data_2DAZ
# 
_entry.id   2DAZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DAZ         
RCSB  RCSB025200   
WWPDB D_1000025200 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hso003006830.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DAZ 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-14 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Inoue, K.'                                              1 
'Nagashima, T.'                                          2 
'Izumi, K.'                                              3 
'Hayashi, F.'                                            4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the 7th PDZ domain of InaD-like protein' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Inoue, K.'     1 
primary 'Nagashima, T.' 2 
primary 'Izumi, K.'     3 
primary 'Hayashi, F.'   4 
primary 'Yokoyama, S.'  5 
# 
_cell.entry_id           2DAZ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2DAZ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'InaD-like protein' 
_entity.formula_weight             13267.878 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PDZ domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Inadl protein, hINADL, Pals1-associated tight junction protein, Protein associated to tight junctions' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGDAFTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEIN
NQILYGRSHQNASAIIKTAPSKVKLVFIRNEDAVNQMASGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGDAFTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEIN
NQILYGRSHQNASAIIKTAPSKVKLVFIRNEDAVNQMASGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hso003006830.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ASP n 
1 9   ALA n 
1 10  PHE n 
1 11  THR n 
1 12  ASP n 
1 13  GLN n 
1 14  LYS n 
1 15  ILE n 
1 16  ARG n 
1 17  GLN n 
1 18  ARG n 
1 19  TYR n 
1 20  ALA n 
1 21  ASP n 
1 22  LEU n 
1 23  PRO n 
1 24  GLY n 
1 25  GLU n 
1 26  LEU n 
1 27  HIS n 
1 28  ILE n 
1 29  ILE n 
1 30  GLU n 
1 31  LEU n 
1 32  GLU n 
1 33  LYS n 
1 34  ASP n 
1 35  LYS n 
1 36  ASN n 
1 37  GLY n 
1 38  LEU n 
1 39  GLY n 
1 40  LEU n 
1 41  SER n 
1 42  LEU n 
1 43  ALA n 
1 44  GLY n 
1 45  ASN n 
1 46  LYS n 
1 47  ASP n 
1 48  ARG n 
1 49  SER n 
1 50  ARG n 
1 51  MET n 
1 52  SER n 
1 53  ILE n 
1 54  PHE n 
1 55  VAL n 
1 56  VAL n 
1 57  GLY n 
1 58  ILE n 
1 59  ASN n 
1 60  PRO n 
1 61  GLU n 
1 62  GLY n 
1 63  PRO n 
1 64  ALA n 
1 65  ALA n 
1 66  ALA n 
1 67  ASP n 
1 68  GLY n 
1 69  ARG n 
1 70  MET n 
1 71  ARG n 
1 72  ILE n 
1 73  GLY n 
1 74  ASP n 
1 75  GLU n 
1 76  LEU n 
1 77  LEU n 
1 78  GLU n 
1 79  ILE n 
1 80  ASN n 
1 81  ASN n 
1 82  GLN n 
1 83  ILE n 
1 84  LEU n 
1 85  TYR n 
1 86  GLY n 
1 87  ARG n 
1 88  SER n 
1 89  HIS n 
1 90  GLN n 
1 91  ASN n 
1 92  ALA n 
1 93  SER n 
1 94  ALA n 
1 95  ILE n 
1 96  ILE n 
1 97  LYS n 
1 98  THR n 
1 99  ALA n 
1 100 PRO n 
1 101 SER n 
1 102 LYS n 
1 103 VAL n 
1 104 LYS n 
1 105 LEU n 
1 106 VAL n 
1 107 PHE n 
1 108 ILE n 
1 109 ARG n 
1 110 ASN n 
1 111 GLU n 
1 112 ASP n 
1 113 ALA n 
1 114 VAL n 
1 115 ASN n 
1 116 GLN n 
1 117 MET n 
1 118 ALA n 
1 119 SER n 
1 120 GLY n 
1 121 PRO n 
1 122 SER n 
1 123 SER n 
1 124 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'INADL, PATJ' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cell free synthesis' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050302-33 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    INADL_HUMAN 
_struct_ref.pdbx_db_accession          Q8NI35 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1219 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DAZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 118 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8NI35 
_struct_ref_seq.db_align_beg                  1219 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1329 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       118 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DAZ GLY A 1   ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 1   1  
1 2DAZ SER A 2   ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 2   2  
1 2DAZ SER A 3   ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 3   3  
1 2DAZ GLY A 4   ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 4   4  
1 2DAZ SER A 5   ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 5   5  
1 2DAZ SER A 6   ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 6   6  
1 2DAZ GLY A 7   ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 7   7  
1 2DAZ SER A 119 ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 119 8  
1 2DAZ GLY A 120 ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 120 9  
1 2DAZ PRO A 121 ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 121 10 
1 2DAZ SER A 122 ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 122 11 
1 2DAZ SER A 123 ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 123 12 
1 2DAZ GLY A 124 ? UNP Q8NI35 ? ? 'CLONING ARTIFACT' 124 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.28mM U-15N,13C-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2DAZ 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2DAZ 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function,structures with the lowest energy,structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DAZ 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.93191  'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2DAZ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DAZ 
_struct.title                     'Solution structure of the 7th PDZ domain of InaD-like protein' 
_struct.pdbx_descriptor           'InaD-like protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DAZ 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;PDZ domain, InaD-like protein, Inadl protein, hINADL, Pals1-associated tight junction protein, Protein associated to tight junctions, INADL, PATJ, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 11  ? TYR A 19  ? THR A 11  TYR A 19  1 ? 9  
HELX_P HELX_P2 2 GLY A 62  ? GLY A 68  ? GLY A 62  GLY A 68  1 ? 7  
HELX_P HELX_P3 3 SER A 88  ? ALA A 99  ? SER A 88  ALA A 99  1 ? 12 
HELX_P HELX_P4 4 ASP A 112 ? MET A 117 ? ASP A 112 MET A 117 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 25  ? GLU A 32  ? GLU A 25  GLU A 32  
A 2 LYS A 102 ? ARG A 109 ? LYS A 102 ARG A 109 
A 3 GLU A 75  ? ILE A 79  ? GLU A 75  ILE A 79  
B 1 LEU A 40  ? ALA A 43  ? LEU A 40  ALA A 43  
B 2 ILE A 53  ? ILE A 58  ? ILE A 53  ILE A 58  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS A 27  ? N HIS A 27  O PHE A 107 ? O PHE A 107 
A 2 3 O VAL A 106 ? O VAL A 106 N GLU A 78  ? N GLU A 78  
B 1 2 N SER A 41  ? N SER A 41  O GLY A 57  ? O GLY A 57  
# 
_database_PDB_matrix.entry_id          2DAZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DAZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -9.856  -23.899 24.350  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -9.978  -22.828 25.321  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -9.815  -21.457 24.696  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -8.742  -20.858 24.769  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -9.421  -24.740 24.603  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -10.951 -22.887 25.786  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -9.220  -22.957 26.080  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -10.881 -20.960 24.078  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -10.850 -19.653 23.432  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -9.632  -19.525 22.523  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -8.975  -18.484 22.489  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -10.835 -18.541 24.483  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -12.078 -18.461 25.159  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -11.708 -21.486 24.053  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -11.743 -19.557 22.833  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -10.059 -18.743 25.206  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -10.639 -17.595 24.000  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -12.446 -17.581 25.048  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -9.336  -20.592 21.787  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -8.194  -20.602 20.880  1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -8.547  -21.303 19.571  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -9.103  -22.400 19.572  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -6.999  -21.296 21.537  1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -7.215  -22.692 21.643  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -9.897  -21.392 21.859  1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -7.931  -19.577 20.666  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -6.115  -21.124 20.943  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -6.852  -20.890 22.528  1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -6.635  -23.056 22.315  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -8.218  -20.658 18.455  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -8.508  -21.233 17.154  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -7.317  -21.178 16.218  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -6.258  -21.732 16.516  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -7.776  -19.786 18.516  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -8.802  -22.264 17.286  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -9.327  -20.690 16.708  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -7.489  -20.510 15.082  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -6.421  -20.389 14.097  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -5.346  -19.420 14.577  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -5.533  -18.203 14.547  1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -6.987  -19.918 12.756  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -6.133  -20.283 11.685  1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -8.357  -20.090 14.902  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -5.978  -21.365 13.968  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -7.955  -20.369 12.598  1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -7.089  -18.842 12.769  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -5.311  -19.792 11.750  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -4.219  -19.968 15.019  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -3.114  -19.152 15.510  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -2.193  -18.740 14.365  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -2.078  -19.442 13.362  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -2.318  -19.918 16.568  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -3.137  -20.263 17.672  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -4.129  -20.944 15.018  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -3.531  -18.264 15.959  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -1.922  -20.823 16.133  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -1.503  -19.301 16.919  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -2.717  -19.974 18.486  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -1.538  -17.594 14.524  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -0.636  -17.106 13.498  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -0.241  -15.658 13.713  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -0.861  -14.750 13.160  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -1.668  -17.075 15.346  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 0.255   -17.715 13.498  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -1.121  -17.195 12.537  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . ASP A 1 8   ? 0.792   -15.442 14.520  1.00 0.00 ? 8   ASP A N    1  
ATOM 67    C CA   . ASP A 1 8   ? 1.269   -14.095 14.807  1.00 0.00 ? 8   ASP A CA   1  
ATOM 68    C C    . ASP A 1 8   ? 2.318   -13.660 13.789  1.00 0.00 ? 8   ASP A C    1  
ATOM 69    O O    . ASP A 1 8   ? 3.315   -13.030 14.140  1.00 0.00 ? 8   ASP A O    1  
ATOM 70    C CB   . ASP A 1 8   ? 1.852   -14.028 16.219  1.00 0.00 ? 8   ASP A CB   1  
ATOM 71    C CG   . ASP A 1 8   ? 0.880   -14.523 17.272  1.00 0.00 ? 8   ASP A CG   1  
ATOM 72    O OD1  . ASP A 1 8   ? 0.386   -15.662 17.134  1.00 0.00 ? 8   ASP A OD1  1  
ATOM 73    O OD2  . ASP A 1 8   ? 0.612   -13.771 18.233  1.00 0.00 ? 8   ASP A OD2  1  
ATOM 74    H H    . ASP A 1 8   ? 1.245   -16.208 14.931  1.00 0.00 ? 8   ASP A H    1  
ATOM 75    H HA   . ASP A 1 8   ? 0.425   -13.424 14.745  1.00 0.00 ? 8   ASP A HA   1  
ATOM 76    H HB2  . ASP A 1 8   ? 2.743   -14.638 16.263  1.00 0.00 ? 8   ASP A HB2  1  
ATOM 77    H HB3  . ASP A 1 8   ? 2.111   -13.004 16.447  1.00 0.00 ? 8   ASP A HB3  1  
ATOM 78    N N    . ALA A 1 9   ? 2.087   -14.003 12.526  1.00 0.00 ? 9   ALA A N    1  
ATOM 79    C CA   . ALA A 1 9   ? 3.011   -13.648 11.456  1.00 0.00 ? 9   ALA A CA   1  
ATOM 80    C C    . ALA A 1 9   ? 2.643   -12.304 10.836  1.00 0.00 ? 9   ALA A C    1  
ATOM 81    O O    . ALA A 1 9   ? 3.380   -11.769 10.008  1.00 0.00 ? 9   ALA A O    1  
ATOM 82    C CB   . ALA A 1 9   ? 3.030   -14.735 10.392  1.00 0.00 ? 9   ALA A CB   1  
ATOM 83    H H    . ALA A 1 9   ? 1.274   -14.506 12.308  1.00 0.00 ? 9   ALA A H    1  
ATOM 84    H HA   . ALA A 1 9   ? 4.002   -13.577 11.881  1.00 0.00 ? 9   ALA A HA   1  
ATOM 85    H HB1  . ALA A 1 9   ? 4.035   -14.848 10.012  1.00 0.00 ? 9   ALA A HB1  1  
ATOM 86    H HB2  . ALA A 1 9   ? 2.701   -15.668 10.825  1.00 0.00 ? 9   ALA A HB2  1  
ATOM 87    H HB3  . ALA A 1 9   ? 2.368   -14.459 9.585   1.00 0.00 ? 9   ALA A HB3  1  
ATOM 88    N N    . PHE A 1 10  ? 1.498   -11.764 11.242  1.00 0.00 ? 10  PHE A N    1  
ATOM 89    C CA   . PHE A 1 10  ? 1.032   -10.483 10.724  1.00 0.00 ? 10  PHE A CA   1  
ATOM 90    C C    . PHE A 1 10  ? 1.220   -9.378  11.759  1.00 0.00 ? 10  PHE A C    1  
ATOM 91    O O    . PHE A 1 10  ? 0.678   -8.281  11.619  1.00 0.00 ? 10  PHE A O    1  
ATOM 92    C CB   . PHE A 1 10  ? -0.442  -10.577 10.325  1.00 0.00 ? 10  PHE A CB   1  
ATOM 93    C CG   . PHE A 1 10  ? -0.685  -11.457 9.132   1.00 0.00 ? 10  PHE A CG   1  
ATOM 94    C CD1  . PHE A 1 10  ? -0.561  -10.954 7.847   1.00 0.00 ? 10  PHE A CD1  1  
ATOM 95    C CD2  . PHE A 1 10  ? -1.037  -12.787 9.295   1.00 0.00 ? 10  PHE A CD2  1  
ATOM 96    C CE1  . PHE A 1 10  ? -0.785  -11.761 6.747   1.00 0.00 ? 10  PHE A CE1  1  
ATOM 97    C CE2  . PHE A 1 10  ? -1.261  -13.599 8.200   1.00 0.00 ? 10  PHE A CE2  1  
ATOM 98    C CZ   . PHE A 1 10  ? -1.134  -13.086 6.924   1.00 0.00 ? 10  PHE A CZ   1  
ATOM 99    H H    . PHE A 1 10  ? 0.954   -12.239 11.904  1.00 0.00 ? 10  PHE A H    1  
ATOM 100   H HA   . PHE A 1 10  ? 1.618   -10.246 9.850   1.00 0.00 ? 10  PHE A HA   1  
ATOM 101   H HB2  . PHE A 1 10  ? -1.008  -10.978 11.152  1.00 0.00 ? 10  PHE A HB2  1  
ATOM 102   H HB3  . PHE A 1 10  ? -0.808  -9.589  10.090  1.00 0.00 ? 10  PHE A HB3  1  
ATOM 103   H HD1  . PHE A 1 10  ? -0.287  -9.918  7.707   1.00 0.00 ? 10  PHE A HD1  1  
ATOM 104   H HD2  . PHE A 1 10  ? -1.136  -13.190 10.293  1.00 0.00 ? 10  PHE A HD2  1  
ATOM 105   H HE1  . PHE A 1 10  ? -0.685  -11.357 5.751   1.00 0.00 ? 10  PHE A HE1  1  
ATOM 106   H HE2  . PHE A 1 10  ? -1.534  -14.635 8.342   1.00 0.00 ? 10  PHE A HE2  1  
ATOM 107   H HZ   . PHE A 1 10  ? -1.310  -13.718 6.067   1.00 0.00 ? 10  PHE A HZ   1  
ATOM 108   N N    . THR A 1 11  ? 1.994   -9.674  12.798  1.00 0.00 ? 11  THR A N    1  
ATOM 109   C CA   . THR A 1 11  ? 2.254   -8.707  13.858  1.00 0.00 ? 11  THR A CA   1  
ATOM 110   C C    . THR A 1 11  ? 3.226   -7.629  13.392  1.00 0.00 ? 11  THR A C    1  
ATOM 111   O O    . THR A 1 11  ? 4.205   -7.919  12.703  1.00 0.00 ? 11  THR A O    1  
ATOM 112   C CB   . THR A 1 11  ? 2.826   -9.391  15.114  1.00 0.00 ? 11  THR A CB   1  
ATOM 113   O OG1  . THR A 1 11  ? 3.851   -10.318 14.743  1.00 0.00 ? 11  THR A OG1  1  
ATOM 114   C CG2  . THR A 1 11  ? 1.731   -10.117 15.881  1.00 0.00 ? 11  THR A CG2  1  
ATOM 115   H H    . THR A 1 11  ? 2.398   -10.565 12.853  1.00 0.00 ? 11  THR A H    1  
ATOM 116   H HA   . THR A 1 11  ? 1.315   -8.242  14.122  1.00 0.00 ? 11  THR A HA   1  
ATOM 117   H HB   . THR A 1 11  ? 3.251   -8.632  15.756  1.00 0.00 ? 11  THR A HB   1  
ATOM 118   H HG1  . THR A 1 11  ? 4.692   -10.027 15.104  1.00 0.00 ? 11  THR A HG1  1  
ATOM 119   H HG21 . THR A 1 11  ? 1.587   -11.101 15.458  1.00 0.00 ? 11  THR A HG21 1  
ATOM 120   H HG22 . THR A 1 11  ? 0.810   -9.557  15.811  1.00 0.00 ? 11  THR A HG22 1  
ATOM 121   H HG23 . THR A 1 11  ? 2.018   -10.210 16.917  1.00 0.00 ? 11  THR A HG23 1  
ATOM 122   N N    . ASP A 1 12  ? 2.951   -6.387  13.773  1.00 0.00 ? 12  ASP A N    1  
ATOM 123   C CA   . ASP A 1 12  ? 3.804   -5.265  13.396  1.00 0.00 ? 12  ASP A CA   1  
ATOM 124   C C    . ASP A 1 12  ? 5.277   -5.653  13.473  1.00 0.00 ? 12  ASP A C    1  
ATOM 125   O O    . ASP A 1 12  ? 6.006   -5.555  12.486  1.00 0.00 ? 12  ASP A O    1  
ATOM 126   C CB   . ASP A 1 12  ? 3.532   -4.063  14.302  1.00 0.00 ? 12  ASP A CB   1  
ATOM 127   C CG   . ASP A 1 12  ? 3.112   -4.475  15.699  1.00 0.00 ? 12  ASP A CG   1  
ATOM 128   O OD1  . ASP A 1 12  ? 2.008   -5.041  15.845  1.00 0.00 ? 12  ASP A OD1  1  
ATOM 129   O OD2  . ASP A 1 12  ? 3.887   -4.231  16.647  1.00 0.00 ? 12  ASP A OD2  1  
ATOM 130   H H    . ASP A 1 12  ? 2.156   -6.220  14.322  1.00 0.00 ? 12  ASP A H    1  
ATOM 131   H HA   . ASP A 1 12  ? 3.568   -4.997  12.377  1.00 0.00 ? 12  ASP A HA   1  
ATOM 132   H HB2  . ASP A 1 12  ? 4.429   -3.467  14.377  1.00 0.00 ? 12  ASP A HB2  1  
ATOM 133   H HB3  . ASP A 1 12  ? 2.743   -3.466  13.869  1.00 0.00 ? 12  ASP A HB3  1  
ATOM 134   N N    . GLN A 1 13  ? 5.708   -6.091  14.651  1.00 0.00 ? 13  GLN A N    1  
ATOM 135   C CA   . GLN A 1 13  ? 7.095   -6.491  14.857  1.00 0.00 ? 13  GLN A CA   1  
ATOM 136   C C    . GLN A 1 13  ? 7.573   -7.396  13.726  1.00 0.00 ? 13  GLN A C    1  
ATOM 137   O O    . GLN A 1 13  ? 8.701   -7.268  13.248  1.00 0.00 ? 13  GLN A O    1  
ATOM 138   C CB   . GLN A 1 13  ? 7.248   -7.208  16.199  1.00 0.00 ? 13  GLN A CB   1  
ATOM 139   C CG   . GLN A 1 13  ? 6.360   -8.434  16.339  1.00 0.00 ? 13  GLN A CG   1  
ATOM 140   C CD   . GLN A 1 13  ? 6.482   -9.091  17.700  1.00 0.00 ? 13  GLN A CD   1  
ATOM 141   O OE1  . GLN A 1 13  ? 5.527   -9.119  18.476  1.00 0.00 ? 13  GLN A OE1  1  
ATOM 142   N NE2  . GLN A 1 13  ? 7.662   -9.624  17.996  1.00 0.00 ? 13  GLN A NE2  1  
