00 0.00 ? 90  MET A CA   5  
ATOM 7696  C C    . MET A 1 90  ? 4.662   22.064  -5.474  1.00 0.00 ? 90  MET A C    5  
ATOM 7697  O O    . MET A 1 90  ? 5.015   23.139  -5.960  1.00 0.00 ? 90  MET A O    5  
ATOM 7698  C CB   . MET A 1 90  ? 6.353   20.228  -5.302  1.00 0.00 ? 90  MET A CB   5  
ATOM 7699  C CG   . MET A 1 90  ? 7.091   19.245  -4.408  1.00 0.00 ? 90  MET A CG   5  
ATOM 7700  S SD   . MET A 1 90  ? 8.120   18.096  -5.342  1.00 0.00 ? 90  MET A SD   5  
ATOM 7701  C CE   . MET A 1 90  ? 8.144   16.687  -4.236  1.00 0.00 ? 90  MET A CE   5  
ATOM 7702  H H    . MET A 1 90  ? 4.690   19.714  -3.439  1.00 0.00 ? 90  MET A H    5  
ATOM 7703  H HA   . MET A 1 90  ? 6.282   21.989  -4.087  1.00 0.00 ? 90  MET A HA   5  
ATOM 7704  H HB2  . MET A 1 90  ? 5.659   19.674  -5.916  1.00 0.00 ? 90  MET A HB2  5  
ATOM 7705  H HB3  . MET A 1 90  ? 7.076   20.715  -5.939  1.00 0.00 ? 90  MET A HB3  5  
ATOM 7706  H HG2  . MET A 1 90  ? 7.721   19.798  -3.728  1.00 0.00 ? 90  MET A HG2  5  
ATOM 7707  H HG3  . MET A 1 90  ? 6.365   18.679  -3.843  1.00 0.00 ? 90  MET A HG3  5  
ATOM 7708  H HE1  . MET A 1 90  ? 7.853   15.799  -4.777  1.00 0.00 ? 90  MET A HE1  5  
ATOM 7709  H HE2  . MET A 1 90  ? 9.140   16.557  -3.840  1.00 0.00 ? 90  MET A HE2  5  
ATOM 7710  H HE3  . MET A 1 90  ? 7.452   16.856  -3.423  1.00 0.00 ? 90  MET A HE3  5  
ATOM 7711  N N    . ASP A 1 91  ? 3.484   21.506  -5.730  1.00 0.00 ? 91  ASP A N    5  
ATOM 7712  C CA   . ASP A 1 91  ? 2.516   22.138  -6.619  1.00 0.00 ? 91  ASP A CA   5  
ATOM 7713  C C    . ASP A 1 91  ? 1.955   23.411  -5.993  1.00 0.00 ? 91  ASP A C    5  
ATOM 7714  O O    . ASP A 1 91  ? 2.137   23.661  -4.802  1.00 0.00 ? 91  ASP A O    5  
ATOM 7715  C CB   . ASP A 1 91  ? 1.377   21.168  -6.939  1.00 0.00 ? 91  ASP A CB   5  
ATOM 7716  C CG   . ASP A 1 91  ? 0.615   21.563  -8.189  1.00 0.00 ? 91  ASP A CG   5  
ATOM 7717  O OD1  . ASP A 1 91  ? 1.247   22.092  -9.127  1.00 0.00 ? 91  ASP A OD1  5  
ATOM 7718  O OD2  . ASP A 1 91  ? -0.614  21.342  -8.228  1.00 0.00 ? 91  ASP A OD2  5  
ATOM 7719  H H    . ASP A 1 91  ? 3.261   20.648  -5.312  1.00 0.00 ? 91  ASP A H    5  
ATOM 7720  H HA   . ASP A 1 91  ? 3.025   22.396  -7.535  1.00 0.00 ? 91  ASP A HA   5  
ATOM 7721  H HB2  . ASP A 1 91  ? 1.786   20.179  -7.087  1.00 0.00 ? 91  ASP A HB2  5  
ATOM 7722  H HB3  . ASP A 1 91  ? 0.686   21.147  -6.109  1.00 0.00 ? 91  ASP A HB3  5  
ATOM 7723  N N    . ALA A 1 92  ? 1.274   24.213  -6.805  1.00 0.00 ? 92  ALA A N    5  
ATOM 7724  C CA   . ALA A 1 92  ? 0.686   25.460  -6.331  1.00 0.00 ? 92  ALA A CA   5  
ATOM 7725  C C    . ALA A 1 92  ? -0.753  25.249  -5.873  1.00 0.00 ? 92  ALA A C    5  
ATOM 7726  O O    . ALA A 1 92  ? -1.491  24.455  -6.458  1.00 0.00 ? 92  ALA A O    5  
ATOM 7727  C CB   . ALA A 1 92  ? 0.745   26.519  -7.422  1.00 0.00 ? 92  ALA A CB   5  
ATOM 7728  H H    . ALA A 1 92  ? 1.163   23.959  -7.745  1.00 0.00 ? 92  ALA A H    5  
ATOM 7729  H HA   . ALA A 1 92  ? 1.272   25.808  -5.493  1.00 0.00 ? 92  ALA A HA   5  
ATOM 7730  H HB1  . ALA A 1 92  ? 0.486   27.480  -7.003  1.00 0.00 ? 92  ALA A HB1  5  
ATOM 7731  H HB2  . ALA A 1 92  ? 1.744   26.560  -7.830  1.00 0.00 ? 92  ALA A HB2  5  
ATOM 7732  H HB3  . ALA A 1 92  ? 0.046   26.267  -8.206  1.00 0.00 ? 92  ALA A HB3  5  
ATOM 7733  N N    . TYR A 1 93  ? -1.146  25.963  -4.824  1.00 0.00 ? 93  TYR A N    5  
ATOM 7734  C CA   . TYR A 1 93  ? -2.496  25.851  -4.285  1.00 0.00 ? 93  TYR A CA   5  
ATOM 7735  C C    . TYR A 1 93  ? -3.167  27.219  -4.209  1.00 0.00 ? 93  TYR A C    5  
ATOM 7736  O O    . TYR A 1 93  ? -2.514  28.252  -4.360  1.00 0.00 ? 93  TYR A O    5  
ATOM 7737  C CB   . TYR A 1 93  ? -2.463  25.208  -2.898  1.00 0.00 ? 93  TYR A CB   5  
ATOM 7738  C CG   . TYR A 1 93  ? -1.522  25.897  -1.934  1.00 0.00 ? 93  TYR A CG   5  
ATOM 7739  C CD1  . TYR A 1 93  ? -0.189  25.519  -1.844  1.00 0.00 ? 93  TYR A CD1  5  
ATOM 7740  C CD2  . TYR A 1 93  ? -1.968  26.926  -1.114  1.00 0.00 ? 93  TYR A CD2  5  
ATOM 7741  C CE1  . TYR A 1 93  ? 0.674   26.144  -0.965  1.00 0.00 ? 93  TYR A CE1  5  
ATOM 7742  C CE2  . TYR A 1 93  ? -1.113  27.558  -0.232  1.00 0.00 ? 93  TYR A CE2  5  
ATOM 7743  C CZ   . TYR A 1 93  ? 0.207   27.164  -0.161  1.00 0.00 ? 93  TYR A CZ   5  
ATOM 7744  O OH   . TYR A 1 93  ? 1.063   27.790  0.715   1.00 0.00 ? 93  TYR A OH   5  
ATOM 7745  H H    . TYR A 1 93  ? -0.512  26.578  -4.400  1.00 0.00 ? 93  TYR A H    5  
ATOM 7746  H HA   . TYR A 1 93  ? -3.067  25.220  -4.950  1.00 0.00 ? 93  TYR A HA   5  
ATOM 7747  H HB2  . TYR A 1 93  ? -3.453  25.237  -2.471  1.00 0.00 ? 93  TYR A HB2  5  
ATOM 7748  H HB3  . TYR A 1 93  ? -2.147  24.180  -2.992  1.00 0.00 ? 93  TYR A HB3  5  
ATOM 7749  H HD1  . TYR A 1 93  ? 0.174   24.720  -2.476  1.00 0.00 ? 93  TYR A HD1  5  
ATOM 7750  H HD2  . TYR A 1 93  ? -3.003  27.233  -1.172  1.00 0.00 ? 93  TYR A HD2  5  
ATOM 7751  H HE1  . TYR A 1 93  ? 1.707   25.836  -0.909  1.00 0.00 ? 93  TYR A HE1  5  
ATOM 7752  H HE2  . TYR A 1 93  ? -1.478  28.356  0.397   1.00 0.00 ? 93  TYR A HE2  5  
ATOM 7753  H HH   . TYR A 1 93  ? 0.978   28.742  0.620   1.00 0.00 ? 93  TYR A HH   5  
ATOM 7754  N N    . SER A 1 94  ? -4.475  27.217  -3.972  1.00 0.00 ? 94  SER A N    5  
ATOM 7755  C CA   . SER A 1 94  ? -5.236  28.457  -3.878  1.00 0.00 ? 94  SER A CA   5  
ATOM 7756  C C    . SER A 1 94  ? -5.329  28.929  -2.430  1.00 0.00 ? 94  SER A C    5  
ATOM 7757  O O    . SER A 1 94  ? -5.680  28.159  -1.536  1.00 0.00 ? 94  SER A O    5  
ATOM 7758  C CB   . SER A 1 94  ? -6.640  28.263  -4.454  1.00 0.00 ? 94  SER A CB   5  
ATOM 7759  O OG   . SER A 1 94  ? -7.372  27.310  -3.704  1.00 0.00 ? 94  SER A OG   5  
ATOM 7760  H H    . SER A 1 94  ? -4.939  26.361  -3.861  1.00 0.00 ? 94  SER A H    5  
ATOM 7761  H HA   . SER A 1 94  ? -4.719  29.209  -4.456  1.00 0.00 ? 94  SER A HA   5  
ATOM 7762  H HB2  . SER A 1 94  ? -7.169  29.204  -4.431  1.00 0.00 ? 94  SER A HB2  5  
ATOM 7763  H HB3  . SER A 1 94  ? -6.562  27.919  -5.475  1.00 0.00 ? 94  SER A HB3  5  
ATOM 7764  H HG   . SER A 1 94  ? -6.766  26.677  -3.312  1.00 0.00 ? 94  SER A HG   5  
ATOM 7765  N N    . SER A 1 95  ? -5.012  30.201  -2.207  1.00 0.00 ? 95  SER A N    5  
ATOM 7766  C CA   . SER A 1 95  ? -5.056  30.776  -0.868  1.00 0.00 ? 95  SER A CA   5  
ATOM 7767  C C    . SER A 1 95  ? -6.342  30.380  -0.148  1.00 0.00 ? 95  SER A C    5  
ATOM 7768  O O    . SER A 1 95  ? -7.434  30.794  -0.533  1.00 0.00 ? 95  SER A O    5  
ATOM 7769  C CB   . SER A 1 95  ? -4.948  32.300  -0.940  1.00 0.00 ? 95  SER A CB   5  
ATOM 7770  O OG   . SER A 1 95  ? -3.594  32.712  -1.018  1.00 0.00 ? 95  SER A OG   5  
ATOM 7771  H H    . SER A 1 95  ? -4.741  30.765  -2.961  1.00 0.00 ? 95  SER A H    5  
ATOM 7772  H HA   . SER A 1 95  ? -4.214  30.390  -0.314  1.00 0.00 ? 95  SER A HA   5  
ATOM 7773  H HB2  . SER A 1 95  ? -5.470  32.654  -1.816  1.00 0.00 ? 95  SER A HB2  5  
ATOM 7774  H HB3  . SER A 1 95  ? -5.393  32.732  -0.056  1.00 0.00 ? 95  SER A HB3  5  
ATOM 7775  H HG   . SER A 1 95  ? -3.242  32.825  -0.132  1.00 0.00 ? 95  SER A HG   5  
ATOM 7776  N N    . ASN A 1 96  ? -6.202  29.574  0.900   1.00 0.00 ? 96  ASN A N    5  
ATOM 7777  C CA   . ASN A 1 96  ? -7.352  29.121  1.674   1.00 0.00 ? 96  ASN A CA   5  
ATOM 7778  C C    . ASN A 1 96  ? -8.087  30.302  2.299   1.00 0.00 ? 96  ASN A C    5  
ATOM 7779  O O    . ASN A 1 96  ? -9.315  30.376  2.255   1.00 0.00 ? 96  ASN A O    5  
ATOM 7780  C CB   . ASN A 1 96  ? -6.905  28.148  2.767   1.00 0.00 ? 96  ASN A CB   5  
ATOM 7781  C CG   . ASN A 1 96  ? -6.342  26.859  2.199   1.00 0.00 ? 96  ASN A CG   5  
ATOM 7782  O OD1  . ASN A 1 96  ? -6.413  26.615  0.995   1.00 0.00 ? 96  ASN A OD1  5  
ATOM 7783  N ND2  . ASN A 1 96  ? -5.780  26.026  3.068   1.00 0.00 ? 96  ASN A ND2  5  
ATOM 7784  H H    . ASN A 1 96  ? -5.305  29.277  1.158   1.00 0.00 ? 96  ASN A H    5  
ATOM 7785  H HA   . ASN A 1 96  ? -8.023  28.609  1.001   1.00 0.00 ? 96  ASN A HA   5  
ATOM 7786  H HB2  . ASN A 1 96  ? -6.140  28.618  3.368   1.00 0.00 ? 96  ASN A HB2  5  
ATOM 7787  H HB3  . ASN A 1 96  ? -7.750  27.905  3.393   1.00 0.00 ? 96  ASN A HB3  5  
ATOM 7788  H HD21 . ASN A 1 96  ? -5.760  26.286  4.013   1.00 0.00 ? 96  ASN A HD21 5  
ATOM 7789  H HD22 . ASN A 1 96  ? -5.408  25.186  2.728   1.00 0.00 ? 96  ASN A HD22 5  
ATOM 7790  N N    . SER A 1 97  ? -7.327  31.226  2.879   1.00 0.00 ? 97  SER A N    5  
ATOM 7791  C CA   . SER A 1 97  ? -7.906  32.403  3.515   1.00 0.00 ? 97  SER A CA   5  
ATOM 7792  C C    . SER A 1 97  ? -9.087  32.932  2.707   1.00 0.00 ? 97  SER A C    5  
ATOM 7793  O O    . SER A 1 97  ? -9.182  32.703  1.502   1.00 0.00 ? 97  SER A O    5  
ATOM 7794  C CB   . SER A 1 97  ? -6.848  33.497  3.670   1.00 0.00 ? 97  SER A CB   5  
ATOM 7795  O OG   . SER A 1 97  ? -6.372  33.928  2.407   1.00 0.00 ? 97  SER A OG   5  
ATOM 7796  H H    . SER A 1 97  ? -6.353  31.111  2.881   1.00 0.00 ? 97  SER A H    5  
ATOM 7797  H HA   . SER A 1 97  ? -8.256  32.112  4.494   1.00 0.00 ? 97  SER A HA   5  
ATOM 7798  H HB2  . SER A 1 97  ? -7.280  34.342  4.185   1.00 0.00 ? 97  SER A HB2  5  
ATOM 7799  H HB3  . SER A 1 97  ? -6.017  33.112  4.243   1.00 0.00 ? 97  SER A HB3  5  
ATOM 7800  H HG   . SER A 1 97  ? -6.523  33.239  1.756   1.00 0.00 ? 97  SER A HG   5  
ATOM 7801  N N    . GLY A 1 98  ? -9.987  33.642  3.382   1.00 0.00 ? 98  GLY A N    5  
ATOM 7802  C CA   . GLY A 1 98  ? -11.150 34.192  2.711   1.00 0.00 ? 98  GLY A CA   5  
ATOM 7803  C C    . GLY A 1 98  ? -10.784 35.248  1.687   1.00 0.00 ? 98  GLY A C    5  
ATOM 7804  O O    . GLY A 1 98  ? -11.036 35.098  0.492   1.00 0.00 ? 98  GLY A O    5  
ATOM 7805  H H    . GLY A 1 98  ? -9.859  33.793  4.342   1.00 0.00 ? 98  GLY A H    5  
ATOM 7806  H HA2  . GLY A 1 98  ? -11.679 33.392  2.215   1.00 0.00 ? 98  GLY A HA2  5  
ATOM 7807  H HA3  . GLY A 1 98  ? -11.801 34.636  3.451   1.00 0.00 ? 98  GLY A HA3  5  
ATOM 7808  N N    . PRO A 1 99  ? -10.175 36.347  2.156   1.00 0.00 ? 99  PRO A N    5  
ATOM 7809  C CA   . PRO A 1 99  ? -9.762  37.454  1.289   1.00 0.00 ? 99  PRO A CA   5  
ATOM 7810  C C    . PRO A 1 99  ? -8.595  37.076  0.383   1.00 0.00 ? 99  PRO A C    5  
ATOM 7811  O O    . PRO A 1 99  ? -7.569  36.582  0.850   1.00 0.00 ? 99  PRO A O    5  
ATOM 7812  C CB   . PRO A 1 99  ? -9.338  38.542  2.280   1.00 0.00 ? 99  PRO A CB   5  
ATOM 7813  C CG   . PRO A 1 99  ? -8.949  37.801  3.512   1.00 0.00 ? 99  PRO A CG   5  
ATOM 7814  C CD   . PRO A 1 99  ? -9.843  36.594  3.570   1.00 0.00 ? 99  PRO A CD   5  
ATOM 7815  H HA   . PRO A 1 99  ? -10.583 37.814  0.686   1.00 0.00 ? 99  PRO A HA   5  
ATOM 7816  H HB2  . PRO A 1 99  ? -8.506  39.099  1.873   1.00 0.00 ? 99  PRO A HB2  5  
ATOM 7817  H HB3  . PRO A 1 99  ? -10.168 39.208  2.465   1.00 0.00 ? 99  PRO A HB3  5  
ATOM 7818  H HG2  . PRO A 1 99  ? -7.915  37.499  3.447   1.00 0.00 ? 99  PRO A HG2  5  
ATOM 7819  H HG3  . PRO A 1 99  ? -9.105  38.425  4.380   1.00 0.00 ? 99  PRO A HG3  5  
ATOM 7820  H HD2  . PRO A 1 99  ? -9.315  35.753  3.994   1.00 0.00 ? 99  PRO A HD2  5  
ATOM 7821  H HD3  . PRO A 1 99  ? -10.733 36.811  4.142   1.00 0.00 ? 99  PRO A HD3  5  
ATOM 7822  N N    . SER A 1 100 ? -8.760  37.312  -0.915  1.00 0.00 ? 100 SER A N    5  
ATOM 7823  C CA   . SER A 1 100 ? -7.721  36.993  -1.887  1.00 0.00 ? 100 SER A CA   5  
ATOM 7824  C C    . SER A 1 100 ? -8.083  37.536  -3.267  1.00 0.00 ? 100 SER A C    5  
ATOM 7825  O O    . SER A 1 100 ? -9.234  37.885  -3.526  1.00 0.00 ? 100 SER A O    5  
ATOM 7826  C CB   . SER A 1 100 ? -7.510  35.479  -1.962  1.00 0.00 ? 100 SER A CB   5  
ATOM 7827  O OG   . SER A 1 100 ? -6.333  35.163  -2.685  1.00 0.00 ? 100 SER A OG   5  
ATOM 7828  H H    . SER A 1 100 ? -9.601  37.708  -1.226  1.00 0.00 ? 100 SER A H    5  
ATOM 7829  H HA   . SER A 1 100 ? -6.804  37.459  -1.559  1.00 0.00 ? 100 SER A HA   5  
ATOM 7830  H HB2  . SER A 1 100 ? -7.422  35.081  -0.963  1.00 0.00 ? 100 SER A HB2  5  
ATOM 7831  H HB3  . SER A 1 100 ? -8.356  35.025  -2.457  1.00 0.00 ? 100 SER A HB3  5  
ATOM 7832  H HG   . SER A 1 100 ? -5.604  35.042  -2.072  1.00 0.00 ? 100 SER A HG   5  
ATOM 7833  N N    . SER A 1 101 ? -7.090  37.603  -4.148  1.00 0.00 ? 101 SER A N    5  
ATOM 7834  C CA   . SER A 1 101 ? -7.301  38.107  -5.500  1.00 0.00 ? 101 SER A CA   5  
ATOM 7835  C C    . SER A 1 101 ? -7.958  39.484  -5.470  1.00 0.00 ? 101 SER A C    5  
ATOM 7836  O O    . SER A 1 101 ? -9.004  39.698  -6.082  1.00 0.00 ? 101 SER A O    5  
ATOM 7837  C CB   . SER A 1 101 ? -8.168  37.133  -6.300  1.00 0.00 ? 101 SER A CB   5  
ATOM 7838  O OG   . SER A 1 101 ? -7.540  35.867  -6.415  1.00 0.00 ? 101 SER A OG   5  
ATOM 7839  H H    . SER A 1 101 ? -6.194  37.310  -3.881  1.00 0.00 ? 101 SER A H    5  
ATOM 7840  H HA   . SER A 1 101 ? -6.336  38.192  -5.977  1.00 0.00 ? 101 SER A HA   5  
ATOM 7841  H HB2  . SER A 1 101 ? -9.117  37.007  -5.802  1.00 0.00 ? 101 SER A HB2  5  
ATOM 7842  H HB3  . SER A 1 101 ? -8.331  37.531  -7.291  1.00 0.00 ? 101 SER A HB3  5  
ATOM 7843  H HG   . SER A 1 101 ? -7.073  35.816  -7.252  1.00 0.00 ? 101 SER A HG   5  
ATOM 7844  N N    . GLY A 1 102 ? -7.336  40.414  -4.753  1.00 0.00 ? 102 GLY A N    5  
ATOM 7845  C CA   . GLY A 1 102 ? -7.874  41.759  -4.656  1.00 0.00 ? 102 GLY A CA   5  
ATOM 7846  C C    . GLY A 1 102 ? -7.481  42.448  -3.364  1.00 0.00 ? 102 GLY A C    5  
ATOM 7847  O O    . GLY A 1 102 ? -7.113  43.622  -3.366  1.00 0.00 ? 102 GLY A O    5  
ATOM 7848  H H    . GLY A 1 102 ? -6.505  40.186  -4.286  1.00 0.00 ? 102 GLY A H    5  
ATOM 7849  H HA2  . GLY A 1 102 ? -7.509  42.342  -5.488  1.00 0.00 ? 102 GLY A HA2  5  
ATOM 7850  H HA3  . GLY A 1 102 ? -8.951  41.708  -4.710  1.00 0.00 ? 102 GLY A HA3  5  
ATOM 7851  N N    . GLY A 1 1   ? -6.706  11.448  -18.070 1.00 0.00 ? 1   GLY A N    6  
ATOM 7852  C CA   . GLY A 1 1   ? -6.571  10.382  -17.094 1.00 0.00 ? 1   GLY A CA   6  
ATOM 7853  C C    . GLY A 1 1   ? -7.205  9.087   -17.560 1.00 0.00 ? 1   GLY A C    6  
ATOM 7854  O O    . GLY A 1 1   ? -8.408  9.034   -17.818 1.00 0.00 ? 1   GLY A O    6  
ATOM 7855  H H1   . GLY A 1 1   ? -7.092  12.309  -17.802 1.00 0.00 ? 1   GLY A H1   6  
ATOM 7856  H HA2  . GLY A 1 1   ? -5.522  10.211  -16.908 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 7857  H HA3  . GLY A 1 1   ? -7.044  10.690  -16.173 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 7858  N N    . SER A 1 2   ? -6.395  8.039   -17.670 1.00 0.00 ? 2   SER A N    6  
ATOM 7859  C CA   . SER A 1 2   ? -6.883  6.738   -18.113 1.00 0.00 ? 2   SER A CA   6  
ATOM 7860  C C    . SER A 1 2   ? -7.737  6.081   -17.034 1.00 0.00 ? 2   SER A C    6  
ATOM 7861  O O    . SER A 1 2   ? -8.872  5.676   -17.285 1.00 0.00 ? 2   SER A O    6  
ATOM 7862  C CB   . SER A 1 2   ? -5.709  5.826   -18.476 1.00 0.00 ? 2   SER A CB   6  
ATOM 7863  O OG   . SER A 1 2   ? -4.948  6.373   -19.539 1.00 0.00 ? 2   SER A OG   6  
ATOM 7864  H H    . SER A 1 2   ? -5.445  8.144   -17.450 1.00 0.00 ? 2   SER A H    6  
ATOM 7865  H HA   . SER A 1 2   ? -7.491  6.894   -18.992 1.00 0.00 ? 2   SER A HA   6  
ATOM 7866  H HB2  . SER A 1 2   ? -5.069  5.708   -17.615 1.00 0.00 ? 2   SER A HB2  6  
ATOM 7867  H HB3  . SER A 1 2   ? -6.088  4.860   -18.779 1.00 0.00 ? 2   SER A HB3  6  
ATOM 7868  H HG   . SER A 1 2   ? -4.834  7.315   -19.399 1.00 0.00 ? 2   SER A HG   6  
ATOM 7869  N N    . SER A 1 3   ? -7.183  5.980   -15.829 1.00 0.00 ? 3   SER A N    6  
ATOM 7870  C CA   . SER A 1 3   ? -7.892  5.370   -14.711 1.00 0.00 ? 3   SER A CA   6  
ATOM 7871  C C    . SER A 1 3   ? -9.296  5.950   -14.576 1.00 0.00 ? 3   SER A C    6  
ATOM 7872  O O    . SER A 1 3   ? -9.584  7.034   -15.082 1.00 0.00 ? 3   SER A O    6  
ATOM 7873  C CB   . SER A 1 3   ? -7.114  5.580   -13.411 1.00 0.00 ? 3   SER A CB   6  
ATOM 7874  O OG   . SER A 1 3   ? -7.763  4.950   -12.320 1.00 0.00 ? 3   SER A OG   6  
ATOM 7875  H H    . SER A 1 3   ? -6.275  6.322   -15.691 1.00 0.00 ? 3   SER A H    6  
ATOM 7876  H HA   . SER A 1 3   ? -7.970  4.311   -14.907 1.00 0.00 ? 3   SER A HA   6  
ATOM 7877  H HB2  . SER A 1 3   ? -6.124  5.161   -13.515 1.00 0.00 ? 3   SER A HB2  6  
ATOM 7878  H HB3  . SER A 1 3   ? -7.037  6.638   -13.207 1.00 0.00 ? 3   SER A HB3  6  
ATOM 7879  H HG   . SER A 1 3   ? -7.142  4.376   -11.865 1.00 0.00 ? 3   SER A HG   6  
ATOM 7880  N N    . GLY A 1 4   ? -10.169 5.219   -13.888 1.00 0.00 ? 4   GLY A N    6  
ATOM 7881  C CA   . GLY A 1 4   ? -11.533 5.676   -13.698 1.00 0.00 ? 4   GLY A CA   6  
ATOM 7882  C C    . GLY A 1 4   ? -12.020 5.471   -12.277 1.00 0.00 ? 4   GLY A C    6  
ATOM 7883  O O    . GLY A 1 4   ? -11.252 5.073   -11.401 1.00 0.00 ? 4   GLY A O    6  
ATOM 7884  H H    . GLY A 1 4   ? -9.883  4.362   -13.506 1.00 0.00 ? 4   GLY A H    6  
ATOM 7885  H HA2  . GLY A 1 4   ? -11.585 6.728   -13.937 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 7886  H HA3  . GLY A 1 4   ? -12.180 5.132   -14.370 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 7887  N N    . SER A 1 5   ? -13.300 5.745   -12.047 1.00 0.00 ? 5   SER A N    6  
ATOM 7888  C CA   . SER A 1 5   ? -13.888 5.594   -10.721 1.00 0.00 ? 5   SER A CA   6  
ATOM 7889  C C    . SER A 1 5   ? -14.762 4.345   -10.654 1.00 0.00 ? 5   SER A C    6  
ATOM 7890  O O    . SER A 1 5   ? -14.613 3.517   -9.755  1.00 0.00 ? 5   SER A O    6  
ATOM 7891  C CB   . SER A 1 5   ? -14.716 6.830   -10.362 1.00 0.00 ? 5   SER A CB   6  
ATOM 7892  O OG   . SER A 1 5   ? -14.731 7.044   -8.962  1.00 0.00 ? 5   SER A OG   6  
ATOM 7893  H H    . SER A 1 5   ? -13.862 6.059   -12.786 1.00 0.00 ? 5   SER A H    6  
ATOM 7894  H HA   . SER A 1 5   ? -13.081 5.493   -10.010 1.00 0.00 ? 5   SER A HA   6  
ATOM 7895  H HB2  . SER A 1 5   ? -14.289 7.697   -10.843 1.00 0.00 ? 5   SER A HB2  6  
ATOM 7896  H HB3  . SER A 1 5   ? -15.731 6.691   -10.705 1.00 0.00 ? 5   SER A HB3  6  
ATOM 7897  H HG   . SER A 1 5   ? -14.680 6.200   -8.508  1.00 0.00 ? 5   SER A HG   6  
ATOM 7898  N N    . SER A 1 6   ? -15.676 4.218   -11.611 1.00 0.00 ? 6   SER A N    6  
ATOM 7899  C CA   . SER A 1 6   ? -16.578 3.073   -11.659 1.00 0.00 ? 6   SER A CA   6  
ATOM 7900  C C    . SER A 1 6   ? -16.438 2.327   -12.982 1.00 0.00 ? 6   SER A C    6  
ATOM 7901  O O    . SER A 1 6   ? -15.984 2.887   -13.979 1.00 0.00 ? 6   SER A O    6  
ATOM 7902  C CB   . SER A 1 6   ? -18.026 3.529   -11.468 1.00 0.00 ? 6   SER A CB   6  
ATOM 7903  O OG   . SER A 1 6   ? -18.495 4.227   -12.609 1.00 0.00 ? 6   SER A OG   6  
ATOM 7904  H H    . SER A 1 6   ? -15.746 4.912   -12.299 1.00 0.00 ? 6   SER A H    6  
ATOM 7905  H HA   . SER A 1 6   ? -16.310 2.406   -10.853 1.00 0.00 ? 6   SER A HA   6  
ATOM 7906  H HB2  . SER A 1 6   ? -18.654 2.666   -11.306 1.00 0.00 ? 6   SER A HB2  6  
ATOM 7907  H HB3  . SER A 1 6   ? -18.084 4.184   -10.611 1.00 0.00 ? 6   SER A HB3  6  
ATOM 7908  H HG   . SER A 1 6   ? -18.577 3.618   -13.346 1.00 0.00 ? 6   SER A HG   6  
ATOM 7909  N N    . GLY A 1 7   ? -16.831 1.056   -12.983 1.00 0.00 ? 7   GLY A N    6  
ATOM 7910  C CA   . GLY A 1 7   ? -16.741 0.253   -14.188 1.00 0.00 ? 7   GLY A CA   6  
ATOM 7911  C C    . GLY A 1 7   ? -16.370 -1.188  -13.897 1.00 0.00 ? 7   GLY A C    6  
ATOM 7912  O O    . GLY A 1 7   ? -17.032 -2.113  -14.368 1.00 0.00 ? 7   GLY A O    6  
ATOM 7913  H H    . GLY A 1 7   ? -17.184 0.662   -12.158 1.00 0.00 ? 7   GLY A H    6  
ATOM 7914  H HA2  . GLY A 1 7   ? -17.696 0.273   -14.692 1.00 0.00 ? 7   GLY A HA2  6  
ATOM 7915  H HA3  . GLY A 1 7   ? -15.992 0.681   -14.838 1.00 0.00 ? 7   GLY A HA3  6  
ATOM 7916  N N    . ARG A 1 8   ? -15.308 -1.379  -13.122 1.00 0.00 ? 8   ARG A N    6  
ATOM 7917  C CA   . ARG A 1 8   ? -14.848 -2.717  -12.772 1.00 0.00 ? 8   ARG A CA   6  
ATOM 7918  C C    . ARG A 1 8   ? -14.283 -2.745  -11.355 1.00 0.00 ? 8   ARG A C    6  
ATOM 7919  O O    . ARG A 1 8   ? -13.667 -1.782  -10.903 1.00 0.00 ? 8   ARG A O    6  
ATOM 7920  C CB   . ARG A 1 8   ? -13.784 -3.190  -13.765 1.00 0.00 ? 8   ARG A CB   6  
ATOM 7921  C CG   . ARG A 1 8   ? -14.362 -3.755  -15.053 1.00 0.00 ? 8   ARG A CG   6  
ATOM 7922  C CD   . ARG A 1 8   ? -13.306 -3.846  -16.144 1.00 0.00 ? 8   ARG A CD   6  
ATOM 7923  N NE   . ARG A 1 8   ? -13.757 -4.652  -17.276 1.00 0.00 ? 8   ARG A NE   6  
ATOM 7924  C CZ   . ARG A 1 8   ? -13.925 -5.968  -17.220 1.00 0.00 ? 8   ARG A CZ   6  
ATOM 7925  N NH1  . ARG A 1 8   ? -13.682 -6.624  -16.093 1.00 0.00 ? 8   ARG A NH1  6  
ATOM 7926  N NH2  . ARG A 1 8   ? -14.338 -6.631  -18.292 1.00 0.00 ? 8   ARG A NH2  6  
ATOM 7927  H H    . ARG A 1 8   ? -14.821 -0.601  -12.777 1.00 0.00 ? 8   ARG A H    6  
ATOM 7928  H HA   . ARG A 1 8   ? -15.696 -3.384  -12.823 1.00 0.00 ? 8   ARG A HA   6  
ATOM 7929  H HB2  . ARG A 1 8   ? -13.148 -2.355  -14.018 1.00 0.00 ? 8   ARG A HB2  6  
ATOM 7930  H HB3  . ARG A 1 8   ? -13.188 -3.958  -13.297 1.00 0.00 ? 8   ARG A HB3  6  
ATOM 7931  H HG2  . ARG A 1 8   ? -14.749 -4.744  -14.859 1.00 0.00 ? 8   ARG A HG2  6  
ATOM 7932  H HG3  . ARG A 1 8   ? -15.161 -3.112  -15.390 1.00 0.00 ? 8   ARG A HG3  6  
ATOM 7933  H HD2  . ARG A 1 8   ? -13.080 -2.849  -16.492 1.00 0.00 ? 8   ARG A HD2  6  
ATOM 7934  H HD3  . ARG A 1 8   ? -12.415 -4.293  -15.728 1.00 0.00 ? 8   ARG A HD3  6  
ATOM 7935  H HE   . ARG A 1 8   ? -13.942 -4.187  -18.118 1.00 0.00 ? 8   ARG A HE   6  
ATOM 7936  H HH11 . ARG A 1 8   ? -13.372 -6.126  -15.283 1.00 0.00 ? 8   ARG A HH11 6  
ATOM 7937  H HH12 . ARG A 1 8   ? -13.811 -7.615  -16.053 1.00 0.00 ? 8   ARG A HH12 6  
ATOM 7938  H HH21 . ARG A 1 8   ? -14.523 -6.141  -19.143 1.00 0.00 ? 8   ARG A HH21 6  
ATOM 7939  H HH22 . ARG A 1 8   ? -14.465 -7.622  -18.249 1.00 0.00 ? 8   ARG A HH22 6  
ATOM 7940  N N    . ASN A 1 9   ? -14.499 -3.857  -10.659 1.00 0.00 ? 9   ASN A N    6  
ATOM 7941  C CA   . ASN A 1 9   ? -14.013 -4.010  -9.293  1.00 0.00 ? 9   ASN A CA   6  
ATOM 7942  C C    . ASN A 1 9   ? -12.499 -4.195  -9.271  1.00 0.00 ? 9   ASN A C    6  
ATOM 7943  O O    . ASN A 1 9   ? -11.909 -4.680  -10.237 1.00 0.00 ? 9   ASN A O    6  
ATOM 7944  C CB   . ASN A 1 9   ? -14.693 -5.204  -8.618  1.00 0.00 ? 9   ASN A CB   6  
ATOM 7945  C CG   . ASN A 1 9   ? -14.387 -5.281  -7.135  1.00 0.00 ? 9   ASN A CG   6  
ATOM 7946  O OD1  . ASN A 1 9   ? -14.481 -4.286  -6.417  1.00 0.00 ? 9   ASN A OD1  6  
ATOM 7947  N ND2  . ASN A 1 9   ? -14.016 -6.469  -6.669  1.00 0.00 ? 9   ASN A ND2  6  
ATOM 7948  H H    . ASN A 1 9   ? -14.998 -4.592  -11.074 1.00 0.00 ? 9   ASN A H    6  
ATOM 7949  H HA   . ASN A 1 9   ? -14.263 -3.111  -8.750  1.00 0.00 ? 9   ASN A HA   6  
ATOM 7950  H HB2  . ASN A 1 9   ? -15.763 -5.117  -8.741  1.00 0.00 ? 9   ASN A HB2  6  
ATOM 7951  H HB3  . ASN A 1 9   ? -14.354 -6.116  -9.086  1.00 0.00 ? 9   ASN A HB3  6  
ATOM 7952  H HD21 . ASN A 1 9   ? -13.963 -7.217  -7.299  1.00 0.00 ? 9   ASN A HD21 6  
ATOM 7953  H HD22 . ASN A 1 9   ? -13.813 -6.547  -5.714  1.00 0.00 ? 9   ASN A HD22 6  
ATOM 7954  N N    . ARG A 1 10  ? -11.877 -3.805  -8.164  1.00 0.00 ? 10  ARG A N    6  
ATOM 7955  C CA   . ARG A 1 10  ? -10.431 -3.926  -8.017  1.00 0.00 ? 10  ARG A CA   6  
ATOM 7956  C C    . ARG A 1 10  ? -10.076 -5.049  -7.046  1.00 0.00 ? 10  ARG A C    6  
ATOM 7957  O O    . ARG A 1 10  ? -10.704 -5.199  -5.998  1.00 0.00 ? 10  ARG A O    6  
ATOM 7958  C CB   . ARG A 1 10  ? -9.834  -2.606  -7.527  1.00 0.00 ? 10  ARG A CB   6  
ATOM 7959  C CG   . ARG A 1 10  ? -9.628  -1.583  -8.632  1.00 0.00 ? 10  ARG A CG   6  
ATOM 7960  C CD   . ARG A 1 10  ? -8.258  -1.727  -9.276  1.00 0.00 ? 10  ARG A CD   6  
ATOM 7961  N NE   . ARG A 1 10  ? -7.252  -0.901  -8.612  1.00 0.00 ? 10  ARG A NE   6  
ATOM 7962  C CZ   . ARG A 1 10  ? -7.274  0.427   -8.613  1.00 0.00 ? 10  ARG A CZ   6  
ATOM 7963  N NH1  . ARG A 1 10  ? -8.246  1.076   -9.239  1.00 0.00 ? 10  ARG A NH1  6  
ATOM 7964  N NH2  . ARG A 1 10  ? -6.323  1.108   -7.986  1.00 0.00 ? 10  ARG A NH2  6  
ATOM 7965  H H    . ARG A 1 10  ? -12.402 -3.425  -7.428  1.00 0.00 ? 10  ARG A H    6  
ATOM 7966  H HA   . ARG A 1 10  ? -10.017 -4.160  -8.986  1.00 0.00 ? 10  ARG A HA   6  
ATOM 7967  H HB2  . ARG A 1 10  ? -10.496 -2.177  -6.788  1.00 0.00 ? 10  ARG A HB2  6  
ATOM 7968  H HB3  . ARG A 1 10  ? -8.878  -2.806  -7.068  1.00 0.00 ? 10  ARG A HB3  6  
ATOM 7969  H HG2  . ARG A 1 10  ? -10.386 -1.727  -9.388  1.00 0.00 ? 10  ARG A HG2  6  
ATOM 7970  H HG3  . ARG A 1 10  ? -9.718  -0.592  -8.213  1.00 0.00 ? 10  ARG A HG3  6  
ATOM 7971  H HD2  . ARG A 1 10  ? -7.955  -2.762  -9.219  1.00 0.00 ? 10  ARG A HD2  6  
ATOM 7972  H HD3  . ARG A 1 10  ? -8.329  -1.429  -10.311 1.00 0.00 ? 10  ARG A HD3  6  
ATOM 7973  H HE   . ARG A 1 10  ? -6.525  -1.361  -8.143  1.00 0.00 ? 10  ARG A HE   6  
ATOM 7974  H HH11 . ARG A 1 10  ? -8.964  0.566   -9.711  1.00 0.00 ? 10  ARG A HH11 6  
ATOM 7975  H HH12 . ARG A 1 10  ? -8.261  2.077   -9.237  1.00 0.00 ? 10  ARG A HH12 6  
ATOM 7976  H HH21 . ARG A 1 10  ? -5.589  0.621   -7.513  1.00 0.00 ? 10  ARG A HH21 6  
ATOM 7977  H HH22 . ARG A 1 10  ? -6.341  2.107   -7.988  1.00 0.00 ? 10  ARG A HH22 6  
ATOM 7978  N N    . PHE A 1 11  ? -9.065  -5.835  -7.403  1.00 0.00 ? 11  PHE A N    6  
ATOM 7979  C CA   . PHE A 1 11  ? -8.627  -6.944  -6.564  1.00 0.00 ? 11  PHE A CA   6  
ATOM 7980  C C    . PHE A 1 11  ? -8.157  -6.444  -5.202  1.00 0.00 ? 11  PHE A C    6  
ATOM 7981  O O    . PHE A 1 11  ? -7.087  -5.846  -5.082  1.00 0.00 ? 11  PHE A O    6  
ATOM 7982  C CB   . PHE A 1 11  ? -7.501  -7.718  -7.253  1.00 0.00 ? 11  PHE A CB   6  
ATOM 7983  C CG   . PHE A 1 11  ? -6.650  -8.511  -6.302  1.00 0.00 ? 11  PHE A CG   6  
ATOM 7984  C CD1  . PHE A 1 11  ? -7.052  -9.767  -5.876  1.00 0.00 ? 11  PHE A CD1  6  
ATOM 7985  C CD2  . PHE A 1 11  ? -5.449  -8.001  -5.836  1.00 0.00 ? 11  PHE A CD2  6  
ATOM 7986  C CE1  . PHE A 1 11  ? -6.271  -10.498 -5.000  1.00 0.00 ? 11  PHE A CE1  6  
ATOM 7987  C CE2  . PHE A 1 11  ? -4.664  -8.728  -4.961  1.00 0.00 ? 11  PHE A CE2  6  
ATOM 7988  C CZ   . PHE A 1 11  ? -5.076  -9.979  -4.544  1.00 0.00 ? 11  PHE A CZ   6  
ATOM 7989  H H    . PHE A 1 11  ? -8.603  -5.664  -8.250  1.00 0.00 ? 11  PHE A H    6  
ATOM 7990  H HA   . PHE A 1 11  ? -9.470  -7.603  -6.421  1.00 0.00 ? 11  PHE A HA   6  
ATOM 7991  H HB2  . PHE A 1 11  ? -7.930  -8.405  -7.966  1.00 0.00 ? 11  PHE A HB2  6  
ATOM 7992  H HB3  . PHE A 1 11  ? -6.860  -7.021  -7.771  1.00 0.00 ? 11  PHE A HB3  6  
ATOM 7993  H HD1  . PHE A 1 11  ? -7.986  -10.175 -6.232  1.00 0.00 ? 11  PHE A HD1  6  
ATOM 7994  H HD2  . PHE A 1 11  ? -5.126  -7.023  -6.163  1.00 0.00 ? 11  PHE A HD2  6  
ATOM 7995  H HE1  . PHE A 1 11  ? -6.595  -11.476 -4.676  1.00 0.00 ? 11  PHE A HE1  6  
ATOM 7996  H HE2  . PHE A 1 11  ? -3.730  -8.319  -4.607  1.00 0.00 ? 11  PHE A HE2  6  
ATOM 7997  H HZ   . PHE A 1 11  ? -4.464  -10.548 -3.860  1.00 0.00 ? 11  PHE A HZ   6  
ATOM 7998  N N    . LYS A 1 12  ? -8.964  -6.693  -4.176  1.00 0.00 ? 12  LYS A N    6  
ATOM 7999  C CA   . LYS A 1 12  ? -8.633  -6.269  -2.821  1.00 0.00 ? 12  LYS A CA   6  
ATOM 8000  C C    . LYS A 1 12  ? -7.789  -7.324  -2.112  1.00 0.00 ? 12  LYS A C    6  
ATOM 8001  O O    . LYS A 1 12  ? -8.172  -8.491  -2.038  1.00 0.00 ? 12  LYS A O    6  
ATOM 8002  C CB   . LYS A 1 12  ? -9.910  -6.001  -2.021  1.00 0.00 ? 12  LYS A CB   6  
ATOM 8003  C CG   . LYS A 1 12  ? -9.652  -5.568  -0.589  1.00 0.00 ? 12  LYS A CG   6  
ATOM 8004  C CD   . LYS A 1 12  ? -9.152  -4.134  -0.522  1.00 0.00 ? 12  LYS A CD   6  
ATOM 8005  C CE   . LYS A 1 12  ? -10.284 -3.139  -0.728  1.00 0.00 ? 12  LYS A CE   6  
ATOM 8006  N NZ   . LYS A 1 12  ? -9.840  -1.737  -0.491  1.00 0.00 ? 12  LYS A NZ   6  
ATOM 8007  H H    . LYS A 1 12  ? -9.804  -7.174  -4.335  1.00 0.00 ? 12  LYS A H    6  
ATOM 8008  H HA   . LYS A 1 12  ? -8.063  -5.355  -2.889  1.00 0.00 ? 12  LYS A HA   6  
ATOM 8009  H HB2  . LYS A 1 12  ? -10.473 -5.223  -2.515  1.00 0.00 ? 12  LYS A HB2  6  
ATOM 8010  H HB3  . LYS A 1 12  ? -10.503 -6.904  -2.000  1.00 0.00 ? 12  LYS A HB3  6  
ATOM 8011  H HG2  . LYS A 1 12  ? -10.571 -5.643  -0.028  1.00 0.00 ? 12  LYS A HG2  6  
ATOM 8012  H HG3  . LYS A 1 12  ? -8.907  -6.219  -0.154  1.00 0.00 ? 12  LYS A HG3  6  
ATOM 8013  H HD2  . LYS A 1 12  ? -8.708  -3.961  0.447   1.00 0.00 ? 12  LYS A HD2  6  
ATOM 8014  H HD3  . LYS A 1 12  ? -8.408  -3.985  -1.292  1.00 0.00 ? 12  LYS A HD3  6  
ATOM 8015  H HE2  . LYS A 1 12  ? -10.643 -3.227  -1.742  1.00 0.00 ? 12  LYS A HE2  6  
ATOM 8016  H HE3  . LYS A 1 12  ? -11.083 -3.376  -0.042  1.00 0.00 ? 12  LYS A HE3  6  
ATOM 8017  H HZ1  . LYS A 1 12  ? -9.096  -1.717  0.235   1.00 0.00 ? 12  LYS A HZ1  6  
ATOM 8018  H HZ2  . LYS A 1 12  ? -10.641 -1.159  -0.167  1.00 0.00 ? 12  LYS A HZ2  6  
ATOM 8019  H HZ3  . LYS A 1 12  ? -9.464  -1.328  -1.370  1.00 0.00 ? 12  LYS A HZ3  6  
ATOM 8020  N N    . TRP A 1 13  ? -6.641  -6.905  -1.593  1.00 0.00 ? 13  TRP A N    6  
ATOM 8021  C CA   . TRP A 1 13  ? -5.744  -7.814  -0.888  1.00 0.00 ? 13  TRP A CA   6  
ATOM 8022  C C    . TRP A 1 13  ? -6.408  -8.371  0.366   1.00 0.00 ? 13  TRP A C    6  
ATOM 8023  O O    . TRP A 1 13  ? -7.456  -7.887  0.792   1.00 0.00 ? 13  TRP A O    6  
ATOM 8024  C CB   . TRP A 1 13  ? -4.445  -7.097  -0.517  1.00 0.00 ? 13  TRP A CB   6  
ATOM 8025  C CG   . TRP A 1 13  ? -3.661  -6.635  -1.708  1.00 0.00 ? 13  TRP A CG   6  
ATOM 8026  C CD1  . TRP A 1 13  ? -3.677  -5.390  -2.268  1.00 0.00 ? 13  TRP A CD1  6  
ATOM 8027  C CD2  . TRP A 1 13  ? -2.746  -7.415  -2.486  1.00 0.00 ? 13  TRP A CD2  6  
ATOM 8028  N NE1  . TRP A 1 13  ? -2.827  -5.348  -3.347  1.00 0.00 ? 13  TRP A NE1  6  
ATOM 8029  C CE2  . TRP A 1 13  ? -2.244  -6.577  -3.501  1.00 0.00 ? 13  TRP A CE2  6  
ATOM 8030  C CE3  . TRP A 1 13  ? -2.301  -8.738  -2.423  1.00 0.00 ? 13  TRP A CE3  6  
ATOM 8031  C CZ2  . TRP A 1 13  ? -1.321  -7.022  -4.444  1.00 0.00 ? 13  TRP A CZ2  6  
ATOM 8032  C CZ3  . TRP A 1 13  ? -1.385  -9.178  -3.359  1.00 0.00 ? 13  TRP A CZ3  6  
ATOM 8033  C CH2  . TRP A 1 13  ? -0.902  -8.322  -4.358  1.00 0.00 ? 13  TRP A CH2  6  
ATOM 8034  H H    . TRP A 1 13  ? -6.390  -5.962  -1.684  1.00 0.00 ? 13  TRP A H    6  
ATOM 8035  H HA   . TRP A 1 13  ? -5.515  -8.634  -1.554  1.00 0.00 ? 13  TRP A HA   6  
ATOM 8036  H HB2  . TRP A 1 13  ? -4.679  -6.231  0.084   1.00 0.00 ? 13  TRP A HB2  6  
ATOM 8037  H HB3  . TRP A 1 13  ? -3.822  -7.769  0.053   1.00 0.00 ? 13  TRP A HB3  6  
ATOM 8038  H HD1  . TRP A 1 13  ? -4.276  -4.568  -1.906  1.00 0.00 ? 13  TRP A HD1  6  
ATOM 8039  H HE1  . TRP A 1 13  ? -2.665  -4.564  -3.913  1.00 0.00 ? 13  TRP A HE1  6  
ATOM 8040  H HE3  . TRP A 1 13  ? -2.661  -9.413  -1.660  1.00 0.00 ? 13  TRP A HE3  6  
ATOM 8041  H HZ2  . TRP A 1 13  ? -0.938  -6.375  -5.220  1.00 0.00 ? 13  TRP A HZ2  6  
ATOM 8042  H HZ3  . TRP A 1 13  ? -1.030  -10.198 -3.327  1.00 0.00 ? 13  TRP A HZ3  6  
ATOM 8043  H HH2  . TRP A 1 13  ? -0.188  -8.709  -5.069  1.00 0.00 ? 13  TRP A HH2  6  
ATOM 8044  N N    . GLY A 1 14  ? -5.791  -9.392  0.954   1.00 0.00 ? 14  GLY A N    6  
ATOM 8045  C CA   . GLY A 1 14  ? -6.338  -9.997  2.154   1.00 0.00 ? 14  GLY A CA   6  
ATOM 8046  C C    . GLY A 1 14  ? -5.645  -9.515  3.414   1.00 0.00 ? 14  GLY A C    6  
ATOM 8047  O O    . GLY A 1 14  ? -4.773  -8.648  3.374   1.00 0.00 ? 14  GLY A O    6  
ATOM 8048  H H    . GLY A 1 14  ? -4.959  -9.737  0.569   1.00 0.00 ? 14  GLY A H    6  
ATOM 8049  H HA2  . GLY A 1 14  ? -7.389  -9.757  2.219   1.00 0.00 ? 14  GLY A HA2  6  
ATOM 8050  H HA3  . GLY A 1 14  ? -6.228  -11.069 2.085   1.00 0.00 ? 14  GLY A HA3  6  
ATOM 8051  N N    . PRO A 1 15  ? -6.036  -10.084 4.563   1.00 0.00 ? 15  PRO A N    6  
ATOM 8052  C CA   . PRO A 1 15  ? -5.460  -9.722  5.862   1.00 0.00 ? 15  PRO A CA   6  
ATOM 8053  C C    . PRO A 1 15  ? -4.017  -10.192 6.007   1.00 0.00 ? 15  PRO A C    6  
ATOM 8054  O O    . PRO A 1 15  ? -3.194  -9.517  6.624   1.00 0.00 ? 15  PRO A O    6  
ATOM 8055  C CB   . PRO A 1 15  ? -6.362  -10.448 6.864   1.00 0.00 ? 15  PRO A CB   6  
ATOM 8056  C CG   . PRO A 1 15  ? -6.925  -11.599 6.104   1.00 0.00 ? 15  PRO A CG   6  
ATOM 8057  C CD   . PRO A 1 15  ? -7.071  -11.125 4.684   1.00 0.00 ? 15  PRO A CD   6  
ATOM 8058  H HA   . PRO A 1 15  ? -5.510  -8.657  6.035   1.00 0.00 ? 15  PRO A HA   6  
ATOM 8059  H HB2  . PRO A 1 15  ? -5.772  -10.780 7.707   1.00 0.00 ? 15  PRO A HB2  6  
ATOM 8060  H HB3  . PRO A 1 15  ? -7.140  -9.780  7.203   1.00 0.00 ? 15  PRO A HB3  6  
ATOM 8061  H HG2  . PRO A 1 15  ? -6.246  -12.437 6.152   1.00 0.00 ? 15  PRO A HG2  6  
ATOM 8062  H HG3  . PRO A 1 15  ? -7.888  -11.870 6.510   1.00 0.00 ? 15  PRO A HG3  6  
ATOM 8063  H HD2  . PRO A 1 15  ? -6.885  -11.936 3.995   1.00 0.00 ? 15  PRO A HD2  6  
ATOM 8064  H HD3  . PRO A 1 15  ? -8.055  -10.710 4.525   1.00 0.00 ? 15  PRO A HD3  6  
ATOM 8065  N N    . ALA A 1 16  ? -3.717  -11.353 5.434   1.00 0.00 ? 16  ALA A N    6  
ATOM 8066  C CA   . ALA A 1 16  ? -2.372  -11.911 5.497   1.00 0.00 ? 16  ALA A CA   6  
ATOM 8067  C C    . ALA A 1 16  ? -1.515  -11.411 4.340   1.00 0.00 ? 16  ALA A C    6  
ATOM 8068  O O    . ALA A 1 16  ? -0.392  -10.947 4.541   1.00 0.00 ? 16  ALA A O    6  
ATOM 8069  C CB   . ALA A 1 16  ? -2.431  -13.432 5.495   1.00 0.00 ? 16  ALA A CB   6  
ATOM 8070  H H    . ALA A 1 16  ? -4.416  -11.845 4.956   1.00 0.00 ? 16  ALA A H    6  
ATOM 8071  H HA   . ALA A 1 16  ? -1.923  -11.594 6.428   1.00 0.00 ? 16  ALA A HA   6  
ATOM 8072  H HB1  . ALA A 1 16  ? -1.603  -13.824 6.068   1.00 0.00 ? 16  ALA A HB1  6  
ATOM 8073  H HB2  . ALA A 1 16  ? -3.361  -13.756 5.936   1.00 0.00 ? 16  ALA A HB2  6  
ATOM 8074  H HB3  . ALA A 1 16  ? -2.368  -13.792 4.479   1.00 0.00 ? 16  ALA A HB3  6  
ATOM 8075  N N    . SER A 1 17  ? -2.050  -11.510 3.127   1.00 0.00 ? 17  SER A N    6  
ATOM 8076  C CA   . SER A 1 17  ? -1.332  -11.071 1.936   1.00 0.00 ? 17  SER A CA   6  
ATOM 8077  C C    . SER A 1 17  ? -0.720  -9.690  2.149   1.00 0.00 ? 17  SER A C    6  
ATOM 8078  O O    . SER A 1 17  ? 0.486   -9.503  1.988   1.00 0.00 ? 17  SER A O    6  
ATOM 8079  C CB   . SER A 1 17  ? -2.272  -11.045 0.729   1.00 0.00 ? 17  SER A CB   6  
ATOM 8080  O OG   . SER A 1 17  ? -3.607  -10.791 1.128   1.00 0.00 ? 17  SER A OG   6  
ATOM 8081  H H    . SER A 1 17  ? -2.949  -11.889 3.031   1.00 0.00 ? 17  SER A H    6  
ATOM 8082  H HA   . SER A 1 17  ? -0.538  -11.779 1.749   1.00 0.00 ? 17  SER A HA   6  
ATOM 8083  H HB2  . SER A 1 17  ? -1.958  -10.267 0.049   1.00 0.00 ? 17  SER A HB2  6  
ATOM 8084  H HB3  . SER A 1 17  ? -2.234  -12.000 0.226   1.00 0.00 ? 17  SER A HB3  6  
ATOM 8085  H HG   . SER A 1 17  ? -3.609  -10.339 1.975   1.00 0.00 ? 17  SER A HG   6  
ATOM 8086  N N    . GLN A 1 18  ? -1.560  -8.726  2.510   1.00 0.00 ? 18  GLN A N    6  
ATOM 8087  C CA   . GLN A 1 18  ? -1.102  -7.362  2.744   1.00 0.00 ? 18  GLN A CA   6  
ATOM 8088  C C    . GLN A 1 18  ? 0.174   -7.352  3.578   1.00 0.00 ? 18  GLN A C    6  
ATOM 8089  O O    . GLN A 1 18  ? 1.215   -6.872  3.130   1.00 0.00 ? 18  GLN A O    6  
ATOM 8090  C CB   . GLN A 1 18  ? -2.191  -6.549  3.447   1.00 0.00 ? 18  GLN A CB   6  
ATOM 8091  C CG   . GLN A 1 18  ? -3.265  -6.029  2.506   1.00 0.00 ? 18  GLN A CG   6  
ATOM 8092  C CD   . GLN A 1 18  ? -3.883  -4.731  2.986   1.00 0.00 ? 18  GLN A CD   6  
ATOM 8093  O OE1  . GLN A 1 18  ? -3.235  -3.937  3.669   1.00 0.00 ? 18  GLN A OE1  6  
ATOM 8094  N NE2  . GLN A 1 18  ? -5.143  -4.507  2.631   1.00 0.00 ? 18  GLN A NE2  6  
ATOM 8095  H H    . GLN A 1 18  ? -2.510  -8.937  2.622   1.00 0.00 ? 18  GLN A H    6  
ATOM 8096  H HA   . GLN A 1 18  ? -0.894  -6.913  1.785   1.00 0.00 ? 18  GLN A HA   6  
ATOM 8097  H HB2  . GLN A 1 18  ? -2.665  -7.172  4.191   1.00 0.00 ? 18  GLN A HB2  6  
ATOM 8098  H HB3  . GLN A 1 18  ? -1.733  -5.703  3.937   1.00 0.00 ? 18  GLN A HB3  6  
ATOM 8099  H HG2  . GLN A 1 18  ? -2.824  -5.862  1.534   1.00 0.00 ? 18  GLN A HG2  6  
ATOM 8100  H HG3  . GLN A 1 18  ? -4.044  -6.773  2.423   1.00 0.00 ? 18  GLN A HG3  6  
ATOM 8101  H HE21 . GLN A 1 18  ? -5.597  -5.185  2.087   1.00 0.00 ? 18  GLN A HE21 6  
ATOM 8102  H HE22 . GLN A 1 18  ? -5.568  -3.677  2.928   1.00 0.00 ? 18  GLN A HE22 6  
ATOM 8103  N N    . GLN A 1 19  ? 0.086   -7.883  4.793   1.00 0.00 ? 19  GLN A N    6  
ATOM 8104  C CA   . GLN A 1 19  ? 1.235   -7.934  5.690   1.00 0.00 ? 19  GLN A CA   6  
ATOM 8105  C C    . GLN A 1 19  ? 2.488   -8.380  4.944   1.00 0.00 ? 19  GLN A C    6  
ATOM 8106  O O    . GLN A 1 19  ? 3.559   -7.794  5.105   1.00 0.00 ? 19  GLN A O    6  
ATOM 8107  C CB   . GLN A 1 19  ? 0.956   -8.883  6.857   1.00 0.00 ? 19  GLN A CB   6  
ATOM 8108  C CG   . GLN A 1 19  ? -0.262  -8.495  7.679   1.00 0.00 ? 19  GLN A CG   6  
ATOM 8109  C CD   . GLN A 1 19  ? -0.173  -8.973  9.115   1.00 0.00 ? 19  GLN A CD   6  
ATOM 8110  O OE1  . GLN A 1 19  ? -0.159  -8.171  10.049  1.00 0.00 ? 19  GLN A OE1  6  
ATOM 8111  N NE2  . GLN A 1 19  ? -0.113  -10.287 9.299   1.00 0.00 ? 19  GLN A NE2  6  
ATOM 8112  H H    . GLN A 1 19  ? -0.771  -8.250  5.094   1.00 0.00 ? 19  GLN A H    6  
ATOM 8113  H HA   . GLN A 1 19  ? 1.396   -6.940  6.078   1.00 0.00 ? 19  GLN A HA   6  
ATOM 8114  H HB2  . GLN A 1 19  ? 0.799   -9.878  6.467   1.00 0.00 ? 19  GLN A HB2  6  
ATOM 8115  H HB3  . GLN A 1 19  ? 1.816   -8.893  7.510   1.00 0.00 ? 19  GLN A HB3  6  
ATOM 8116  H HG2  . GLN A 1 19  ? -0.352  -7.419  7.680   1.00 0.00 ? 19  GLN A HG2  6  
ATOM 8117  H HG3  . GLN A 1 19  ? -1.140  -8.928  7.224   1.00 0.00 ? 19  GLN A HG3  6  
ATOM 8118  H HE21 . GLN A 1 19  ? -0.128  -10.866 8.508   1.00 0.00 ? 19  GLN A HE21 6  
ATOM 8119  H HE22 . GLN A 1 19  ? -0.054  -10.624 10.216  1.00 0.00 ? 19  GLN A HE22 6  
ATOM 8120  N N    . ILE A 1 20  ? 2.347   -9.420  4.129   1.00 0.00 ? 20  ILE A N    6  
ATOM 8121  C CA   . ILE A 1 20  ? 3.468   -9.943  3.358   1.00 0.00 ? 20  ILE A CA   6  
ATOM 8122  C C    . ILE A 1 20  ? 4.062   -8.869  2.454   1.00 0.00 ? 20  ILE A C    6  
ATOM 8123  O O    . ILE A 1 20  ? 5.282   -8.769  2.308   1.00 0.00 ? 20  ILE A O    6  
ATOM 8124  C CB   . ILE A 1 20  ? 3.045   -11.148 2.497   1.00 0.00 ? 20  ILE A CB   6  
ATOM 8125  C CG1  . ILE A 1 20  ? 2.472   -12.258 3.380   1.00 0.00 ? 20  ILE A CG1  6  
ATOM 8126  C CG2  . ILE A 1 20  ? 4.228   -11.663 1.690   1.00 0.00 ? 20  ILE A CG2  6  
ATOM 8127  C CD1  . ILE A 1 20  ? 1.465   -13.136 2.670   1.00 0.00 ? 20  ILE A CD1  6  
ATOM 8128  H H    . ILE A 1 20  ? 1.468   -9.844  4.044   1.00 0.00 ? 20  ILE A H    6  
ATOM 8129  H HA   . ILE A 1 20  ? 4.226   -10.272 4.055   1.00 0.00 ? 20  ILE A HA   6  
ATOM 8130  H HB   . ILE A 1 20  ? 2.285   -10.818 1.806   1.00 0.00 ? 20  ILE A HB   6  
ATOM 8131  H HG12 . ILE A 1 20  ? 3.276   -12.888 3.724   1.00 0.00 ? 20  ILE A HG12 6  
ATOM 8132  H HG13 . ILE A 1 20  ? 1.980   -11.811 4.233   1.00 0.00 ? 20  ILE A HG13 6  
ATOM 8133  H HG21 . ILE A 1 20  ? 4.637   -10.858 1.098   1.00 0.00 ? 20  ILE A HG21 6  
ATOM 8134  H HG22 . ILE A 1 20  ? 4.986   -12.036 2.362   1.00 0.00 ? 20  ILE A HG22 6  
ATOM 8135  H HG23 . ILE A 1 20  ? 3.900   -12.460 1.039   1.00 0.00 ? 20  ILE A HG23 6  
ATOM 8136  H HD11 . ILE A 1 20  ? 1.372   -12.818 1.642   1.00 0.00 ? 20  ILE A HD11 6  
ATOM 8137  H HD12 . ILE A 1 20  ? 1.796   -14.163 2.702   1.00 0.00 ? 20  ILE A HD12 6  
ATOM 8138  H HD13 . ILE A 1 20  ? 0.506   -13.052 3.160   1.00 0.00 ? 20  ILE A HD13 6  
ATOM 8139  N N    . LEU A 1 21  ? 3.194   -8.066  1.849   1.00 0.00 ? 21  LEU A N    6  
ATOM 8140  C CA   . LEU A 1 21  ? 3.633   -6.997  0.959   1.00 0.00 ? 21  LEU A CA   6  
ATOM 8141  C C    . LEU A 1 21  ? 4.472   -5.970  1.714   1.00 0.00 ? 21  LEU A C    6  
ATOM 8142  O O    . LEU A 1 21  ? 5.443   -5.434  1.180   1.00 0.00 ? 21  LEU A O    6  
ATOM 8143  C CB   . LEU A 1 21  ? 2.424   -6.312  0.318   1.00 0.00 ? 21  LEU A CB   6  
ATOM 8144  C CG   . LEU A 1 21  ? 1.387   -7.239  -0.317  1.00 0.00 ? 21  LEU A CG   6  
ATOM 8145  C CD1  . LEU A 1 21  ? 0.293   -6.430  -0.996  1.00 0.00 ? 21  LEU A CD1  6  
ATOM 8146  C CD2  . LEU A 1 21  ? 2.051   -8.181  -1.311  1.00 0.00 ? 21  LEU A CD2  6  
ATOM 8147  H H    . LEU A 1 21  ? 2.235   -8.195  2.004   1.00 0.00 ? 21  LEU A H    6  
ATOM 8148  H HA   . LEU A 1 21  ? 4.240   -7.439  0.183   1.00 0.00 ? 21  LEU A HA   6  
ATOM 8149  H HB2  . LEU A 1 21  ? 1.928   -5.735  1.082   1.00 0.00 ? 21  LEU A HB2  6  
ATOM 8150  H HB3  . LEU A 1 21  ? 2.791   -5.648  -0.452  1.00 0.00 ? 21  LEU A HB3  6  
ATOM 8151  H HG   . LEU A 1 21  ? 0.927   -7.838  0.457   1.00 0.00 ? 21  LEU A HG   6  
ATOM 8152  H HD11 . LEU A 1 21  ? -0.285  -7.075  -1.640  1.00 0.00 ? 21  LEU A HD11 6  
ATOM 8153  H HD12 . LEU A 1 21  ? 0.740   -5.641  -1.583  1.00 0.00 ? 21  LEU A HD12 6  
ATOM 8154  H HD13 . LEU A 1 21  ? -0.353  -5.998  -0.245  1.00 0.00 ? 21  LEU A HD13 6  
ATOM 8155  H HD21 . LEU A 1 21  ? 2.970   -8.560  -0.889  1.00 0.00 ? 21  LEU A HD21 6  
ATOM 8156  H HD22 . LEU A 1 21  ? 2.268   -7.646  -2.224  1.00 0.00 ? 21  LEU A HD22 6  
ATOM 8157  H HD23 . LEU A 1 21  ? 1.386   -9.005  -1.525  1.00 0.00 ? 21  LEU A HD23 6  
ATOM 8158  N N    . TYR A 1 22  ? 4.091   -5.703  2.958   1.00 0.00 ? 22  TYR A N    6  
ATOM 8159  C CA   . TYR A 1 22  ? 4.808   -4.741  3.786   1.00 0.00 ? 22  TYR A CA   6  
ATOM 8160  C C    . TYR A 1 22  ? 6.191   -5.267  4.160   1.00 0.00 ? 22  TYR A C    6  
ATOM 8161  O O    . TYR A 1 22  ? 7.192   -4.564  4.023   1.00 0.00 ? 22  TYR A O    6  
ATOM 8162  C CB   . TYR A 1 22  ? 4.009   -4.431  5.053   1.00 0.00 ? 22  TYR A CB   6  
ATOM 8163  C CG   . TYR A 1 22  ? 2.740   -3.651  4.792   1.00 0.00 ? 22  TYR A CG   6  
ATOM 8164  C CD1  . TYR A 1 22  ? 2.763   -2.266  4.677   1.00 0.00 ? 22  TYR A CD1  6  
ATOM 8165  C CD2  . TYR A 1 22  ? 1.517   -4.298  4.661   1.00 0.00 ? 22  TYR A CD2  6  
ATOM 8166  C CE1  . TYR A 1 22  ? 1.607   -1.549  4.440   1.00 0.00 ? 22  TYR A CE1  6  
ATOM 8167  C CE2  . TYR A 1 22  ? 0.356   -3.589  4.422   1.00 0.00 ? 22  TYR A CE2  6  
ATOM 8168  C CZ   . TYR A 1 22  ? 0.406   -2.215  4.312   1.00 0.00 ? 22  TYR A CZ   6  
ATOM 8169  O OH   . TYR A 1 22  ? -0.749  -1.506  4.075   1.00 0.00 ? 22  TYR A OH   6  
ATOM 8170  H H    . TYR A 1 22  ? 3.309   -6.162  3.328   1.00 0.00 ? 22  TYR A H    6  
ATOM 8171  H HA   . TYR A 1 22  ? 4.924   -3.832  3.214   1.00 0.00 ? 22  TYR A HA   6  
ATOM 8172  H HB2  . TYR A 1 22  ? 3.735   -5.357  5.533   1.00 0.00 ? 22  TYR A HB2  6  
ATOM 8173  H HB3  . TYR A 1 22  ? 4.623   -3.850  5.725   1.00 0.00 ? 22  TYR A HB3  6  
ATOM 8174  H HD1  . TYR A 1 22  ? 3.706   -1.747  4.778   1.00 0.00 ? 22  TYR A HD1  6  
ATOM 8175  H HD2  . TYR A 1 22  ? 1.482   -5.374  4.748   1.00 0.00 ? 22  TYR A HD2  6  
ATOM 8176  H HE1  . TYR A 1 22  ? 1.645   -0.473  4.354   1.00 0.00 ? 22  TYR A HE1  6  
ATOM 8177  H HE2  . TYR A 1 22  ? -0.585  -4.111  4.322   1.00 0.00 ? 22  TYR A HE2  6  
ATOM 8178  H HH   . TYR A 1 22  ? -1.443  -2.108  3.794   1.00 0.00 ? 22  TYR A HH   6  
ATOM 8179  N N    . GLN A 1 23  ? 6.236   -6.508  4.633   1.00 0.00 ? 23  GLN A N    6  
ATOM 8180  C CA   . GLN A 1 23  ? 7.495   -7.130  5.027   1.00 0.00 ? 23  GLN A CA   6  
ATOM 8181  C C    . GLN A 1 23  ? 8.513   -7.064  3.893   1.00 0.00 ? 23  GLN A C    6  
ATOM 8182  O O    . GLN A 1 23  ? 9.691   -6.792  4.119   1.00 0.00 ? 23  GLN A O    6  
ATOM 8183  C CB   . GLN A 1 23  ? 7.263   -8.585  5.437   1.00 0.00 ? 23  GLN A CB   6  
ATOM 8184  C CG   . GLN A 1 23  ? 6.962   -8.760  6.916   1.00 0.00 ? 23  GLN A CG   6  
ATOM 8185  C CD   . GLN A 1 23  ? 8.217   -8.826  7.764   1.00 0.00 ? 23  GLN A CD   6  
ATOM 8186  O OE1  . GLN A 1 23  ? 9.321   -9.002  7.246   1.00 0.00 ? 23  GLN A OE1  6  
ATOM 8187  N NE2  . GLN A 1 23  ? 8.056   -8.685  9.074   1.00 0.00 ? 23  GLN A NE2  6  
ATOM 8188  H H    . GLN A 1 23  ? 5.404   -7.018  4.719   1.00 0.00 ? 23  GLN A H    6  
ATOM 8189  H HA   . GLN A 1 23  ? 7.883   -6.584  5.874   1.00 0.00 ? 23  GLN A HA   6  
ATOM 8190  H HB2  . GLN A 1 23  ? 6.430   -8.977  4.873   1.00 0.00 ? 23  GLN A HB2  6  
ATOM 8191  H HB3  . GLN A 1 23  ? 8.148   -9.158  5.202   1.00 0.00 ? 23  GLN A HB3  6  
ATOM 8192  H HG2  . GLN A 1 23  ? 6.365   -7.924  7.250   1.00 0.00 ? 23  GLN A HG2  6  
ATOM 8193  H HG3  . GLN A 1 23  ? 6.405   -9.675  7.051   1.00 0.00 ? 23  GLN A HG3  6  
ATOM 8194  H HE21 . GLN A 1 23  ? 7.146   -8.550  9.416   1.00 0.00 ? 23  GLN A HE21 6  
ATOM 8195  H HE22 . GLN A 1 23  ? 8.850   -8.725  9.646   1.00 0.00 ? 23  GLN A HE22 6  
ATOM 8196  N N    . ALA A 1 24  ? 8.049   -7.316  2.673   1.00 0.00 ? 24  ALA A N    6  
ATOM 8197  C CA   . ALA A 1 24  ? 8.919   -7.283  1.504   1.00 0.00 ? 24  ALA A CA   6  
ATOM 8198  C C    . ALA A 1 24  ? 9.276   -5.850  1.124   1.00 0.00 ? 24  ALA A C    6  
ATOM 8199  O O    . ALA A 1 24  ? 10.426  -5.550  0.805   1.00 0.00 ? 24  ALA A O    6  
ATOM 8200  C CB   . ALA A 1 24  ? 8.255   -7.992  0.332   1.00 0.00 ? 24  ALA A CB   6  
ATOM 8201  H H    . ALA A 1 24  ? 7.099   -7.526  2.557   1.00 0.00 ? 24  ALA A H    6  
ATOM 8202  H HA   . ALA A 1 24  ? 9.826   -7.817  1.748   1.00 0.00 ? 24  ALA A HA   6  
ATOM 8203  H HB1  . ALA A 1 24  ? 8.078   -7.282  -0.463  1.00 0.00 ? 24  ALA A HB1  6  
ATOM 8204  H HB2  . ALA A 1 24  ? 8.901   -8.780  -0.025  1.00 0.00 ? 24  ALA A HB2  6  
ATOM 8205  H HB3  . ALA A 1 24  ? 7.314   -8.414  0.654   1.00 0.00 ? 24  ALA A HB3  6  
ATOM 8206  N N    . TYR A 1 25  ? 8.282   -4.969  1.160   1.00 0.00 ? 25  TYR A N    6  
ATOM 8207  C CA   . TYR A 1 25  ? 8.491   -3.567  0.817   1.00 0.00 ? 25  TYR A CA   6  
ATOM 8208  C C    . TYR A 1 25  ? 9.443   -2.900  1.805   1.00 0.00 ? 25  TYR A C    6  
ATOM 8209  O O    . TYR A 1 25  ? 10.210  -2.009  1.440   1.00 0.00 ? 25  TYR A O    6  
ATOM 8210  C CB   . TYR A 1 25  ? 7.156   -2.822  0.795   1.00 0.00 ? 25  TYR A CB   6  
ATOM 8211  C CG   . TYR A 1 25  ? 7.257   -1.414  0.251   1.00 0.00 ? 25  TYR A CG   6  
ATOM 8212  C CD1  . TYR A 1 25  ? 7.978   -0.438  0.927   1.00 0.00 ? 25  TYR A CD1  6  
ATOM 8213  C CD2  . TYR A 1 25  ? 6.631   -1.061  -0.938  1.00 0.00 ? 25  TYR A CD2  6  
ATOM 8214  C CE1  . TYR A 1 25  ? 8.073   0.849   0.435   1.00 0.00 ? 25  TYR A CE1  6  
ATOM 8215  C CE2  . TYR A 1 25  ? 6.722   0.224   -1.438  1.00 0.00 ? 25  TYR A CE2  6  
ATOM 8216  C CZ   . TYR A 1 25  ? 7.444   1.175   -0.748  1.00 0.00 ? 25  TYR A CZ   6  
ATOM 8217  O OH   . TYR A 1 25  ? 7.535   2.456   -1.243  1.00 0.00 ? 25  TYR A OH   6  
ATOM 8218  H H    . TYR A 1 25  ? 7.387   -5.268  1.423   1.00 0.00 ? 25  TYR A H    6  
ATOM 8219  H HA   . TYR A 1 25  ? 8.930   -3.529  -0.170  1.00 0.00 ? 25  TYR A HA   6  
ATOM 8220  H HB2  . TYR A 1 25  ? 6.458   -3.365  0.177   1.00 0.00 ? 25  TYR A HB2  6  
ATOM 8221  H HB3  . TYR A 1 25  ? 6.768   -2.762  1.801   1.00 0.00 ? 25  TYR A HB3  6  
ATOM 8222  H HD1  . TYR A 1 25  ? 8.470   -0.696  1.854   1.00 0.00 ? 25  TYR A HD1  6  
ATOM 8223  H HD2  . TYR A 1 25  ? 6.066   -1.809  -1.475  1.00 0.00 ? 25  TYR A HD2  6  
ATOM 8224  H HE1  . TYR A 1 25  ? 8.639   1.595   0.975   1.00 0.00 ? 25  TYR A HE1  6  
ATOM 8225  H HE2  . TYR A 1 25  ? 6.229   0.479   -2.365  1.00 0.00 ? 25  TYR A HE2  6  
ATOM 8226  H HH   . TYR A 1 25  ? 8.401   2.816   -1.039  1.00 0.00 ? 25  TYR A HH   6  
ATOM 8227  N N    . ASP A 1 26  ? 9.387   -3.339  3.058   1.00 0.00 ? 26  ASP A N    6  
ATOM 8228  C CA   . ASP A 1 26  ? 10.244  -2.786  4.100   1.00 0.00 ? 26  ASP A CA   6  
ATOM 8229  C C    . ASP A 1 26  ? 11.716  -3.007  3.766   1.00 0.00 ? 26  ASP A C    6  
ATOM 8230  O O    . ASP A 1 26  ? 12.566  -2.174  4.082   1.00 0.00 ? 26  ASP A O    6  
ATOM 8231  C CB   . ASP A 1 26  ? 9.914   -3.422  5.452   1.00 0.00 ? 26  ASP A CB   6  
ATOM 8232  C CG   . ASP A 1 26  ? 10.220  -2.500  6.615   1.00 0.00 ? 26  ASP A CG   6  
ATOM 8233  O OD1  . ASP A 1 26  ? 9.555   -1.449  6.731   1.00 0.00 ? 26  ASP A OD1  6  
ATOM 8234  O OD2  . ASP A 1 26  ? 11.125  -2.829  7.411   1.00 0.00 ? 26  ASP A OD2  6  
ATOM 8235  H H    . ASP A 1 26  ? 8.754   -4.051  3.287   1.00 0.00 ? 26  ASP A H    6  
ATOM 8236  H HA   . ASP A 1 26  ? 10.056  -1.725  4.156   1.00 0.00 ? 26  ASP A HA   6  
ATOM 8237  H HB2  . ASP A 1 26  ? 8.863   -3.669  5.479   1.00 0.00 ? 26  ASP A HB2  6  
ATOM 8238  H HB3  . ASP A 1 26  ? 10.495  -4.325  5.569   1.00 0.00 ? 26  ASP A HB3  6  
ATOM 8239  N N    . ARG A 1 27  ? 12.010  -4.135  3.127   1.00 0.00 ? 27  ARG A N    6  
ATOM 8240  C CA   . ARG A 1 27  ? 13.380  -4.466  2.753   1.00 0.00 ? 27  ARG A CA   6  
ATOM 8241  C C    . ARG A 1 27  ? 13.775  -3.762  1.458   1.00 0.00 ? 27  ARG A C    6  
ATOM 8242  O O    . ARG A 1 27  ? 14.823  -3.121  1.384   1.00 0.00 ? 27  ARG A O    6  
ATOM 8243  C CB   . ARG A 1 27  ? 13.535  -5.979  2.592   1.00 0.00 ? 27  ARG A CB   6  
ATOM 8244  C CG   . ARG A 1 27  ? 12.973  -6.777  3.757   1.00 0.00 ? 27  ARG A CG   6  
ATOM 8245  C CD   . ARG A 1 27  ? 13.393  -8.237  3.686   1.00 0.00 ? 27  ARG A CD   6  
ATOM 8246  N NE   . ARG A 1 27  ? 13.376  -8.875  5.000   1.00 0.00 ? 27  ARG A NE   6  
ATOM 8247  C CZ   . ARG A 1 27  ? 12.262  -9.164  5.662   1.00 0.00 ? 27  ARG A CZ   6  
ATOM 8248  N NH1  . ARG A 1 27  ? 11.080  -8.873  5.137   1.00 0.00 ? 27  ARG A NH1  6  
ATOM 8249  N NH2  . ARG A 1 27  ? 12.329  -9.745  6.854   1.00 0.00 ? 27  ARG A NH2  6  
ATOM 8250  H H    . ARG A 1 27  ? 11.289  -4.760  2.903   1.00 0.00 ? 27  ARG A H    6  
ATOM 8251  H HA   . ARG A 1 27  ? 14.031  -4.129  3.545   1.00 0.00 ? 27  ARG A HA   6  
ATOM 8252  H HB2  . ARG A 1 27  ? 13.023  -6.288  1.692   1.00 0.00 ? 27  ARG A HB2  6  
ATOM 8253  H HB3  . ARG A 1 27  ? 14.585  -6.213  2.497   1.00 0.00 ? 27  ARG A HB3  6  
ATOM 8254  H HG2  . ARG A 1 27  ? 13.338  -6.353  4.681   1.00 0.00 ? 27  ARG A HG2  6  
ATOM 8255  H HG3  . ARG A 1 27  ? 11.895  -6.719  3.733   1.00 0.00 ? 27  ARG A HG3  6  
ATOM 8256  H HD2  . ARG A 1 27  ? 12.712  -8.762  3.033   1.00 0.00 ? 27  ARG A HD2  6  
ATOM 8257  H HD3  . ARG A 1 27  ? 14.392  -8.291  3.282   1.00 0.00 ? 27  ARG A HD3  6  
ATOM 8258  H HE   . ARG A 1 27  ? 14.239  -9.099  5.406   1.00 0.00 ? 27  ARG A HE   6  
ATOM 8259  H HH11 . ARG A 1 27  ? 11.026  -8.436  4.239   1.00 0.00 ? 27  ARG A HH11 6  
ATOM 8260  H HH12 . ARG A 1 27  ? 10.242  -9.093  5.638   1.00 0.00 ? 27  ARG A HH12 6  
ATOM 8261  H HH21 . ARG A 1 27  ? 13.218  -9.966  7.253   1.00 0.00 ? 27  ARG A HH21 6  
ATOM 8262  H HH22 . ARG A 1 27  ? 11.490  -9.962  7.351   1.00 0.00 ? 27  ARG A HH22 6  
ATOM 8263  N N    . GLN A 1 28  ? 12.929  -3.887  0.441   1.00 0.00 ? 28  GLN A N    6  
ATOM 8264  C CA   . GLN A 1 28  ? 13.190  -3.264  -0.851  1.00 0.00 ? 28  GLN A CA   6  
ATOM 8265  C C    . GLN A 1 28  ? 11.970  -2.492  -1.341  1.00 0.00 ? 28  GLN A C    6  
ATOM 8266  O O    . GLN A 1 28  ? 10.846  -2.993  -1.295  1.00 0.00 ? 28  GLN A O    6  
ATOM 8267  C CB   . GLN A 1 28  ? 13.586  -4.324  -1.881  1.00 0.00 ? 28  GLN A CB   6  
ATOM 8268  C CG   . GLN A 1 28  ? 13.832  -3.759  -3.271  1.00 0.00 ? 28  GLN A CG   6  
ATOM 8269  C CD   . GLN A 1 28  ? 15.187  -3.089  -3.396  1.00 0.00 ? 28  GLN A CD   6  
ATOM 8270  O OE1  . GLN A 1 28  ? 15.674  -2.465  -2.453  1.00 0.00 ? 28  GLN A OE1  6  
ATOM 8271  N NE2  . GLN A 1 28  ? 15.803  -3.214  -4.566  1.00 0.00 ? 28  GLN A NE2  6  
ATOM 8272  H H    . GLN A 1 28  ? 12.110  -4.411  0.562   1.00 0.00 ? 28  GLN A H    6  
ATOM 8273  H HA   . GLN A 1 28  ? 14.011  -2.574  -0.726  1.00 0.00 ? 28  GLN A HA   6  
ATOM 8274  H HB2  . GLN A 1 28  ? 14.489  -4.813  -1.549  1.00 0.00 ? 28  GLN A HB2  6  
ATOM 8275  H HB3  . GLN A 1 28  ? 12.794  -5.055  -1.950  1.00 0.00 ? 28  GLN A HB3  6  
ATOM 8276  H HG2  . GLN A 1 28  ? 13.779  -4.564  -3.988  1.00 0.00 ? 28  GLN A HG2  6  
ATOM 8277  H HG3  . GLN A 1 28  ? 13.065  -3.031  -3.491  1.00 0.00 ? 28  GLN A HG3  6  
ATOM 8278  H HE21 . GLN A 1 28  ? 15.354  -3.724  -5.273  1.00 0.00 ? 28  GLN A HE21 6  
ATOM 8279  H HE22 . GLN A 1 28  ? 16.679  -2.790  -4.675  1.00 0.00 ? 28  GLN A HE22 6  
ATOM 8280  N N    . LYS A 1 29  ? 12.197  -1.270  -1.809  1.00 0.00 ? 29  LYS A N    6  
ATOM 8281  C CA   . LYS A 1 29  ? 11.117  -0.428  -2.309  1.00 0.00 ? 29  LYS A CA   6  
ATOM 8282  C C    . LYS A 1 29  ? 10.695  -0.858  -3.710  1.00 0.00 ? 29  LYS A C    6  
ATOM 8283  O O    . LYS A 1 29  ? 9.510   -0.860  -4.038  1.00 0.00 ? 29  LYS A O    6  
ATOM 8284  C CB   . LYS A 1 29  ? 11.552  1.040   -2.323  1.00 0.00 ? 29  LYS A CB   6  
ATOM 8285  C CG   . LYS A 1 29  ? 12.216  1.490   -1.034  1.00 0.00 ? 29  LYS A CG   6  
ATOM 8286  C CD   . LYS A 1 29  ? 11.191  1.925   -0.001  1.00 0.00 ? 29  LYS A CD   6  
ATOM 8287  C CE   . LYS A 1 29  ? 11.755  1.853   1.410   1.00 0.00 ? 29  LYS A CE   6  
ATOM 8288  N NZ   . LYS A 1 29  ? 10.853  2.500   2.402   1.00 0.00 ? 29  LYS A NZ   6  
ATOM 8289  H H    . LYS A 1 29  ? 13.116  -0.926  -1.820  1.00 0.00 ? 29  LYS A H    6  
ATOM 8290  H HA   . LYS A 1 29  ? 10.275  -0.538  -1.643  1.00 0.00 ? 29  LYS A HA   6  
ATOM 8291  H HB2  . LYS A 1 29  ? 12.249  1.188   -3.134  1.00 0.00 ? 29  LYS A HB2  6  
ATOM 8292  H HB3  . LYS A 1 29  ? 10.682  1.658   -2.490  1.00 0.00 ? 29  LYS A HB3  6  
ATOM 8293  H HG2  . LYS A 1 29  ? 12.792  0.670   -0.631  1.00 0.00 ? 29  LYS A HG2  6  
ATOM 8294  H HG3  . LYS A 1 29  ? 12.872  2.321   -1.249  1.00 0.00 ? 29  LYS A HG3  6  
ATOM 8295  H HD2  . LYS A 1 29  ? 10.895  2.944   -0.206  1.00 0.00 ? 29  LYS A HD2  6  
ATOM 8296  H HD3  . LYS A 1 29  ? 10.328  1.278   -0.068  1.00 0.00 ? 29  LYS A HD3  6  
ATOM 8297  H HE2  . LYS A 1 29  ? 11.886  0.816   1.678   1.00 0.00 ? 29  LYS A HE2  6  
ATOM 8298  H HE3  . LYS A 1 29  ? 12.713  2.353   1.426   1.00 0.00 ? 29  LYS A HE3  6  
ATOM 8299  H HZ1  . LYS A 1 29  ? 10.678  3.490   2.133   1.00 0.00 ? 29  LYS A HZ1  6  
ATOM 8300  H HZ2  . LYS A 1 29  ? 11.289  2.482   3.346   1.00 0.00 ? 29  LYS A HZ2  6  
ATOM 8301  H HZ3  . LYS A 1 29  ? 9.945   1.997   2.442   1.00 0.00 ? 29  LYS A HZ3  6  
ATOM 8302  N N    . ASN A 1 30  ? 11.674  -1.222  -4.532  1.00 0.00 ? 30  ASN A N    6  
ATOM 8303  C CA   . ASN A 1 30  ? 11.403  -1.656  -5.898  1.00 0.00 ? 30  ASN A CA   6  
ATOM 8304  C C    . ASN A 1 30  ? 11.748  -3.131  -6.079  1.00 0.00 ? 30  ASN A C    6  
ATOM 8305  O O    . ASN A 1 30  ? 12.852  -3.490  -6.487  1.00 0.00 ? 30  ASN A O    6  
ATOM 8306  C CB   . ASN A 1 30  ? 12.201  -0.808  -6.891  1.00 0.00 ? 30  ASN A CB   6  
ATOM 8307  C CG   . ASN A 1 30  ? 11.872  0.668   -6.787  1.00 0.00 ? 30  ASN A CG   6  
ATOM 8308  O OD1  . ASN A 1 30  ? 10.809  1.111   -7.222  1.00 0.00 ? 30  ASN A OD1  6  
ATOM 8309  N ND2  . ASN A 1 30  ? 12.786  1.438   -6.208  1.00 0.00 ? 30  ASN A ND2  6  
ATOM 8310  H H    . ASN A 1 30  ? 12.600  -1.199  -4.213  1.00 0.00 ? 30  ASN A H    6  
ATOM 8311  H HA   . ASN A 1 30  ? 10.349  -1.518  -6.087  1.00 0.00 ? 30  ASN A HA   6  
ATOM 8312  H HB2  . ASN A 1 30  ? 13.256  -0.937  -6.698  1.00 0.00 ? 30  ASN A HB2  6  
ATOM 8313  H HB3  . ASN A 1 30  ? 11.981  -1.138  -7.896  1.00 0.00 ? 30  ASN A HB3  6  
ATOM 8314  H HD21 . ASN A 1 30  ? 13.609  1.017   -5.884  1.00 0.00 ? 30  ASN A HD21 6  
ATOM 8315  H HD22 . ASN A 1 30  ? 12.598  2.397   -6.126  1.00 0.00 ? 30  ASN A HD22 6  
ATOM 8316  N N    . PRO A 1 31  ? 10.780  -4.007  -5.770  1.00 0.00 ? 31  PRO A N    6  
ATOM 8317  C CA   . PRO A 1 31  ? 10.956  -5.457  -5.892  1.00 0.00 ? 31  PRO A CA   6  
ATOM 8318  C C    . PRO A 1 31  ? 11.038  -5.911  -7.345  1.00 0.00 ? 31  PRO A C    6  
ATOM 8319  O O    . PRO A 1 31  ? 10.274  -5.450  -8.193  1.00 0.00 ? 31  PRO A O    6  
ATOM 8320  C CB   . PRO A 1 31  ? 9.701   -6.024  -5.224  1.00 0.00 ? 31  PRO A CB   6  
ATOM 8321  C CG   . PRO A 1 31  ? 8.682   -4.945  -5.356  1.00 0.00 ? 31  PRO A CG   6  
ATOM 8322  C CD   . PRO A 1 31  ? 9.439   -3.649  -5.278  1.00 0.00 ? 31  PRO A CD   6  
ATOM 8323  H HA   . PRO A 1 31  ? 11.833  -5.796  -5.360  1.00 0.00 ? 31  PRO A HA   6  
ATOM 8324  H HB2  . PRO A 1 31  ? 9.393   -6.924  -5.737  1.00 0.00 ? 31  PRO A HB2  6  
ATOM 8325  H HB3  . PRO A 1 31  ? 9.909   -6.246  -4.188  1.00 0.00 ? 31  PRO A HB3  6  
ATOM 8326  H HG2  . PRO A 1 31  ? 8.179   -5.030  -6.307  1.00 0.00 ? 31  PRO A HG2  6  
ATOM 8327  H HG3  . PRO A 1 31  ? 7.970   -5.012  -4.546  1.00 0.00 ? 31  PRO A HG3  6  
ATOM 8328  H HD2  . PRO A 1 31  ? 8.981   -2.906  -5.914  1.00 0.00 ? 31  PRO A HD2  6  
ATOM 8329  H HD3  . PRO A 1 31  ? 9.484   -3.298  -4.258  1.00 0.00 ? 31  PRO A HD3  6  
ATOM 8330  N N    . SER A 1 32  ? 11.969  -6.817  -7.626  1.00 0.00 ? 32  SER A N    6  
ATOM 8331  C CA   . SER A 1 32  ? 12.152  -7.331  -8.978  1.00 0.00 ? 32  SER A CA   6  
ATOM 8332  C C    . SER A 1 32  ? 11.449  -8.674  -9.149  1.00 0.00 ? 32  SER A C    6  
ATOM 8333  O O    . SER A 1 32  ? 10.862  -9.206  -8.206  1.00 0.00 ? 32  SER A O    6  
ATOM 8334  C CB   . SER A 1 32  ? 13.642  -7.480  -9.292  1.00 0.00 ? 32  SER A CB   6  
ATOM 8335  O OG   . SER A 1 32  ? 14.228  -6.225  -9.591  1.00 0.00 ? 32  SER A OG   6  
ATOM 8336  H H    . SER A 1 32  ? 12.548  -7.146  -6.906  1.00 0.00 ? 32  SER A H    6  
ATOM 8337  H HA   . SER A 1 32  ? 11.718  -6.620  -9.665  1.00 0.00 ? 32  SER A HA   6  
ATOM 8338  H HB2  . SER A 1 32  ? 14.147  -7.905  -8.438  1.00 0.00 ? 32  SER A HB2  6  
ATOM 8339  H HB3  . SER A 1 32  ? 13.764  -8.133  -10.144 1.00 0.00 ? 32  SER A HB3  6  
ATOM 8340  H HG   . SER A 1 32  ? 13.562  -5.640  -9.958  1.00 0.00 ? 32  SER A HG   6  
ATOM 8341  N N    . LYS A 1 33  ? 11.511  -9.218  -10.360 1.00 0.00 ? 33  LYS A N    6  
ATOM 8342  C CA   . LYS A 1 33  ? 10.882  -10.499 -10.657 1.00 0.00 ? 33  LYS A CA   6  
ATOM 8343  C C    . LYS A 1 33  ? 10.974  -11.441 -9.461  1.00 0.00 ? 33  LYS A C    6  
ATOM 8344  O O    . LYS A 1 33  ? 9.991   -12.078 -9.085  1.00 0.00 ? 33  LYS A O    6  
ATOM 8345  C CB   . LYS A 1 33  ? 11.541  -11.143 -11.879 1.00 0.00 ? 33  LYS A CB   6  
ATOM 8346  C CG   . LYS A 1 33  ? 10.857  -12.419 -12.337 1.00 0.00 ? 33  LYS A CG   6  
ATOM 8347  C CD   . LYS A 1 33  ? 9.615   -12.123 -13.160 1.00 0.00 ? 33  LYS A CD   6  
ATOM 8348  C CE   . LYS A 1 33  ? 9.194   -13.328 -13.987 1.00 0.00 ? 33  LYS A CE   6  
ATOM 8349  N NZ   . LYS A 1 33  ? 10.187  -13.646 -15.050 1.00 0.00 ? 33  LYS A NZ   6  
ATOM 8350  H H    . LYS A 1 33  ? 11.993  -8.745  -11.071 1.00 0.00 ? 33  LYS A H    6  
ATOM 8351  H HA   . LYS A 1 33  ? 9.841   -10.315 -10.875 1.00 0.00 ? 33  LYS A HA   6  
ATOM 8352  H HB2  . LYS A 1 33  ? 11.523  -10.437 -12.696 1.00 0.00 ? 33  LYS A HB2  6  
ATOM 8353  H HB3  . LYS A 1 33  ? 12.568  -11.375 -11.638 1.00 0.00 ? 33  LYS A HB3  6  
ATOM 8354  H HG2  . LYS A 1 33  ? 11.548  -12.991 -12.940 1.00 0.00 ? 33  LYS A HG2  6  
ATOM 8355  H HG3  . LYS A 1 33  ? 10.573  -12.996 -11.468 1.00 0.00 ? 33  LYS A HG3  6  
ATOM 8356  H HD2  . LYS A 1 33  ? 8.807   -11.857 -12.494 1.00 0.00 ? 33  LYS A HD2  6  
ATOM 8357  H HD3  . LYS A 1 33  ? 9.823   -11.296 -13.825 1.00 0.00 ? 33  LYS A HD3  6  
ATOM 8358  H HE2  . LYS A 1 33  ? 9.094   -14.180 -13.332 1.00 0.00 ? 33  LYS A HE2  6  
ATOM 8359  H HE3  . LYS A 1 33  ? 8.240   -13.116 -14.448 1.00 0.00 ? 33  LYS A HE3  6  
ATOM 8360  H HZ1  . LYS A 1 33  ? 10.683  -14.531 -14.821 1.00 0.00 ? 33  LYS A HZ1  6  
ATOM 8361  H HZ2  . LYS A 1 33  ? 10.885  -12.880 -15.127 1.00 0.00 ? 33  LYS A HZ2  6  
ATOM 8362  H HZ3  . LYS A 1 33  ? 9.707   -13.758 -15.966 1.00 0.00 ? 33  LYS A HZ3  6  
ATOM 8363  N N    . GLU A 1 34  ? 12.161  -11.522 -8.868  1.00 0.00 ? 34  GLU A N    6  
ATOM 8364  C CA   . GLU A 1 34  ? 12.380  -12.387 -7.714  1.00 0.00 ? 34  GLU A CA   6  
ATOM 8365  C C    . GLU A 1 34  ? 11.580  -11.899 -6.510  1.00 0.00 ? 34  GLU A C    6  
ATOM 8366  O O    . GLU A 1 34  ? 10.736  -12.621 -5.979  1.00 0.00 ? 34  GLU A O    6  
ATOM 8367  C CB   . GLU A 1 34  ? 13.869  -12.440 -7.364  1.00 0.00 ? 34  GLU A CB   6  
ATOM 8368  C CG   . GLU A 1 34  ? 14.727  -13.067 -8.449  1.00 0.00 ? 34  GLU A CG   6  
ATOM 8369  C CD   . GLU A 1 34  ? 14.474  -14.554 -8.606  1.00 0.00 ? 34  GLU A CD   6  
ATOM 8370  O OE1  . GLU A 1 34  ? 15.108  -15.344 -7.874  1.00 0.00 ? 34  GLU A OE1  6  
ATOM 8371  O OE2  . GLU A 1 34  ? 13.644  -14.929 -9.460  1.00 0.00 ? 34  GLU A OE2  6  
ATOM 8372  H H    . GLU A 1 34  ? 12.907  -10.989 -9.214  1.00 0.00 ? 34  GLU A H    6  
ATOM 8373  H HA   . GLU A 1 34  ? 12.046  -13.379 -7.975  1.00 0.00 ? 34  GLU A HA   6  
ATOM 8374  H HB2  . GLU A 1 34  ? 14.222  -11.434 -7.190  1.00 0.00 ? 34  GLU A HB2  6  
ATOM 8375  H HB3  . GLU A 1 34  ? 13.992  -13.016 -6.459  1.00 0.00 ? 34  GLU A HB3  6  
ATOM 8376  H HG2  . GLU A 1 34  ? 14.511  -12.580 -9.388  1.00 0.00 ? 34  GLU A HG2  6  
ATOM 8377  H HG3  . GLU A 1 34  ? 15.767  -12.918 -8.199  1.00 0.00 ? 34  GLU A HG3  6  
ATOM 8378  N N    . GLU A 1 35  ? 11.853  -10.670 -6.084  1.00 0.00 ? 35  GLU A N    6  
ATOM 8379  C CA   . GLU A 1 35  ? 11.160  -10.087 -4.941  1.00 0.00 ? 35  GLU A CA   6  
ATOM 8380  C C    . GLU A 1 35  ? 9.647   -10.193 -5.110  1.00 0.00 ? 35  GLU A C    6  
ATOM 8381  O O    . GLU A 1 35  ? 8.968   -10.854 -4.324  1.00 0.00 ? 35  GLU A O    6  
ATOM 8382  C CB   . GLU A 1 35  ? 11.562  -8.621  -4.766  1.00 0.00 ? 35  GLU A CB   6  
ATOM 8383  C CG   . GLU A 1 35  ? 13.058  -8.417  -4.593  1.00 0.00 ? 35  GLU A CG   6  
ATOM 8384  C CD   . GLU A 1 35  ? 13.519  -8.655  -3.168  1.00 0.00 ? 35  GLU A CD   6  
ATOM 8385  O OE1  . GLU A 1 35  ? 13.032  -7.948  -2.262  1.00 0.00 ? 35  GLU A OE1  6  
ATOM 8386  O OE2  . GLU A 1 35  ? 14.366  -9.549  -2.960  1.00 0.00 ? 35  GLU A OE2  6  
ATOM 8387  H H    . GLU A 1 35  ? 12.536  -10.143 -6.548  1.00 0.00 ? 35  GLU A H    6  
ATOM 8388  H HA   . GLU A 1 35  ? 11.451  -10.638 -4.060  1.00 0.00 ? 35  GLU A HA   6  
ATOM 8389  H HB2  . GLU A 1 35  ? 11.242  -8.065  -5.634  1.00 0.00 ? 35  GLU A HB2  6  
ATOM 8390  H HB3  . GLU A 1 35  ? 11.064  -8.226  -3.893  1.00 0.00 ? 35  GLU A HB3  6  
ATOM 8391  H HG2  . GLU A 1 35  ? 13.579  -9.104  -5.243  1.00 0.00 ? 35  GLU A HG2  6  
ATOM 8392  H HG3  . GLU A 1 35  ? 13.305  -7.403  -4.871  1.00 0.00 ? 35  GLU A HG3  6  
ATOM 8393  N N    . ARG A 1 36  ? 9.125   -9.537  -6.142  1.00 0.00 ? 36  ARG A N    6  
ATOM 8394  C CA   . ARG A 1 36  ? 7.693   -9.556  -6.414  1.00 0.00 ? 36  ARG A CA   6  
ATOM 8395  C C    . ARG A 1 36  ? 7.157   -10.984 -6.406  1.00 0.00 ? 36  ARG A C    6  
ATOM 8396  O O    . ARG A 1 36  ? 6.132   -11.269 -5.787  1.00 0.00 ? 36  ARG A O    6  
ATOM 8397  C CB   . ARG A 1 36  ? 7.400   -8.897  -7.763  1.00 0.00 ? 36  ARG A CB   6  
ATOM 8398  C CG   . ARG A 1 36  ? 7.307   -7.381  -7.693  1.00 0.00 ? 36  ARG A CG   6  
ATOM 8399  C CD   . ARG A 1 36  ? 6.373   -6.831  -8.760  1.00 0.00 ? 36  ARG A CD   6  
ATOM 8400  N NE   . ARG A 1 36  ? 7.069   -6.576  -10.018 1.00 0.00 ? 36  ARG A NE   6  
ATOM 8401  C CZ   . ARG A 1 36  ? 7.846   -5.519  -10.227 1.00 0.00 ? 36  ARG A CZ   6  
ATOM 8402  N NH1  . ARG A 1 36  ? 8.025   -4.623  -9.267  1.00 0.00 ? 36  ARG A NH1  6  
ATOM 8403  N NH2  . ARG A 1 36  ? 8.446   -5.356  -11.400 1.00 0.00 ? 36  ARG A NH2  6  
ATOM 8404  H H    . ARG A 1 36  ? 9.717   -9.027  -6.734  1.00 0.00 ? 36  ARG A H    6  
ATOM 8405  H HA   . ARG A 1 36  ? 7.200   -8.995  -5.635  1.00 0.00 ? 36  ARG A HA   6  
ATOM 8406  H HB2  . ARG A 1 36  ? 8.187   -9.155  -8.456  1.00 0.00 ? 36  ARG A HB2  6  
ATOM 8407  H HB3  . ARG A 1 36  ? 6.462   -9.276  -8.139  1.00 0.00 ? 36  ARG A HB3  6  
ATOM 8408  H HG2  . ARG A 1 36  ? 6.932   -7.097  -6.721  1.00 0.00 ? 36  ARG A HG2  6  
ATOM 8409  H HG3  . ARG A 1 36  ? 8.292   -6.963  -7.838  1.00 0.00 ? 36  ARG A HG3  6  
ATOM 8410  H HD2  . ARG A 1 36  ? 5.585   -7.548  -8.935  1.00 0.00 ? 36  ARG A HD2  6  
ATOM 8411  H HD3  . ARG A 1 36  ? 5.945   -5.906  -8.402  1.00 0.00 ? 36  ARG A HD3  6  
ATOM 8412  H HE   . ARG A 1 36  ? 6.951   -7.225  -10.742 1.00 0.00 ? 36  ARG A HE   6  
ATOM 8413  H HH11 . ARG A 1 36  ? 7.574   -4.743  -8.382  1.00 0.00 ? 36  ARG A HH11 6  
ATOM 8414  H HH12 . ARG A 1 36  ? 8.611   -3.828  -9.426  1.00 0.00 ? 36  ARG A HH12 6  
ATOM 8415  H HH21 . ARG A 1 36  ? 8.314   -6.030  -12.126 1.00 0.00 ? 36  ARG A HH21 6  
ATOM 8416  H HH22 . ARG A 1 36  ? 9.030   -4.560  -11.556 1.00 0.00 ? 36  ARG A HH22 6  
ATOM 8417  N N    . GLU A 1 37  ? 7.857   -11.877 -7.099  1.00 0.00 ? 37  GLU A N    6  
ATOM 8418  C CA   . GLU A 1 37  ? 7.449   -13.276 -7.172  1.00 0.00 ? 37  GLU A CA   6  
ATOM 8419  C C    . GLU A 1 37  ? 7.229   -13.852 -5.777  1.00 0.00 ? 37  GLU A C    6  
ATOM 8420  O O    . GLU A 1 37  ? 6.204   -14.476 -5.506  1.00 0.00 ? 37  GLU A O    6  
ATOM 8421  C CB   . GLU A 1 37  ? 8.504   -14.099 -7.916  1.00 0.00 ? 37  GLU A CB   6  
ATOM 8422  C CG   . GLU A 1 37  ? 8.325   -14.096 -9.425  1.00 0.00 ? 37  GLU A CG   6  
ATOM 8423  C CD   . GLU A 1 37  ? 7.425   -15.217 -9.908  1.00 0.00 ? 37  GLU A CD   6  
ATOM 8424  O OE1  . GLU A 1 37  ? 6.189   -15.050 -9.857  1.00 0.00 ? 37  GLU A OE1  6  
ATOM 8425  O OE2  . GLU A 1 37  ? 7.958   -16.261 -10.337 1.00 0.00 ? 37  GLU A OE2  6  
ATOM 8426  H H    . GLU A 1 37  ? 8.665   -11.589 -7.572  1.00 0.00 ? 37  GLU A H    6  
ATOM 8427  H HA   . GLU A 1 37  ? 6.519   -13.322 -7.719  1.00 0.00 ? 37  GLU A HA   6  
ATOM 8428  H HB2  . GLU A 1 37  ? 9.481   -13.699 -7.688  1.00 0.00 ? 37  GLU A HB2  6  
ATOM 8429  H HB3  . GLU A 1 37  ? 8.453   -15.121 -7.571  1.00 0.00 ? 37  GLU A HB3  6  
ATOM 8430  H HG2  . GLU A 1 37  ? 7.890   -13.153 -9.721  1.00 0.00 ? 37  GLU A HG2  6  
ATOM 8431  H HG3  . GLU A 1 37  ? 9.294   -14.206 -9.889  1.00 0.00 ? 37  GLU A HG3  6  
ATOM 8432  N N    . ALA A 1 38  ? 8.200   -13.639 -4.895  1.00 0.00 ? 38  ALA A N    6  
ATOM 8433  C CA   . ALA A 1 38  ? 8.113   -14.136 -3.527  1.00 0.00 ? 38  ALA A CA   6  
ATOM 8434  C C    . ALA A 1 38  ? 6.819   -13.681 -2.860  1.00 0.00 ? 38  ALA A C    6  
ATOM 8435  O O    . ALA A 1 38  ? 6.366   -14.284 -1.886  1.00 0.00 ? 38  ALA A O    6  
ATOM 8436  C CB   . ALA A 1 38  ? 9.317   -13.673 -2.720  1.00 0.00 ? 38  ALA A CB   6  
ATOM 8437  H H    . ALA A 1 38  ? 8.994   -13.134 -5.171  1.00 0.00 ? 38  ALA A H    6  
ATOM 8438  H HA   . ALA A 1 38  ? 8.128   -15.215 -3.563  1.00 0.00 ? 38  ALA A HA   6  
ATOM 8439  H HB1  . ALA A 1 38  ? 10.143  -14.348 -2.888  1.00 0.00 ? 38  ALA A HB1  6  
ATOM 8440  H HB2  . ALA A 1 38  ? 9.596   -12.677 -3.030  1.00 0.00 ? 38  ALA A HB2  6  
ATOM 8441  H HB3  . ALA A 1 38  ? 9.065   -13.667 -1.670  1.00 0.00 ? 38  ALA A HB3  6  
ATOM 8442  N N    . LEU A 1 39  ? 6.229   -12.615 -3.389  1.00 0.00 ? 39  LEU A N    6  
ATOM 8443  C CA   . LEU A 1 39  ? 4.987   -12.078 -2.843  1.00 0.00 ? 39  LEU A CA   6  
ATOM 8444  C C    . LEU A 1 39  ? 3.779   -12.648 -3.579  1.00 0.00 ? 39  LEU A C    6  
ATOM 8445  O O    . LEU A 1 39  ? 2.668   -12.668 -3.049  1.00 0.00 ? 39  LEU A O    6  
ATOM 8446  C CB   . LEU A 1 39  ? 4.983   -10.552 -2.938  1.00 0.00 ? 39  LEU A CB   6  
ATOM 8447  C CG   . LEU A 1 39  ? 6.292   -9.853  -2.571  1.00 0.00 ? 39  LEU A CG   6  
ATOM 8448  C CD1  . LEU A 1 39  ? 6.110   -8.343  -2.572  1.00 0.00 ? 39  LEU A CD1  6  
ATOM 8449  C CD2  . LEU A 1 39  ? 6.790   -10.331 -1.215  1.00 0.00 ? 39  LEU A CD2  6  
ATOM 8450  H H    . LEU A 1 39  ? 6.638   -12.177 -4.164  1.00 0.00 ? 39  LEU A H    6  
ATOM 8451  H HA   . LEU A 1 39  ? 4.930   -12.367 -1.804  1.00 0.00 ? 39  LEU A HA   6  
ATOM 8452  H HB2  . LEU A 1 39  ? 4.739   -10.284 -3.954  1.00 0.00 ? 39  LEU A HB2  6  
ATOM 8453  H HB3  . LEU A 1 39  ? 4.213   -10.182 -2.276  1.00 0.00 ? 39  LEU A HB3  6  
ATOM 8454  H HG   . LEU A 1 39  ? 7.043   -10.098 -3.309  1.00 0.00 ? 39  LEU A HG   6  
ATOM 8455  H HD11 . LEU A 1 39  ? 6.398   -7.946  -3.533  1.00 0.00 ? 39  LEU A HD11 6  
ATOM 8456  H HD12 . LEU A 1 39  ? 6.729   -7.905  -1.802  1.00 0.00 ? 39  LEU A HD12 6  
ATOM 8457  H HD13 . LEU A 1 39  ? 5.074   -8.106  -2.379  1.00 0.00 ? 39  LEU A HD13 6  
ATOM 8458  H HD21 . LEU A 1 39  ? 6.611   -11.392 -1.120  1.00 0.00 ? 39  LEU A HD21 6  
ATOM 8459  H HD22 . LEU A 1 39  ? 6.262   -9.806  -0.432  1.00 0.00 ? 39  LEU A HD22 6  
ATOM 8460  H HD23 . LEU A 1 39  ? 7.849   -10.135 -1.130  1.00 0.00 ? 39  LEU A HD23 6  
ATOM 8461  N N    . VAL A 1 40  ? 4.003   -13.114 -4.804  1.00 0.00 ? 40  VAL A N    6  
ATOM 8462  C CA   . VAL A 1 40  ? 2.934   -13.687 -5.612  1.00 0.00 ? 40  VAL A CA   6  
ATOM 8463  C C    . VAL A 1 40  ? 2.553   -15.076 -5.113  1.00 0.00 ? 40  VAL A C    6  
ATOM 8464  O O    . VAL A 1 40  ? 1.379   -15.445 -5.111  1.00 0.00 ? 40  VAL A O    6  
ATOM 8465  C CB   . VAL A 1 40  ? 3.339   -13.780 -7.095  1.00 0.00 ? 40  VAL A CB   6  
ATOM 8466  C CG1  . VAL A 1 40  ? 2.330   -14.610 -7.874  1.00 0.00 ? 40  VAL A CG1  6  
ATOM 8467  C CG2  . VAL A 1 40  ? 3.477   -12.390 -7.697  1.00 0.00 ? 40  VAL A CG2  6  
ATOM 8468  H H    . VAL A 1 40  ? 4.910   -13.071 -5.173  1.00 0.00 ? 40  VAL A H    6  
ATOM 8469  H HA   . VAL A 1 40  ? 2.073   -13.039 -5.536  1.00 0.00 ? 40  VAL A HA   6  
ATOM 8470  H HB   . VAL A 1 40  ? 4.299   -14.272 -7.155  1.00 0.00 ? 40  VAL A HB   6  
ATOM 8471  H HG11 . VAL A 1 40  ? 1.332   -14.255 -7.661  1.00 0.00 ? 40  VAL A HG11 6  
ATOM 8472  H HG12 . VAL A 1 40  ? 2.528   -14.519 -8.932  1.00 0.00 ? 40  VAL A HG12 6  
ATOM 8473  H HG13 . VAL A 1 40  ? 2.412   -15.646 -7.579  1.00 0.00 ? 40  VAL A HG13 6  
ATOM 8474  H HG21 . VAL A 1 40  ? 2.495   -11.978 -7.877  1.00 0.00 ? 40  VAL A HG21 6  
ATOM 8475  H HG22 . VAL A 1 40  ? 4.016   -11.752 -7.012  1.00 0.00 ? 40  VAL A HG22 6  
ATOM 8476  H HG23 . VAL A 1 40  ? 4.017   -12.453 -8.630  1.00 0.00 ? 40  VAL A HG23 6  
ATOM 8477  N N    . GLU A 1 41  ? 3.553   -15.842 -4.689  1.00 0.00 ? 41  GLU A N    6  
ATOM 8478  C CA   . GLU A 1 41  ? 3.322   -17.192 -4.187  1.00 0.00 ? 41  GLU A CA   6  
ATOM 8479  C C    . GLU A 1 41  ? 3.010   -17.171 -2.694  1.00 0.00 ? 41  GLU A C    6  
ATOM 8480  O O    . GLU A 1 41  ? 2.111   -17.870 -2.228  1.00 0.00 ? 41  GLU A O    6  
ATOM 8481  C CB   . GLU A 1 41  ? 4.543   -18.074 -4.451  1.00 0.00 ? 41  GLU A CB   6  
ATOM 8482  C CG   . GLU A 1 41  ? 5.827   -17.537 -3.841  1.00 0.00 ? 41  GLU A CG   6  
ATOM 8483  C CD   . GLU A 1 41  ? 7.024   -18.423 -4.125  1.00 0.00 ? 41  GLU A CD   6  
ATOM 8484  O OE1  . GLU A 1 41  ? 7.465   -18.469 -5.292  1.00 0.00 ? 41  GLU A OE1  6  
ATOM 8485  O OE2  . GLU A 1 41  ? 7.520   -19.070 -3.179  1.00 0.00 ? 41  GLU A OE2  6  
ATOM 8486  H H    . GLU A 1 41  ? 4.468   -15.492 -4.715  1.00 0.00 ? 41  GLU A H    6  
ATOM 8487  H HA   . GLU A 1 41  ? 2.473   -17.600 -4.714  1.00 0.00 ? 41  GLU A HA   6  
ATOM 8488  H HB2  . GLU A 1 41  ? 4.358   -19.057 -4.042  1.00 0.00 ? 41  GLU A HB2  6  
ATOM 8489  H HB3  . GLU A 1 41  ? 4.686   -18.160 -5.519  1.00 0.00 ? 41  GLU A HB3  6  
ATOM 8490  H HG2  . GLU A 1 41  ? 6.020   -16.555 -4.248  1.00 0.00 ? 41  GLU A HG2  6  
ATOM 8491  H HG3  . GLU A 1 41  ? 5.698   -17.462 -2.771  1.00 0.00 ? 41  GLU A HG3  6  
ATOM 8492  N N    . GLU A 1 42  ? 3.759   -16.363 -1.949  1.00 0.00 ? 42  GLU A N    6  
ATOM 8493  C CA   . GLU A 1 42  ? 3.563   -16.252 -0.509  1.00 0.00 ? 42  GLU A CA   6  
ATOM 8494  C C    . GLU A 1 42  ? 2.135   -15.821 -0.186  1.00 0.00 ? 42  GLU A C    6  
ATOM 8495  O O    . GLU A 1 42  ? 1.484   -16.397 0.686   1.00 0.00 ? 42  GLU A O    6  
ATOM 8496  C CB   . GLU A 1 42  ? 4.557   -15.254 0.088   1.00 0.00 ? 42  GLU A CB   6  
ATOM 8497  C CG   . GLU A 1 42  ? 4.443   -15.110 1.597   1.00 0.00 ? 42  GLU A CG   6  
ATOM 8498  C CD   . GLU A 1 42  ? 5.028   -16.294 2.341   1.00 0.00 ? 42  GLU A CD   6  
ATOM 8499  O OE1  . GLU A 1 42  ? 4.636   -17.440 2.037   1.00 0.00 ? 42  GLU A OE1  6  
ATOM 8500  O OE2  . GLU A 1 42  ? 5.879   -16.074 3.229   1.00 0.00 ? 42  GLU A OE2  6  
ATOM 8501  H H    . GLU A 1 42  ? 4.460   -15.830 -2.379  1.00 0.00 ? 42  GLU A H    6  
ATOM 8502  H HA   . GLU A 1 42  ? 3.739   -17.225 -0.074  1.00 0.00 ? 42  GLU A HA   6  
ATOM 8503  H HB2  . GLU A 1 42  ? 5.560   -15.578 -0.148  1.00 0.00 ? 42  GLU A HB2  6  
ATOM 8504  H HB3  . GLU A 1 42  ? 4.387   -14.285 -0.358  1.00 0.00 ? 42  GLU A HB3  6  
ATOM 8505  H HG2  . GLU A 1 42  ? 4.969   -14.217 1.901   1.00 0.00 ? 42  GLU A HG2  6  
ATOM 8506  H HG3  . GLU A 1 42  ? 3.400   -15.018 1.859   1.00 0.00 ? 42  GLU A HG3  6  
ATOM 8507  N N    . CYS A 1 43  ? 1.657   -14.803 -0.893  1.00 0.00 ? 43  CYS A N    6  
ATOM 8508  C CA   . CYS A 1 43  ? 0.307   -14.292 -0.681  1.00 0.00 ? 43  CYS A CA   6  
ATOM 8509  C C    . CYS A 1 43  ? -0.734  -15.365 -0.984  1.00 0.00 ? 43  CYS A C    6  
ATOM 8510  O O    . CYS A 1 43  ? -1.431  -15.838 -0.087  1.00 0.00 ? 43  CYS A O    6  
ATOM 8511  C CB   . CYS A 1 43  ? 0.061   -13.064 -1.558  1.00 0.00 ? 43  CYS A CB   6  
ATOM 8512  S SG   . CYS A 1 43  ? 0.845   -11.553 -0.949  1.00 0.00 ? 43  CYS A SG   6  
ATOM 8513  H H    . CYS A 1 43  ? 2.225   -14.385 -1.574  1.00 0.00 ? 43  CYS A H    6  
ATOM 8514  H HA   . CYS A 1 43  ? 0.221   -14.007 0.356   1.00 0.00 ? 43  CYS A HA   6  
ATOM 8515  H HB2  . CYS A 1 43  ? 0.446   -13.255 -2.549  1.00 0.00 ? 43  CYS A HB2  6  
ATOM 8516  H HB3  . CYS A 1 43  ? -1.002  -12.882 -1.620  1.00 0.00 ? 43  CYS A HB3  6  
ATOM 8517  H HG   . CYS A 1 43  ? 1.994   -11.402 -1.589  1.00 0.00 ? 43  CYS A HG   6  
ATOM 8518  N N    . ASN A 1 44  ? -0.834  -15.743 -2.254  1.00 0.00 ? 44  ASN A N    6  
ATOM 8519  C CA   . ASN A 1 44  ? -1.792  -16.759 -2.676  1.00 0.00 ? 44  ASN A CA   6  
ATOM 8520  C C    . ASN A 1 44  ? -1.764  -17.958 -1.733  1.00 0.00 ? 44  ASN A C    6  
ATOM 8521  O O    . ASN A 1 44  ? -2.796  -18.573 -1.463  1.00 0.00 ? 44  ASN A O    6  
ATOM 8522  C CB   . ASN A 1 44  ? -1.489  -17.213 -4.105  1.00 0.00 ? 44  ASN A CB   6  
ATOM 8523  C CG   . ASN A 1 44  ? -2.108  -16.300 -5.145  1.00 0.00 ? 44  ASN A CG   6  
ATOM 8524  O OD1  . ASN A 1 44  ? -3.249  -15.859 -5.000  1.00 0.00 ? 44  ASN A OD1  6  
ATOM 8525  N ND2  . ASN A 1 44  ? -1.357  -16.011 -6.202  1.00 0.00 ? 44  ASN A ND2  6  
ATOM 8526  H H    . ASN A 1 44  ? -0.250  -15.330 -2.924  1.00 0.00 ? 44  ASN A H    6  
ATOM 8527  H HA   . ASN A 1 44  ? -2.776  -16.317 -2.649  1.00 0.00 ? 44  ASN A HA   6  
ATOM 8528  H HB2  . ASN A 1 44  ? -0.419  -17.223 -4.254  1.00 0.00 ? 44  ASN A HB2  6  
ATOM 8529  H HB3  . ASN A 1 44  ? -1.878  -18.210 -4.250  1.00 0.00 ? 44  ASN A HB3  6  
ATOM 8530  H HD21 . ASN A 1 44  ? -0.458  -16.399 -6.251  1.00 0.00 ? 44  ASN A HD21 6  
ATOM 8531  H HD22 . ASN A 1 44  ? -1.733  -15.423 -6.889  1.00 0.00 ? 44  ASN A HD22 6  
ATOM 8532  N N    . ARG A 1 45  ? -0.576  -18.284 -1.234  1.00 0.00 ? 45  ARG A N    6  
ATOM 8533  C CA   . ARG A 1 45  ? -0.413  -19.409 -0.321  1.00 0.00 ? 45  ARG A CA   6  
ATOM 8534  C C    . ARG A 1 45  ? -1.104  -19.133 1.011   1.00 0.00 ? 45  ARG A C    6  
ATOM 8535  O O    . ARG A 1 45  ? -1.972  -19.892 1.440   1.00 0.00 ? 45  ARG A O    6  
ATOM 8536  C CB   . ARG A 1 45  ? 1.072   -19.694 -0.089  1.00 0.00 ? 45  ARG A CB   6  
ATOM 8537  C CG   . ARG A 1 45  ? 1.335   -20.658 1.057   1.00 0.00 ? 45  ARG A CG   6  
ATOM 8538  C CD   . ARG A 1 45  ? 2.770   -20.557 1.550   1.00 0.00 ? 45  ARG A CD   6  
ATOM 8539  N NE   . ARG A 1 45  ? 3.663   -21.455 0.822   1.00 0.00 ? 45  ARG A NE   6  
ATOM 8540  C CZ   . ARG A 1 45  ? 3.764   -22.755 1.074   1.00 0.00 ? 45  ARG A CZ   6  
ATOM 8541  N NH1  . ARG A 1 45  ? 3.030   -23.307 2.031   1.00 0.00 ? 45  ARG A NH1  6  
ATOM 8542  N NH2  . ARG A 1 45  ? 4.599   -23.506 0.368   1.00 0.00 ? 45  ARG A NH2  6  
ATOM 8543  H H    . ARG A 1 45  ? 0.210   -17.756 -1.486  1.00 0.00 ? 45  ARG A H    6  
ATOM 8544  H HA   . ARG A 1 45  ? -0.870  -20.275 -0.777  1.00 0.00 ? 45  ARG A HA   6  
ATOM 8545  H HB2  . ARG A 1 45  ? 1.491   -20.119 -0.990  1.00 0.00 ? 45  ARG A HB2  6  
ATOM 8546  H HB3  . ARG A 1 45  ? 1.575   -18.764 0.128   1.00 0.00 ? 45  ARG A HB3  6  
ATOM 8547  H HG2  . ARG A 1 45  ? 0.668   -20.422 1.873   1.00 0.00 ? 45  ARG A HG2  6  
ATOM 8548  H HG3  . ARG A 1 45  ? 1.150   -21.666 0.717   1.00 0.00 ? 45  ARG A HG3  6  
ATOM 8549  H HD2  . ARG A 1 45  ? 3.112   -19.542 1.420   1.00 0.00 ? 45  ARG A HD2  6  
ATOM 8550  H HD3  . ARG A 1 45  ? 2.794   -20.813 2.599   1.00 0.00 ? 45  ARG A HD3  6  
ATOM 8551  H HE   . ARG A 1 45  ? 4.214   -21.068 0.111   1.00 0.00 ? 45  ARG A HE   6  
ATOM 8552  H HH11 . ARG A 1 45  ? 2.399   -22.744 2.563   1.00 0.00 ? 45  ARG A HH11 6  
ATOM 8553  H HH12 . ARG A 1 45  ? 3.107   -24.287 2.218   1.00 0.00 ? 45  ARG A HH12 6  
ATOM 8554  H HH21 . ARG A 1 45  ? 5.154   -23.094 -0.354  1.00 0.00 ? 45  ARG A HH21 6  
ATOM 8555  H HH22 . ARG A 1 45  ? 4.675   -24.484 0.558   1.00 0.00 ? 45  ARG A HH22 6  
ATOM 8556  N N    . ALA A 1 46  ? -0.710  -18.043 1.661   1.00 0.00 ? 46  ALA A N    6  
ATOM 8557  C CA   . ALA A 1 46  ? -1.292  -17.666 2.943   1.00 0.00 ? 46  ALA A CA   6  
ATOM 8558  C C    . ALA A 1 46  ? -2.804  -17.506 2.834   1.00 0.00 ? 46  ALA A C    6  
ATOM 8559  O O    . ALA A 1 46  ? -3.550  -17.976 3.692   1.00 0.00 ? 46  ALA A O    6  
ATOM 8560  C CB   . ALA A 1 46  ? -0.659  -16.380 3.452   1.00 0.00 ? 46  ALA A CB   6  
ATOM 8561  H H    . ALA A 1 46  ? -0.013  -17.478 1.267   1.00 0.00 ? 46  ALA A H    6  
ATOM 8562  H HA   . ALA A 1 46  ? -1.073  -18.451 3.652   1.00 0.00 ? 46  ALA A HA   6  
ATOM 8563  H HB1  . ALA A 1 46  ? -0.072  -16.593 4.334   1.00 0.00 ? 46  ALA A HB1  6  
ATOM 8564  H HB2  . ALA A 1 46  ? -0.020  -15.965 2.686   1.00 0.00 ? 46  ALA A HB2  6  
ATOM 8565  H HB3  . ALA A 1 46  ? -1.434  -15.670 3.698   1.00 0.00 ? 46  ALA A HB3  6  
ATOM 8566  N N    . GLU A 1 47  ? -3.249  -16.840 1.773   1.00 0.00 ? 47  GLU A N    6  
ATOM 8567  C CA   . GLU A 1 47  ? -4.674  -16.617 1.554   1.00 0.00 ? 47  GLU A CA   6  
ATOM 8568  C C    . GLU A 1 47  ? -5.451  -17.926 1.660   1.00 0.00 ? 47  GLU A C    6  
ATOM 8569  O O    . GLU A 1 47  ? -6.518  -17.979 2.274   1.00 0.00 ? 47  GLU A O    6  
ATOM 8570  C CB   . GLU A 1 47  ? -4.908  -15.982 0.182   1.00 0.00 ? 47  GLU A CB   6  
ATOM 8571  C CG   . GLU A 1 47  ? -4.326  -14.585 0.051   1.00 0.00 ? 47  GLU A CG   6  
ATOM 8572  C CD   . GLU A 1 47  ? -5.095  -13.722 -0.931  1.00 0.00 ? 47  GLU A CD   6  
ATOM 8573  O OE1  . GLU A 1 47  ? -6.319  -13.558 -0.743  1.00 0.00 ? 47  GLU A OE1  6  
ATOM 8574  O OE2  . GLU A 1 47  ? -4.474  -13.211 -1.886  1.00 0.00 ? 47  GLU A OE2  6  
ATOM 8575  H H    . GLU A 1 47  ? -2.605  -16.489 1.123   1.00 0.00 ? 47  GLU A H    6  
ATOM 8576  H HA   . GLU A 1 47  ? -5.025  -15.941 2.318   1.00 0.00 ? 47  GLU A HA   6  
ATOM 8577  H HB2  . GLU A 1 47  ? -4.460  -16.610 -0.574  1.00 0.00 ? 47  GLU A HB2  6  
ATOM 8578  H HB3  . GLU A 1 47  ? -5.972  -15.924 0.003   1.00 0.00 ? 47  GLU A HB3  6  
ATOM 8579  H HG2  . GLU A 1 47  ? -4.347  -14.107 1.019   1.00 0.00 ? 47  GLU A HG2  6  
ATOM 8580  H HG3  . GLU A 1 47  ? -3.303  -14.665 -0.287  1.00 0.00 ? 47  GLU A HG3  6  
ATOM 8581  N N    . CYS A 1 48  ? -4.911  -18.979 1.057   1.00 0.00 ? 48  CYS A N    6  
ATOM 8582  C CA   . CYS A 1 48  ? -5.554  -20.288 1.082   1.00 0.00 ? 48  CYS A CA   6  
ATOM 8583  C C    . CYS A 1 48  ? -5.608  -20.840 2.503   1.00 0.00 ? 48  CYS A C    6  
ATOM 8584  O O    . CYS A 1 48  ? -6.606  -21.435 2.912   1.00 0.00 ? 48  CYS A O    6  
ATOM 8585  C CB   . CYS A 1 48  ? -4.807  -21.263 0.171   1.00 0.00 ? 48  CYS A CB   6  
ATOM 8586  S SG   . CYS A 1 48  ? -5.189  -21.070 -1.586  1.00 0.00 ? 48  CYS A SG   6  
ATOM 8587  H H    . CYS A 1 48  ? -4.059  -18.874 0.584   1.00 0.00 ? 48  CYS A H    6  
ATOM 8588  H HA   . CYS A 1 48  ? -6.562  -20.168 0.718   1.00 0.00 ? 48  CYS A HA   6  
ATOM 8589  H HB2  . CYS A 1 48  ? -3.744  -21.117 0.293   1.00 0.00 ? 48  CYS A HB2  6  
ATOM 8590  H HB3  . CYS A 1 48  ? -5.060  -22.274 0.454   1.00 0.00 ? 48  CYS A HB3  6  
ATOM 8591  H HG   . CYS A 1 48  ? -4.059  -20.797 -2.221  1.00 0.00 ? 48  CYS A HG   6  
ATOM 8592  N N    . LEU A 1 49  ? -4.527  -20.642 3.250   1.00 0.00 ? 49  LEU A N    6  
ATOM 8593  C CA   . LEU A 1 49  ? -4.450  -21.122 4.626   1.00 0.00 ? 49  LEU A CA   6  
ATOM 8594  C C    . LEU A 1 49  ? -5.511  -20.454 5.496   1.00 0.00 ? 49  LEU A C    6  
ATOM 8595  O O    . LEU A 1 49  ? -6.343  -21.129 6.102   1.00 0.00 ? 49  LEU A O    6  
ATOM 8596  C CB   . LEU A 1 49  ? -3.059  -20.854 5.203   1.00 0.00 ? 49  LEU A CB   6  
ATOM 8597  C CG   . LEU A 1 49  ? -1.878  -21.209 4.299   1.00 0.00 ? 49  LEU A CG   6  
ATOM 8598  C CD1  . LEU A 1 49  ? -0.613  -21.396 5.123   1.00 0.00 ? 49  LEU A CD1  6  
ATOM 8599  C CD2  . LEU A 1 49  ? -2.181  -22.464 3.494   1.00 0.00 ? 49  LEU A CD2  6  
ATOM 8600  H H    . LEU A 1 49  ? -3.763  -20.162 2.869   1.00 0.00 ? 49  LEU A H    6  
ATOM 8601  H HA   . LEU A 1 49  ? -4.628  -22.187 4.616   1.00 0.00 ? 49  LEU A HA   6  
ATOM 8602  H HB2  . LEU A 1 49  ? -2.994  -19.802 5.433   1.00 0.00 ? 49  LEU A HB2  6  
ATOM 8603  H HB3  . LEU A 1 49  ? -2.964  -21.427 6.114   1.00 0.00 ? 49  LEU A HB3  6  
ATOM 8604  H HG   . LEU A 1 49  ? -1.707  -20.398 3.605   1.00 0.00 ? 49  LEU A HG   6  
ATOM 8605  H HD11 . LEU A 1 49  ? -0.844  -21.271 6.170   1.00 0.00 ? 49  LEU A HD11 6  
ATOM 8606  H HD12 . LEU A 1 49  ? 0.121   -20.661 4.826   1.00 0.00 ? 49  LEU A HD12 6  
ATOM 8607  H HD13 . LEU A 1 49  ? -0.218  -22.387 4.956   1.00 0.00 ? 49  LEU A HD13 6  
ATOM 8608  H HD21 . LEU A 1 49  ? -2.556  -23.233 4.153   1.00 0.00 ? 49  LEU A HD21 6  
ATOM 8609  H HD22 . LEU A 1 49  ? -1.278  -22.811 3.013   1.00 0.00 ? 49  LEU A HD22 6  
ATOM 8610  H HD23 . LEU A 1 49  ? -2.925  -22.239 2.744   1.00 0.00 ? 49  LEU A HD23 6  
ATOM 8611  N N    . GLN A 1 50  ? -5.476  -19.127 5.549   1.00 0.00 ? 50  GLN A N    6  
ATOM 8612  C CA   . GLN A 1 50  ? -6.436  -18.369 6.343   1.00 0.00 ? 50  GLN A CA   6  
ATOM 8613  C C    . GLN A 1 50  ? -7.865  -18.685 5.917   1.00 0.00 ? 50  GLN A C    6  
ATOM 8614  O O    . GLN A 1 50  ? -8.758  -18.817 6.754   1.00 0.00 ? 50  GLN A O    6  
ATOM 8615  C CB   . GLN A 1 50  ? -6.170  -16.869 6.208   1.00 0.00 ? 50  GLN A CB   6  
ATOM 8616  C CG   . GLN A 1 50  ? -6.418  -16.331 4.807   1.00 0.00 ? 50  GLN A CG   6  
ATOM 8617  C CD   . GLN A 1 50  ? -6.152  -14.843 4.698   1.00 0.00 ? 50  GLN A CD   6  
ATOM 8618  O OE1  . GLN A 1 50  ? -7.064  -14.026 4.829   1.00 0.00 ? 50  GLN A OE1  6  
ATOM 8619  N NE2  . GLN A 1 50  ? -4.897  -14.482 4.456   1.00 0.00 ? 50  GLN A NE2  6  
ATOM 8620  H H    . GLN A 1 50  ? -4.789  -18.646 5.043   1.00 0.00 ? 50  GLN A H    6  
ATOM 8621  H HA   . GLN A 1 50  ? -6.310  -18.656 7.376   1.00 0.00 ? 50  GLN A HA   6  
ATOM 8622  H HB2  . GLN A 1 50  ? -6.813  -16.338 6.893   1.00 0.00 ? 50  GLN A HB2  6  
ATOM 8623  H HB3  . GLN A 1 50  ? -5.140  -16.673 6.467   1.00 0.00 ? 50  GLN A HB3  6  
ATOM 8624  H HG2  . GLN A 1 50  ? -5.769  -16.849 4.117   1.00 0.00 ? 50  GLN A HG2  6  
ATOM 8625  H HG3  . GLN A 1 50  ? -7.448  -16.519 4.541   1.00 0.00 ? 50  GLN A HG3  6  
ATOM 8626  H HE21 . GLN A 1 50  ? -4.223  -15.188 4.362   1.00 0.00 ? 50  GLN A HE21 6  
ATOM 8627  H HE22 . GLN A 1 50  ? -4.697  -13.527 4.380   1.00 0.00 ? 50  GLN A HE22 6  
ATOM 8628  N N    . ARG A 1 51  ? -8.075  -18.806 4.610   1.00 0.00 ? 51  ARG A N    6  
ATOM 8629  C CA   . ARG A 1 51  ? -9.396  -19.105 4.072   1.00 0.00 ? 51  ARG A CA   6  
ATOM 8630  C C    . ARG A 1 51  ? -9.695  -20.598 4.163   1.00 0.00 ? 51  ARG A C    6  
ATOM 8631  O O    . ARG A 1 51  ? -10.721 -21.068 3.673   1.00 0.00 ? 51  ARG A O    6  
ATOM 8632  C CB   . ARG A 1 51  ? -9.495  -18.642 2.617   1.00 0.00 ? 51  ARG A CB   6  
ATOM 8633  C CG   . ARG A 1 51  ? -9.763  -17.153 2.469   1.00 0.00 ? 51  ARG A CG   6  
ATOM 8634  C CD   . ARG A 1 51  ? -9.452  -16.669 1.061   1.00 0.00 ? 51  ARG A CD   6  
ATOM 8635  N NE   . ARG A 1 51  ? -9.872  -15.287 0.852   1.00 0.00 ? 51  ARG A NE   6  
ATOM 8636  C CZ   . ARG A 1 51  ? -9.230  -14.239 1.356   1.00 0.00 ? 51  ARG A CZ   6  
ATOM 8637  N NH1  . ARG A 1 51  ? -8.142  -14.416 2.093   1.00 0.00 ? 51  ARG A NH1  6  
ATOM 8638  N NH2  . ARG A 1 51  ? -9.674  -13.011 1.122   1.00 0.00 ? 51  ARG A NH2  6  
ATOM 8639  H H    . ARG A 1 51  ? -7.323  -18.690 3.992   1.00 0.00 ? 51  ARG A H    6  
ATOM 8640  H HA   . ARG A 1 51  ? -10.124 -18.568 4.662   1.00 0.00 ? 51  ARG A HA   6  
ATOM 8641  H HB2  . ARG A 1 51  ? -8.567  -18.871 2.115   1.00 0.00 ? 51  ARG A HB2  6  
ATOM 8642  H HB3  . ARG A 1 51  ? -10.298 -19.180 2.135   1.00 0.00 ? 51  ARG A HB3  6  
ATOM 8643  H HG2  . ARG A 1 51  ? -10.804 -16.961 2.682   1.00 0.00 ? 51  ARG A HG2  6  
ATOM 8644  H HG3  . ARG A 1 51  ? -9.144  -16.614 3.171   1.00 0.00 ? 51  ARG A HG3  6  
ATOM 8645  H HD2  . ARG A 1 51  ? -8.387  -16.740 0.897   1.00 0.00 ? 51  ARG A HD2  6  
ATOM 8646  H HD3  . ARG A 1 51  ? -9.967  -17.303 0.355   1.00 0.00 ? 51  ARG A HD3  6  
ATOM 8647  H HE   . ARG A 1 51  ? -10.674 -15.133 0.310   1.00 0.00 ? 51  ARG A HE   6  
ATOM 8648  H HH11 . ARG A 1 51  ? -7.804  -15.340 2.271   1.00 0.00 ? 51  ARG A HH11 6  
ATOM 8649  H HH12 . ARG A 1 51  ? -7.659  -13.625 2.471   1.00 0.00 ? 51  ARG A HH12 6  
ATOM 8650  H HH21 . ARG A 1 51  ? -10.493 -12.873 0.566   1.00 0.00 ? 51  ARG A HH21 6  
ATOM 8651  H HH22 . ARG A 1 51  ? -9.190  -12.223 1.501   1.00 0.00 ? 51  ARG A HH22 6  
ATOM 8652  N N    . GLY A 1 52  ? -8.790  -21.341 4.795   1.00 0.00 ? 52  GLY A N    6  
ATOM 8653  C CA   . GLY A 1 52  ? -8.975  -22.773 4.938   1.00 0.00 ? 52  GLY A CA   6  
ATOM 8654  C C    . GLY A 1 52  ? -8.533  -23.540 3.708   1.00 0.00 ? 52  GLY A C    6  
ATOM 8655  O O    . GLY A 1 52  ? -8.175  -24.715 3.795   1.00 0.00 ? 52  GLY A O    6  
ATOM 8656  H H    . GLY A 1 52  ? -7.991  -20.912 5.166   1.00 0.00 ? 52  GLY A H    6  
ATOM 8657  H HA2  . GLY A 1 52  ? -8.403  -23.115 5.787   1.00 0.00 ? 52  GLY A HA2  6  
ATOM 8658  H HA3  . GLY A 1 52  ? -10.021 -22.973 5.117   1.00 0.00 ? 52  GLY A HA3  6  
ATOM 8659  N N    . VAL A 1 53  ? -8.560  -22.876 2.556   1.00 0.00 ? 53  VAL A N    6  
ATOM 8660  C CA   . VAL A 1 53  ? -8.160  -23.504 1.302   1.00 0.00 ? 53  VAL A CA   6  
ATOM 8661  C C    . VAL A 1 53  ? -6.722  -24.003 1.372   1.00 0.00 ? 53  VAL A C    6  
ATOM 8662  O O    . VAL A 1 53  ? -6.019  -23.768 2.355   1.00 0.00 ? 53  VAL A O    6  
ATOM 8663  C CB   . VAL A 1 53  ? -8.297  -22.528 0.118   1.00 0.00 ? 53  VAL A CB   6  