ATOM 143   H H    . GLN A 1 13  ? 5.079   -6.146  15.400  1.00 0.00 ? 13  GLN A H    1  
ATOM 144   H HA   . GLN A 1 13  ? 7.700   -5.597  14.865  1.00 0.00 ? 13  GLN A HA   1  
ATOM 145   H HB2  . GLN A 1 13  ? 8.275   -7.519  16.313  1.00 0.00 ? 13  GLN A HB2  1  
ATOM 146   H HB3  . GLN A 1 13  ? 6.999   -6.518  16.992  1.00 0.00 ? 13  GLN A HB3  1  
ATOM 147   H HG2  . GLN A 1 13  ? 5.332   -8.137  16.191  1.00 0.00 ? 13  GLN A HG2  1  
ATOM 148   H HG3  . GLN A 1 13  ? 6.639   -9.152  15.582  1.00 0.00 ? 13  GLN A HG3  1  
ATOM 149   H HE21 . GLN A 1 13  ? 8.378   -9.562  17.329  1.00 0.00 ? 13  GLN A HE21 1  
ATOM 150   H HE22 . GLN A 1 13  ? 7.769   -10.054 18.869  1.00 0.00 ? 13  GLN A HE22 1  
ATOM 151   N N    . LYS A 1 14  ? 6.710   -8.313  13.303  1.00 0.00 ? 14  LYS A N    1  
ATOM 152   C CA   . LYS A 1 14  ? 7.042   -9.240  12.228  1.00 0.00 ? 14  LYS A CA   1  
ATOM 153   C C    . LYS A 1 14  ? 6.983   -8.544  10.872  1.00 0.00 ? 14  LYS A C    1  
ATOM 154   O O    . LYS A 1 14  ? 7.759   -8.858  9.969   1.00 0.00 ? 14  LYS A O    1  
ATOM 155   C CB   . LYS A 1 14  ? 6.086   -10.434 12.243  1.00 0.00 ? 14  LYS A CB   1  
ATOM 156   C CG   . LYS A 1 14  ? 6.482   -11.518 13.231  1.00 0.00 ? 14  LYS A CG   1  
ATOM 157   C CD   . LYS A 1 14  ? 7.542   -12.440 12.653  1.00 0.00 ? 14  LYS A CD   1  
ATOM 158   C CE   . LYS A 1 14  ? 8.336   -13.133 13.750  1.00 0.00 ? 14  LYS A CE   1  
ATOM 159   N NZ   . LYS A 1 14  ? 9.513   -12.326 14.177  1.00 0.00 ? 14  LYS A NZ   1  
ATOM 160   H H    . LYS A 1 14  ? 5.825   -8.366  13.724  1.00 0.00 ? 14  LYS A H    1  
ATOM 161   H HA   . LYS A 1 14  ? 8.049   -9.593  12.394  1.00 0.00 ? 14  LYS A HA   1  
ATOM 162   H HB2  . LYS A 1 14  ? 5.097   -10.085 12.500  1.00 0.00 ? 14  LYS A HB2  1  
ATOM 163   H HB3  . LYS A 1 14  ? 6.059   -10.871 11.255  1.00 0.00 ? 14  LYS A HB3  1  
ATOM 164   H HG2  . LYS A 1 14  ? 6.872   -11.053 14.124  1.00 0.00 ? 14  LYS A HG2  1  
ATOM 165   H HG3  . LYS A 1 14  ? 5.607   -12.102 13.481  1.00 0.00 ? 14  LYS A HG3  1  
ATOM 166   H HD2  . LYS A 1 14  ? 7.061   -13.191 12.044  1.00 0.00 ? 14  LYS A HD2  1  
ATOM 167   H HD3  . LYS A 1 14  ? 8.219   -11.858 12.044  1.00 0.00 ? 14  LYS A HD3  1  
ATOM 168   H HE2  . LYS A 1 14  ? 7.690   -13.289 14.600  1.00 0.00 ? 14  LYS A HE2  1  
ATOM 169   H HE3  . LYS A 1 14  ? 8.680   -14.087 13.379  1.00 0.00 ? 14  LYS A HE3  1  
ATOM 170   H HZ1  . LYS A 1 14  ? 10.371  -12.666 13.698  1.00 0.00 ? 14  LYS A HZ1  1  
ATOM 171   H HZ2  . LYS A 1 14  ? 9.648   -12.407 15.205  1.00 0.00 ? 14  LYS A HZ2  1  
ATOM 172   H HZ3  . LYS A 1 14  ? 9.367   -11.325 13.935  1.00 0.00 ? 14  LYS A HZ3  1  
ATOM 173   N N    . ILE A 1 15  ? 6.059   -7.599  10.737  1.00 0.00 ? 15  ILE A N    1  
ATOM 174   C CA   . ILE A 1 15  ? 5.901   -6.858  9.491   1.00 0.00 ? 15  ILE A CA   1  
ATOM 175   C C    . ILE A 1 15  ? 7.127   -6.000  9.203   1.00 0.00 ? 15  ILE A C    1  
ATOM 176   O O    . ILE A 1 15  ? 7.675   -6.032  8.101   1.00 0.00 ? 15  ILE A O    1  
ATOM 177   C CB   . ILE A 1 15  ? 4.653   -5.956  9.528   1.00 0.00 ? 15  ILE A CB   1  
ATOM 178   C CG1  . ILE A 1 15  ? 3.391   -6.800  9.710   1.00 0.00 ? 15  ILE A CG1  1  
ATOM 179   C CG2  . ILE A 1 15  ? 4.563   -5.125  8.256   1.00 0.00 ? 15  ILE A CG2  1  
ATOM 180   C CD1  . ILE A 1 15  ? 2.134   -5.978  9.890   1.00 0.00 ? 15  ILE A CD1  1  
ATOM 181   H H    . ILE A 1 15  ? 5.470   -7.395  11.493  1.00 0.00 ? 15  ILE A H    1  
ATOM 182   H HA   . ILE A 1 15  ? 5.779   -7.574  8.691   1.00 0.00 ? 15  ILE A HA   1  
ATOM 183   H HB   . ILE A 1 15  ? 4.750   -5.280  10.364  1.00 0.00 ? 15  ILE A HB   1  
ATOM 184   H HG12 . ILE A 1 15  ? 3.255   -7.426  8.841   1.00 0.00 ? 15  ILE A HG12 1  
ATOM 185   H HG13 . ILE A 1 15  ? 3.507   -7.425  10.583  1.00 0.00 ? 15  ILE A HG13 1  
ATOM 186   H HG21 . ILE A 1 15  ? 4.442   -4.083  8.515   1.00 0.00 ? 15  ILE A HG21 1  
ATOM 187   H HG22 . ILE A 1 15  ? 5.468   -5.249  7.681   1.00 0.00 ? 15  ILE A HG22 1  
ATOM 188   H HG23 . ILE A 1 15  ? 3.717   -5.452  7.672   1.00 0.00 ? 15  ILE A HG23 1  
ATOM 189   H HD11 . ILE A 1 15  ? 1.295   -6.502  9.458   1.00 0.00 ? 15  ILE A HD11 1  
ATOM 190   H HD12 . ILE A 1 15  ? 1.956   -5.817  10.942  1.00 0.00 ? 15  ILE A HD12 1  
ATOM 191   H HD13 . ILE A 1 15  ? 2.254   -5.024  9.395   1.00 0.00 ? 15  ILE A HD13 1  
ATOM 192   N N    . ARG A 1 16  ? 7.556   -5.235  10.202  1.00 0.00 ? 16  ARG A N    1  
ATOM 193   C CA   . ARG A 1 16  ? 8.719   -4.368  10.056  1.00 0.00 ? 16  ARG A CA   1  
ATOM 194   C C    . ARG A 1 16  ? 9.983   -5.190  9.821   1.00 0.00 ? 16  ARG A C    1  
ATOM 195   O O    . ARG A 1 16  ? 10.839  -4.813  9.022   1.00 0.00 ? 16  ARG A O    1  
ATOM 196   C CB   . ARG A 1 16  ? 8.889   -3.494  11.300  1.00 0.00 ? 16  ARG A CB   1  
ATOM 197   C CG   . ARG A 1 16  ? 9.195   -4.284  12.562  1.00 0.00 ? 16  ARG A CG   1  
ATOM 198   C CD   . ARG A 1 16  ? 9.370   -3.368  13.763  1.00 0.00 ? 16  ARG A CD   1  
ATOM 199   N NE   . ARG A 1 16  ? 10.159  -3.996  14.820  1.00 0.00 ? 16  ARG A NE   1  
ATOM 200   C CZ   . ARG A 1 16  ? 10.247  -3.516  16.055  1.00 0.00 ? 16  ARG A CZ   1  
ATOM 201   N NH1  . ARG A 1 16  ? 9.598   -2.408  16.388  1.00 0.00 ? 16  ARG A NH1  1  
ATOM 202   N NH2  . ARG A 1 16  ? 10.985  -4.144  16.962  1.00 0.00 ? 16  ARG A NH2  1  
ATOM 203   H H    . ARG A 1 16  ? 7.078   -5.253  11.057  1.00 0.00 ? 16  ARG A H    1  
ATOM 204   H HA   . ARG A 1 16  ? 8.553   -3.732  9.200   1.00 0.00 ? 16  ARG A HA   1  
ATOM 205   H HB2  . ARG A 1 16  ? 9.700   -2.801  11.130  1.00 0.00 ? 16  ARG A HB2  1  
ATOM 206   H HB3  . ARG A 1 16  ? 7.978   -2.938  11.461  1.00 0.00 ? 16  ARG A HB3  1  
ATOM 207   H HG2  . ARG A 1 16  ? 8.379   -4.964  12.757  1.00 0.00 ? 16  ARG A HG2  1  
ATOM 208   H HG3  . ARG A 1 16  ? 10.106  -4.845  12.412  1.00 0.00 ? 16  ARG A HG3  1  
ATOM 209   H HD2  . ARG A 1 16  ? 9.870   -2.466  13.442  1.00 0.00 ? 16  ARG A HD2  1  
ATOM 210   H HD3  . ARG A 1 16  ? 8.395   -3.120  14.154  1.00 0.00 ? 16  ARG A HD3  1  
ATOM 211   H HE   . ARG A 1 16  ? 10.647  -4.815  14.596  1.00 0.00 ? 16  ARG A HE   1  
ATOM 212   H HH11 . ARG A 1 16  ? 9.040   -1.934  15.707  1.00 0.00 ? 16  ARG A HH11 1  
ATOM 213   H HH12 . ARG A 1 16  ? 9.665   -2.050  17.319  1.00 0.00 ? 16  ARG A HH12 1  
ATOM 214   H HH21 . ARG A 1 16  ? 11.476  -4.979  16.715  1.00 0.00 ? 16  ARG A HH21 1  
ATOM 215   H HH22 . ARG A 1 16  ? 11.051  -3.782  17.891  1.00 0.00 ? 16  ARG A HH22 1  
ATOM 216   N N    . GLN A 1 17  ? 10.092  -6.312  10.524  1.00 0.00 ? 17  GLN A N    1  
ATOM 217   C CA   . GLN A 1 17  ? 11.252  -7.186  10.393  1.00 0.00 ? 17  GLN A CA   1  
ATOM 218   C C    . GLN A 1 17  ? 11.199  -7.969  9.085   1.00 0.00 ? 17  GLN A C    1  
ATOM 219   O O    . GLN A 1 17  ? 12.234  -8.320  8.518   1.00 0.00 ? 17  GLN A O    1  
ATOM 220   C CB   . GLN A 1 17  ? 11.326  -8.152  11.577  1.00 0.00 ? 17  GLN A CB   1  
ATOM 221   C CG   . GLN A 1 17  ? 12.112  -7.606  12.759  1.00 0.00 ? 17  GLN A CG   1  
ATOM 222   C CD   . GLN A 1 17  ? 12.644  -8.702  13.661  1.00 0.00 ? 17  GLN A CD   1  
ATOM 223   O OE1  . GLN A 1 17  ? 12.452  -9.889  13.395  1.00 0.00 ? 17  GLN A OE1  1  
ATOM 224   N NE2  . GLN A 1 17  ? 13.316  -8.309  14.737  1.00 0.00 ? 17  GLN A NE2  1  
ATOM 225   H H    . GLN A 1 17  ? 9.376   -6.559  11.146  1.00 0.00 ? 17  GLN A H    1  
ATOM 226   H HA   . GLN A 1 17  ? 12.135  -6.565  10.391  1.00 0.00 ? 17  GLN A HA   1  
ATOM 227   H HB2  . GLN A 1 17  ? 10.323  -8.372  11.909  1.00 0.00 ? 17  GLN A HB2  1  
ATOM 228   H HB3  . GLN A 1 17  ? 11.798  -9.067  11.250  1.00 0.00 ? 17  GLN A HB3  1  
ATOM 229   H HG2  . GLN A 1 17  ? 12.947  -7.032  12.386  1.00 0.00 ? 17  GLN A HG2  1  
ATOM 230   H HG3  . GLN A 1 17  ? 11.465  -6.964  13.338  1.00 0.00 ? 17  GLN A HG3  1  
ATOM 231   H HE21 . GLN A 1 17  ? 13.429  -7.346  14.886  1.00 0.00 ? 17  GLN A HE21 1  
ATOM 232   H HE22 . GLN A 1 17  ? 13.670  -8.996  15.338  1.00 0.00 ? 17  GLN A HE22 1  
ATOM 233   N N    . ARG A 1 18  ? 9.987   -8.239  8.612   1.00 0.00 ? 18  ARG A N    1  
ATOM 234   C CA   . ARG A 1 18  ? 9.799   -8.982  7.372   1.00 0.00 ? 18  ARG A CA   1  
ATOM 235   C C    . ARG A 1 18  ? 10.223  -8.146  6.168   1.00 0.00 ? 18  ARG A C    1  
ATOM 236   O O    . ARG A 1 18  ? 10.819  -8.660  5.221   1.00 0.00 ? 18  ARG A O    1  
ATOM 237   C CB   . ARG A 1 18  ? 8.336   -9.406  7.223   1.00 0.00 ? 18  ARG A CB   1  
ATOM 238   C CG   . ARG A 1 18  ? 7.982   -9.890  5.826   1.00 0.00 ? 18  ARG A CG   1  
ATOM 239   C CD   . ARG A 1 18  ? 6.737   -10.763 5.838   1.00 0.00 ? 18  ARG A CD   1  
ATOM 240   N NE   . ARG A 1 18  ? 6.882   -11.910 6.730   1.00 0.00 ? 18  ARG A NE   1  
ATOM 241   C CZ   . ARG A 1 18  ? 5.965   -12.862 6.858   1.00 0.00 ? 18  ARG A CZ   1  
ATOM 242   N NH1  . ARG A 1 18  ? 4.842   -12.804 6.156   1.00 0.00 ? 18  ARG A NH1  1  
ATOM 243   N NH2  . ARG A 1 18  ? 6.170   -13.875 7.691   1.00 0.00 ? 18  ARG A NH2  1  
ATOM 244   H H    . ARG A 1 18  ? 9.200   -7.933  9.109   1.00 0.00 ? 18  ARG A H    1  
ATOM 245   H HA   . ARG A 1 18  ? 10.418  -9.866  7.417   1.00 0.00 ? 18  ARG A HA   1  
ATOM 246   H HB2  . ARG A 1 18  ? 8.133   -10.206 7.919   1.00 0.00 ? 18  ARG A HB2  1  
ATOM 247   H HB3  . ARG A 1 18  ? 7.704   -8.563  7.460   1.00 0.00 ? 18  ARG A HB3  1  