ATOM 8664  C CG1  . VAL A 1 53  ? -8.429  -23.292 -1.190  1.00 0.00 ? 53  VAL A CG1  6  
ATOM 8665  C CG2  . VAL A 1 53  ? -9.485  -21.601 0.326   1.00 0.00 ? 53  VAL A CG2  6  
ATOM 8666  H H    . VAL A 1 53  ? -8.855  -21.942 2.550   1.00 0.00 ? 53  VAL A H    6  
ATOM 8667  H HA   . VAL A 1 53  ? -8.815  -24.345 1.126   1.00 0.00 ? 53  VAL A HA   6  
ATOM 8668  H HB   . VAL A 1 53  ? -7.401  -21.926 0.069   1.00 0.00 ? 53  VAL A HB   6  
ATOM 8669  H HG11 . VAL A 1 53  ? -9.053  -22.732 -1.872  1.00 0.00 ? 53  VAL A HG11 6  
ATOM 8670  H HG12 . VAL A 1 53  ? -7.451  -23.430 -1.627  1.00 0.00 ? 53  VAL A HG12 6  
ATOM 8671  H HG13 . VAL A 1 53  ? -8.879  -24.255 -1.001  1.00 0.00 ? 53  VAL A HG13 6  
ATOM 8672  H HG21 . VAL A 1 53  ? -10.238 -22.108 0.910   1.00 0.00 ? 53  VAL A HG21 6  
ATOM 8673  H HG22 . VAL A 1 53  ? -9.162  -20.713 0.850   1.00 0.00 ? 53  VAL A HG22 6  
ATOM 8674  H HG23 . VAL A 1 53  ? -9.898  -21.323 -0.632  1.00 0.00 ? 53  VAL A HG23 6  
ATOM 8675  N N    . SER A 1 54  ? -6.289  -24.694 0.322   1.00 0.00 ? 54  SER A N    6  
ATOM 8676  C CA   . SER A 1 54  ? -4.935  -25.230 0.265   1.00 0.00 ? 54  SER A CA   6  
ATOM 8677  C C    . SER A 1 54  ? -4.022  -24.316 -0.548  1.00 0.00 ? 54  SER A C    6  
ATOM 8678  O O    . SER A 1 54  ? -4.414  -23.758 -1.573  1.00 0.00 ? 54  SER A O    6  
ATOM 8679  C CB   . SER A 1 54  ? -4.944  -26.633 -0.345  1.00 0.00 ? 54  SER A CB   6  
ATOM 8680  O OG   . SER A 1 54  ? -3.890  -27.423 0.177   1.00 0.00 ? 54  SER A OG   6  
ATOM 8681  H H    . SER A 1 54  ? -6.898  -24.848 -0.431  1.00 0.00 ? 54  SER A H    6  
ATOM 8682  H HA   . SER A 1 54  ? -4.559  -25.289 1.275   1.00 0.00 ? 54  SER A HA   6  
ATOM 8683  H HB2  . SER A 1 54  ? -5.884  -27.114 -0.121  1.00 0.00 ? 54  SER A HB2  6  
ATOM 8684  H HB3  . SER A 1 54  ? -4.825  -26.557 -1.417  1.00 0.00 ? 54  SER A HB3  6  
ATOM 8685  H HG   . SER A 1 54  ? -3.435  -27.867 -0.543  1.00 0.00 ? 54  SER A HG   6  
ATOM 8686  N N    . PRO A 1 55  ? -2.775  -24.159 -0.079  1.00 0.00 ? 55  PRO A N    6  
ATOM 8687  C CA   . PRO A 1 55  ? -1.780  -23.314 -0.746  1.00 0.00 ? 55  PRO A CA   6  
ATOM 8688  C C    . PRO A 1 55  ? -1.313  -23.905 -2.072  1.00 0.00 ? 55  PRO A C    6  
ATOM 8689  O O    . PRO A 1 55  ? -0.443  -23.346 -2.740  1.00 0.00 ? 55  PRO A O    6  
ATOM 8690  C CB   . PRO A 1 55  ? -0.624  -23.269 0.256   1.00 0.00 ? 55  PRO A CB   6  
ATOM 8691  C CG   . PRO A 1 55  ? -0.764  -24.520 1.052   1.00 0.00 ? 55  PRO A CG   6  
ATOM 8692  C CD   . PRO A 1 55  ? -2.240  -24.794 1.137   1.00 0.00 ? 55  PRO A CD   6  
ATOM 8693  H HA   . PRO A 1 55  ? -2.155  -22.314 -0.911  1.00 0.00 ? 55  PRO A HA   6  
ATOM 8694  H HB2  . PRO A 1 55  ? 0.316   -23.241 -0.276  1.00 0.00 ? 55  PRO A HB2  6  
ATOM 8695  H HB3  . PRO A 1 55  ? -0.717  -22.392 0.879   1.00 0.00 ? 55  PRO A HB3  6  
ATOM 8696  H HG2  . PRO A 1 55  ? -0.260  -25.332 0.552   1.00 0.00 ? 55  PRO A HG2  6  
ATOM 8697  H HG3  . PRO A 1 55  ? -0.354  -24.373 2.041   1.00 0.00 ? 55  PRO A HG3  6  
ATOM 8698  H HD2  . PRO A 1 55  ? -2.428  -25.857 1.131   1.00 0.00 ? 55  PRO A HD2  6  
ATOM 8699  H HD3  . PRO A 1 55  ? -2.658  -24.340 2.023   1.00 0.00 ? 55  PRO A HD3  6  
ATOM 8700  N N    . SER A 1 56  ? -1.897  -25.038 -2.448  1.00 0.00 ? 56  SER A N    6  
ATOM 8701  C CA   . SER A 1 56  ? -1.537  -25.707 -3.693  1.00 0.00 ? 56  SER A CA   6  
ATOM 8702  C C    . SER A 1 56  ? -2.622  -25.511 -4.748  1.00 0.00 ? 56  SER A C    6  
ATOM 8703  O O    . SER A 1 56  ? -2.360  -25.591 -5.948  1.00 0.00 ? 56  SER A O    6  
ATOM 8704  C CB   . SER A 1 56  ? -1.312  -27.200 -3.448  1.00 0.00 ? 56  SER A CB   6  
ATOM 8705  O OG   . SER A 1 56  ? -0.395  -27.739 -4.385  1.00 0.00 ? 56  SER A OG   6  
ATOM 8706  H H    . SER A 1 56  ? -2.584  -25.436 -1.872  1.00 0.00 ? 56  SER A H    6  
ATOM 8707  H HA   . SER A 1 56  ? -0.619  -25.268 -4.052  1.00 0.00 ? 56  SER A HA   6  
ATOM 8708  H HB2  . SER A 1 56  ? -0.918  -27.344 -2.454  1.00 0.00 ? 56  SER A HB2  6  
ATOM 8709  H HB3  . SER A 1 56  ? -2.253  -27.723 -3.541  1.00 0.00 ? 56  SER A HB3  6  
ATOM 8710  H HG   . SER A 1 56  ? -0.165  -28.635 -4.130  1.00 0.00 ? 56  SER A HG   6  
ATOM 8711  N N    . LYS A 1 57  ? -3.843  -25.254 -4.291  1.00 0.00 ? 57  LYS A N    6  
ATOM 8712  C CA   . LYS A 1 57  ? -4.970  -25.045 -5.192  1.00 0.00 ? 57  LYS A CA   6  
ATOM 8713  C C    . LYS A 1 57  ? -5.300  -23.561 -5.315  1.00 0.00 ? 57  LYS A C    6  
ATOM 8714  O O    . LYS A 1 57  ? -6.457  -23.186 -5.499  1.00 0.00 ? 57  LYS A O    6  
ATOM 8715  C CB   . LYS A 1 57  ? -6.197  -25.812 -4.694  1.00 0.00 ? 57  LYS A CB   6  
ATOM 8716  C CG   . LYS A 1 57  ? -5.878  -27.209 -4.192  1.00 0.00 ? 57  LYS A CG   6  
ATOM 8717  C CD   . LYS A 1 57  ? -7.047  -28.157 -4.402  1.00 0.00 ? 57  LYS A CD   6  
ATOM 8718  C CE   . LYS A 1 57  ? -6.809  -29.495 -3.719  1.00 0.00 ? 57  LYS A CE   6  
ATOM 8719  N NZ   . LYS A 1 57  ? -5.949  -30.392 -4.540  1.00 0.00 ? 57  LYS A NZ   6  
ATOM 8720  H H    . LYS A 1 57  ? -3.990  -25.203 -3.322  1.00 0.00 ? 57  LYS A H    6  
ATOM 8721  H HA   . LYS A 1 57  ? -4.691  -25.421 -6.165  1.00 0.00 ? 57  LYS A HA   6  
ATOM 8722  H HB2  . LYS A 1 57  ? -6.651  -25.256 -3.887  1.00 0.00 ? 57  LYS A HB2  6  
ATOM 8723  H HB3  . LYS A 1 57  ? -6.906  -25.896 -5.505  1.00 0.00 ? 57  LYS A HB3  6  
ATOM 8724  H HG2  . LYS A 1 57  ? -5.021  -27.588 -4.728  1.00 0.00 ? 57  LYS A HG2  6  
ATOM 8725  H HG3  . LYS A 1 57  ? -5.652  -27.159 -3.136  1.00 0.00 ? 57  LYS A HG3  6  
ATOM 8726  H HD2  . LYS A 1 57  ? -7.940  -27.710 -3.991  1.00 0.00 ? 57  LYS A HD2  6  
ATOM 8727  H HD3  . LYS A 1 57  ? -7.179  -28.322 -5.462  1.00 0.00 ? 57  LYS A HD3  6  
ATOM 8728  H HE2  . LYS A 1 57  ? -6.327  -29.319 -2.769  1.00 0.00 ? 57  LYS A HE2  6  
ATOM 8729  H HE3  . LYS A 1 57  ? -7.763  -29.975 -3.555  1.00 0.00 ? 57  LYS A HE3  6  
ATOM 8730  H HZ1  . LYS A 1 57  ? -5.589  -31.174 -3.956  1.00 0.00 ? 57  LYS A HZ1  6  
ATOM 8731  H HZ2  . LYS A 1 57  ? -5.142  -29.860 -4.923  1.00 0.00 ? 57  LYS A HZ2  6  
ATOM 8732  H HZ3  . LYS A 1 57  ? -6.497  -30.787 -5.331  1.00 0.00 ? 57  LYS A HZ3  6  
ATOM 8733  N N    . ALA A 1 58  ? -4.275  -22.721 -5.213  1.00 0.00 ? 58  ALA A N    6  
ATOM 8734  C CA   . ALA A 1 58  ? -4.456  -21.278 -5.317  1.00 0.00 ? 58  ALA A CA   6  
ATOM 8735  C C    . ALA A 1 58  ? -5.168  -20.906 -6.613  1.00 0.00 ? 58  ALA A C    6  
ATOM 8736  O O    . ALA A 1 58  ? -5.890  -19.910 -6.673  1.00 0.00 ? 58  ALA A O    6  
ATOM 8737  C CB   . ALA A 1 58  ? -3.113  -20.569 -5.227  1.00 0.00 ? 58  ALA A CB   6  
ATOM 8738  H H    . ALA A 1 58  ? -3.375  -23.080 -5.067  1.00 0.00 ? 58  ALA A H    6  
ATOM 8739  H HA   . ALA A 1 58  ? -5.061  -20.957 -4.481  1.00 0.00 ? 58  ALA A HA   6  
ATOM 8740  H HB1  . ALA A 1 58  ? -3.271  -19.533 -4.966  1.00 0.00 ? 58  ALA A HB1  6  
ATOM 8741  H HB2  . ALA A 1 58  ? -2.506  -21.044 -4.471  1.00 0.00 ? 58  ALA A HB2  6  
ATOM 8742  H HB3  . ALA A 1 58  ? -2.611  -20.628 -6.182  1.00 0.00 ? 58  ALA A HB3  6  
ATOM 8743  N N    . HIS A 1 59  ? -4.959  -21.711 -7.650  1.00 0.00 ? 59  HIS A N    6  
ATOM 8744  C CA   . HIS A 1 59  ? -5.581  -21.466 -8.946  1.00 0.00 ? 59  HIS A CA   6  
ATOM 8745  C C    . HIS A 1 59  ? -7.066  -21.153 -8.786  1.00 0.00 ? 59  HIS A C    6  
ATOM 8746  O O    . HIS A 1 59  ? -7.647  -20.425 -9.590  1.00 0.00 ? 59  HIS A O    6  
ATOM 8747  C CB   . HIS A 1 59  ? -5.399  -22.678 -9.860  1.00 0.00 ? 59  HIS A CB   6  
ATOM 8748  C CG   . HIS A 1 59  ? -5.781  -23.976 -9.218  1.00 0.00 ? 59  HIS A CG   6  
ATOM 8749  N ND1  . HIS A 1 59  ? -7.020  -24.559 -9.377  1.00 0.00 ? 59  HIS A ND1  6  
ATOM 8750  C CD2  . HIS A 1 59  ? -5.078  -24.805 -8.411  1.00 0.00 ? 59  HIS A CD2  6  
ATOM 8751  C CE1  . HIS A 1 59  ? -7.063  -25.690 -8.696  1.00 0.00 ? 59  HIS A CE1  6  
ATOM 8752  N NE2  . HIS A 1 59  ? -5.897  -25.862 -8.101  1.00 0.00 ? 59  HIS A NE2  6  
ATOM 8753  H H    . HIS A 1 59  ? -4.374  -22.489 -7.540  1.00 0.00 ? 59  HIS A H    6  
ATOM 8754  H HA   . HIS A 1 59  ? -5.092  -20.613 -9.392  1.00 0.00 ? 59  HIS A HA   6  
ATOM 8755  H HB2  . HIS A 1 59  ? -6.012  -22.551 -10.741 1.00 0.00 ? 59  HIS A HB2  6  
ATOM 8756  H HB3  . HIS A 1 59  ? -4.362  -22.745 -10.156 1.00 0.00 ? 59  HIS A HB3  6  
ATOM 8757  H HD1  . HIS A 1 59  ? -7.758  -24.197 -9.910  1.00 0.00 ? 59  HIS A HD1  6  
ATOM 8758  H HD2  . HIS A 1 59  ? -4.061  -24.662 -8.073  1.00 0.00 ? 59  HIS A HD2  6  
ATOM 8759  H HE1  . HIS A 1 59  ? -7.908  -26.360 -8.635  1.00 0.00 ? 59  HIS A HE1  6  
ATOM 8760  H HE2  . HIS A 1 59  ? -5.689  -26.577 -7.464  1.00 0.00 ? 59  HIS A HE2  6  
ATOM 8761  N N    . GLY A 1 60  ? -7.674  -21.709 -7.742  1.00 0.00 ? 60  GLY A N    6  
ATOM 8762  C CA   . GLY A 1 60  ? -9.085  -21.478 -7.497  1.00 0.00 ? 60  GLY A CA   6  
ATOM 8763  C C    . GLY A 1 60  ? -9.379  -20.042 -7.110  1.00 0.00 ? 60  GLY A C    6  
ATOM 8764  O O    . GLY A 1 60  ? -10.426 -19.498 -7.464  1.00 0.00 ? 60  GLY A O    6  
ATOM 8765  H H    . GLY A 1 60  ? -7.160  -22.281 -7.134  1.00 0.00 ? 60  GLY A H    6  
ATOM 8766  H HA2  . GLY A 1 60  ? -9.640  -21.720 -8.391  1.00 0.00 ? 60  GLY A HA2  6  
ATOM 8767  H HA3  . GLY A 1 60  ? -9.411  -22.127 -6.697  1.00 0.00 ? 60  GLY A HA3  6  
ATOM 8768  N N    . LEU A 1 61  ? -8.455  -19.426 -6.381  1.00 0.00 ? 61  LEU A N    6  
ATOM 8769  C CA   . LEU A 1 61  ? -8.620  -18.044 -5.945  1.00 0.00 ? 61  LEU A CA   6  
ATOM 8770  C C    . LEU A 1 61  ? -9.247  -17.196 -7.047  1.00 0.00 ? 61  LEU A C    6  
ATOM 8771  O O    . LEU A 1 61  ? -10.009 -16.270 -6.774  1.00 0.00 ? 61  LEU A O    6  
ATOM 8772  C CB   . LEU A 1 61  ? -7.270  -17.453 -5.536  1.00 0.00 ? 61  LEU A CB   6  
ATOM 8773  C CG   . LEU A 1 61  ? -6.649  -18.018 -4.258  1.00 0.00 ? 61  LEU A CG   6  
ATOM 8774  C CD1  . LEU A 1 61  ? -5.166  -17.690 -4.195  1.00 0.00 ? 61  LEU A CD1  6  
ATOM 8775  C CD2  . LEU A 1 61  ? -7.369  -17.477 -3.031  1.00 0.00 ? 61  LEU A CD2  6  
ATOM 8776  H H    . LEU A 1 61  ? -7.642  -19.911 -6.130  1.00 0.00 ? 61  LEU A H    6  
ATOM 8777  H HA   . LEU A 1 61  ? -9.278  -18.044 -5.089  1.00 0.00 ? 61  LEU A HA   6  
ATOM 8778  H HB2  . LEU A 1 61  ? -6.576  -17.624 -6.344  1.00 0.00 ? 61  LEU A HB2  6  
ATOM 8779  H HB3  . LEU A 1 61  ? -7.404  -16.389 -5.398  1.00 0.00 ? 61  LEU A HB3  6  
ATOM 8780  H HG   . LEU A 1 61  ? -6.753  -19.094 -4.260  1.00 0.00 ? 61  LEU A HG   6  
ATOM 8781  H HD11 . LEU A 1 61  ? -4.632  -18.518 -3.753  1.00 0.00 ? 61  LEU A HD11 6  
ATOM 8782  H HD12 . LEU A 1 61  ? -5.018  -16.805 -3.593  1.00 0.00 ? 61  LEU A HD12 6  
ATOM 8783  H HD13 . LEU A 1 61  ? -4.794  -17.512 -5.193  1.00 0.00 ? 61  LEU A HD13 6  
ATOM 8784  H HD21 . LEU A 1 61  ? -7.510  -18.274 -2.316  1.00 0.00 ? 61  LEU A HD21 6  
ATOM 8785  H HD22 . LEU A 1 61  ? -8.332  -17.082 -3.323  1.00 0.00 ? 61  LEU A HD22 6  
ATOM 8786  H HD23 . LEU A 1 61  ? -6.778  -16.692 -2.583  1.00 0.00 ? 61  LEU A HD23 6  
ATOM 8787  N N    . GLY A 1 62  ? -8.922  -17.521 -8.294  1.00 0.00 ? 62  GLY A N    6  
ATOM 8788  C CA   . GLY A 1 62  ? -9.463  -16.781 -9.419  1.00 0.00 ? 62  GLY A CA   6  
ATOM 8789  C C    . GLY A 1 62  ? -9.262  -15.285 -9.280  1.00 0.00 ? 62  GLY A C    6  
ATOM 8790  O O    . GLY A 1 62  ? -8.161  -14.778 -9.494  1.00 0.00 ? 62  GLY A O    6  
ATOM 8791  H H    . GLY A 1 62  ? -8.309  -18.270 -8.452  1.00 0.00 ? 62  GLY A H    6  
ATOM 8792  H HA2  . GLY A 1 62  ? -8.978  -17.117 -10.324 1.00 0.00 ? 62  GLY A HA2  6  
ATOM 8793  H HA3  . GLY A 1 62  ? -10.521 -16.985 -9.493  1.00 0.00 ? 62  GLY A HA3  6  
ATOM 8794  N N    . SER A 1 63  ? -10.328 -14.577 -8.922  1.00 0.00 ? 63  SER A N    6  
ATOM 8795  C CA   . SER A 1 63  ? -10.264 -13.129 -8.760  1.00 0.00 ? 63  SER A CA   6  
ATOM 8796  C C    . SER A 1 63  ? -9.335  -12.752 -7.610  1.00 0.00 ? 63  SER A C    6  
ATOM 8797  O O    . SER A 1 63  ? -8.608  -11.762 -7.685  1.00 0.00 ? 63  SER A O    6  
ATOM 8798  C CB   . SER A 1 63  ? -11.663 -12.561 -8.508  1.00 0.00 ? 63  SER A CB   6  
ATOM 8799  O OG   . SER A 1 63  ? -12.192 -13.034 -7.282  1.00 0.00 ? 63  SER A OG   6  
ATOM 8800  H H    . SER A 1 63  ? -11.178 -15.039 -8.765  1.00 0.00 ? 63  SER A H    6  
ATOM 8801  H HA   . SER A 1 63  ? -9.874  -12.710 -9.675  1.00 0.00 ? 63  SER A HA   6  
ATOM 8802  H HB2  . SER A 1 63  ? -11.610 -11.484 -8.472  1.00 0.00 ? 63  SER A HB2  6  
ATOM 8803  H HB3  . SER A 1 63  ? -12.320 -12.863 -9.311  1.00 0.00 ? 63  SER A HB3  6  
ATOM 8804  H HG   . SER A 1 63  ? -12.548 -12.297 -6.781  1.00 0.00 ? 63  SER A HG   6  
ATOM 8805  N N    . ASN A 1 64  ? -9.367  -13.548 -6.546  1.00 0.00 ? 64  ASN A N    6  
ATOM 8806  C CA   . ASN A 1 64  ? -8.528  -13.297 -5.379  1.00 0.00 ? 64  ASN A CA   6  
ATOM 8807  C C    . ASN A 1 64  ? -7.120  -13.842 -5.595  1.00 0.00 ? 64  ASN A C    6  
ATOM 8808  O O    . ASN A 1 64  ? -6.325  -13.929 -4.657  1.00 0.00 ? 64  ASN A O    6  
ATOM 8809  C CB   . ASN A 1 64  ? -9.148  -13.934 -4.134  1.00 0.00 ? 64  ASN A CB   6  
ATOM 8810  C CG   . ASN A 1 64  ? -8.749  -13.218 -2.858  1.00 0.00 ? 64  ASN A CG   6  
ATOM 8811  O OD1  . ASN A 1 64  ? -8.191  -12.121 -2.898  1.00 0.00 ? 64  ASN A OD1  6  
ATOM 8812  N ND2  . ASN A 1 64  ? -9.033  -13.837 -1.718  1.00 0.00 ? 64  ASN A ND2  6  
ATOM 8813  H H    . ASN A 1 64  ? -9.968  -14.322 -6.545  1.00 0.00 ? 64  ASN A H    6  
ATOM 8814  H HA   . ASN A 1 64  ? -8.471  -12.229 -5.236  1.00 0.00 ? 64  ASN A HA   6  
ATOM 8815  H HB2  . ASN A 1 64  ? -10.225 -13.903 -4.219  1.00 0.00 ? 64  ASN A HB2  6  
ATOM 8816  H HB3  . ASN A 1 64  ? -8.826  -14.962 -4.064  1.00 0.00 ? 64  ASN A HB3  6  
ATOM 8817  H HD21 . ASN A 1 64  ? -9.479  -14.709 -1.763  1.00 0.00 ? 64  ASN A HD21 6  
ATOM 8818  H HD22 . ASN A 1 64  ? -8.787  -13.396 -0.879  1.00 0.00 ? 64  ASN A HD22 6  
ATOM 8819  N N    . LEU A 1 65  ? -6.816  -14.207 -6.835  1.00 0.00 ? 65  LEU A N    6  
ATOM 8820  C CA   . LEU A 1 65  ? -5.502  -14.743 -7.175  1.00 0.00 ? 65  LEU A CA   6  
ATOM 8821  C C    . LEU A 1 65  ? -4.498  -13.618 -7.404  1.00 0.00 ? 65  LEU A C    6  
ATOM 8822  O O    . LEU A 1 65  ? -4.779  -12.656 -8.119  1.00 0.00 ? 65  LEU A O    6  
ATOM 8823  C CB   . LEU A 1 65  ? -5.595  -15.620 -8.425  1.00 0.00 ? 65  LEU A CB   6  
ATOM 8824  C CG   . LEU A 1 65  ? -4.338  -16.412 -8.785  1.00 0.00 ? 65  LEU A CG   6  
ATOM 8825  C CD1  . LEU A 1 65  ? -4.355  -17.776 -8.113  1.00 0.00 ? 65  LEU A CD1  6  
ATOM 8826  C CD2  . LEU A 1 65  ? -4.214  -16.561 -10.294 1.00 0.00 ? 65  LEU A CD2  6  
ATOM 8827  H H    . LEU A 1 65  ? -7.490  -14.115 -7.540  1.00 0.00 ? 65  LEU A H    6  
ATOM 8828  H HA   . LEU A 1 65  ? -5.166  -15.346 -6.346  1.00 0.00 ? 65  LEU A HA   6  
ATOM 8829  H HB2  . LEU A 1 65  ? -6.398  -16.326 -8.275  1.00 0.00 ? 65  LEU A HB2  6  
ATOM 8830  H HB3  . LEU A 1 65  ? -5.834  -14.979 -9.261  1.00 0.00 ? 65  LEU A HB3  6  
ATOM 8831  H HG   . LEU A 1 65  ? -3.468  -15.876 -8.428  1.00 0.00 ? 65  LEU A HG   6  
ATOM 8832  H HD11 . LEU A 1 65  ? -5.338  -18.212 -8.208  1.00 0.00 ? 65  LEU A HD11 6  
ATOM 8833  H HD12 . LEU A 1 65  ? -4.111  -17.665 -7.066  1.00 0.00 ? 65  LEU A HD12 6  
ATOM 8834  H HD13 . LEU A 1 65  ? -3.628  -18.419 -8.585  1.00 0.00 ? 65  LEU A HD13 6  
ATOM 8835  H HD21 . LEU A 1 65  ? -4.874  -15.857 -10.780 1.00 0.00 ? 65  LEU A HD21 6  
ATOM 8836  H HD22 . LEU A 1 65  ? -4.487  -17.566 -10.580 1.00 0.00 ? 65  LEU A HD22 6  
ATOM 8837  H HD23 . LEU A 1 65  ? -3.195  -16.364 -10.593 1.00 0.00 ? 65  LEU A HD23 6  
ATOM 8838  N N    . VAL A 1 66  ? -3.324  -13.746 -6.794  1.00 0.00 ? 66  VAL A N    6  
ATOM 8839  C CA   . VAL A 1 66  ? -2.276  -12.743 -6.933  1.00 0.00 ? 66  VAL A CA   6  
ATOM 8840  C C    . VAL A 1 66  ? -1.379  -13.046 -8.128  1.00 0.00 ? 66  VAL A C    6  
ATOM 8841  O O    . VAL A 1 66  ? -1.270  -14.194 -8.561  1.00 0.00 ? 66  VAL A O    6  
ATOM 8842  C CB   . VAL A 1 66  ? -1.409  -12.657 -5.663  1.00 0.00 ? 66  VAL A CB   6  
ATOM 8843  C CG1  . VAL A 1 66  ? -0.509  -11.431 -5.712  1.00 0.00 ? 66  VAL A CG1  6  
ATOM 8844  C CG2  . VAL A 1 66  ? -2.285  -12.635 -4.420  1.00 0.00 ? 66  VAL A CG2  6  
ATOM 8845  H H    . VAL A 1 66  ? -3.159  -14.536 -6.237  1.00 0.00 ? 66  VAL A H    6  
ATOM 8846  H HA   . VAL A 1 66  ? -2.750  -11.784 -7.085  1.00 0.00 ? 66  VAL A HA   6  
ATOM 8847  H HB   . VAL A 1 66  ? -0.781  -13.535 -5.620  1.00 0.00 ? 66  VAL A HB   6  
ATOM 8848  H HG11 . VAL A 1 66  ? 0.250   -11.573 -6.468  1.00 0.00 ? 66  VAL A HG11 6  
ATOM 8849  H HG12 . VAL A 1 66  ? -1.100  -10.560 -5.953  1.00 0.00 ? 66  VAL A HG12 6  
ATOM 8850  H HG13 . VAL A 1 66  ? -0.037  -11.293 -4.751  1.00 0.00 ? 66  VAL A HG13 6  
ATOM 8851  H HG21 . VAL A 1 66  ? -1.703  -12.942 -3.564  1.00 0.00 ? 66  VAL A HG21 6  
ATOM 8852  H HG22 . VAL A 1 66  ? -2.659  -11.633 -4.260  1.00 0.00 ? 66  VAL A HG22 6  
ATOM 8853  H HG23 . VAL A 1 66  ? -3.116  -13.311 -4.553  1.00 0.00 ? 66  VAL A HG23 6  
ATOM 8854  N N    . THR A 1 67  ? -0.737  -12.010 -8.658  1.00 0.00 ? 67  THR A N    6  
ATOM 8855  C CA   . THR A 1 67  ? 0.150   -12.165 -9.804  1.00 0.00 ? 67  THR A CA   6  
ATOM 8856  C C    . THR A 1 67  ? 1.196   -11.057 -9.843  1.00 0.00 ? 67  THR A C    6  
ATOM 8857  O O    . THR A 1 67  ? 0.980   -9.969  -9.310  1.00 0.00 ? 67  THR A O    6  
ATOM 8858  C CB   . THR A 1 67  ? -0.637  -12.160 -11.128 1.00 0.00 ? 67  THR A CB   6  
ATOM 8859  O OG1  . THR A 1 67  ? -1.149  -10.848 -11.388 1.00 0.00 ? 67  THR A OG1  6  
ATOM 8860  C CG2  . THR A 1 67  ? -1.784  -13.158 -11.080 1.00 0.00 ? 67  THR A CG2  6  
ATOM 8861  H H    . THR A 1 67  ? -0.866  -11.120 -8.269  1.00 0.00 ? 67  THR A H    6  
ATOM 8862  H HA   . THR A 1 67  ? 0.651   -13.117 -9.711  1.00 0.00 ? 67  THR A HA   6  
ATOM 8863  H HB   . THR A 1 67  ? 0.033   -12.442 -11.928 1.00 0.00 ? 67  THR A HB   6  
ATOM 8864  H HG1  . THR A 1 67  ? -1.808  -10.895 -12.086 1.00 0.00 ? 67  THR A HG1  6  
ATOM 8865  H HG21 . THR A 1 67  ? -1.394  -14.145 -10.882 1.00 0.00 ? 67  THR A HG21 6  
ATOM 8866  H HG22 . THR A 1 67  ? -2.300  -13.158 -12.028 1.00 0.00 ? 67  THR A HG22 6  
ATOM 8867  H HG23 . THR A 1 67  ? -2.471  -12.878 -10.296 1.00 0.00 ? 67  THR A HG23 6  
ATOM 8868  N N    . GLU A 1 68  ? 2.329   -11.341 -10.477 1.00 0.00 ? 68  GLU A N    6  
ATOM 8869  C CA   . GLU A 1 68  ? 3.409   -10.367 -10.585 1.00 0.00 ? 68  GLU A CA   6  
ATOM 8870  C C    . GLU A 1 68  ? 2.853   -8.951  -10.713 1.00 0.00 ? 68  GLU A C    6  
ATOM 8871  O O    . GLU A 1 68  ? 3.362   -8.014  -10.097 1.00 0.00 ? 68  GLU A O    6  
ATOM 8872  C CB   . GLU A 1 68  ? 4.298   -10.689 -11.788 1.00 0.00 ? 68  GLU A CB   6  
ATOM 8873  C CG   . GLU A 1 68  ? 5.699   -10.111 -11.681 1.00 0.00 ? 68  GLU A CG   6  
ATOM 8874  C CD   . GLU A 1 68  ? 6.404   -10.037 -13.022 1.00 0.00 ? 68  GLU A CD   6  
ATOM 8875  O OE1  . GLU A 1 68  ? 6.167   -10.927 -13.865 1.00 0.00 ? 68  GLU A OE1  6  
ATOM 8876  O OE2  . GLU A 1 68  ? 7.192   -9.091  -13.227 1.00 0.00 ? 68  GLU A OE2  6  
ATOM 8877  H H    . GLU A 1 68  ? 2.442   -12.227 -10.882 1.00 0.00 ? 68  GLU A H    6  
ATOM 8878  H HA   . GLU A 1 68  ? 4.001   -10.428 -9.685  1.00 0.00 ? 68  GLU A HA   6  
ATOM 8879  H HB2  . GLU A 1 68  ? 4.379   -11.761 -11.884 1.00 0.00 ? 68  GLU A HB2  6  
ATOM 8880  H HB3  . GLU A 1 68  ? 3.834   -10.291 -12.679 1.00 0.00 ? 68  GLU A HB3  6  
ATOM 8881  H HG2  . GLU A 1 68  ? 5.634   -9.114  -11.271 1.00 0.00 ? 68  GLU A HG2  6  
ATOM 8882  H HG3  . GLU A 1 68  ? 6.282   -10.734 -11.018 1.00 0.00 ? 68  GLU A HG3  6  
ATOM 8883  N N    . VAL A 1 69  ? 1.806   -8.804  -11.518 1.00 0.00 ? 69  VAL A N    6  
ATOM 8884  C CA   . VAL A 1 69  ? 1.180   -7.503  -11.728 1.00 0.00 ? 69  VAL A CA   6  
ATOM 8885  C C    . VAL A 1 69  ? 0.566   -6.975  -10.437 1.00 0.00 ? 69  VAL A C    6  
ATOM 8886  O O    . VAL A 1 69  ? 0.847   -5.851  -10.019 1.00 0.00 ? 69  VAL A O    6  
ATOM 8887  C CB   . VAL A 1 69  ? 0.088   -7.574  -12.812 1.00 0.00 ? 69  VAL A CB   6  
ATOM 8888  C CG1  . VAL A 1 69  ? -0.846  -6.378  -12.708 1.00 0.00 ? 69  VAL A CG1  6  
ATOM 8889  C CG2  . VAL A 1 69  ? 0.716   -7.653  -14.196 1.00 0.00 ? 69  VAL A CG2  6  
ATOM 8890  H H    . VAL A 1 69  ? 1.445   -9.588  -11.982 1.00 0.00 ? 69  VAL A H    6  
ATOM 8891  H HA   . VAL A 1 69  ? 1.944   -6.815  -12.061 1.00 0.00 ? 69  VAL A HA   6  
ATOM 8892  H HB   . VAL A 1 69  ? -0.492  -8.471  -12.652 1.00 0.00 ? 69  VAL A HB   6  
ATOM 8893  H HG11 . VAL A 1 69  ? -1.525  -6.523  -11.880 1.00 0.00 ? 69  VAL A HG11 6  
ATOM 8894  H HG12 . VAL A 1 69  ? -0.266  -5.481  -12.548 1.00 0.00 ? 69  VAL A HG12 6  
ATOM 8895  H HG13 . VAL A 1 69  ? -1.412  -6.283  -13.623 1.00 0.00 ? 69  VAL A HG13 6  
ATOM 8896  H HG21 . VAL A 1 69  ? 1.178   -6.707  -14.434 1.00 0.00 ? 69  VAL A HG21 6  
ATOM 8897  H HG22 . VAL A 1 69  ? 1.463   -8.433  -14.209 1.00 0.00 ? 69  VAL A HG22 6  
ATOM 8898  H HG23 . VAL A 1 69  ? -0.048  -7.875  -14.926 1.00 0.00 ? 69  VAL A HG23 6  
ATOM 8899  N N    . ARG A 1 70  ? -0.273  -7.792  -9.809  1.00 0.00 ? 70  ARG A N    6  
ATOM 8900  C CA   . ARG A 1 70  ? -0.928  -7.406  -8.565  1.00 0.00 ? 70  ARG A CA   6  
ATOM 8901  C C    . ARG A 1 70  ? 0.063   -6.747  -7.611  1.00 0.00 ? 70  ARG A C    6  
ATOM 8902  O O    . ARG A 1 70  ? -0.161  -5.631  -7.140  1.00 0.00 ? 70  ARG A O    6  
ATOM 8903  C CB   . ARG A 1 70  ? -1.561  -8.628  -7.897  1.00 0.00 ? 70  ARG A CB   6  
ATOM 8904  C CG   . ARG A 1 70  ? -2.580  -9.341  -8.770  1.00 0.00 ? 70  ARG A CG   6  
ATOM 8905  C CD   . ARG A 1 70  ? -3.974  -8.765  -8.583  1.00 0.00 ? 70  ARG A CD   6  
ATOM 8906  N NE   . ARG A 1 70  ? -4.795  -8.917  -9.782  1.00 0.00 ? 70  ARG A NE   6  
ATOM 8907  C CZ   . ARG A 1 70  ? -4.652  -8.169  -10.870 1.00 0.00 ? 70  ARG A CZ   6  
ATOM 8908  N NH1  . ARG A 1 70  ? -3.725  -7.222  -10.910 1.00 0.00 ? 70  ARG A NH1  6  
ATOM 8909  N NH2  . ARG A 1 70  ? -5.438  -8.368  -11.921 1.00 0.00 ? 70  ARG A NH2  6  
ATOM 8910  H H    . ARG A 1 70  ? -0.457  -8.675  -10.192 1.00 0.00 ? 70  ARG A H    6  
ATOM 8911  H HA   . ARG A 1 70  ? -1.705  -6.696  -8.806  1.00 0.00 ? 70  ARG A HA   6  
ATOM 8912  H HB2  . ARG A 1 70  ? -0.780  -9.331  -7.646  1.00 0.00 ? 70  ARG A HB2  6  
ATOM 8913  H HB3  . ARG A 1 70  ? -2.054  -8.312  -6.990  1.00 0.00 ? 70  ARG A HB3  6  
ATOM 8914  H HG2  . ARG A 1 70  ? -2.293  -9.231  -9.806  1.00 0.00 ? 70  ARG A HG2  6  
ATOM 8915  H HG3  . ARG A 1 70  ? -2.594  -10.389 -8.508  1.00 0.00 ? 70  ARG A HG3  6  
ATOM 8916  H HD2  . ARG A 1 70  ? -4.454  -9.277  -7.763  1.00 0.00 ? 70  ARG A HD2  6  
ATOM 8917  H HD3  . ARG A 1 70  ? -3.886  -7.714  -8.349  1.00 0.00 ? 70  ARG A HD3  6  
ATOM 8918  H HE   . ARG A 1 70  ? -5.486  -9.611  -9.773  1.00 0.00 ? 70  ARG A HE   6  
ATOM 8919  H HH11 . ARG A 1 70  ? -3.132  -7.070  -10.120 1.00 0.00 ? 70  ARG A HH11 6  
ATOM 8920  H HH12 . ARG A 1 70  ? -3.619  -6.660  -11.732 1.00 0.00 ? 70  ARG A HH12 6  
ATOM 8921  H HH21 . ARG A 1 70  ? -6.137  -9.081  -11.894 1.00 0.00 ? 70  ARG A HH21 6  
ATOM 8922  H HH22 . ARG A 1 70  ? -5.329  -7.804  -12.739 1.00 0.00 ? 70  ARG A HH22 6  
ATOM 8923  N N    . VAL A 1 71  ? 1.158   -7.444  -7.329  1.00 0.00 ? 71  VAL A N    6  
ATOM 8924  C CA   . VAL A 1 71  ? 2.184   -6.927  -6.431  1.00 0.00 ? 71  VAL A CA   6  
ATOM 8925  C C    . VAL A 1 71  ? 2.810   -5.653  -6.987  1.00 0.00 ? 71  VAL A C    6  
ATOM 8926  O O    . VAL A 1 71  ? 3.043   -4.692  -6.254  1.00 0.00 ? 71  VAL A O    6  
ATOM 8927  C CB   . VAL A 1 71  ? 3.294   -7.967  -6.188  1.00 0.00 ? 71  VAL A CB   6  
ATOM 8928  C CG1  . VAL A 1 71  ? 4.178   -7.542  -5.025  1.00 0.00 ? 71  VAL A CG1  6  
ATOM 8929  C CG2  . VAL A 1 71  ? 2.690   -9.340  -5.935  1.00 0.00 ? 71  VAL A CG2  6  
ATOM 8930  H H    . VAL A 1 71  ? 1.280   -8.328  -7.734  1.00 0.00 ? 71  VAL A H    6  
ATOM 8931  H HA   . VAL A 1 71  ? 1.716   -6.702  -5.483  1.00 0.00 ? 71  VAL A HA   6  
ATOM 8932  H HB   . VAL A 1 71  ? 3.907   -8.024  -7.075  1.00 0.00 ? 71  VAL A HB   6  
ATOM 8933  H HG11 . VAL A 1 71  ? 5.216   -7.662  -5.301  1.00 0.00 ? 71  VAL A HG11 6  
ATOM 8934  H HG12 . VAL A 1 71  ? 3.986   -6.507  -4.785  1.00 0.00 ? 71  VAL A HG12 6  
ATOM 8935  H HG13 . VAL A 1 71  ? 3.962   -8.158  -4.165  1.00 0.00 ? 71  VAL A HG13 6  
ATOM 8936  H HG21 . VAL A 1 71  ? 3.131   -9.768  -5.047  1.00 0.00 ? 71  VAL A HG21 6  
ATOM 8937  H HG22 . VAL A 1 71  ? 1.623   -9.245  -5.798  1.00 0.00 ? 71  VAL A HG22 6  
ATOM 8938  H HG23 . VAL A 1 71  ? 2.888   -9.982  -6.781  1.00 0.00 ? 71  VAL A HG23 6  
ATOM 8939  N N    . TYR A 1 72  ? 3.078   -5.652  -8.288  1.00 0.00 ? 72  TYR A N    6  
ATOM 8940  C CA   . TYR A 1 72  ? 3.678   -4.496  -8.944  1.00 0.00 ? 72  TYR A CA   6  
ATOM 8941  C C    . TYR A 1 72  ? 2.838   -3.243  -8.717  1.00 0.00 ? 72  TYR A C    6  
ATOM 8942  O O    . TYR A 1 72  ? 3.367   -2.175  -8.410  1.00 0.00 ? 72  TYR A O    6  
ATOM 8943  C CB   . TYR A 1 72  ? 3.831   -4.756  -10.444 1.00 0.00 ? 72  TYR A CB   6  
ATOM 8944  C CG   . TYR A 1 72  ? 3.997   -3.496  -11.263 1.00 0.00 ? 72  TYR A CG   6  
ATOM 8945  C CD1  . TYR A 1 72  ? 2.923   -2.644  -11.487 1.00 0.00 ? 72  TYR A CD1  6  
ATOM 8946  C CD2  . TYR A 1 72  ? 5.227   -3.159  -11.813 1.00 0.00 ? 72  TYR A CD2  6  
ATOM 8947  C CE1  . TYR A 1 72  ? 3.070   -1.492  -12.236 1.00 0.00 ? 72  TYR A CE1  6  
ATOM 8948  C CE2  . TYR A 1 72  ? 5.384   -2.009  -12.562 1.00 0.00 ? 72  TYR A CE2  6  
ATOM 8949  C CZ   . TYR A 1 72  ? 4.302   -1.178  -12.770 1.00 0.00 ? 72  TYR A CZ   6  
ATOM 8950  O OH   . TYR A 1 72  ? 4.453   -0.032  -13.517 1.00 0.00 ? 72  TYR A OH   6  
ATOM 8951  H H    . TYR A 1 72  ? 2.869   -6.447  -8.821  1.00 0.00 ? 72  TYR A H    6  
ATOM 8952  H HA   . TYR A 1 72  ? 4.657   -4.342  -8.514  1.00 0.00 ? 72  TYR A HA   6  
ATOM 8953  H HB2  . TYR A 1 72  ? 4.699   -5.375  -10.608 1.00 0.00 ? 72  TYR A HB2  6  
ATOM 8954  H HB3  . TYR A 1 72  ? 2.953   -5.273  -10.803 1.00 0.00 ? 72  TYR A HB3  6  
ATOM 8955  H HD1  . TYR A 1 72  ? 1.959   -2.892  -11.067 1.00 0.00 ? 72  TYR A HD1  6  
ATOM 8956  H HD2  . TYR A 1 72  ? 6.072   -3.812  -11.649 1.00 0.00 ? 72  TYR A HD2  6  
ATOM 8957  H HE1  . TYR A 1 72  ? 2.223   -0.841  -12.399 1.00 0.00 ? 72  TYR A HE1  6  
ATOM 8958  H HE2  . TYR A 1 72  ? 6.348   -1.763  -12.981 1.00 0.00 ? 72  TYR A HE2  6  
ATOM 8959  H HH   . TYR A 1 72  ? 5.343   0.310   -13.400 1.00 0.00 ? 72  TYR A HH   6  
ATOM 8960  N N    . ASN A 1 73  ? 1.526   -3.383  -8.869  1.00 0.00 ? 73  ASN A N    6  
ATOM 8961  C CA   . ASN A 1 73  ? 0.610   -2.263  -8.681  1.00 0.00 ? 73  ASN A CA   6  
ATOM 8962  C C    . ASN A 1 73  ? 0.612   -1.798  -7.228  1.00 0.00 ? 73  ASN A C    6  
ATOM 8963  O O    . ASN A 1 73  ? 0.827   -0.620  -6.943  1.00 0.00 ? 73  ASN A O    6  
ATOM 8964  C CB   . ASN A 1 73  ? -0.807  -2.660  -9.099  1.00 0.00 ? 73  ASN A CB   6  
ATOM 8965  C CG   . ASN A 1 73  ? -1.012  -2.574  -10.599 1.00 0.00 ? 73  ASN A CG   6  
ATOM 8966  O OD1  . ASN A 1 73  ? -1.212  -1.490  -11.148 1.00 0.00 ? 73  ASN A OD1  6  
ATOM 8967  N ND2  . ASN A 1 73  ? -0.963  -3.719  -11.270 1.00 0.00 ? 73  ASN A ND2  6  
ATOM 8968  H H    . ASN A 1 73  ? 1.163   -4.260  -9.115  1.00 0.00 ? 73  ASN A H    6  
ATOM 8969  H HA   . ASN A 1 73  ? 0.947   -1.451  -9.307  1.00 0.00 ? 73  ASN A HA   6  
ATOM 8970  H HB2  . ASN A 1 73  ? -0.996  -3.677  -8.787  1.00 0.00 ? 73  ASN A HB2  6  
ATOM 8971  H HB3  . ASN A 1 73  ? -1.515  -2.002  -8.619  1.00 0.00 ? 73  ASN A HB3  6  
ATOM 8972  H HD21 . ASN A 1 73  ? -0.800  -4.544  -10.766 1.00 0.00 ? 73  ASN A HD21 6  
ATOM 8973  H HD22 . ASN A 1 73  ? -1.092  -3.692  -12.241 1.00 0.00 ? 73  ASN A HD22 6  
ATOM 8974  N N    . TRP A 1 74  ? 0.372   -2.731  -6.313  1.00 0.00 ? 74  TRP A N    6  
ATOM 8975  C CA   . TRP A 1 74  ? 0.347   -2.417  -4.889  1.00 0.00 ? 74  TRP A CA   6  
ATOM 8976  C C    . TRP A 1 74  ? 1.558   -1.579  -4.495  1.00 0.00 ? 74  TRP A C    6  
ATOM 8977  O O    . TRP A 1 74  ? 1.420   -0.522  -3.880  1.00 0.00 ? 74  TRP A O    6  
ATOM 8978  C CB   . TRP A 1 74  ? 0.310   -3.703  -4.063  1.00 0.00 ? 74  TRP A CB   6  
ATOM 8979  C CG   . TRP A 1 74  ? 0.215   -3.459  -2.587  1.00 0.00 ? 74  TRP A CG   6  
ATOM 8980  C CD1  . TRP A 1 74  ? -0.927  -3.346  -1.847  1.00 0.00 ? 74  TRP A CD1  6  
ATOM 8981  C CD2  . TRP A 1 74  ? 1.305   -3.295  -1.674  1.00 0.00 ? 74  TRP A CD2  6  
ATOM 8982  N NE1  . TRP A 1 74  ? -0.613  -3.122  -0.528  1.00 0.00 ? 74  TRP A NE1  6  
ATOM 8983  C CE2  . TRP A 1 74  ? 0.750   -3.087  -0.396  1.00 0.00 ? 74  TRP A CE2  6  
ATOM 8984  C CE3  . TRP A 1 74  ? 2.696   -3.305  -1.810  1.00 0.00 ? 74  TRP A CE3  6  
ATOM 8985  C CZ2  . TRP A 1 74  ? 1.539   -2.890  0.735   1.00 0.00 ? 74  TRP A CZ2  6  
ATOM 8986  C CZ3  . TRP A 1 74  ? 3.477   -3.109  -0.688  1.00 0.00 ? 74  TRP A CZ3  6  
ATOM 8987  C CH2  . TRP A 1 74  ? 2.897   -2.905  0.572   1.00 0.00 ? 74  TRP A CH2  6  
ATOM 8988  H H    . TRP A 1 74  ? 0.209   -3.653  -6.602  1.00 0.00 ? 74  TRP A H    6  
ATOM 8989  H HA   . TRP A 1 74  ? -0.550  -1.847  -4.692  1.00 0.00 ? 74  TRP A HA   6  
ATOM 8990  H HB2  . TRP A 1 74  ? -0.546  -4.290  -4.359  1.00 0.00 ? 74  TRP A HB2  6  
ATOM 8991  H HB3  . TRP A 1 74  ? 1.211   -4.269  -4.250  1.00 0.00 ? 74  TRP A HB3  6  
ATOM 8992  H HD1  . TRP A 1 74  ? -1.924  -3.423  -2.253  1.00 0.00 ? 74  TRP A HD1  6  
ATOM 8993  H HE1  . TRP A 1 74  ? -1.260  -3.008  0.199   1.00 0.00 ? 74  TRP A HE1  6  
ATOM 8994  H HE3  . TRP A 1 74  ? 3.161   -3.461  -2.773  1.00 0.00 ? 74  TRP A HE3  6  
ATOM 8995  H HZ2  . TRP A 1 74  ? 1.107   -2.732  1.712   1.00 0.00 ? 74  TRP A HZ2  6  
ATOM 8996  H HZ3  . TRP A 1 74  ? 4.554   -3.114  -0.774  1.00 0.00 ? 74  TRP A HZ3  6  
ATOM 8997  H HH2  . TRP A 1 74  ? 3.546   -2.756  1.421   1.00 0.00 ? 74  TRP A HH2  6  
ATOM 8998  N N    . PHE A 1 75  ? 2.745   -2.058  -4.853  1.00 0.00 ? 75  PHE A N    6  
ATOM 8999  C CA   . PHE A 1 75  ? 3.981   -1.352  -4.535  1.00 0.00 ? 75  PHE A CA   6  
ATOM 9000  C C    . PHE A 1 75  ? 3.959   0.066   -5.099  1.00 0.00 ? 75  PHE A C    6  
ATOM 9001  O O    . PHE A 1 75  ? 4.427   1.007   -4.460  1.00 0.00 ? 75  PHE A O    6  
ATOM 9002  C CB   . PHE A 1 75  ? 5.186   -2.115  -5.091  1.00 0.00 ? 75  PHE A CB   6  
ATOM 9003  C CG   . PHE A 1 75  ? 5.757   -3.116  -4.129  1.00 0.00 ? 75  PHE A CG   6  
ATOM 9004  C CD1  . PHE A 1 75  ? 5.093   -4.304  -3.868  1.00 0.00 ? 75  PHE A CD1  6  
ATOM 9005  C CD2  . PHE A 1 75  ? 6.959   -2.870  -3.485  1.00 0.00 ? 75  PHE A CD2  6  
ATOM 9006  C CE1  . PHE A 1 75  ? 5.616   -5.227  -2.982  1.00 0.00 ? 75  PHE A CE1  6  
ATOM 9007  C CE2  . PHE A 1 75  ? 7.488   -3.789  -2.598  1.00 0.00 ? 75  PHE A CE2  6  
ATOM 9008  C CZ   . PHE A 1 75  ? 6.816   -4.970  -2.347  1.00 0.00 ? 75  PHE A CZ   6  
ATOM 9009  H H    . PHE A 1 75  ? 2.791   -2.906  -5.342  1.00 0.00 ? 75  PHE A H    6  
ATOM 9010  H HA   . PHE A 1 75  ? 4.065   -1.298  -3.461  1.00 0.00 ? 75  PHE A HA   6  
ATOM 9011  H HB2  . PHE A 1 75  ? 4.887   -2.645  -5.982  1.00 0.00 ? 75  PHE A HB2  6  
ATOM 9012  H HB3  . PHE A 1 75  ? 5.965   -1.410  -5.341  1.00 0.00 ? 75  PHE A HB3  6  
ATOM 9013  H HD1  . PHE A 1 75  ? 4.156   -4.507  -4.365  1.00 0.00 ? 75  PHE A HD1  6  
ATOM 9014  H HD2  . PHE A 1 75  ? 7.486   -1.946  -3.680  1.00 0.00 ? 75  PHE A HD2  6  
ATOM 9015  H HE1  . PHE A 1 75  ? 5.089   -6.149  -2.788  1.00 0.00 ? 75  PHE A HE1  6  
ATOM 9016  H HE2  . PHE A 1 75  ? 8.426   -3.585  -2.103  1.00 0.00 ? 75  PHE A HE2  6  
ATOM 9017  H HZ   . PHE A 1 75  ? 7.227   -5.689  -1.655  1.00 0.00 ? 75  PHE A HZ   6  
ATOM 9018  N N    . ALA A 1 76  ? 3.411   0.209   -6.301  1.00 0.00 ? 76  ALA A N    6  
ATOM 9019  C CA   . ALA A 1 76  ? 3.325   1.511   -6.951  1.00 0.00 ? 76  ALA A CA   6  
ATOM 9020  C C    . ALA A 1 76  ? 2.485   2.482   -6.127  1.00 0.00 ? 76  ALA A C    6  
ATOM 9021  O O    . ALA A 1 76  ? 2.860   3.638   -5.941  1.00 0.00 ? 76  ALA A O    6  
ATOM 9022  C CB   . ALA A 1 76  ? 2.746   1.366   -8.351  1.00 0.00 ? 76  ALA A CB   6  
ATOM 9023  H H    . ALA A 1 76  ? 3.054   -0.579  -6.761  1.00 0.00 ? 76  ALA A H    6  
ATOM 9024  H HA   . ALA A 1 76  ? 4.327   1.906   -7.042  1.00 0.00 ? 76  ALA A HA   6  
ATOM 9025  H HB1  . ALA A 1 76  ? 2.239   0.415   -8.432  1.00 0.00 ? 76  ALA A HB1  6  
ATOM 9026  H HB2  . ALA A 1 76  ? 2.045   2.166   -8.535  1.00 0.00 ? 76  ALA A HB2  6  
ATOM 9027  H HB3  . ALA A 1 76  ? 3.544   1.411   -9.076  1.00 0.00 ? 76  ALA A HB3  6  
ATOM 9028  N N    . ASN A 1 77  ? 1.346   2.003   -5.637  1.00 0.00 ? 77  ASN A N    6  
ATOM 9029  C CA   . ASN A 1 77  ? 0.453   2.829   -4.834  1.00 0.00 ? 77  ASN A CA   6  
ATOM 9030  C C    . ASN A 1 77  ? 1.094   3.183   -3.496  1.00 0.00 ? 77  ASN A C    6  
ATOM 9031  O O    . ASN A 1 77  ? 0.840   4.250   -2.937  1.00 0.00 ? 77  ASN A O    6  
ATOM 9032  C CB   . ASN A 1 77  ? -0.874  2.104   -4.600  1.00 0.00 ? 77  ASN A CB   6  
ATOM 9033  C CG   . ASN A 1 77  ? -2.010  3.060   -4.293  1.00 0.00 ? 77  ASN A CG   6  
ATOM 9034  O OD1  . ASN A 1 77  ? -2.452  3.171   -3.150  1.00 0.00 ? 77  ASN A OD1  6  
ATOM 9035  N ND2  . ASN A 1 77  ? -2.489  3.758   -5.317  1.00 0.00 ? 77  ASN A ND2  6  
ATOM 9036  H H    . ASN A 1 77  ? 1.101   1.072   -5.820  1.00 0.00 ? 77  ASN A H    6  
ATOM 9037  H HA   . ASN A 1 77  ? 0.263   3.740   -5.381  1.00 0.00 ? 77  ASN A HA   6  
ATOM 9038  H HB2  . ASN A 1 77  ? -1.132  1.543   -5.487  1.00 0.00 ? 77  ASN A HB2  6  
ATOM 9039  H HB3  . ASN A 1 77  ? -0.765  1.425   -3.768  1.00 0.00 ? 77  ASN A HB3  6  
ATOM 9040  H HD21 . ASN A 1 77  ? -2.088  3.618   -6.201  1.00 0.00 ? 77  ASN A HD21 6  
ATOM 9041  H HD22 . ASN A 1 77  ? -3.223  4.384   -5.147  1.00 0.00 ? 77  ASN A HD22 6  
ATOM 9042  N N    . ARG A 1 78  ? 1.928   2.281   -2.989  1.00 0.00 ? 78  ARG A N    6  
ATOM 9043  C CA   . ARG A 1 78  ? 2.606   2.498   -1.716  1.00 0.00 ? 78  ARG A CA   6  
ATOM 9044  C C    . ARG A 1 78  ? 3.664   3.589   -1.843  1.00 0.00 ? 78  ARG A C    6  
ATOM 9045  O O    . ARG A 1 78  ? 4.049   4.213   -0.854  1.00 0.00 ? 78  ARG A O    6  
ATOM 9046  C CB   . ARG A 1 78  ? 3.253   1.199   -1.231  1.00 0.00 ? 78  ARG A CB   6  
ATOM 9047  C CG   . ARG A 1 78  ? 2.260   0.069   -1.013  1.00 0.00 ? 78  ARG A CG   6  
ATOM 9048  C CD   . ARG A 1 78  ? 1.615   0.152   0.362   1.00 0.00 ? 78  ARG A CD   6  
ATOM 9049  N NE   . ARG A 1 78  ? 0.261   -0.395  0.365   1.00 0.00 ? 78  ARG A NE   6  
ATOM 9050  C CZ   . ARG A 1 78  ? -0.586  -0.255  1.378   1.00 0.00 ? 78  ARG A CZ   6  
ATOM 9051  N NH1  . ARG A 1 78  ? -0.221  0.412   2.464   1.00 0.00 ? 78  ARG A NH1  6  
ATOM 9052  N NH2  . ARG A 1 78  ? -1.802  -0.782  1.306   1.00 0.00 ? 78  ARG A NH2  6  
ATOM 9053  H H    . ARG A 1 78  ? 2.091   1.450   -3.481  1.00 0.00 ? 78  ARG A H    6  
ATOM 9054  H HA   . ARG A 1 78  ? 1.866   2.812   -0.995  1.00 0.00 ? 78  ARG A HA   6  
ATOM 9055  H HB2  . ARG A 1 78  ? 3.977   0.875   -1.964  1.00 0.00 ? 78  ARG A HB2  6  
ATOM 9056  H HB3  . ARG A 1 78  ? 3.759   1.390   -0.297  1.00 0.00 ? 78  ARG A HB3  6  
ATOM 9057  H HG2  . ARG A 1 78  ? 1.488   0.130   -1.765  1.00 0.00 ? 78  ARG A HG2  6  
ATOM 9058  H HG3  . ARG A 1 78  ? 2.778   -0.875  -1.101  1.00 0.00 ? 78  ARG A HG3  6  
ATOM 9059  H HD2  . ARG A 1 78  ? 2.219   -0.404  1.063   1.00 0.00 ? 78  ARG A HD2  6  
ATOM 9060  H HD3  . ARG A 1 78  ? 1.575   1.188   0.664   1.00 0.00 ? 78  ARG A HD3  6  
ATOM 9061  H HE   . ARG A 1 78  ? -0.030  -0.891  -0.428  1.00 0.00 ? 78  ARG A HE   6  
ATOM 9062  H HH11 . ARG A 1 78  ? 0.694   0.811   2.521   1.00 0.00 ? 78  ARG A HH11 6  
ATOM 9063  H HH12 . ARG A 1 78  ? -0.861  0.517   3.226   1.00 0.00 ? 78  ARG A HH12 6  
ATOM 9064  H HH21 . ARG A 1 78  ? -2.081  -1.285  0.489   1.00 0.00 ? 78  ARG A HH21 6  
ATOM 9065  H HH22 . ARG A 1 78  ? -2.439  -0.676  2.070   1.00 0.00 ? 78  ARG A HH22 6  
ATOM 9066  N N    . ARG A 1 79  ? 4.131   3.814   -3.067  1.00 0.00 ? 79  ARG A N    6  
ATOM 9067  C CA   . ARG A 1 79  ? 5.147   4.829   -3.323  1.00 0.00 ? 79  ARG A CA   6  
ATOM 9068  C C    . ARG A 1 79  ? 4.503   6.150   -3.733  1.00 0.00 ? 79  ARG A C    6  
ATOM 9069  O O    . ARG A 1 79  ? 5.090   7.219   -3.561  1.00 0.00 ? 79  ARG A O    6  
ATOM 9070  C CB   . ARG A 1 79  ? 6.107   4.356   -4.416  1.00 0.00 ? 79  ARG A CB   6  
ATOM 9071  C CG   . ARG A 1 79  ? 7.308   3.592   -3.882  1.00 0.00 ? 79  ARG A CG   6  
ATOM 9072  C CD   . ARG A 1 79  ? 8.499   3.702   -4.821  1.00 0.00 ? 79  ARG A CD   6  
ATOM 9073  N NE   . ARG A 1 79  ? 9.770   3.619   -4.106  1.00 0.00 ? 79  ARG A NE   6  
ATOM 9074  C CZ   . ARG A 1 79  ? 10.951  3.810   -4.682  1.00 0.00 ? 79  ARG A CZ   6  
ATOM 9075  N NH1  . ARG A 1 79  ? 11.024  4.095   -5.974  1.00 0.00 ? 79  ARG A NH1  6  
ATOM 9076  N NH2  . ARG A 1 79  ? 12.063  3.718   -3.964  1.00 0.00 ? 79  ARG A NH2  6  
ATOM 9077  H H    . ARG A 1 79  ? 3.786   3.285   -3.816  1.00 0.00 ? 79  ARG A H    6  
ATOM 9078  H HA   . ARG A 1 79  ? 5.702   4.981   -2.409  1.00 0.00 ? 79  ARG A HA   6  
ATOM 9079  H HB2  . ARG A 1 79  ? 5.570   3.710   -5.095  1.00 0.00 ? 79  ARG A HB2  6  
ATOM 9080  H HB3  . ARG A 1 79  ? 6.467   5.217   -4.959  1.00 0.00 ? 79  ARG A HB3  6  
ATOM 9081  H HG2  . ARG A 1 79  ? 7.584   3.999   -2.921  1.00 0.00 ? 79  ARG A HG2  6  
ATOM 9082  H HG3  . ARG A 1 79  ? 7.041   2.552   -3.772  1.00 0.00 ? 79  ARG A HG3  6  
ATOM 9083  H HD2  . ARG A 1 79  ? 8.449   2.898   -5.540  1.00 0.00 ? 79  ARG A HD2  6  
ATOM 9084  H HD3  . ARG A 1 79  ? 8.448   4.649   -5.337  1.00 0.00 ? 79  ARG A HD3  6  
ATOM 9085  H HE   . ARG A 1 79  ? 9.739   3.409   -3.149  1.00 0.00 ? 79  ARG A HE   6  
ATOM 9086  H HH11 . ARG A 1 79  ? 10.188  4.166   -6.518  1.00 0.00 ? 79  ARG A HH11 6  
ATOM 9087  H HH12 . ARG A 1 79  ? 11.915  4.240   -6.405  1.00 0.00 ? 79  ARG A HH12 6  
ATOM 9088  H HH21 . ARG A 1 79  ? 12.012  3.503   -2.989  1.00 0.00 ? 79  ARG A HH21 6  
ATOM 9089  H HH22 . ARG A 1 79  ? 12.952  3.862   -4.398  1.00 0.00 ? 79  ARG A HH22 6  
ATOM 9090  N N    . LYS A 1 80  ? 3.294   6.070   -4.277  1.00 0.00 ? 80  LYS A N    6  
ATOM 9091  C CA   . LYS A 1 80  ? 2.569   7.258   -4.711  1.00 0.00 ? 80  LYS A CA   6  
ATOM 9092  C C    . LYS A 1 80  ? 1.918   7.963   -3.525  1.00 0.00 ? 80  LYS A C    6  
ATOM 9093  O O    . LYS A 1 80  ? 1.796   9.187   -3.510  1.00 0.00 ? 80  LYS A O    6  
ATOM 9094  C CB   . LYS A 1 80  ? 1.502   6.882   -5.742  1.00 0.00 ? 80  LYS A CB   6  
ATOM 9095  C CG   . LYS A 1 80  ? 2.010   6.889   -7.173  1.00 0.00 ? 80  LYS A CG   6  
ATOM 9096  C CD   . LYS A 1 80  ? 0.975   6.331   -8.135  1.00 0.00 ? 80  LYS A CD   6  
ATOM 9097  C CE   . LYS A 1 80  ? -0.143  7.331   -8.393  1.00 0.00 ? 80  LYS A CE   6  
ATOM 9098  N NZ   . LYS A 1 80  ? -1.352  6.676   -8.963  1.00 0.00 ? 80  LYS A NZ   6  
ATOM 9099  H H    . LYS A 1 80  ? 2.877   5.189   -4.388  1.00 0.00 ? 80  LYS A H    6  
ATOM 9100  H HA   . LYS A 1 80  ? 3.278   7.930   -5.169  1.00 0.00 ? 80  LYS A HA   6  
ATOM 9101  H HB2  . LYS A 1 80  ? 1.135   5.891   -5.517  1.00 0.00 ? 80  LYS A HB2  6  
ATOM 9102  H HB3  . LYS A 1 80  ? 0.684   7.584   -5.668  1.00 0.00 ? 80  LYS A HB3  6  
ATOM 9103  H HG2  . LYS A 1 80  ? 2.240   7.905   -7.459  1.00 0.00 ? 80  LYS A HG2  6  
ATOM 9104  H HG3  . LYS A 1 80  ? 2.904   6.286   -7.231  1.00 0.00 ? 80  LYS A HG3  6  
ATOM 9105  H HD2  . LYS A 1 80  ? 1.456   6.097   -9.073  1.00 0.00 ? 80  LYS A HD2  6  
ATOM 9106  H HD3  . LYS A 1 80  ? 0.550   5.432   -7.712  1.00 0.00 ? 80  LYS A HD3  6  
ATOM 9107  H HE2  . LYS A 1 80  ? -0.406  7.804   -7.460  1.00 0.00 ? 80  LYS A HE2  6  
ATOM 9108  H HE3  . LYS A 1 80  ? 0.214   8.077   -9.088  1.00 0.00 ? 80  LYS A HE3  6  
ATOM 9109  H HZ1  . LYS A 1 80  ? -1.092  6.106   -9.794  1.00 0.00 ? 80  LYS A HZ1  6  
ATOM 9110  H HZ2  . LYS A 1 80  ? -2.044  7.395   -9.254  1.00 0.00 ? 80  LYS A HZ2  6  
ATOM 9111  H HZ3  . LYS A 1 80  ? -1.790  6.054   -8.254  1.00 0.00 ? 80  LYS A HZ3  6  
ATOM 9112  N N    . GLU A 1 81  ? 1.505   7.181   -2.532  1.00 0.00 ? 81  GLU A N    6  
ATOM 9113  C CA   . GLU A 1 81  ? 0.868   7.733   -1.342  1.00 0.00 ? 81  GLU A CA   6  
ATOM 9114  C C    . GLU A 1 81  ? 1.892   8.426   -0.448  1.00 0.00 ? 81  GLU A C    6  
ATOM 9115  O O    . GLU A 1 81  ? 1.701   9.571   -0.041  1.00 0.00 ? 81  GLU A O    6  
ATOM 9116  C CB   . GLU A 1 81  ? 0.157   6.627   -0.559  1.00 0.00 ? 81  GLU A CB   6  
ATOM 9117  C CG   . GLU A 1 81  ? 1.106   5.678   0.153   1.00 0.00 ? 81  GLU A CG   6  
ATOM 9118  C CD   . GLU A 1 81  ? 0.388   4.510   0.801   1.00 0.00 ? 81  GLU A CD   6  
ATOM 9119  O OE1  . GLU A 1 81  ? -0.837  4.378   0.594   1.00 0.00 ? 81  GLU A OE1  6  
ATOM 9120  O OE2  . GLU A 1 81  ? 1.050   3.729   1.515   1.00 0.00 ? 81  GLU A OE2  6  
ATOM 9121  H H    . GLU A 1 81  ? 1.631   6.212   -2.602  1.00 0.00 ? 81  GLU A H    6  
ATOM 9122  H HA   . GLU A 1 81  ? 0.138   8.460   -1.663  1.00 0.00 ? 81  GLU A HA   6  
ATOM 9123  H HB2  . GLU A 1 81  ? -0.486  7.082   0.181   1.00 0.00 ? 81  GLU A HB2  6  
ATOM 9124  H HB3  . GLU A 1 81  ? -0.449  6.051   -1.243  1.00 0.00 ? 81  GLU A HB3  6  
ATOM 9125  H HG2  . GLU A 1 81  ? 1.814   5.291   -0.566  1.00 0.00 ? 81  GLU A HG2  6  
ATOM 9126  H HG3  . GLU A 1 81  ? 1.636   6.225   0.918   1.00 0.00 ? 81  GLU A HG3  6  
ATOM 9127  N N    . GLU A 1 82  ? 2.979   7.722   -0.147  1.00 0.00 ? 82  GLU A N    6  
ATOM 9128  C CA   . GLU A 1 82  ? 4.033   8.269   0.699   1.00 0.00 ? 82  GLU A CA   6  
ATOM 9129  C C    . GLU A 1 82  ? 4.544   9.595   0.143   1.00 0.00 ? 82  GLU A C    6  
ATOM 9130  O O    . GLU A 1 82  ? 4.839   10.524  0.894   1.00 0.00 ? 82  GLU A O    6  
ATOM 9131  C CB   . GLU A 1 82  ? 5.189   7.274   0.820   1.00 0.00 ? 82  GLU A CB   6  
ATOM 9132  C CG   . GLU A 1 82  ? 5.997   7.122   -0.457  1.00 0.00 ? 82  GLU A CG   6  
ATOM 9133  C CD   . GLU A 1 82  ? 7.121   6.113   -0.320  1.00 0.00 ? 82  GLU A CD   6  
ATOM 9134  O OE1  . GLU A 1 82  ? 6.889   5.048   0.289   1.00 0.00 ? 82  GLU A OE1  6  
ATOM 9135  O OE2  . GLU A 1 82  ? 8.231   6.388   -0.822  1.00 0.00 ? 82  GLU A OE2  6  
ATOM 9136  H H    . GLU A 1 82  ? 3.075   6.814   -0.503  1.00 0.00 ? 82  GLU A H    6  
ATOM 9137  H HA   . GLU A 1 82  ? 3.615   8.442   1.679   1.00 0.00 ? 82  GLU A HA   6  
ATOM 9138  H HB2  . GLU A 1 82  ? 5.853   7.606   1.605   1.00 0.00 ? 82  GLU A HB2  6  
ATOM 9139  H HB3  . GLU A 1 82  ? 4.789   6.307   1.085   1.00 0.00 ? 82  GLU A HB3  6  
ATOM 9140  H HG2  . GLU A 1 82  ? 5.338   6.799   -1.249  1.00 0.00 ? 82  GLU A HG2  6  
ATOM 9141  H HG3  . GLU A 1 82  ? 6.424   8.081   -0.715  1.00 0.00 ? 82  GLU A HG3  6  
ATOM 9142  N N    . ALA A 1 83  ? 4.648   9.674   -1.180  1.00 0.00 ? 83  ALA A N    6  
ATOM 9143  C CA   . ALA A 1 83  ? 5.122   10.885  -1.838  1.00 0.00 ? 83  ALA A CA   6  
ATOM 9144  C C    . ALA A 1 83  ? 3.990   11.889  -2.022  1.00 0.00 ? 83  ALA A C    6  
ATOM 9145  O O    . ALA A 1 83  ? 4.229   13.075  -2.253  1.00 0.00 ? 83  ALA A O    6  
ATOM 9146  C CB   . ALA A 1 83  ? 5.751   10.544  -3.181  1.00 0.00 ? 83  ALA A CB   6  
ATOM 9147  H H    . ALA A 1 83  ? 4.398   8.900   -1.726  1.00 0.00 ? 83  ALA A H    6  
ATOM 9148  H HA   . ALA A 1 83  ? 5.885   11.328  -1.213  1.00 0.00 ? 83  ALA A HA   6  
ATOM 9149  H HB1  . ALA A 1 83  ? 6.704   11.047  -3.269  1.00 0.00 ? 83  ALA A HB1  6  
ATOM 9150  H HB2  . ALA A 1 83  ? 5.899   9.477   -3.248  1.00 0.00 ? 83  ALA A HB2  6  
ATOM 9151  H HB3  . ALA A 1 83  ? 5.098   10.869  -3.977  1.00 0.00 ? 83  ALA A HB3  6  
ATOM 9152  N N    . PHE A 1 84  ? 2.756   11.408  -1.918  1.00 0.00 ? 84  PHE A N    6  
ATOM 9153  C CA   . PHE A 1 84  ? 1.585   12.264  -2.075  1.00 0.00 ? 84  PHE A CA   6  
ATOM 9154  C C    . PHE A 1 84  ? 1.657   13.461  -1.131  1.00 0.00 ? 84  PHE A C    6  
ATOM 9155  O O    . PHE A 1 84  ? 1.802   14.602  -1.569  1.00 0.00 ? 84  PHE A O    6  
ATOM 9156  C CB   . PHE A 1 84  ? 0.306   11.468  -1.811  1.00 0.00 ? 84  PHE A CB   6  
ATOM 9157  C CG   . PHE A 1 84  ? -0.926  12.105  -2.387  1.00 0.00 ? 84  PHE A CG   6  
ATOM 9158  C CD1  . PHE A 1 84  ? -1.380  13.324  -1.910  1.00 0.00 ? 84  PHE A CD1  6  
ATOM 9159  C CD2  . PHE A 1 84  ? -1.631  11.485  -3.406  1.00 0.00 ? 84  PHE A CD2  6  
ATOM 9160  C CE1  . PHE A 1 84  ? -2.513  13.912  -2.438  1.00 0.00 ? 84  PHE A CE1  6  
ATOM 9161  C CE2  . PHE A 1 84  ? -2.766  12.068  -3.938  1.00 0.00 ? 84  PHE A CE2  6  
ATOM 9162  C CZ   . PHE A 1 84  ? -3.207  13.284  -3.454  1.00 0.00 ? 84  PHE A CZ   6  
ATOM 9163  H H    . PHE A 1 84  ? 2.629   10.454  -1.732  1.00 0.00 ? 84  PHE A H    6  
ATOM 9164  H HA   . PHE A 1 84  ? 1.572   12.623  -3.092  1.00 0.00 ? 84  PHE A HA   6  
ATOM 9165  H HB2  . PHE A 1 84  ? 0.405   10.485  -2.247  1.00 0.00 ? 84  PHE A HB2  6  
ATOM 9166  H HB3  . PHE A 1 84  ? 0.164   11.371  -0.745  1.00 0.00 ? 84  PHE A HB3  6  
ATOM 9167  H HD1  . PHE A 1 84  ? -0.838  13.817  -1.116  1.00 0.00 ? 84  PHE A HD1  6  
ATOM 9168  H HD2  . PHE A 1 84  ? -1.286  10.533  -3.786  1.00 0.00 ? 84  PHE A HD2  6  
ATOM 9169  H HE1  . PHE A 1 84  ? -2.856  14.863  -2.057  1.00 0.00 ? 84  PHE A HE1  6  
ATOM 9170  H HE2  . PHE A 1 84  ? -3.305  11.575  -4.733  1.00 0.00 ? 84  PHE A HE2  6  
ATOM 9171  H HZ   . PHE A 1 84  ? -4.093  13.741  -3.868  1.00 0.00 ? 84  PHE A HZ   6  
ATOM 9172  N N    . ARG A 1 85  ? 1.552   13.191  0.166   1.00 0.00 ? 85  ARG A N    6  
ATOM 9173  C CA   . ARG A 1 85  ? 1.603   14.245  1.172   1.00 0.00 ? 85  ARG A CA   6  
ATOM 9174  C C    . ARG A 1 85  ? 2.692   15.261  0.841   1.00 0.00 ? 85  ARG A C    6  
ATOM 9175  O O    . ARG A 1 85  ? 2.630   16.412  1.271   1.00 0.00 ? 85  ARG A O    6  
ATOM 9176  C CB   . ARG A 1 85  ? 1.855   13.645  2.557   1.00 0.00 ? 85  ARG A CB   6  
ATOM 9177  C CG   . ARG A 1 85  ? 0.634   12.968  3.158   1.00 0.00 ? 85  ARG A CG   6  
ATOM 9178  C CD   . ARG A 1 85  ? 0.898   12.506  4.583   1.00 0.00 ? 85  ARG A CD   6  
ATOM 9179  N NE   . ARG A 1 85  ? 1.306   13.610  5.449   1.00 0.00 ? 85  ARG A NE   6  
ATOM 9180  C CZ   . ARG A 1 85  ? 2.560   14.034  5.558   1.00 0.00 ? 85  ARG A CZ   6  
ATOM 9181  N NH1  . ARG A 1 85  ? 3.524   13.451  4.859   1.00 0.00 ? 85  ARG A NH1  6  
ATOM 9182  N NH2  . ARG A 1 85  ? 2.852   15.044  6.367   1.00 0.00 ? 85  ARG A NH2  6  
ATOM 9183  H H    . ARG A 1 85  ? 1.438   12.261  0.453   1.00 0.00 ? 85  ARG A H    6  
ATOM 9184  H HA   . ARG A 1 85  ? 0.647   14.747  1.175   1.00 0.00 ? 85  ARG A HA   6  
ATOM 9185  H HB2  . ARG A 1 85  ? 2.645   12.913  2.481   1.00 0.00 ? 85  ARG A HB2  6  
ATOM 9186  H HB3  . ARG A 1 85  ? 2.168   14.433  3.225   1.00 0.00 ? 85  ARG A HB3  6  
ATOM 9187  H HG2  . ARG A 1 85  ? -0.188  13.668  3.165   1.00 0.00 ? 85  ARG A HG2  6  
ATOM 9188  H HG3  . ARG A 1 85  ? 0.375   12.111  2.554   1.00 0.00 ? 85  ARG A HG3  6  
ATOM 9189  H HD2  . ARG A 1 85  ? -0.005  12.066  4.978   1.00 0.00 ? 85  ARG A HD2  6  
ATOM 9190  H HD3  . ARG A 1 85  ? 1.683   11.765  4.567   1.00 0.00 ? 85  ARG A HD3  6  
ATOM 9191  H HE   . ARG A 1 85  ? 0.609   14.055  5.974   1.00 0.00 ? 85  ARG A HE   6  
ATOM 9192  H HH11 . ARG A 1 85  ? 3.306   12.690  4.248   1.00 0.00 ? 85  ARG A HH11 6  
ATOM 9193  H HH12 . ARG A 1 85  ? 4.467   13.773  4.942   1.00 0.00 ? 85  ARG A HH12 6  
ATOM 9194  H HH21 . ARG A 1 85  ? 2.128   15.487  6.895   1.00 0.00 ? 85  ARG A HH21 6  
ATOM 9195  H HH22 . ARG A 1 85  ? 3.796   15.363  6.449   1.00 0.00 ? 85  ARG A HH22 6  
ATOM 9196  N N    . GLN A 1 86  ? 3.687   14.826  0.074   1.00 0.00 ? 86  GLN A N    6  
ATOM 9197  C CA   . GLN A 1 86  ? 4.789   15.698  -0.314  1.00 0.00 ? 86  GLN A CA   6  
ATOM 9198  C C    . GLN A 1 86  ? 4.455   16.463  -1.590  1.00 0.00 ? 86  GLN A C    6  
ATOM 9199  O O    . GLN A 1 86  ? 4.742   17.654  -1.706  1.00 0.00 ? 86  GLN A O    6  
ATOM 9200  C CB   . GLN A 1 86  ? 6.067   14.881  -0.513  1.00 0.00 ? 86  GLN A CB   6  
ATOM 9201  C CG   . GLN A 1 86  ? 6.523   14.149  0.738   1.00 0.00 ? 86  GLN A CG   6  
ATOM 9202  C CD   . GLN A 1 86  ? 8.009   13.848  0.730   1.00 0.00 ? 86  GLN A CD   6  
ATOM 9203  O OE1  . GLN A 1 86  ? 8.509   13.159  -0.159  1.00 0.00 ? 86  GLN A OE1  6  
ATOM 9204  N NE2  . GLN A 1 86  ? 8.723   14.365  1.722   1.00 0.00 ? 86  GLN A NE2  6  
ATOM 9205  H H    . GLN A 1 86  ? 3.679   13.898  -0.238  1.00 0.00 ? 86  GLN A H    6  
ATOM 9206  H HA   . GLN A 1 86  ? 4.947   16.407  0.485   1.00 0.00 ? 86  GLN A HA   6  
ATOM 9207  H HB2  . GLN A 1 86  ? 5.896   14.151  -1.290  1.00 0.00 ? 86  GLN A HB2  6  
ATOM 9208  H HB3  . GLN A 1 86  ? 6.860   15.546  -0.824  1.00 0.00 ? 86  GLN A HB3  6  
ATOM 9209  H HG2  . GLN A 1 86  ? 6.301   14.761  1.599   1.00 0.00 ? 86  GLN A HG2  6  
ATOM 9210  H HG3  . GLN A 1 86  ? 5.982   13.217  0.811   1.00 0.00 ? 86  GLN A HG3  6  
ATOM 9211  H HE21 . GLN A 1 86  ? 8.257   14.903  2.396   1.00 0.00 ? 86  GLN A HE21 6  
ATOM 9212  H HE22 . GLN A 1 86  ? 9.686   14.186  1.742   1.00 0.00 ? 86  GLN A HE22 6  
ATOM 9213  N N    . LYS A 1 87  ? 3.848   15.769  -2.548  1.00 0.00 ? 87  LYS A N    6  
ATOM 9214  C CA   . LYS A 1 87  ? 3.474   16.382  -3.817  1.00 0.00 ? 87  LYS A CA   6  
ATOM 9215  C C    . LYS A 1 87  ? 2.534   17.563  -3.595  1.00 0.00 ? 87  LYS A C    6  
ATOM 9216  O O    . LYS A 1 87  ? 2.738   18.644  -4.149  1.00 0.00 ? 87  LYS A O    6  
ATOM 9217  C CB   . LYS A 1 87  ? 2.806   15.350  -4.728  1.00 0.00 ? 87  LYS A CB   6  
ATOM 9218  C CG   . LYS A 1 87  ? 1.915   15.965  -5.793  1.00 0.00 ? 87  LYS A CG   6  
ATOM 9219  C CD   . LYS A 1 87  ? 1.118   14.904  -6.533  1.00 0.00 ? 87  LYS A CD   6  
ATOM 9220  C CE   . LYS A 1 87  ? -0.094  14.457  -5.731  1.00 0.00 ? 87  LYS A CE   6  
ATOM 9221  N NZ   . LYS A 1 87  ? -1.140  15.515  -5.669  1.00 0.00 ? 87  LYS A NZ   6  
ATOM 9222  H H    . LYS A 1 87  ? 3.646   14.822  -2.396  1.00 0.00 ? 87  LYS A H    6  
ATOM 9223  H HA   . LYS A 1 87  ? 4.375   16.739  -4.291  1.00 0.00 ? 87  LYS A HA   6  
ATOM 9224  H HB2  . LYS A 1 87  ? 3.574   14.771  -5.220  1.00 0.00 ? 87  LYS A HB2  6  
ATOM 9225  H HB3  . LYS A 1 87  ? 2.203   14.689  -4.121  1.00 0.00 ? 87  LYS A HB3  6  
ATOM 9226  H HG2  . LYS A 1 87  ? 1.229   16.653  -5.323  1.00 0.00 ? 87  LYS A HG2  6  
ATOM 9227  H HG3  . LYS A 1 87  ? 2.533   16.498  -6.502  1.00 0.00 ? 87  LYS A HG3  6  
ATOM 9228  H HD2  . LYS A 1 87  ? 0.781   15.311  -7.475  1.00 0.00 ? 87  LYS A HD2  6  
ATOM 9229  H HD3  . LYS A 1 87  ? 1.754   14.050  -6.716  1.00 0.00 ? 87  LYS A HD3  6  
ATOM 9230  H HE2  . LYS A 1 87  ? -0.512  13.576  -6.194  1.00 0.00 ? 87  LYS A HE2  6  
ATOM 9231  H HE3  . LYS A 1 87  ? 0.224   14.218  -4.726  1.00 0.00 ? 87  LYS A HE3  6  
ATOM 9232  H HZ1  . LYS A 1 87  ? -0.717  16.446  -5.856  1.00 0.00 ? 87  LYS A HZ1  6  
ATOM 9233  H HZ2  . LYS A 1 87  ? -1.579  15.529  -4.726  1.00 0.00 ? 87  LYS A HZ2  6  
ATOM 9234  H HZ3  . LYS A 1 87  ? -1.877  15.331  -6.379  1.00 0.00 ? 87  LYS A HZ3  6  
ATOM 9235  N N    . LEU A 1 88  ? 1.507   17.350  -2.780  1.00 0.00 ? 88  LEU A N    6  
ATOM 9236  C CA   . LEU A 1 88  ? 0.536   18.398  -2.483  1.00 0.00 ? 88  LEU A CA   6  
ATOM 9237  C C    . LEU A 1 88  ? 1.173   19.513  -1.659  1.00 0.00 ? 88  LEU A C    6  
ATOM 9238  O O    . LEU A 1 88  ? 0.570   20.564  -1.447  1.00 0.00 ? 88  LEU A O    6  
ATOM 9239  C CB   . LEU A 1 88  ? -0.661  17.814  -1.732  1.00 0.00 ? 88  LEU A CB   6  
ATOM 9240  C CG   . LEU A 1 88  ? -0.338  17.032  -0.459  1.00 0.00 ? 88  LEU A CG   6  
ATOM 9241  C CD1  . LEU A 1 88  ? 0.265   17.950  0.593   1.00 0.00 ? 88  LEU A CD1  6  
ATOM 9242  C CD2  . LEU A 1 88  ? -1.588  16.350  0.080   1.00 0.00 ? 88  LEU A CD2  6  
ATOM 9243  H H    . LEU A 1 88  ? 1.397   16.468  -2.368  1.00 0.00 ? 88  LEU A H    6  
ATOM 9244  H HA   . LEU A 1 88  ? 0.196   18.810  -3.422  1.00 0.00 ? 88  LEU A HA   6  
ATOM 9245  H HB2  . LEU A 1 88  ? -1.313  18.631  -1.462  1.00 0.00 ? 88  LEU A HB2  6  
ATOM 9246  H HB3  . LEU A 1 88  ? -1.181  17.149  -2.407  1.00 0.00 ? 88  LEU A HB3  6  
ATOM 9247  H HG   . LEU A 1 88  ? 0.389   16.266  -0.689  1.00 0.00 ? 88  LEU A HG   6  
ATOM 9248  H HD11 . LEU A 1 88  ? -0.177  18.932  0.510   1.00 0.00 ? 88  LEU A HD11 6  
ATOM 9249  H HD12 . LEU A 1 88  ? 1.331   18.021  0.439   1.00 0.00 ? 88  LEU A HD12 6  
ATOM 9250  H HD13 . LEU A 1 88  ? 0.069   17.549  1.576   1.00 0.00 ? 88  LEU A HD13 6  
ATOM 9251  H HD21 . LEU A 1 88  ? -1.393  15.296  0.212   1.00 0.00 ? 88  LEU A HD21 6  
ATOM 9252  H HD22 . LEU A 1 88  ? -2.399  16.480  -0.621  1.00 0.00 ? 88  LEU A HD22 6  
ATOM 9253  H HD23 . LEU A 1 88  ? -1.857  16.789  1.029   1.00 0.00 ? 88  LEU A HD23 6  
ATOM 9254  N N    . ALA A 1 89  ? 2.397   19.276  -1.199  1.00 0.00 ? 89  ALA A N    6  
ATOM 9255  C CA   . ALA A 1 89  ? 3.117   20.261  -0.402  1.00 0.00 ? 89  ALA A CA   6  
ATOM 9256  C C    . ALA A 1 89  ? 3.958   21.174  -1.287  1.00 0.00 ? 89  ALA A C    6  
ATOM 9257  O O    . ALA A 1 89  ? 4.248   22.313  -0.922  1.00 0.00 ? 89  ALA A O    6  
ATOM 9258  C CB   . ALA A 1 89  ? 3.996   19.566  0.628   1.00 0.00 ? 89  ALA A CB   6  
ATOM 9259  H H    . ALA A 1 89  ? 2.826   18.418  -1.401  1.00 0.00 ? 89  ALA A H    6  
ATOM 9260  H HA   . ALA A 1 89  ? 2.390   20.859  0.127   1.00 0.00 ? 89  ALA A HA   6  
ATOM 9261  H HB1  . ALA A 1 89  ? 4.866   19.154  0.138   1.00 0.00 ? 89  ALA A HB1  6  
ATOM 9262  H HB2  . ALA A 1 89  ? 4.307   20.280  1.376   1.00 0.00 ? 89  ALA A HB2  6  
ATOM 9263  H HB3  . ALA A 1 89  ? 3.438   18.771  1.099   1.00 0.00 ? 89  ALA A HB3  6  
ATOM 9264  N N    . MET A 1 90  ? 4.348   20.667  -2.452  1.00 0.00 ? 90  MET A N    6  
ATOM 9265  C CA   . MET A 1 90  ? 5.155   21.439  -3.390  1.00 0.00 ? 90  MET A CA   6  
ATOM 9266  C C    . MET A 1 90  ? 4.371   22.631  -3.929  1.00 0.00 ? 90  MET A C    6  
ATOM 9267  O O    . MET A 1 90  ? 4.918   23.721  -4.096  1.00 0.00 ? 90  MET A O    6  
ATOM 9268  C CB   . MET A 1 90  ? 5.618   20.552  -4.547  1.00 0.00 ? 90  MET A CB   6  
ATOM 9269  C CG   . MET A 1 90  ? 6.309   19.275  -4.096  1.00 0.00 ? 90  MET A CG   6  
ATOM 9270  S SD   . MET A 1 90  ? 6.552   18.103  -5.444  1.00 0.00 ? 90  MET A SD   6  
ATOM 9271  C CE   . MET A 1 90  ? 6.990   16.625  -4.533  1.00 0.00 ? 90  MET A CE   6  
ATOM 9272  H H    . MET A 1 90  ? 4.085   19.753  -2.688  1.00 0.00 ? 90  MET A H    6  
ATOM 9273  H HA   . MET A 1 90  ? 6.022   21.803  -2.858  1.00 0.00 ? 90  MET A HA   6  
ATOM 9274  H HB2  . MET A 1 90  ? 4.760   20.280  -5.142  1.00 0.00 ? 90  MET A HB2  6  
ATOM 9275  H HB3  . MET A 1 90  ? 6.309   21.111  -5.160  1.00 0.00 ? 90  MET A HB3  6  
ATOM 9276  H HG2  . MET A 1 90  ? 7.274   19.530  -3.682  1.00 0.00 ? 90  MET A HG2  6  
ATOM 9277  H HG3  . MET A 1 90  ? 5.706   18.806  -3.333  1.00 0.00 ? 90  MET A HG3  6  
ATOM 9278  H HE1  . MET A 1 90  ? 7.149   16.876  -3.495  1.00 0.00 ? 90  MET A HE1  6  
ATOM 9279  H HE2  . MET A 1 90  ? 6.190   15.904  -4.610  1.00 0.00 ? 90  MET A HE2  6  
ATOM 9280  H HE3  . MET A 1 90  ? 7.896   16.204  -4.945  1.00 0.00 ? 90  MET A HE3  6  
ATOM 9281  N N    . ASP A 1 91  ? 3.089   22.416  -4.200  1.00 0.00 ? 91  ASP A N    6  
ATOM 9282  C CA   . ASP A 1 91  ? 2.230   23.474  -4.720  1.00 0.00 ? 91  ASP A CA   6  
ATOM 9283  C C    . ASP A 1 91  ? 2.176   24.654  -3.755  1.00 0.00 ? 91  ASP A C    6  
ATOM 9284  O O    . ASP A 1 91  ? 2.742   24.602  -2.664  1.00 0.00 ? 91  ASP A O    6  
ATOM 9285  C CB   . ASP A 1 91  ? 0.819   22.937  -4.970  1.00 0.00 ? 91  ASP A CB   6  
ATOM 9286  C CG   . ASP A 1 91  ? 0.031   23.807  -5.930  1.00 0.00 ? 91  ASP A CG   6  
ATOM 9287  O OD1  . ASP A 1 91  ? 0.614   24.259  -6.937  1.00 0.00 ? 91  ASP A OD1  6  
ATOM 9288  O OD2  . ASP A 1 91  ? -1.170  24.035  -5.673  1.00 0.00 ? 91  ASP A OD2  6  
ATOM 9289  H H    . ASP A 1 91  ? 2.710   21.525  -4.046  1.00 0.00 ? 91  ASP A H    6  
ATOM 9290  H HA   . ASP A 1 91  ? 2.648   23.810  -5.657  1.00 0.00 ? 91  ASP A HA   6  
ATOM 9291  H HB2  . ASP A 1 91  ? 0.887   21.944  -5.388  1.00 0.00 ? 91  ASP A HB2  6  
ATOM 9292  H HB3  . ASP A 1 91  ? 0.287   22.893  -4.031  1.00 0.00 ? 91  ASP A HB3  6  
ATOM 9293  N N    . ALA A 1 92  ? 1.491   25.716  -4.166  1.00 0.00 ? 92  ALA A N    6  
ATOM 9294  C CA   . ALA A 1 92  ? 1.362   26.908  -3.337  1.00 0.00 ? 92  ALA A CA   6  
ATOM 9295  C C    . ALA A 1 92  ? 0.137   26.819  -2.433  1.00 0.00 ? 92  ALA A C    6  
ATOM 9296  O O    . ALA A 1 92  ? -0.979  26.596  -2.903  1.00 0.00 ? 92  ALA A O    6  
ATOM 9297  C CB   . ALA A 1 92  ? 1.285   28.152  -4.210  1.00 0.00 ? 92  ALA A CB   6  
ATOM 9298  H H    . ALA A 1 92  ? 1.061   25.697  -5.046  1.00 0.00 ? 92  ALA A H    6  
ATOM 9299  H HA   . ALA A 1 92  ? 2.247   26.984  -2.722  1.00 0.00 ? 92  ALA A HA   6  
ATOM 9300  H HB1  . ALA A 1 92  ? 2.262   28.362  -4.622  1.00 0.00 ? 92  ALA A HB1  6  
ATOM 9301  H HB2  . ALA A 1 92  ? 0.584   27.985  -5.014  1.00 0.00 ? 92  ALA A HB2  6  
ATOM 9302  H HB3  . ALA A 1 92  ? 0.958   28.991  -3.614  1.00 0.00 ? 92  ALA A HB3  6  
ATOM 9303  N N    . TYR A 1 93  ? 0.354   26.992  -1.133  1.00 0.00 ? 93  TYR A N    6  
ATOM 9304  C CA   . TYR A 1 93  ? -0.732  26.927  -0.163  1.00 0.00 ? 93  TYR A CA   6  
ATOM 9305  C C    . TYR A 1 93  ? -1.317  28.313  0.094   1.00 0.00 ? 93  TYR A C    6  
ATOM 9306  O O    . TYR A 1 93  ? -0.751  29.325  -0.320  1.00 0.00 ? 93  TYR A O    6  
ATOM 9307  C CB   . TYR A 1 93  ? -0.235  26.320  1.150   1.00 0.00 ? 93  TYR A CB   6  
ATOM 9308  C CG   . TYR A 1 93  ? 1.119   26.837  1.582   1.00 0.00 ? 93  TYR A CG   6  
ATOM 9309  C CD1  . TYR A 1 93  ? 1.365   28.201  1.678   1.00 0.00 ? 93  TYR A CD1  6  
ATOM 9310  C CD2  . TYR A 1 93  ? 2.152   25.961  1.892   1.00 0.00 ? 93  TYR A CD2  6  
ATOM 9311  C CE1  . TYR A 1 93  ? 2.601   28.677  2.071   1.00 0.00 ? 93  TYR A CE1  6  
ATOM 9312  C CE2  . TYR A 1 93  ? 3.390   26.429  2.288   1.00 0.00 ? 93  TYR A CE2  6  
ATOM 9313  C CZ   . TYR A 1 93  ? 3.610   27.787  2.375   1.00 0.00 ? 93  TYR A CZ   6  
ATOM 9314  O OH   . TYR A 1 93  ? 4.842   28.257  2.767   1.00 0.00 ? 93  TYR A OH   6  
ATOM 9315  H H    . TYR A 1 93  ? 1.265   27.166  -0.819  1.00 0.00 ? 93  TYR A H    6  
ATOM 9316  H HA   . TYR A 1 93  ? -1.505  26.293  -0.571  1.00 0.00 ? 93  TYR A HA   6  
ATOM 9317  H HB2  . TYR A 1 93  ? -0.941  26.548  1.934   1.00 0.00 ? 93  TYR A HB2  6  
ATOM 9318  H HB3  . TYR A 1 93  ? -0.162  25.249  1.038   1.00 0.00 ? 93  TYR A HB3  6  
ATOM 9319  H HD1  . TYR A 1 93  ? 0.573   28.896  1.439   1.00 0.00 ? 93  TYR A HD1  6  
ATOM 9320  H HD2  . TYR A 1 93  ? 1.976   24.897  1.822   1.00 0.00 ? 93  TYR A HD2  6  
ATOM 9321  H HE1  . TYR A 1 93  ? 2.774   29.741  2.140   1.00 0.00 ? 93  TYR A HE1  6  
ATOM 9322  H HE2  . TYR A 1 93  ? 4.180   25.732  2.525   1.00 0.00 ? 93  TYR A HE2  6  
ATOM 9323  H HH   . TYR A 1 93  ? 5.530   27.788  2.290   1.00 0.00 ? 93  TYR A HH   6  
ATOM 9324  N N    . SER A 1 94  ? -2.455  28.350  0.780   1.00 0.00 ? 94  SER A N    6  
ATOM 9325  C CA   . SER A 1 94  ? -3.119  29.611  1.090   1.00 0.00 ? 94  SER A CA   6  
ATOM 9326  C C    . SER A 1 94  ? -2.573  30.210  2.383   1.00 0.00 ? 94  SER A C    6  
ATOM 9327  O O    . SER A 1 94  ? -1.835  29.556  3.119   1.00 0.00 ? 94  SER A O    6  
ATOM 9328  C CB   . SER A 1 94  ? -4.630  29.398  1.212   1.00 0.00 ? 94  SER A CB   6  
ATOM 9329  O OG   . SER A 1 94  ? -5.173  28.892  0.005   1.00 0.00 ? 94  SER A OG   6  
ATOM 9330  H H    . SER A 1 94  ? -2.858  27.510  1.083   1.00 0.00 ? 94  SER A H    6  
ATOM 9331  H HA   . SER A 1 94  ? -2.925  30.296  0.279   1.00 0.00 ? 94  SER A HA   6  
ATOM 9332  H HB2  . SER A 1 94  ? -4.829  28.694  2.006   1.00 0.00 ? 94  SER A HB2  6  
ATOM 9333  H HB3  . SER A 1 94  ? -5.106  30.341  1.440   1.00 0.00 ? 94  SER A HB3  6  
ATOM 9334  H HG   . SER A 1 94  ? -4.499  28.397  -0.466  1.00 0.00 ? 94  SER A HG   6  
ATOM 9335  N N    . SER A 1 95  ? -2.940  31.458  2.650   1.00 0.00 ? 95  SER A N    6  
ATOM 9336  C CA   . SER A 1 95  ? -2.484  32.149  3.851   1.00 0.00 ? 95  SER A CA   6  
ATOM 9337  C C    . SER A 1 95  ? -2.884  31.378  5.106   1.00 0.00 ? 95  SER A C    6  
ATOM 9338  O O    . SER A 1 95  ? -4.064  31.118  5.338   1.00 0.00 ? 95  SER A O    6  
ATOM 9339  C CB   . SER A 1 95  ? -3.063  33.564  3.903   1.00 0.00 ? 95  SER A CB   6  
ATOM 9340  O OG   . SER A 1 95  ? -4.474  33.543  3.777   1.00 0.00 ? 95  SER A OG   6  
ATOM 9341  H H    . SER A 1 95  ? -3.531  31.928  2.024   1.00 0.00 ? 95  SER A H    6  
ATOM 9342  H HA   . SER A 1 95  ? -1.407  32.211  3.809   1.00 0.00 ? 95  SER A HA   6  
ATOM 9343  H HB2  . SER A 1 95  ? -2.805  34.022  4.845   1.00 0.00 ? 95  SER A HB2  6  
ATOM 9344  H HB3  . SER A 1 95  ? -2.650  34.148  3.093   1.00 0.00 ? 95  SER A HB3  6  
ATOM 9345  H HG   . SER A 1 95  ? -4.812  32.703  4.098   1.00 0.00 ? 95  SER A HG   6  
ATOM 9346  N N    . ASN A 1 96  ? -1.891  31.015  5.911   1.00 0.00 ? 96  ASN A N    6  
ATOM 9347  C CA   . ASN A 1 96  ? -2.137  30.273  7.142   1.00 0.00 ? 96  ASN A CA   6  
ATOM 9348  C C    . ASN A 1 96  ? -1.124  30.652  8.218   1.00 0.00 ? 96  ASN A C    6  
ATOM 9349  O O    . ASN A 1 96  ? -0.091  31.256  7.928   1.00 0.00 ? 96  ASN A O    6  
ATOM 9350  C CB   . ASN A 1 96  ? -2.076  28.768  6.876   1.00 0.00 ? 96  ASN A CB   6  
ATOM 9351  C CG   . ASN A 1 96  ? -3.398  28.214  6.382   1.00 0.00 ? 96  ASN A CG   6  
ATOM 9352  O OD1  . ASN A 1 96  ? -3.901  28.620  5.334   1.00 0.00 ? 96  ASN A OD1  6  
ATOM 9353  N ND2  . ASN A 1 96  ? -3.968  27.281  7.136   1.00 0.00 ? 96  ASN A ND2  6  
ATOM 9354  H H    . ASN A 1 96  ? -0.970  31.251  5.672   1.00 0.00 ? 96  ASN A H    6  
ATOM 9355  H HA   . ASN A 1 96  ? -3.127  30.528  7.490   1.00 0.00 ? 96  ASN A HA   6  
ATOM 9356  H HB2  . ASN A 1 96  ? -1.323  28.571  6.127   1.00 0.00 ? 96  ASN A HB2  6  
ATOM 9357  H HB3  . ASN A 1 96  ? -1.811  28.257  7.790   1.00 0.00 ? 96  ASN A HB3  6  
ATOM 9358  H HD21 . ASN A 1 96  ? -3.510  27.007  7.958   1.00 0.00 ? 96  ASN A HD21 6  
ATOM 9359  H HD22 . ASN A 1 96  ? -4.823  26.905  6.839   1.00 0.00 ? 96  ASN A HD22 6  
ATOM 9360  N N    . SER A 1 97  ? -1.427  30.294  9.462   1.00 0.00 ? 97  SER A N    6  
ATOM 9361  C CA   . SER A 1 97  ? -0.545  30.599  10.582  1.00 0.00 ? 97  SER A CA   6  
ATOM 9362  C C    . SER A 1 97  ? 0.291   29.381  10.962  1.00 0.00 ? 97  SER A C    6  
ATOM 9363  O O    . SER A 1 97  ? -0.185  28.477  11.647  1.00 0.00 ? 97  SER A O    6  
ATOM 9364  C CB   . SER A 1 97  ? -1.361  31.069  11.788  1.00 0.00 ? 97  SER A CB   6  
ATOM 9365  O OG   . SER A 1 97  ? -0.568  31.844  12.670  1.00 0.00 ? 97  SER A OG   6  
ATOM 9366  H H    . SER A 1 97  ? -2.266  29.815  9.630   1.00 0.00 ? 97  SER A H    6  
ATOM 9367  H HA   . SER A 1 97  ? 0.118   31.394  10.275  1.00 0.00 ? 97  SER A HA   6  
ATOM 9368  H HB2  . SER A 1 97  ? -2.190  31.669  11.446  1.00 0.00 ? 97  SER A HB2  6  
ATOM 9369  H HB3  . SER A 1 97  ? -1.736  30.208  12.322  1.00 0.00 ? 97  SER A HB3  6  
ATOM 9370  H HG   . SER A 1 97  ? -0.240  32.619  12.208  1.00 0.00 ? 97  SER A HG   6  
ATOM 9371  N N    . GLY A 1 98  ? 1.542   29.365  10.512  1.00 0.00 ? 98  GLY A N    6  
ATOM 9372  C CA   . GLY A 1 98  ? 2.425   28.254  10.814  1.00 0.00 ? 98  GLY A CA   6  
ATOM 9373  C C    . GLY A 1 98  ? 3.787   28.712  11.299  1.00 0.00 ? 98  GLY A C    6  
ATOM 9374  O O    . GLY A 1 98  ? 3.952   29.828  11.792  1.00 0.00 ? 98  GLY A O    6  
ATOM 9375  H H    . GLY A 1 98  ? 1.868   30.114  9.970   1.00 0.00 ? 98  GLY A H    6  
ATOM 9376  H HA2  . GLY A 1 98  ? 1.969   27.644  11.579  1.00 0.00 ? 98  GLY A HA2  6  
ATOM 9377  H HA3  . GLY A 1 98  ? 2.555   27.659  9.922   1.00 0.00 ? 98  GLY A HA3  6  
ATOM 9378  N N    . PRO A 1 99  ? 4.793   27.836  11.161  1.00 0.00 ? 99  PRO A N    6  
ATOM 9379  C CA   . PRO A 1 99  ? 6.165   28.133  11.583  1.00 0.00 ? 99  PRO A CA   6  
ATOM 9380  C C    . PRO A 1 99  ? 6.829   29.184  10.700  1.00 0.00 ? 99  PRO A C    6  
ATOM 9381  O O    . PRO A 1 99  ? 6.900   29.029  9.481   1.00 0.00 ? 99  PRO A O    6  
ATOM 9382  C CB   . PRO A 1 99  ? 6.880   26.787  11.441  1.00 0.00 ? 99  PRO A CB   6  
ATOM 9383  C CG   . PRO A 1 99  ? 6.098   26.050  10.409  1.00 0.00 ? 99  PRO A CG   6  
ATOM 9384  C CD   . PRO A 1 99  ? 4.670   26.488  10.581  1.00 0.00 ? 99  PRO A CD   6  
ATOM 9385  H HA   . PRO A 1 99  ? 6.202   28.455  12.614  1.00 0.00 ? 99  PRO A HA   6  
ATOM 9386  H HB2  . PRO A 1 99  ? 7.900   26.950  11.123  1.00 0.00 ? 99  PRO A HB2  6  
ATOM 9387  H HB3  . PRO A 1 99  ? 6.870   26.269  12.388  1.00 0.00 ? 99  PRO A HB3  6  
ATOM 9388  H HG2  . PRO A 1 99  ? 6.454   26.310  9.424   1.00 0.00 ? 99  PRO A HG2  6  
ATOM 9389  H HG3  . PRO A 1 99  ? 6.186   24.986  10.573  1.00 0.00 ? 99  PRO A HG3  6  
ATOM 9390  H HD2  . PRO A 1 99  ? 4.168   26.524  9.625   1.00 0.00 ? 99  PRO A HD2  6  
ATOM 9391  H HD3  . PRO A 1 99  ? 4.150   25.824  11.257  1.00 0.00 ? 99  PRO A HD3  6  
ATOM 9392  N N    . SER A 1 100 ? 7.313   30.254  11.323  1.00 0.00 ? 100 SER A N    6  
ATOM 9393  C CA   . SER A 1 100 ? 7.969   31.332  10.592  1.00 0.00 ? 100 SER A CA   6  
ATOM 9394  C C    . SER A 1 100 ? 9.436   31.448  10.995  1.00 0.00 ? 100 SER A C    6  
ATOM 9395  O O    . SER A 1 100 ? 9.765   31.480  12.181  1.00 0.00 ? 100 SER A O    6  
ATOM 9396  C CB   . SER A 1 100 ? 7.252   32.659  10.849  1.00 0.00 ? 100 SER A CB   6  
ATOM 9397  O OG   . SER A 1 100 ? 8.031   33.755  10.401  1.00 0.00 ? 100 SER A OG   6  
ATOM 9398  H H    . SER A 1 100 ? 7.226   30.320  12.297  1.00 0.00 ? 100 SER A H    6  
ATOM 9399  H HA   . SER A 1 100 ? 7.914   31.101  9.539   1.00 0.00 ? 100 SER A HA   6  
ATOM 9400  H HB2  . SER A 1 100 ? 6.310   32.664  10.322  1.00 0.00 ? 100 SER A HB2  6  
ATOM 9401  H HB3  . SER A 1 100 ? 7.072   32.769  11.908  1.00 0.00 ? 100 SER A HB3  6  
ATOM 9402  H HG   . SER A 1 100 ? 7.456   34.421  10.016  1.00 0.00 ? 100 SER A HG   6  
ATOM 9403  N N    . SER A 1 101 ? 10.313  31.511  9.998   1.00 0.00 ? 101 SER A N    6  
ATOM 9404  C CA   . SER A 1 101 ? 11.746  31.619  10.247  1.00 0.00 ? 101 SER A CA   6  
ATOM 9405  C C    . SER A 1 101 ? 12.486  32.039  8.981   1.00 0.00 ? 101 SER A C    6  
ATOM 9406  O O    . SER A 1 101 ? 12.562  31.284  8.013   1.00 0.00 ? 101 SER A O    6  
ATOM 9407  C CB   . SER A 1 101 ? 12.299  30.287  10.756  1.00 0.00 ? 101 SER A CB   6  
ATOM 9408  O OG   . SER A 1 101 ? 13.623  30.435  11.239  1.00 0.00 ? 101 SER A OG   6  
ATOM 9409  H H    . SER A 1 101 ? 9.989   31.481  9.074   1.00 0.00 ? 101 SER A H    6  
ATOM 9410  H HA   . SER A 1 101 ? 11.895  32.374  11.004  1.00 0.00 ? 101 SER A HA   6  
ATOM 9411  H HB2  . SER A 1 101 ? 11.675  29.925  11.559  1.00 0.00 ? 101 SER A HB2  6  
ATOM 9412  H HB3  . SER A 1 101 ? 12.300  29.569  9.949   1.00 0.00 ? 101 SER A HB3  6  
ATOM 9413  H HG   . SER A 1 101 ? 13.755  31.337  11.541  1.00 0.00 ? 101 SER A HG   6  
ATOM 9414  N N    . GLY A 1 102 ? 13.032  33.252  8.996   1.00 0.00 ? 102 GLY A N    6  
ATOM 9415  C CA   . GLY A 1 102 ? 13.759  33.753  7.845   1.00 0.00 ? 102 GLY A CA   6  
ATOM 9416  C C    . GLY A 1 102 ? 14.001  35.248  7.918   1.00 0.00 ? 102 GLY A C    6  
ATOM 9417  O O    . GLY A 1 102 ? 14.092  35.816  9.005   1.00 0.00 ? 102 GLY A O    6  
ATOM 9418  H H    . GLY A 1 102 ? 12.939  33.811  9.796   1.00 0.00 ? 102 GLY A H    6  
ATOM 9419  H HA2  . GLY A 1 102 ? 14.711  33.247  7.787   1.00 0.00 ? 102 GLY A HA2  6  
ATOM 9420  H HA3  . GLY A 1 102 ? 13.192  33.535  6.952   1.00 0.00 ? 102 GLY A HA3  6  
ATOM 9421  N N    . GLY A 1 1   ? 8.693   -5.621  -20.703 1.00 0.00 ? 1   GLY A N    7  
ATOM 9422  C CA   . GLY A 1 1   ? 7.526   -6.130  -20.006 1.00 0.00 ? 1   GLY A CA   7  
ATOM 9423  C C    . GLY A 1 1   ? 6.345   -6.342  -20.932 1.00 0.00 ? 1   GLY A C    7  
ATOM 9424  O O    . GLY A 1 1   ? 6.000   -5.463  -21.721 1.00 0.00 ? 1   GLY A O    7  
ATOM 9425  H H1   . GLY A 1 1   ? 8.609   -4.843  -21.292 1.00 0.00 ? 1   GLY A H1   7  
ATOM 9426  H HA2  . GLY A 1 1   ? 7.780   -7.070  -19.541 1.00 0.00 ? 1   GLY A HA2  7  
ATOM 9427  H HA3  . GLY A 1 1   ? 7.244   -5.424  -19.238 1.00 0.00 ? 1   GLY A HA3  7  
ATOM 9428  N N    . SER A 1 2   ? 5.724   -7.513  -20.837 1.00 0.00 ? 2   SER A N    7  
ATOM 9429  C CA   . SER A 1 2   ? 4.578   -7.841  -21.677 1.00 0.00 ? 2   SER A CA   7  
ATOM 9430  C C    . SER A 1 2   ? 3.720   -8.923  -21.027 1.00 0.00 ? 2   SER A C    7  
ATOM 9431  O O    . SER A 1 2   ? 4.092   -10.097 -21.008 1.00 0.00 ? 2   SER A O    7  
ATOM 9432  C CB   . SER A 1 2   ? 5.046   -8.305  -23.057 1.00 0.00 ? 2   SER A CB   7  
ATOM 9433  O OG   . SER A 1 2   ? 3.978   -8.294  -23.988 1.00 0.00 ? 2   SER A OG   7  
ATOM 9434  H H    . SER A 1 2   ? 6.046   -8.174  -20.188 1.00 0.00 ? 2   SER A H    7  
ATOM 9435  H HA   . SER A 1 2   ? 3.983   -6.947  -21.790 1.00 0.00 ? 2   SER A HA   7  
ATOM 9436  H HB2  . SER A 1 2   ? 5.824   -7.646  -23.411 1.00 0.00 ? 2   SER A HB2  7  
ATOM 9437  H HB3  . SER A 1 2   ? 5.434   -9.311  -22.983 1.00 0.00 ? 2   SER A HB3  7  
ATOM 9438  H HG   . SER A 1 2   ? 4.159   -8.923  -24.691 1.00 0.00 ? 2   SER A HG   7  
ATOM 9439  N N    . SER A 1 3   ? 2.570   -8.520  -20.497 1.00 0.00 ? 3   SER A N    7  
ATOM 9440  C CA   . SER A 1 3   ? 1.661   -9.453  -19.843 1.00 0.00 ? 3   SER A CA   7  
ATOM 9441  C C    . SER A 1 3   ? 0.239   -9.284  -20.369 1.00 0.00 ? 3   SER A C    7  
ATOM 9442  O O    . SER A 1 3   ? -0.405  -10.251 -20.774 1.00 0.00 ? 3   SER A O    7  
ATOM 9443  C CB   . SER A 1 3   ? 1.685   -9.245  -18.328 1.00 0.00 ? 3   SER A CB   7  
ATOM 9444  O OG   . SER A 1 3   ? 1.493   -7.880  -17.997 1.00 0.00 ? 3   SER A OG   7  
ATOM 9445  H H    . SER A 1 3   ? 2.330   -7.571  -20.544 1.00 0.00 ? 3   SER A H    7  
ATOM 9446  H HA   . SER A 1 3   ? 1.997   -10.455 -20.066 1.00 0.00 ? 3   SER A HA   7  
ATOM 9447  H HB2  . SER A 1 3   ? 0.897   -9.827  -17.874 1.00 0.00 ? 3   SER A HB2  7  
ATOM 9448  H HB3  . SER A 1 3   ? 2.640   -9.566  -17.938 1.00 0.00 ? 3   SER A HB3  7  
ATOM 9449  H HG   . SER A 1 3   ? 0.558   -7.713  -17.856 1.00 0.00 ? 3   SER A HG   7  
ATOM 9450  N N    . GLY A 1 4   ? -0.246  -8.046  -20.358 1.00 0.00 ? 4   GLY A N    7  
ATOM 9451  C CA   . GLY A 1 4   ? -1.589  -7.771  -20.835 1.00 0.00 ? 4   GLY A CA   7  
ATOM 9452  C C    . GLY A 1 4   ? -1.840  -6.290  -21.038 1.00 0.00 ? 4   GLY A C    7  
ATOM 9453  O O    . GLY A 1 4   ? -0.900  -5.502  -21.143 1.00 0.00 ? 4   GLY A O    7  
ATOM 9454  H H    . GLY A 1 4   ? 0.312   -7.313  -20.023 1.00 0.00 ? 4   GLY A H    7  
ATOM 9455  H HA2  . GLY A 1 4   ? -1.738  -8.283  -21.774 1.00 0.00 ? 4   GLY A HA2  7  
ATOM 9456  H HA3  . GLY A 1 4   ? -2.299  -8.148  -20.114 1.00 0.00 ? 4   GLY A HA3  7  
ATOM 9457  N N    . SER A 1 5   ? -3.112  -5.909  -21.097 1.00 0.00 ? 5   SER A N    7  
ATOM 9458  C CA   . SER A 1 5   ? -3.484  -4.513  -21.295 1.00 0.00 ? 5   SER A CA   7  
ATOM 9459  C C    . SER A 1 5   ? -4.209  -3.965  -20.069 1.00 0.00 ? 5   SER A C    7  
ATOM 9460  O O    . SER A 1 5   ? -5.176  -4.557  -19.589 1.00 0.00 ? 5   SER A O    7  
ATOM 9461  C CB   . SER A 1 5   ? -4.373  -4.371  -22.532 1.00 0.00 ? 5   SER A CB   7  
ATOM 9462  O OG   . SER A 1 5   ? -4.275  -3.069  -23.083 1.00 0.00 ? 5   SER A OG   7  
ATOM 9463  H H    . SER A 1 5   ? -3.817  -6.584  -21.007 1.00 0.00 ? 5   SER A H    7  
ATOM 9464  H HA   . SER A 1 5   ? -2.578  -3.947  -21.446 1.00 0.00 ? 5   SER A HA   7  
ATOM 9465  H HB2  . SER A 1 5   ? -4.065  -5.088  -23.277 1.00 0.00 ? 5   SER A HB2  7  
ATOM 9466  H HB3  . SER A 1 5   ? -5.401  -4.556  -22.257 1.00 0.00 ? 5   SER A HB3  7  
ATOM 9467  H HG   . SER A 1 5   ? -3.356  -2.791  -23.087 1.00 0.00 ? 5   SER A HG   7  
ATOM 9468  N N    . SER A 1 6   ? -3.733  -2.830  -19.567 1.00 0.00 ? 6   SER A N    7  
ATOM 9469  C CA   . SER A 1 6   ? -4.332  -2.202  -18.395 1.00 0.00 ? 6   SER A CA   7  
ATOM 9470  C C    . SER A 1 6   ? -5.844  -2.403  -18.384 1.00 0.00 ? 6   SER A C    7  
ATOM 9471  O O    . SER A 1 6   ? -6.510  -2.244  -19.406 1.00 0.00 ? 6   SER A O    7  
ATOM 9472  C CB   . SER A 1 6   ? -4.004  -0.708  -18.367 1.00 0.00 ? 6   SER A CB   7  
ATOM 9473  O OG   . SER A 1 6   ? -2.722  -0.477  -17.809 1.00 0.00 ? 6   SER A OG   7  
ATOM 9474  H H    . SER A 1 6   ? -2.959  -2.406  -19.994 1.00 0.00 ? 6   SER A H    7  
ATOM 9475  H HA   . SER A 1 6   ? -3.912  -2.671  -17.517 1.00 0.00 ? 6   SER A HA   7  
ATOM 9476  H HB2  . SER A 1 6   ? -4.021  -0.320  -19.373 1.00 0.00 ? 6   SER A HB2  7  
ATOM 9477  H HB3  . SER A 1 6   ? -4.742  -0.192  -17.769 1.00 0.00 ? 6   SER A HB3  7  
ATOM 9478  H HG   . SER A 1 6   ? -2.048  -0.801  -18.411 1.00 0.00 ? 6   SER A HG   7  
ATOM 9479  N N    . GLY A 1 7   ? -6.380  -2.755  -17.219 1.00 0.00 ? 7   GLY A N    7  
ATOM 9480  C CA   . GLY A 1 7   ? -7.809  -2.972  -17.095 1.00 0.00 ? 7   GLY A CA   7  
ATOM 9481  C C    . GLY A 1 7   ? -8.257  -3.076  -15.650 1.00 0.00 ? 7   GLY A C    7  
ATOM 9482  O O    . GLY A 1 7   ? -7.653  -3.797  -14.856 1.00 0.00 ? 7   GLY A O    7  
ATOM 9483  H H    . GLY A 1 7   ? -5.800  -2.868  -16.437 1.00 0.00 ? 7   GLY A H    7  
ATOM 9484  H HA2  . GLY A 1 7   ? -8.329  -2.151  -17.564 1.00 0.00 ? 7   GLY A HA2  7  
ATOM 9485  H HA3  . GLY A 1 7   ? -8.068  -3.888  -17.606 1.00 0.00 ? 7   GLY A HA3  7  
ATOM 9486  N N    . ARG A 1 8   ? -9.319  -2.353  -15.308 1.00 0.00 ? 8   ARG A N    7  
ATOM 9487  C CA   . ARG A 1 8   ? -9.845  -2.365  -13.949 1.00 0.00 ? 8   ARG A CA   7  
ATOM 9488  C C    . ARG A 1 8   ? -10.394 -3.743  -13.590 1.00 0.00 ? 8   ARG A C    7  
ATOM 9489  O O    . ARG A 1 8   ? -11.184 -4.320  -14.336 1.00 0.00 ? 8   ARG A O    7  
ATOM 9490  C CB   . ARG A 1 8   ? -10.943 -1.311  -13.795 1.00 0.00 ? 8   ARG A CB   7  
ATOM 9491  C CG   . ARG A 1 8   ? -10.415 0.114   -13.740 1.00 0.00 ? 8   ARG A CG   7  
ATOM 9492  C CD   . ARG A 1 8   ? -11.537 1.114   -13.508 1.00 0.00 ? 8   ARG A CD   7  
ATOM 9493  N NE   . ARG A 1 8   ? -12.322 1.347   -14.717 1.00 0.00 ? 8   ARG A NE   7  
ATOM 9494  C CZ   . ARG A 1 8   ? -13.205 2.332   -14.842 1.00 0.00 ? 8   ARG A CZ   7  
ATOM 9495  N NH1  . ARG A 1 8   ? -13.413 3.171   -13.837 1.00 0.00 ? 8   ARG A NH1  7  
ATOM 9496  N NH2  . ARG A 1 8   ? -13.880 2.479   -15.974 1.00 0.00 ? 8   ARG A NH2  7  
ATOM 9497  H H    . ARG A 1 8   ? -9.758  -1.798  -15.986 1.00 0.00 ? 8   ARG A H    7  
ATOM 9498  H HA   . ARG A 1 8   ? -9.034  -2.128  -13.277 1.00 0.00 ? 8   ARG A HA   7  
ATOM 9499  H HB2  . ARG A 1 8   ? -11.620 -1.388  -14.632 1.00 0.00 ? 8   ARG A HB2  7  
ATOM 9500  H HB3  . ARG A 1 8   ? -11.486 -1.505  -12.883 1.00 0.00 ? 8   ARG A HB3  7  
ATOM 9501  H HG2  . ARG A 1 8   ? -9.704  0.194   -12.932 1.00 0.00 ? 8   ARG A HG2  7  
ATOM 9502  H HG3  . ARG A 1 8   ? -9.928  0.343   -14.676 1.00 0.00 ? 8   ARG A HG3  7  
ATOM 9503  H HD2  . ARG A 1 8   ? -12.188 0.732   -12.736 1.00 0.00 ? 8   ARG A HD2  7  
ATOM 9504  H HD3  . ARG A 1 8   ? -11.105 2.049   -13.184 1.00 0.00 ? 8   ARG A HD3  7  
ATOM 9505  H HE   . ARG A 1 8   ? -12.184 0.739   -15.472 1.00 0.00 ? 8   ARG A HE   7  
ATOM 9506  H HH11 . ARG A 1 8   ? -12.905 3.063   -12.983 1.00 0.00 ? 8   ARG A HH11 7  
ATOM 9507  H HH12 . ARG A 1 8   ? -14.077 3.913   -13.934 1.00 0.00 ? 8   ARG A HH12 7  
ATOM 9508  H HH21 . ARG A 1 8   ? -13.726 1.849   -16.734 1.00 0.00 ? 8   ARG A HH21 7  
ATOM 9509  H HH22 . ARG A 1 8   ? -14.545 3.221   -16.067 1.00 0.00 ? 8   ARG A HH22 7  
ATOM 9510  N N    . ASN A 1 9   ? -9.970  -4.263  -12.443 1.00 0.00 ? 9   ASN A N    7  
ATOM 9511  C CA   . ASN A 1 9   ? -10.419 -5.573  -11.986 1.00 0.00 ? 9   ASN A CA   7  
ATOM 9512  C C    . ASN A 1 9   ? -10.845 -5.523  -10.522 1.00 0.00 ? 9   ASN A C    7  
ATOM 9513  O O    . ASN A 1 9   ? -10.275 -4.778  -9.725  1.00 0.00 ? 9   ASN A O    7  
ATOM 9514  C CB   . ASN A 1 9   ? -9.307  -6.609  -12.170 1.00 0.00 ? 9   ASN A CB   7  
ATOM 9515  C CG   . ASN A 1 9   ? -7.987  -6.150  -11.580 1.00 0.00 ? 9   ASN A CG   7  
ATOM 9516  O OD1  . ASN A 1 9   ? -7.882  -5.909  -10.377 1.00 0.00 ? 9   ASN A OD1  7  
ATOM 9517  N ND2  . ASN A 1 9   ? -6.971  -6.028  -12.427 1.00 0.00 ? 9   ASN A ND2  7  
ATOM 9518  H H    . ASN A 1 9   ? -9.340  -3.754  -11.891 1.00 0.00 ? 9   ASN A H    7  
ATOM 9519  H HA   . ASN A 1 9   ? -11.268 -5.861  -12.587 1.00 0.00 ? 9   ASN A HA   7  
ATOM 9520  H HB2  . ASN A 1 9   ? -9.596  -7.529  -11.683 1.00 0.00 ? 9   ASN A HB2  7  
ATOM 9521  H HB3  . ASN A 1 9   ? -9.165  -6.793  -13.224 1.00 0.00 ? 9   ASN A HB3  7  
ATOM 9522  H HD21 . ASN A 1 9   ? -7.128  -6.238  -13.371 1.00 0.00 ? 9   ASN A HD21 7  
ATOM 9523  H HD22 . ASN A 1 9   ? -6.106  -5.734  -12.072 1.00 0.00 ? 9   ASN A HD22 7  
ATOM 9524  N N    . ARG A 1 10  ? -11.850 -6.320  -10.176 1.00 0.00 ? 10  ARG A N    7  
ATOM 9525  C CA   . ARG A 1 10  ? -12.353 -6.366  -8.809  1.00 0.00 ? 10  ARG A CA   7  
ATOM 9526  C C    . ARG A 1 10  ? -11.507 -7.300  -7.949  1.00 0.00 ? 10  ARG A C    7  
ATOM 9527  O O    . ARG A 1 10  ? -11.895 -8.438  -7.683  1.00 0.00 ? 10  ARG A O    7  
ATOM 9528  C CB   . ARG A 1 10  ? -13.813 -6.824  -8.794  1.00 0.00 ? 10  ARG A CB   7  
ATOM 9529  C CG   . ARG A 1 10  ? -14.799 -5.727  -9.160  1.00 0.00 ? 10  ARG A CG   7  
ATOM 9530  C CD   . ARG A 1 10  ? -16.155 -5.958  -8.510  1.00 0.00 ? 10  ARG A CD   7  
ATOM 9531  N NE   . ARG A 1 10  ? -17.022 -4.788  -8.624  1.00 0.00 ? 10  ARG A NE   7  
ATOM 9532  C CZ   . ARG A 1 10  ? -18.340 -4.832  -8.464  1.00 0.00 ? 10  ARG A CZ   7  
ATOM 9533  N NH1  . ARG A 1 10  ? -18.939 -5.982  -8.184  1.00 0.00 ? 10  ARG A NH1  7  
ATOM 9534  N NH2  . ARG A 1 10  ? -19.061 -3.725  -8.582  1.00 0.00 ? 10  ARG A NH2  7  
ATOM 9535  H H    . ARG A 1 10  ? -12.264 -6.891  -10.857 1.00 0.00 ? 10  ARG A H    7  
ATOM 9536  H HA   . ARG A 1 10  ? -12.294 -5.368  -8.400  1.00 0.00 ? 10  ARG A HA   7  
ATOM 9537  H HB2  . ARG A 1 10  ? -13.931 -7.633  -9.500  1.00 0.00 ? 10  ARG A HB2  7  
ATOM 9538  H HB3  . ARG A 1 10  ? -14.055 -7.181  -7.805  1.00 0.00 ? 10  ARG A HB3  7  
ATOM 9539  H HG2  . ARG A 1 10  ? -14.408 -4.778  -8.824  1.00 0.00 ? 10  ARG A HG2  7  
ATOM 9540  H HG3  . ARG A 1 10  ? -14.921 -5.709  -10.232 1.00 0.00 ? 10  ARG A HG3  7  
ATOM 9541  H HD2  . ARG A 1 10  ? -16.632 -6.796  -8.994  1.00 0.00 ? 10  ARG A HD2  7  
ATOM 9542  H HD3  . ARG A 1 10  ? -16.004 -6.183  -7.465  1.00 0.00 ? 10  ARG A HD3  7  
ATOM 9543  H HE   . ARG A 1 10  ? -16.600 -3.929  -8.830  1.00 0.00 ? 10  ARG A HE   7  
ATOM 9544  H HH11 . ARG A 1 10  ? -18.398 -6.818  -8.093  1.00 0.00 ? 10  ARG A HH11 7  
ATOM 9545  H HH12 . ARG A 1 10  ? -19.931 -6.012  -8.063  1.00 0.00 ? 10  ARG A HH12 7  
ATOM 9546  H HH21 . ARG A 1 10  ? -18.614 -2.857  -8.793  1.00 0.00 ? 10  ARG A HH21 7  
ATOM 9547  H HH22 . ARG A 1 10  ? -20.053 -3.760  -8.462  1.00 0.00 ? 10  ARG A HH22 7  
ATOM 9548  N N    . PHE A 1 11  ? -10.349 -6.812  -7.517  1.00 0.00 ? 11  PHE A N    7  
ATOM 9549  C CA   . PHE A 1 11  ? -9.447  -7.604  -6.689  1.00 0.00 ? 11  PHE A CA   7  
ATOM 9550  C C    . PHE A 1 11  ? -9.116  -6.872  -5.392  1.00 0.00 ? 11  PHE A C    7  
ATOM 9551  O O    . PHE A 1 11  ? -8.829  -5.675  -5.396  1.00 0.00 ? 11  PHE A O    7  
ATOM 9552  C CB   . PHE A 1 11  ? -8.159  -7.915  -7.454  1.00 0.00 ? 11  PHE A CB   7  
ATOM 9553  C CG   . PHE A 1 11  ? -6.972  -8.144  -6.562  1.00 0.00 ? 11  PHE A CG   7  
ATOM 9554  C CD1  . PHE A 1 11  ? -6.719  -9.399  -6.032  1.00 0.00 ? 11  PHE A CD1  7  
ATOM 9555  C CD2  . PHE A 1 11  ? -6.109  -7.104  -6.255  1.00 0.00 ? 11  PHE A CD2  7  
ATOM 9556  C CE1  . PHE A 1 11  ? -5.628  -9.612  -5.211  1.00 0.00 ? 11  PHE A CE1  7  
ATOM 9557  C CE2  . PHE A 1 11  ? -5.017  -7.311  -5.434  1.00 0.00 ? 11  PHE A CE2  7  
ATOM 9558  C CZ   . PHE A 1 11  ? -4.775  -8.567  -4.912  1.00 0.00 ? 11  PHE A CZ   7  
ATOM 9559  H H    . PHE A 1 11  ? -10.094 -5.898  -7.762  1.00 0.00 ? 11  PHE A H    7  
ATOM 9560  H HA   . PHE A 1 11  ? -9.946  -8.530  -6.449  1.00 0.00 ? 11  PHE A HA   7  
ATOM 9561  H HB2  . PHE A 1 11  ? -8.306  -8.807  -8.045  1.00 0.00 ? 11  PHE A HB2  7  
ATOM 9562  H HB3  . PHE A 1 11  ? -7.929  -7.089  -8.109  1.00 0.00 ? 11  PHE A HB3  7  
ATOM 9563  H HD1  . PHE A 1 11  ? -7.384  -10.217 -6.266  1.00 0.00 ? 11  PHE A HD1  7  
ATOM 9564  H HD2  . PHE A 1 11  ? -6.298  -6.121  -6.663  1.00 0.00 ? 11  PHE A HD2  7  
ATOM 9565  H HE1  . PHE A 1 11  ? -5.441  -10.595 -4.805  1.00 0.00 ? 11  PHE A HE1  7  
ATOM 9566  H HE2  . PHE A 1 11  ? -4.352  -6.492  -5.203  1.00 0.00 ? 11  PHE A HE2  7  
ATOM 9567  H HZ   . PHE A 1 11  ? -3.922  -8.731  -4.271  1.00 0.00 ? 11  PHE A HZ   7  
ATOM 9568  N N    . LYS A 1 12  ? -9.160  -7.600  -4.281  1.00 0.00 ? 12  LYS A N    7  
ATOM 9569  C CA   . LYS A 1 12  ? -8.865  -7.022  -2.975  1.00 0.00 ? 12  LYS A CA   7  
ATOM 9570  C C    . LYS A 1 12  ? -7.907  -7.913  -2.190  1.00 0.00 ? 12  LYS A C    7  
ATOM 9571  O O    . LYS A 1 12  ? -8.081  -9.130  -2.135  1.00 0.00 ? 12  LYS A O    7  
ATOM 9572  C CB   . LYS A 1 12  ? -10.157 -6.820  -2.180  1.00 0.00 ? 12  LYS A CB   7  
ATOM 9573  C CG   . LYS A 1 12  ? -9.993  -5.915  -0.972  1.00 0.00 ? 12  LYS A CG   7  
ATOM 9574  C CD   . LYS A 1 12  ? -10.144 -4.450  -1.348  1.00 0.00 ? 12  LYS A CD   7  
ATOM 9575  C CE   . LYS A 1 12  ? -11.599 -4.089  -1.606  1.00 0.00 ? 12  LYS A CE   7  
ATOM 9576  N NZ   . LYS A 1 12  ? -12.338 -3.827  -0.340  1.00 0.00 ? 12  LYS A NZ   7  
ATOM 9577  H H    . LYS A 1 12  ? -9.395  -8.550  -4.341  1.00 0.00 ? 12  LYS A H    7  
ATOM 9578  H HA   . LYS A 1 12  ? -8.397  -6.063  -3.134  1.00 0.00 ? 12  LYS A HA   7  
ATOM 9579  H HB2  . LYS A 1 12  ? -10.902 -6.386  -2.831  1.00 0.00 ? 12  LYS A HB2  7  
ATOM 9580  H HB3  . LYS A 1 12  ? -10.508 -7.783  -1.837  1.00 0.00 ? 12  LYS A HB3  7  
ATOM 9581  H HG2  . LYS A 1 12  ? -10.745 -6.167  -0.239  1.00 0.00 ? 12  LYS A HG2  7  
ATOM 9582  H HG3  . LYS A 1 12  ? -9.010  -6.069  -0.549  1.00 0.00 ? 12  LYS A HG3  7  
ATOM 9583  H HD2  . LYS A 1 12  ? -9.771  -3.839  -0.539  1.00 0.00 ? 12  LYS A HD2  7  
ATOM 9584  H HD3  . LYS A 1 12  ? -9.570  -4.256  -2.243  1.00 0.00 ? 12  LYS A HD3  7  
ATOM 9585  H HE2  . LYS A 1 12  ? -11.632 -3.203  -2.222  1.00 0.00 ? 12  LYS A HE2  7  
ATOM 9586  H HE3  . LYS A 1 12  ? -12.073 -4.908  -2.126  1.00 0.00 ? 12  LYS A HE3  7  
ATOM 9587  H HZ1  . LYS A 1 12  ? -13.356 -3.737  -0.533  1.00 0.00 ? 12  LYS A HZ1  7  
ATOM 9588  H HZ2  . LYS A 1 12  ? -12.001 -2.944  0.095   1.00 0.00 ? 12  LYS A HZ2  7  
ATOM 9589  H HZ3  . LYS A 1 12  ? -12.190 -4.609  0.329   1.00 0.00 ? 12  LYS A HZ3  7  
ATOM 9590  N N    . TRP A 1 13  ? -6.898  -7.298  -1.584  1.00 0.00 ? 13  TRP A N    7  
ATOM 9591  C CA   . TRP A 1 13  ? -5.913  -8.036  -0.801  1.00 0.00 ? 13  TRP A CA   7  
ATOM 9592  C C    . TRP A 1 13  ? -6.551  -8.641  0.444   1.00 0.00 ? 13  TRP A C    7  
ATOM 9593  O O    . TRP A 1 13  ? -7.545  -8.128  0.956   1.00 0.00 ? 13  TRP A O    7  
ATOM 9594  C CB   . TRP A 1 13  ? -4.757  -7.117  -0.402  1.00 0.00 ? 13  TRP A CB   7  
ATOM 9595  C CG   . TRP A 1 13  ? -3.921  -6.674  -1.564  1.00 0.00 ? 13  TRP A CG   7  
ATOM 9596  C CD1  . TRP A 1 13  ? -3.954  -5.456  -2.181  1.00 0.00 ? 13  TRP A CD1  7  
ATOM 9597  C CD2  . TRP A 1 13  ? -2.930  -7.447  -2.251  1.00 0.00 ? 13  TRP A CD2  7  
ATOM 9598  N NE1  . TRP A 1 13  ? -3.043  -5.425  -3.209  1.00 0.00 ? 13  TRP A NE1  7  
ATOM 9599  C CE2  . TRP A 1 13  ? -2.402  -6.633  -3.272  1.00 0.00 ? 13  TRP A CE2  7  
ATOM 9600  C CE3  . TRP A 1 13  ? -2.436  -8.745  -2.101  1.00 0.00 ? 13  TRP A CE3  7  
ATOM 9601  C CZ2  . TRP A 1 13  ? -1.406  -7.078  -4.138  1.00 0.00 ? 13  TRP A CZ2  7  
ATOM 9602  C CZ3  . TRP A 1 13  ? -1.448  -9.186  -2.961  1.00 0.00 ? 13  TRP A CZ3  7  
ATOM 9603  C CH2  . TRP A 1 13  ? -0.941  -8.354  -3.968  1.00 0.00 ? 13  TRP A CH2  7  
ATOM 9604  H H    . TRP A 1 13  ? -6.812  -6.324  -1.665  1.00 0.00 ? 13  TRP A H    7  
ATOM 9605  H HA   . TRP A 1 13  ? -5.530  -8.834  -1.419  1.00 0.00 ? 13  TRP A HA   7  
ATOM 9606  H HB2  . TRP A 1 13  ? -5.155  -6.235  0.078   1.00 0.00 ? 13  TRP A HB2  7  
ATOM 9607  H HB3  . TRP A 1 13  ? -4.114  -7.641  0.292   1.00 0.00 ? 13  TRP A HB3  7  
ATOM 9608  H HD1  . TRP A 1 13  ? -4.607  -4.647  -1.893  1.00 0.00 ? 13  TRP A HD1  7  
ATOM 9609  H HE1  . TRP A 1 13  ? -2.879  -4.660  -3.800  1.00 0.00 ? 13  TRP A HE1  7  
ATOM 9610  H HE3  . TRP A 1 13  ? -2.814  -9.401  -1.330  1.00 0.00 ? 13  TRP A HE3  7  
ATOM 9611  H HZ2  . TRP A 1 13  ? -1.005  -6.449  -4.919  1.00 0.00 ? 13  TRP A HZ2  7  
ATOM 9612  H HZ3  . TRP A 1 13  ? -1.054  -10.186 -2.861  1.00 0.00 ? 13  TRP A HZ3  7  
ATOM 9613  H HH2  . TRP A 1 13  ? -0.170  -8.740  -4.617  1.00 0.00 ? 13  TRP A HH2  7  
ATOM 9614  N N    . GLY A 1 14  ? -5.972  -9.736  0.928   1.00 0.00 ? 14  GLY A N    7  
ATOM 9615  C CA   . GLY A 1 14  ? -6.498  -10.393 2.110   1.00 0.00 ? 14  GLY A CA   7  
ATOM 9616  C C    . GLY A 1 14  ? -5.830  -9.916  3.385   1.00 0.00 ? 14  GLY A C    7  
ATOM 9617  O O    . GLY A 1 14  ? -4.991  -9.016  3.371   1.00 0.00 ? 14  GLY A O    7  
ATOM 9618  H H    . GLY A 1 14  ? -5.181  -10.101 0.479   1.00 0.00 ? 14  GLY A H    7  
ATOM 9619  H HA2  . GLY A 1 14  ? -7.558  -10.196 2.176   1.00 0.00 ? 14  GLY A HA2  7  
ATOM 9620  H HA3  . GLY A 1 14  ? -6.345  -11.458 2.015   1.00 0.00 ? 14  GLY A HA3  7  
ATOM 9621  N N    . PRO A 1 15  ? -6.206  -10.526 4.519   1.00 0.00 ? 15  PRO A N    7  
ATOM 9622  C CA   . PRO A 1 15  ? -5.651  -10.174 5.829   1.00 0.00 ? 15  PRO A CA   7  
ATOM 9623  C C    . PRO A 1 15  ? -4.192  -10.593 5.971   1.00 0.00 ? 15  PRO A C    7  
ATOM 9624  O O    . PRO A 1 15  ? -3.390  -9.887  6.583   1.00 0.00 ? 15  PRO A O    7  
ATOM 9625  C CB   . PRO A 1 15  ? -6.530  -10.955 6.808   1.00 0.00 ? 15  PRO A CB   7  
ATOM 9626  C CG   . PRO A 1 15  ? -7.046  -12.108 6.018   1.00 0.00 ? 15  PRO A CG   7  
ATOM 9627  C CD   . PRO A 1 15  ? -7.202  -11.607 4.609   1.00 0.00 ? 15  PRO A CD   7  
ATOM 9628  H HA   . PRO A 1 15  ? -5.741  -9.115  6.026   1.00 0.00 ? 15  PRO A HA   7  
ATOM 9629  H HB2  . PRO A 1 15  ? -5.933  -11.285 7.647   1.00 0.00 ? 15  PRO A HB2  7  
ATOM 9630  H HB3  . PRO A 1 15  ? -7.334  -10.325 7.157   1.00 0.00 ? 15  PRO A HB3  7  
ATOM 9631  H HG2  . PRO A 1 15  ? -6.337  -12.921 6.051   1.00 0.00 ? 15  PRO A HG2  7  
ATOM 9632  H HG3  . PRO A 1 15  ? -8.001  -12.424 6.411   1.00 0.00 ? 15  PRO A HG3  7  
ATOM 9633  H HD2  . PRO A 1 15  ? -6.983  -12.393 3.902   1.00 0.00 ? 15  PRO A HD2  7  