ATOM 248   H HG2  . ARG A 1 18  ? 7.801   -9.033  5.194   1.00 0.00 ? 18  ARG A HG2  1  
ATOM 249   H HG3  . ARG A 1 18  ? 8.809   -10.462 5.433   1.00 0.00 ? 18  ARG A HG3  1  
ATOM 250   H HD2  . ARG A 1 18  ? 5.899   -10.167 6.168   1.00 0.00 ? 18  ARG A HD2  1  
ATOM 251   H HD3  . ARG A 1 18  ? 6.554   -11.119 4.836   1.00 0.00 ? 18  ARG A HD3  1  
ATOM 252   H HE   . ARG A 1 18  ? 7.705   -11.973 7.259   1.00 0.00 ? 18  ARG A HE   1  
ATOM 253   H HH11 . ARG A 1 18  ? 4.685   -12.042 5.528   1.00 0.00 ? 18  ARG A HH11 1  
ATOM 254   H HH12 . ARG A 1 18  ? 4.152   -13.522 6.254   1.00 0.00 ? 18  ARG A HH12 1  
ATOM 255   H HH21 . ARG A 1 18  ? 7.015   -13.923 8.222   1.00 0.00 ? 18  ARG A HH21 1  
ATOM 256   H HH22 . ARG A 1 18  ? 5.478   -14.591 7.787   1.00 0.00 ? 18  ARG A HH22 1  
ATOM 257   N N    . TYR A 1 19  ? 9.910   -6.856  6.211   1.00 0.00 ? 19  TYR A N    1  
ATOM 258   C CA   . TYR A 1 19  ? 10.255  -5.949  5.122   1.00 0.00 ? 19  TYR A CA   1  
ATOM 259   C C    . TYR A 1 19  ? 11.400  -5.024  5.526   1.00 0.00 ? 19  TYR A C    1  
ATOM 260   O O    . TYR A 1 19  ? 11.691  -4.043  4.843   1.00 0.00 ? 19  TYR A O    1  
ATOM 261   C CB   . TYR A 1 19  ? 9.036   -5.121  4.714   1.00 0.00 ? 19  TYR A CB   1  
ATOM 262   C CG   . TYR A 1 19  ? 7.899   -5.950  4.160   1.00 0.00 ? 19  TYR A CG   1  
ATOM 263   C CD1  . TYR A 1 19  ? 7.990   -6.540  2.906   1.00 0.00 ? 19  TYR A CD1  1  
ATOM 264   C CD2  . TYR A 1 19  ? 6.734   -6.144  4.893   1.00 0.00 ? 19  TYR A CD2  1  
ATOM 265   C CE1  . TYR A 1 19  ? 6.953   -7.298  2.396   1.00 0.00 ? 19  TYR A CE1  1  
ATOM 266   C CE2  . TYR A 1 19  ? 5.693   -6.902  4.391   1.00 0.00 ? 19  TYR A CE2  1  
ATOM 267   C CZ   . TYR A 1 19  ? 5.807   -7.476  3.143   1.00 0.00 ? 19  TYR A CZ   1  
ATOM 268   O OH   . TYR A 1 19  ? 4.773   -8.231  2.639   1.00 0.00 ? 19  TYR A OH   1  
ATOM 269   H H    . TYR A 1 19  ? 9.434   -6.505  6.992   1.00 0.00 ? 19  TYR A H    1  
ATOM 270   H HA   . TYR A 1 19  ? 10.571  -6.547  4.280   1.00 0.00 ? 19  TYR A HA   1  
ATOM 271   H HB2  . TYR A 1 19  ? 8.667   -4.587  5.575   1.00 0.00 ? 19  TYR A HB2  1  
ATOM 272   H HB3  . TYR A 1 19  ? 9.329   -4.411  3.954   1.00 0.00 ? 19  TYR A HB3  1  
ATOM 273   H HD1  . TYR A 1 19  ? 8.889   -6.399  2.324   1.00 0.00 ? 19  TYR A HD1  1  
ATOM 274   H HD2  . TYR A 1 19  ? 6.648   -5.693  5.871   1.00 0.00 ? 19  TYR A HD2  1  
ATOM 275   H HE1  . TYR A 1 19  ? 7.043   -7.748  1.418   1.00 0.00 ? 19  TYR A HE1  1  
ATOM 276   H HE2  . TYR A 1 19  ? 4.795   -7.041  4.975   1.00 0.00 ? 19  TYR A HE2  1  
ATOM 277   H HH   . TYR A 1 19  ? 4.931   -9.158  2.831   1.00 0.00 ? 19  TYR A HH   1  
ATOM 278   N N    . ALA A 1 20  ? 12.046  -5.346  6.642   1.00 0.00 ? 20  ALA A N    1  
ATOM 279   C CA   . ALA A 1 20  ? 13.160  -4.547  7.137   1.00 0.00 ? 20  ALA A CA   1  
ATOM 280   C C    . ALA A 1 20  ? 14.328  -4.568  6.158   1.00 0.00 ? 20  ALA A C    1  
ATOM 281   O O    . ALA A 1 20  ? 15.199  -3.698  6.196   1.00 0.00 ? 20  ALA A O    1  
ATOM 282   C CB   . ALA A 1 20  ? 13.604  -5.049  8.503   1.00 0.00 ? 20  ALA A CB   1  
ATOM 283   H H    . ALA A 1 20  ? 11.767  -6.140  7.144   1.00 0.00 ? 20  ALA A H    1  
ATOM 284   H HA   . ALA A 1 20  ? 12.816  -3.528  7.250   1.00 0.00 ? 20  ALA A HA   1  
ATOM 285   H HB1  . ALA A 1 20  ? 13.095  -5.975  8.728   1.00 0.00 ? 20  ALA A HB1  1  
ATOM 286   H HB2  . ALA A 1 20  ? 14.671  -5.217  8.495   1.00 0.00 ? 20  ALA A HB2  1  
ATOM 287   H HB3  . ALA A 1 20  ? 13.361  -4.313  9.254   1.00 0.00 ? 20  ALA A HB3  1  
ATOM 288   N N    . ASP A 1 21  ? 14.342  -5.567  5.282   1.00 0.00 ? 21  ASP A N    1  
ATOM 289   C CA   . ASP A 1 21  ? 15.404  -5.702  4.292   1.00 0.00 ? 21  ASP A CA   1  
ATOM 290   C C    . ASP A 1 21  ? 15.269  -4.642  3.203   1.00 0.00 ? 21  ASP A C    1  
ATOM 291   O O    . ASP A 1 21  ? 16.262  -4.212  2.613   1.00 0.00 ? 21  ASP A O    1  
ATOM 292   C CB   . ASP A 1 21  ? 15.376  -7.098  3.669   1.00 0.00 ? 21  ASP A CB   1  
ATOM 293   C CG   . ASP A 1 21  ? 15.681  -8.188  4.677   1.00 0.00 ? 21  ASP A CG   1  
ATOM 294   O OD1  . ASP A 1 21  ? 14.859  -8.396  5.594   1.00 0.00 ? 21  ASP A OD1  1  
ATOM 295   O OD2  . ASP A 1 21  ? 16.742  -8.835  4.548   1.00 0.00 ? 21  ASP A OD2  1  
ATOM 296   H H    . ASP A 1 21  ? 13.620  -6.230  5.302   1.00 0.00 ? 21  ASP A H    1  
ATOM 297   H HA   . ASP A 1 21  ? 16.348  -5.562  4.797   1.00 0.00 ? 21  ASP A HA   1  
ATOM 298   H HB2  . ASP A 1 21  ? 14.394  -7.281  3.255   1.00 0.00 ? 21  ASP A HB2  1  
ATOM 299   H HB3  . ASP A 1 21  ? 16.110  -7.147  2.878   1.00 0.00 ? 21  ASP A HB3  1  
ATOM 300   N N    . LEU A 1 22  ? 14.036  -4.225  2.940   1.00 0.00 ? 22  LEU A N    1  
ATOM 301   C CA   . LEU A 1 22  ? 13.770  -3.216  1.921   1.00 0.00 ? 22  LEU A CA   1  
ATOM 302   C C    . LEU A 1 22  ? 14.573  -1.947  2.189   1.00 0.00 ? 22  LEU A C    1  
ATOM 303   O O    . LEU A 1 22  ? 14.896  -1.617  3.330   1.00 0.00 ? 22  LEU A O    1  
ATOM 304   C CB   . LEU A 1 22  ? 12.277  -2.888  1.877   1.00 0.00 ? 22  LEU A CB   1  
ATOM 305   C CG   . LEU A 1 22  ? 11.331  -4.082  1.737   1.00 0.00 ? 22  LEU A CG   1  
ATOM 306   C CD1  . LEU A 1 22  ? 9.903   -3.609  1.515   1.00 0.00 ? 22  LEU A CD1  1  
ATOM 307   C CD2  . LEU A 1 22  ? 11.779  -4.986  0.598   1.00 0.00 ? 22  LEU A CD2  1  
ATOM 308   H H    . LEU A 1 22  ? 13.285  -4.604  3.443   1.00 0.00 ? 22  LEU A H    1  
ATOM 309   H HA   . LEU A 1 22  ? 14.070  -3.622  0.967   1.00 0.00 ? 22  LEU A HA   1  
ATOM 310   H HB2  . LEU A 1 22  ? 12.024  -2.372  2.790   1.00 0.00 ? 22  LEU A HB2  1  
ATOM 311   H HB3  . LEU A 1 22  ? 12.108  -2.231  1.036   1.00 0.00 ? 22  LEU A HB3  1  
ATOM 312   H HG   . LEU A 1 22  ? 11.352  -4.659  2.652   1.00 0.00 ? 22  LEU A HG   1  
ATOM 313   H HD11 . LEU A 1 22  ? 9.821   -3.161  0.536   1.00 0.00 ? 22  LEU A HD11 1  
ATOM 314   H HD12 . LEU A 1 22  ? 9.644   -2.879  2.267   1.00 0.00 ? 22  LEU A HD12 1  
ATOM 315   H HD13 . LEU A 1 22  ? 9.230   -4.451  1.584   1.00 0.00 ? 22  LEU A HD13 1  
ATOM 316   H HD21 . LEU A 1 22  ? 10.919  -5.485  0.176   1.00 0.00 ? 22  LEU A HD21 1  
ATOM 317   H HD22 . LEU A 1 22  ? 12.472  -5.724  0.976   1.00 0.00 ? 22  LEU A HD22 1  
ATOM 318   H HD23 . LEU A 1 22  ? 12.263  -4.393  -0.163  1.00 0.00 ? 22  LEU A HD23 1  
ATOM 319   N N    . PRO A 1 23  ? 14.902  -1.216  1.113   1.00 0.00 ? 23  PRO A N    1  
ATOM 320   C CA   . PRO A 1 23  ? 15.668  0.030   1.206   1.00 0.00 ? 23  PRO A CA   1  
ATOM 321   C C    . PRO A 1 23  ? 14.867  1.157   1.849   1.00 0.00 ? 23  PRO A C    1  
ATOM 322   O O    . PRO A 1 23  ? 15.344  1.828   2.763   1.00 0.00 ? 23  PRO A O    1  
ATOM 323   C CB   . PRO A 1 23  ? 15.984  0.363   -0.254  1.00 0.00 ? 23  PRO A CB   1  
ATOM 324   C CG   . PRO A 1 23  ? 14.902  -0.300  -1.035  1.00 0.00 ? 23  PRO A CG   1  
ATOM 325   C CD   . PRO A 1 23  ? 14.550  -1.550  -0.277  1.00 0.00 ? 23  PRO A CD   1  
ATOM 326   H HA   . PRO A 1 23  ? 16.590  -0.112  1.752   1.00 0.00 ? 23  PRO A HA   1  
ATOM 327   H HB2  . PRO A 1 23  ? 15.972  1.435   -0.392  1.00 0.00 ? 23  PRO A HB2  1  
ATOM 328   H HB3  . PRO A 1 23  ? 16.955  -0.029  -0.515  1.00 0.00 ? 23  PRO A HB3  1  
ATOM 329   H HG2  . PRO A 1 23  ? 14.045  0.352   -1.102  1.00 0.00 ? 23  PRO A HG2  1  
ATOM 330   H HG3  . PRO A 1 23  ? 15.263  -0.550  -2.022  1.00 0.00 ? 23  PRO A HG3  1  
ATOM 331   H HD2  . PRO A 1 23  ? 13.494  -1.761  -0.368  1.00 0.00 ? 23  PRO A HD2  1  
ATOM 332   H HD3  . PRO A 1 23  ? 15.135  -2.385  -0.633  1.00 0.00 ? 23  PRO A HD3  1  
ATOM 333   N N    . GLY A 1 24  ? 13.645  1.359   1.364   1.00 0.00 ? 24  GLY A N    1  
ATOM 334   C CA   . GLY A 1 24  ? 12.797  2.406   1.903   1.00 0.00 ? 24  GLY A CA   1  
ATOM 335   C C    . GLY A 1 24  ? 12.497  2.208   3.376   1.00 0.00 ? 24  GLY A C    1  
ATOM 336   O O    . GLY A 1 24  ? 13.135  1.393   4.041   1.00 0.00 ? 24  GLY A O    1  
ATOM 337   H H    . GLY A 1 24  ? 13.317  0.793   0.634   1.00 0.00 ? 24  GLY A H    1  
ATOM 338   H HA2  . GLY A 1 24  ? 13.291  3.357   1.772   1.00 0.00 ? 24  GLY A HA2  1  
ATOM 339   H HA3  . GLY A 1 24  ? 11.866  2.416   1.356   1.00 0.00 ? 24  GLY A HA3  1  
ATOM 340   N N    . GLU A 1 25  ? 11.523  2.956   3.886   1.00 0.00 ? 25  GLU A N    1  
ATOM 341   C CA   . GLU A 1 25  ? 11.142  2.859   5.290   1.00 0.00 ? 25  GLU A CA   1  
ATOM 342   C C    . GLU A 1 25  ? 9.670   2.484   5.430   1.00 0.00 ? 25  GLU A C    1  
ATOM 343   O O    . GLU A 1 25  ? 8.789   3.184   4.928   1.00 0.00 ? 25  GLU A O    1  
ATOM 344   C CB   . GLU A 1 25  ? 11.413  4.183   6.007   1.00 0.00 ? 25  GLU A CB   1  
ATOM 345   C CG   . GLU A 1 25  ? 11.596  4.036   7.508   1.00 0.00 ? 25  GLU A CG   1  
ATOM 346   C CD   . GLU A 1 25  ? 13.027  3.713   7.893   1.00 0.00 ? 25  GLU A CD   1  
ATOM 347   O OE1  . GLU A 1 25  ? 13.398  2.521   7.851   1.00 0.00 ? 25  GLU A OE1  1  
ATOM 348   O OE2  . GLU A 1 25  ? 13.775  4.652   8.235   1.00 0.00 ? 25  GLU A OE2  1  
ATOM 349   H H    . GLU A 1 25  ? 11.051  3.588   3.304   1.00 0.00 ? 25  GLU A H    1  
ATOM 350   H HA   . GLU A 1 25  ? 11.743  2.086   5.744   1.00 0.00 ? 25  GLU A HA   1  
ATOM 351   H HB2  . GLU A 1 25  ? 12.310  4.625   5.597   1.00 0.00 ? 25  GLU A HB2  1  
ATOM 352   H HB3  . GLU A 1 25  ? 10.582  4.850   5.831   1.00 0.00 ? 25  GLU A HB3  1  