ATOM 9634  H HD3  . PRO A 1 15  ? -8.200  -11.225 4.453   1.00 0.00 ? 15  PRO A HD3  7  
ATOM 9635  N N    . ALA A 1 16  ? -3.853  -11.745 5.402   1.00 0.00 ? 16  ALA A N    7  
ATOM 9636  C CA   . ALA A 1 16  ? -2.490  -12.257 5.464   1.00 0.00 ? 16  ALA A CA   7  
ATOM 9637  C C    . ALA A 1 16  ? -1.636  -11.679 4.341   1.00 0.00 ? 16  ALA A C    7  
ATOM 9638  O O    . ALA A 1 16  ? -0.559  -11.135 4.584   1.00 0.00 ? 16  ALA A O    7  
ATOM 9639  C CB   . ALA A 1 16  ? -2.493  -13.777 5.399   1.00 0.00 ? 16  ALA A CB   7  
ATOM 9640  H H    . ALA A 1 16  ? -4.537  -12.263 4.928   1.00 0.00 ? 16  ALA A H    7  
ATOM 9641  H HA   . ALA A 1 16  ? -2.066  -11.962 6.413   1.00 0.00 ? 16  ALA A HA   7  
ATOM 9642  H HB1  . ALA A 1 16  ? -2.538  -14.092 4.367   1.00 0.00 ? 16  ALA A HB1  7  
ATOM 9643  H HB2  . ALA A 1 16  ? -1.591  -14.158 5.854   1.00 0.00 ? 16  ALA A HB2  7  
ATOM 9644  H HB3  . ALA A 1 16  ? -3.353  -14.158 5.930   1.00 0.00 ? 16  ALA A HB3  7  
ATOM 9645  N N    . SER A 1 17  ? -2.122  -11.803 3.110   1.00 0.00 ? 17  SER A N    7  
ATOM 9646  C CA   . SER A 1 17  ? -1.400  -11.297 1.948   1.00 0.00 ? 17  SER A CA   7  
ATOM 9647  C C    . SER A 1 17  ? -0.828  -9.910  2.226   1.00 0.00 ? 17  SER A C    7  
ATOM 9648  O O    . SER A 1 17  ? 0.385   -9.708  2.183   1.00 0.00 ? 17  SER A O    7  
ATOM 9649  C CB   . SER A 1 17  ? -2.324  -11.246 0.730   1.00 0.00 ? 17  SER A CB   7  
ATOM 9650  O OG   . SER A 1 17  ? -2.681  -12.549 0.305   1.00 0.00 ? 17  SER A OG   7  
ATOM 9651  H H    . SER A 1 17  ? -2.986  -12.247 2.980   1.00 0.00 ? 17  SER A H    7  
ATOM 9652  H HA   . SER A 1 17  ? -0.586  -11.975 1.743   1.00 0.00 ? 17  SER A HA   7  
ATOM 9653  H HB2  . SER A 1 17  ? -3.223  -10.705 0.985   1.00 0.00 ? 17  SER A HB2  7  
ATOM 9654  H HB3  . SER A 1 17  ? -1.818  -10.741 -0.081  1.00 0.00 ? 17  SER A HB3  7  
ATOM 9655  H HG   . SER A 1 17  ? -3.626  -12.676 0.419   1.00 0.00 ? 17  SER A HG   7  
ATOM 9656  N N    . GLN A 1 18  ? -1.711  -8.959  2.511   1.00 0.00 ? 18  GLN A N    7  
ATOM 9657  C CA   . GLN A 1 18  ? -1.295  -7.591  2.794   1.00 0.00 ? 18  GLN A CA   7  
ATOM 9658  C C    . GLN A 1 18  ? -0.030  -7.572  3.647   1.00 0.00 ? 18  GLN A C    7  
ATOM 9659  O O    . GLN A 1 18  ? 1.005   -7.057  3.226   1.00 0.00 ? 18  GLN A O    7  
ATOM 9660  C CB   . GLN A 1 18  ? -2.415  -6.831  3.507   1.00 0.00 ? 18  GLN A CB   7  
ATOM 9661  C CG   . GLN A 1 18  ? -3.508  -6.339  2.572   1.00 0.00 ? 18  GLN A CG   7  
ATOM 9662  C CD   . GLN A 1 18  ? -4.180  -5.077  3.073   1.00 0.00 ? 18  GLN A CD   7  
ATOM 9663  O OE1  . GLN A 1 18  ? -3.643  -4.370  3.925   1.00 0.00 ? 18  GLN A OE1  7  
ATOM 9664  N NE2  . GLN A 1 18  ? -5.363  -4.786  2.544   1.00 0.00 ? 18  GLN A NE2  7  
ATOM 9665  H H    . GLN A 1 18  ? -2.665  -9.182  2.530   1.00 0.00 ? 18  GLN A H    7  
ATOM 9666  H HA   . GLN A 1 18  ? -1.086  -7.106  1.853   1.00 0.00 ? 18  GLN A HA   7  
ATOM 9667  H HB2  . GLN A 1 18  ? -2.865  -7.483  4.241   1.00 0.00 ? 18  GLN A HB2  7  
ATOM 9668  H HB3  . GLN A 1 18  ? -1.990  -5.975  4.010   1.00 0.00 ? 18  GLN A HB3  7  
ATOM 9669  H HG2  . GLN A 1 18  ? -3.071  -6.137  1.605   1.00 0.00 ? 18  GLN A HG2  7  
ATOM 9670  H HG3  . GLN A 1 18  ? -4.254  -7.114  2.473   1.00 0.00 ? 18  GLN A HG3  7  
ATOM 9671  H HE21 . GLN A 1 18  ? -5.731  -5.397  1.870   1.00 0.00 ? 18  GLN A HE21 7  
ATOM 9672  H HE22 . GLN A 1 18  ? -5.821  -3.977  2.850   1.00 0.00 ? 18  GLN A HE22 7  
ATOM 9673  N N    . GLN A 1 19  ? -0.122  -8.138  4.846   1.00 0.00 ? 19  GLN A N    7  
ATOM 9674  C CA   . GLN A 1 19  ? 1.015   -8.185  5.757   1.00 0.00 ? 19  GLN A CA   7  
ATOM 9675  C C    . GLN A 1 19  ? 2.287   -8.589  5.020   1.00 0.00 ? 19  GLN A C    7  
ATOM 9676  O O    . GLN A 1 19  ? 3.333   -7.959  5.175   1.00 0.00 ? 19  GLN A O    7  
ATOM 9677  C CB   . GLN A 1 19  ? 0.740   -9.165  6.899   1.00 0.00 ? 19  GLN A CB   7  
ATOM 9678  C CG   . GLN A 1 19  ? -0.503  -8.826  7.706   1.00 0.00 ? 19  GLN A CG   7  
ATOM 9679  C CD   . GLN A 1 19  ? -0.399  -9.268  9.152   1.00 0.00 ? 19  GLN A CD   7  
ATOM 9680  O OE1  . GLN A 1 19  ? -0.617  -10.436 9.474   1.00 0.00 ? 19  GLN A OE1  7  
ATOM 9681  N NE2  . GLN A 1 19  ? -0.063  -8.333  10.034  1.00 0.00 ? 19  GLN A NE2  7  
ATOM 9682  H H    . GLN A 1 19  ? -0.974  -8.532  5.124   1.00 0.00 ? 19  GLN A H    7  
ATOM 9683  H HA   . GLN A 1 19  ? 1.151   -7.196  6.169   1.00 0.00 ? 19  GLN A HA   7  
ATOM 9684  H HB2  . GLN A 1 19  ? 0.617   -10.155 6.486   1.00 0.00 ? 19  GLN A HB2  7  
ATOM 9685  H HB3  . GLN A 1 19  ? 1.588   -9.166  7.569   1.00 0.00 ? 19  GLN A HB3  7  
ATOM 9686  H HG2  . GLN A 1 19  ? -0.652  -7.757  7.682   1.00 0.00 ? 19  GLN A HG2  7  
ATOM 9687  H HG3  . GLN A 1 19  ? -1.353  -9.317  7.255   1.00 0.00 ? 19  GLN A HG3  7  
ATOM 9688  H HE21 . GLN A 1 19  ? 0.095   -7.423  9.705   1.00 0.00 ? 19  GLN A HE21 7  
ATOM 9689  H HE22 . GLN A 1 19  ? 0.011   -8.590  10.976  1.00 0.00 ? 19  GLN A HE22 7  
ATOM 9690  N N    . ILE A 1 20  ? 2.190   -9.644  4.217   1.00 0.00 ? 20  ILE A N    7  
ATOM 9691  C CA   . ILE A 1 20  ? 3.333   -10.131 3.455   1.00 0.00 ? 20  ILE A CA   7  
ATOM 9692  C C    . ILE A 1 20  ? 3.931   -9.025  2.593   1.00 0.00 ? 20  ILE A C    7  
ATOM 9693  O O    . ILE A 1 20  ? 5.151   -8.874  2.515   1.00 0.00 ? 20  ILE A O    7  
ATOM 9694  C CB   . ILE A 1 20  ? 2.944   -11.317 2.553   1.00 0.00 ? 20  ILE A CB   7  
ATOM 9695  C CG1  . ILE A 1 20  ? 2.394   -12.469 3.395   1.00 0.00 ? 20  ILE A CG1  7  
ATOM 9696  C CG2  . ILE A 1 20  ? 4.142   -11.776 1.736   1.00 0.00 ? 20  ILE A CG2  7  
ATOM 9697  C CD1  . ILE A 1 20  ? 1.392   -13.331 2.660   1.00 0.00 ? 20  ILE A CD1  7  
ATOM 9698  H H    . ILE A 1 20  ? 1.330   -10.105 4.135   1.00 0.00 ? 20  ILE A H    7  
ATOM 9699  H HA   . ILE A 1 20  ? 4.082   -10.470 4.158   1.00 0.00 ? 20  ILE A HA   7  
ATOM 9700  H HB   . ILE A 1 20  ? 2.179   -10.983 1.868   1.00 0.00 ? 20  ILE A HB   7  
ATOM 9701  H HG12 . ILE A 1 20  ? 3.210   -13.102 3.706   1.00 0.00 ? 20  ILE A HG12 7  
ATOM 9702  H HG13 . ILE A 1 20  ? 1.905   -12.064 4.270   1.00 0.00 ? 20  ILE A HG13 7  
ATOM 9703  H HG21 . ILE A 1 20  ? 4.944   -12.061 2.401   1.00 0.00 ? 20  ILE A HG21 7  
ATOM 9704  H HG22 . ILE A 1 20  ? 3.861   -12.625 1.130   1.00 0.00 ? 20  ILE A HG22 7  
ATOM 9705  H HG23 . ILE A 1 20  ? 4.473   -10.971 1.097   1.00 0.00 ? 20  ILE A HG23 7  
ATOM 9706  H HD11 . ILE A 1 20  ? 0.407   -13.171 3.073   1.00 0.00 ? 20  ILE A HD11 7  
ATOM 9707  H HD12 . ILE A 1 20  ? 1.391   -13.069 1.613   1.00 0.00 ? 20  ILE A HD12 7  
ATOM 9708  H HD13 . ILE A 1 20  ? 1.662   -14.371 2.770   1.00 0.00 ? 20  ILE A HD13 7  
ATOM 9709  N N    . LEU A 1 21  ? 3.065   -8.251  1.949   1.00 0.00 ? 21  LEU A N    7  
ATOM 9710  C CA   . LEU A 1 21  ? 3.507   -7.156  1.093   1.00 0.00 ? 21  LEU A CA   7  
ATOM 9711  C C    . LEU A 1 21  ? 4.325   -6.141  1.885   1.00 0.00 ? 21  LEU A C    7  
ATOM 9712  O O    . LEU A 1 21  ? 5.351   -5.652  1.413   1.00 0.00 ? 21  LEU A O    7  
ATOM 9713  C CB   . LEU A 1 21  ? 2.302   -6.466  0.451   1.00 0.00 ? 21  LEU A CB   7  
ATOM 9714  C CG   . LEU A 1 21  ? 1.261   -7.388  -0.187  1.00 0.00 ? 21  LEU A CG   7  
ATOM 9715  C CD1  . LEU A 1 21  ? 0.141   -6.574  -0.815  1.00 0.00 ? 21  LEU A CD1  7  
ATOM 9716  C CD2  . LEU A 1 21  ? 1.913   -8.291  -1.223  1.00 0.00 ? 21  LEU A CD2  7  
ATOM 9717  H H    . LEU A 1 21  ? 2.105   -8.420  2.050   1.00 0.00 ? 21  LEU A H    7  
ATOM 9718  H HA   . LEU A 1 21  ? 4.129   -7.573  0.315   1.00 0.00 ? 21  LEU A HA   7  
ATOM 9719  H HB2  . LEU A 1 21  ? 1.806   -5.887  1.215   1.00 0.00 ? 21  LEU A HB2  7  
ATOM 9720  H HB3  . LEU A 1 21  ? 2.672   -5.802  -0.318  1.00 0.00 ? 21  LEU A HB3  7  
ATOM 9721  H HG   . LEU A 1 21  ? 0.828   -8.016  0.580   1.00 0.00 ? 21  LEU A HG   7  
ATOM 9722  H HD11 . LEU A 1 21  ? -0.411  -6.063  -0.040  1.00 0.00 ? 21  LEU A HD11 7  
ATOM 9723  H HD12 . LEU A 1 21  ? -0.523  -7.233  -1.355  1.00 0.00 ? 21  LEU A HD12 7  
ATOM 9724  H HD13 . LEU A 1 21  ? 0.561   -5.849  -1.497  1.00 0.00 ? 21  LEU A HD13 7  
ATOM 9725  H HD21 . LEU A 1 21  ? 2.028   -7.749  -2.151  1.00 0.00 ? 21  LEU A HD21 7  
ATOM 9726  H HD22 . LEU A 1 21  ? 1.290   -9.158  -1.388  1.00 0.00 ? 21  LEU A HD22 7  
ATOM 9727  H HD23 . LEU A 1 21  ? 2.883   -8.606  -0.867  1.00 0.00 ? 21  LEU A HD23 7  
ATOM 9728  N N    . TYR A 1 22  ? 3.866   -5.832  3.092   1.00 0.00 ? 22  TYR A N    7  
ATOM 9729  C CA   . TYR A 1 22  ? 4.555   -4.876  3.951   1.00 0.00 ? 22  TYR A CA   7  
ATOM 9730  C C    . TYR A 1 22  ? 5.936   -5.393  4.343   1.00 0.00 ? 22  TYR A C    7  
ATOM 9731  O O    . TYR A 1 22  ? 6.930   -4.675  4.242   1.00 0.00 ? 22  TYR A O    7  
ATOM 9732  C CB   . TYR A 1 22  ? 3.727   -4.597  5.206   1.00 0.00 ? 22  TYR A CB   7  
ATOM 9733  C CG   . TYR A 1 22  ? 2.445   -3.844  4.931   1.00 0.00 ? 22  TYR A CG   7  
ATOM 9734  C CD1  . TYR A 1 22  ? 2.443   -2.460  4.802   1.00 0.00 ? 22  TYR A CD1  7  
ATOM 9735  C CD2  . TYR A 1 22  ? 1.236   -4.515  4.801   1.00 0.00 ? 22  TYR A CD2  7  
ATOM 9736  C CE1  . TYR A 1 22  ? 1.274   -1.768  4.552   1.00 0.00 ? 22  TYR A CE1  7  
ATOM 9737  C CE2  . TYR A 1 22  ? 0.062   -3.831  4.549   1.00 0.00 ? 22  TYR A CE2  7  
ATOM 9738  C CZ   . TYR A 1 22  ? 0.087   -2.458  4.425   1.00 0.00 ? 22  TYR A CZ   7  
ATOM 9739  O OH   . TYR A 1 22  ? -1.080  -1.772  4.175   1.00 0.00 ? 22  TYR A OH   7  
ATOM 9740  H H    . TYR A 1 22  ? 3.042   -6.256  3.414   1.00 0.00 ? 22  TYR A H    7  
ATOM 9741  H HA   . TYR A 1 22  ? 4.671   -3.956  3.396   1.00 0.00 ? 22  TYR A HA   7  
ATOM 9742  H HB2  . TYR A 1 22  ? 3.466   -5.534  5.673   1.00 0.00 ? 22  TYR A HB2  7  
ATOM 9743  H HB3  . TYR A 1 22  ? 4.316   -4.009  5.894   1.00 0.00 ? 22  TYR A HB3  7  
ATOM 9744  H HD1  . TYR A 1 22  ? 3.375   -1.923  4.902   1.00 0.00 ? 22  TYR A HD1  7  
ATOM 9745  H HD2  . TYR A 1 22  ? 1.220   -5.591  4.899   1.00 0.00 ? 22  TYR A HD2  7  
ATOM 9746  H HE1  . TYR A 1 22  ? 1.293   -0.692  4.455   1.00 0.00 ? 22  TYR A HE1  7  
ATOM 9747  H HE2  . TYR A 1 22  ? -0.868  -4.371  4.450   1.00 0.00 ? 22  TYR A HE2  7  
ATOM 9748  H HH   . TYR A 1 22  ? -1.828  -2.291  4.482   1.00 0.00 ? 22  TYR A HH   7  
ATOM 9749  N N    . GLN A 1 23  ? 5.987   -6.643  4.791   1.00 0.00 ? 23  GLN A N    7  
ATOM 9750  C CA   . GLN A 1 23  ? 7.245   -7.257  5.198   1.00 0.00 ? 23  GLN A CA   7  
ATOM 9751  C C    . GLN A 1 23  ? 8.272   -7.193  4.072   1.00 0.00 ? 23  GLN A C    7  
ATOM 9752  O O    . GLN A 1 23  ? 9.473   -7.091  4.320   1.00 0.00 ? 23  GLN A O    7  
ATOM 9753  C CB   . GLN A 1 23  ? 7.017   -8.711  5.614   1.00 0.00 ? 23  GLN A CB   7  
ATOM 9754  C CG   . GLN A 1 23  ? 6.702   -8.880  7.092   1.00 0.00 ? 23  GLN A CG   7  
ATOM 9755  C CD   . GLN A 1 23  ? 7.950   -8.967  7.948   1.00 0.00 ? 23  GLN A CD   7  
ATOM 9756  O OE1  . GLN A 1 23  ? 8.529   -7.948  8.326   1.00 0.00 ? 23  GLN A OE1  7  
ATOM 9757  N NE2  . GLN A 1 23  ? 8.371   -10.187 8.259   1.00 0.00 ? 23  GLN A NE2  7  
ATOM 9758  H H    . GLN A 1 23  ? 5.160   -7.165  4.848   1.00 0.00 ? 23  GLN A H    7  
ATOM 9759  H HA   . GLN A 1 23  ? 7.624   -6.706  6.046   1.00 0.00 ? 23  GLN A HA   7  
ATOM 9760  H HB2  . GLN A 1 23  ? 6.191   -9.111  5.044   1.00 0.00 ? 23  GLN A HB2  7  
ATOM 9761  H HB3  . GLN A 1 23  ? 7.906   -9.281  5.391   1.00 0.00 ? 23  GLN A HB3  7  
ATOM 9762  H HG2  . GLN A 1 23  ? 6.117   -8.033  7.421   1.00 0.00 ? 23  GLN A HG2  7  
ATOM 9763  H HG3  . GLN A 1 23  ? 6.128   -9.785  7.223   1.00 0.00 ? 23  GLN A HG3  7  
ATOM 9764  H HE21 . GLN A 1 23  ? 7.859   -10.953 7.921   1.00 0.00 ? 23  GLN A HE21 7  
ATOM 9765  H HE22 . GLN A 1 23  ? 9.175   -10.273 8.810   1.00 0.00 ? 23  GLN A HE22 7  
ATOM 9766  N N    . ALA A 1 24  ? 7.791   -7.255  2.835   1.00 0.00 ? 24  ALA A N    7  
ATOM 9767  C CA   . ALA A 1 24  ? 8.667   -7.202  1.671   1.00 0.00 ? 24  ALA A CA   7  
ATOM 9768  C C    . ALA A 1 24  ? 9.089   -5.769  1.367   1.00 0.00 ? 24  ALA A C    7  
ATOM 9769  O O    . ALA A 1 24  ? 10.273  -5.487  1.178   1.00 0.00 ? 24  ALA A O    7  
ATOM 9770  C CB   . ALA A 1 24  ? 7.978   -7.819  0.464   1.00 0.00 ? 24  ALA A CB   7  
ATOM 9771  H H    . ALA A 1 24  ? 6.824   -7.336  2.702   1.00 0.00 ? 24  ALA A H    7  
ATOM 9772  H HA   . ALA A 1 24  ? 9.548   -7.788  1.890   1.00 0.00 ? 24  ALA A HA   7  
ATOM 9773  H HB1  . ALA A 1 24  ? 8.515   -8.706  0.158   1.00 0.00 ? 24  ALA A HB1  7  
ATOM 9774  H HB2  . ALA A 1 24  ? 6.964   -8.084  0.724   1.00 0.00 ? 24  ALA A HB2  7  
ATOM 9775  H HB3  . ALA A 1 24  ? 7.967   -7.107  -0.348  1.00 0.00 ? 24  ALA A HB3  7  
ATOM 9776  N N    . TYR A 1 25  ? 8.115   -4.867  1.320   1.00 0.00 ? 25  TYR A N    7  
ATOM 9777  C CA   . TYR A 1 25  ? 8.386   -3.463  1.035   1.00 0.00 ? 25  TYR A CA   7  
ATOM 9778  C C    . TYR A 1 25  ? 9.381   -2.886  2.037   1.00 0.00 ? 25  TYR A C    7  
ATOM 9779  O O    . TYR A 1 25  ? 10.245  -2.085  1.680   1.00 0.00 ? 25  TYR A O    7  
ATOM 9780  C CB   . TYR A 1 25  ? 7.088   -2.655  1.065   1.00 0.00 ? 25  TYR A CB   7  
ATOM 9781  C CG   . TYR A 1 25  ? 7.216   -1.279  0.452   1.00 0.00 ? 25  TYR A CG   7  
ATOM 9782  C CD1  . TYR A 1 25  ? 7.934   -0.276  1.092   1.00 0.00 ? 25  TYR A CD1  7  
ATOM 9783  C CD2  . TYR A 1 25  ? 6.620   -0.982  -0.768  1.00 0.00 ? 25  TYR A CD2  7  
ATOM 9784  C CE1  . TYR A 1 25  ? 8.053   0.983   0.536   1.00 0.00 ? 25  TYR A CE1  7  
ATOM 9785  C CE2  . TYR A 1 25  ? 6.736   0.274   -1.332  1.00 0.00 ? 25  TYR A CE2  7  
ATOM 9786  C CZ   . TYR A 1 25  ? 7.453   1.253   -0.677  1.00 0.00 ? 25  TYR A CZ   7  
ATOM 9787  O OH   . TYR A 1 25  ? 7.569   2.505   -1.235  1.00 0.00 ? 25  TYR A OH   7  
ATOM 9788  H H    . TYR A 1 25  ? 7.191   -5.152  1.479   1.00 0.00 ? 25  TYR A H    7  
ATOM 9789  H HA   . TYR A 1 25  ? 8.813   -3.402  0.044   1.00 0.00 ? 25  TYR A HA   7  
ATOM 9790  H HB2  . TYR A 1 25  ? 6.326   -3.190  0.520   1.00 0.00 ? 25  TYR A HB2  7  
ATOM 9791  H HB3  . TYR A 1 25  ? 6.772   -2.533  2.091   1.00 0.00 ? 25  TYR A HB3  7  
ATOM 9792  H HD1  . TYR A 1 25  ? 8.403   -0.490  2.041   1.00 0.00 ? 25  TYR A HD1  7  
ATOM 9793  H HD2  . TYR A 1 25  ? 6.058   -1.751  -1.278  1.00 0.00 ? 25  TYR A HD2  7  
ATOM 9794  H HE1  . TYR A 1 25  ? 8.615   1.750   1.048   1.00 0.00 ? 25  TYR A HE1  7  
ATOM 9795  H HE2  . TYR A 1 25  ? 6.265   0.486   -2.281  1.00 0.00 ? 25  TYR A HE2  7  
ATOM 9796  H HH   . TYR A 1 25  ? 7.303   3.167   -0.593  1.00 0.00 ? 25  TYR A HH   7  
ATOM 9797  N N    . ASP A 1 26  ? 9.253   -3.299  3.293   1.00 0.00 ? 26  ASP A N    7  
ATOM 9798  C CA   . ASP A 1 26  ? 10.141  -2.826  4.348   1.00 0.00 ? 26  ASP A CA   7  
ATOM 9799  C C    . ASP A 1 26  ? 11.595  -3.147  4.019   1.00 0.00 ? 26  ASP A C    7  
ATOM 9800  O O    . ASP A 1 26  ? 12.504  -2.400  4.383   1.00 0.00 ? 26  ASP A O    7  
ATOM 9801  C CB   . ASP A 1 26  ? 9.757   -3.456  5.688   1.00 0.00 ? 26  ASP A CB   7  
ATOM 9802  C CG   . ASP A 1 26  ? 10.074  -2.553  6.864   1.00 0.00 ? 26  ASP A CG   7  
ATOM 9803  O OD1  . ASP A 1 26  ? 11.142  -1.907  6.844   1.00 0.00 ? 26  ASP A OD1  7  
ATOM 9804  O OD2  . ASP A 1 26  ? 9.255   -2.495  7.805   1.00 0.00 ? 26  ASP A OD2  7  
ATOM 9805  H H    . ASP A 1 26  ? 8.544   -3.939  3.515   1.00 0.00 ? 26  ASP A H    7  
ATOM 9806  H HA   . ASP A 1 26  ? 10.029  -1.755  4.420   1.00 0.00 ? 26  ASP A HA   7  
ATOM 9807  H HB2  . ASP A 1 26  ? 8.696   -3.661  5.691   1.00 0.00 ? 26  ASP A HB2  7  
ATOM 9808  H HB3  . ASP A 1 26  ? 10.299  -4.382  5.811   1.00 0.00 ? 26  ASP A HB3  7  
ATOM 9809  N N    . ARG A 1 27  ? 11.808  -4.262  3.329   1.00 0.00 ? 27  ARG A N    7  
ATOM 9810  C CA   . ARG A 1 27  ? 13.153  -4.683  2.953   1.00 0.00 ? 27  ARG A CA   7  
ATOM 9811  C C    . ARG A 1 27  ? 13.589  -4.012  1.653   1.00 0.00 ? 27  ARG A C    7  
ATOM 9812  O O    . ARG A 1 27  ? 14.683  -3.456  1.569   1.00 0.00 ? 27  ARG A O    7  
ATOM 9813  C CB   . ARG A 1 27  ? 13.209  -6.204  2.798   1.00 0.00 ? 27  ARG A CB   7  
ATOM 9814  C CG   . ARG A 1 27  ? 12.671  -6.959  4.002   1.00 0.00 ? 27  ARG A CG   7  
ATOM 9815  C CD   . ARG A 1 27  ? 12.792  -8.464  3.816   1.00 0.00 ? 27  ARG A CD   7  
ATOM 9816  N NE   . ARG A 1 27  ? 12.913  -9.165  5.091   1.00 0.00 ? 27  ARG A NE   7  
ATOM 9817  C CZ   . ARG A 1 27  ? 12.888  -10.488 5.207   1.00 0.00 ? 27  ARG A CZ   7  
ATOM 9818  N NH1  . ARG A 1 27  ? 12.749  -11.249 4.131   1.00 0.00 ? 27  ARG A NH1  7  
ATOM 9819  N NH2  . ARG A 1 27  ? 13.004  -11.053 6.403   1.00 0.00 ? 27  ARG A NH2  7  
ATOM 9820  H H    . ARG A 1 27  ? 11.043  -4.816  3.067   1.00 0.00 ? 27  ARG A H    7  
ATOM 9821  H HA   . ARG A 1 27  ? 13.827  -4.385  3.742   1.00 0.00 ? 27  ARG A HA   7  
ATOM 9822  H HB2  . ARG A 1 27  ? 12.627  -6.488  1.933   1.00 0.00 ? 27  ARG A HB2  7  
ATOM 9823  H HB3  . ARG A 1 27  ? 14.236  -6.500  2.644   1.00 0.00 ? 27  ARG A HB3  7  
ATOM 9824  H HG2  . ARG A 1 27  ? 13.234  -6.670  4.878   1.00 0.00 ? 27  ARG A HG2  7  
ATOM 9825  H HG3  . ARG A 1 27  ? 11.631  -6.705  4.139   1.00 0.00 ? 27  ARG A HG3  7  
ATOM 9826  H HD2  . ARG A 1 27  ? 11.913  -8.821  3.301   1.00 0.00 ? 27  ARG A HD2  7  
ATOM 9827  H HD3  . ARG A 1 27  ? 13.668  -8.670  3.218   1.00 0.00 ? 27  ARG A HD3  7  
ATOM 9828  H HE   . ARG A 1 27  ? 13.017  -8.622  5.900   1.00 0.00 ? 27  ARG A HE   7  
ATOM 9829  H HH11 . ARG A 1 27  ? 12.663  -10.827 3.229   1.00 0.00 ? 27  ARG A HH11 7  
ATOM 9830  H HH12 . ARG A 1 27  ? 12.732  -12.245 4.221   1.00 0.00 ? 27  ARG A HH12 7  
ATOM 9831  H HH21 . ARG A 1 27  ? 13.109  -10.482 7.217   1.00 0.00 ? 27  ARG A HH21 7  
ATOM 9832  H HH22 . ARG A 1 27  ? 12.985  -12.048 6.489   1.00 0.00 ? 27  ARG A HH22 7  
ATOM 9833  N N    . GLN A 1 28  ? 12.726  -4.071  0.644   1.00 0.00 ? 28  GLN A N    7  
ATOM 9834  C CA   . GLN A 1 28  ? 13.023  -3.470  -0.650  1.00 0.00 ? 28  GLN A CA   7  
ATOM 9835  C C    . GLN A 1 28  ? 11.863  -2.602  -1.127  1.00 0.00 ? 28  GLN A C    7  
ATOM 9836  O O    . GLN A 1 28  ? 10.715  -3.045  -1.161  1.00 0.00 ? 28  GLN A O    7  
ATOM 9837  C CB   . GLN A 1 28  ? 13.321  -4.557  -1.685  1.00 0.00 ? 28  GLN A CB   7  
ATOM 9838  C CG   . GLN A 1 28  ? 13.545  -4.017  -3.088  1.00 0.00 ? 28  GLN A CG   7  
ATOM 9839  C CD   . GLN A 1 28  ? 14.959  -3.512  -3.299  1.00 0.00 ? 28  GLN A CD   7  
ATOM 9840  O OE1  . GLN A 1 28  ? 15.548  -2.891  -2.413  1.00 0.00 ? 28  GLN A OE1  7  
ATOM 9841  N NE2  . GLN A 1 28  ? 15.512  -3.775  -4.477  1.00 0.00 ? 28  GLN A NE2  7  
ATOM 9842  H H    . GLN A 1 28  ? 11.869  -4.529  0.774   1.00 0.00 ? 28  GLN A H    7  
ATOM 9843  H HA   . GLN A 1 28  ? 13.897  -2.848  -0.534  1.00 0.00 ? 28  GLN A HA   7  
ATOM 9844  H HB2  . GLN A 1 28  ? 14.208  -5.092  -1.381  1.00 0.00 ? 28  GLN A HB2  7  
ATOM 9845  H HB3  . GLN A 1 28  ? 12.488  -5.245  -1.716  1.00 0.00 ? 28  GLN A HB3  7  
ATOM 9846  H HG2  . GLN A 1 28  ? 13.352  -4.806  -3.799  1.00 0.00 ? 28  GLN A HG2  7  
ATOM 9847  H HG3  . GLN A 1 28  ? 12.857  -3.202  -3.260  1.00 0.00 ? 28  GLN A HG3  7  
ATOM 9848  H HE21 . GLN A 1 28  ? 14.982  -4.272  -5.136  1.00 0.00 ? 28  GLN A HE21 7  
ATOM 9849  H HE22 . GLN A 1 28  ? 16.424  -3.459  -4.642  1.00 0.00 ? 28  GLN A HE22 7  
ATOM 9850  N N    . LYS A 1 29  ? 12.170  -1.363  -1.494  1.00 0.00 ? 29  LYS A N    7  
ATOM 9851  C CA   . LYS A 1 29  ? 11.154  -0.431  -1.970  1.00 0.00 ? 29  LYS A CA   7  
ATOM 9852  C C    . LYS A 1 29  ? 10.715  -0.782  -3.388  1.00 0.00 ? 29  LYS A C    7  
ATOM 9853  O O    . LYS A 1 29  ? 9.541   -0.662  -3.733  1.00 0.00 ? 29  LYS A O    7  
ATOM 9854  C CB   . LYS A 1 29  ? 11.688  1.002   -1.930  1.00 0.00 ? 29  LYS A CB   7  
ATOM 9855  C CG   . LYS A 1 29  ? 12.372  1.360   -0.622  1.00 0.00 ? 29  LYS A CG   7  
ATOM 9856  C CD   . LYS A 1 29  ? 11.387  1.928   0.386   1.00 0.00 ? 29  LYS A CD   7  
ATOM 9857  C CE   . LYS A 1 29  ? 11.883  1.747   1.812   1.00 0.00 ? 29  LYS A CE   7  
ATOM 9858  N NZ   . LYS A 1 29  ? 10.860  2.162   2.812   1.00 0.00 ? 29  LYS A NZ   7  
ATOM 9859  H H    . LYS A 1 29  ? 13.103  -1.067  -1.445  1.00 0.00 ? 29  LYS A H    7  
ATOM 9860  H HA   . LYS A 1 29  ? 10.300  -0.507  -1.313  1.00 0.00 ? 29  LYS A HA   7  
ATOM 9861  H HB2  . LYS A 1 29  ? 12.399  1.131   -2.732  1.00 0.00 ? 29  LYS A HB2  7  
ATOM 9862  H HB3  . LYS A 1 29  ? 10.863  1.685   -2.079  1.00 0.00 ? 29  LYS A HB3  7  
ATOM 9863  H HG2  . LYS A 1 29  ? 12.823  0.471   -0.207  1.00 0.00 ? 29  LYS A HG2  7  
ATOM 9864  H HG3  . LYS A 1 29  ? 13.138  2.097   -0.818  1.00 0.00 ? 29  LYS A HG3  7  
ATOM 9865  H HD2  . LYS A 1 29  ? 11.255  2.982   0.193   1.00 0.00 ? 29  LYS A HD2  7  
ATOM 9866  H HD3  . LYS A 1 29  ? 10.440  1.419   0.276   1.00 0.00 ? 29  LYS A HD3  7  
ATOM 9867  H HE2  . LYS A 1 29  ? 12.124  0.707   1.967   1.00 0.00 ? 29  LYS A HE2  7  
ATOM 9868  H HE3  . LYS A 1 29  ? 12.771  2.346   1.949   1.00 0.00 ? 29  LYS A HE3  7  
ATOM 9869  H HZ1  . LYS A 1 29  ? 10.895  1.534   3.640   1.00 0.00 ? 29  LYS A HZ1  7  
ATOM 9870  H HZ2  . LYS A 1 29  ? 9.910   2.111   2.393   1.00 0.00 ? 29  LYS A HZ2  7  
ATOM 9871  H HZ3  . LYS A 1 29  ? 11.038  3.138   3.122   1.00 0.00 ? 29  LYS A HZ3  7  
ATOM 9872  N N    . ASN A 1 30  ? 11.668  -1.218  -4.206  1.00 0.00 ? 30  ASN A N    7  
ATOM 9873  C CA   . ASN A 1 30  ? 11.379  -1.588  -5.587  1.00 0.00 ? 30  ASN A CA   7  
ATOM 9874  C C    . ASN A 1 30  ? 11.664  -3.068  -5.825  1.00 0.00 ? 30  ASN A C    7  
ATOM 9875  O O    . ASN A 1 30  ? 12.750  -3.455  -6.258  1.00 0.00 ? 30  ASN A O    7  
ATOM 9876  C CB   . ASN A 1 30  ? 12.210  -0.736  -6.550  1.00 0.00 ? 30  ASN A CB   7  
ATOM 9877  C CG   . ASN A 1 30  ? 12.080  0.748   -6.267  1.00 0.00 ? 30  ASN A CG   7  
ATOM 9878  O OD1  . ASN A 1 30  ? 10.990  1.314   -6.348  1.00 0.00 ? 30  ASN A OD1  7  
ATOM 9879  N ND2  . ASN A 1 30  ? 13.196  1.387   -5.933  1.00 0.00 ? 30  ASN A ND2  7  
ATOM 9880  H H    . ASN A 1 30  ? 12.587  -1.293  -3.874  1.00 0.00 ? 30  ASN A H    7  
ATOM 9881  H HA   . ASN A 1 30  ? 10.332  -1.401  -5.768  1.00 0.00 ? 30  ASN A HA   7  
ATOM 9882  H HB2  . ASN A 1 30  ? 13.251  -1.010  -6.457  1.00 0.00 ? 30  ASN A HB2  7  
ATOM 9883  H HB3  . ASN A 1 30  ? 11.882  -0.921  -7.561  1.00 0.00 ? 30  ASN A HB3  7  
ATOM 9884  H HD21 . ASN A 1 30  ? 14.028  0.872   -5.888  1.00 0.00 ? 30  ASN A HD21 7  
ATOM 9885  H HD22 . ASN A 1 30  ? 13.140  2.347   -5.744  1.00 0.00 ? 30  ASN A HD22 7  
ATOM 9886  N N    . PRO A 1 31  ? 10.666  -3.916  -5.537  1.00 0.00 ? 31  PRO A N    7  
ATOM 9887  C CA   . PRO A 1 31  ? 10.785  -5.366  -5.713  1.00 0.00 ? 31  PRO A CA   7  
ATOM 9888  C C    . PRO A 1 31  ? 10.835  -5.770  -7.183  1.00 0.00 ? 31  PRO A C    7  
ATOM 9889  O O    . PRO A 1 31  ? 10.019  -5.321  -7.988  1.00 0.00 ? 31  PRO A O    7  
ATOM 9890  C CB   . PRO A 1 31  ? 9.515   -5.909  -5.053  1.00 0.00 ? 31  PRO A CB   7  
ATOM 9891  C CG   . PRO A 1 31  ? 8.537   -4.787  -5.134  1.00 0.00 ? 31  PRO A CG   7  
ATOM 9892  C CD   . PRO A 1 31  ? 9.345   -3.524  -5.018  1.00 0.00 ? 31  PRO A CD   7  
ATOM 9893  H HA   . PRO A 1 31  ? 11.653  -5.758  -5.204  1.00 0.00 ? 31  PRO A HA   7  
ATOM 9894  H HB2  . PRO A 1 31  ? 9.167   -6.777  -5.594  1.00 0.00 ? 31  PRO A HB2  7  
ATOM 9895  H HB3  . PRO A 1 31  ? 9.724   -6.176  -4.028  1.00 0.00 ? 31  PRO A HB3  7  
ATOM 9896  H HG2  . PRO A 1 31  ? 8.022   -4.817  -6.082  1.00 0.00 ? 31  PRO A HG2  7  
ATOM 9897  H HG3  . PRO A 1 31  ? 7.831   -4.856  -4.319  1.00 0.00 ? 31  PRO A HG3  7  
ATOM 9898  H HD2  . PRO A 1 31  ? 8.910   -2.742  -5.622  1.00 0.00 ? 31  PRO A HD2  7  
ATOM 9899  H HD3  . PRO A 1 31  ? 9.414   -3.214  -3.986  1.00 0.00 ? 31  PRO A HD3  7  
ATOM 9900  N N    . SER A 1 32  ? 11.797  -6.620  -7.526  1.00 0.00 ? 32  SER A N    7  
ATOM 9901  C CA   . SER A 1 32  ? 11.955  -7.082  -8.900  1.00 0.00 ? 32  SER A CA   7  
ATOM 9902  C C    . SER A 1 32  ? 11.272  -8.432  -9.101  1.00 0.00 ? 32  SER A C    7  
ATOM 9903  O O    . SER A 1 32  ? 10.720  -9.008  -8.164  1.00 0.00 ? 32  SER A O    7  
ATOM 9904  C CB   . SER A 1 32  ? 13.439  -7.190  -9.256  1.00 0.00 ? 32  SER A CB   7  
ATOM 9905  O OG   . SER A 1 32  ? 13.990  -5.915  -9.536  1.00 0.00 ? 32  SER A OG   7  
ATOM 9906  H H    . SER A 1 32  ? 12.417  -6.943  -6.838  1.00 0.00 ? 32  SER A H    7  
ATOM 9907  H HA   . SER A 1 32  ? 11.489  -6.356  -9.549  1.00 0.00 ? 32  SER A HA   7  
ATOM 9908  H HB2  . SER A 1 32  ? 13.975  -7.626  -8.427  1.00 0.00 ? 32  SER A HB2  7  
ATOM 9909  H HB3  . SER A 1 32  ? 13.552  -7.817  -10.129 1.00 0.00 ? 32  SER A HB3  7  
ATOM 9910  H HG   . SER A 1 32  ? 13.514  -5.513  -10.266 1.00 0.00 ? 32  SER A HG   7  
ATOM 9911  N N    . LYS A 1 33  ? 11.315  -8.931  -10.332 1.00 0.00 ? 33  LYS A N    7  
ATOM 9912  C CA   . LYS A 1 33  ? 10.702  -10.213 -10.660 1.00 0.00 ? 33  LYS A CA   7  
ATOM 9913  C C    . LYS A 1 33  ? 10.861  -11.201 -9.509  1.00 0.00 ? 33  LYS A C    7  
ATOM 9914  O O    . LYS A 1 33  ? 9.911   -11.888 -9.134  1.00 0.00 ? 33  LYS A O    7  
ATOM 9915  C CB   . LYS A 1 33  ? 11.328  -10.790 -11.932 1.00 0.00 ? 33  LYS A CB   7  
ATOM 9916  C CG   . LYS A 1 33  ? 10.551  -11.957 -12.516 1.00 0.00 ? 33  LYS A CG   7  
ATOM 9917  C CD   . LYS A 1 33  ? 9.360   -11.481 -13.331 1.00 0.00 ? 33  LYS A CD   7  
ATOM 9918  C CE   . LYS A 1 33  ? 8.889   -12.549 -14.306 1.00 0.00 ? 33  LYS A CE   7  
ATOM 9919  N NZ   . LYS A 1 33  ? 8.097   -11.969 -15.426 1.00 0.00 ? 33  LYS A NZ   7  
ATOM 9920  H H    . LYS A 1 33  ? 11.770  -8.424  -11.038 1.00 0.00 ? 33  LYS A H    7  
ATOM 9921  H HA   . LYS A 1 33  ? 9.650   -10.044 -10.831 1.00 0.00 ? 33  LYS A HA   7  
ATOM 9922  H HB2  . LYS A 1 33  ? 11.382  -10.010 -12.677 1.00 0.00 ? 33  LYS A HB2  7  
ATOM 9923  H HB3  . LYS A 1 33  ? 12.329  -11.129 -11.704 1.00 0.00 ? 33  LYS A HB3  7  
ATOM 9924  H HG2  . LYS A 1 33  ? 11.206  -12.529 -13.157 1.00 0.00 ? 33  LYS A HG2  7  
ATOM 9925  H HG3  . LYS A 1 33  ? 10.197  -12.582 -11.709 1.00 0.00 ? 33  LYS A HG3  7  
ATOM 9926  H HD2  . LYS A 1 33  ? 8.549   -11.240 -12.660 1.00 0.00 ? 33  LYS A HD2  7  
ATOM 9927  H HD3  . LYS A 1 33  ? 9.644   -10.599 -13.887 1.00 0.00 ? 33  LYS A HD3  7  
ATOM 9928  H HE2  . LYS A 1 33  ? 9.752   -13.054 -14.711 1.00 0.00 ? 33  LYS A HE2  7  
ATOM 9929  H HE3  . LYS A 1 33  ? 8.274   -13.259 -13.772 1.00 0.00 ? 33  LYS A HE3  7  
ATOM 9930  H HZ1  . LYS A 1 33  ? 7.088   -11.944 -15.174 1.00 0.00 ? 33  LYS A HZ1  7  
ATOM 9931  H HZ2  . LYS A 1 33  ? 8.215   -12.545 -16.283 1.00 0.00 ? 33  LYS A HZ2  7  
ATOM 9932  H HZ3  . LYS A 1 33  ? 8.418   -11.000 -15.625 1.00 0.00 ? 33  LYS A HZ3  7  
ATOM 9933  N N    . GLU A 1 34  ? 12.066  -11.266 -8.952  1.00 0.00 ? 34  GLU A N    7  
ATOM 9934  C CA   . GLU A 1 34  ? 12.347  -12.171 -7.843  1.00 0.00 ? 34  GLU A CA   7  
ATOM 9935  C C    . GLU A 1 34  ? 11.584  -11.749 -6.591  1.00 0.00 ? 34  GLU A C    7  
ATOM 9936  O O    . GLU A 1 34  ? 10.860  -12.546 -5.996  1.00 0.00 ? 34  GLU A O    7  
ATOM 9937  C CB   . GLU A 1 34  ? 13.848  -12.205 -7.552  1.00 0.00 ? 34  GLU A CB   7  
ATOM 9938  C CG   . GLU A 1 34  ? 14.663  -12.896 -8.634  1.00 0.00 ? 34  GLU A CG   7  
ATOM 9939  C CD   . GLU A 1 34  ? 14.522  -14.405 -8.596  1.00 0.00 ? 34  GLU A CD   7  
ATOM 9940  O OE1  . GLU A 1 34  ? 15.097  -15.031 -7.681  1.00 0.00 ? 34  GLU A OE1  7  
ATOM 9941  O OE2  . GLU A 1 34  ? 13.837  -14.960 -9.481  1.00 0.00 ? 34  GLU A OE2  7  
ATOM 9942  H H    . GLU A 1 34  ? 12.783  -10.693 -9.295  1.00 0.00 ? 34  GLU A H    7  
ATOM 9943  H HA   . GLU A 1 34  ? 12.023  -13.159 -8.132  1.00 0.00 ? 34  GLU A HA   7  
ATOM 9944  H HB2  . GLU A 1 34  ? 14.207  -11.192 -7.452  1.00 0.00 ? 34  GLU A HB2  7  
ATOM 9945  H HB3  . GLU A 1 34  ? 14.010  -12.728 -6.621  1.00 0.00 ? 34  GLU A HB3  7  
ATOM 9946  H HG2  . GLU A 1 34  ? 14.329  -12.543 -9.598  1.00 0.00 ? 34  GLU A HG2  7  
ATOM 9947  H HG3  . GLU A 1 34  ? 15.704  -12.643 -8.499  1.00 0.00 ? 34  GLU A HG3  7  
ATOM 9948  N N    . GLU A 1 35  ? 11.754  -10.491 -6.197  1.00 0.00 ? 35  GLU A N    7  
ATOM 9949  C CA   . GLU A 1 35  ? 11.083  -9.964  -5.015  1.00 0.00 ? 35  GLU A CA   7  
ATOM 9950  C C    . GLU A 1 35  ? 9.568   -10.088 -5.148  1.00 0.00 ? 35  GLU A C    7  
ATOM 9951  O O    . GLU A 1 35  ? 8.930   -10.844 -4.416  1.00 0.00 ? 35  GLU A O    7  
ATOM 9952  C CB   . GLU A 1 35  ? 11.468  -8.499  -4.793  1.00 0.00 ? 35  GLU A CB   7  
ATOM 9953  C CG   . GLU A 1 35  ? 12.960  -8.285  -4.598  1.00 0.00 ? 35  GLU A CG   7  
ATOM 9954  C CD   . GLU A 1 35  ? 13.417  -8.608  -3.189  1.00 0.00 ? 35  GLU A CD   7  
ATOM 9955  O OE1  . GLU A 1 35  ? 13.694  -9.794  -2.912  1.00 0.00 ? 35  GLU A OE1  7  
ATOM 9956  O OE2  . GLU A 1 35  ? 13.497  -7.675  -2.363  1.00 0.00 ? 35  GLU A OE2  7  
ATOM 9957  H H    . GLU A 1 35  ? 12.345  -9.903  -6.714  1.00 0.00 ? 35  GLU A H    7  
ATOM 9958  H HA   . GLU A 1 35  ? 11.406  -10.544 -4.164  1.00 0.00 ? 35  GLU A HA   7  
ATOM 9959  H HB2  . GLU A 1 35  ? 11.150  -7.922  -5.648  1.00 0.00 ? 35  GLU A HB2  7  
ATOM 9960  H HB3  . GLU A 1 35  ? 10.956  -8.135  -3.914  1.00 0.00 ? 35  GLU A HB3  7  
ATOM 9961  H HG2  . GLU A 1 35  ? 13.495  -8.920  -5.288  1.00 0.00 ? 35  GLU A HG2  7  
ATOM 9962  H HG3  . GLU A 1 35  ? 13.192  -7.251  -4.808  1.00 0.00 ? 35  GLU A HG3  7  
ATOM 9963  N N    . ARG A 1 36  ? 8.999   -9.339  -6.088  1.00 0.00 ? 36  ARG A N    7  
ATOM 9964  C CA   . ARG A 1 36  ? 7.560   -9.364  -6.316  1.00 0.00 ? 36  ARG A CA   7  
ATOM 9965  C C    . ARG A 1 36  ? 7.035   -10.797 -6.327  1.00 0.00 ? 36  ARG A C    7  
ATOM 9966  O O    . ARG A 1 36  ? 6.031   -11.104 -5.685  1.00 0.00 ? 36  ARG A O    7  
ATOM 9967  C CB   . ARG A 1 36  ? 7.220   -8.675  -7.640  1.00 0.00 ? 36  ARG A CB   7  
ATOM 9968  C CG   . ARG A 1 36  ? 7.071   -7.167  -7.521  1.00 0.00 ? 36  ARG A CG   7  
ATOM 9969  C CD   . ARG A 1 36  ? 6.107   -6.620  -8.562  1.00 0.00 ? 36  ARG A CD   7  
ATOM 9970  N NE   . ARG A 1 36  ? 6.779   -6.304  -9.819  1.00 0.00 ? 36  ARG A NE   7  
ATOM 9971  C CZ   . ARG A 1 36  ? 7.397   -5.151  -10.052 1.00 0.00 ? 36  ARG A CZ   7  
ATOM 9972  N NH1  . ARG A 1 36  ? 7.427   -4.210  -9.119  1.00 0.00 ? 36  ARG A NH1  7  
ATOM 9973  N NH2  . ARG A 1 36  ? 7.986   -4.938  -11.222 1.00 0.00 ? 36  ARG A NH2  7  
ATOM 9974  H H    . ARG A 1 36  ? 9.561   -8.756  -6.640  1.00 0.00 ? 36  ARG A H    7  
ATOM 9975  H HA   . ARG A 1 36  ? 7.086   -8.825  -5.509  1.00 0.00 ? 36  ARG A HA   7  
ATOM 9976  H HB2  . ARG A 1 36  ? 8.006   -8.882  -8.352  1.00 0.00 ? 36  ARG A HB2  7  
ATOM 9977  H HB3  . ARG A 1 36  ? 6.291   -9.079  -8.013  1.00 0.00 ? 36  ARG A HB3  7  
ATOM 9978  H HG2  . ARG A 1 36  ? 6.695   -6.928  -6.537  1.00 0.00 ? 36  ARG A HG2  7  
ATOM 9979  H HG3  . ARG A 1 36  ? 8.038   -6.708  -7.661  1.00 0.00 ? 36  ARG A HG3  7  
ATOM 9980  H HD2  . ARG A 1 36  ? 5.343   -7.359  -8.749  1.00 0.00 ? 36  ARG A HD2  7  
ATOM 9981  H HD3  . ARG A 1 36  ? 5.651   -5.722  -8.172  1.00 0.00 ? 36  ARG A HD3  7  
ATOM 9982  H HE   . ARG A 1 36  ? 6.769   -6.985  -10.523 1.00 0.00 ? 36  ARG A HE   7  
ATOM 9983  H HH11 . ARG A 1 36  ? 6.985   -4.368  -8.236  1.00 0.00 ? 36  ARG A HH11 7  
ATOM 9984  H HH12 . ARG A 1 36  ? 7.894   -3.343  -9.297  1.00 0.00 ? 36  ARG A HH12 7  
ATOM 9985  H HH21 . ARG A 1 36  ? 7.966   -5.645  -11.928 1.00 0.00 ? 36  ARG A HH21 7  
ATOM 9986  H HH22 . ARG A 1 36  ? 8.451   -4.070  -11.397 1.00 0.00 ? 36  ARG A HH22 7  
ATOM 9987  N N    . GLU A 1 37  ? 7.721   -11.667 -7.061  1.00 0.00 ? 37  GLU A N    7  
ATOM 9988  C CA   . GLU A 1 37  ? 7.323   -13.067 -7.155  1.00 0.00 ? 37  GLU A CA   7  
ATOM 9989  C C    . GLU A 1 37  ? 7.175   -13.685 -5.768  1.00 0.00 ? 37  GLU A C    7  
ATOM 9990  O O    . GLU A 1 37  ? 6.151   -14.289 -5.452  1.00 0.00 ? 37  GLU A O    7  
ATOM 9991  C CB   . GLU A 1 37  ? 8.347   -13.858 -7.972  1.00 0.00 ? 37  GLU A CB   7  
ATOM 9992  C CG   . GLU A 1 37  ? 8.136   -13.757 -9.473  1.00 0.00 ? 37  GLU A CG   7  
ATOM 9993  C CD   . GLU A 1 37  ? 7.140   -14.776 -9.992  1.00 0.00 ? 37  GLU A CD   7  
ATOM 9994  O OE1  . GLU A 1 37  ? 6.973   -15.828 -9.339  1.00 0.00 ? 37  GLU A OE1  7  
ATOM 9995  O OE2  . GLU A 1 37  ? 6.528   -14.523 -11.050 1.00 0.00 ? 37  GLU A OE2  7  
ATOM 9996  H H    . GLU A 1 37  ? 8.513   -11.361 -7.550  1.00 0.00 ? 37  GLU A H    7  
ATOM 9997  H HA   . GLU A 1 37  ? 6.368   -13.107 -7.657  1.00 0.00 ? 37  GLU A HA   7  
ATOM 9998  H HB2  . GLU A 1 37  ? 9.335   -13.488 -7.742  1.00 0.00 ? 37  GLU A HB2  7  
ATOM 9999  H HB3  . GLU A 1 37  ? 8.287   -14.899 -7.690  1.00 0.00 ? 37  GLU A HB3  7  
ATOM 10000 H HG2  . GLU A 1 37  ? 7.771   -12.769 -9.708  1.00 0.00 ? 37  GLU A HG2  7  
ATOM 10001 H HG3  . GLU A 1 37  ? 9.083   -13.917 -9.968  1.00 0.00 ? 37  GLU A HG3  7  
ATOM 10002 N N    . ALA A 1 38  ? 8.207   -13.530 -4.944  1.00 0.00 ? 38  ALA A N    7  
ATOM 10003 C CA   . ALA A 1 38  ? 8.192   -14.071 -3.591  1.00 0.00 ? 38  ALA A CA   7  
ATOM 10004 C C    . ALA A 1 38  ? 6.904   -13.700 -2.865  1.00 0.00 ? 38  ALA A C    7  
ATOM 10005 O O    . ALA A 1 38  ? 6.514   -14.354 -1.897  1.00 0.00 ? 38  ALA A O    7  
ATOM 10006 C CB   . ALA A 1 38  ? 9.401   -13.576 -2.812  1.00 0.00 ? 38  ALA A CB   7  
ATOM 10007 H H    . ALA A 1 38  ? 8.996   -13.039 -5.254  1.00 0.00 ? 38  ALA A H    7  
ATOM 10008 H HA   . ALA A 1 38  ? 8.256   -15.148 -3.662  1.00 0.00 ? 38  ALA A HA   7  
ATOM 10009 H HB1  . ALA A 1 38  ? 10.263  -14.176 -3.066  1.00 0.00 ? 38  ALA A HB1  7  
ATOM 10010 H HB2  . ALA A 1 38  ? 9.594   -12.544 -3.064  1.00 0.00 ? 38  ALA A HB2  7  
ATOM 10011 H HB3  . ALA A 1 38  ? 9.205   -13.658 -1.753  1.00 0.00 ? 38  ALA A HB3  7  
ATOM 10012 N N    . LEU A 1 39  ? 6.247   -12.646 -3.337  1.00 0.00 ? 39  LEU A N    7  
ATOM 10013 C CA   . LEU A 1 39  ? 5.001   -12.187 -2.732  1.00 0.00 ? 39  LEU A CA   7  
ATOM 10014 C C    . LEU A 1 39  ? 3.795   -12.786 -3.448  1.00 0.00 ? 39  LEU A C    7  
ATOM 10015 O O    . LEU A 1 39  ? 2.733   -12.968 -2.851  1.00 0.00 ? 39  LEU A O    7  
ATOM 10016 C CB   . LEU A 1 39  ? 4.925   -10.660 -2.772  1.00 0.00 ? 39  LEU A CB   7  
ATOM 10017 C CG   . LEU A 1 39  ? 6.222   -9.914  -2.456  1.00 0.00 ? 39  LEU A CG   7  
ATOM 10018 C CD1  . LEU A 1 39  ? 5.984   -8.413  -2.435  1.00 0.00 ? 39  LEU A CD1  7  
ATOM 10019 C CD2  . LEU A 1 39  ? 6.797   -10.384 -1.127  1.00 0.00 ? 39  LEU A CD2  7  
ATOM 10020 H H    . LEU A 1 39  ? 6.607   -12.165 -4.111  1.00 0.00 ? 39  LEU A H    7  
ATOM 10021 H HA   . LEU A 1 39  ? 4.993   -12.513 -1.703  1.00 0.00 ? 39  LEU A HA   7  
ATOM 10022 H HB2  . LEU A 1 39  ? 4.611   -10.370 -3.763  1.00 0.00 ? 39  LEU A HB2  7  
ATOM 10023 H HB3  . LEU A 1 39  ? 4.180   -10.348 -2.054  1.00 0.00 ? 39  LEU A HB3  7  
ATOM 10024 H HG   . LEU A 1 39  ? 6.949   -10.126 -3.229  1.00 0.00 ? 39  LEU A HG   7  
ATOM 10025 H HD11 . LEU A 1 39  ? 6.217   -7.998  -3.403  1.00 0.00 ? 39  LEU A HD11 7  
ATOM 10026 H HD12 . LEU A 1 39  ? 6.616   -7.958  -1.687  1.00 0.00 ? 39  LEU A HD12 7  
ATOM 10027 H HD13 . LEU A 1 39  ? 4.948   -8.216  -2.198  1.00 0.00 ? 39  LEU A HD13 7  
ATOM 10028 H HD21 . LEU A 1 39  ? 7.874   -10.304 -1.153  1.00 0.00 ? 39  LEU A HD21 7  
ATOM 10029 H HD22 . LEU A 1 39  ? 6.516   -11.413 -0.957  1.00 0.00 ? 39  LEU A HD22 7  
ATOM 10030 H HD23 . LEU A 1 39  ? 6.409   -9.768  -0.330  1.00 0.00 ? 39  LEU A HD23 7  
ATOM 10031 N N    . VAL A 1 40  ? 3.966   -13.094 -4.729  1.00 0.00 ? 40  VAL A N    7  
ATOM 10032 C CA   . VAL A 1 40  ? 2.893   -13.677 -5.526  1.00 0.00 ? 40  VAL A CA   7  
ATOM 10033 C C    . VAL A 1 40  ? 2.554   -15.084 -5.046  1.00 0.00 ? 40  VAL A C    7  
ATOM 10034 O O    . VAL A 1 40  ? 1.389   -15.479 -5.027  1.00 0.00 ? 40  VAL A O    7  
ATOM 10035 C CB   . VAL A 1 40  ? 3.268   -13.732 -7.019  1.00 0.00 ? 40  VAL A CB   7  
ATOM 10036 C CG1  . VAL A 1 40  ? 2.245   -14.546 -7.797  1.00 0.00 ? 40  VAL A CG1  7  
ATOM 10037 C CG2  . VAL A 1 40  ? 3.389   -12.327 -7.589  1.00 0.00 ? 40  VAL A CG2  7  
ATOM 10038 H H    . VAL A 1 40  ? 4.836   -12.926 -5.149  1.00 0.00 ? 40  VAL A H    7  
ATOM 10039 H HA   . VAL A 1 40  ? 2.019   -13.050 -5.418  1.00 0.00 ? 40  VAL A HA   7  
ATOM 10040 H HB   . VAL A 1 40  ? 4.228   -14.219 -7.110  1.00 0.00 ? 40  VAL A HB   7  
ATOM 10041 H HG11 . VAL A 1 40  ? 2.405   -15.598 -7.609  1.00 0.00 ? 40  VAL A HG11 7  
ATOM 10042 H HG12 . VAL A 1 40  ? 1.250   -14.270 -7.481  1.00 0.00 ? 40  VAL A HG12 7  
ATOM 10043 H HG13 . VAL A 1 40  ? 2.356   -14.348 -8.853  1.00 0.00 ? 40  VAL A HG13 7  
ATOM 10044 H HG21 . VAL A 1 40  ? 3.393   -11.610 -6.781  1.00 0.00 ? 40  VAL A HG21 7  
ATOM 10045 H HG22 . VAL A 1 40  ? 4.309   -12.243 -8.149  1.00 0.00 ? 40  VAL A HG22 7  
ATOM 10046 H HG23 . VAL A 1 40  ? 2.552   -12.130 -8.242  1.00 0.00 ? 40  VAL A HG23 7  
ATOM 10047 N N    . GLU A 1 41  ? 3.580   -15.834 -4.658  1.00 0.00 ? 41  GLU A N    7  
ATOM 10048 C CA   . GLU A 1 41  ? 3.391   -17.198 -4.179  1.00 0.00 ? 41  GLU A CA   7  
ATOM 10049 C C    . GLU A 1 41  ? 3.080   -17.211 -2.684  1.00 0.00 ? 41  GLU A C    7  
ATOM 10050 O O    . GLU A 1 41  ? 2.207   -17.948 -2.228  1.00 0.00 ? 41  GLU A O    7  
ATOM 10051 C CB   . GLU A 1 41  ? 4.638   -18.039 -4.459  1.00 0.00 ? 41  GLU A CB   7  
ATOM 10052 C CG   . GLU A 1 41  ? 5.906   -17.469 -3.848  1.00 0.00 ? 41  GLU A CG   7  
ATOM 10053 C CD   . GLU A 1 41  ? 7.133   -18.303 -4.165  1.00 0.00 ? 41  GLU A CD   7  
ATOM 10054 O OE1  . GLU A 1 41  ? 7.091   -19.529 -3.933  1.00 0.00 ? 41  GLU A OE1  7  
ATOM 10055 O OE2  . GLU A 1 41  ? 8.133   -17.730 -4.644  1.00 0.00 ? 41  GLU A OE2  7  
ATOM 10056 H H    . GLU A 1 41  ? 4.486   -15.462 -4.697  1.00 0.00 ? 41  GLU A H    7  
ATOM 10057 H HA   . GLU A 1 41  ? 2.554   -17.624 -4.711  1.00 0.00 ? 41  GLU A HA   7  
ATOM 10058 H HB2  . GLU A 1 41  ? 4.485   -19.032 -4.061  1.00 0.00 ? 41  GLU A HB2  7  
ATOM 10059 H HB3  . GLU A 1 41  ? 4.777   -18.108 -5.528  1.00 0.00 ? 41  GLU A HB3  7  
ATOM 10060 H HG2  . GLU A 1 41  ? 6.059   -16.472 -4.232  1.00 0.00 ? 41  GLU A HG2  7  
ATOM 10061 H HG3  . GLU A 1 41  ? 5.786   -17.425 -2.775  1.00 0.00 ? 41  GLU A HG3  7  
ATOM 10062 N N    . GLU A 1 42  ? 3.803   -16.390 -1.929  1.00 0.00 ? 42  GLU A N    7  
ATOM 10063 C CA   . GLU A 1 42  ? 3.605   -16.308 -0.486  1.00 0.00 ? 42  GLU A CA   7  
ATOM 10064 C C    . GLU A 1 42  ? 2.171   -15.904 -0.155  1.00 0.00 ? 42  GLU A C    7  
ATOM 10065 O O    . GLU A 1 42  ? 1.537   -16.491 0.722   1.00 0.00 ? 42  GLU A O    7  
ATOM 10066 C CB   . GLU A 1 42  ? 4.584   -15.305 0.129   1.00 0.00 ? 42  GLU A CB   7  
ATOM 10067 C CG   . GLU A 1 42  ? 4.555   -15.280 1.648   1.00 0.00 ? 42  GLU A CG   7  
ATOM 10068 C CD   . GLU A 1 42  ? 5.015   -16.588 2.262   1.00 0.00 ? 42  GLU A CD   7  
ATOM 10069 O OE1  . GLU A 1 42  ? 6.110   -17.063 1.894   1.00 0.00 ? 42  GLU A OE1  7  
ATOM 10070 O OE2  . GLU A 1 42  ? 4.280   -17.137 3.109   1.00 0.00 ? 42  GLU A OE2  7  
ATOM 10071 H H    . GLU A 1 42  ? 4.484   -15.826 -2.351  1.00 0.00 ? 42  GLU A H    7  
ATOM 10072 H HA   . GLU A 1 42  ? 3.796   -17.285 -0.070  1.00 0.00 ? 42  GLU A HA   7  
ATOM 10073 H HB2  . GLU A 1 42  ? 5.585   -15.557 -0.188  1.00 0.00 ? 42  GLU A HB2  7  
ATOM 10074 H HB3  . GLU A 1 42  ? 4.341   -14.316 -0.232  1.00 0.00 ? 42  GLU A HB3  7  
ATOM 10075 H HG2  . GLU A 1 42  ? 5.205   -14.490 1.994   1.00 0.00 ? 42  GLU A HG2  7  
ATOM 10076 H HG3  . GLU A 1 42  ? 3.544   -15.082 1.972   1.00 0.00 ? 42  GLU A HG3  7  
ATOM 10077 N N    . CYS A 1 43  ? 1.668   -14.898 -0.863  1.00 0.00 ? 43  CYS A N    7  
ATOM 10078 C CA   . CYS A 1 43  ? 0.310   -14.414 -0.644  1.00 0.00 ? 43  CYS A CA   7  
ATOM 10079 C C    . CYS A 1 43  ? -0.712  -15.502 -0.956  1.00 0.00 ? 43  CYS A C    7  
ATOM 10080 O O    . CYS A 1 43  ? -1.376  -16.019 -0.059  1.00 0.00 ? 43  CYS A O    7  
ATOM 10081 C CB   . CYS A 1 43  ? 0.041   -13.181 -1.508  1.00 0.00 ? 43  CYS A CB   7  
ATOM 10082 S SG   . CYS A 1 43  ? 0.972   -11.713 -1.010  1.00 0.00 ? 43  CYS A SG   7  
ATOM 10083 H H    . CYS A 1 43  ? 2.223   -14.470 -1.548  1.00 0.00 ? 43  CYS A H    7  
ATOM 10084 H HA   . CYS A 1 43  ? 0.220   -14.141 0.397   1.00 0.00 ? 43  CYS A HA   7  
ATOM 10085 H HB2  . CYS A 1 43  ? 0.302   -13.404 -2.532  1.00 0.00 ? 43  CYS A HB2  7  
ATOM 10086 H HB3  . CYS A 1 43  ? -1.010  -12.938 -1.457  1.00 0.00 ? 43  CYS A HB3  7  
ATOM 10087 H HG   . CYS A 1 43  ? 2.146   -11.748 -1.621  1.00 0.00 ? 43  CYS A HG   7  
ATOM 10088 N N    . ASN A 1 44  ? -0.833  -15.843 -2.235  1.00 0.00 ? 44  ASN A N    7  
ATOM 10089 C CA   . ASN A 1 44  ? -1.777  -16.869 -2.666  1.00 0.00 ? 44  ASN A CA   7  
ATOM 10090 C C    . ASN A 1 44  ? -1.729  -18.077 -1.736  1.00 0.00 ? 44  ASN A C    7  
ATOM 10091 O O    . ASN A 1 44  ? -2.748  -18.723 -1.489  1.00 0.00 ? 44  ASN A O    7  
ATOM 10092 C CB   . ASN A 1 44  ? -1.470  -17.302 -4.101  1.00 0.00 ? 44  ASN A CB   7  
ATOM 10093 C CG   . ASN A 1 44  ? -2.052  -16.352 -5.129  1.00 0.00 ? 44  ASN A CG   7  
ATOM 10094 O OD1  . ASN A 1 44  ? -3.124  -15.781 -4.927  1.00 0.00 ? 44  ASN A OD1  7  
ATOM 10095 N ND2  . ASN A 1 44  ? -1.345  -16.177 -6.240  1.00 0.00 ? 44  ASN A ND2  7  
ATOM 10096 H H    . ASN A 1 44  ? -0.276  -15.395 -2.905  1.00 0.00 ? 44  ASN A H    7  
ATOM 10097 H HA   . ASN A 1 44  ? -2.768  -16.442 -2.633  1.00 0.00 ? 44  ASN A HA   7  
ATOM 10098 H HB2  . ASN A 1 44  ? -0.399  -17.338 -4.238  1.00 0.00 ? 44  ASN A HB2  7  
ATOM 10099 H HB3  . ASN A 1 44  ? -1.884  -18.285 -4.270  1.00 0.00 ? 44  ASN A HB3  7  
ATOM 10100 H HD21 . ASN A 1 44  ? -0.500  -16.665 -6.333  1.00 0.00 ? 44  ASN A HD21 7  
ATOM 10101 H HD22 . ASN A 1 44  ? -1.697  -15.567 -6.921  1.00 0.00 ? 44  ASN A HD22 7  
ATOM 10102 N N    . ARG A 1 45  ? -0.540  -18.377 -1.225  1.00 0.00 ? 45  ARG A N    7  
ATOM 10103 C CA   . ARG A 1 45  ? -0.359  -19.508 -0.323  1.00 0.00 ? 45  ARG A CA   7  
ATOM 10104 C C    . ARG A 1 45  ? -1.082  -19.270 1.000   1.00 0.00 ? 45  ARG A C    7  
ATOM 10105 O O    . ARG A 1 45  ? -1.974  -20.029 1.376   1.00 0.00 ? 45  ARG A O    7  
ATOM 10106 C CB   . ARG A 1 45  ? 1.130   -19.750 -0.066  1.00 0.00 ? 45  ARG A CB   7  
ATOM 10107 C CG   . ARG A 1 45  ? 1.401   -20.757 1.039   1.00 0.00 ? 45  ARG A CG   7  
ATOM 10108 C CD   . ARG A 1 45  ? 2.789   -20.573 1.633   1.00 0.00 ? 45  ARG A CD   7  
ATOM 10109 N NE   . ARG A 1 45  ? 2.883   -21.118 2.984   1.00 0.00 ? 45  ARG A NE   7  
ATOM 10110 C CZ   . ARG A 1 45  ? 2.905   -22.418 3.253   1.00 0.00 ? 45  ARG A CZ   7  
ATOM 10111 N NH1  . ARG A 1 45  ? 2.841   -23.303 2.267   1.00 0.00 ? 45  ARG A NH1  7  
ATOM 10112 N NH2  . ARG A 1 45  ? 2.992   -22.837 4.509   1.00 0.00 ? 45  ARG A NH2  7  
ATOM 10113 H H    . ARG A 1 45  ? 0.235   -17.824 -1.460  1.00 0.00 ? 45  ARG A H    7  
ATOM 10114 H HA   . ARG A 1 45  ? -0.780  -20.381 -0.797  1.00 0.00 ? 45  ARG A HA   7  
ATOM 10115 H HB2  . ARG A 1 45  ? 1.586   -20.114 -0.975  1.00 0.00 ? 45  ARG A HB2  7  
ATOM 10116 H HB3  . ARG A 1 45  ? 1.592   -18.814 0.209   1.00 0.00 ? 45  ARG A HB3  7  
ATOM 10117 H HG2  . ARG A 1 45  ? 0.667   -20.627 1.821   1.00 0.00 ? 45  ARG A HG2  7  
ATOM 10118 H HG3  . ARG A 1 45  ? 1.323   -21.754 0.631   1.00 0.00 ? 45  ARG A HG3  7  
ATOM 10119 H HD2  . ARG A 1 45  ? 3.506   -21.076 1.001   1.00 0.00 ? 45  ARG A HD2  7  
ATOM 10120 H HD3  . ARG A 1 45  ? 3.015   -19.517 1.663   1.00 0.00 ? 45  ARG A HD3  7  
ATOM 10121 H HE   . ARG A 1 45  ? 2.932   -20.482 3.728   1.00 0.00 ? 45  ARG A HE   7  
ATOM 10122 H HH11 . ARG A 1 45  ? 2.776   -22.991 1.320   1.00 0.00 ? 45  ARG A HH11 7  
ATOM 10123 H HH12 . ARG A 1 45  ? 2.858   -24.282 2.472   1.00 0.00 ? 45  ARG A HH12 7  
ATOM 10124 H HH21 . ARG A 1 45  ? 3.041   -22.173 5.254   1.00 0.00 ? 45  ARG A HH21 7  
ATOM 10125 H HH22 . ARG A 1 45  ? 3.008   -23.816 4.710   1.00 0.00 ? 45  ARG A HH22 7  
ATOM 10126 N N    . ALA A 1 46  ? -0.690  -18.211 1.700   1.00 0.00 ? 46  ALA A N    7  
ATOM 10127 C CA   . ALA A 1 46  ? -1.301  -17.872 2.979   1.00 0.00 ? 46  ALA A CA   7  
ATOM 10128 C C    . ALA A 1 46  ? -2.815  -17.750 2.849   1.00 0.00 ? 46  ALA A C    7  
ATOM 10129 O O    . ALA A 1 46  ? -3.559  -18.166 3.737   1.00 0.00 ? 46  ALA A O    7  
ATOM 10130 C CB   . ALA A 1 46  ? -0.710  -16.578 3.520   1.00 0.00 ? 46  ALA A CB   7  
ATOM 10131 H H    . ALA A 1 46  ? 0.027   -17.643 1.348   1.00 0.00 ? 46  ALA A H    7  
ATOM 10132 H HA   . ALA A 1 46  ? -1.072  -18.663 3.679   1.00 0.00 ? 46  ALA A HA   7  
ATOM 10133 H HB1  . ALA A 1 46  ? -0.107  -16.111 2.755   1.00 0.00 ? 46  ALA A HB1  7  
ATOM 10134 H HB2  . ALA A 1 46  ? -1.509  -15.910 3.807   1.00 0.00 ? 46  ALA A HB2  7  
ATOM 10135 H HB3  . ALA A 1 46  ? -0.095  -16.796 4.381   1.00 0.00 ? 46  ALA A HB3  7  
ATOM 10136 N N    . GLU A 1 47  ? -3.265  -17.177 1.737   1.00 0.00 ? 47  GLU A N    7  
ATOM 10137 C CA   . GLU A 1 47  ? -4.692  -17.000 1.493   1.00 0.00 ? 47  GLU A CA   7  
ATOM 10138 C C    . GLU A 1 47  ? -5.430  -18.332 1.590   1.00 0.00 ? 47  GLU A C    7  
ATOM 10139 O O    . GLU A 1 47  ? -6.507  -18.414 2.181   1.00 0.00 ? 47  GLU A O    7  
ATOM 10140 C CB   . GLU A 1 47  ? -4.922  -16.376 0.114   1.00 0.00 ? 47  GLU A CB   7  
ATOM 10141 C CG   . GLU A 1 47  ? -4.402  -14.953 -0.004  1.00 0.00 ? 47  GLU A CG   7  
ATOM 10142 C CD   . GLU A 1 47  ? -5.202  -14.120 -0.987  1.00 0.00 ? 47  GLU A CD   7  
ATOM 10143 O OE1  . GLU A 1 47  ? -5.003  -14.289 -2.208  1.00 0.00 ? 47  GLU A OE1  7  
ATOM 10144 O OE2  . GLU A 1 47  ? -6.027  -13.299 -0.535  1.00 0.00 ? 47  GLU A OE2  7  
ATOM 10145 H H    . GLU A 1 47  ? -2.622  -16.865 1.066   1.00 0.00 ? 47  GLU A H    7  
ATOM 10146 H HA   . GLU A 1 47  ? -5.077  -16.332 2.248   1.00 0.00 ? 47  GLU A HA   7  
ATOM 10147 H HB2  . GLU A 1 47  ? -4.426  -16.982 -0.629  1.00 0.00 ? 47  GLU A HB2  7  
ATOM 10148 H HB3  . GLU A 1 47  ? -5.982  -16.368 -0.090  1.00 0.00 ? 47  GLU A HB3  7  
ATOM 10149 H HG2  . GLU A 1 47  ? -4.453  -14.483 0.966   1.00 0.00 ? 47  GLU A HG2  7  
ATOM 10150 H HG3  . GLU A 1 47  ? -3.374  -14.985 -0.335  1.00 0.00 ? 47  GLU A HG3  7  
ATOM 10151 N N    . CYS A 1 48  ? -4.843  -19.370 1.007   1.00 0.00 ? 48  CYS A N    7  
ATOM 10152 C CA   . CYS A 1 48  ? -5.444  -20.699 1.026   1.00 0.00 ? 48  CYS A CA   7  
ATOM 10153 C C    . CYS A 1 48  ? -5.479  -21.260 2.444   1.00 0.00 ? 48  CYS A C    7  
ATOM 10154 O O    . CYS A 1 48  ? -6.466  -21.868 2.859   1.00 0.00 ? 48  CYS A O    7  
ATOM 10155 C CB   . CYS A 1 48  ? -4.670  -21.646 0.108   1.00 0.00 ? 48  CYS A CB   7  
ATOM 10156 S SG   . CYS A 1 48  ? -5.050  -21.447 -1.648  1.00 0.00 ? 48  CYS A SG   7  
ATOM 10157 H H    . CYS A 1 48  ? -3.984  -19.242 0.551   1.00 0.00 ? 48  CYS A H    7  
ATOM 10158 H HA   . CYS A 1 48  ? -6.457  -20.609 0.663   1.00 0.00 ? 48  CYS A HA   7  
ATOM 10159 H HB2  . CYS A 1 48  ? -3.611  -21.473 0.236   1.00 0.00 ? 48  CYS A HB2  7  
ATOM 10160 H HB3  . CYS A 1 48  ? -4.896  -22.666 0.382   1.00 0.00 ? 48  CYS A HB3  7  
ATOM 10161 H HG   . CYS A 1 48  ? -3.908  -21.271 -2.296  1.00 0.00 ? 48  CYS A HG   7  
ATOM 10162 N N    . LEU A 1 49  ? -4.394  -21.053 3.182   1.00 0.00 ? 49  LEU A N    7  
ATOM 10163 C CA   . LEU A 1 49  ? -4.298  -21.540 4.554   1.00 0.00 ? 49  LEU A CA   7  
ATOM 10164 C C    . LEU A 1 49  ? -5.384  -20.920 5.429   1.00 0.00 ? 49  LEU A C    7  
ATOM 10165 O O    . LEU A 1 49  ? -6.212  -21.628 6.001   1.00 0.00 ? 49  LEU A O    7  
ATOM 10166 C CB   . LEU A 1 49  ? -2.919  -21.223 5.134   1.00 0.00 ? 49  LEU A CB   7  
ATOM 10167 C CG   . LEU A 1 49  ? -1.727  -21.491 4.214   1.00 0.00 ? 49  LEU A CG   7  
ATOM 10168 C CD1  . LEU A 1 49  ? -0.436  -21.548 5.015   1.00 0.00 ? 49  LEU A CD1  7  
ATOM 10169 C CD2  . LEU A 1 49  ? -1.933  -22.783 3.436   1.00 0.00 ? 49  LEU A CD2  7  
ATOM 10170 H H    . LEU A 1 49  ? -3.639  -20.562 2.797   1.00 0.00 ? 49  LEU A H    7  
ATOM 10171 H HA   . LEU A 1 49  ? -4.435  -22.610 4.536   1.00 0.00 ? 49  LEU A HA   7  
ATOM 10172 H HB2  . LEU A 1 49  ? -2.903  -20.177 5.398   1.00 0.00 ? 49  LEU A HB2  7  
ATOM 10173 H HB3  . LEU A 1 49  ? -2.790  -21.820 6.025   1.00 0.00 ? 49  LEU A HB3  7  
ATOM 10174 H HG   . LEU A 1 49  ? -1.641  -20.681 3.502   1.00 0.00 ? 49  LEU A HG   7  
ATOM 10175 H HD11 . LEU A 1 49  ? 0.033   -22.510 4.874   1.00 0.00 ? 49  LEU A HD11 7  
ATOM 10176 H HD12 . LEU A 1 49  ? -0.656  -21.406 6.063   1.00 0.00 ? 49  LEU A HD12 7  
ATOM 10177 H HD13 . LEU A 1 49  ? 0.232   -20.769 4.679   1.00 0.00 ? 49  LEU A HD13 7  
ATOM 10178 H HD21 . LEU A 1 49  ? -1.846  -23.624 4.109   1.00 0.00 ? 49  LEU A HD21 7  
ATOM 10179 H HD22 . LEU A 1 49  ? -1.182  -22.861 2.663   1.00 0.00 ? 49  LEU A HD22 7  
ATOM 10180 H HD23 . LEU A 1 49  ? -2.914  -22.780 2.987   1.00 0.00 ? 49  LEU A HD23 7  
ATOM 10181 N N    . GLN A 1 50  ? -5.374  -19.594 5.525   1.00 0.00 ? 50  GLN A N    7  
ATOM 10182 C CA   . GLN A 1 50  ? -6.359  -18.880 6.328   1.00 0.00 ? 50  GLN A CA   7  
ATOM 10183 C C    . GLN A 1 50  ? -7.777  -19.254 5.910   1.00 0.00 ? 50  GLN A C    7  
ATOM 10184 O O    . GLN A 1 50  ? -8.640  -19.497 6.755   1.00 0.00 ? 50  GLN A O    7  
ATOM 10185 C CB   . GLN A 1 50  ? -6.158  -17.369 6.195   1.00 0.00 ? 50  GLN A CB   7  
ATOM 10186 C CG   . GLN A 1 50  ? -6.385  -16.847 4.786   1.00 0.00 ? 50  GLN A CG   7  
ATOM 10187 C CD   . GLN A 1 50  ? -6.196  -15.346 4.682   1.00 0.00 ? 50  GLN A CD   7  
ATOM 10188 O OE1  . GLN A 1 50  ? -7.145  -14.577 4.843   1.00 0.00 ? 50  GLN A OE1  7  
ATOM 10189 N NE2  . GLN A 1 50  ? -4.968  -14.921 4.411   1.00 0.00 ? 50  GLN A NE2  7  
ATOM 10190 H H    . GLN A 1 50  ? -4.689  -19.085 5.045   1.00 0.00 ? 50  GLN A H    7  
ATOM 10191 H HA   . GLN A 1 50  ? -6.214  -19.163 7.359   1.00 0.00 ? 50  GLN A HA   7  
ATOM 10192 H HB2  . GLN A 1 50  ? -6.846  -16.866 6.858   1.00 0.00 ? 50  GLN A HB2  7  
ATOM 10193 H HB3  . GLN A 1 50  ? -5.147  -17.126 6.487   1.00 0.00 ? 50  GLN A HB3  7  
ATOM 10194 H HG2  . GLN A 1 50  ? -5.684  -17.329 4.120   1.00 0.00 ? 50  GLN A HG2  7  
ATOM 10195 H HG3  . GLN A 1 50  ? -7.393  -17.091 4.484   1.00 0.00 ? 50  GLN A HG3  7  
ATOM 10196 H HE21 . GLN A 1 50  ? -4.262  -15.591 4.294   1.00 0.00 ? 50  GLN A HE21 7  
ATOM 10197 H HE22 . GLN A 1 50  ? -4.818  -13.956 4.337   1.00 0.00 ? 50  GLN A HE22 7  
ATOM 10198 N N    . ARG A 1 51  ? -8.011  -19.299 4.603   1.00 0.00 ? 51  ARG A N    7  
ATOM 10199 C CA   . ARG A 1 51  ? -9.326  -19.643 4.074   1.00 0.00 ? 51  ARG A CA   7  
ATOM 10200 C C    . ARG A 1 51  ? -9.572  -21.146 4.163   1.00 0.00 ? 51  ARG A C    7  
ATOM 10201 O O    . ARG A 1 51  ? -10.601 -21.645 3.709   1.00 0.00 ? 51  ARG A O    7  
ATOM 10202 C CB   . ARG A 1 51  ? -9.451  -19.180 2.621   1.00 0.00 ? 51  ARG A CB   7  
ATOM 10203 C CG   . ARG A 1 51  ? -9.765  -17.699 2.479   1.00 0.00 ? 51  ARG A CG   7  
ATOM 10204 C CD   . ARG A 1 51  ? -9.662  -17.245 1.031   1.00 0.00 ? 51  ARG A CD   7  
ATOM 10205 N NE   . ARG A 1 51  ? -10.256 -15.926 0.828   1.00 0.00 ? 51  ARG A NE   7  
ATOM 10206 C CZ   . ARG A 1 51  ? -10.527 -15.419 -0.369  1.00 0.00 ? 51  ARG A CZ   7  
ATOM 10207 N NH1  . ARG A 1 51  ? -10.258 -16.116 -1.465  1.00 0.00 ? 51  ARG A NH1  7  
ATOM 10208 N NH2  . ARG A 1 51  ? -11.067 -14.212 -0.473  1.00 0.00 ? 51  ARG A NH2  7  
ATOM 10209 H H    . ARG A 1 51  ? -7.283  -19.096 3.979   1.00 0.00 ? 51  ARG A H    7  
ATOM 10210 H HA   . ARG A 1 51  ? -10.067 -19.133 4.670   1.00 0.00 ? 51  ARG A HA   7  
ATOM 10211 H HB2  . ARG A 1 51  ? -8.520  -19.379 2.110   1.00 0.00 ? 51  ARG A HB2  7  
ATOM 10212 H HB3  . ARG A 1 51  ? -10.241 -19.741 2.144   1.00 0.00 ? 51  ARG A HB3  7  
ATOM 10213 H HG2  . ARG A 1 51  ? -10.770 -17.518 2.830   1.00 0.00 ? 51  ARG A HG2  7  
ATOM 10214 H HG3  . ARG A 1 51  ? -9.065  -17.134 3.075   1.00 0.00 ? 51  ARG A HG3  7  
ATOM 10215 H HD2  . ARG A 1 51  ? -8.619  -17.206 0.753   1.00 0.00 ? 51  ARG A HD2  7  
ATOM 10216 H HD3  . ARG A 1 51  ? -10.174 -17.961 0.406   1.00 0.00 ? 51  ARG A HD3  7  
ATOM 10217 H HE   . ARG A 1 51  ? -10.462 -15.394 1.624   1.00 0.00 ? 51  ARG A HE   7  
ATOM 10218 H HH11 . ARG A 1 51  ? -9.852  -17.026 -1.390  1.00 0.00 ? 51  ARG A HH11 7  
ATOM 10219 H HH12 . ARG A 1 51  ? -10.464 -15.732 -2.365  1.00 0.00 ? 51  ARG A HH12 7  
ATOM 10220 H HH21 . ARG A 1 51  ? -11.271 -13.683 0.351   1.00 0.00 ? 51  ARG A HH21 7  
ATOM 10221 H HH22 . ARG A 1 51  ? -11.270 -13.831 -1.374  1.00 0.00 ? 51  ARG A HH22 7  
ATOM 10222 N N    . GLY A 1 52  ? -8.618  -21.863 4.750   1.00 0.00 ? 52  GLY A N    7  
ATOM 10223 C CA   . GLY A 1 52  ? -8.750  -23.302 4.887   1.00 0.00 ? 52  GLY A CA   7  
ATOM 10224 C C    . GLY A 1 52  ? -8.294  -24.046 3.647   1.00 0.00 ? 52  GLY A C    7  
ATOM 10225 O O    . GLY A 1 52  ? -7.890  -25.207 3.725   1.00 0.00 ? 52  GLY A O    7  
ATOM 10226 H H    . GLY A 1 52  ? -7.819  -21.411 5.093   1.00 0.00 ? 52  GLY A H    7  
ATOM 10227 H HA2  . GLY A 1 52  ? -8.157  -23.628 5.728   1.00 0.00 ? 52  GLY A HA2  7  
ATOM 10228 H HA3  . GLY A 1 52  ? -9.786  -23.541 5.075   1.00 0.00 ? 52  GLY A HA3  7  
ATOM 10229 N N    . VAL A 1 53  ? -8.359  -23.378 2.500   1.00 0.00 ? 53  VAL A N    7  
ATOM 10230 C CA   . VAL A 1 53  ? -7.951  -23.984 1.238   1.00 0.00 ? 53  VAL A CA   7  
ATOM 10231 C C    . VAL A 1 53  ? -6.494  -24.431 1.290   1.00 0.00 ? 53  VAL A C    7  
ATOM 10232 O O    . VAL A 1 53  ? -5.788  -24.169 2.263   1.00 0.00 ? 53  VAL A O    7  
ATOM 10233 C CB   . VAL A 1 53  ? -8.136  -23.008 0.061   1.00 0.00 ? 53  VAL A CB   7  
ATOM 10234 C CG1  . VAL A 1 53  ? -8.238  -23.769 -1.252  1.00 0.00 ? 53  VAL A CG1  7  
ATOM 10235 C CG2  . VAL A 1 53  ? -9.364  -22.138 0.279   1.00 0.00 ? 53  VAL A CG2  7  
ATOM 10236 H H    . VAL A 1 53  ? -8.690  -22.456 2.502   1.00 0.00 ? 53  VAL A H    7  
ATOM 10237 H HA   . VAL A 1 53  ? -8.576  -24.848 1.064   1.00 0.00 ? 53  VAL A HA   7  
ATOM 10238 H HB   . VAL A 1 53  ? -7.269  -22.366 0.013   1.00 0.00 ? 53  VAL A HB   7  
ATOM 10239 H HG11 . VAL A 1 53  ? -7.254  -23.868 -1.688  1.00 0.00 ? 53  VAL A HG11 7  
ATOM 10240 H HG12 . VAL A 1 53  ? -8.652  -24.749 -1.070  1.00 0.00 ? 53  VAL A HG12 7  
ATOM 10241 H HG13 . VAL A 1 53  ? -8.878  -23.227 -1.932  1.00 0.00 ? 53  VAL A HG13 7  
ATOM 10242 H HG21 . VAL A 1 53  ? -10.091 -22.682 0.863   1.00 0.00 ? 53  VAL A HG21 7  
ATOM 10243 H HG22 . VAL A 1 53  ? -9.079  -21.239 0.807   1.00 0.00 ? 53  VAL A HG22 7  
ATOM 10244 H HG23 . VAL A 1 53  ? -9.792  -21.873 -0.676  1.00 0.00 ? 53  VAL A HG23 7  
ATOM 10245 N N    . SER A 1 54  ? -6.051  -25.107 0.235   1.00 0.00 ? 54  SER A N    7  
ATOM 10246 C CA   . SER A 1 54  ? -4.678  -25.594 0.161   1.00 0.00 ? 54  SER A CA   7  
ATOM 10247 C C    . SER A 1 54  ? -3.814  -24.658 -0.679  1.00 0.00 ? 54  SER A C    7  
ATOM 10248 O O    . SER A 1 54  ? -4.244  -24.125 -1.702  1.00 0.00 ? 54  SER A O    7  
ATOM 10249 C CB   . SER A 1 54  ? -4.646  -27.004 -0.432  1.00 0.00 ? 54  SER A CB   7  
ATOM 10250 O OG   . SER A 1 54  ? -3.554  -27.748 0.080   1.00 0.00 ? 54  SER A OG   7  
ATOM 10251 H H    . SER A 1 54  ? -6.662  -25.285 -0.510  1.00 0.00 ? 54  SER A H    7  
ATOM 10252 H HA   . SER A 1 54  ? -4.283  -25.626 1.165   1.00 0.00 ? 54  SER A HA   7  
ATOM 10253 H HB2  . SER A 1 54  ? -5.563  -27.517 -0.184  1.00 0.00 ? 54  SER A HB2  7  
ATOM 10254 H HB3  . SER A 1 54  ? -4.550  -26.938 -1.506  1.00 0.00 ? 54  SER A HB3  7  
ATOM 10255 H HG   . SER A 1 54  ? -3.164  -28.271 -0.625  1.00 0.00 ? 54  SER A HG   7  
ATOM 10256 N N    . PRO A 1 55  ? -2.565  -24.452 -0.236  1.00 0.00 ? 55  PRO A N    7  
ATOM 10257 C CA   . PRO A 1 55  ? -1.613  -23.580 -0.931  1.00 0.00 ? 55  PRO A CA   7  
ATOM 10258 C C    . PRO A 1 55  ? -1.150  -24.169 -2.259  1.00 0.00 ? 55  PRO A C    7  
ATOM 10259 O O    . PRO A 1 55  ? -0.376  -23.549 -2.988  1.00 0.00 ? 55  PRO A O    7  
ATOM 10260 C CB   . PRO A 1 55  ? -0.441  -23.483 0.049   1.00 0.00 ? 55  PRO A CB   7  
ATOM 10261 C CG   . PRO A 1 55  ? -0.522  -24.729 0.861   1.00 0.00 ? 55  PRO A CG   7  
ATOM 10262 C CD   . PRO A 1 55  ? -1.985  -25.054 0.976   1.00 0.00 ? 55  PRO A CD   7  
ATOM 10263 H HA   . PRO A 1 55  ? -2.026  -22.596 -1.099  1.00 0.00 ? 55  PRO A HA   7  
ATOM 10264 H HB2  . PRO A 1 55  ? 0.488   -23.428 -0.502  1.00 0.00 ? 55  PRO A HB2  7  
ATOM 10265 H HB3  . PRO A 1 55  ? -0.553  -22.603 0.664   1.00 0.00 ? 55  PRO A HB3  7  
ATOM 10266 H HG2  . PRO A 1 55  ? 0.002   -25.529 0.360   1.00 0.00 ? 55  PRO A HG2  7  
ATOM 10267 H HG3  . PRO A 1 55  ? -0.098  -24.557 1.839   1.00 0.00 ? 55  PRO A HG3  7  
ATOM 10268 H HD2  . PRO A 1 55  ? -2.135  -26.123 0.985   1.00 0.00 ? 55  PRO A HD2  7  
ATOM 10269 H HD3  . PRO A 1 55  ? -2.403  -24.605 1.866   1.00 0.00 ? 55  PRO A HD3  7  
ATOM 10270 N N    . SER A 1 56  ? -1.630  -25.369 -2.568  1.00 0.00 ? 56  SER A N    7  
ATOM 10271 C CA   . SER A 1 56  ? -1.262  -26.044 -3.807  1.00 0.00 ? 56  SER A CA   7  
ATOM 10272 C C    . SER A 1 56  ? -2.336  -25.845 -4.873  1.00 0.00 ? 56  SER A C    7  
ATOM 10273 O O    . SER A 1 56  ? -2.076  -25.989 -6.068  1.00 0.00 ? 56  SER A O    7  
ATOM 10274 C CB   . SER A 1 56  ? -1.047  -27.537 -3.556  1.00 0.00 ? 56  SER A CB   7  
ATOM 10275 O OG   . SER A 1 56  ? 0.049   -27.755 -2.685  1.00 0.00 ? 56  SER A OG   7  
ATOM 10276 H H    . SER A 1 56  ? -2.244  -25.813 -1.946  1.00 0.00 ? 56  SER A H    7  
ATOM 10277 H HA   . SER A 1 56  ? -0.338  -25.610 -4.159  1.00 0.00 ? 56  SER A HA   7  
ATOM 10278 H HB2  . SER A 1 56  ? -1.935  -27.956 -3.108  1.00 0.00 ? 56  SER A HB2  7  
ATOM 10279 H HB3  . SER A 1 56  ? -0.850  -28.033 -4.495  1.00 0.00 ? 56  SER A HB3  7  
ATOM 10280 H HG   . SER A 1 56  ? 0.168   -26.987 -2.121  1.00 0.00 ? 56  SER A HG   7  
ATOM 10281 N N    . LYS A 1 57  ? -3.544  -25.514 -4.431  1.00 0.00 ? 57  LYS A N    7  
ATOM 10282 C CA   . LYS A 1 57  ? -4.660  -25.294 -5.345  1.00 0.00 ? 57  LYS A CA   7  
ATOM 10283 C C    . LYS A 1 57  ? -5.007  -23.811 -5.432  1.00 0.00 ? 57  LYS A C    7  
ATOM 10284 O O    . LYS A 1 57  ? -6.163  -23.446 -5.644  1.00 0.00 ? 57  LYS A O    7  
ATOM 10285 C CB   . LYS A 1 57  ? -5.884  -26.089 -4.888  1.00 0.00 ? 57  LYS A CB   7  
ATOM 10286 C CG   . LYS A 1 57  ? -5.599  -27.562 -4.650  1.00 0.00 ? 57  LYS A CG   7  
ATOM 10287 C CD   . LYS A 1 57  ? -5.758  -28.373 -5.925  1.00 0.00 ? 57  LYS A CD   7  
ATOM 10288 C CE   . LYS A 1 57  ? -5.996  -29.845 -5.622  1.00 0.00 ? 57  LYS A CE   7  
ATOM 10289 N NZ   . LYS A 1 57  ? -6.791  -30.509 -6.692  1.00 0.00 ? 57  LYS A NZ   7  
ATOM 10290 H H    . LYS A 1 57  ? -3.690  -25.413 -3.467  1.00 0.00 ? 57  LYS A H    7  
ATOM 10291 H HA   . LYS A 1 57  ? -4.361  -25.639 -6.323  1.00 0.00 ? 57  LYS A HA   7  
ATOM 10292 H HB2  . LYS A 1 57  ? -6.253  -25.662 -3.967  1.00 0.00 ? 57  LYS A HB2  7  
ATOM 10293 H HB3  . LYS A 1 57  ? -6.652  -26.010 -5.644  1.00 0.00 ? 57  LYS A HB3  7  
ATOM 10294 H HG2  . LYS A 1 57  ? -4.586  -27.670 -4.291  1.00 0.00 ? 57  LYS A HG2  7  
ATOM 10295 H HG3  . LYS A 1 57  ? -6.288  -27.937 -3.907  1.00 0.00 ? 57  LYS A HG3  7  
ATOM 10296 H HD2  . LYS A 1 57  ? -6.600  -27.991 -6.482  1.00 0.00 ? 57  LYS A HD2  7  
ATOM 10297 H HD3  . LYS A 1 57  ? -4.859  -28.277 -6.517  1.00 0.00 ? 57  LYS A HD3  7  
ATOM 10298 H HE2  . LYS A 1 57  ? -5.041  -30.340 -5.535  1.00 0.00 ? 57  LYS A HE2  7  
ATOM 10299 H HE3  . LYS A 1 57  ? -6.530  -29.925 -4.687  1.00 0.00 ? 57  LYS A HE3  7  
ATOM 10300 H HZ1  . LYS A 1 57  ? -6.352  -31.416 -6.952  1.00 0.00 ? 57  LYS A HZ1  7  
ATOM 10301 H HZ2  . LYS A 1 57  ? -6.831  -29.903 -7.536  1.00 0.00 ? 57  LYS A HZ2  7  
ATOM 10302 H HZ3  . LYS A 1 57  ? -7.760  -30.688 -6.360  1.00 0.00 ? 57  LYS A HZ3  7  
ATOM 10303 N N    . ALA A 1 58  ? -3.998  -22.961 -5.269  1.00 0.00 ? 58  ALA A N    7  
ATOM 10304 C CA   . ALA A 1 58  ? -4.197  -21.518 -5.333  1.00 0.00 ? 58  ALA A CA   7  
ATOM 10305 C C    . ALA A 1 58  ? -4.878  -21.115 -6.637  1.00 0.00 ? 58  ALA A C    7  
ATOM 10306 O O    . ALA A 1 58  ? -5.771  -20.267 -6.646  1.00 0.00 ? 58  ALA A O    7  
ATOM 10307 C CB   . ALA A 1 58  ? -2.866  -20.795 -5.185  1.00 0.00 ? 58  ALA A CB   7  
ATOM 10308 H H    . ALA A 1 58  ? -3.099  -23.313 -5.103  1.00 0.00 ? 58  ALA A H    7  
ATOM 10309 H HA   . ALA A 1 58  ? -4.829  -21.231 -4.505  1.00 0.00 ? 58  ALA A HA   7  
ATOM 10310 H HB1  . ALA A 1 58  ? -2.502  -20.510 -6.161  1.00 0.00 ? 58  ALA A HB1  7  
ATOM 10311 H HB2  . ALA A 1 58  ? -3.003  -19.912 -4.579  1.00 0.00 ? 58  ALA A HB2  7  
ATOM 10312 H HB3  . ALA A 1 58  ? -2.152  -21.451 -4.711  1.00 0.00 ? 58  ALA A HB3  7  
ATOM 10313 N N    . HIS A 1 59  ? -4.450  -21.728 -7.736  1.00 0.00 ? 59  HIS A N    7  
ATOM 10314 C CA   . HIS A 1 59  ? -5.019  -21.432 -9.046  1.00 0.00 ? 59  HIS A CA   7  
ATOM 10315 C C    . HIS A 1 59  ? -6.533  -21.260 -8.955  1.00 0.00 ? 59  HIS A C    7  
ATOM 10316 O O    . HIS A 1 59  ? -7.134  -20.539 -9.750  1.00 0.00 ? 59  HIS A O    7  
ATOM 10317 C CB   . HIS A 1 59  ? -4.680  -22.547 -10.036 1.00 0.00 ? 59  HIS A CB   7  
ATOM 10318 C CG   . HIS A 1 59  ? -4.973  -23.920 -9.516  1.00 0.00 ? 59  HIS A CG   7  
ATOM 10319 N ND1  . HIS A 1 59  ? -6.104  -24.630 -9.861  1.00 0.00 ? 59  HIS A ND1  7  
ATOM 10320 C CD2  . HIS A 1 59  ? -4.274  -24.716 -8.673  1.00 0.00 ? 59  HIS A CD2  7  
ATOM 10321 C CE1  . HIS A 1 59  ? -6.089  -25.802 -9.250  1.00 0.00 ? 59  HIS A CE1  7  
ATOM 10322 N NE2  . HIS A 1 59  ? -4.989  -25.879 -8.524  1.00 0.00 ? 59  HIS A NE2  7  
ATOM 10323 H H    . HIS A 1 59  ? -3.736  -22.395 -7.665  1.00 0.00 ? 59  HIS A H    7  
ATOM 10324 H HA   . HIS A 1 59  ? -4.585  -20.508 -9.396  1.00 0.00 ? 59  HIS A HA   7  
ATOM 10325 H HB2  . HIS A 1 59  ? -5.255  -22.405 -10.939 1.00 0.00 ? 59  HIS A HB2  7  
ATOM 10326 H HB3  . HIS A 1 59  ? -3.627  -22.499 -10.275 1.00 0.00 ? 59  HIS A HB3  7  
ATOM 10327 H HD1  . HIS A 1 59  ? -6.813  -24.320 -10.461 1.00 0.00 ? 59  HIS A HD1  7  
ATOM 10328 H HD2  . HIS A 1 59  ? -3.329  -24.480 -8.203  1.00 0.00 ? 59  HIS A HD2  7  
ATOM 10329 H HE1  . HIS A 1 59  ? -6.847  -26.567 -9.332  1.00 0.00 ? 59  HIS A HE1  7  
ATOM 10330 H HE2  . HIS A 1 59  ? -4.772  -26.606 -7.905  1.00 0.00 ? 59  HIS A HE2  7  
ATOM 10331 N N    . GLY A 1 60  ? -7.142  -21.929 -7.981  1.00 0.00 ? 60  GLY A N    7  
ATOM 10332 C CA   . GLY A 1 60  ? -8.579  -21.837 -7.804  1.00 0.00 ? 60  GLY A CA   7  
ATOM 10333 C C    . GLY A 1 60  ? -8.980  -20.700 -6.886  1.00 0.00 ? 60  GLY A C    7  
ATOM 10334 O O    . GLY A 1 60  ? -9.947  -20.812 -6.131  1.00 0.00 ? 60  GLY A O    7  
ATOM 10335 H H    . GLY A 1 60  ? -6.611  -22.489 -7.376  1.00 0.00 ? 60  GLY A H    7  
ATOM 10336 H HA2  . GLY A 1 60  ? -9.041  -21.687 -8.769  1.00 0.00 ? 60  GLY A HA2  7  
ATOM 10337 H HA3  . GLY A 1 60  ? -8.939  -22.766 -7.386  1.00 0.00 ? 60  GLY A HA3  7  
ATOM 10338 N N    . LEU A 1 61  ? -8.234  -19.602 -6.948  1.00 0.00 ? 61  LEU A N    7  
ATOM 10339 C CA   . LEU A 1 61  ? -8.516  -18.438 -6.113  1.00 0.00 ? 61  LEU A CA   7  
ATOM 10340 C C    . LEU A 1 61  ? -9.368  -17.422 -6.866  1.00 0.00 ? 61  LEU A C    7  
ATOM 10341 O O    . LEU A 1 61  ? -9.985  -16.545 -6.262  1.00 0.00 ? 61  LEU A O    7  
ATOM 10342 C CB   . LEU A 1 61  ? -7.209  -17.787 -5.656  1.00 0.00 ? 61  LEU A CB   7  
ATOM 10343 C CG   . LEU A 1 61  ? -6.558  -18.390 -4.411  1.00 0.00 ? 61  LEU A CG   7  
ATOM 10344 C CD1  . LEU A 1 61  ? -5.102  -17.964 -4.311  1.00 0.00 ? 61  LEU A CD1  7  
ATOM 10345 C CD2  . LEU A 1 61  ? -7.322  -17.982 -3.159  1.00 0.00 ? 61  LEU A CD2  7  
ATOM 10346 H H    . LEU A 1 61  ? -7.477  -19.572 -7.568  1.00 0.00 ? 61  LEU A H    7  
ATOM 10347 H HA   . LEU A 1 61  ? -9.062  -18.777 -5.246  1.00 0.00 ? 61  LEU A HA   7  
ATOM 10348 H HB2  . LEU A 1 61  ? -6.502  -17.860 -6.467  1.00 0.00 ? 61  LEU A HB2  7  
ATOM 10349 H HB3  . LEU A 1 61  ? -7.414  -16.745 -5.452  1.00 0.00 ? 61  LEU A HB3  7  
ATOM 10350 H HG   . LEU A 1 61  ? -6.586  -19.468 -4.484  1.00 0.00 ? 61  LEU A HG   7  
ATOM 10351 H HD11 . LEU A 1 61  ? -4.733  -17.711 -5.293  1.00 0.00 ? 61  LEU A HD11 7  
ATOM 10352 H HD12 . LEU A 1 61  ? -4.517  -18.775 -3.905  1.00 0.00 ? 61  LEU A HD12 7  
ATOM 10353 H HD13 . LEU A 1 61  ? -5.022  -17.103 -3.663  1.00 0.00 ? 61  LEU A HD13 7  
ATOM 10354 H HD21 . LEU A 1 61  ? -6.645  -17.510 -2.463  1.00 0.00 ? 61  LEU A HD21 7  
ATOM 10355 H HD22 . LEU A 1 61  ? -7.756  -18.859 -2.701  1.00 0.00 ? 61  LEU A HD22 7  
ATOM 10356 H HD23 . LEU A 1 61  ? -8.106  -17.289 -3.426  1.00 0.00 ? 61  LEU A HD23 7  
ATOM 10357 N N    . GLY A 1 62  ? -9.400  -17.548 -8.189  1.00 0.00 ? 62  GLY A N    7  
ATOM 10358 C CA   . GLY A 1 62  ? -10.182 -16.635 -9.003  1.00 0.00 ? 62  GLY A CA   7  
ATOM 10359 C C    . GLY A 1 62  ? -9.605  -15.234 -9.019  1.00 0.00 ? 62  GLY A C    7  
ATOM 10360 O O    . GLY A 1 62  ? -8.419  -15.047 -9.293  1.00 0.00 ? 62  GLY A O    7  
ATOM 10361 H H    . GLY A 1 62  ? -8.888  -18.267 -8.617  1.00 0.00 ? 62  GLY A H    7  
ATOM 10362 H HA2  . GLY A 1 62  ? -10.217 -17.011 -10.014 1.00 0.00 ? 62  GLY A HA2  7  
ATOM 10363 H HA3  . GLY A 1 62  ? -11.188 -16.593 -8.611  1.00 0.00 ? 62  GLY A HA3  7  
ATOM 10364 N N    . SER A 1 63  ? -10.445 -14.246 -8.728  1.00 0.00 ? 63  SER A N    7  
ATOM 10365 C CA   . SER A 1 63  ? -10.013 -12.853 -8.716  1.00 0.00 ? 63  SER A CA   7  
ATOM 10366 C C    . SER A 1 63  ? -9.070  -12.587 -7.546  1.00 0.00 ? 63  SER A C    7  
ATOM 10367 O O    . SER A 1 63  ? -8.172  -11.751 -7.636  1.00 0.00 ? 63  SER A O    7  
ATOM 10368 C CB   . SER A 1 63  ? -11.224 -11.922 -8.632  1.00 0.00 ? 63  SER A CB   7  
ATOM 10369 O OG   . SER A 1 63  ? -12.145 -12.371 -7.654  1.00 0.00 ? 63  SER A OG   7  
ATOM 10370 H H    . SER A 1 63  ? -11.379 -14.459 -8.518  1.00 0.00 ? 63  SER A H    7  
ATOM 10371 H HA   . SER A 1 63  ? -9.485  -12.662 -9.639  1.00 0.00 ? 63  SER A HA   7  
ATOM 10372 H HB2  . SER A 1 63  ? -10.893 -10.929 -8.368  1.00 0.00 ? 63  SER A HB2  7  
ATOM 10373 H HB3  . SER A 1 63  ? -11.720 -11.894 -9.591  1.00 0.00 ? 63  SER A HB3  7  
ATOM 10374 H HG   . SER A 1 63  ? -12.623 -11.620 -7.295  1.00 0.00 ? 63  SER A HG   7  
ATOM 10375 N N    . ASN A 1 64  ? -9.282  -13.305 -6.448  1.00 0.00 ? 64  ASN A N    7  
ATOM 10376 C CA   . ASN A 1 64  ? -8.453  -13.147 -5.259  1.00 0.00 ? 64  ASN A CA   7  
ATOM 10377 C C    . ASN A 1 64  ? -7.028  -13.626 -5.522  1.00 0.00 ? 64  ASN A C    7  
ATOM 10378 O O    . ASN A 1 64  ? -6.150  -13.496 -4.669  1.00 0.00 ? 64  ASN A O    7  
ATOM 10379 C CB   . ASN A 1 64  ? -9.054  -13.922 -4.085  1.00 0.00 ? 64  ASN A CB   7  
ATOM 10380 C CG   . ASN A 1 64  ? -10.547 -13.691 -3.944  1.00 0.00 ? 64  ASN A CG   7  
ATOM 10381 O OD1  . ASN A 1 64  ? -11.356 -14.436 -4.496  1.00 0.00 ? 64  ASN A OD1  7  
ATOM 10382 N ND2  . ASN A 1 64  ? -10.917 -12.654 -3.201  1.00 0.00 ? 64  ASN A ND2  7  
ATOM 10383 H H    . ASN A 1 64  ? -10.014 -13.957 -6.437  1.00 0.00 ? 64  ASN A H    7  
ATOM 10384 H HA   . ASN A 1 64  ? -8.427  -12.097 -5.010  1.00 0.00 ? 64  ASN A HA   7  
ATOM 10385 H HB2  . ASN A 1 64  ? -8.886  -14.979 -4.235  1.00 0.00 ? 64  ASN A HB2  7  
ATOM 10386 H HB3  . ASN A 1 64  ? -8.572  -13.611 -3.171  1.00 0.00 ? 64  ASN A HB3  7  
ATOM 10387 H HD21 . ASN A 1 64  ? -10.217 -12.104 -2.792  1.00 0.00 ? 64  ASN A HD21 7  
ATOM 10388 H HD22 . ASN A 1 64  ? -11.875 -12.482 -3.093  1.00 0.00 ? 64  ASN A HD22 7  
ATOM 10389 N N    . LEU A 1 65  ? -6.806  -14.180 -6.709  1.00 0.00 ? 65  LEU A N    7  
ATOM 10390 C CA   . LEU A 1 65  ? -5.488  -14.678 -7.086  1.00 0.00 ? 65  LEU A CA   7  
ATOM 10391 C C    . LEU A 1 65  ? -4.491  -13.532 -7.222  1.00 0.00 ? 65  LEU A C    7  
ATOM 10392 O O    . LEU A 1 65  ? -4.812  -12.477 -7.770  1.00 0.00 ? 65  LEU A O    7  
ATOM 10393 C CB   . LEU A 1 65  ? -5.571  -15.455 -8.401  1.00 0.00 ? 65  LEU A CB   7  
ATOM 10394 C CG   . LEU A 1 65  ? -4.328  -16.257 -8.788  1.00 0.00 ? 65  LEU A CG   7  
ATOM 10395 C CD1  . LEU A 1 65  ? -4.376  -17.646 -8.170  1.00 0.00 ? 65  LEU A CD1  7  
ATOM 10396 C CD2  . LEU A 1 65  ? -4.201  -16.348 -10.301 1.00 0.00 ? 65  LEU A CD2  7  
ATOM 10397 H H    . LEU A 1 65  ? -7.545  -14.256 -7.348  1.00 0.00 ? 65  LEU A H    7  
ATOM 10398 H HA   . LEU A 1 65  ? -5.149  -15.343 -6.306  1.00 0.00 ? 65  LEU A HA   7  
ATOM 10399 H HB2  . LEU A 1 65  ? -6.399  -16.144 -8.327  1.00 0.00 ? 65  LEU A HB2  7  
ATOM 10400 H HB3  . LEU A 1 65  ? -5.767  -14.744 -9.192  1.00 0.00 ? 65  LEU A HB3  7  
ATOM 10401 H HG   . LEU A 1 65  ? -3.450  -15.753 -8.407  1.00 0.00 ? 65  LEU A HG   7  
ATOM 10402 H HD11 . LEU A 1 65  ? -3.989  -17.606 -7.164  1.00 0.00 ? 65  LEU A HD11 7  
ATOM 10403 H HD12 . LEU A 1 65  ? -3.776  -18.323 -8.760  1.00 0.00 ? 65  LEU A HD12 7  
ATOM 10404 H HD13 . LEU A 1 65  ? -5.398  -17.996 -8.150  1.00 0.00 ? 65  LEU A HD13 7  
ATOM 10405 H HD21 . LEU A 1 65  ? -3.235  -15.972 -10.604 1.00 0.00 ? 65  LEU A HD21 7  
ATOM 10406 H HD22 . LEU A 1 65  ? -4.978  -15.757 -10.764 1.00 0.00 ? 65  LEU A HD22 7  
ATOM 10407 H HD23 . LEU A 1 65  ? -4.300  -17.378 -10.609 1.00 0.00 ? 65  LEU A HD23 7  
ATOM 10408 N N    . VAL A 1 66  ? -3.278  -13.746 -6.720  1.00 0.00 ? 66  VAL A N    7  
ATOM 10409 C CA   . VAL A 1 66  ? -2.233  -12.732 -6.788  1.00 0.00 ? 66  VAL A CA   7  
ATOM 10410 C C    . VAL A 1 66  ? -1.308  -12.976 -7.975  1.00 0.00 ? 66  VAL A C    7  
ATOM 10411 O O    . VAL A 1 66  ? -1.010  -14.120 -8.321  1.00 0.00 ? 66  VAL A O    7  
ATOM 10412 C CB   . VAL A 1 66  ? -1.395  -12.703 -5.496  1.00 0.00 ? 66  VAL A CB   7  
ATOM 10413 C CG1  . VAL A 1 66  ? -0.454  -11.508 -5.497  1.00 0.00 ? 66  VAL A CG1  7  
ATOM 10414 C CG2  . VAL A 1 66  ? -2.301  -12.677 -4.275  1.00 0.00 ? 66  VAL A CG2  7  
ATOM 10415 H H    . VAL A 1 66  ? -3.083  -14.607 -6.295  1.00 0.00 ? 66  VAL A H    7  
ATOM 10416 H HA   . VAL A 1 66  ? -2.708  -11.770 -6.906  1.00 0.00 ? 66  VAL A HA   7  
ATOM 10417 H HB   . VAL A 1 66  ? -0.799  -13.602 -5.457  1.00 0.00 ? 66  VAL A HB   7  
ATOM 10418 H HG11 . VAL A 1 66  ? -0.192  -11.257 -6.515  1.00 0.00 ? 66  VAL A HG11 7  
ATOM 10419 H HG12 . VAL A 1 66  ? -0.941  -10.664 -5.031  1.00 0.00 ? 66  VAL A HG12 7  
ATOM 10420 H HG13 . VAL A 1 66  ? 0.442   -11.755 -4.947  1.00 0.00 ? 66  VAL A HG13 7  
ATOM 10421 H HG21 . VAL A 1 66  ? -3.074  -13.423 -4.385  1.00 0.00 ? 66  VAL A HG21 7  
ATOM 10422 H HG22 . VAL A 1 66  ? -1.719  -12.889 -3.389  1.00 0.00 ? 66  VAL A HG22 7  
ATOM 10423 H HG23 . VAL A 1 66  ? -2.753  -11.700 -4.182  1.00 0.00 ? 66  VAL A HG23 7  
ATOM 10424 N N    . THR A 1 67  ? -0.854  -11.892 -8.597  1.00 0.00 ? 67  THR A N    7  
ATOM 10425 C CA   . THR A 1 67  ? 0.037   -11.987 -9.746  1.00 0.00 ? 67  THR A CA   7  
ATOM 10426 C C    . THR A 1 67  ? 1.044   -10.842 -9.757  1.00 0.00 ? 67  THR A C    7  
ATOM 10427 O O    . THR A 1 67  ? 0.787   -9.773  -9.205  1.00 0.00 ? 67  THR A O    7  
ATOM 10428 C CB   . THR A 1 67  ? -0.750  -11.976 -11.070 1.00 0.00 ? 67  THR A CB   7  
ATOM 10429 O OG1  . THR A 1 67  ? -1.210  -10.650 -11.355 1.00 0.00 ? 67  THR A OG1  7  
ATOM 10430 C CG2  . THR A 1 67  ? -1.936  -12.926 -11.002 1.00 0.00 ? 67  THR A CG2  7  
ATOM 10431 H H    . THR A 1 67  ? -1.127  -11.008 -8.274  1.00 0.00 ? 67  THR A H    7  
ATOM 10432 H HA   . THR A 1 67  ? 0.572   -12.923 -9.677  1.00 0.00 ? 67  THR A HA   7  
ATOM 10433 H HB   . THR A 1 67  ? -0.093  -12.299 -11.865 1.00 0.00 ? 67  THR A HB   7  
ATOM 10434 H HG1  . THR A 1 67  ? -0.545  -10.184 -11.867 1.00 0.00 ? 67  THR A HG1  7  
ATOM 10435 H HG21 . THR A 1 67  ? -1.631  -13.849 -10.532 1.00 0.00 ? 67  THR A HG21 7  
ATOM 10436 H HG22 . THR A 1 67  ? -2.290  -13.131 -12.002 1.00 0.00 ? 67  THR A HG22 7  
ATOM 10437 H HG23 . THR A 1 67  ? -2.728  -12.472 -10.426 1.00 0.00 ? 67  THR A HG23 7  
ATOM 10438 N N    . GLU A 1 68  ? 2.190   -11.074 -10.390 1.00 0.00 ? 68  GLU A N    7  
ATOM 10439 C CA   . GLU A 1 68  ? 3.235   -10.061 -10.472 1.00 0.00 ? 68  GLU A CA   7  
ATOM 10440 C C    . GLU A 1 68  ? 2.631   -8.663  -10.577 1.00 0.00 ? 68  GLU A C    7  
ATOM 10441 O O    . GLU A 1 68  ? 3.123   -7.714  -9.967  1.00 0.00 ? 68  GLU A O    7  
ATOM 10442 C CB   . GLU A 1 68  ? 4.142   -10.328 -11.675 1.00 0.00 ? 68  GLU A CB   7  
ATOM 10443 C CG   . GLU A 1 68  ? 5.547   -9.773  -11.513 1.00 0.00 ? 68  GLU A CG   7  
ATOM 10444 C CD   . GLU A 1 68  ? 6.303   -9.706  -12.826 1.00 0.00 ? 68  GLU A CD   7  
ATOM 10445 O OE1  . GLU A 1 68  ? 6.455   -10.760 -13.477 1.00 0.00 ? 68  GLU A OE1  7  
ATOM 10446 O OE2  . GLU A 1 68  ? 6.743   -8.599  -13.201 1.00 0.00 ? 68  GLU A OE2  7  
ATOM 10447 H H    . GLU A 1 68  ? 2.336   -11.947 -10.811 1.00 0.00 ? 68  GLU A H    7  
ATOM 10448 H HA   . GLU A 1 68  ? 3.824   -10.118 -9.569  1.00 0.00 ? 68  GLU A HA   7  
ATOM 10449 H HB2  . GLU A 1 68  ? 4.213   -11.395 -11.827 1.00 0.00 ? 68  GLU A HB2  7  
ATOM 10450 H HB3  . GLU A 1 68  ? 3.699   -9.877  -12.551 1.00 0.00 ? 68  GLU A HB3  7  
ATOM 10451 H HG2  . GLU A 1 68  ? 5.482   -8.777  -11.101 1.00 0.00 ? 68  GLU A HG2  7  
ATOM 10452 H HG3  . GLU A 1 68  ? 6.095   -10.408 -10.831 1.00 0.00 ? 68  GLU A HG3  7  
ATOM 10453 N N    . VAL A 1 69  ? 1.561   -8.545  -11.357 1.00 0.00 ? 69  VAL A N    7  
ATOM 10454 C CA   . VAL A 1 69  ? 0.888   -7.264  -11.543 1.00 0.00 ? 69  VAL A CA   7  
ATOM 10455 C C    . VAL A 1 69  ? 0.271   -6.773  -10.238 1.00 0.00 ? 69  VAL A C    7  
ATOM 10456 O O    . VAL A 1 69  ? 0.528   -5.651  -9.802  1.00 0.00 ? 69  VAL A O    7  
ATOM 10457 C CB   . VAL A 1 69  ? -0.213  -7.360  -12.615 1.00 0.00 ? 69  VAL A CB   7  
ATOM 10458 C CG1  . VAL A 1 69  ? -1.218  -6.230  -12.450 1.00 0.00 ? 69  VAL A CG1  7  
ATOM 10459 C CG2  . VAL A 1 69  ? 0.397   -7.342  -14.009 1.00 0.00 ? 69  VAL A CG2  7  
ATOM 10460 H H    . VAL A 1 69  ? 1.215   -9.337  -11.818 1.00 0.00 ? 69  VAL A H    7  
ATOM 10461 H HA   . VAL A 1 69  ? 1.624   -6.546  -11.875 1.00 0.00 ? 69  VAL A HA   7  
ATOM 10462 H HB   . VAL A 1 69  ? -0.734  -8.297  -12.485 1.00 0.00 ? 69  VAL A HB   7  
ATOM 10463 H HG11 . VAL A 1 69  ? -1.798  -6.129  -13.356 1.00 0.00 ? 69  VAL A HG11 7  
ATOM 10464 H HG12 . VAL A 1 69  ? -1.876  -6.451  -11.623 1.00 0.00 ? 69  VAL A HG12 7  
ATOM 10465 H HG13 . VAL A 1 69  ? -0.693  -5.307  -12.255 1.00 0.00 ? 69  VAL A HG13 7  
ATOM 10466 H HG21 . VAL A 1 69  ? 1.091   -8.162  -14.107 1.00 0.00 ? 69  VAL A HG21 7  
ATOM 10467 H HG22 . VAL A 1 69  ? -0.386  -7.442  -14.747 1.00 0.00 ? 69  VAL A HG22 7  
ATOM 10468 H HG23 . VAL A 1 69  ? 0.918   -6.408  -14.162 1.00 0.00 ? 69  VAL A HG23 7  
ATOM 10469 N N    . ARG A 1 70  ? -0.543  -7.622  -9.619  1.00 0.00 ? 70  ARG A N    7  
ATOM 10470 C CA   . ARG A 1 70  ? -1.198  -7.274  -8.364  1.00 0.00 ? 70  ARG A CA   7  
ATOM 10471 C C    . ARG A 1 70  ? -0.216  -6.604  -7.406  1.00 0.00 ? 70  ARG A C    7  
ATOM 10472 O O    . ARG A 1 70  ? -0.498  -5.539  -6.857  1.00 0.00 ? 70  ARG A O    7  
ATOM 10473 C CB   . ARG A 1 70  ? -1.792  -8.523  -7.711  1.00 0.00 ? 70  ARG A CB   7  
ATOM 10474 C CG   . ARG A 1 70  ? -2.798  -9.250  -8.589  1.00 0.00 ? 70  ARG A CG   7  
ATOM 10475 C CD   . ARG A 1 70  ? -4.111  -8.488  -8.679  1.00 0.00 ? 70  ARG A CD   7  
ATOM 10476 N NE   . ARG A 1 70  ? -5.204  -9.337  -9.146  1.00 0.00 ? 70  ARG A NE   7  
ATOM 10477 C CZ   . ARG A 1 70  ? -5.462  -9.565  -10.429 1.00 0.00 ? 70  ARG A CZ   7  
ATOM 10478 N NH1  . ARG A 1 70  ? -4.708  -9.011  -11.368 1.00 0.00 ? 70  ARG A NH1  7  
ATOM 10479 N NH2  . ARG A 1 70  ? -6.475  -10.349 -10.774 1.00 0.00 ? 70  ARG A NH2  7  
ATOM 10480 H H    . ARG A 1 70  ? -0.708  -8.502  -10.016 1.00 0.00 ? 70  ARG A H    7  
ATOM 10481 H HA   . ARG A 1 70  ? -1.995  -6.581  -8.586  1.00 0.00 ? 70  ARG A HA   7  
ATOM 10482 H HB2  . ARG A 1 70  ? -0.991  -9.208  -7.476  1.00 0.00 ? 70  ARG A HB2  7  
ATOM 10483 H HB3  . ARG A 1 70  ? -2.288  -8.235  -6.796  1.00 0.00 ? 70  ARG A HB3  7  
ATOM 10484 H HG2  . ARG A 1 70  ? -2.386  -9.353  -9.582  1.00 0.00 ? 70  ARG A HG2  7  
ATOM 10485 H HG3  . ARG A 1 70  ? -2.986  -10.227 -8.171  1.00 0.00 ? 70  ARG A HG3  7  
ATOM 10486 H HD2  . ARG A 1 70  ? -4.358  -8.105  -7.701  1.00 0.00 ? 70  ARG A HD2  7  
ATOM 10487 H HD3  . ARG A 1 70  ? -3.987  -7.665  -9.367  1.00 0.00 ? 70  ARG A HD3  7  
ATOM 10488 H HE   . ARG A 1 70  ? -5.774  -9.756  -8.468  1.00 0.00 ? 70  ARG A HE   7  
ATOM 10489 H HH11 . ARG A 1 70  ? -3.944  -8.420  -11.111 1.00 0.00 ? 70  ARG A HH11 7  
ATOM 10490 H HH12 . ARG A 1 70  ? -4.904  -9.185  -12.334 1.00 0.00 ? 70  ARG A HH12 7  
ATOM 10491 H HH21 . ARG A 1 70  ? -7.045  -10.769 -10.069 1.00 0.00 ? 70  ARG A HH21 7  
ATOM 10492 H HH22 . ARG A 1 70  ? -6.668  -10.520 -11.740 1.00 0.00 ? 70  ARG A HH22 7  
ATOM 10493 N N    . VAL A 1 71  ? 0.936   -7.237  -7.210  1.00 0.00 ? 71  VAL A N    7  
ATOM 10494 C CA   . VAL A 1 71  ? 1.959   -6.702  -6.320  1.00 0.00 ? 71  VAL A CA   7  
ATOM 10495 C C    . VAL A 1 71  ? 2.538   -5.402  -6.865  1.00 0.00 ? 71  VAL A C    7  
ATOM 10496 O O    . VAL A 1 71  ? 2.792   -4.460  -6.114  1.00 0.00 ? 71  VAL A O    7  
ATOM 10497 C CB   . VAL A 1 71  ? 3.103   -7.712  -6.109  1.00 0.00 ? 71  VAL A CB   7  
ATOM 10498 C CG1  . VAL A 1 71  ? 3.967   -7.302  -4.926  1.00 0.00 ? 71  VAL A CG1  7  
ATOM 10499 C CG2  . VAL A 1 71  ? 2.546   -9.114  -5.913  1.00 0.00 ? 71  VAL A CG2  7  
ATOM 10500 H H    . VAL A 1 71  ? 1.102   -8.083  -7.676  1.00 0.00 ? 71  VAL A H    7  
ATOM 10501 H HA   . VAL A 1 71  ? 1.500   -6.507  -5.362  1.00 0.00 ? 71  VAL A HA   7  
ATOM 10502 H HB   . VAL A 1 71  ? 3.722   -7.714  -6.994  1.00 0.00 ? 71  VAL A HB   7  
ATOM 10503 H HG11 . VAL A 1 71  ? 5.009   -7.402  -5.190  1.00 0.00 ? 71  VAL A HG11 7  
ATOM 10504 H HG12 . VAL A 1 71  ? 3.757   -6.276  -4.665  1.00 0.00 ? 71  VAL A HG12 7  
ATOM 10505 H HG13 . VAL A 1 71  ? 3.747   -7.941  -4.083  1.00 0.00 ? 71  VAL A HG13 7  
ATOM 10506 H HG21 . VAL A 1 71  ? 1.477   -9.059  -5.772  1.00 0.00 ? 71  VAL A HG21 7  
ATOM 10507 H HG22 . VAL A 1 71  ? 2.764   -9.714  -6.785  1.00 0.00 ? 71  VAL A HG22 7  
ATOM 10508 H HG23 . VAL A 1 71  ? 3.002   -9.565  -5.044  1.00 0.00 ? 71  VAL A HG23 7  
ATOM 10509 N N    . TYR A 1 72  ? 2.744   -5.357  -8.177  1.00 0.00 ? 72  TYR A N    7  
ATOM 10510 C CA   . TYR A 1 72  ? 3.295   -4.172  -8.824  1.00 0.00 ? 72  TYR A CA   7  
ATOM 10511 C C    . TYR A 1 72  ? 2.442   -2.943  -8.527  1.00 0.00 ? 72  TYR A C    7  
ATOM 10512 O O    . TYR A 1 72  ? 2.963   -1.869  -8.232  1.00 0.00 ? 72  TYR A O    7  
ATOM 10513 C CB   . TYR A 1 72  ? 3.391   -4.389  -10.335 1.00 0.00 ? 72  TYR A CB   7  
ATOM 10514 C CG   . TYR A 1 72  ? 3.447   -3.103  -11.128 1.00 0.00 ? 72  TYR A CG   7  
ATOM 10515 C CD1  . TYR A 1 72  ? 2.300   -2.350  -11.350 1.00 0.00 ? 72  TYR A CD1  7  
ATOM 10516 C CD2  . TYR A 1 72  ? 4.645   -2.641  -11.657 1.00 0.00 ? 72  TYR A CD2  7  
ATOM 10517 C CE1  . TYR A 1 72  ? 2.346   -1.175  -12.075 1.00 0.00 ? 72  TYR A CE1  7  
ATOM 10518 C CE2  . TYR A 1 72  ? 4.701   -1.466  -12.381 1.00 0.00 ? 72  TYR A CE2  7  
ATOM 10519 C CZ   . TYR A 1 72  ? 3.549   -0.737  -12.588 1.00 0.00 ? 72  TYR A CZ   7  
ATOM 10520 O OH   . TYR A 1 72  ? 3.600   0.433   -13.311 1.00 0.00 ? 72  TYR A OH   7  
ATOM 10521 H H    . TYR A 1 72  ? 2.522   -6.140  -8.723  1.00 0.00 ? 72  TYR A H    7  
ATOM 10522 H HA   . TYR A 1 72  ? 4.288   -4.011  -8.430  1.00 0.00 ? 72  TYR A HA   7  
ATOM 10523 H HB2  . TYR A 1 72  ? 4.284   -4.953  -10.556 1.00 0.00 ? 72  TYR A HB2  7  
ATOM 10524 H HB3  . TYR A 1 72  ? 2.527   -4.946  -10.667 1.00 0.00 ? 72  TYR A HB3  7  
ATOM 10525 H HD1  . TYR A 1 72  ? 1.359   -2.696  -10.947 1.00 0.00 ? 72  TYR A HD1  7  
ATOM 10526 H HD2  . TYR A 1 72  ? 5.546   -3.214  -11.493 1.00 0.00 ? 72  TYR A HD2  7  
ATOM 10527 H HE1  . TYR A 1 72  ? 1.443   -0.604  -12.237 1.00 0.00 ? 72  TYR A HE1  7  
ATOM 10528 H HE2  . TYR A 1 72  ? 5.643   -1.123  -12.784 1.00 0.00 ? 72  TYR A HE2  7  
ATOM 10529 H HH   . TYR A 1 72  ? 3.375   1.172   -12.740 1.00 0.00 ? 72  TYR A HH   7  
ATOM 10530 N N    . ASN A 1 73  ? 1.126   -3.111  -8.609  1.00 0.00 ? 73  ASN A N    7  
ATOM 10531 C CA   . ASN A 1 73  ? 0.198   -2.016  -8.349  1.00 0.00 ? 73  ASN A CA   7  
ATOM 10532 C C    . ASN A 1 73  ? 0.237   -1.606  -6.880  1.00 0.00 ? 73  ASN A C    7  
ATOM 10533 O O    . ASN A 1 73  ? 0.350   -0.424  -6.558  1.00 0.00 ? 73  ASN A O    7  
ATOM 10534 C CB   . ASN A 1 73  ? -1.224  -2.422  -8.739  1.00 0.00 ? 73  ASN A CB   7  
ATOM 10535 C CG   . ASN A 1 73  ? -1.490  -2.245  -10.222 1.00 0.00 ? 73  ASN A CG   7  
ATOM 10536 O OD1  . ASN A 1 73  ? -1.702  -1.129  -10.697 1.00 0.00 ? 73  ASN A OD1  7  
ATOM 10537 N ND2  . ASN A 1 73  ? -1.480  -3.349  -10.960 1.00 0.00 ? 73  ASN A ND2  7  
ATOM 10538 H H    . ASN A 1 73  ? 0.770   -3.992  -8.849  1.00 0.00 ? 73  ASN A H    7  
ATOM 10539 H HA   . ASN A 1 73  ? 0.502   -1.175  -8.954  1.00 0.00 ? 73  ASN A HA   7  
ATOM 10540 H HB2  . ASN A 1 73  ? -1.377  -3.461  -8.488  1.00 0.00 ? 73  ASN A HB2  7  
ATOM 10541 H HB3  . ASN A 1 73  ? -1.929  -1.815  -8.191  1.00 0.00 ? 73  ASN A HB3  7  
ATOM 10542 H HD21 . ASN A 1 73  ? -1.303  -4.203  -10.514 1.00 0.00 ? 73  ASN A HD21 7  
ATOM 10543 H HD22 . ASN A 1 73  ? -1.648  -3.263  -11.922 1.00 0.00 ? 73  ASN A HD22 7  
ATOM 10544 N N    . TRP A 1 74  ? 0.144   -2.592  -5.995  1.00 0.00 ? 74  TRP A N    7  
ATOM 10545 C CA   . TRP A 1 74  ? 0.169   -2.334  -4.559  1.00 0.00 ? 74  TRP A CA   7  
ATOM 10546 C C    . TRP A 1 74  ? 1.397   -1.515  -4.175  1.00 0.00 ? 74  TRP A C    7  
ATOM 10547 O O    . TRP A 1 74  ? 1.289   -0.510  -3.472  1.00 0.00 ? 74  TRP A O    7  
ATOM 10548 C CB   . TRP A 1 74  ? 0.157   -3.652  -3.783  1.00 0.00 ? 74  TRP A CB   7  
ATOM 10549 C CG   . TRP A 1 74  ? 0.052   -3.467  -2.300  1.00 0.00 ? 74  TRP A CG   7  
ATOM 10550 C CD1  . TRP A 1 74  ? -1.086  -3.509  -1.547  1.00 0.00 ? 74  TRP A CD1  7  
ATOM 10551 C CD2  . TRP A 1 74  ? 1.127   -3.208  -1.390  1.00 0.00 ? 74  TRP A CD2  7  
ATOM 10552 N NE1  . TRP A 1 74  ? -0.784  -3.292  -0.224  1.00 0.00 ? 74  TRP A NE1  7  
ATOM 10553 C CE2  . TRP A 1 74  ? 0.568   -3.106  -0.102  1.00 0.00 ? 74  TRP A CE2  7  
ATOM 10554 C CE3  . TRP A 1 74  ? 2.509   -3.056  -1.539  1.00 0.00 ? 74  TRP A CE3  7  
ATOM 10555 C CZ2  . TRP A 1 74  ? 1.342   -2.857  1.028   1.00 0.00 ? 74  TRP A CZ2  7  
ATOM 10556 C CZ3  . TRP A 1 74  ? 3.276   -2.808  -0.416  1.00 0.00 ? 74  TRP A CZ3  7  
ATOM 10557 C CH2  . TRP A 1 74  ? 2.692   -2.711  0.854   1.00 0.00 ? 74  TRP A CH2  7  
ATOM 10558 H H    . TRP A 1 74  ? 0.056   -3.515  -6.313  1.00 0.00 ? 74  TRP A H    7  
ATOM 10559 H HA   . TRP A 1 74  ? -0.718  -1.771  -4.309  1.00 0.00 ? 74  TRP A HA   7  
ATOM 10560 H HB2  . TRP A 1 74  ? -0.686  -4.244  -4.105  1.00 0.00 ? 74  TRP A HB2  7  
ATOM 10561 H HB3  . TRP A 1 74  ? 1.071   -4.191  -3.989  1.00 0.00 ? 74  TRP A HB3  7  
ATOM 10562 H HD1  . TRP A 1 74  ? -2.073  -3.686  -1.946  1.00 0.00 ? 74  TRP A HD1  7  
ATOM 10563 H HE1  . TRP A 1 74  ? -1.431  -3.276  0.512   1.00 0.00 ? 74  TRP A HE1  7  
ATOM 10564 H HE3  . TRP A 1 74  ? 2.977   -3.127  -2.509  1.00 0.00 ? 74  TRP A HE3  7  
ATOM 10565 H HZ2  . TRP A 1 74  ? 0.907   -2.780  2.014   1.00 0.00 ? 74  TRP A HZ2  7  
ATOM 10566 H HZ3  . TRP A 1 74  ? 4.345   -2.686  -0.512  1.00 0.00 ? 74  TRP A HZ3  7  
ATOM 10567 H HH2  . TRP A 1 74  ? 3.329   -2.517  1.702   1.00 0.00 ? 74  TRP A HH2  7  
ATOM 10568 N N    . PHE A 1 75  ? 2.563   -1.951  -4.640  1.00 0.00 ? 75  PHE A N    7  
ATOM 10569 C CA   . PHE A 1 75  ? 3.811   -1.257  -4.343  1.00 0.00 ? 75  PHE A CA   7  
ATOM 10570 C C    . PHE A 1 75  ? 3.818   0.138   -4.961  1.00 0.00 ? 75  PHE A C    7  
ATOM 10571 O O    . PHE A 1 75  ? 4.313   1.091   -4.361  1.00 0.00 ? 75  PHE A O    7  
ATOM 10572 C CB   . PHE A 1 75  ? 5.003   -2.064  -4.864  1.00 0.00 ? 75  PHE A CB   7  
ATOM 10573 C CG   . PHE A 1 75  ? 5.545   -3.045  -3.864  1.00 0.00 ? 75  PHE A CG   7  
ATOM 10574 C CD1  . PHE A 1 75  ? 4.830   -4.186  -3.536  1.00 0.00 ? 75  PHE A CD1  7  
ATOM 10575 C CD2  . PHE A 1 75  ? 6.769   -2.827  -3.254  1.00 0.00 ? 75  PHE A CD2  7  
ATOM 10576 C CE1  . PHE A 1 75  ? 5.326   -5.090  -2.616  1.00 0.00 ? 75  PHE A CE1  7  
ATOM 10577 C CE2  . PHE A 1 75  ? 7.271   -3.728  -2.333  1.00 0.00 ? 75  PHE A CE2  7  
ATOM 10578 C CZ   . PHE A 1 75  ? 6.549   -4.862  -2.015  1.00 0.00 ? 75  PHE A CZ   7  
ATOM 10579 H H    . PHE A 1 75  ? 2.584   -2.758  -5.195  1.00 0.00 ? 75  PHE A H    7  
ATOM 10580 H HA   . PHE A 1 75  ? 3.891   -1.164  -3.271  1.00 0.00 ? 75  PHE A HA   7  
ATOM 10581 H HB2  . PHE A 1 75  ? 4.699   -2.617  -5.740  1.00 0.00 ? 75  PHE A HB2  7  
ATOM 10582 H HB3  . PHE A 1 75  ? 5.799   -1.385  -5.130  1.00 0.00 ? 75  PHE A HB3  7  
ATOM 10583 H HD1  . PHE A 1 75  ? 3.875   -4.366  -4.006  1.00 0.00 ? 75  PHE A HD1  7  
ATOM 10584 H HD2  . PHE A 1 75  ? 7.336   -1.940  -3.502  1.00 0.00 ? 75  PHE A HD2  7  
ATOM 10585 H HE1  . PHE A 1 75  ? 4.760   -5.975  -2.369  1.00 0.00 ? 75  PHE A HE1  7  
ATOM 10586 H HE2  . PHE A 1 75  ? 8.227   -3.546  -1.865  1.00 0.00 ? 75  PHE A HE2  7  
ATOM 10587 H HZ   . PHE A 1 75  ? 6.938   -5.566  -1.295  1.00 0.00 ? 75  PHE A HZ   7  
ATOM 10588 N N    . ALA A 1 76  ? 3.266   0.249   -6.164  1.00 0.00 ? 76  ALA A N    7  
ATOM 10589 C CA   . ALA A 1 76  ? 3.206   1.527   -6.863  1.00 0.00 ? 76  ALA A CA   7  
ATOM 10590 C C    . ALA A 1 76  ? 2.462   2.570   -6.037  1.00 0.00 ? 76  ALA A C    7  
ATOM 10591 O O    . ALA A 1 76  ? 2.914   3.706   -5.902  1.00 0.00 ? 76  ALA A O    7  
ATOM 10592 C CB   . ALA A 1 76  ? 2.544   1.355   -8.222  1.00 0.00 ? 76  ALA A CB   7  
ATOM 10593 H H    . ALA A 1 76  ? 2.887   -0.548  -6.592  1.00 0.00 ? 76  ALA A H    7  
ATOM 10594 H HA   . ALA A 1 76  ? 4.220   1.866   -7.025  1.00 0.00 ? 76  ALA A HA   7  
ATOM 10595 H HB1  . ALA A 1 76  ? 3.152   1.825   -8.981  1.00 0.00 ? 76  ALA A HB1  7  
ATOM 10596 H HB2  . ALA A 1 76  ? 2.442   0.303   -8.442  1.00 0.00 ? 76  ALA A HB2  7  
ATOM 10597 H HB3  . ALA A 1 76  ? 1.567   1.816   -8.207  1.00 0.00 ? 76  ALA A HB3  7  
ATOM 10598 N N    . ASN A 1 77  ? 1.317   2.177   -5.488  1.00 0.00 ? 77  ASN A N    7  
ATOM 10599 C CA   . ASN A 1 77  ? 0.509   3.079   -4.676  1.00 0.00 ? 77  ASN A CA   7  
ATOM 10600 C C    . ASN A 1 77  ? 1.252   3.480   -3.405  1.00 0.00 ? 77  ASN A C    7  
ATOM 10601 O O    . ASN A 1 77  ? 1.106   4.601   -2.916  1.00 0.00 ? 77  ASN A O    7  
ATOM 10602 C CB   . ASN A 1 77  ? -0.823  2.419   -4.315  1.00 0.00 ? 77  ASN A CB   7  