ATOM 353   H HG2  . GLU A 1 25  ? 11.312  4.963   7.985   1.00 0.00 ? 25  GLU A HG2  1  
ATOM 354   H HG3  . GLU A 1 25  ? 10.955  3.241   7.860   1.00 0.00 ? 25  GLU A HG3  1  
ATOM 355   N N    . LEU A 1 26  ? 9.410   1.375   6.114   1.00 0.00 ? 26  LEU A N    1  
ATOM 356   C CA   . LEU A 1 26  ? 8.045   0.906   6.320   1.00 0.00 ? 26  LEU A CA   1  
ATOM 357   C C    . LEU A 1 26  ? 7.195   1.979   6.993   1.00 0.00 ? 26  LEU A C    1  
ATOM 358   O O    . LEU A 1 26  ? 7.583   2.540   8.019   1.00 0.00 ? 26  LEU A O    1  
ATOM 359   C CB   . LEU A 1 26  ? 8.045   -0.367  7.168   1.00 0.00 ? 26  LEU A CB   1  
ATOM 360   C CG   . LEU A 1 26  ? 6.819   -1.270  7.025   1.00 0.00 ? 26  LEU A CG   1  
ATOM 361   C CD1  . LEU A 1 26  ? 6.918   -2.107  5.759   1.00 0.00 ? 26  LEU A CD1  1  
ATOM 362   C CD2  . LEU A 1 26  ? 6.668   -2.163  8.247   1.00 0.00 ? 26  LEU A CD2  1  
ATOM 363   H H    . LEU A 1 26  ? 10.154  0.860   6.490   1.00 0.00 ? 26  LEU A H    1  
ATOM 364   H HA   . LEU A 1 26  ? 7.621   0.683   5.352   1.00 0.00 ? 26  LEU A HA   1  
ATOM 365   H HB2  . LEU A 1 26  ? 8.914   -0.945  6.897   1.00 0.00 ? 26  LEU A HB2  1  
ATOM 366   H HB3  . LEU A 1 26  ? 8.120   -0.072  8.205   1.00 0.00 ? 26  LEU A HB3  1  
ATOM 367   H HG   . LEU A 1 26  ? 5.933   -0.654  6.948   1.00 0.00 ? 26  LEU A HG   1  
ATOM 368   H HD11 . LEU A 1 26  ? 7.674   -1.691  5.111   1.00 0.00 ? 26  LEU A HD11 1  
ATOM 369   H HD12 . LEU A 1 26  ? 5.966   -2.104  5.250   1.00 0.00 ? 26  LEU A HD12 1  
ATOM 370   H HD13 . LEU A 1 26  ? 7.184   -3.122  6.019   1.00 0.00 ? 26  LEU A HD13 1  
ATOM 371   H HD21 . LEU A 1 26  ? 7.023   -3.156  8.013   1.00 0.00 ? 26  LEU A HD21 1  
ATOM 372   H HD22 . LEU A 1 26  ? 5.627   -2.211  8.532   1.00 0.00 ? 26  LEU A HD22 1  
ATOM 373   H HD23 . LEU A 1 26  ? 7.247   -1.757  9.063   1.00 0.00 ? 26  LEU A HD23 1  
ATOM 374   N N    . HIS A 1 27  ? 6.034   2.259   6.411   1.00 0.00 ? 27  HIS A N    1  
ATOM 375   C CA   . HIS A 1 27  ? 5.127   3.263   6.956   1.00 0.00 ? 27  HIS A CA   1  
ATOM 376   C C    . HIS A 1 27  ? 3.721   2.694   7.120   1.00 0.00 ? 27  HIS A C    1  
ATOM 377   O O    . HIS A 1 27  ? 2.962   2.604   6.154   1.00 0.00 ? 27  HIS A O    1  
ATOM 378   C CB   . HIS A 1 27  ? 5.090   4.493   6.049   1.00 0.00 ? 27  HIS A CB   1  
ATOM 379   C CG   . HIS A 1 27  ? 6.124   5.521   6.392   1.00 0.00 ? 27  HIS A CG   1  
ATOM 380   N ND1  . HIS A 1 27  ? 5.831   6.860   6.545   1.00 0.00 ? 27  HIS A ND1  1  
ATOM 381   C CD2  . HIS A 1 27  ? 7.454   5.401   6.612   1.00 0.00 ? 27  HIS A CD2  1  
ATOM 382   C CE1  . HIS A 1 27  ? 6.937   7.519   6.844   1.00 0.00 ? 27  HIS A CE1  1  
ATOM 383   N NE2  . HIS A 1 27  ? 7.936   6.656   6.891   1.00 0.00 ? 27  HIS A NE2  1  
ATOM 384   H H    . HIS A 1 27  ? 5.780   1.778   5.596   1.00 0.00 ? 27  HIS A H    1  
ATOM 385   H HA   . HIS A 1 27  ? 5.499   3.554   7.927   1.00 0.00 ? 27  HIS A HA   1  
ATOM 386   H HB2  . HIS A 1 27  ? 5.256   4.184   5.027   1.00 0.00 ? 27  HIS A HB2  1  
ATOM 387   H HB3  . HIS A 1 27  ? 4.118   4.960   6.125   1.00 0.00 ? 27  HIS A HB3  1  
ATOM 388   H HD1  . HIS A 1 27  ? 4.946   7.267   6.448   1.00 0.00 ? 27  HIS A HD1  1  
ATOM 389   H HD2  . HIS A 1 27  ? 8.030   4.487   6.575   1.00 0.00 ? 27  HIS A HD2  1  
ATOM 390   H HE1  . HIS A 1 27  ? 7.012   8.581   7.020   1.00 0.00 ? 27  HIS A HE1  1  
ATOM 391   H HE2  . HIS A 1 27  ? 8.880   6.891   7.007   1.00 0.00 ? 27  HIS A HE2  1  
ATOM 392   N N    . ILE A 1 28  ? 3.382   2.312   8.346   1.00 0.00 ? 28  ILE A N    1  
ATOM 393   C CA   . ILE A 1 28  ? 2.067   1.753   8.635   1.00 0.00 ? 28  ILE A CA   1  
ATOM 394   C C    . ILE A 1 28  ? 1.112   2.827   9.145   1.00 0.00 ? 28  ILE A C    1  
ATOM 395   O O    . ILE A 1 28  ? 1.269   3.333   10.257  1.00 0.00 ? 28  ILE A O    1  
ATOM 396   C CB   . ILE A 1 28  ? 2.153   0.621   9.677   1.00 0.00 ? 28  ILE A CB   1  
ATOM 397   C CG1  . ILE A 1 28  ? 3.151   -0.445  9.222   1.00 0.00 ? 28  ILE A CG1  1  
ATOM 398   C CG2  . ILE A 1 28  ? 0.780   0.007   9.905   1.00 0.00 ? 28  ILE A CG2  1  
ATOM 399   C CD1  . ILE A 1 28  ? 3.459   -1.477  10.285  1.00 0.00 ? 28  ILE A CD1  1  
ATOM 400   H H    . ILE A 1 28  ? 4.030   2.409   9.074   1.00 0.00 ? 28  ILE A H    1  
ATOM 401   H HA   . ILE A 1 28  ? 1.671   1.341   7.718   1.00 0.00 ? 28  ILE A HA   1  
ATOM 402   H HB   . ILE A 1 28  ? 2.491   1.046   10.610  1.00 0.00 ? 28  ILE A HB   1  
ATOM 403   H HG12 . ILE A 1 28  ? 2.751   -0.962  8.365   1.00 0.00 ? 28  ILE A HG12 1  
ATOM 404   H HG13 . ILE A 1 28  ? 4.079   0.035   8.946   1.00 0.00 ? 28  ILE A HG13 1  
ATOM 405   H HG21 . ILE A 1 28  ? 0.777   -1.011  9.543   1.00 0.00 ? 28  ILE A HG21 1  
ATOM 406   H HG22 . ILE A 1 28  ? 0.555   0.013   10.961  1.00 0.00 ? 28  ILE A HG22 1  
ATOM 407   H HG23 . ILE A 1 28  ? 0.036   0.580   9.374   1.00 0.00 ? 28  ILE A HG23 1  
ATOM 408   H HD11 . ILE A 1 28  ? 2.578   -1.650  10.885  1.00 0.00 ? 28  ILE A HD11 1  
ATOM 409   H HD12 . ILE A 1 28  ? 3.762   -2.400  9.814   1.00 0.00 ? 28  ILE A HD12 1  
ATOM 410   H HD13 . ILE A 1 28  ? 4.258   -1.116  10.916  1.00 0.00 ? 28  ILE A HD13 1  
ATOM 411   N N    . ILE A 1 29  ? 0.123   3.169   8.327   1.00 0.00 ? 29  ILE A N    1  
ATOM 412   C CA   . ILE A 1 29  ? -0.858  4.181   8.697   1.00 0.00 ? 29  ILE A CA   1  
ATOM 413   C C    . ILE A 1 29  ? -2.280  3.670   8.487   1.00 0.00 ? 29  ILE A C    1  
ATOM 414   O O    . ILE A 1 29  ? -2.573  3.017   7.486   1.00 0.00 ? 29  ILE A O    1  
ATOM 415   C CB   . ILE A 1 29  ? -0.665  5.476   7.886   1.00 0.00 ? 29  ILE A CB   1  
ATOM 416   C CG1  . ILE A 1 29  ? -0.899  5.211   6.397   1.00 0.00 ? 29  ILE A CG1  1  
ATOM 417   C CG2  . ILE A 1 29  ? 0.728   6.042   8.116   1.00 0.00 ? 29  ILE A CG2  1  
ATOM 418   C CD1  . ILE A 1 29  ? -0.808  6.454   5.540   1.00 0.00 ? 29  ILE A CD1  1  
ATOM 419   H H    . ILE A 1 29  ? 0.052   2.730   7.454   1.00 0.00 ? 29  ILE A H    1  
ATOM 420   H HA   . ILE A 1 29  ? -0.721  4.411   9.743   1.00 0.00 ? 29  ILE A HA   1  
ATOM 421   H HB   . ILE A 1 29  ? -1.384  6.202   8.232   1.00 0.00 ? 29  ILE A HB   1  
ATOM 422   H HG12 . ILE A 1 29  ? -0.160  4.510   6.042   1.00 0.00 ? 29  ILE A HG12 1  
ATOM 423   H HG13 . ILE A 1 29  ? -1.884  4.787   6.265   1.00 0.00 ? 29  ILE A HG13 1  
ATOM 424   H HG21 . ILE A 1 29  ? 1.142   5.621   9.021   1.00 0.00 ? 29  ILE A HG21 1  
ATOM 425   H HG22 . ILE A 1 29  ? 1.362   5.789   7.279   1.00 0.00 ? 29  ILE A HG22 1  
ATOM 426   H HG23 . ILE A 1 29  ? 0.669   7.116   8.212   1.00 0.00 ? 29  ILE A HG23 1  
ATOM 427   H HD11 . ILE A 1 29  ? -1.768  6.649   5.086   1.00 0.00 ? 29  ILE A HD11 1  
ATOM 428   H HD12 . ILE A 1 29  ? -0.522  7.295   6.154   1.00 0.00 ? 29  ILE A HD12 1  
ATOM 429   H HD13 . ILE A 1 29  ? -0.069  6.305   4.767   1.00 0.00 ? 29  ILE A HD13 1  
ATOM 430   N N    . GLU A 1 30  ? -3.159  3.975   9.437   1.00 0.00 ? 30  GLU A N    1  
ATOM 431   C CA   . GLU A 1 30  ? -4.550  3.547   9.354   1.00 0.00 ? 30  GLU A CA   1  
ATOM 432   C C    . GLU A 1 30  ? -5.420  4.640   8.740   1.00 0.00 ? 30  GLU A C    1  
ATOM 433   O O    . GLU A 1 30  ? -5.518  5.745   9.275   1.00 0.00 ? 30  GLU A O    1  
ATOM 434   C CB   . GLU A 1 30  ? -5.078  3.182   10.744  1.00 0.00 ? 30  GLU A CB   1  
ATOM 435   C CG   . GLU A 1 30  ? -4.868  1.722   11.109  1.00 0.00 ? 30  GLU A CG   1  
ATOM 436   C CD   . GLU A 1 30  ? -4.718  1.510   12.603  1.00 0.00 ? 30  GLU A CD   1  
ATOM 437   O OE1  . GLU A 1 30  ? -5.681  1.803   13.343  1.00 0.00 ? 30  GLU A OE1  1  
ATOM 438   O OE2  . GLU A 1 30  ? -3.639  1.052   13.033  1.00 0.00 ? 30  GLU A OE2  1  
ATOM 439   H H    . GLU A 1 30  ? -2.864  4.499   10.210  1.00 0.00 ? 30  GLU A H    1  
ATOM 440   H HA   . GLU A 1 30  ? -4.592  2.673   8.722   1.00 0.00 ? 30  GLU A HA   1  
ATOM 441   H HB2  . GLU A 1 30  ? -4.574  3.792   11.479  1.00 0.00 ? 30  GLU A HB2  1  
ATOM 442   H HB3  . GLU A 1 30  ? -6.136  3.391   10.780  1.00 0.00 ? 30  GLU A HB3  1  
ATOM 443   H HG2  . GLU A 1 30  ? -5.718  1.152   10.764  1.00 0.00 ? 30  GLU A HG2  1  
ATOM 444   H HG3  . GLU A 1 30  ? -3.974  1.365   10.618  1.00 0.00 ? 30  GLU A HG3  1  
ATOM 445   N N    . LEU A 1 31  ? -6.049  4.324   7.613   1.00 0.00 ? 31  LEU A N    1  
ATOM 446   C CA   . LEU A 1 31  ? -6.910  5.278   6.924   1.00 0.00 ? 31  LEU A CA   1  
ATOM 447   C C    . LEU A 1 31  ? -8.348  4.770   6.865   1.00 0.00 ? 31  LEU A C    1  
ATOM 448   O O    . LEU A 1 31  ? -8.618  3.709   6.305   1.00 0.00 ? 31  LEU A O    1  
ATOM 449   C CB   . LEU A 1 31  ? -6.390  5.535   5.509   1.00 0.00 ? 31  LEU A CB   1  
ATOM 450   C CG   . LEU A 1 31  ? -4.918  5.933   5.397   1.00 0.00 ? 31  LEU A CG   1  
ATOM 451   C CD1  . LEU A 1 31  ? -4.517  6.092   3.938   1.00 0.00 ? 31  LEU A CD1  1  
ATOM 452   C CD2  . LEU A 1 31  ? -4.652  7.218   6.168   1.00 0.00 ? 31  LEU A CD2  1  
ATOM 453   H H    . LEU A 1 31  ? -5.932  3.428   7.235   1.00 0.00 ? 31  LEU A H    1  
ATOM 454   H HA   . LEU A 1 31  ? -6.891  6.204   7.480   1.00 0.00 ? 31  LEU A HA   1  
ATOM 455   H HB2  . LEU A 1 31  ? -6.533  4.633   4.935   1.00 0.00 ? 31  LEU A HB2  1  
ATOM 456   H HB3  . LEU A 1 31  ? -6.982  6.331   5.079   1.00 0.00 ? 31  LEU A HB3  1  
ATOM 457   H HG   . LEU A 1 31  ? -4.307  5.151   5.827   1.00 0.00 ? 31  LEU A HG   1  