ATOM 10603 C CG   . ASN A 1 77  ? -1.916  3.434   -4.041  1.00 0.00 ? 77  ASN A CG   7  
ATOM 10604 O OD1  . ASN A 1 77  ? -2.196  3.767   -2.890  1.00 0.00 ? 77  ASN A OD1  7  
ATOM 10605 N ND2  . ASN A 1 77  ? -2.540  3.932   -5.103  1.00 0.00 ? 77  ASN A ND2  7  
ATOM 10606 H H    . ASN A 1 77  ? 1.008   1.258   -5.632  1.00 0.00 ? 77  ASN A H    7  
ATOM 10607 H HA   . ASN A 1 77  ? 0.314   3.966   -5.260  1.00 0.00 ? 77  ASN A HA   7  
ATOM 10608 H HB2  . ASN A 1 77  ? -1.140  1.790   -5.134  1.00 0.00 ? 77  ASN A HB2  7  
ATOM 10609 H HB3  . ASN A 1 77  ? -0.690  1.813   -3.431  1.00 0.00 ? 77  ASN A HB3  7  
ATOM 10610 H HD21 . ASN A 1 77  ? -2.264  3.620   -5.990  1.00 0.00 ? 77  ASN A HD21 7  
ATOM 10611 H HD22 . ASN A 1 77  ? -3.250  4.590   -4.955  1.00 0.00 ? 77  ASN A HD22 7  
ATOM 10612 N N    . ARG A 1 78  ? 2.050   2.558   -2.877  1.00 0.00 ? 78  ARG A N    7  
ATOM 10613 C CA   . ARG A 1 78  ? 2.815   2.815   -1.663  1.00 0.00 ? 78  ARG A CA   7  
ATOM 10614 C C    . ARG A 1 78  ? 3.913   3.844   -1.920  1.00 0.00 ? 78  ARG A C    7  
ATOM 10615 O O    . ARG A 1 78  ? 4.353   4.538   -1.003  1.00 0.00 ? 78  ARG A O    7  
ATOM 10616 C CB   . ARG A 1 78  ? 3.431   1.516   -1.138  1.00 0.00 ? 78  ARG A CB   7  
ATOM 10617 C CG   . ARG A 1 78  ? 2.404   0.446   -0.807  1.00 0.00 ? 78  ARG A CG   7  
ATOM 10618 C CD   . ARG A 1 78  ? 1.865   0.610   0.605   1.00 0.00 ? 78  ARG A CD   7  
ATOM 10619 N NE   . ARG A 1 78  ? 0.854   1.661   0.687   1.00 0.00 ? 78  ARG A NE   7  
ATOM 10620 C CZ   . ARG A 1 78  ? -0.329  1.591   0.088   1.00 0.00 ? 78  ARG A CZ   7  
ATOM 10621 N NH1  . ARG A 1 78  ? -0.650  0.524   -0.631  1.00 0.00 ? 78  ARG A NH1  7  
ATOM 10622 N NH2  . ARG A 1 78  ? -1.196  2.589   0.209   1.00 0.00 ? 78  ARG A NH2  7  
ATOM 10623 H H    . ARG A 1 78  ? 2.125   1.683   -3.313  1.00 0.00 ? 78  ARG A H    7  
ATOM 10624 H HA   . ARG A 1 78  ? 2.137   3.207   -0.920  1.00 0.00 ? 78  ARG A HA   7  
ATOM 10625 H HB2  . ARG A 1 78  ? 4.101   1.121   -1.887  1.00 0.00 ? 78  ARG A HB2  7  
ATOM 10626 H HB3  . ARG A 1 78  ? 3.993   1.735   -0.243  1.00 0.00 ? 78  ARG A HB3  7  
ATOM 10627 H HG2  . ARG A 1 78  ? 1.583   0.519   -1.505  1.00 0.00 ? 78  ARG A HG2  7  
ATOM 10628 H HG3  . ARG A 1 78  ? 2.869   -0.525  -0.895  1.00 0.00 ? 78  ARG A HG3  7  
ATOM 10629 H HD2  . ARG A 1 78  ? 1.424   -0.325  0.919   1.00 0.00 ? 78  ARG A HD2  7  
ATOM 10630 H HD3  . ARG A 1 78  ? 2.684   0.859   1.263   1.00 0.00 ? 78  ARG A HD3  7  
ATOM 10631 H HE   . ARG A 1 78  ? 1.070   2.458   1.213   1.00 0.00 ? 78  ARG A HE   7  
ATOM 10632 H HH11 . ARG A 1 78  ? 0.001   -0.229  -0.723  1.00 0.00 ? 78  ARG A HH11 7  
ATOM 10633 H HH12 . ARG A 1 78  ? -1.542  0.473   -1.080  1.00 0.00 ? 78  ARG A HH12 7  
ATOM 10634 H HH21 . ARG A 1 78  ? -0.958  3.394   0.751   1.00 0.00 ? 78  ARG A HH21 7  
ATOM 10635 H HH22 . ARG A 1 78  ? -2.086  2.535   -0.242  1.00 0.00 ? 78  ARG A HH22 7  
ATOM 10636 N N    . ARG A 1 79  ? 4.350   3.934   -3.171  1.00 0.00 ? 79  ARG A N    7  
ATOM 10637 C CA   . ARG A 1 79  ? 5.397   4.876   -3.548  1.00 0.00 ? 79  ARG A CA   7  
ATOM 10638 C C    . ARG A 1 79  ? 4.796   6.185   -4.051  1.00 0.00 ? 79  ARG A C    7  
ATOM 10639 O O    . ARG A 1 79  ? 5.421   7.242   -3.966  1.00 0.00 ? 79  ARG A O    7  
ATOM 10640 C CB   . ARG A 1 79  ? 6.296   4.268   -4.626  1.00 0.00 ? 79  ARG A CB   7  
ATOM 10641 C CG   . ARG A 1 79  ? 7.425   3.416   -4.069  1.00 0.00 ? 79  ARG A CG   7  
ATOM 10642 C CD   . ARG A 1 79  ? 8.308   2.867   -5.178  1.00 0.00 ? 79  ARG A CD   7  
ATOM 10643 N NE   . ARG A 1 79  ? 9.373   3.798   -5.541  1.00 0.00 ? 79  ARG A NE   7  
ATOM 10644 C CZ   . ARG A 1 79  ? 9.229   4.765   -6.440  1.00 0.00 ? 79  ARG A CZ   7  
ATOM 10645 N NH1  . ARG A 1 79  ? 8.070   4.927   -7.064  1.00 0.00 ? 79  ARG A NH1  7  
ATOM 10646 N NH2  . ARG A 1 79  ? 10.245  5.573   -6.717  1.00 0.00 ? 79  ARG A NH2  7  
ATOM 10647 H H    . ARG A 1 79  ? 3.960   3.354   -3.858  1.00 0.00 ? 79  ARG A H    7  
ATOM 10648 H HA   . ARG A 1 79  ? 5.991   5.081   -2.670  1.00 0.00 ? 79  ARG A HA   7  
ATOM 10649 H HB2  . ARG A 1 79  ? 5.693   3.648   -5.274  1.00 0.00 ? 79  ARG A HB2  7  
ATOM 10650 H HB3  . ARG A 1 79  ? 6.731   5.067   -5.208  1.00 0.00 ? 79  ARG A HB3  7  
ATOM 10651 H HG2  . ARG A 1 79  ? 8.029   4.022   -3.409  1.00 0.00 ? 79  ARG A HG2  7  
ATOM 10652 H HG3  . ARG A 1 79  ? 7.001   2.591   -3.516  1.00 0.00 ? 79  ARG A HG3  7  
ATOM 10653 H HD2  . ARG A 1 79  ? 8.752   1.941   -4.842  1.00 0.00 ? 79  ARG A HD2  7  
ATOM 10654 H HD3  . ARG A 1 79  ? 7.696   2.678   -6.047  1.00 0.00 ? 79  ARG A HD3  7  
ATOM 10655 H HE   . ARG A 1 79  ? 10.238  3.696   -5.092  1.00 0.00 ? 79  ARG A HE   7  
ATOM 10656 H HH11 . ARG A 1 79  ? 7.303   4.321   -6.857  1.00 0.00 ? 79  ARG A HH11 7  
ATOM 10657 H HH12 . ARG A 1 79  ? 7.964   5.657   -7.740  1.00 0.00 ? 79  ARG A HH12 7  
ATOM 10658 H HH21 . ARG A 1 79  ? 11.120  5.453   -6.248  1.00 0.00 ? 79  ARG A HH21 7  
ATOM 10659 H HH22 . ARG A 1 79  ? 10.135  6.300   -7.393  1.00 0.00 ? 79  ARG A HH22 7  
ATOM 10660 N N    . LYS A 1 80  ? 3.578   6.107   -4.578  1.00 0.00 ? 80  LYS A N    7  
ATOM 10661 C CA   . LYS A 1 80  ? 2.890   7.284   -5.095  1.00 0.00 ? 80  LYS A CA   7  
ATOM 10662 C C    . LYS A 1 80  ? 2.332   8.131   -3.956  1.00 0.00 ? 80  LYS A C    7  
ATOM 10663 O O    . LYS A 1 80  ? 2.241   9.353   -4.067  1.00 0.00 ? 80  LYS A O    7  
ATOM 10664 C CB   . LYS A 1 80  ? 1.758   6.866   -6.036  1.00 0.00 ? 80  LYS A CB   7  
ATOM 10665 C CG   . LYS A 1 80  ? 2.227   6.540   -7.444  1.00 0.00 ? 80  LYS A CG   7  
ATOM 10666 C CD   . LYS A 1 80  ? 1.075   6.086   -8.324  1.00 0.00 ? 80  LYS A CD   7  
ATOM 10667 C CE   . LYS A 1 80  ? 0.255   7.267   -8.821  1.00 0.00 ? 80  LYS A CE   7  
ATOM 10668 N NZ   . LYS A 1 80  ? -0.637  6.886   -9.951  1.00 0.00 ? 80  LYS A NZ   7  
ATOM 10669 H H    . LYS A 1 80  ? 3.130   5.235   -4.618  1.00 0.00 ? 80  LYS A H    7  
ATOM 10670 H HA   . LYS A 1 80  ? 3.608   7.872   -5.647  1.00 0.00 ? 80  LYS A HA   7  
ATOM 10671 H HB2  . LYS A 1 80  ? 1.272   5.992   -5.630  1.00 0.00 ? 80  LYS A HB2  7  
ATOM 10672 H HB3  . LYS A 1 80  ? 1.040   7.671   -6.096  1.00 0.00 ? 80  LYS A HB3  7  
ATOM 10673 H HG2  . LYS A 1 80  ? 2.673   7.422   -7.879  1.00 0.00 ? 80  LYS A HG2  7  
ATOM 10674 H HG3  . LYS A 1 80  ? 2.963   5.750   -7.394  1.00 0.00 ? 80  LYS A HG3  7  
ATOM 10675 H HD2  . LYS A 1 80  ? 1.472   5.554   -9.176  1.00 0.00 ? 80  LYS A HD2  7  
ATOM 10676 H HD3  . LYS A 1 80  ? 0.435   5.429   -7.753  1.00 0.00 ? 80  LYS A HD3  7  
ATOM 10677 H HE2  . LYS A 1 80  ? -0.348  7.637   -8.007  1.00 0.00 ? 80  LYS A HE2  7  
ATOM 10678 H HE3  . LYS A 1 80  ? 0.929   8.043   -9.152  1.00 0.00 ? 80  LYS A HE3  7  
ATOM 10679 H HZ1  . LYS A 1 80  ? -0.845  5.867   -9.914  1.00 0.00 ? 80  LYS A HZ1  7  
ATOM 10680 H HZ2  . LYS A 1 80  ? -0.177  7.101   -10.858 1.00 0.00 ? 80  LYS A HZ2  7  
ATOM 10681 H HZ3  . LYS A 1 80  ? -1.531  7.414   -9.895  1.00 0.00 ? 80  LYS A HZ3  7  
ATOM 10682 N N    . GLU A 1 81  ? 1.960   7.474   -2.862  1.00 0.00 ? 81  GLU A N    7  
ATOM 10683 C CA   . GLU A 1 81  ? 1.411   8.169   -1.704  1.00 0.00 ? 81  GLU A CA   7  
ATOM 10684 C C    . GLU A 1 81  ? 2.506   8.915   -0.948  1.00 0.00 ? 81  GLU A C    7  
ATOM 10685 O O    . GLU A 1 81  ? 2.364   10.097  -0.636  1.00 0.00 ? 81  GLU A O    7  
ATOM 10686 C CB   . GLU A 1 81  ? 0.715   7.177   -0.768  1.00 0.00 ? 81  GLU A CB   7  
ATOM 10687 C CG   . GLU A 1 81  ? 1.675   6.252   -0.040  1.00 0.00 ? 81  GLU A CG   7  
ATOM 10688 C CD   . GLU A 1 81  ? 0.959   5.214   0.802   1.00 0.00 ? 81  GLU A CD   7  
ATOM 10689 O OE1  . GLU A 1 81  ? -0.277  5.095   0.673   1.00 0.00 ? 81  GLU A OE1  7  
ATOM 10690 O OE2  . GLU A 1 81  ? 1.636   4.521   1.590   1.00 0.00 ? 81  GLU A OE2  7  
ATOM 10691 H H    . GLU A 1 81  ? 2.056   6.499   -2.834  1.00 0.00 ? 81  GLU A H    7  
ATOM 10692 H HA   . GLU A 1 81  ? 0.684   8.884   -2.059  1.00 0.00 ? 81  GLU A HA   7  
ATOM 10693 H HB2  . GLU A 1 81  ? 0.151   7.730   -0.032  1.00 0.00 ? 81  GLU A HB2  7  
ATOM 10694 H HB3  . GLU A 1 81  ? 0.035   6.571   -1.348  1.00 0.00 ? 81  GLU A HB3  7  
ATOM 10695 H HG2  . GLU A 1 81  ? 2.287   5.742   -0.769  1.00 0.00 ? 81  GLU A HG2  7  
ATOM 10696 H HG3  . GLU A 1 81  ? 2.306   6.845   0.606   1.00 0.00 ? 81  GLU A HG3  7  
ATOM 10697 N N    . GLU A 1 82  ? 3.598   8.215   -0.656  1.00 0.00 ? 82  GLU A N    7  
ATOM 10698 C CA   . GLU A 1 82  ? 4.717   8.811   0.065   1.00 0.00 ? 82  GLU A CA   7  
ATOM 10699 C C    . GLU A 1 82  ? 5.215   10.066  -0.646  1.00 0.00 ? 82  GLU A C    7  
ATOM 10700 O O    . GLU A 1 82  ? 5.504   11.080  -0.010  1.00 0.00 ? 82  GLU A O    7  
ATOM 10701 C CB   . GLU A 1 82  ? 5.859   7.803   0.203   1.00 0.00 ? 82  GLU A CB   7  
ATOM 10702 C CG   . GLU A 1 82  ? 6.489   7.412   -1.123  1.00 0.00 ? 82  GLU A CG   7  
ATOM 10703 C CD   . GLU A 1 82  ? 7.648   6.447   -0.956  1.00 0.00 ? 82  GLU A CD   7  
ATOM 10704 O OE1  . GLU A 1 82  ? 8.792   6.918   -0.789  1.00 0.00 ? 82  GLU A OE1  7  
ATOM 10705 O OE2  . GLU A 1 82  ? 7.409   5.222   -0.993  1.00 0.00 ? 82  GLU A OE2  7  
ATOM 10706 H H    . GLU A 1 82  ? 3.652   7.276   -0.931  1.00 0.00 ? 82  GLU A H    7  
ATOM 10707 H HA   . GLU A 1 82  ? 4.369   9.084   1.050   1.00 0.00 ? 82  GLU A HA   7  
ATOM 10708 H HB2  . GLU A 1 82  ? 6.626   8.230   0.832   1.00 0.00 ? 82  GLU A HB2  7  
ATOM 10709 H HB3  . GLU A 1 82  ? 5.478   6.908   0.674   1.00 0.00 ? 82  GLU A HB3  7  
ATOM 10710 H HG2  . GLU A 1 82  ? 5.737   6.943   -1.740  1.00 0.00 ? 82  GLU A HG2  7  
ATOM 10711 H HG3  . GLU A 1 82  ? 6.850   8.304   -1.612  1.00 0.00 ? 82  GLU A HG3  7  
ATOM 10712 N N    . ALA A 1 83  ? 5.314   9.990   -1.969  1.00 0.00 ? 83  ALA A N    7  
ATOM 10713 C CA   . ALA A 1 83  ? 5.776   11.119  -2.767  1.00 0.00 ? 83  ALA A CA   7  
ATOM 10714 C C    . ALA A 1 83  ? 4.675   12.160  -2.934  1.00 0.00 ? 83  ALA A C    7  
ATOM 10715 O O    . ALA A 1 83  ? 4.943   13.314  -3.268  1.00 0.00 ? 83  ALA A O    7  
ATOM 10716 C CB   . ALA A 1 83  ? 6.263   10.640  -4.127  1.00 0.00 ? 83  ALA A CB   7  
ATOM 10717 H H    . ALA A 1 83  ? 5.069   9.155   -2.419  1.00 0.00 ? 83  ALA A H    7  
ATOM 10718 H HA   . ALA A 1 83  ? 6.611   11.572  -2.252  1.00 0.00 ? 83  ALA A HA   7  
ATOM 10719 H HB1  . ALA A 1 83  ? 6.292   9.560   -4.138  1.00 0.00 ? 83  ALA A HB1  7  
ATOM 10720 H HB2  . ALA A 1 83  ? 5.588   10.990  -4.894  1.00 0.00 ? 83  ALA A HB2  7  
ATOM 10721 H HB3  . ALA A 1 83  ? 7.253   11.029  -4.312  1.00 0.00 ? 83  ALA A HB3  7  
ATOM 10722 N N    . PHE A 1 84  ? 3.434   11.746  -2.699  1.00 0.00 ? 84  PHE A N    7  
ATOM 10723 C CA   . PHE A 1 84  ? 2.291   12.643  -2.825  1.00 0.00 ? 84  PHE A CA   7  
ATOM 10724 C C    . PHE A 1 84  ? 2.491   13.900  -1.983  1.00 0.00 ? 84  PHE A C    7  
ATOM 10725 O O    . PHE A 1 84  ? 2.599   15.005  -2.515  1.00 0.00 ? 84  PHE A O    7  
ATOM 10726 C CB   . PHE A 1 84  ? 1.006   11.929  -2.399  1.00 0.00 ? 84  PHE A CB   7  
ATOM 10727 C CG   . PHE A 1 84  ? -0.244  12.621  -2.861  1.00 0.00 ? 84  PHE A CG   7  
ATOM 10728 C CD1  . PHE A 1 84  ? -0.525  13.916  -2.456  1.00 0.00 ? 84  PHE A CD1  7  
ATOM 10729 C CD2  . PHE A 1 84  ? -1.139  11.977  -3.700  1.00 0.00 ? 84  PHE A CD2  7  
ATOM 10730 C CE1  . PHE A 1 84  ? -1.676  14.555  -2.879  1.00 0.00 ? 84  PHE A CE1  7  
ATOM 10731 C CE2  . PHE A 1 84  ? -2.291  12.610  -4.126  1.00 0.00 ? 84  PHE A CE2  7  
ATOM 10732 C CZ   . PHE A 1 84  ? -2.559  13.901  -3.715  1.00 0.00 ? 84  PHE A CZ   7  
ATOM 10733 H H    . PHE A 1 84  ? 3.284   10.813  -2.435  1.00 0.00 ? 84  PHE A H    7  
ATOM 10734 H HA   . PHE A 1 84  ? 2.208   12.928  -3.862  1.00 0.00 ? 84  PHE A HA   7  
ATOM 10735 H HB2  . PHE A 1 84  ? 1.004   10.931  -2.811  1.00 0.00 ? 84  PHE A HB2  7  
ATOM 10736 H HB3  . PHE A 1 84  ? 0.976   11.870  -1.322  1.00 0.00 ? 84  PHE A HB3  7  
ATOM 10737 H HD1  . PHE A 1 84  ? 0.166   14.429  -1.803  1.00 0.00 ? 84  PHE A HD1  7  
ATOM 10738 H HD2  . PHE A 1 84  ? -0.930  10.966  -4.022  1.00 0.00 ? 84  PHE A HD2  7  
ATOM 10739 H HE1  . PHE A 1 84  ? -1.883  15.564  -2.557  1.00 0.00 ? 84  PHE A HE1  7  
ATOM 10740 H HE2  . PHE A 1 84  ? -2.980  12.096  -4.780  1.00 0.00 ? 84  PHE A HE2  7  
ATOM 10741 H HZ   . PHE A 1 84  ? -3.459  14.398  -4.047  1.00 0.00 ? 84  PHE A HZ   7  
ATOM 10742 N N    . ARG A 1 85  ? 2.539   13.722  -0.667  1.00 0.00 ? 85  ARG A N    7  
ATOM 10743 C CA   . ARG A 1 85  ? 2.724   14.841  0.249   1.00 0.00 ? 85  ARG A CA   7  
ATOM 10744 C C    . ARG A 1 85  ? 3.788   15.802  -0.274  1.00 0.00 ? 85  ARG A C    7  
ATOM 10745 O O    . ARG A 1 85  ? 3.803   16.979  0.083   1.00 0.00 ? 85  ARG A O    7  
ATOM 10746 C CB   . ARG A 1 85  ? 3.120   14.332  1.636   1.00 0.00 ? 85  ARG A CB   7  
ATOM 10747 C CG   . ARG A 1 85  ? 1.933   14.030  2.536   1.00 0.00 ? 85  ARG A CG   7  
ATOM 10748 C CD   . ARG A 1 85  ? 2.365   13.828  3.980   1.00 0.00 ? 85  ARG A CD   7  
ATOM 10749 N NE   . ARG A 1 85  ? 2.380   15.082  4.728   1.00 0.00 ? 85  ARG A NE   7  
ATOM 10750 C CZ   . ARG A 1 85  ? 2.797   15.183  5.985   1.00 0.00 ? 85  ARG A CZ   7  
ATOM 10751 N NH1  . ARG A 1 85  ? 3.231   14.110  6.631   1.00 0.00 ? 85  ARG A NH1  7  
ATOM 10752 N NH2  . ARG A 1 85  ? 2.781   16.360  6.598   1.00 0.00 ? 85  ARG A NH2  7  
ATOM 10753 H H    . ARG A 1 85  ? 2.447   12.816  -0.303  1.00 0.00 ? 85  ARG A H    7  
ATOM 10754 H HA   . ARG A 1 85  ? 1.785   15.368  0.323   1.00 0.00 ? 85  ARG A HA   7  
ATOM 10755 H HB2  . ARG A 1 85  ? 3.697   13.425  1.524   1.00 0.00 ? 85  ARG A HB2  7  
ATOM 10756 H HB3  . ARG A 1 85  ? 3.730   15.079  2.120   1.00 0.00 ? 85  ARG A HB3  7  
ATOM 10757 H HG2  . ARG A 1 85  ? 1.240   14.858  2.492   1.00 0.00 ? 85  ARG A HG2  7  
ATOM 10758 H HG3  . ARG A 1 85  ? 1.446   13.132  2.186   1.00 0.00 ? 85  ARG A HG3  7  
ATOM 10759 H HD2  . ARG A 1 85  ? 1.677   13.145  4.455   1.00 0.00 ? 85  ARG A HD2  7  
ATOM 10760 H HD3  . ARG A 1 85  ? 3.357   13.402  3.988   1.00 0.00 ? 85  ARG A HD3  7  
ATOM 10761 H HE   . ARG A 1 85  ? 2.064   15.888  4.269   1.00 0.00 ? 85  ARG A HE   7  
ATOM 10762 H HH11 . ARG A 1 85  ? 3.245   13.222  6.172   1.00 0.00 ? 85  ARG A HH11 7  
ATOM 10763 H HH12 . ARG A 1 85  ? 3.545   14.189  7.578   1.00 0.00 ? 85  ARG A HH12 7  
ATOM 10764 H HH21 . ARG A 1 85  ? 2.455   17.171  6.114   1.00 0.00 ? 85  ARG A HH21 7  
ATOM 10765 H HH22 . ARG A 1 85  ? 3.095   16.435  7.544   1.00 0.00 ? 85  ARG A HH22 7  
ATOM 10766 N N    . GLN A 1 86  ? 4.675   15.290  -1.122  1.00 0.00 ? 86  GLN A N    7  
ATOM 10767 C CA   . GLN A 1 86  ? 5.742   16.103  -1.693  1.00 0.00 ? 86  GLN A CA   7  
ATOM 10768 C C    . GLN A 1 86  ? 5.303   16.730  -3.012  1.00 0.00 ? 86  GLN A C    7  
ATOM 10769 O O    . GLN A 1 86  ? 5.572   17.902  -3.275  1.00 0.00 ? 86  GLN A O    7  
ATOM 10770 C CB   . GLN A 1 86  ? 6.997   15.256  -1.910  1.00 0.00 ? 86  GLN A CB   7  
ATOM 10771 C CG   . GLN A 1 86  ? 7.302   14.313  -0.757  1.00 0.00 ? 86  GLN A CG   7  
ATOM 10772 C CD   . GLN A 1 86  ? 8.157   14.960  0.315   1.00 0.00 ? 86  GLN A CD   7  
ATOM 10773 O OE1  . GLN A 1 86  ? 7.684   15.802  1.079   1.00 0.00 ? 86  GLN A OE1  7  
ATOM 10774 N NE2  . GLN A 1 86  ? 9.425   14.570  0.376   1.00 0.00 ? 86  GLN A NE2  7  
ATOM 10775 H H    . GLN A 1 86  ? 4.610   14.344  -1.368  1.00 0.00 ? 86  GLN A H    7  
ATOM 10776 H HA   . GLN A 1 86  ? 5.969   16.892  -0.991  1.00 0.00 ? 86  GLN A HA   7  
ATOM 10777 H HB2  . GLN A 1 86  ? 6.867   14.665  -2.805  1.00 0.00 ? 86  GLN A HB2  7  
ATOM 10778 H HB3  . GLN A 1 86  ? 7.843   15.914  -2.042  1.00 0.00 ? 86  GLN A HB3  7  
ATOM 10779 H HG2  . GLN A 1 86  ? 6.371   13.998  -0.310  1.00 0.00 ? 86  GLN A HG2  7  
ATOM 10780 H HG3  . GLN A 1 86  ? 7.825   13.451  -1.142  1.00 0.00 ? 86  GLN A HG3  7  
ATOM 10781 H HE21 . GLN A 1 86  ? 9.733   13.896  -0.267  1.00 0.00 ? 86  GLN A HE21 7  
ATOM 10782 H HE22 . GLN A 1 86  ? 10.001  14.972  1.058   1.00 0.00 ? 86  GLN A HE22 7  
ATOM 10783 N N    . LYS A 1 87  ? 4.624   15.942  -3.839  1.00 0.00 ? 87  LYS A N    7  
ATOM 10784 C CA   . LYS A 1 87  ? 4.146   16.418  -5.131  1.00 0.00 ? 87  LYS A CA   7  
ATOM 10785 C C    . LYS A 1 87  ? 3.165   17.574  -4.955  1.00 0.00 ? 87  LYS A C    7  
ATOM 10786 O O    . LYS A 1 87  ? 3.213   18.560  -5.692  1.00 0.00 ? 87  LYS A O    7  
ATOM 10787 C CB   . LYS A 1 87  ? 3.475   15.279  -5.902  1.00 0.00 ? 87  LYS A CB   7  
ATOM 10788 C CG   . LYS A 1 87  ? 2.690   15.745  -7.115  1.00 0.00 ? 87  LYS A CG   7  
ATOM 10789 C CD   . LYS A 1 87  ? 1.245   16.050  -6.761  1.00 0.00 ? 87  LYS A CD   7  
ATOM 10790 C CE   . LYS A 1 87  ? 0.424   14.777  -6.620  1.00 0.00 ? 87  LYS A CE   7  
ATOM 10791 N NZ   . LYS A 1 87  ? -0.998  15.068  -6.290  1.00 0.00 ? 87  LYS A NZ   7  
ATOM 10792 H H    . LYS A 1 87  ? 4.440   15.016  -3.572  1.00 0.00 ? 87  LYS A H    7  
ATOM 10793 H HA   . LYS A 1 87  ? 4.999   16.768  -5.692  1.00 0.00 ? 87  LYS A HA   7  
ATOM 10794 H HB2  . LYS A 1 87  ? 4.236   14.589  -6.234  1.00 0.00 ? 87  LYS A HB2  7  
ATOM 10795 H HB3  . LYS A 1 87  ? 2.798   14.761  -5.238  1.00 0.00 ? 87  LYS A HB3  7  
ATOM 10796 H HG2  . LYS A 1 87  ? 3.150   16.640  -7.508  1.00 0.00 ? 87  LYS A HG2  7  
ATOM 10797 H HG3  . LYS A 1 87  ? 2.711   14.968  -7.866  1.00 0.00 ? 87  LYS A HG3  7  
ATOM 10798 H HD2  . LYS A 1 87  ? 1.218   16.588  -5.825  1.00 0.00 ? 87  LYS A HD2  7  
ATOM 10799 H HD3  . LYS A 1 87  ? 0.813   16.662  -7.541  1.00 0.00 ? 87  LYS A HD3  7  
ATOM 10800 H HE2  . LYS A 1 87  ? 0.465   14.233  -7.551  1.00 0.00 ? 87  LYS A HE2  7  
ATOM 10801 H HE3  . LYS A 1 87  ? 0.852   14.175  -5.832  1.00 0.00 ? 87  LYS A HE3  7  
ATOM 10802 H HZ1  . LYS A 1 87  ? -1.348  15.853  -6.876  1.00 0.00 ? 87  LYS A HZ1  7  
ATOM 10803 H HZ2  . LYS A 1 87  ? -1.086  15.333  -5.288  1.00 0.00 ? 87  LYS A HZ2  7  
ATOM 10804 H HZ3  . LYS A 1 87  ? -1.585  14.228  -6.468  1.00 0.00 ? 87  LYS A HZ3  7  
ATOM 10805 N N    . LEU A 1 88  ? 2.277   17.446  -3.975  1.00 0.00 ? 88  LEU A N    7  
ATOM 10806 C CA   . LEU A 1 88  ? 1.286   18.481  -3.702  1.00 0.00 ? 88  LEU A CA   7  
ATOM 10807 C C    . LEU A 1 88  ? 1.948   19.735  -3.141  1.00 0.00 ? 88  LEU A C    7  
ATOM 10808 O O    . LEU A 1 88  ? 1.282   20.736  -2.879  1.00 0.00 ? 88  LEU A O    7  
ATOM 10809 C CB   . LEU A 1 88  ? 0.236   17.961  -2.719  1.00 0.00 ? 88  LEU A CB   7  
ATOM 10810 C CG   . LEU A 1 88  ? 0.767   17.441  -1.383  1.00 0.00 ? 88  LEU A CG   7  
ATOM 10811 C CD1  . LEU A 1 88  ? 1.514   18.538  -0.641  1.00 0.00 ? 88  LEU A CD1  7  
ATOM 10812 C CD2  . LEU A 1 88  ? -0.372  16.899  -0.531  1.00 0.00 ? 88  LEU A CD2  7  
ATOM 10813 H H    . LEU A 1 88  ? 2.288   16.638  -3.422  1.00 0.00 ? 88  LEU A H    7  
ATOM 10814 H HA   . LEU A 1 88  ? 0.802   18.730  -4.635  1.00 0.00 ? 88  LEU A HA   7  
ATOM 10815 H HB2  . LEU A 1 88  ? -0.449  18.769  -2.510  1.00 0.00 ? 88  LEU A HB2  7  
ATOM 10816 H HB3  . LEU A 1 88  ? -0.298  17.155  -3.201  1.00 0.00 ? 88  LEU A HB3  7  
ATOM 10817 H HG   . LEU A 1 88  ? 1.460   16.632  -1.568  1.00 0.00 ? 88  LEU A HG   7  
ATOM 10818 H HD11 . LEU A 1 88  ? 2.504   18.645  -1.059  1.00 0.00 ? 88  LEU A HD11 7  
ATOM 10819 H HD12 . LEU A 1 88  ? 1.591   18.278  0.404   1.00 0.00 ? 88  LEU A HD12 7  
ATOM 10820 H HD13 . LEU A 1 88  ? 0.978   19.470  -0.741  1.00 0.00 ? 88  LEU A HD13 7  
ATOM 10821 H HD21 . LEU A 1 88  ? -0.216  15.846  -0.350  1.00 0.00 ? 88  LEU A HD21 7  
ATOM 10822 H HD22 . LEU A 1 88  ? -1.309  17.041  -1.050  1.00 0.00 ? 88  LEU A HD22 7  
ATOM 10823 H HD23 . LEU A 1 88  ? -0.398  17.426  0.412   1.00 0.00 ? 88  LEU A HD23 7  
ATOM 10824 N N    . ALA A 1 89  ? 3.264   19.674  -2.962  1.00 0.00 ? 89  ALA A N    7  
ATOM 10825 C CA   . ALA A 1 89  ? 4.017   20.806  -2.436  1.00 0.00 ? 89  ALA A CA   7  
ATOM 10826 C C    . ALA A 1 89  ? 4.751   21.542  -3.552  1.00 0.00 ? 89  ALA A C    7  
ATOM 10827 O O    . ALA A 1 89  ? 4.894   22.764  -3.512  1.00 0.00 ? 89  ALA A O    7  
ATOM 10828 C CB   . ALA A 1 89  ? 5.000   20.338  -1.374  1.00 0.00 ? 89  ALA A CB   7  
ATOM 10829 H H    . ALA A 1 89  ? 3.739   18.848  -3.190  1.00 0.00 ? 89  ALA A H    7  
ATOM 10830 H HA   . ALA A 1 89  ? 3.317   21.485  -1.970  1.00 0.00 ? 89  ALA A HA   7  
ATOM 10831 H HB1  . ALA A 1 89  ? 4.696   20.720  -0.410  1.00 0.00 ? 89  ALA A HB1  7  
ATOM 10832 H HB2  . ALA A 1 89  ? 5.013   19.259  -1.346  1.00 0.00 ? 89  ALA A HB2  7  
ATOM 10833 H HB3  . ALA A 1 89  ? 5.987   20.705  -1.611  1.00 0.00 ? 89  ALA A HB3  7  
ATOM 10834 N N    . MET A 1 90  ? 5.215   20.791  -4.545  1.00 0.00 ? 90  MET A N    7  
ATOM 10835 C CA   . MET A 1 90  ? 5.935   21.373  -5.671  1.00 0.00 ? 90  MET A CA   7  
ATOM 10836 C C    . MET A 1 90  ? 5.019   22.274  -6.494  1.00 0.00 ? 90  MET A C    7  
ATOM 10837 O O    . MET A 1 90  ? 5.439   23.325  -6.979  1.00 0.00 ? 90  MET A O    7  
ATOM 10838 C CB   . MET A 1 90  ? 6.515   20.270  -6.559  1.00 0.00 ? 90  MET A CB   7  
ATOM 10839 C CG   . MET A 1 90  ? 7.322   19.235  -5.792  1.00 0.00 ? 90  MET A CG   7  
ATOM 10840 S SD   . MET A 1 90  ? 7.874   17.872  -6.835  1.00 0.00 ? 90  MET A SD   7  
ATOM 10841 C CE   . MET A 1 90  ? 8.306   16.652  -5.598  1.00 0.00 ? 90  MET A CE   7  
ATOM 10842 H H    . MET A 1 90  ? 5.070   19.822  -4.520  1.00 0.00 ? 90  MET A H    7  
ATOM 10843 H HA   . MET A 1 90  ? 6.744   21.968  -5.275  1.00 0.00 ? 90  MET A HA   7  
ATOM 10844 H HB2  . MET A 1 90  ? 5.704   19.764  -7.060  1.00 0.00 ? 90  MET A HB2  7  
ATOM 10845 H HB3  . MET A 1 90  ? 7.160   20.721  -7.298  1.00 0.00 ? 90  MET A HB3  7  
ATOM 10846 H HG2  . MET A 1 90  ? 8.189   19.717  -5.366  1.00 0.00 ? 90  MET A HG2  7  
ATOM 10847 H HG3  . MET A 1 90  ? 6.708   18.837  -4.998  1.00 0.00 ? 90  MET A HG3  7  
ATOM 10848 H HE1  . MET A 1 90  ? 8.972   15.920  -6.031  1.00 0.00 ? 90  MET A HE1  7  
ATOM 10849 H HE2  . MET A 1 90  ? 8.797   17.139  -4.768  1.00 0.00 ? 90  MET A HE2  7  
ATOM 10850 H HE3  . MET A 1 90  ? 7.409   16.161  -5.248  1.00 0.00 ? 90  MET A HE3  7  
ATOM 10851 N N    . ASP A 1 91  ? 3.767   21.856  -6.647  1.00 0.00 ? 91  ASP A N    7  
ATOM 10852 C CA   . ASP A 1 91  ? 2.792   22.626  -7.410  1.00 0.00 ? 91  ASP A CA   7  
ATOM 10853 C C    . ASP A 1 91  ? 2.695   24.055  -6.884  1.00 0.00 ? 91  ASP A C    7  
ATOM 10854 O O    . ASP A 1 91  ? 3.400   24.431  -5.948  1.00 0.00 ? 91  ASP A O    7  
ATOM 10855 C CB   . ASP A 1 91  ? 1.420   21.953  -7.351  1.00 0.00 ? 91  ASP A CB   7  
ATOM 10856 C CG   . ASP A 1 91  ? 0.564   22.274  -8.561  1.00 0.00 ? 91  ASP A CG   7  
ATOM 10857 O OD1  . ASP A 1 91  ? 1.136   22.595  -9.624  1.00 0.00 ? 91  ASP A OD1  7  
ATOM 10858 O OD2  . ASP A 1 91  ? -0.677  22.205  -8.445  1.00 0.00 ? 91  ASP A OD2  7  
ATOM 10859 H H    . ASP A 1 91  ? 3.492   21.010  -6.236  1.00 0.00 ? 91  ASP A H    7  
ATOM 10860 H HA   . ASP A 1 91  ? 3.124   22.656  -8.437  1.00 0.00 ? 91  ASP A HA   7  
ATOM 10861 H HB2  . ASP A 1 91  ? 1.553   20.882  -7.302  1.00 0.00 ? 91  ASP A HB2  7  
ATOM 10862 H HB3  . ASP A 1 91  ? 0.900   22.288  -6.465  1.00 0.00 ? 91  ASP A HB3  7  
ATOM 10863 N N    . ALA A 1 92  ? 1.817   24.846  -7.492  1.00 0.00 ? 92  ALA A N    7  
ATOM 10864 C CA   . ALA A 1 92  ? 1.627   26.232  -7.084  1.00 0.00 ? 92  ALA A CA   7  
ATOM 10865 C C    . ALA A 1 92  ? 0.763   26.322  -5.831  1.00 0.00 ? 92  ALA A C    7  
ATOM 10866 O O    . ALA A 1 92  ? 0.238   25.316  -5.354  1.00 0.00 ? 92  ALA A O    7  
ATOM 10867 C CB   . ALA A 1 92  ? 1.004   27.035  -8.216  1.00 0.00 ? 92  ALA A CB   7  
ATOM 10868 H H    . ALA A 1 92  ? 1.284   24.488  -8.232  1.00 0.00 ? 92  ALA A H    7  
ATOM 10869 H HA   . ALA A 1 92  ? 2.599   26.653  -6.869  1.00 0.00 ? 92  ALA A HA   7  
ATOM 10870 H HB1  . ALA A 1 92  ? 1.737   27.185  -8.996  1.00 0.00 ? 92  ALA A HB1  7  
ATOM 10871 H HB2  . ALA A 1 92  ? 0.158   26.497  -8.616  1.00 0.00 ? 92  ALA A HB2  7  
ATOM 10872 H HB3  . ALA A 1 92  ? 0.678   27.993  -7.841  1.00 0.00 ? 92  ALA A HB3  7  
ATOM 10873 N N    . TYR A 1 93  ? 0.619   27.532  -5.303  1.00 0.00 ? 93  TYR A N    7  
ATOM 10874 C CA   . TYR A 1 93  ? -0.180  27.753  -4.103  1.00 0.00 ? 93  TYR A CA   7  
ATOM 10875 C C    . TYR A 1 93  ? 0.063   26.650  -3.077  1.00 0.00 ? 93  TYR A C    7  
ATOM 10876 O O    . TYR A 1 93  ? -0.879  26.058  -2.551  1.00 0.00 ? 93  TYR A O    7  
ATOM 10877 C CB   . TYR A 1 93  ? -1.666  27.815  -4.459  1.00 0.00 ? 93  TYR A CB   7  
ATOM 10878 C CG   . TYR A 1 93  ? -2.063  26.869  -5.570  1.00 0.00 ? 93  TYR A CG   7  
ATOM 10879 C CD1  . TYR A 1 93  ? -1.770  27.161  -6.896  1.00 0.00 ? 93  TYR A CD1  7  
ATOM 10880 C CD2  . TYR A 1 93  ? -2.731  25.683  -5.292  1.00 0.00 ? 93  TYR A CD2  7  
ATOM 10881 C CE1  . TYR A 1 93  ? -2.131  26.300  -7.914  1.00 0.00 ? 93  TYR A CE1  7  
ATOM 10882 C CE2  . TYR A 1 93  ? -3.095  24.815  -6.304  1.00 0.00 ? 93  TYR A CE2  7  
ATOM 10883 C CZ   . TYR A 1 93  ? -2.794  25.128  -7.613  1.00 0.00 ? 93  TYR A CZ   7  
ATOM 10884 O OH   . TYR A 1 93  ? -3.155  24.267  -8.623  1.00 0.00 ? 93  TYR A OH   7  
ATOM 10885 H H    . TYR A 1 93  ? 1.062   28.296  -5.729  1.00 0.00 ? 93  TYR A H    7  
ATOM 10886 H HA   . TYR A 1 93  ? 0.118   28.699  -3.675  1.00 0.00 ? 93  TYR A HA   7  
ATOM 10887 H HB2  . TYR A 1 93  ? -2.249  27.565  -3.586  1.00 0.00 ? 93  TYR A HB2  7  
ATOM 10888 H HB3  . TYR A 1 93  ? -1.911  28.819  -4.774  1.00 0.00 ? 93  TYR A HB3  7  
ATOM 10889 H HD1  . TYR A 1 93  ? -1.250  28.080  -7.128  1.00 0.00 ? 93  TYR A HD1  7  
ATOM 10890 H HD2  . TYR A 1 93  ? -2.966  25.440  -4.266  1.00 0.00 ? 93  TYR A HD2  7  
ATOM 10891 H HE1  . TYR A 1 93  ? -1.895  26.545  -8.939  1.00 0.00 ? 93  TYR A HE1  7  
ATOM 10892 H HE2  . TYR A 1 93  ? -3.614  23.897  -6.068  1.00 0.00 ? 93  TYR A HE2  7  
ATOM 10893 H HH   . TYR A 1 93  ? -3.960  23.806  -8.378  1.00 0.00 ? 93  TYR A HH   7  
ATOM 10894 N N    . SER A 1 94  ? 1.334   26.381  -2.797  1.00 0.00 ? 94  SER A N    7  
ATOM 10895 C CA   . SER A 1 94  ? 1.703   25.347  -1.836  1.00 0.00 ? 94  SER A CA   7  
ATOM 10896 C C    . SER A 1 94  ? 2.101   25.966  -0.499  1.00 0.00 ? 94  SER A C    7  
ATOM 10897 O O    . SER A 1 94  ? 2.136   27.188  -0.354  1.00 0.00 ? 94  SER A O    7  
ATOM 10898 C CB   . SER A 1 94  ? 2.854   24.501  -2.382  1.00 0.00 ? 94  SER A CB   7  
ATOM 10899 O OG   . SER A 1 94  ? 4.061   25.243  -2.417  1.00 0.00 ? 94  SER A OG   7  
ATOM 10900 H H    . SER A 1 94  ? 2.041   26.888  -3.249  1.00 0.00 ? 94  SER A H    7  
ATOM 10901 H HA   . SER A 1 94  ? 0.842   24.714  -1.684  1.00 0.00 ? 94  SER A HA   7  
ATOM 10902 H HB2  . SER A 1 94  ? 2.995   23.638  -1.749  1.00 0.00 ? 94  SER A HB2  7  
ATOM 10903 H HB3  . SER A 1 94  ? 2.615   24.177  -3.385  1.00 0.00 ? 94  SER A HB3  7  
ATOM 10904 H HG   . SER A 1 94  ? 4.282   25.453  -3.327  1.00 0.00 ? 94  SER A HG   7  
ATOM 10905 N N    . SER A 1 95  ? 2.400   25.112  0.475   1.00 0.00 ? 95  SER A N    7  
ATOM 10906 C CA   . SER A 1 95  ? 2.792   25.573  1.802   1.00 0.00 ? 95  SER A CA   7  
ATOM 10907 C C    . SER A 1 95  ? 3.899   26.618  1.708   1.00 0.00 ? 95  SER A C    7  
ATOM 10908 O O    . SER A 1 95  ? 4.422   26.890  0.628   1.00 0.00 ? 95  SER A O    7  
ATOM 10909 C CB   . SER A 1 95  ? 3.258   24.394  2.657   1.00 0.00 ? 95  SER A CB   7  
ATOM 10910 O OG   . SER A 1 95  ? 2.175   23.541  2.984   1.00 0.00 ? 95  SER A OG   7  
ATOM 10911 H H    . SER A 1 95  ? 2.353   24.149  0.297   1.00 0.00 ? 95  SER A H    7  
ATOM 10912 H HA   . SER A 1 95  ? 1.926   26.023  2.265   1.00 0.00 ? 95  SER A HA   7  
ATOM 10913 H HB2  . SER A 1 95  ? 3.996   23.826  2.111   1.00 0.00 ? 95  SER A HB2  7  
ATOM 10914 H HB3  . SER A 1 95  ? 3.697   24.767  3.571   1.00 0.00 ? 95  SER A HB3  7  
ATOM 10915 H HG   . SER A 1 95  ? 1.361   24.049  3.000   1.00 0.00 ? 95  SER A HG   7  
ATOM 10916 N N    . ASN A 1 96  ? 4.251   27.201  2.850   1.00 0.00 ? 96  ASN A N    7  
ATOM 10917 C CA   . ASN A 1 96  ? 5.296   28.218  2.898   1.00 0.00 ? 96  ASN A CA   7  
ATOM 10918 C C    . ASN A 1 96  ? 6.400   27.912  1.890   1.00 0.00 ? 96  ASN A C    7  
ATOM 10919 O O    . ASN A 1 96  ? 6.883   26.783  1.806   1.00 0.00 ? 96  ASN A O    7  
ATOM 10920 C CB   . ASN A 1 96  ? 5.887   28.305  4.307   1.00 0.00 ? 96  ASN A CB   7  
ATOM 10921 C CG   . ASN A 1 96  ? 6.694   29.571  4.518   1.00 0.00 ? 96  ASN A CG   7  
ATOM 10922 O OD1  . ASN A 1 96  ? 6.243   30.504  5.183   1.00 0.00 ? 96  ASN A OD1  7  
ATOM 10923 N ND2  . ASN A 1 96  ? 7.894   29.609  3.951   1.00 0.00 ? 96  ASN A ND2  7  
ATOM 10924 H H    . ASN A 1 96  ? 3.798   26.943  3.679   1.00 0.00 ? 96  ASN A H    7  
ATOM 10925 H HA   . ASN A 1 96  ? 4.848   29.167  2.646   1.00 0.00 ? 96  ASN A HA   7  
ATOM 10926 H HB2  . ASN A 1 96  ? 5.084   28.288  5.029   1.00 0.00 ? 96  ASN A HB2  7  
ATOM 10927 H HB3  . ASN A 1 96  ? 6.533   27.456  4.473   1.00 0.00 ? 96  ASN A HB3  7  
ATOM 10928 H HD21 . ASN A 1 96  ? 8.188   28.829  3.435   1.00 0.00 ? 96  ASN A HD21 7  
ATOM 10929 H HD22 . ASN A 1 96  ? 8.438   30.416  4.072   1.00 0.00 ? 96  ASN A HD22 7  
ATOM 10930 N N    . SER A 1 97  ? 6.794   28.926  1.126   1.00 0.00 ? 97  SER A N    7  
ATOM 10931 C CA   . SER A 1 97  ? 7.838   28.765  0.121   1.00 0.00 ? 97  SER A CA   7  
ATOM 10932 C C    . SER A 1 97  ? 8.520   30.098  -0.172  1.00 0.00 ? 97  SER A C    7  
ATOM 10933 O O    . SER A 1 97  ? 7.894   31.155  -0.111  1.00 0.00 ? 97  SER A O    7  
ATOM 10934 C CB   . SER A 1 97  ? 7.250   28.186  -1.168  1.00 0.00 ? 97  SER A CB   7  
ATOM 10935 O OG   . SER A 1 97  ? 8.274   27.837  -2.083  1.00 0.00 ? 97  SER A OG   7  
ATOM 10936 H H    . SER A 1 97  ? 6.370   29.802  1.240   1.00 0.00 ? 97  SER A H    7  
ATOM 10937 H HA   . SER A 1 97  ? 8.572   28.077  0.513   1.00 0.00 ? 97  SER A HA   7  
ATOM 10938 H HB2  . SER A 1 97  ? 6.677   27.302  -0.933  1.00 0.00 ? 97  SER A HB2  7  
ATOM 10939 H HB3  . SER A 1 97  ? 6.606   28.921  -1.628  1.00 0.00 ? 97  SER A HB3  7  
ATOM 10940 H HG   . SER A 1 97  ? 8.434   28.572  -2.680  1.00 0.00 ? 97  SER A HG   7  
ATOM 10941 N N    . GLY A 1 98  ? 9.810   30.039  -0.491  1.00 0.00 ? 98  GLY A N    7  
ATOM 10942 C CA   . GLY A 1 98  ? 10.557  31.247  -0.788  1.00 0.00 ? 98  GLY A CA   7  
ATOM 10943 C C    . GLY A 1 98  ? 9.767   32.222  -1.638  1.00 0.00 ? 98  GLY A C    7  
ATOM 10944 O O    . GLY A 1 98  ? 8.979   31.832  -2.500  1.00 0.00 ? 98  GLY A O    7  
ATOM 10945 H H    . GLY A 1 98  ? 10.257  29.167  -0.524  1.00 0.00 ? 98  GLY A H    7  
ATOM 10946 H HA2  . GLY A 1 98  ? 10.825  31.729  0.140   1.00 0.00 ? 98  GLY A HA2  7  
ATOM 10947 H HA3  . GLY A 1 98  ? 11.459  30.977  -1.316  1.00 0.00 ? 98  GLY A HA3  7  
ATOM 10948 N N    . PRO A 1 99  ? 9.973   33.525  -1.396  1.00 0.00 ? 99  PRO A N    7  
ATOM 10949 C CA   . PRO A 1 99  ? 9.282   34.587  -2.134  1.00 0.00 ? 99  PRO A CA   7  
ATOM 10950 C C    . PRO A 1 99  ? 9.747   34.682  -3.583  1.00 0.00 ? 99  PRO A C    7  
ATOM 10951 O O    . PRO A 1 99  ? 10.946  34.719  -3.859  1.00 0.00 ? 99  PRO A O    7  
ATOM 10952 C CB   . PRO A 1 99  ? 9.660   35.856  -1.367  1.00 0.00 ? 99  PRO A CB   7  
ATOM 10953 C CG   . PRO A 1 99  ? 10.956  35.530  -0.709  1.00 0.00 ? 99  PRO A CG   7  
ATOM 10954 C CD   . PRO A 1 99  ? 10.897  34.063  -0.383  1.00 0.00 ? 99  PRO A CD   7  
ATOM 10955 H HA   . PRO A 1 99  ? 8.210   34.455  -2.109  1.00 0.00 ? 99  PRO A HA   7  
ATOM 10956 H HB2  . PRO A 1 99  ? 9.764   36.681  -2.058  1.00 0.00 ? 99  PRO A HB2  7  
ATOM 10957 H HB3  . PRO A 1 99  ? 8.895   36.083  -0.640  1.00 0.00 ? 99  PRO A HB3  7  
ATOM 10958 H HG2  . PRO A 1 99  ? 11.773  35.731  -1.386  1.00 0.00 ? 99  PRO A HG2  7  
ATOM 10959 H HG3  . PRO A 1 99  ? 11.065  36.110  0.195   1.00 0.00 ? 99  PRO A HG3  7  
ATOM 10960 H HD2  . PRO A 1 99  ? 11.876  33.616  -0.477  1.00 0.00 ? 99  PRO A HD2  7  
ATOM 10961 H HD3  . PRO A 1 99  ? 10.506  33.913  0.613   1.00 0.00 ? 99  PRO A HD3  7  
ATOM 10962 N N    . SER A 1 100 ? 8.790   34.722  -4.505  1.00 0.00 ? 100 SER A N    7  
ATOM 10963 C CA   . SER A 1 100 ? 9.102   34.810  -5.927  1.00 0.00 ? 100 SER A CA   7  
ATOM 10964 C C    . SER A 1 100 ? 7.829   34.964  -6.754  1.00 0.00 ? 100 SER A C    7  
ATOM 10965 O O    . SER A 1 100 ? 6.920   34.138  -6.674  1.00 0.00 ? 100 SER A O    7  
ATOM 10966 C CB   . SER A 1 100 ? 9.870   33.566  -6.380  1.00 0.00 ? 100 SER A CB   7  
ATOM 10967 O OG   . SER A 1 100 ? 10.010  33.539  -7.789  1.00 0.00 ? 100 SER A OG   7  
ATOM 10968 H H    . SER A 1 100 ? 7.852   34.689  -4.222  1.00 0.00 ? 100 SER A H    7  
ATOM 10969 H HA   . SER A 1 100 ? 9.723   35.680  -6.077  1.00 0.00 ? 100 SER A HA   7  
ATOM 10970 H HB2  . SER A 1 100 ? 10.853  33.571  -5.933  1.00 0.00 ? 100 SER A HB2  7  
ATOM 10971 H HB3  . SER A 1 100 ? 9.336   32.682  -6.065  1.00 0.00 ? 100 SER A HB3  7  
ATOM 10972 H HG   . SER A 1 100 ? 9.975   34.434  -8.133  1.00 0.00 ? 100 SER A HG   7  
ATOM 10973 N N    . SER A 1 101 ? 7.773   36.028  -7.548  1.00 0.00 ? 101 SER A N    7  
ATOM 10974 C CA   . SER A 1 101 ? 6.610   36.295  -8.387  1.00 0.00 ? 101 SER A CA   7  
ATOM 10975 C C    . SER A 1 101 ? 6.913   35.981  -9.849  1.00 0.00 ? 101 SER A C    7  
ATOM 10976 O O    . SER A 1 101 ? 8.039   35.633  -10.201 1.00 0.00 ? 101 SER A O    7  
ATOM 10977 C CB   . SER A 1 101 ? 6.177   37.755  -8.247  1.00 0.00 ? 101 SER A CB   7  
ATOM 10978 O OG   . SER A 1 101 ? 5.539   37.980  -7.001  1.00 0.00 ? 101 SER A OG   7  
ATOM 10979 H H    . SER A 1 101 ? 8.530   36.651  -7.567  1.00 0.00 ? 101 SER A H    7  
ATOM 10980 H HA   . SER A 1 101 ? 5.807   35.656  -8.053  1.00 0.00 ? 101 SER A HA   7  
ATOM 10981 H HB2  . SER A 1 101 ? 7.045   38.394  -8.313  1.00 0.00 ? 101 SER A HB2  7  
ATOM 10982 H HB3  . SER A 1 101 ? 5.487   38.001  -9.041  1.00 0.00 ? 101 SER A HB3  7  
ATOM 10983 H HG   . SER A 1 101 ? 5.156   38.861  -6.992  1.00 0.00 ? 101 SER A HG   7  
ATOM 10984 N N    . GLY A 1 102 ? 5.897   36.106  -10.698 1.00 0.00 ? 102 GLY A N    7  
ATOM 10985 C CA   . GLY A 1 102 ? 6.073   35.832  -12.112 1.00 0.00 ? 102 GLY A CA   7  
ATOM 10986 C C    . GLY A 1 102 ? 4.798   36.037  -12.905 1.00 0.00 ? 102 GLY A C    7  
ATOM 10987 O O    . GLY A 1 102 ? 3.911   36.781  -12.486 1.00 0.00 ? 102 GLY A O    7  
ATOM 10988 H H    . GLY A 1 102 ? 5.020   36.387  -10.360 1.00 0.00 ? 102 GLY A H    7  
ATOM 10989 H HA2  . GLY A 1 102 ? 6.837   36.488  -12.502 1.00 0.00 ? 102 GLY A HA2  7  
ATOM 10990 H HA3  . GLY A 1 102 ? 6.396   34.808  -12.231 1.00 0.00 ? 102 GLY A HA3  7  
ATOM 10991 N N    . GLY A 1 1   ? -9.033  15.430  -4.562  1.00 0.00 ? 1   GLY A N    8  
ATOM 10992 C CA   . GLY A 1 1   ? -8.697  16.114  -5.797  1.00 0.00 ? 1   GLY A CA   8  
ATOM 10993 C C    . GLY A 1 1   ? -9.633  15.753  -6.934  1.00 0.00 ? 1   GLY A C    8  
ATOM 10994 O O    . GLY A 1 1   ? -10.821 15.516  -6.717  1.00 0.00 ? 1   GLY A O    8  
ATOM 10995 H H1   . GLY A 1 1   ? -9.938  15.505  -4.193  1.00 0.00 ? 1   GLY A H1   8  
ATOM 10996 H HA2  . GLY A 1 1   ? -8.745  17.180  -5.630  1.00 0.00 ? 1   GLY A HA2  8  
ATOM 10997 H HA3  . GLY A 1 1   ? -7.688  15.849  -6.079  1.00 0.00 ? 1   GLY A HA3  8  
ATOM 10998 N N    . SER A 1 2   ? -9.097  15.713  -8.149  1.00 0.00 ? 2   SER A N    8  
ATOM 10999 C CA   . SER A 1 2   ? -9.894  15.384  -9.325  1.00 0.00 ? 2   SER A CA   8  
ATOM 11000 C C    . SER A 1 2   ? -10.542 14.011  -9.175  1.00 0.00 ? 2   SER A C    8  
ATOM 11001 O O    . SER A 1 2   ? -9.901  13.054  -8.743  1.00 0.00 ? 2   SER A O    8  
ATOM 11002 C CB   . SER A 1 2   ? -9.023  15.415  -10.583 1.00 0.00 ? 2   SER A CB   8  
ATOM 11003 O OG   . SER A 1 2   ? -9.653  14.738  -11.656 1.00 0.00 ? 2   SER A OG   8  
ATOM 11004 H H    . SER A 1 2   ? -8.143  15.912  -8.258  1.00 0.00 ? 2   SER A H    8  
ATOM 11005 H HA   . SER A 1 2   ? -10.671 16.128  -9.418  1.00 0.00 ? 2   SER A HA   8  
ATOM 11006 H HB2  . SER A 1 2   ? -8.849  16.440  -10.872 1.00 0.00 ? 2   SER A HB2  8  
ATOM 11007 H HB3  . SER A 1 2   ? -8.078  14.934  -10.374 1.00 0.00 ? 2   SER A HB3  8  
ATOM 11008 H HG   . SER A 1 2   ? -10.606 14.815  -11.568 1.00 0.00 ? 2   SER A HG   8  
ATOM 11009 N N    . SER A 1 3   ? -11.819 13.924  -9.536  1.00 0.00 ? 3   SER A N    8  
ATOM 11010 C CA   . SER A 1 3   ? -12.557 12.671  -9.438  1.00 0.00 ? 3   SER A CA   8  
ATOM 11011 C C    . SER A 1 3   ? -12.669 11.999  -10.803 1.00 0.00 ? 3   SER A C    8  
ATOM 11012 O O    . SER A 1 3   ? -13.550 12.325  -11.598 1.00 0.00 ? 3   SER A O    8  
ATOM 11013 C CB   . SER A 1 3   ? -13.953 12.919  -8.864  1.00 0.00 ? 3   SER A CB   8  
ATOM 11014 O OG   . SER A 1 3   ? -14.788 11.789  -9.045  1.00 0.00 ? 3   SER A OG   8  
ATOM 11015 H H    . SER A 1 3   ? -12.275 14.724  -9.873  1.00 0.00 ? 3   SER A H    8  
ATOM 11016 H HA   . SER A 1 3   ? -12.014 12.017  -8.772  1.00 0.00 ? 3   SER A HA   8  
ATOM 11017 H HB2  . SER A 1 3   ? -13.873 13.127  -7.807  1.00 0.00 ? 3   SER A HB2  8  
ATOM 11018 H HB3  . SER A 1 3   ? -14.399 13.766  -9.364  1.00 0.00 ? 3   SER A HB3  8  
ATOM 11019 H HG   . SER A 1 3   ? -14.371 11.017  -8.654  1.00 0.00 ? 3   SER A HG   8  
ATOM 11020 N N    . GLY A 1 4   ? -11.768 11.057  -11.069 1.00 0.00 ? 4   GLY A N    8  
ATOM 11021 C CA   . GLY A 1 4   ? -11.782 10.353  -12.338 1.00 0.00 ? 4   GLY A CA   8  
ATOM 11022 C C    . GLY A 1 4   ? -11.227 8.947   -12.227 1.00 0.00 ? 4   GLY A C    8  
ATOM 11023 O O    . GLY A 1 4   ? -10.012 8.752   -12.210 1.00 0.00 ? 4   GLY A O    8  
ATOM 11024 H H    . GLY A 1 4   ? -11.089 10.839  -10.397 1.00 0.00 ? 4   GLY A H    8  
ATOM 11025 H HA2  . GLY A 1 4   ? -12.799 10.300  -12.696 1.00 0.00 ? 4   GLY A HA2  8  
ATOM 11026 H HA3  . GLY A 1 4   ? -11.188 10.907  -13.050 1.00 0.00 ? 4   GLY A HA3  8  
ATOM 11027 N N    . SER A 1 5   ? -12.119 7.965   -12.151 1.00 0.00 ? 5   SER A N    8  
ATOM 11028 C CA   . SER A 1 5   ? -11.711 6.569   -12.035 1.00 0.00 ? 5   SER A CA   8  
ATOM 11029 C C    . SER A 1 5   ? -12.504 5.690   -12.998 1.00 0.00 ? 5   SER A C    8  
ATOM 11030 O O    . SER A 1 5   ? -13.486 6.132   -13.593 1.00 0.00 ? 5   SER A O    8  
ATOM 11031 C CB   . SER A 1 5   ? -11.903 6.077   -10.600 1.00 0.00 ? 5   SER A CB   8  
ATOM 11032 O OG   . SER A 1 5   ? -13.278 6.024   -10.259 1.00 0.00 ? 5   SER A OG   8  
ATOM 11033 H H    . SER A 1 5   ? -13.074 8.184   -12.170 1.00 0.00 ? 5   SER A H    8  
ATOM 11034 H HA   . SER A 1 5   ? -10.663 6.508   -12.291 1.00 0.00 ? 5   SER A HA   8  
ATOM 11035 H HB2  . SER A 1 5   ? -11.482 5.088   -10.502 1.00 0.00 ? 5   SER A HB2  8  
ATOM 11036 H HB3  . SER A 1 5   ? -11.401 6.750   -9.921  1.00 0.00 ? 5   SER A HB3  8  
ATOM 11037 H HG   . SER A 1 5   ? -13.368 5.934   -9.308  1.00 0.00 ? 5   SER A HG   8  
ATOM 11038 N N    . SER A 1 6   ? -12.069 4.443   -13.145 1.00 0.00 ? 6   SER A N    8  
ATOM 11039 C CA   . SER A 1 6   ? -12.735 3.501   -14.037 1.00 0.00 ? 6   SER A CA   8  
ATOM 11040 C C    . SER A 1 6   ? -12.762 2.103   -13.429 1.00 0.00 ? 6   SER A C    8  
ATOM 11041 O O    . SER A 1 6   ? -11.722 1.469   -13.254 1.00 0.00 ? 6   SER A O    8  
ATOM 11042 C CB   . SER A 1 6   ? -12.029 3.466   -15.394 1.00 0.00 ? 6   SER A CB   8  
ATOM 11043 O OG   . SER A 1 6   ? -12.323 4.626   -16.153 1.00 0.00 ? 6   SER A OG   8  
ATOM 11044 H H    . SER A 1 6   ? -11.280 4.150   -12.643 1.00 0.00 ? 6   SER A H    8  
ATOM 11045 H HA   . SER A 1 6   ? -13.750 3.840   -14.178 1.00 0.00 ? 6   SER A HA   8  
ATOM 11046 H HB2  . SER A 1 6   ? -10.962 3.412   -15.241 1.00 0.00 ? 6   SER A HB2  8  
ATOM 11047 H HB3  . SER A 1 6   ? -12.357 2.597   -15.945 1.00 0.00 ? 6   SER A HB3  8  
ATOM 11048 H HG   . SER A 1 6   ? -12.676 4.369   -17.008 1.00 0.00 ? 6   SER A HG   8  
ATOM 11049 N N    . GLY A 1 7   ? -13.962 1.627   -13.108 1.00 0.00 ? 7   GLY A N    8  
ATOM 11050 C CA   . GLY A 1 7   ? -14.104 0.307   -12.522 1.00 0.00 ? 7   GLY A CA   8  
ATOM 11051 C C    . GLY A 1 7   ? -13.986 0.327   -11.011 1.00 0.00 ? 7   GLY A C    8  
ATOM 11052 O O    . GLY A 1 7   ? -12.951 0.715   -10.468 1.00 0.00 ? 7   GLY A O    8  
ATOM 11053 H H    . GLY A 1 7   ? -14.756 2.177   -13.270 1.00 0.00 ? 7   GLY A H    8  
ATOM 11054 H HA2  . GLY A 1 7   ? -15.070 -0.093  -12.792 1.00 0.00 ? 7   GLY A HA2  8  
ATOM 11055 H HA3  . GLY A 1 7   ? -13.334 -0.337  -12.923 1.00 0.00 ? 7   GLY A HA3  8  
ATOM 11056 N N    . ARG A 1 8   ? -15.049 -0.090  -10.330 1.00 0.00 ? 8   ARG A N    8  
ATOM 11057 C CA   . ARG A 1 8   ? -15.061 -0.115  -8.873  1.00 0.00 ? 8   ARG A CA   8  
ATOM 11058 C C    . ARG A 1 8   ? -14.551 -1.454  -8.348  1.00 0.00 ? 8   ARG A C    8  
ATOM 11059 O O    . ARG A 1 8   ? -13.533 -1.516  -7.661  1.00 0.00 ? 8   ARG A O    8  
ATOM 11060 C CB   . ARG A 1 8   ? -16.474 0.146   -8.349  1.00 0.00 ? 8   ARG A CB   8  
ATOM 11061 C CG   . ARG A 1 8   ? -16.952 1.572   -8.569  1.00 0.00 ? 8   ARG A CG   8  
ATOM 11062 C CD   . ARG A 1 8   ? -18.339 1.791   -7.986  1.00 0.00 ? 8   ARG A CD   8  
ATOM 11063 N NE   . ARG A 1 8   ? -18.285 2.230   -6.594  1.00 0.00 ? 8   ARG A NE   8  
ATOM 11064 C CZ   . ARG A 1 8   ? -17.801 3.407   -6.214  1.00 0.00 ? 8   ARG A CZ   8  
ATOM 11065 N NH1  . ARG A 1 8   ? -17.332 4.258   -7.116  1.00 0.00 ? 8   ARG A NH1  8  
ATOM 11066 N NH2  . ARG A 1 8   ? -17.786 3.735   -4.928  1.00 0.00 ? 8   ARG A NH2  8  
ATOM 11067 H H    . ARG A 1 8   ? -15.844 -0.387  -10.820 1.00 0.00 ? 8   ARG A H    8  
ATOM 11068 H HA   . ARG A 1 8   ? -14.406 0.669   -8.522  1.00 0.00 ? 8   ARG A HA   8  
ATOM 11069 H HB2  . ARG A 1 8   ? -17.160 -0.521  -8.849  1.00 0.00 ? 8   ARG A HB2  8  
ATOM 11070 H HB3  . ARG A 1 8   ? -16.495 -0.058  -7.289  1.00 0.00 ? 8   ARG A HB3  8  
ATOM 11071 H HG2  . ARG A 1 8   ? -16.261 2.251   -8.091  1.00 0.00 ? 8   ARG A HG2  8  
ATOM 11072 H HG3  . ARG A 1 8   ? -16.980 1.772   -9.630  1.00 0.00 ? 8   ARG A HG3  8  
ATOM 11073 H HD2  . ARG A 1 8   ? -18.846 2.543   -8.572  1.00 0.00 ? 8   ARG A HD2  8  
ATOM 11074 H HD3  . ARG A 1 8   ? -18.888 0.863   -8.040  1.00 0.00 ? 8   ARG A HD3  8  
ATOM 11075 H HE   . ARG A 1 8   ? -18.626 1.617   -5.911  1.00 0.00 ? 8   ARG A HE   8  
ATOM 11076 H HH11 . ARG A 1 8   ? -17.343 4.014   -8.085  1.00 0.00 ? 8   ARG A HH11 8  
ATOM 11077 H HH12 . ARG A 1 8   ? -16.969 5.144   -6.826  1.00 0.00 ? 8   ARG A HH12 8  
ATOM 11078 H HH21 . ARG A 1 8   ? -18.138 3.096   -4.245  1.00 0.00 ? 8   ARG A HH21 8  
ATOM 11079 H HH22 . ARG A 1 8   ? -17.421 4.621   -4.642  1.00 0.00 ? 8   ARG A HH22 8  
ATOM 11080 N N    . ASN A 1 9   ? -15.268 -2.524  -8.677  1.00 0.00 ? 9   ASN A N    8  
ATOM 11081 C CA   . ASN A 1 9   ? -14.889 -3.862  -8.238  1.00 0.00 ? 9   ASN A CA   8  
ATOM 11082 C C    . ASN A 1 9   ? -13.457 -4.186  -8.654  1.00 0.00 ? 9   ASN A C    8  
ATOM 11083 O O    . ASN A 1 9   ? -13.173 -4.383  -9.836  1.00 0.00 ? 9   ASN A O    8  
ATOM 11084 C CB   . ASN A 1 9   ? -15.848 -4.903  -8.819  1.00 0.00 ? 9   ASN A CB   8  
ATOM 11085 C CG   . ASN A 1 9   ? -15.570 -5.194  -10.281 1.00 0.00 ? 9   ASN A CG   8  
ATOM 11086 O OD1  . ASN A 1 9   ? -15.079 -6.267  -10.629 1.00 0.00 ? 9   ASN A OD1  8  
ATOM 11087 N ND2  . ASN A 1 9   ? -15.884 -4.235  -11.145 1.00 0.00 ? 9   ASN A ND2  8  