ATOM 458   H HD11 . LEU A 1 31  ? -5.404  6.189   3.330   1.00 0.00 ? 31  LEU A HD11 1  
ATOM 459   H HD12 . LEU A 1 31  ? -3.957  5.224   3.622   1.00 0.00 ? 31  LEU A HD12 1  
ATOM 460   H HD13 . LEU A 1 31  ? -3.905  6.975   3.827   1.00 0.00 ? 31  LEU A HD13 1  
ATOM 461   H HD21 . LEU A 1 31  ? -5.523  7.472   6.754   1.00 0.00 ? 31  LEU A HD21 1  
ATOM 462   H HD22 . LEU A 1 31  ? -4.440  8.017   5.473   1.00 0.00 ? 31  LEU A HD22 1  
ATOM 463   H HD23 . LEU A 1 31  ? -3.806  7.076   6.823   1.00 0.00 ? 31  LEU A HD23 1  
ATOM 464   N N    . GLU A 1 32  ? -9.265  5.538   7.445   1.00 0.00 ? 32  GLU A N    1  
ATOM 465   C CA   . GLU A 1 32  ? -10.675 5.165   7.457   1.00 0.00 ? 32  GLU A CA   1  
ATOM 466   C C    . GLU A 1 32  ? -11.312 5.402   6.091   1.00 0.00 ? 32  GLU A C    1  
ATOM 467   O O    . GLU A 1 32  ? -11.441 6.542   5.642   1.00 0.00 ? 32  GLU A O    1  
ATOM 468   C CB   . GLU A 1 32  ? -11.426 5.960   8.527   1.00 0.00 ? 32  GLU A CB   1  
ATOM 469   C CG   . GLU A 1 32  ? -12.614 5.218   9.115   1.00 0.00 ? 32  GLU A CG   1  
ATOM 470   C CD   . GLU A 1 32  ? -13.330 6.017   10.187  1.00 0.00 ? 32  GLU A CD   1  
ATOM 471   O OE1  . GLU A 1 32  ? -12.830 6.057   11.331  1.00 0.00 ? 32  GLU A OE1  1  
ATOM 472   O OE2  . GLU A 1 32  ? -14.389 6.603   9.881   1.00 0.00 ? 32  GLU A OE2  1  
ATOM 473   H H    . GLU A 1 32  ? -8.987  6.373   7.875   1.00 0.00 ? 32  GLU A H    1  
ATOM 474   H HA   . GLU A 1 32  ? -10.738 4.114   7.693   1.00 0.00 ? 32  GLU A HA   1  
ATOM 475   H HB2  . GLU A 1 32  ? -10.743 6.198   9.329   1.00 0.00 ? 32  GLU A HB2  1  
ATOM 476   H HB3  . GLU A 1 32  ? -11.785 6.880   8.088   1.00 0.00 ? 32  GLU A HB3  1  
ATOM 477   H HG2  . GLU A 1 32  ? -13.315 5.000   8.323   1.00 0.00 ? 32  GLU A HG2  1  
ATOM 478   H HG3  . GLU A 1 32  ? -12.265 4.293   9.550   1.00 0.00 ? 32  GLU A HG3  1  
ATOM 479   N N    . LYS A 1 33  ? -11.707 4.318   5.433   1.00 0.00 ? 33  LYS A N    1  
ATOM 480   C CA   . LYS A 1 33  ? -12.331 4.405   4.118   1.00 0.00 ? 33  LYS A CA   1  
ATOM 481   C C    . LYS A 1 33  ? -13.320 5.565   4.061   1.00 0.00 ? 33  LYS A C    1  
ATOM 482   O O    . LYS A 1 33  ? -14.192 5.692   4.920   1.00 0.00 ? 33  LYS A O    1  
ATOM 483   C CB   . LYS A 1 33  ? -13.046 3.094   3.782   1.00 0.00 ? 33  LYS A CB   1  
ATOM 484   C CG   . LYS A 1 33  ? -12.104 1.974   3.375   1.00 0.00 ? 33  LYS A CG   1  
ATOM 485   C CD   . LYS A 1 33  ? -12.783 0.986   2.442   1.00 0.00 ? 33  LYS A CD   1  
ATOM 486   C CE   . LYS A 1 33  ? -13.744 0.078   3.195   1.00 0.00 ? 33  LYS A CE   1  
ATOM 487   N NZ   . LYS A 1 33  ? -15.110 0.664   3.280   1.00 0.00 ? 33  LYS A NZ   1  
ATOM 488   H H    . LYS A 1 33  ? -11.577 3.436   5.843   1.00 0.00 ? 33  LYS A H    1  
ATOM 489   H HA   . LYS A 1 33  ? -11.551 4.576   3.391   1.00 0.00 ? 33  LYS A HA   1  
ATOM 490   H HB2  . LYS A 1 33  ? -13.604 2.770   4.648   1.00 0.00 ? 33  LYS A HB2  1  
ATOM 491   H HB3  . LYS A 1 33  ? -13.734 3.272   2.968   1.00 0.00 ? 33  LYS A HB3  1  
ATOM 492   H HG2  . LYS A 1 33  ? -11.250 2.400   2.871   1.00 0.00 ? 33  LYS A HG2  1  
ATOM 493   H HG3  . LYS A 1 33  ? -11.777 1.451   4.263   1.00 0.00 ? 33  LYS A HG3  1  
ATOM 494   H HD2  . LYS A 1 33  ? -13.336 1.533   1.693   1.00 0.00 ? 33  LYS A HD2  1  
ATOM 495   H HD3  . LYS A 1 33  ? -12.028 0.379   1.963   1.00 0.00 ? 33  LYS A HD3  1  
ATOM 496   H HE2  . LYS A 1 33  ? -13.800 -0.870  2.681   1.00 0.00 ? 33  LYS A HE2  1  
ATOM 497   H HE3  . LYS A 1 33  ? -13.364 -0.076  4.194   1.00 0.00 ? 33  LYS A HE3  1  
ATOM 498   H HZ1  . LYS A 1 33  ? -15.170 1.312   4.092   1.00 0.00 ? 33  LYS A HZ1  1  
ATOM 499   H HZ2  . LYS A 1 33  ? -15.815 -0.090  3.400   1.00 0.00 ? 33  LYS A HZ2  1  
ATOM 500   H HZ3  . LYS A 1 33  ? -15.327 1.193   2.412   1.00 0.00 ? 33  LYS A HZ3  1  
ATOM 501   N N    . ASP A 1 34  ? -13.179 6.407   3.043   1.00 0.00 ? 34  ASP A N    1  
ATOM 502   C CA   . ASP A 1 34  ? -14.061 7.555   2.872   1.00 0.00 ? 34  ASP A CA   1  
ATOM 503   C C    . ASP A 1 34  ? -15.301 7.173   2.070   1.00 0.00 ? 34  ASP A C    1  
ATOM 504   O O    . ASP A 1 34  ? -15.423 6.044   1.594   1.00 0.00 ? 34  ASP A O    1  
ATOM 505   C CB   . ASP A 1 34  ? -13.319 8.697   2.176   1.00 0.00 ? 34  ASP A CB   1  
ATOM 506   C CG   . ASP A 1 34  ? -14.004 10.035  2.368   1.00 0.00 ? 34  ASP A CG   1  
ATOM 507   O OD1  . ASP A 1 34  ? -14.232 10.423  3.534   1.00 0.00 ? 34  ASP A OD1  1  
ATOM 508   O OD2  . ASP A 1 34  ? -14.312 10.695  1.354   1.00 0.00 ? 34  ASP A OD2  1  
ATOM 509   H H    . ASP A 1 34  ? -12.464 6.252   2.390   1.00 0.00 ? 34  ASP A H    1  
ATOM 510   H HA   . ASP A 1 34  ? -14.370 7.885   3.853   1.00 0.00 ? 34  ASP A HA   1  
ATOM 511   H HB2  . ASP A 1 34  ? -12.318 8.765   2.577   1.00 0.00 ? 34  ASP A HB2  1  
ATOM 512   H HB3  . ASP A 1 34  ? -13.265 8.489   1.117   1.00 0.00 ? 34  ASP A HB3  1  
ATOM 513   N N    . LYS A 1 35  ? -16.220 8.121   1.924   1.00 0.00 ? 35  LYS A N    1  
ATOM 514   C CA   . LYS A 1 35  ? -17.452 7.885   1.179   1.00 0.00 ? 35  LYS A CA   1  
ATOM 515   C C    . LYS A 1 35  ? -17.207 6.937   0.009   1.00 0.00 ? 35  LYS A C    1  
ATOM 516   O O    . LYS A 1 35  ? -18.072 6.137   -0.344  1.00 0.00 ? 35  LYS A O    1  
ATOM 517   C CB   . LYS A 1 35  ? -18.023 9.209   0.665   1.00 0.00 ? 35  LYS A CB   1  
ATOM 518   C CG   . LYS A 1 35  ? -18.341 10.203  1.769   1.00 0.00 ? 35  LYS A CG   1  
ATOM 519   C CD   . LYS A 1 35  ? -19.190 11.354  1.255   1.00 0.00 ? 35  LYS A CD   1  
ATOM 520   C CE   . LYS A 1 35  ? -18.344 12.395  0.539   1.00 0.00 ? 35  LYS A CE   1  
ATOM 521   N NZ   . LYS A 1 35  ? -19.169 13.527  0.032   1.00 0.00 ? 35  LYS A NZ   1  
ATOM 522   H H    . LYS A 1 35  ? -16.066 9.002   2.326   1.00 0.00 ? 35  LYS A H    1  
ATOM 523   H HA   . LYS A 1 35  ? -18.164 7.432   1.851   1.00 0.00 ? 35  LYS A HA   1  
ATOM 524   H HB2  . LYS A 1 35  ? -17.305 9.662   -0.003  1.00 0.00 ? 35  LYS A HB2  1  
ATOM 525   H HB3  . LYS A 1 35  ? -18.932 9.007   0.119   1.00 0.00 ? 35  LYS A HB3  1  
ATOM 526   H HG2  . LYS A 1 35  ? -18.879 9.695   2.555   1.00 0.00 ? 35  LYS A HG2  1  
ATOM 527   H HG3  . LYS A 1 35  ? -17.415 10.599  2.162   1.00 0.00 ? 35  LYS A HG3  1  
ATOM 528   H HD2  . LYS A 1 35  ? -19.925 10.967  0.564   1.00 0.00 ? 35  LYS A HD2  1  
ATOM 529   H HD3  . LYS A 1 35  ? -19.691 11.821  2.091   1.00 0.00 ? 35  LYS A HD3  1  
ATOM 530   H HE2  . LYS A 1 35  ? -17.608 12.778  1.229   1.00 0.00 ? 35  LYS A HE2  1  
ATOM 531   H HE3  . LYS A 1 35  ? -17.845 11.923  -0.294  1.00 0.00 ? 35  LYS A HE3  1  
ATOM 532   H HZ1  . LYS A 1 35  ? -19.037 13.633  -0.994  1.00 0.00 ? 35  LYS A HZ1  1  
ATOM 533   H HZ2  . LYS A 1 35  ? -18.887 14.412  0.500   1.00 0.00 ? 35  LYS A HZ2  1  
ATOM 534   H HZ3  . LYS A 1 35  ? -20.175 13.350  0.225   1.00 0.00 ? 35  LYS A HZ3  1  
ATOM 535   N N    . ASN A 1 36  ? -16.022 7.032   -0.586  1.00 0.00 ? 36  ASN A N    1  
ATOM 536   C CA   . ASN A 1 36  ? -15.664 6.182   -1.715  1.00 0.00 ? 36  ASN A CA   1  
ATOM 537   C C    . ASN A 1 36  ? -14.660 5.113   -1.294  1.00 0.00 ? 36  ASN A C    1  
ATOM 538   O O    . ASN A 1 36  ? -14.607 4.032   -1.878  1.00 0.00 ? 36  ASN A O    1  
ATOM 539   C CB   . ASN A 1 36  ? -15.082 7.025   -2.851  1.00 0.00 ? 36  ASN A CB   1  
ATOM 540   C CG   . ASN A 1 36  ? -14.283 6.195   -3.837  1.00 0.00 ? 36  ASN A CG   1  
ATOM 541   O OD1  . ASN A 1 36  ? -14.846 5.539   -4.713  1.00 0.00 ? 36  ASN A OD1  1  
ATOM 542   N ND2  . ASN A 1 36  ? -12.962 6.219   -3.697  1.00 0.00 ? 36  ASN A ND2  1  
ATOM 543   H H    . ASN A 1 36  ? -15.374 7.690   -0.258  1.00 0.00 ? 36  ASN A H    1  
ATOM 544   H HA   . ASN A 1 36  ? -16.563 5.697   -2.063  1.00 0.00 ? 36  ASN A HA   1  
ATOM 545   H HB2  . ASN A 1 36  ? -15.889 7.505   -3.385  1.00 0.00 ? 36  ASN A HB2  1  
ATOM 546   H HB3  . ASN A 1 36  ? -14.432 7.780   -2.434  1.00 0.00 ? 36  ASN A HB3  1  
ATOM 547   H HD21 . ASN A 1 36  ? -12.583 6.763   -2.976  1.00 0.00 ? 36  ASN A HD21 1  
ATOM 548   H HD22 . ASN A 1 36  ? -12.422 5.691   -4.321  1.00 0.00 ? 36  ASN A HD22 1  
ATOM 549   N N    . GLY A 1 37  ? -13.865 5.424   -0.274  1.00 0.00 ? 37  GLY A N    1  
ATOM 550   C CA   . GLY A 1 37  ? -12.873 4.480   0.208   1.00 0.00 ? 37  GLY A CA   1  
ATOM 551   C C    . GLY A 1 37  ? -11.455 4.949   -0.047  1.00 0.00 ? 37  GLY A C    1  
ATOM 552   O O    . GLY A 1 37  ? -11.228 6.111   -0.387  1.00 0.00 ? 37  GLY A O    1  
ATOM 553   H H    . GLY A 1 37  ? -13.952 6.302   0.153   1.00 0.00 ? 37  GLY A H    1  
ATOM 554   H HA2  . GLY A 1 37  ? -13.011 4.342   1.270   1.00 0.00 ? 37  GLY A HA2  1  
ATOM 555   H HA3  . GLY A 1 37  ? -13.022 3.534   -0.290  1.00 0.00 ? 37  GLY A HA3  1  
ATOM 556   N N    . LEU A 1 38  ? -10.496 4.045   0.120   1.00 0.00 ? 38  LEU A N    1  
ATOM 557   C CA   . LEU A 1 38  ? -9.090  4.372   -0.092  1.00 0.00 ? 38  LEU A CA   1  
ATOM 558   C C    . LEU A 1 38  ? -8.805  4.613   -1.571  1.00 0.00 ? 38  LEU A C    1  
ATOM 559   O O    . LEU A 1 38  ? -8.397  3.703   -2.291  1.00 0.00 ? 38  LEU A O    1  
ATOM 560   C CB   . LEU A 1 38  ? -8.199  3.246   0.434   1.00 0.00 ? 38  LEU A CB   1  
ATOM 561   C CG   . LEU A 1 38  ? -8.571  2.680   1.805   1.00 0.00 ? 38  LEU A CG   1  
ATOM 562   C CD1  . LEU A 1 38  ? -7.653  1.525   2.173   1.00 0.00 ? 38  LEU A CD1  1  
ATOM 563   C CD2  . LEU A 1 38  ? -8.512  3.770   2.866   1.00 0.00 ? 38  LEU A CD2  1  
ATOM 564   H H    . LEU A 1 38  ? -10.738 3.136   0.393   1.00 0.00 ? 38  LEU A H    1  
ATOM 565   H HA   . LEU A 1 38  ? -8.874  5.277   0.456   1.00 0.00 ? 38  LEU A HA   1  
ATOM 566   H HB2  . LEU A 1 38  ? -8.233  2.437   -0.278  1.00 0.00 ? 38  LEU A HB2  1  
ATOM 567   H HB3  . LEU A 1 38  ? -7.189  3.626   0.496   1.00 0.00 ? 38  LEU A HB3  1  
ATOM 568   H HG   . LEU A 1 38  ? -9.584  2.303   1.768   1.00 0.00 ? 38  LEU A HG   1  
ATOM 569   H HD11 . LEU A 1 38  ? -7.098  1.776   3.064   1.00 0.00 ? 38  LEU A HD11 1  
ATOM 570   H HD12 . LEU A 1 38  ? -6.966  1.339   1.361   1.00 0.00 ? 38  LEU A HD12 1  
ATOM 571   H HD13 . LEU A 1 38  ? -8.244  0.639   2.354   1.00 0.00 ? 38  LEU A HD13 1  
ATOM 572   H HD21 . LEU A 1 38  ? -8.134  3.353   3.788   1.00 0.00 ? 38  LEU A HD21 1  
ATOM 573   H HD22 . LEU A 1 38  ? -9.504  4.166   3.030   1.00 0.00 ? 38  LEU A HD22 1  
ATOM 574   H HD23 . LEU A 1 38  ? -7.858  4.561   2.533   1.00 0.00 ? 38  LEU A HD23 1  
ATOM 575   N N    . GLY A 1 39  ? -9.020  5.847   -2.017  1.00 0.00 ? 39  GLY A N    1  
ATOM 576   C CA   . GLY A 1 39  ? -8.779  6.186   -3.407  1.00 0.00 ? 39  GLY A CA   1  
ATOM 577   C C    . GLY A 1 39  ? -7.311  6.431   -3.698  1.00 0.00 ? 39  GLY A C    1  
ATOM 578   O O    . GLY A 1 39  ? -6.793  7.519   -3.443  1.00 0.00 ? 39  GLY A O    1  
ATOM 579   H H    . GLY A 1 39  ? -9.346  6.533   -1.397  1.00 0.00 ? 39  GLY A H    1  
ATOM 580   H HA2  . GLY A 1 39  ? -9.128  5.376   -4.030  1.00 0.00 ? 39  GLY A HA2  1  
ATOM 581   H HA3  . GLY A 1 39  ? -9.335  7.080   -3.650  1.00 0.00 ? 39  GLY A HA3  1  
ATOM 582   N N    . LEU A 1 40  ? -6.639  5.417   -4.231  1.00 0.00 ? 40  LEU A N    1  
ATOM 583   C CA   . LEU A 1 40  ? -5.221  5.526   -4.556  1.00 0.00 ? 40  LEU A CA   1  
ATOM 584   C C    . LEU A 1 40  ? -4.924  4.902   -5.916  1.00 0.00 ? 40  LEU A C    1  
ATOM 585   O O    . LEU A 1 40  ? -5.421  3.823   -6.236  1.00 0.00 ? 40  LEU A O    1  
ATOM 586   C CB   . LEU A 1 40  ? -4.376  4.848   -3.475  1.00 0.00 ? 40  LEU A CB   1  
ATOM 587   C CG   . LEU A 1 40  ? -4.499  5.427   -2.066  1.00 0.00 ? 40  LEU A CG   1  
ATOM 588   C CD1  . LEU A 1 40  ? -4.253  4.349   -1.022  1.00 0.00 ? 40  LEU A CD1  1  
ATOM 589   C CD2  . LEU A 1 40  ? -3.530  6.585   -1.878  1.00 0.00 ? 40  LEU A CD2  1  
ATOM 590   H H    . LEU A 1 40  ? -7.106  4.575   -4.412  1.00 0.00 ? 40  LEU A H    1  
ATOM 591   H HA   . LEU A 1 40  ? -4.969  6.576   -4.592  1.00 0.00 ? 40  LEU A HA   1  
ATOM 592   H HB2  . LEU A 1 40  ? -4.667  3.810   -3.432  1.00 0.00 ? 40  LEU A HB2  1  
ATOM 593   H HB3  . LEU A 1 40  ? -3.340  4.918   -3.774  1.00 0.00 ? 40  LEU A HB3  1  
ATOM 594   H HG   . LEU A 1 40  ? -5.503  5.804   -1.924  1.00 0.00 ? 40  LEU A HG   1  
ATOM 595   H HD11 . LEU A 1 40  ? -4.677  4.657   -0.079  1.00 0.00 ? 40  LEU A HD11 1  
ATOM 596   H HD12 . LEU A 1 40  ? -3.190  4.196   -0.907  1.00 0.00 ? 40  LEU A HD12 1  
ATOM 597   H HD13 . LEU A 1 40  ? -4.716  3.427   -1.341  1.00 0.00 ? 40  LEU A HD13 1  
ATOM 598   H HD21 . LEU A 1 40  ? -2.636  6.230   -1.386  1.00 0.00 ? 40  LEU A HD21 1  
ATOM 599   H HD22 . LEU A 1 40  ? -3.994  7.349   -1.272  1.00 0.00 ? 40  LEU A HD22 1  
ATOM 600   H HD23 . LEU A 1 40  ? -3.270  6.997   -2.842  1.00 0.00 ? 40  LEU A HD23 1  
ATOM 601   N N    . SER A 1 41  ? -4.108  5.588   -6.710  1.00 0.00 ? 41  SER A N    1  
ATOM 602   C CA   . SER A 1 41  ? -3.746  5.102   -8.036  1.00 0.00 ? 41  SER A CA   1  
ATOM 603   C C    . SER A 1 41  ? -2.598  4.100   -7.953  1.00 0.00 ? 41  SER A C    1  
ATOM 604   O O    . SER A 1 41  ? -1.481  4.448   -7.568  1.00 0.00 ? 41  SER A O    1  
ATOM 605   C CB   . SER A 1 41  ? -3.352  6.271   -8.941  1.00 0.00 ? 41  SER A CB   1  
ATOM 606   O OG   . SER A 1 41  ? -4.458  7.123   -9.184  1.00 0.00 ? 41  SER A OG   1  
ATOM 607   H H    . SER A 1 41  ? -3.744  6.443   -6.398  1.00 0.00 ? 41  SER A H    1  
ATOM 608   H HA   . SER A 1 41  ? -4.609  4.608   -8.456  1.00 0.00 ? 41  SER A HA   1  
ATOM 609   H HB2  . SER A 1 41  ? -2.570  6.843   -8.466  1.00 0.00 ? 41  SER A HB2  1  
ATOM 610   H HB3  . SER A 1 41  ? -2.994  5.887   -9.886  1.00 0.00 ? 41  SER A HB3  1  
ATOM 611   H HG   . SER A 1 41  ? -5.095  7.032   -8.471  1.00 0.00 ? 41  SER A HG   1  
ATOM 612   N N    . LEU A 1 42  ? -2.882  2.854   -8.316  1.00 0.00 ? 42  LEU A N    1  
ATOM 613   C CA   . LEU A 1 42  ? -1.874  1.799   -8.283  1.00 0.00 ? 42  LEU A CA   1  
ATOM 614   C C    . LEU A 1 42  ? -1.367  1.486   -9.687  1.00 0.00 ? 42  LEU A C    1  
ATOM 615   O O    . LEU A 1 42  ? -2.090  1.649   -10.669 1.00 0.00 ? 42  LEU A O    1  
ATOM 616   C CB   . LEU A 1 42  ? -2.452  0.535   -7.644  1.00 0.00 ? 42  LEU A CB   1  
ATOM 617   C CG   . LEU A 1 42  ? -3.161  0.725   -6.303  1.00 0.00 ? 42  LEU A CG   1  
ATOM 618   C CD1  . LEU A 1 42  ? -3.736  -0.594  -5.811  1.00 0.00 ? 42  LEU A CD1  1  
ATOM 619   C CD2  . LEU A 1 42  ? -2.207  1.310   -5.272  1.00 0.00 ? 42  LEU A CD2  1  
ATOM 620   H H    . LEU A 1 42  ? -3.789  2.637   -8.614  1.00 0.00 ? 42  LEU A H    1  
ATOM 621   H HA   . LEU A 1 42  ? -1.047  2.150   -7.684  1.00 0.00 ? 42  LEU A HA   1  
ATOM 622   H HB2  . LEU A 1 42  ? -3.162  0.110   -8.336  1.00 0.00 ? 42  LEU A HB2  1  
ATOM 623   H HB3  . LEU A 1 42  ? -1.638  -0.160  -7.493  1.00 0.00 ? 42  LEU A HB3  1  
ATOM 624   H HG   . LEU A 1 42  ? -3.982  1.418   -6.432  1.00 0.00 ? 42  LEU A HG   1  
ATOM 625   H HD11 . LEU A 1 42  ? -2.935  -1.301  -5.659  1.00 0.00 ? 42  LEU A HD11 1  
ATOM 626   H HD12 . LEU A 1 42  ? -4.425  -0.983  -6.546  1.00 0.00 ? 42  LEU A HD12 1  
ATOM 627   H HD13 . LEU A 1 42  ? -4.258  -0.435  -4.879  1.00 0.00 ? 42  LEU A HD13 1  
ATOM 628   H HD21 . LEU A 1 42  ? -2.496  0.979   -4.286  1.00 0.00 ? 42  LEU A HD21 1  
ATOM 629   H HD22 . LEU A 1 42  ? -2.247  2.389   -5.316  1.00 0.00 ? 42  LEU A HD22 1  
ATOM 630   H HD23 . LEU A 1 42  ? -1.201  0.978   -5.483  1.00 0.00 ? 42  LEU A HD23 1  
ATOM 631   N N    . ALA A 1 43  ? -0.120  1.035   -9.773  1.00 0.00 ? 43  ALA A N    1  
ATOM 632   C CA   . ALA A 1 43  ? 0.483   0.695   -11.056 1.00 0.00 ? 43  ALA A CA   1  
ATOM 633   C C    . ALA A 1 43  ? 1.611   -0.317  -10.882 1.00 0.00 ? 43  ALA A C    1  
ATOM 634   O O    . ALA A 1 43  ? 2.427   -0.200  -9.969  1.00 0.00 ? 43  ALA A O    1  
ATOM 635   C CB   . ALA A 1 43  ? 0.998   1.950   -11.745 1.00 0.00 ? 43  ALA A CB   1  
ATOM 636   H H    . ALA A 1 43  ? 0.407   0.927   -8.954  1.00 0.00 ? 43  ALA A H    1  
ATOM 637   H HA   . ALA A 1 43  ? -0.284  0.260   -11.680 1.00 0.00 ? 43  ALA A HA   1  
ATOM 638   H HB1  . ALA A 1 43  ? 1.880   1.706   -12.321 1.00 0.00 ? 43  ALA A HB1  1  
ATOM 639   H HB2  . ALA A 1 43  ? 0.235   2.339   -12.402 1.00 0.00 ? 43  ALA A HB2  1  
ATOM 640   H HB3  . ALA A 1 43  ? 1.248   2.692   -11.002 1.00 0.00 ? 43  ALA A HB3  1  
ATOM 641   N N    . GLY A 1 44  ? 1.648   -1.311  -11.763 1.00 0.00 ? 44  GLY A N    1  
ATOM 642   C CA   . GLY A 1 44  ? 2.680   -2.330  -11.689 1.00 0.00 ? 44  GLY A CA   1  
ATOM 643   C C    . GLY A 1 44  ? 4.066   -1.771  -11.941 1.00 0.00 ? 44  GLY A C    1  
ATOM 644   O O    . GLY A 1 44  ? 4.212   -0.627  -12.371 1.00 0.00 ? 44  GLY A O    1  
ATOM 645   H H    . GLY A 1 44  ? 0.971   -1.354  -12.470 1.00 0.00 ? 44  GLY A H    1  
ATOM 646   H HA2  . GLY A 1 44  ? 2.657   -2.779  -10.707 1.00 0.00 ? 44  GLY A HA2  1  
ATOM 647   H HA3  . GLY A 1 44  ? 2.472   -3.091  -12.427 1.00 0.00 ? 44  GLY A HA3  1  
ATOM 648   N N    . ASN A 1 45  ? 5.086   -2.579  -11.671 1.00 0.00 ? 45  ASN A N    1  
ATOM 649   C CA   . ASN A 1 45  ? 6.468   -2.157  -11.869 1.00 0.00 ? 45  ASN A CA   1  
ATOM 650   C C    . ASN A 1 45  ? 6.805   -2.079  -13.355 1.00 0.00 ? 45  ASN A C    1  
ATOM 651   O O    . ASN A 1 45  ? 6.305   -2.866  -14.159 1.00 0.00 ? 45  ASN A O    1  
ATOM 652   C CB   . ASN A 1 45  ? 7.424   -3.124  -11.168 1.00 0.00 ? 45  ASN A CB   1  
ATOM 653   C CG   . ASN A 1 45  ? 8.858   -2.633  -11.183 1.00 0.00 ? 45  ASN A CG   1  
ATOM 654   O OD1  . ASN A 1 45  ? 9.467   -2.494  -12.244 1.00 0.00 ? 45  ASN A OD1  1  
ATOM 655   N ND2  . ASN A 1 45  ? 9.405   -2.367  -10.002 1.00 0.00 ? 45  ASN A ND2  1  
ATOM 656   H H    . ASN A 1 45  ? 4.906   -3.480  -11.330 1.00 0.00 ? 45  ASN A H    1  
ATOM 657   H HA   . ASN A 1 45  ? 6.580   -1.175  -11.434 1.00 0.00 ? 45  ASN A HA   1  
ATOM 658   H HB2  . ASN A 1 45  ? 7.115   -3.243  -10.139 1.00 0.00 ? 45  ASN A HB2  1  
ATOM 659   H HB3  . ASN A 1 45  ? 7.385   -4.082  -11.664 1.00 0.00 ? 45  ASN A HB3  1  
ATOM 660   H HD21 . ASN A 1 45  ? 8.860   -2.501  -9.199  1.00 0.00 ? 45  ASN A HD21 1  
ATOM 661   H HD22 . ASN A 1 45  ? 10.331  -2.047  -9.983  1.00 0.00 ? 45  ASN A HD22 1  
ATOM 662   N N    . LYS A 1 46  ? 7.658   -1.124  -13.713 1.00 0.00 ? 46  LYS A N    1  
ATOM 663   C CA   . LYS A 1 46  ? 8.065   -0.943  -15.101 1.00 0.00 ? 46  LYS A CA   1  
ATOM 664   C C    . LYS A 1 46  ? 8.164   -2.285  -15.819 1.00 0.00 ? 46  LYS A C    1  
ATOM 665   O O    . LYS A 1 46  ? 7.590   -2.469  -16.893 1.00 0.00 ? 46  LYS A O    1  
ATOM 666   C CB   . LYS A 1 46  ? 9.410   -0.216  -15.169 1.00 0.00 ? 46  LYS A CB   1  
ATOM 667   C CG   . LYS A 1 46  ? 9.298   1.289   -14.994 1.00 0.00 ? 46  LYS A CG   1  