ATOM 11088 H H    . ASN A 1 9   ? -16.070 -2.411  -9.228  1.00 0.00 ? 9   ASN A H    8  
ATOM 11089 H HA   . ASN A 1 9   ? -14.953 -3.888  -7.161  1.00 0.00 ? 9   ASN A HA   8  
ATOM 11090 H HB2  . ASN A 1 9   ? -15.749 -5.824  -8.263  1.00 0.00 ? 9   ASN A HB2  8  
ATOM 11091 H HB3  . ASN A 1 9   ? -16.861 -4.540  -8.729  1.00 0.00 ? 9   ASN A HB3  8  
ATOM 11092 H HD21 . ASN A 1 9   ? -16.272 -3.405  -10.795 1.00 0.00 ? 9   ASN A HD21 8  
ATOM 11093 H HD22 . ASN A 1 9   ? -15.715 -4.396  -12.096 1.00 0.00 ? 9   ASN A HD22 8  
ATOM 11094 N N    . ARG A 1 10  ? -12.560 -4.240  -7.675  1.00 0.00 ? 10  ARG A N    8  
ATOM 11095 C CA   . ARG A 1 10  ? -11.158 -4.540  -7.939  1.00 0.00 ? 10  ARG A CA   8  
ATOM 11096 C C    . ARG A 1 10  ? -10.589 -5.468  -6.870  1.00 0.00 ? 10  ARG A C    8  
ATOM 11097 O O    . ARG A 1 10  ? -10.844 -5.290  -5.679  1.00 0.00 ? 10  ARG A O    8  
ATOM 11098 C CB   . ARG A 1 10  ? -10.340 -3.248  -7.995  1.00 0.00 ? 10  ARG A CB   8  
ATOM 11099 C CG   . ARG A 1 10  ? -10.299 -2.612  -9.374  1.00 0.00 ? 10  ARG A CG   8  
ATOM 11100 C CD   . ARG A 1 10  ? -9.318  -3.327  -10.289 1.00 0.00 ? 10  ARG A CD   8  
ATOM 11101 N NE   . ARG A 1 10  ? -9.512  -2.965  -11.691 1.00 0.00 ? 10  ARG A NE   8  
ATOM 11102 C CZ   . ARG A 1 10  ? -10.464 -3.484  -12.458 1.00 0.00 ? 10  ARG A CZ   8  
ATOM 11103 N NH1  . ARG A 1 10  ? -11.305 -4.381  -11.963 1.00 0.00 ? 10  ARG A NH1  8  
ATOM 11104 N NH2  . ARG A 1 10  ? -10.577 -3.104  -13.725 1.00 0.00 ? 10  ARG A NH2  8  
ATOM 11105 H H    . ARG A 1 10  ? -12.847 -4.074  -6.753  1.00 0.00 ? 10  ARG A H    8  
ATOM 11106 H HA   . ARG A 1 10  ? -11.099 -5.034  -8.897  1.00 0.00 ? 10  ARG A HA   8  
ATOM 11107 H HB2  . ARG A 1 10  ? -10.768 -2.534  -7.306  1.00 0.00 ? 10  ARG A HB2  8  
ATOM 11108 H HB3  . ARG A 1 10  ? -9.327  -3.464  -7.692  1.00 0.00 ? 10  ARG A HB3  8  
ATOM 11109 H HG2  . ARG A 1 10  ? -11.285 -2.662  -9.813  1.00 0.00 ? 10  ARG A HG2  8  
ATOM 11110 H HG3  . ARG A 1 10  ? -9.999  -1.579  -9.276  1.00 0.00 ? 10  ARG A HG3  8  
ATOM 11111 H HD2  . ARG A 1 10  ? -8.313  -3.062  -9.995  1.00 0.00 ? 10  ARG A HD2  8  
ATOM 11112 H HD3  . ARG A 1 10  ? -9.456  -4.393  -10.179 1.00 0.00 ? 10  ARG A HD3  8  
ATOM 11113 H HE   . ARG A 1 10  ? -8.902  -2.304  -12.077 1.00 0.00 ? 10  ARG A HE   8  
ATOM 11114 H HH11 . ARG A 1 10  ? -11.222 -4.669  -11.009 1.00 0.00 ? 10  ARG A HH11 8  
ATOM 11115 H HH12 . ARG A 1 10  ? -12.022 -4.769  -12.543 1.00 0.00 ? 10  ARG A HH12 8  
ATOM 11116 H HH21 . ARG A 1 10  ? -9.946  -2.427  -14.102 1.00 0.00 ? 10  ARG A HH21 8  
ATOM 11117 H HH22 . ARG A 1 10  ? -11.294 -3.494  -14.302 1.00 0.00 ? 10  ARG A HH22 8  
ATOM 11118 N N    . PHE A 1 11  ? -9.819  -6.460  -7.305  1.00 0.00 ? 11  PHE A N    8  
ATOM 11119 C CA   . PHE A 1 11  ? -9.216  -7.418  -6.385  1.00 0.00 ? 11  PHE A CA   8  
ATOM 11120 C C    . PHE A 1 11  ? -8.790  -6.735  -5.089  1.00 0.00 ? 11  PHE A C    8  
ATOM 11121 O O    . PHE A 1 11  ? -8.067  -5.739  -5.108  1.00 0.00 ? 11  PHE A O    8  
ATOM 11122 C CB   . PHE A 1 11  ? -8.009  -8.094  -7.039  1.00 0.00 ? 11  PHE A CB   8  
ATOM 11123 C CG   . PHE A 1 11  ? -6.974  -8.557  -6.054  1.00 0.00 ? 11  PHE A CG   8  
ATOM 11124 C CD1  . PHE A 1 11  ? -7.109  -9.775  -5.408  1.00 0.00 ? 11  PHE A CD1  8  
ATOM 11125 C CD2  . PHE A 1 11  ? -5.866  -7.774  -5.774  1.00 0.00 ? 11  PHE A CD2  8  
ATOM 11126 C CE1  . PHE A 1 11  ? -6.159  -10.203 -4.500  1.00 0.00 ? 11  PHE A CE1  8  
ATOM 11127 C CE2  . PHE A 1 11  ? -4.912  -8.196  -4.867  1.00 0.00 ? 11  PHE A CE2  8  
ATOM 11128 C CZ   . PHE A 1 11  ? -5.058  -9.413  -4.230  1.00 0.00 ? 11  PHE A CZ   8  
ATOM 11129 H H    . PHE A 1 11  ? -9.653  -6.551  -8.267  1.00 0.00 ? 11  PHE A H    8  
ATOM 11130 H HA   . PHE A 1 11  ? -9.957  -8.168  -6.156  1.00 0.00 ? 11  PHE A HA   8  
ATOM 11131 H HB2  . PHE A 1 11  ? -8.345  -8.956  -7.596  1.00 0.00 ? 11  PHE A HB2  8  
ATOM 11132 H HB3  . PHE A 1 11  ? -7.537  -7.397  -7.715  1.00 0.00 ? 11  PHE A HB3  8  
ATOM 11133 H HD1  . PHE A 1 11  ? -7.969  -10.395 -5.619  1.00 0.00 ? 11  PHE A HD1  8  
ATOM 11134 H HD2  . PHE A 1 11  ? -5.750  -6.821  -6.272  1.00 0.00 ? 11  PHE A HD2  8  
ATOM 11135 H HE1  . PHE A 1 11  ? -6.276  -11.155 -4.004  1.00 0.00 ? 11  PHE A HE1  8  
ATOM 11136 H HE2  . PHE A 1 11  ? -4.053  -7.576  -4.659  1.00 0.00 ? 11  PHE A HE2  8  
ATOM 11137 H HZ   . PHE A 1 11  ? -4.315  -9.745  -3.521  1.00 0.00 ? 11  PHE A HZ   8  
ATOM 11138 N N    . LYS A 1 12  ? -9.244  -7.277  -3.965  1.00 0.00 ? 12  LYS A N    8  
ATOM 11139 C CA   . LYS A 1 12  ? -8.911  -6.722  -2.658  1.00 0.00 ? 12  LYS A CA   8  
ATOM 11140 C C    . LYS A 1 12  ? -7.963  -7.646  -1.900  1.00 0.00 ? 12  LYS A C    8  
ATOM 11141 O O    . LYS A 1 12  ? -8.246  -8.831  -1.724  1.00 0.00 ? 12  LYS A O    8  
ATOM 11142 C CB   . LYS A 1 12  ? -10.183 -6.495  -1.838  1.00 0.00 ? 12  LYS A CB   8  
ATOM 11143 C CG   . LYS A 1 12  ? -9.996  -5.531  -0.680  1.00 0.00 ? 12  LYS A CG   8  
ATOM 11144 C CD   . LYS A 1 12  ? -10.045 -4.085  -1.144  1.00 0.00 ? 12  LYS A CD   8  
ATOM 11145 C CE   . LYS A 1 12  ? -11.470 -3.552  -1.159  1.00 0.00 ? 12  LYS A CE   8  
ATOM 11146 N NZ   . LYS A 1 12  ? -11.505 -2.067  -1.265  1.00 0.00 ? 12  LYS A NZ   8  
ATOM 11147 H H    . LYS A 1 12  ? -9.817  -8.072  -4.015  1.00 0.00 ? 12  LYS A H    8  
ATOM 11148 H HA   . LYS A 1 12  ? -8.421  -5.774  -2.816  1.00 0.00 ? 12  LYS A HA   8  
ATOM 11149 H HB2  . LYS A 1 12  ? -10.950 -6.100  -2.488  1.00 0.00 ? 12  LYS A HB2  8  
ATOM 11150 H HB3  . LYS A 1 12  ? -10.515 -7.444  -1.440  1.00 0.00 ? 12  LYS A HB3  8  
ATOM 11151 H HG2  . LYS A 1 12  ? -10.783 -5.693  0.042   1.00 0.00 ? 12  LYS A HG2  8  
ATOM 11152 H HG3  . LYS A 1 12  ? -9.038  -5.720  -0.218  1.00 0.00 ? 12  LYS A HG3  8  
ATOM 11153 H HD2  . LYS A 1 12  ? -9.454  -3.480  -0.473  1.00 0.00 ? 12  LYS A HD2  8  
ATOM 11154 H HD3  . LYS A 1 12  ? -9.636  -4.023  -2.143  1.00 0.00 ? 12  LYS A HD3  8  
ATOM 11155 H HE2  . LYS A 1 12  ? -11.990 -3.977  -2.004  1.00 0.00 ? 12  LYS A HE2  8  
ATOM 11156 H HE3  . LYS A 1 12  ? -11.961 -3.852  -0.245  1.00 0.00 ? 12  LYS A HE3  8  
ATOM 11157 H HZ1  . LYS A 1 12  ? -10.537 -1.689  -1.297  1.00 0.00 ? 12  LYS A HZ1  8  
ATOM 11158 H HZ2  . LYS A 1 12  ? -11.996 -1.662  -0.443  1.00 0.00 ? 12  LYS A HZ2  8  
ATOM 11159 H HZ3  . LYS A 1 12  ? -12.007 -1.782  -2.130  1.00 0.00 ? 12  LYS A HZ3  8  
ATOM 11160 N N    . TRP A 1 13  ? -6.841  -7.096  -1.453  1.00 0.00 ? 13  TRP A N    8  
ATOM 11161 C CA   . TRP A 1 13  ? -5.852  -7.871  -0.712  1.00 0.00 ? 13  TRP A CA   8  
ATOM 11162 C C    . TRP A 1 13  ? -6.473  -8.498  0.532   1.00 0.00 ? 13  TRP A C    8  
ATOM 11163 O O    . TRP A 1 13  ? -7.510  -8.046  1.014   1.00 0.00 ? 13  TRP A O    8  
ATOM 11164 C CB   . TRP A 1 13  ? -4.671  -6.984  -0.315  1.00 0.00 ? 13  TRP A CB   8  
ATOM 11165 C CG   . TRP A 1 13  ? -3.829  -6.560  -1.480  1.00 0.00 ? 13  TRP A CG   8  
ATOM 11166 C CD1  . TRP A 1 13  ? -3.777  -5.318  -2.045  1.00 0.00 ? 13  TRP A CD1  8  
ATOM 11167 C CD2  . TRP A 1 13  ? -2.920  -7.380  -2.224  1.00 0.00 ? 13  TRP A CD2  8  
ATOM 11168 N NE1  . TRP A 1 13  ? -2.891  -5.316  -3.095  1.00 0.00 ? 13  TRP A NE1  8  
ATOM 11169 C CE2  . TRP A 1 13  ? -2.351  -6.568  -3.225  1.00 0.00 ? 13  TRP A CE2  8  
ATOM 11170 C CE3  . TRP A 1 13  ? -2.530  -8.719  -2.140  1.00 0.00 ? 13  TRP A CE3  8  
ATOM 11171 C CZ2  . TRP A 1 13  ? -1.415  -7.054  -4.134  1.00 0.00 ? 13  TRP A CZ2  8  
ATOM 11172 C CZ3  . TRP A 1 13  ? -1.601  -9.199  -3.044  1.00 0.00 ? 13  TRP A CZ3  8  
ATOM 11173 C CH2  . TRP A 1 13  ? -1.051  -8.369  -4.029  1.00 0.00 ? 13  TRP A CH2  8  
ATOM 11174 H H    . TRP A 1 13  ? -6.672  -6.146  -1.624  1.00 0.00 ? 13  TRP A H    8  
ATOM 11175 H HA   . TRP A 1 13  ? -5.497  -8.660  -1.359  1.00 0.00 ? 13  TRP A HA   8  
ATOM 11176 H HB2  . TRP A 1 13  ? -5.043  -6.094  0.168   1.00 0.00 ? 13  TRP A HB2  8  
ATOM 11177 H HB3  . TRP A 1 13  ? -4.039  -7.526  0.374   1.00 0.00 ? 13  TRP A HB3  8  
ATOM 11178 H HD1  . TRP A 1 13  ? -4.356  -4.472  -1.707  1.00 0.00 ? 13  TRP A HD1  8  
ATOM 11179 H HE1  . TRP A 1 13  ? -2.679  -4.542  -3.659  1.00 0.00 ? 13  TRP A HE1  8  
ATOM 11180 H HE3  . TRP A 1 13  ? -2.942  -9.375  -1.388  1.00 0.00 ? 13  TRP A HE3  8  
ATOM 11181 H HZ2  . TRP A 1 13  ? -0.982  -6.426  -4.899  1.00 0.00 ? 13  TRP A HZ2  8  
ATOM 11182 H HZ3  . TRP A 1 13  ? -1.288  -10.232 -2.995  1.00 0.00 ? 13  TRP A HZ3  8  
ATOM 11183 H HH2  . TRP A 1 13  ? -0.330  -8.787  -4.714  1.00 0.00 ? 13  TRP A HH2  8  
ATOM 11184 N N    . GLY A 1 14  ? -5.830  -9.542  1.047   1.00 0.00 ? 14  GLY A N    8  
ATOM 11185 C CA   . GLY A 1 14  ? -6.335  -10.214 2.230   1.00 0.00 ? 14  GLY A CA   8  
ATOM 11186 C C    . GLY A 1 14  ? -5.605  -9.794  3.491   1.00 0.00 ? 14  GLY A C    8  
ATOM 11187 O O    . GLY A 1 14  ? -4.750  -8.908  3.473   1.00 0.00 ? 14  GLY A O    8  
ATOM 11188 H H    . GLY A 1 14  ? -5.007  -9.859  0.620   1.00 0.00 ? 14  GLY A H    8  
ATOM 11189 H HA2  . GLY A 1 14  ? -7.384  -9.984  2.341   1.00 0.00 ? 14  GLY A HA2  8  
ATOM 11190 H HA3  . GLY A 1 14  ? -6.222  -11.280 2.101   1.00 0.00 ? 14  GLY A HA3  8  
ATOM 11191 N N    . PRO A 1 15  ? -5.943  -10.439 4.617   1.00 0.00 ? 15  PRO A N    8  
ATOM 11192 C CA   . PRO A 1 15  ? -5.326  -10.144 5.914   1.00 0.00 ? 15  PRO A CA   8  
ATOM 11193 C C    . PRO A 1 15  ? -3.870  -10.592 5.978   1.00 0.00 ? 15  PRO A C    8  
ATOM 11194 O O    . PRO A 1 15  ? -3.019  -9.892  6.526   1.00 0.00 ? 15  PRO A O    8  
ATOM 11195 C CB   . PRO A 1 15  ? -6.176  -10.945 6.902   1.00 0.00 ? 15  PRO A CB   8  
ATOM 11196 C CG   . PRO A 1 15  ? -6.746  -12.060 6.095   1.00 0.00 ? 15  PRO A CG   8  
ATOM 11197 C CD   . PRO A 1 15  ? -6.953  -11.506 4.712   1.00 0.00 ? 15  PRO A CD   8  
ATOM 11198 H HA   . PRO A 1 15  ? -5.389  -9.092  6.153   1.00 0.00 ? 15  PRO A HA   8  
ATOM 11199 H HB2  . PRO A 1 15  ? -5.550  -11.315 7.702   1.00 0.00 ? 15  PRO A HB2  8  
ATOM 11200 H HB3  . PRO A 1 15  ? -6.953  -10.315 7.308   1.00 0.00 ? 15  PRO A HB3  8  
ATOM 11201 H HG2  . PRO A 1 15  ? -6.052  -12.886 6.067   1.00 0.00 ? 15  PRO A HG2  8  
ATOM 11202 H HG3  . PRO A 1 15  ? -7.689  -12.374 6.517   1.00 0.00 ? 15  PRO A HG3  8  
ATOM 11203 H HD2  . PRO A 1 15  ? -6.778  -12.270 3.969   1.00 0.00 ? 15  PRO A HD2  8  
ATOM 11204 H HD3  . PRO A 1 15  ? -7.950  -11.102 4.613   1.00 0.00 ? 15  PRO A HD3  8  
ATOM 11205 N N    . ALA A 1 16  ? -3.590  -11.762 5.415   1.00 0.00 ? 16  ALA A N    8  
ATOM 11206 C CA   . ALA A 1 16  ? -2.236  -12.302 5.406   1.00 0.00 ? 16  ALA A CA   8  
ATOM 11207 C C    . ALA A 1 16  ? -1.407  -11.687 4.285   1.00 0.00 ? 16  ALA A C    8  
ATOM 11208 O O    . ALA A 1 16  ? -0.302  -11.194 4.515   1.00 0.00 ? 16  ALA A O    8  
ATOM 11209 C CB   . ALA A 1 16  ? -2.273  -13.817 5.268   1.00 0.00 ? 16  ALA A CB   8  
ATOM 11210 H H    . ALA A 1 16  ? -4.312  -12.274 4.994   1.00 0.00 ? 16  ALA A H    8  
ATOM 11211 H HA   . ALA A 1 16  ? -1.776  -12.063 6.354   1.00 0.00 ? 16  ALA A HA   8  
ATOM 11212 H HB1  . ALA A 1 16  ? -2.287  -14.082 4.221   1.00 0.00 ? 16  ALA A HB1  8  
ATOM 11213 H HB2  . ALA A 1 16  ? -1.397  -14.242 5.735   1.00 0.00 ? 16  ALA A HB2  8  
ATOM 11214 H HB3  . ALA A 1 16  ? -3.160  -14.201 5.749   1.00 0.00 ? 16  ALA A HB3  8  
ATOM 11215 N N    . SER A 1 17  ? -1.946  -11.718 3.070   1.00 0.00 ? 17  SER A N    8  
ATOM 11216 C CA   . SER A 1 17  ? -1.253  -11.167 1.911   1.00 0.00 ? 17  SER A CA   8  
ATOM 11217 C C    . SER A 1 17  ? -0.650  -9.804  2.237   1.00 0.00 ? 17  SER A C    8  
ATOM 11218 O O    . SER A 1 17  ? 0.567   -9.627  2.194   1.00 0.00 ? 17  SER A O    8  
ATOM 11219 C CB   . SER A 1 17  ? -2.214  -11.042 0.728   1.00 0.00 ? 17  SER A CB   8  
ATOM 11220 O OG   . SER A 1 17  ? -2.675  -12.315 0.308   1.00 0.00 ? 17  SER A OG   8  
ATOM 11221 H H    . SER A 1 17  ? -2.830  -12.125 2.951   1.00 0.00 ? 17  SER A H    8  
ATOM 11222 H HA   . SER A 1 17  ? -0.457  -11.847 1.647   1.00 0.00 ? 17  SER A HA   8  
ATOM 11223 H HB2  . SER A 1 17  ? -3.064  -10.444 1.019   1.00 0.00 ? 17  SER A HB2  8  
ATOM 11224 H HB3  . SER A 1 17  ? -1.705  -10.567 -0.098  1.00 0.00 ? 17  SER A HB3  8  
ATOM 11225 H HG   . SER A 1 17  ? -3.626  -12.368 0.429   1.00 0.00 ? 17  SER A HG   8  
ATOM 11226 N N    . GLN A 1 18  ? -1.511  -8.845  2.562   1.00 0.00 ? 18  GLN A N    8  
ATOM 11227 C CA   . GLN A 1 18  ? -1.063  -7.498  2.894   1.00 0.00 ? 18  GLN A CA   8  
ATOM 11228 C C    . GLN A 1 18  ? 0.201   -7.539  3.746   1.00 0.00 ? 18  GLN A C    8  
ATOM 11229 O O    . GLN A 1 18  ? 1.253   -7.048  3.335   1.00 0.00 ? 18  GLN A O    8  
ATOM 11230 C CB   . GLN A 1 18  ? -2.166  -6.739  3.633   1.00 0.00 ? 18  GLN A CB   8  
ATOM 11231 C CG   . GLN A 1 18  ? -3.253  -6.199  2.717   1.00 0.00 ? 18  GLN A CG   8  
ATOM 11232 C CD   . GLN A 1 18  ? -3.901  -4.941  3.259   1.00 0.00 ? 18  GLN A CD   8  
ATOM 11233 O OE1  . GLN A 1 18  ? -3.347  -4.268  4.129   1.00 0.00 ? 18  GLN A OE1  8  
ATOM 11234 N NE2  . GLN A 1 18  ? -5.082  -4.615  2.746   1.00 0.00 ? 18  GLN A NE2  8  
ATOM 11235 H H    . GLN A 1 18  ? -2.469  -9.048  2.578   1.00 0.00 ? 18  GLN A H    8  
ATOM 11236 H HA   . GLN A 1 18  ? -0.843  -6.985  1.970   1.00 0.00 ? 18  GLN A HA   8  
ATOM 11237 H HB2  . GLN A 1 18  ? -2.626  -7.403  4.349   1.00 0.00 ? 18  GLN A HB2  8  
ATOM 11238 H HB3  . GLN A 1 18  ? -1.723  -5.906  4.159   1.00 0.00 ? 18  GLN A HB3  8  
ATOM 11239 H HG2  . GLN A 1 18  ? -2.816  -5.975  1.755   1.00 0.00 ? 18  GLN A HG2  8  
ATOM 11240 H HG3  . GLN A 1 18  ? -4.014  -6.957  2.598   1.00 0.00 ? 18  GLN A HG3  8  
ATOM 11241 H HE21 . GLN A 1 18  ? -5.463  -5.198  2.056   1.00 0.00 ? 18  GLN A HE21 8  
ATOM 11242 H HE22 . GLN A 1 18  ? -5.524  -3.807  3.078   1.00 0.00 ? 18  GLN A HE22 8  
ATOM 11243 N N    . GLN A 1 19  ? 0.091   -8.126  4.932   1.00 0.00 ? 19  GLN A N    8  
ATOM 11244 C CA   . GLN A 1 19  ? 1.225   -8.230  5.842   1.00 0.00 ? 19  GLN A CA   8  
ATOM 11245 C C    . GLN A 1 19  ? 2.484   -8.659  5.095   1.00 0.00 ? 19  GLN A C    8  
ATOM 11246 O O    . GLN A 1 19  ? 3.558   -8.090  5.293   1.00 0.00 ? 19  GLN A O    8  
ATOM 11247 C CB   . GLN A 1 19  ? 0.919   -9.225  6.963   1.00 0.00 ? 19  GLN A CB   8  
ATOM 11248 C CG   . GLN A 1 19  ? -0.268  -8.825  7.824   1.00 0.00 ? 19  GLN A CG   8  
ATOM 11249 C CD   . GLN A 1 19  ? -0.153  -7.409  8.355   1.00 0.00 ? 19  GLN A CD   8  
ATOM 11250 O OE1  . GLN A 1 19  ? -0.444  -6.444  7.649   1.00 0.00 ? 19  GLN A OE1  8  
ATOM 11251 N NE2  . GLN A 1 19  ? 0.273   -7.279  9.606   1.00 0.00 ? 19  GLN A NE2  8  
ATOM 11252 H H    . GLN A 1 19  ? -0.774  -8.498  5.203   1.00 0.00 ? 19  GLN A H    8  
ATOM 11253 H HA   . GLN A 1 19  ? 1.393   -7.255  6.275   1.00 0.00 ? 19  GLN A HA   8  
ATOM 11254 H HB2  . GLN A 1 19  ? 0.710   -10.189 6.524   1.00 0.00 ? 19  GLN A HB2  8  
ATOM 11255 H HB3  . GLN A 1 19  ? 1.786   -9.309  7.601   1.00 0.00 ? 19  GLN A HB3  8  
ATOM 11256 H HG2  . GLN A 1 19  ? -1.168  -8.898  7.231   1.00 0.00 ? 19  GLN A HG2  8  
ATOM 11257 H HG3  . GLN A 1 19  ? -0.334  -9.504  8.661   1.00 0.00 ? 19  GLN A HG3  8  
ATOM 11258 H HE21 . GLN A 1 19  ? 0.488   -8.093  10.108  1.00 0.00 ? 19  GLN A HE21 8  
ATOM 11259 H HE22 . GLN A 1 19  ? 0.357   -6.376  9.974   1.00 0.00 ? 19  GLN A HE22 8  
ATOM 11260 N N    . ILE A 1 20  ? 2.344   -9.664  4.238   1.00 0.00 ? 20  ILE A N    8  
ATOM 11261 C CA   . ILE A 1 20  ? 3.470   -10.168 3.462   1.00 0.00 ? 20  ILE A CA   8  
ATOM 11262 C C    . ILE A 1 20  ? 4.080   -9.068  2.600   1.00 0.00 ? 20  ILE A C    8  
ATOM 11263 O O    . ILE A 1 20  ? 5.302   -8.960  2.484   1.00 0.00 ? 20  ILE A O    8  
ATOM 11264 C CB   . ILE A 1 20  ? 3.050   -11.340 2.556   1.00 0.00 ? 20  ILE A CB   8  
ATOM 11265 C CG1  . ILE A 1 20  ? 2.462   -12.477 3.395   1.00 0.00 ? 20  ILE A CG1  8  
ATOM 11266 C CG2  . ILE A 1 20  ? 4.237   -11.834 1.743   1.00 0.00 ? 20  ILE A CG2  8  
ATOM 11267 C CD1  . ILE A 1 20  ? 1.419   -13.292 2.663   1.00 0.00 ? 20  ILE A CD1  8  
ATOM 11268 H H    . ILE A 1 20  ? 1.463   -10.076 4.125   1.00 0.00 ? 20  ILE A H    8  
ATOM 11269 H HA   . ILE A 1 20  ? 4.219   -10.525 4.154   1.00 0.00 ? 20  ILE A HA   8  
ATOM 11270 H HB   . ILE A 1 20  ? 2.298   -10.983 1.869   1.00 0.00 ? 20  ILE A HB   8  
ATOM 11271 H HG12 . ILE A 1 20  ? 3.255   -13.144 3.692   1.00 0.00 ? 20  ILE A HG12 8  
ATOM 11272 H HG13 . ILE A 1 20  ? 1.999   -12.060 4.278   1.00 0.00 ? 20  ILE A HG13 8  
ATOM 11273 H HG21 . ILE A 1 20  ? 3.932   -12.670 1.131   1.00 0.00 ? 20  ILE A HG21 8  
ATOM 11274 H HG22 . ILE A 1 20  ? 4.595   -11.037 1.109   1.00 0.00 ? 20  ILE A HG22 8  
ATOM 11275 H HG23 . ILE A 1 20  ? 5.026   -12.145 2.411   1.00 0.00 ? 20  ILE A HG23 8  
ATOM 11276 H HD11 . ILE A 1 20  ? 0.472   -13.210 3.175   1.00 0.00 ? 20  ILE A HD11 8  
ATOM 11277 H HD12 . ILE A 1 20  ? 1.317   -12.923 1.653   1.00 0.00 ? 20  ILE A HD12 8  
ATOM 11278 H HD13 . ILE A 1 20  ? 1.725   -14.328 2.637   1.00 0.00 ? 20  ILE A HD13 8  
ATOM 11279 N N    . LEU A 1 21  ? 3.222   -8.250  2.000   1.00 0.00 ? 21  LEU A N    8  
ATOM 11280 C CA   . LEU A 1 21  ? 3.676   -7.155  1.149   1.00 0.00 ? 21  LEU A CA   8  
ATOM 11281 C C    . LEU A 1 21  ? 4.534   -6.172  1.940   1.00 0.00 ? 21  LEU A C    8  
ATOM 11282 O O    . LEU A 1 21  ? 5.523   -5.646  1.429   1.00 0.00 ? 21  LEU A O    8  
ATOM 11283 C CB   . LEU A 1 21  ? 2.477   -6.427  0.538   1.00 0.00 ? 21  LEU A CB   8  
ATOM 11284 C CG   . LEU A 1 21  ? 1.398   -7.315  -0.081  1.00 0.00 ? 21  LEU A CG   8  
ATOM 11285 C CD1  . LEU A 1 21  ? 0.321   -6.466  -0.740  1.00 0.00 ? 21  LEU A CD1  8  
ATOM 11286 C CD2  . LEU A 1 21  ? 2.011   -8.277  -1.088  1.00 0.00 ? 21  LEU A CD2  8  
ATOM 11287 H H    . LEU A 1 21  ? 2.261   -8.385  2.131   1.00 0.00 ? 21  LEU A H    8  
ATOM 11288 H HA   . LEU A 1 21  ? 4.273   -7.578  0.355   1.00 0.00 ? 21  LEU A HA   8  
ATOM 11289 H HB2  . LEU A 1 21  ? 2.016   -5.840  1.317   1.00 0.00 ? 21  LEU A HB2  8  
ATOM 11290 H HB3  . LEU A 1 21  ? 2.850   -5.769  -0.234  1.00 0.00 ? 21  LEU A HB3  8  
ATOM 11291 H HG   . LEU A 1 21  ? 0.930   -7.900  0.699   1.00 0.00 ? 21  LEU A HG   8  
ATOM 11292 H HD11 . LEU A 1 21  ? 0.572   -6.309  -1.778  1.00 0.00 ? 21  LEU A HD11 8  
ATOM 11293 H HD12 . LEU A 1 21  ? 0.257   -5.513  -0.236  1.00 0.00 ? 21  LEU A HD12 8  
ATOM 11294 H HD13 . LEU A 1 21  ? -0.630  -6.974  -0.671  1.00 0.00 ? 21  LEU A HD13 8  
ATOM 11295 H HD21 . LEU A 1 21  ? 2.216   -7.751  -2.009  1.00 0.00 ? 21  LEU A HD21 8  
ATOM 11296 H HD22 . LEU A 1 21  ? 1.320   -9.085  -1.282  1.00 0.00 ? 21  LEU A HD22 8  
ATOM 11297 H HD23 . LEU A 1 21  ? 2.931   -8.677  -0.689  1.00 0.00 ? 21  LEU A HD23 8  
ATOM 11298 N N    . TYR A 1 22  ? 4.149   -5.930  3.188   1.00 0.00 ? 22  TYR A N    8  
ATOM 11299 C CA   . TYR A 1 22  ? 4.883   -5.009  4.049   1.00 0.00 ? 22  TYR A CA   8  
ATOM 11300 C C    . TYR A 1 22  ? 6.267   -5.558  4.378   1.00 0.00 ? 22  TYR A C    8  
ATOM 11301 O O    . TYR A 1 22  ? 7.270   -4.855  4.257   1.00 0.00 ? 22  TYR A O    8  
ATOM 11302 C CB   . TYR A 1 22  ? 4.102   -4.754  5.339   1.00 0.00 ? 22  TYR A CB   8  
ATOM 11303 C CG   . TYR A 1 22  ? 2.839   -3.950  5.134   1.00 0.00 ? 22  TYR A CG   8  
ATOM 11304 C CD1  . TYR A 1 22  ? 2.877   -2.562  5.072   1.00 0.00 ? 22  TYR A CD1  8  
ATOM 11305 C CD2  . TYR A 1 22  ? 1.606   -4.577  5.002   1.00 0.00 ? 22  TYR A CD2  8  
ATOM 11306 C CE1  . TYR A 1 22  ? 1.725   -1.823  4.885   1.00 0.00 ? 22  TYR A CE1  8  
ATOM 11307 C CE2  . TYR A 1 22  ? 0.449   -3.846  4.813   1.00 0.00 ? 22  TYR A CE2  8  
ATOM 11308 C CZ   . TYR A 1 22  ? 0.514   -2.470  4.756   1.00 0.00 ? 22  TYR A CZ   8  
ATOM 11309 O OH   . TYR A 1 22  ? -0.637  -1.738  4.569   1.00 0.00 ? 22  TYR A OH   8  
ATOM 11310 H H    . TYR A 1 22  ? 3.352   -6.379  3.538   1.00 0.00 ? 22  TYR A H    8  
ATOM 11311 H HA   . TYR A 1 22  ? 4.995   -4.076  3.517   1.00 0.00 ? 22  TYR A HA   8  
ATOM 11312 H HB2  . TYR A 1 22  ? 3.825   -5.700  5.777   1.00 0.00 ? 22  TYR A HB2  8  
ATOM 11313 H HB3  . TYR A 1 22  ? 4.732   -4.213  6.031   1.00 0.00 ? 22  TYR A HB3  8  
ATOM 11314 H HD1  . TYR A 1 22  ? 3.828   -2.058  5.174   1.00 0.00 ? 22  TYR A HD1  8  
ATOM 11315 H HD2  . TYR A 1 22  ? 1.559   -5.656  5.047   1.00 0.00 ? 22  TYR A HD2  8  
ATOM 11316 H HE1  . TYR A 1 22  ? 1.775   -0.745  4.840   1.00 0.00 ? 22  TYR A HE1  8  
ATOM 11317 H HE2  . TYR A 1 22  ? -0.500  -4.352  4.712   1.00 0.00 ? 22  TYR A HE2  8  
ATOM 11318 H HH   . TYR A 1 22  ? -1.053  -1.574  5.419   1.00 0.00 ? 22  TYR A HH   8  
ATOM 11319 N N    . GLN A 1 23  ? 6.313   -6.819  4.796   1.00 0.00 ? 23  GLN A N    8  
ATOM 11320 C CA   . GLN A 1 23  ? 7.574   -7.464  5.143   1.00 0.00 ? 23  GLN A CA   8  
ATOM 11321 C C    . GLN A 1 23  ? 8.578   -7.347  4.001   1.00 0.00 ? 23  GLN A C    8  
ATOM 11322 O O    . GLN A 1 23  ? 9.778   -7.202  4.229   1.00 0.00 ? 23  GLN A O    8  
ATOM 11323 C CB   . GLN A 1 23  ? 7.341   -8.936  5.485   1.00 0.00 ? 23  GLN A CB   8  
ATOM 11324 C CG   . GLN A 1 23  ? 7.055   -9.181  6.958   1.00 0.00 ? 23  GLN A CG   8  
ATOM 11325 C CD   . GLN A 1 23  ? 8.300   -9.092  7.817   1.00 0.00 ? 23  GLN A CD   8  
ATOM 11326 O OE1  . GLN A 1 23  ? 9.417   -9.010  7.306   1.00 0.00 ? 23  GLN A OE1  8  
ATOM 11327 N NE2  . GLN A 1 23  ? 8.114   -9.106  9.132   1.00 0.00 ? 23  GLN A NE2  8  
ATOM 11328 H H    . GLN A 1 23  ? 5.479   -7.328  4.872   1.00 0.00 ? 23  GLN A H    8  
ATOM 11329 H HA   . GLN A 1 23  ? 7.974   -6.961  6.011   1.00 0.00 ? 23  GLN A HA   8  
ATOM 11330 H HB2  . GLN A 1 23  ? 6.501   -9.299  4.911   1.00 0.00 ? 23  GLN A HB2  8  
ATOM 11331 H HB3  . GLN A 1 23  ? 8.222   -9.500  5.214   1.00 0.00 ? 23  GLN A HB3  8  
ATOM 11332 H HG2  . GLN A 1 23  ? 6.345   -8.443  7.301   1.00 0.00 ? 23  GLN A HG2  8  
ATOM 11333 H HG3  . GLN A 1 23  ? 6.628   -10.167 7.069   1.00 0.00 ? 23  GLN A HG3  8  
ATOM 11334 H HE21 . GLN A 1 23  ? 7.196   -9.175  9.469   1.00 0.00 ? 23  GLN A HE21 8  
ATOM 11335 H HE22 . GLN A 1 23  ? 8.902   -9.051  9.711   1.00 0.00 ? 23  GLN A HE22 8  
ATOM 11336 N N    . ALA A 1 24  ? 8.078   -7.410  2.771   1.00 0.00 ? 24  ALA A N    8  
ATOM 11337 C CA   . ALA A 1 24  ? 8.931   -7.310  1.594   1.00 0.00 ? 24  ALA A CA   8  
ATOM 11338 C C    . ALA A 1 24  ? 9.281   -5.857  1.292   1.00 0.00 ? 24  ALA A C    8  
ATOM 11339 O O    . ALA A 1 24  ? 10.440  -5.528  1.036   1.00 0.00 ? 24  ALA A O    8  
ATOM 11340 C CB   . ALA A 1 24  ? 8.250   -7.951  0.393   1.00 0.00 ? 24  ALA A CB   8  
ATOM 11341 H H    . ALA A 1 24  ? 7.112   -7.526  2.654   1.00 0.00 ? 24  ALA A H    8  
ATOM 11342 H HA   . ALA A 1 24  ? 9.842   -7.855  1.794   1.00 0.00 ? 24  ALA A HA   8  
ATOM 11343 H HB1  . ALA A 1 24  ? 7.249   -8.251  0.666   1.00 0.00 ? 24  ALA A HB1  8  
ATOM 11344 H HB2  . ALA A 1 24  ? 8.205   -7.239  -0.417  1.00 0.00 ? 24  ALA A HB2  8  
ATOM 11345 H HB3  . ALA A 1 24  ? 8.814   -8.818  0.081   1.00 0.00 ? 24  ALA A HB3  8  
ATOM 11346 N N    . TYR A 1 25  ? 8.274   -4.992  1.323   1.00 0.00 ? 25  TYR A N    8  
ATOM 11347 C CA   . TYR A 1 25  ? 8.475   -3.574  1.050   1.00 0.00 ? 25  TYR A CA   8  
ATOM 11348 C C    . TYR A 1 25  ? 9.416   -2.949  2.076   1.00 0.00 ? 25  TYR A C    8  
ATOM 11349 O O    . TYR A 1 25  ? 10.129  -1.990  1.779   1.00 0.00 ? 25  TYR A O    8  
ATOM 11350 C CB   . TYR A 1 25  ? 7.135   -2.836  1.055   1.00 0.00 ? 25  TYR A CB   8  
ATOM 11351 C CG   . TYR A 1 25  ? 7.229   -1.407  0.569   1.00 0.00 ? 25  TYR A CG   8  
ATOM 11352 C CD1  . TYR A 1 25  ? 7.865   -0.435  1.331   1.00 0.00 ? 25  TYR A CD1  8  
ATOM 11353 C CD2  . TYR A 1 25  ? 6.680   -1.029  -0.650  1.00 0.00 ? 25  TYR A CD2  8  
ATOM 11354 C CE1  . TYR A 1 25  ? 7.952   0.872   0.892   1.00 0.00 ? 25  TYR A CE1  8  
ATOM 11355 C CE2  . TYR A 1 25  ? 6.764   0.275   -1.097  1.00 0.00 ? 25  TYR A CE2  8  
ATOM 11356 C CZ   . TYR A 1 25  ? 7.401   1.222   -0.323  1.00 0.00 ? 25  TYR A CZ   8  
ATOM 11357 O OH   . TYR A 1 25  ? 7.485   2.522   -0.764  1.00 0.00 ? 25  TYR A OH   8  
ATOM 11358 H H    . TYR A 1 25  ? 7.373   -5.314  1.534   1.00 0.00 ? 25  TYR A H    8  
ATOM 11359 H HA   . TYR A 1 25  ? 8.920   -3.485  0.070   1.00 0.00 ? 25  TYR A HA   8  
ATOM 11360 H HB2  . TYR A 1 25  ? 6.442   -3.359  0.414   1.00 0.00 ? 25  TYR A HB2  8  
ATOM 11361 H HB3  . TYR A 1 25  ? 6.745   -2.820  2.062   1.00 0.00 ? 25  TYR A HB3  8  
ATOM 11362 H HD1  . TYR A 1 25  ? 8.296   -0.712  2.282   1.00 0.00 ? 25  TYR A HD1  8  
ATOM 11363 H HD2  . TYR A 1 25  ? 6.182   -1.774  -1.254  1.00 0.00 ? 25  TYR A HD2  8  
ATOM 11364 H HE1  . TYR A 1 25  ? 8.451   1.614   1.498   1.00 0.00 ? 25  TYR A HE1  8  
ATOM 11365 H HE2  . TYR A 1 25  ? 6.332   0.549   -2.048  1.00 0.00 ? 25  TYR A HE2  8  
ATOM 11366 H HH   . TYR A 1 25  ? 8.408   2.777   -0.835  1.00 0.00 ? 25  TYR A HH   8  
ATOM 11367 N N    . ASP A 1 26  ? 9.412   -3.501  3.284   1.00 0.00 ? 26  ASP A N    8  
ATOM 11368 C CA   . ASP A 1 26  ? 10.266  -3.001  4.356   1.00 0.00 ? 26  ASP A CA   8  
ATOM 11369 C C    . ASP A 1 26  ? 11.738  -3.250  4.040   1.00 0.00 ? 26  ASP A C    8  
ATOM 11370 O O    . ASP A 1 26  ? 12.616  -2.534  4.520   1.00 0.00 ? 26  ASP A O    8  
ATOM 11371 C CB   . ASP A 1 26  ? 9.897   -3.666  5.683   1.00 0.00 ? 26  ASP A CB   8  
ATOM 11372 C CG   . ASP A 1 26  ? 10.169  -2.769  6.875   1.00 0.00 ? 26  ASP A CG   8  
ATOM 11373 O OD1  . ASP A 1 26  ? 10.166  -1.533  6.700   1.00 0.00 ? 26  ASP A OD1  8  
ATOM 11374 O OD2  . ASP A 1 26  ? 10.384  -3.304  7.982   1.00 0.00 ? 26  ASP A OD2  8  
ATOM 11375 H H    . ASP A 1 26  ? 8.822   -4.264  3.460   1.00 0.00 ? 26  ASP A H    8  
ATOM 11376 H HA   . ASP A 1 26  ? 10.104  -1.937  4.440   1.00 0.00 ? 26  ASP A HA   8  
ATOM 11377 H HB2  . ASP A 1 26  ? 8.846   -3.913  5.675   1.00 0.00 ? 26  ASP A HB2  8  
ATOM 11378 H HB3  . ASP A 1 26  ? 10.475  -4.572  5.797   1.00 0.00 ? 26  ASP A HB3  8  
ATOM 11379 N N    . ARG A 1 27  ? 11.999  -4.270  3.229   1.00 0.00 ? 27  ARG A N    8  
ATOM 11380 C CA   . ARG A 1 27  ? 13.364  -4.615  2.851   1.00 0.00 ? 27  ARG A CA   8  
ATOM 11381 C C    . ARG A 1 27  ? 13.779  -3.878  1.581   1.00 0.00 ? 27  ARG A C    8  
ATOM 11382 O O    . ARG A 1 27  ? 14.855  -3.285  1.520   1.00 0.00 ? 27  ARG A O    8  
ATOM 11383 C CB   . ARG A 1 27  ? 13.492  -6.125  2.641   1.00 0.00 ? 27  ARG A CB   8  
ATOM 11384 C CG   . ARG A 1 27  ? 12.983  -6.948  3.814   1.00 0.00 ? 27  ARG A CG   8  
ATOM 11385 C CD   . ARG A 1 27  ? 13.258  -8.430  3.615   1.00 0.00 ? 27  ARG A CD   8  
ATOM 11386 N NE   . ARG A 1 27  ? 13.258  -9.161  4.880   1.00 0.00 ? 27  ARG A NE   8  
ATOM 11387 C CZ   . ARG A 1 27  ? 13.599  -10.440 4.989   1.00 0.00 ? 27  ARG A CZ   8  
ATOM 11388 N NH1  . ARG A 1 27  ? 13.965  -11.126 3.916   1.00 0.00 ? 27  ARG A NH1  8  
ATOM 11389 N NH2  . ARG A 1 27  ? 13.574  -11.036 6.175   1.00 0.00 ? 27  ARG A NH2  8  
ATOM 11390 H H    . ARG A 1 27  ? 11.256  -4.805  2.878   1.00 0.00 ? 27  ARG A H    8  
ATOM 11391 H HA   . ARG A 1 27  ? 14.017  -4.316  3.656   1.00 0.00 ? 27  ARG A HA   8  
ATOM 11392 H HB2  . ARG A 1 27  ? 12.928  -6.405  1.763   1.00 0.00 ? 27  ARG A HB2  8  
ATOM 11393 H HB3  . ARG A 1 27  ? 14.532  -6.368  2.484   1.00 0.00 ? 27  ARG A HB3  8  
ATOM 11394 H HG2  . ARG A 1 27  ? 13.479  -6.619  4.715   1.00 0.00 ? 27  ARG A HG2  8  
ATOM 11395 H HG3  . ARG A 1 27  ? 11.918  -6.798  3.911   1.00 0.00 ? 27  ARG A HG3  8  
ATOM 11396 H HD2  . ARG A 1 27  ? 12.493  -8.842  2.973   1.00 0.00 ? 27  ARG A HD2  8  
ATOM 11397 H HD3  . ARG A 1 27  ? 14.223  -8.544  3.144   1.00 0.00 ? 27  ARG A HD3  8  
ATOM 11398 H HE   . ARG A 1 27  ? 12.990  -8.673  5.686   1.00 0.00 ? 27  ARG A HE   8  
ATOM 11399 H HH11 . ARG A 1 27  ? 13.986  -10.680 3.021   1.00 0.00 ? 27  ARG A HH11 8  
ATOM 11400 H HH12 . ARG A 1 27  ? 14.223  -12.089 4.001   1.00 0.00 ? 27  ARG A HH12 8  
ATOM 11401 H HH21 . ARG A 1 27  ? 13.298  -10.522 6.987   1.00 0.00 ? 27  ARG A HH21 8  
ATOM 11402 H HH22 . ARG A 1 27  ? 13.831  -11.998 6.256   1.00 0.00 ? 27  ARG A HH22 8  
ATOM 11403 N N    . GLN A 1 28  ? 12.917  -3.921  0.569   1.00 0.00 ? 28  GLN A N    8  
ATOM 11404 C CA   . GLN A 1 28  ? 13.195  -3.259  -0.699  1.00 0.00 ? 28  GLN A CA   8  
ATOM 11405 C C    . GLN A 1 28  ? 11.970  -2.500  -1.197  1.00 0.00 ? 28  GLN A C    8  
ATOM 11406 O O    . GLN A 1 28  ? 10.854  -3.021  -1.180  1.00 0.00 ? 28  GLN A O    8  
ATOM 11407 C CB   . GLN A 1 28  ? 13.637  -4.282  -1.747  1.00 0.00 ? 28  GLN A CB   8  
ATOM 11408 C CG   . GLN A 1 28  ? 13.853  -3.684  -3.128  1.00 0.00 ? 28  GLN A CG   8  
ATOM 11409 C CD   . GLN A 1 28  ? 15.189  -2.979  -3.256  1.00 0.00 ? 28  GLN A CD   8  
ATOM 11410 O OE1  . GLN A 1 28  ? 15.409  -1.927  -2.655  1.00 0.00 ? 28  GLN A OE1  8  
ATOM 11411 N NE2  . GLN A 1 28  ? 16.091  -3.556  -4.042  1.00 0.00 ? 28  GLN A NE2  8  
ATOM 11412 H H    . GLN A 1 28  ? 12.076  -4.410  0.679   1.00 0.00 ? 28  GLN A H    8  
ATOM 11413 H HA   . GLN A 1 28  ? 13.997  -2.555  -0.536  1.00 0.00 ? 28  GLN A HA   8  
ATOM 11414 H HB2  . GLN A 1 28  ? 14.563  -4.733  -1.424  1.00 0.00 ? 28  GLN A HB2  8  
ATOM 11415 H HB3  . GLN A 1 28  ? 12.881  -5.048  -1.826  1.00 0.00 ? 28  GLN A HB3  8  
ATOM 11416 H HG2  . GLN A 1 28  ? 13.811  -4.476  -3.860  1.00 0.00 ? 28  GLN A HG2  8  
ATOM 11417 H HG3  . GLN A 1 28  ? 13.066  -2.971  -3.324  1.00 0.00 ? 28  GLN A HG3  8  
ATOM 11418 H HE21 . GLN A 1 28  ? 15.845  -4.393  -4.489  1.00 0.00 ? 28  GLN A HE21 8  
ATOM 11419 H HE22 . GLN A 1 28  ? 16.962  -3.122  -4.143  1.00 0.00 ? 28  GLN A HE22 8  
ATOM 11420 N N    . LYS A 1 29  ? 12.184  -1.266  -1.641  1.00 0.00 ? 29  LYS A N    8  
ATOM 11421 C CA   . LYS A 1 29  ? 11.097  -0.434  -2.145  1.00 0.00 ? 29  LYS A CA   8  
ATOM 11422 C C    . LYS A 1 29  ? 10.727  -0.828  -3.571  1.00 0.00 ? 29  LYS A C    8  
ATOM 11423 O O    . LYS A 1 29  ? 9.555   -0.815  -3.944  1.00 0.00 ? 29  LYS A O    8  
ATOM 11424 C CB   . LYS A 1 29  ? 11.495  1.043   -2.099  1.00 0.00 ? 29  LYS A CB   8  
ATOM 11425 C CG   . LYS A 1 29  ? 12.060  1.480   -0.759  1.00 0.00 ? 29  LYS A CG   8  
ATOM 11426 C CD   . LYS A 1 29  ? 10.963  1.946   0.184   1.00 0.00 ? 29  LYS A CD   8  
ATOM 11427 C CE   . LYS A 1 29  ? 11.372  1.783   1.640   1.00 0.00 ? 29  LYS A CE   8  
ATOM 11428 N NZ   . LYS A 1 29  ? 12.105  2.977   2.146   1.00 0.00 ? 29  LYS A NZ   8  
ATOM 11429 H H    . LYS A 1 29  ? 13.096  -0.905  -1.629  1.00 0.00 ? 29  LYS A H    8  
ATOM 11430 H HA   . LYS A 1 29  ? 10.239  -0.587  -1.508  1.00 0.00 ? 29  LYS A HA   8  
ATOM 11431 H HB2  . LYS A 1 29  ? 12.241  1.226   -2.858  1.00 0.00 ? 29  LYS A HB2  8  
ATOM 11432 H HB3  . LYS A 1 29  ? 10.623  1.645   -2.312  1.00 0.00 ? 29  LYS A HB3  8  
ATOM 11433 H HG2  . LYS A 1 29  ? 12.577  0.646   -0.307  1.00 0.00 ? 29  LYS A HG2  8  
ATOM 11434 H HG3  . LYS A 1 29  ? 12.754  2.293   -0.918  1.00 0.00 ? 29  LYS A HG3  8  
ATOM 11435 H HD2  . LYS A 1 29  ? 10.756  2.989   -0.006  1.00 0.00 ? 29  LYS A HD2  8  
ATOM 11436 H HD3  . LYS A 1 29  ? 10.072  1.362   0.002   1.00 0.00 ? 29  LYS A HD3  8  
ATOM 11437 H HE2  . LYS A 1 29  ? 10.484  1.637   2.235   1.00 0.00 ? 29  LYS A HE2  8  
ATOM 11438 H HE3  . LYS A 1 29  ? 12.010  0.916   1.726   1.00 0.00 ? 29  LYS A HE3  8  
ATOM 11439 H HZ1  . LYS A 1 29  ? 13.058  2.704   2.460   1.00 0.00 ? 29  LYS A HZ1  8  
ATOM 11440 H HZ2  . LYS A 1 29  ? 11.594  3.394   2.950   1.00 0.00 ? 29  LYS A HZ2  8  
ATOM 11441 H HZ3  . LYS A 1 29  ? 12.190  3.690   1.395   1.00 0.00 ? 29  LYS A HZ3  8  
ATOM 11442 N N    . ASN A 1 30  ? 11.735  -1.179  -4.363  1.00 0.00 ? 30  ASN A N    8  
ATOM 11443 C CA   . ASN A 1 30  ? 11.515  -1.578  -5.749  1.00 0.00 ? 30  ASN A CA   8  
ATOM 11444 C C    . ASN A 1 30  ? 11.771  -3.071  -5.932  1.00 0.00 ? 30  ASN A C    8  
ATOM 11445 O O    . ASN A 1 30  ? 12.852  -3.495  -6.343  1.00 0.00 ? 30  ASN A O    8  
ATOM 11446 C CB   . ASN A 1 30  ? 12.422  -0.775  -6.683  1.00 0.00 ? 30  ASN A CB   8  
ATOM 11447 C CG   . ASN A 1 30  ? 12.364  0.715   -6.404  1.00 0.00 ? 30  ASN A CG   8  
ATOM 11448 O OD1  . ASN A 1 30  ? 11.590  1.444   -7.024  1.00 0.00 ? 30  ASN A OD1  8  
ATOM 11449 N ND2  . ASN A 1 30  ? 13.187  1.173   -5.468  1.00 0.00 ? 30  ASN A ND2  8  
ATOM 11450 H H    . ASN A 1 30  ? 12.648  -1.170  -4.008  1.00 0.00 ? 30  ASN A H    8  
ATOM 11451 H HA   . ASN A 1 30  ? 10.484  -1.369  -5.994  1.00 0.00 ? 30  ASN A HA   8  
ATOM 11452 H HB2  . ASN A 1 30  ? 13.442  -1.106  -6.557  1.00 0.00 ? 30  ASN A HB2  8  
ATOM 11453 H HB3  . ASN A 1 30  ? 12.117  -0.944  -7.705  1.00 0.00 ? 30  ASN A HB3  8  
ATOM 11454 H HD21 . ASN A 1 30  ? 13.776  0.534   -5.015  1.00 0.00 ? 30  ASN A HD21 8  
ATOM 11455 H HD22 . ASN A 1 30  ? 13.170  2.132   -5.267  1.00 0.00 ? 30  ASN A HD22 8  
ATOM 11456 N N    . PRO A 1 31  ? 10.754  -3.889  -5.622  1.00 0.00 ? 31  PRO A N    8  
ATOM 11457 C CA   . PRO A 1 31  ? 10.844  -5.347  -5.746  1.00 0.00 ? 31  PRO A CA   8  
ATOM 11458 C C    . PRO A 1 31  ? 10.897  -5.803  -7.200  1.00 0.00 ? 31  PRO A C    8  
ATOM 11459 O O    . PRO A 1 31  ? 10.074  -5.392  -8.019  1.00 0.00 ? 31  PRO A O    8  
ATOM 11460 C CB   . PRO A 1 31  ? 9.559   -5.840  -5.077  1.00 0.00 ? 31  PRO A CB   8  
ATOM 11461 C CG   . PRO A 1 31  ? 8.605   -4.703  -5.205  1.00 0.00 ? 31  PRO A CG   8  
ATOM 11462 C CD   . PRO A 1 31  ? 9.437   -3.453  -5.128  1.00 0.00 ? 31  PRO A CD   8  
ATOM 11463 H HA   . PRO A 1 31  ? 11.701  -5.737  -5.217  1.00 0.00 ? 31  PRO A HA   8  
ATOM 11464 H HB2  . PRO A 1 31  ? 9.198   -6.720  -5.590  1.00 0.00 ? 31  PRO A HB2  8  
ATOM 11465 H HB3  . PRO A 1 31  ? 9.755   -6.075  -4.042  1.00 0.00 ? 31  PRO A HB3  8  
ATOM 11466 H HG2  . PRO A 1 31  ? 8.096   -4.756  -6.155  1.00 0.00 ? 31  PRO A HG2  8  
ATOM 11467 H HG3  . PRO A 1 31  ? 7.892   -4.729  -4.394  1.00 0.00 ? 31  PRO A HG3  8  
ATOM 11468 H HD2  . PRO A 1 31  ? 9.022   -2.683  -5.761  1.00 0.00 ? 31  PRO A HD2  8  
ATOM 11469 H HD3  . PRO A 1 31  ? 9.505   -3.107  -4.106  1.00 0.00 ? 31  PRO A HD3  8  
ATOM 11470 N N    . SER A 1 32  ? 11.868  -6.654  -7.514  1.00 0.00 ? 32  SER A N    8  
ATOM 11471 C CA   . SER A 1 32  ? 12.029  -7.164  -8.871  1.00 0.00 ? 32  SER A CA   8  
ATOM 11472 C C    . SER A 1 32  ? 11.321  -8.505  -9.035  1.00 0.00 ? 32  SER A C    8  
ATOM 11473 O O    . SER A 1 32  ? 10.792  -9.063  -8.074  1.00 0.00 ? 32  SER A O    8  
ATOM 11474 C CB   . SER A 1 32  ? 13.513  -7.313  -9.209  1.00 0.00 ? 32  SER A CB   8  
ATOM 11475 O OG   . SER A 1 32  ? 14.046  -6.100  -9.712  1.00 0.00 ? 32  SER A OG   8  
ATOM 11476 H H    . SER A 1 32  ? 12.492  -6.945  -6.817  1.00 0.00 ? 32  SER A H    8  
ATOM 11477 H HA   . SER A 1 32  ? 11.584  -6.450  -9.548  1.00 0.00 ? 32  SER A HA   8  
ATOM 11478 H HB2  . SER A 1 32  ? 14.057  -7.589  -8.319  1.00 0.00 ? 32  SER A HB2  8  
ATOM 11479 H HB3  . SER A 1 32  ? 13.633  -8.083  -9.958  1.00 0.00 ? 32  SER A HB3  8  
ATOM 11480 H HG   . SER A 1 32  ? 13.361  -5.620  -10.183 1.00 0.00 ? 32  SER A HG   8  
ATOM 11481 N N    . LYS A 1 33  ? 11.314  -9.017  -10.261 1.00 0.00 ? 33  LYS A N    8  
ATOM 11482 C CA   . LYS A 1 33  ? 10.673  -10.293 -10.555 1.00 0.00 ? 33  LYS A CA   8  
ATOM 11483 C C    . LYS A 1 33  ? 10.842  -11.267 -9.393  1.00 0.00 ? 33  LYS A C    8  
ATOM 11484 O O    . LYS A 1 33  ? 9.903   -11.969 -9.019  1.00 0.00 ? 33  LYS A O    8  
ATOM 11485 C CB   . LYS A 1 33  ? 11.258  -10.900 -11.832 1.00 0.00 ? 33  LYS A CB   8  
ATOM 11486 C CG   . LYS A 1 33  ? 10.872  -12.353 -12.047 1.00 0.00 ? 33  LYS A CG   8  
ATOM 11487 C CD   . LYS A 1 33  ? 10.805  -12.699 -13.525 1.00 0.00 ? 33  LYS A CD   8  
ATOM 11488 C CE   . LYS A 1 33  ? 10.313  -14.122 -13.743 1.00 0.00 ? 33  LYS A CE   8  
ATOM 11489 N NZ   . LYS A 1 33  ? 10.107  -14.423 -15.186 1.00 0.00 ? 33  LYS A NZ   8  
ATOM 11490 H H    . LYS A 1 33  ? 11.753  -8.524  -10.987 1.00 0.00 ? 33  LYS A H    8  
ATOM 11491 H HA   . LYS A 1 33  ? 9.620   -10.109 -10.704 1.00 0.00 ? 33  LYS A HA   8  
ATOM 11492 H HB2  . LYS A 1 33  ? 10.912  -10.328 -12.680 1.00 0.00 ? 33  LYS A HB2  8  
ATOM 11493 H HB3  . LYS A 1 33  ? 12.336  -10.839 -11.783 1.00 0.00 ? 33  LYS A HB3  8  
ATOM 11494 H HG2  . LYS A 1 33  ? 11.608  -12.986 -11.573 1.00 0.00 ? 33  LYS A HG2  8  
ATOM 11495 H HG3  . LYS A 1 33  ? 9.903   -12.528 -11.601 1.00 0.00 ? 33  LYS A HG3  8  
ATOM 11496 H HD2  . LYS A 1 33  ? 10.126  -12.017 -14.015 1.00 0.00 ? 33  LYS A HD2  8  
ATOM 11497 H HD3  . LYS A 1 33  ? 11.792  -12.599 -13.955 1.00 0.00 ? 33  LYS A HD3  8  
ATOM 11498 H HE2  . LYS A 1 33  ? 11.045  -14.807 -13.342 1.00 0.00 ? 33  LYS A HE2  8  
ATOM 11499 H HE3  . LYS A 1 33  ? 9.377   -14.249 -13.220 1.00 0.00 ? 33  LYS A HE3  8  
ATOM 11500 H HZ1  . LYS A 1 33  ? 10.797  -15.133 -15.505 1.00 0.00 ? 33  LYS A HZ1  8  
ATOM 11501 H HZ2  . LYS A 1 33  ? 10.230  -13.559 -15.753 1.00 0.00 ? 33  LYS A HZ2  8  
ATOM 11502 H HZ3  . LYS A 1 33  ? 9.148   -14.793 -15.341 1.00 0.00 ? 33  LYS A HZ3  8  
ATOM 11503 N N    . GLU A 1 34  ? 12.044  -11.302 -8.826  1.00 0.00 ? 34  GLU A N    8  
ATOM 11504 C CA   . GLU A 1 34  ? 12.334  -12.189 -7.706  1.00 0.00 ? 34  GLU A CA   8  
ATOM 11505 C C    . GLU A 1 34  ? 11.568  -11.759 -6.458  1.00 0.00 ? 34  GLU A C    8  
ATOM 11506 O O    . GLU A 1 34  ? 10.760  -12.517 -5.921  1.00 0.00 ? 34  GLU A O    8  
ATOM 11507 C CB   . GLU A 1 34  ? 13.836  -12.206 -7.415  1.00 0.00 ? 34  GLU A CB   8  
ATOM 11508 C CG   . GLU A 1 34  ? 14.613  -13.182 -8.282  1.00 0.00 ? 34  GLU A CG   8  
ATOM 11509 C CD   . GLU A 1 34  ? 14.423  -14.623 -7.851  1.00 0.00 ? 34  GLU A CD   8  
ATOM 11510 O OE1  . GLU A 1 34  ? 13.262  -15.080 -7.801  1.00 0.00 ? 34  GLU A OE1  8  
ATOM 11511 O OE2  . GLU A 1 34  ? 15.436  -15.295 -7.564  1.00 0.00 ? 34  GLU A OE2  8  
ATOM 11512 H H    . GLU A 1 34  ? 12.752  -10.717 -9.169  1.00 0.00 ? 34  GLU A H    8  
ATOM 11513 H HA   . GLU A 1 34  ? 12.019  -13.184 -7.981  1.00 0.00 ? 34  GLU A HA   8  
ATOM 11514 H HB2  . GLU A 1 34  ? 14.233  -11.215 -7.579  1.00 0.00 ? 34  GLU A HB2  8  
ATOM 11515 H HB3  . GLU A 1 34  ? 13.986  -12.477 -6.380  1.00 0.00 ? 34  GLU A HB3  8  
ATOM 11516 H HG2  . GLU A 1 34  ? 14.279  -13.081 -9.303  1.00 0.00 ? 34  GLU A HG2  8  
ATOM 11517 H HG3  . GLU A 1 34  ? 15.664  -12.939 -8.222  1.00 0.00 ? 34  GLU A HG3  8  
ATOM 11518 N N    . GLU A 1 35  ? 11.828  -10.537 -6.003  1.00 0.00 ? 35  GLU A N    8  
ATOM 11519 C CA   . GLU A 1 35  ? 11.164  -10.007 -4.818  1.00 0.00 ? 35  GLU A CA   8  
ATOM 11520 C C    . GLU A 1 35  ? 9.647   -10.090 -4.961  1.00 0.00 ? 35  GLU A C    8  
ATOM 11521 O O    . GLU A 1 35  ? 8.977   -10.775 -4.188  1.00 0.00 ? 35  GLU A O    8  
ATOM 11522 C CB   . GLU A 1 35  ? 11.586  -8.556  -4.576  1.00 0.00 ? 35  GLU A CB   8  
ATOM 11523 C CG   . GLU A 1 35  ? 13.031  -8.409  -4.130  1.00 0.00 ? 35  GLU A CG   8  
ATOM 11524 C CD   . GLU A 1 35  ? 13.194  -8.536  -2.628  1.00 0.00 ? 35  GLU A CD   8  
ATOM 11525 O OE1  . GLU A 1 35  ? 12.401  -9.272  -2.005  1.00 0.00 ? 35  GLU A OE1  8  
ATOM 11526 O OE2  . GLU A 1 35  ? 14.115  -7.898  -2.075  1.00 0.00 ? 35  GLU A OE2  8  
ATOM 11527 H H    . GLU A 1 35  ? 12.482  -9.980  -6.474  1.00 0.00 ? 35  GLU A H    8  
ATOM 11528 H HA   . GLU A 1 35  ? 11.467  -10.605 -3.972  1.00 0.00 ? 35  GLU A HA   8  
ATOM 11529 H HB2  . GLU A 1 35  ? 11.454  -7.998  -5.491  1.00 0.00 ? 35  GLU A HB2  8  
ATOM 11530 H HB3  . GLU A 1 35  ? 10.951  -8.132  -3.812  1.00 0.00 ? 35  GLU A HB3  8  
ATOM 11531 H HG2  . GLU A 1 35  ? 13.621  -9.176  -4.607  1.00 0.00 ? 35  GLU A HG2  8  
ATOM 11532 H HG3  . GLU A 1 35  ? 13.391  -7.437  -4.435  1.00 0.00 ? 35  GLU A HG3  8  
ATOM 11533 N N    . ARG A 1 36  ? 9.113   -9.386  -5.954  1.00 0.00 ? 36  ARG A N    8  
ATOM 11534 C CA   . ARG A 1 36  ? 7.676   -9.379  -6.198  1.00 0.00 ? 36  ARG A CA   8  
ATOM 11535 C C    . ARG A 1 36  ? 7.114   -10.797 -6.186  1.00 0.00 ? 36  ARG A C    8  
ATOM 11536 O O    . ARG A 1 36  ? 6.129   -11.079 -5.505  1.00 0.00 ? 36  ARG A O    8  
ATOM 11537 C CB   . ARG A 1 36  ? 7.368   -8.708  -7.538  1.00 0.00 ? 36  ARG A CB   8  
ATOM 11538 C CG   . ARG A 1 36  ? 7.295   -7.192  -7.459  1.00 0.00 ? 36  ARG A CG   8  
ATOM 11539 C CD   . ARG A 1 36  ? 6.572   -6.606  -8.661  1.00 0.00 ? 36  ARG A CD   8  
ATOM 11540 N NE   . ARG A 1 36  ? 7.488   -6.306  -9.758  1.00 0.00 ? 36  ARG A NE   8  
ATOM 11541 C CZ   . ARG A 1 36  ? 7.114   -6.239  -11.031 1.00 0.00 ? 36  ARG A CZ   8  
ATOM 11542 N NH1  . ARG A 1 36  ? 5.849   -6.450  -11.365 1.00 0.00 ? 36  ARG A NH1  8  
ATOM 11543 N NH2  . ARG A 1 36  ? 8.007   -5.961  -11.972 1.00 0.00 ? 36  ARG A NH2  8  
ATOM 11544 H H    . ARG A 1 36  ? 9.699   -8.860  -6.536  1.00 0.00 ? 36  ARG A H    8  
ATOM 11545 H HA   . ARG A 1 36  ? 7.208   -8.812  -5.407  1.00 0.00 ? 36  ARG A HA   8  
ATOM 11546 H HB2  . ARG A 1 36  ? 8.140   -8.973  -8.246  1.00 0.00 ? 36  ARG A HB2  8  
ATOM 11547 H HB3  . ARG A 1 36  ? 6.419   -9.074  -7.901  1.00 0.00 ? 36  ARG A HB3  8  
ATOM 11548 H HG2  . ARG A 1 36  ? 6.763   -6.913  -6.562  1.00 0.00 ? 36  ARG A HG2  8  
ATOM 11549 H HG3  . ARG A 1 36  ? 8.298   -6.794  -7.423  1.00 0.00 ? 36  ARG A HG3  8  
ATOM 11550 H HD2  . ARG A 1 36  ? 5.836   -7.317  -9.004  1.00 0.00 ? 36  ARG A HD2  8  
ATOM 11551 H HD3  . ARG A 1 36  ? 6.078   -5.695  -8.358  1.00 0.00 ? 36  ARG A HD3  8  
ATOM 11552 H HE   . ARG A 1 36  ? 8.428   -6.146  -9.533  1.00 0.00 ? 36  ARG A HE   8  
ATOM 11553 H HH11 . ARG A 1 36  ? 5.174   -6.659  -10.658 1.00 0.00 ? 36  ARG A HH11 8  
ATOM 11554 H HH12 . ARG A 1 36  ? 5.569   -6.398  -12.324 1.00 0.00 ? 36  ARG A HH12 8  
ATOM 11555 H HH21 . ARG A 1 36  ? 8.962   -5.801  -11.724 1.00 0.00 ? 36  ARG A HH21 8  
ATOM 11556 H HH22 . ARG A 1 36  ? 7.724   -5.911  -12.930 1.00 0.00 ? 36  ARG A HH22 8  
ATOM 11557 N N    . GLU A 1 37  ? 7.749   -11.686 -6.945  1.00 0.00 ? 37  GLU A N    8  
ATOM 11558 C CA   . GLU A 1 37  ? 7.311   -13.075 -7.021  1.00 0.00 ? 37  GLU A CA   8  
ATOM 11559 C C    . GLU A 1 37  ? 7.138   -13.669 -5.626  1.00 0.00 ? 37  GLU A C    8  
ATOM 11560 O O    . GLU A 1 37  ? 6.087   -14.219 -5.300  1.00 0.00 ? 37  GLU A O    8  
ATOM 11561 C CB   . GLU A 1 37  ? 8.316   -13.906 -7.821  1.00 0.00 ? 37  GLU A CB   8  
ATOM 11562 C CG   . GLU A 1 37  ? 8.112   -13.828 -9.324  1.00 0.00 ? 37  GLU A CG   8  
ATOM 11563 C CD   . GLU A 1 37  ? 7.083   -14.823 -9.825  1.00 0.00 ? 37  GLU A CD   8  
ATOM 11564 O OE1  . GLU A 1 37  ? 7.434   -16.012 -9.979  1.00 0.00 ? 37  GLU A OE1  8  
ATOM 11565 O OE2  . GLU A 1 37  ? 5.928   -14.414 -10.064 1.00 0.00 ? 37  GLU A OE2  8  
ATOM 11566 H H    . GLU A 1 37  ? 8.528   -11.401 -7.465  1.00 0.00 ? 37  GLU A H    8  
ATOM 11567 H HA   . GLU A 1 37  ? 6.358   -13.095 -7.528  1.00 0.00 ? 37  GLU A HA   8  
ATOM 11568 H HB2  . GLU A 1 37  ? 9.314   -13.558 -7.595  1.00 0.00 ? 37  GLU A HB2  8  
ATOM 11569 H HB3  . GLU A 1 37  ? 8.230   -14.940 -7.520  1.00 0.00 ? 37  GLU A HB3  8  
ATOM 11570 H HG2  . GLU A 1 37  ? 7.780   -12.833 -9.579  1.00 0.00 ? 37  GLU A HG2  8  
ATOM 11571 H HG3  . GLU A 1 37  ? 9.053   -14.029 -9.814  1.00 0.00 ? 37  GLU A HG3  8  
ATOM 11572 N N    . ALA A 1 38  ? 8.