ATOM 668   C CD   . LYS A 1 46  ? 10.663  1.934   -14.824 1.00 0.00 ? 46  LYS A CD   1  
ATOM 669   C CE   . LYS A 1 46  ? 10.589  3.445   -14.979 1.00 0.00 ? 46  LYS A CE   1  
ATOM 670   N NZ   . LYS A 1 46  ? 10.335  3.846   -16.390 1.00 0.00 ? 46  LYS A NZ   1  
ATOM 671   H H    . LYS A 1 46  ? 8.023   -0.527  -13.026 1.00 0.00 ? 46  LYS A H    1  
ATOM 672   H HA   . LYS A 1 46  ? 7.315   -0.341  -15.591 1.00 0.00 ? 46  LYS A HA   1  
ATOM 673   H HB2  . LYS A 1 46  ? 10.053  -0.601  -14.391 1.00 0.00 ? 46  LYS A HB2  1  
ATOM 674   H HB3  . LYS A 1 46  ? 9.864   -0.413  -16.129 1.00 0.00 ? 46  LYS A HB3  1  
ATOM 675   H HG2  . LYS A 1 46  ? 8.820   1.709   -15.867 1.00 0.00 ? 46  LYS A HG2  1  
ATOM 676   H HG3  . LYS A 1 46  ? 8.699   1.497   -14.119 1.00 0.00 ? 46  LYS A HG3  1  
ATOM 677   H HD2  . LYS A 1 46  ? 11.040  1.703   -13.838 1.00 0.00 ? 46  LYS A HD2  1  
ATOM 678   H HD3  . LYS A 1 46  ? 11.335  1.536   -15.571 1.00 0.00 ? 46  LYS A HD3  1  
ATOM 679   H HE2  . LYS A 1 46  ? 9.789   3.819   -14.358 1.00 0.00 ? 46  LYS A HE2  1  
ATOM 680   H HE3  . LYS A 1 46  ? 11.526  3.873   -14.655 1.00 0.00 ? 46  LYS A HE3  1  
ATOM 681   H HZ1  . LYS A 1 46  ? 10.081  3.012   -16.958 1.00 0.00 ? 46  LYS A HZ1  1  
ATOM 682   H HZ2  . LYS A 1 46  ? 11.187  4.282   -16.797 1.00 0.00 ? 46  LYS A HZ2  1  
ATOM 683   H HZ3  . LYS A 1 46  ? 9.554   4.531   -16.432 1.00 0.00 ? 46  LYS A HZ3  1  
ATOM 684   N N    . ASP A 1 47  ? 8.893   -3.219  -15.219 1.00 0.00 ? 47  ASP A N    1  
ATOM 685   C CA   . ASP A 1 47  ? 9.064   -4.546  -15.800 1.00 0.00 ? 47  ASP A CA   1  
ATOM 686   C C    . ASP A 1 47  ? 8.014   -5.514  -15.264 1.00 0.00 ? 47  ASP A C    1  
ATOM 687   O O    . ASP A 1 47  ? 7.966   -5.792  -14.066 1.00 0.00 ? 47  ASP A O    1  
ATOM 688   C CB   . ASP A 1 47  ? 10.466  -5.079  -15.502 1.00 0.00 ? 47  ASP A CB   1  
ATOM 689   C CG   . ASP A 1 47  ? 10.965  -6.029  -16.574 1.00 0.00 ? 47  ASP A CG   1  
ATOM 690   O OD1  . ASP A 1 47  ? 10.921  -5.654  -17.765 1.00 0.00 ? 47  ASP A OD1  1  
ATOM 691   O OD2  . ASP A 1 47  ? 11.398  -7.145  -16.222 1.00 0.00 ? 47  ASP A OD2  1  
ATOM 692   H H    . ASP A 1 47  ? 9.325   -3.012  -14.364 1.00 0.00 ? 47  ASP A H    1  
ATOM 693   H HA   . ASP A 1 47  ? 8.942   -4.458  -16.869 1.00 0.00 ? 47  ASP A HA   1  
ATOM 694   H HB2  . ASP A 1 47  ? 11.154  -4.248  -15.436 1.00 0.00 ? 47  ASP A HB2  1  
ATOM 695   H HB3  . ASP A 1 47  ? 10.452  -5.605  -14.559 1.00 0.00 ? 47  ASP A HB3  1  
ATOM 696   N N    . ARG A 1 48  ? 7.174   -6.023  -16.159 1.00 0.00 ? 48  ARG A N    1  
ATOM 697   C CA   . ARG A 1 48  ? 6.123   -6.957  -15.776 1.00 0.00 ? 48  ARG A CA   1  
ATOM 698   C C    . ARG A 1 48  ? 6.668   -8.037  -14.845 1.00 0.00 ? 48  ARG A C    1  
ATOM 699   O O    . ARG A 1 48  ? 6.122   -8.276  -13.768 1.00 0.00 ? 48  ARG A O    1  
ATOM 700   C CB   . ARG A 1 48  ? 5.508   -7.604  -17.019 1.00 0.00 ? 48  ARG A CB   1  
ATOM 701   C CG   . ARG A 1 48  ? 4.584   -8.770  -16.705 1.00 0.00 ? 48  ARG A CG   1  
ATOM 702   C CD   . ARG A 1 48  ? 3.229   -8.289  -16.208 1.00 0.00 ? 48  ARG A CD   1  
ATOM 703   N NE   . ARG A 1 48  ? 2.312   -9.398  -15.963 1.00 0.00 ? 48  ARG A NE   1  
ATOM 704   C CZ   . ARG A 1 48  ? 1.658   -10.038 -16.926 1.00 0.00 ? 48  ARG A CZ   1  
ATOM 705   N NH1  . ARG A 1 48  ? 1.821   -9.682  -18.192 1.00 0.00 ? 48  ARG A NH1  1  
ATOM 706   N NH2  . ARG A 1 48  ? 0.840   -11.038 -16.623 1.00 0.00 ? 48  ARG A NH2  1  
ATOM 707   H H    . ARG A 1 48  ? 7.262   -5.762  -17.100 1.00 0.00 ? 48  ARG A H    1  
ATOM 708   H HA   . ARG A 1 48  ? 5.358   -6.401  -15.254 1.00 0.00 ? 48  ARG A HA   1  
ATOM 709   H HB2  . ARG A 1 48  ? 4.940   -6.858  -17.555 1.00 0.00 ? 48  ARG A HB2  1  
ATOM 710   H HB3  . ARG A 1 48  ? 6.303   -7.964  -17.653 1.00 0.00 ? 48  ARG A HB3  1  
ATOM 711   H HG2  . ARG A 1 48  ? 4.440   -9.354  -17.601 1.00 0.00 ? 48  ARG A HG2  1  
ATOM 712   H HG3  . ARG A 1 48  ? 5.041   -9.383  -15.942 1.00 0.00 ? 48  ARG A HG3  1  
ATOM 713   H HD2  . ARG A 1 48  ? 3.372   -7.742  -15.289 1.00 0.00 ? 48  ARG A HD2  1  
ATOM 714   H HD3  . ARG A 1 48  ? 2.800   -7.636  -16.953 1.00 0.00 ? 48  ARG A HD3  1  
ATOM 715   H HE   . ARG A 1 48  ? 2.176   -9.678  -15.034 1.00 0.00 ? 48  ARG A HE   1  
ATOM 716   H HH11 . ARG A 1 48  ? 2.438   -8.929  -18.423 1.00 0.00 ? 48  ARG A HH11 1  
ATOM 717   H HH12 . ARG A 1 48  ? 1.329   -10.166 -18.916 1.00 0.00 ? 48  ARG A HH12 1  
ATOM 718   H HH21 . ARG A 1 48  ? 0.715   -11.310 -15.669 1.00 0.00 ? 48  ARG A HH21 1  
ATOM 719   H HH22 . ARG A 1 48  ? 0.349   -11.519 -17.348 1.00 0.00 ? 48  ARG A HH22 1  
ATOM 720   N N    . SER A 1 49  ? 7.748   -8.685  -15.268 1.00 0.00 ? 49  SER A N    1  
ATOM 721   C CA   . SER A 1 49  ? 8.365   -9.742  -14.475 1.00 0.00 ? 49  SER A CA   1  
ATOM 722   C C    . SER A 1 49  ? 8.421   -9.352  -13.001 1.00 0.00 ? 49  SER A C    1  
ATOM 723   O O    . SER A 1 49  ? 8.264   -10.196 -12.118 1.00 0.00 ? 49  SER A O    1  
ATOM 724   C CB   . SER A 1 49  ? 9.775   -10.038 -14.989 1.00 0.00 ? 49  SER A CB   1  
ATOM 725   O OG   . SER A 1 49  ? 9.732   -10.691 -16.246 1.00 0.00 ? 49  SER A OG   1  
ATOM 726   H H    . SER A 1 49  ? 8.138   -8.449  -16.136 1.00 0.00 ? 49  SER A H    1  
ATOM 727   H HA   . SER A 1 49  ? 7.759   -10.630 -14.577 1.00 0.00 ? 49  SER A HA   1  
ATOM 728   H HB2  . SER A 1 49  ? 10.318  -9.112  -15.097 1.00 0.00 ? 49  SER A HB2  1  
ATOM 729   H HB3  . SER A 1 49  ? 10.286  -10.676 -14.283 1.00 0.00 ? 49  SER A HB3  1  
ATOM 730   H HG   . SER A 1 49  ? 10.585  -10.610 -16.679 1.00 0.00 ? 49  SER A HG   1  
ATOM 731   N N    . ARG A 1 50  ? 8.646   -8.068  -12.743 1.00 0.00 ? 50  ARG A N    1  
ATOM 732   C CA   . ARG A 1 50  ? 8.724   -7.565  -11.377 1.00 0.00 ? 50  ARG A CA   1  
ATOM 733   C C    . ARG A 1 50  ? 7.347   -7.142  -10.873 1.00 0.00 ? 50  ARG A C    1  
ATOM 734   O O    . ARG A 1 50  ? 6.763   -6.180  -11.370 1.00 0.00 ? 50  ARG A O    1  
ATOM 735   C CB   . ARG A 1 50  ? 9.692   -6.383  -11.300 1.00 0.00 ? 50  ARG A CB   1  
ATOM 736   C CG   . ARG A 1 50  ? 11.150  -6.797  -11.177 1.00 0.00 ? 50  ARG A CG   1  
ATOM 737   C CD   . ARG A 1 50  ? 12.043  -5.605  -10.871 1.00 0.00 ? 50  ARG A CD   1  
ATOM 738   N NE   . ARG A 1 50  ? 13.322  -6.013  -10.296 1.00 0.00 ? 50  ARG A NE   1  
ATOM 739   C CZ   . ARG A 1 50  ? 13.445  -6.567  -9.096  1.00 0.00 ? 50  ARG A CZ   1  
ATOM 740   N NH1  . ARG A 1 50  ? 12.372  -6.780  -8.347  1.00 0.00 ? 50  ARG A NH1  1  
ATOM 741   N NH2  . ARG A 1 50  ? 14.644  -6.912  -8.642  1.00 0.00 ? 50  ARG A NH2  1  
ATOM 742   H H    . ARG A 1 50  ? 8.763   -7.444  -13.489 1.00 0.00 ? 50  ARG A H    1  
ATOM 743   H HA   . ARG A 1 50  ? 9.094   -8.363  -10.750 1.00 0.00 ? 50  ARG A HA   1  
ATOM 744   H HB2  . ARG A 1 50  ? 9.585   -5.786  -12.194 1.00 0.00 ? 50  ARG A HB2  1  
ATOM 745   H HB3  . ARG A 1 50  ? 9.438   -5.781  -10.441 1.00 0.00 ? 50  ARG A HB3  1  
ATOM 746   H HG2  . ARG A 1 50  ? 11.244  -7.517  -10.378 1.00 0.00 ? 50  ARG A HG2  1  
ATOM 747   H HG3  . ARG A 1 50  ? 11.467  -7.244  -12.107 1.00 0.00 ? 50  ARG A HG3  1  
ATOM 748   H HD2  . ARG A 1 50  ? 12.227  -5.065  -11.788 1.00 0.00 ? 50  ARG A HD2  1  
ATOM 749   H HD3  . ARG A 1 50  ? 11.533  -4.960  -10.170 1.00 0.00 ? 50  ARG A HD3  1  
ATOM 750   H HE   . ARG A 1 50  ? 14.129  -5.865  -10.833 1.00 0.00 ? 50  ARG A HE   1  
ATOM 751   H HH11 . ARG A 1 50  ? 11.467  -6.523  -8.687  1.00 0.00 ? 50  ARG A HH11 1  
ATOM 752   H HH12 . ARG A 1 50  ? 12.467  -7.199  -7.444  1.00 0.00 ? 50  ARG A HH12 1  
ATOM 753   H HH21 . ARG A 1 50  ? 15.455  -6.753  -9.204  1.00 0.00 ? 50  ARG A HH21 1  
ATOM 754   H HH22 . ARG A 1 50  ? 14.735  -7.329  -7.739  1.00 0.00 ? 50  ARG A HH22 1  
ATOM 755   N N    . MET A 1 51  ? 6.836   -7.869  -9.885  1.00 0.00 ? 51  MET A N    1  
ATOM 756   C CA   . MET A 1 51  ? 5.528   -7.568  -9.314  1.00 0.00 ? 51  MET A CA   1  
ATOM 757   C C    . MET A 1 51  ? 5.661   -6.648  -8.105  1.00 0.00 ? 51  MET A C    1  
ATOM 758   O O    . MET A 1 51  ? 6.422   -6.930  -7.179  1.00 0.00 ? 51  MET A O    1  
ATOM 759   C CB   . MET A 1 51  ? 4.814   -8.860  -8.911  1.00 0.00 ? 51  MET A CB   1  
ATOM 760   C CG   . MET A 1 51  ? 3.949   -9.446  -10.015 1.00 0.00 ? 51  MET A CG   1  
ATOM 761   S SD   . MET A 1 51  ? 2.686   -8.295  -10.593 1.00 0.00 ? 51  MET A SD   1  
ATOM 762   C CE   . MET A 1 51  ? 1.197   -9.114  -10.027 1.00 0.00 ? 51  MET A CE   1  
ATOM 763   H H    . MET A 1 51  ? 7.349   -8.624  -9.530  1.00 0.00 ? 51  MET A H    1  
ATOM 764   H HA   . MET A 1 51  ? 4.944   -7.066  -10.071 1.00 0.00 ? 51  MET A HA   1  
ATOM 765   H HB2  . MET A 1 51  ? 5.555   -9.595  -8.635  1.00 0.00 ? 51  MET A HB2  1  
ATOM 766   H HB3  . MET A 1 51  ? 4.183   -8.658  -8.058  1.00 0.00 ? 51  MET A HB3  1  
ATOM 767   H HG2  . MET A 1 51  ? 4.582   -9.710  -10.849 1.00 0.00 ? 51  MET A HG2  1  
ATOM 768   H HG3  . MET A 1 51  ? 3.463   -10.334 -9.639  1.00 0.00 ? 51  MET A HG3  1  
ATOM 769   H HE1  . MET A 1 51  ? 0.333   -8.610  -10.433 1.00 0.00 ? 51  MET A HE1  1  
ATOM 770   H HE2  . MET A 1 51  ? 1.204   -10.142 -10.359 1.00 0.00 ? 51  MET A HE2  1  
ATOM 771   H HE3  . MET A 1 51  ? 1.158   -9.084  -8.948  1.00 0.00 ? 51  MET A HE3  1  
ATOM 772   N N    . SER A 1 52  ? 4.916   -5.547  -8.119  1.00 0.00 ? 52  SER A N    1  
ATOM 773   C CA   . SER A 1 52  ? 4.954   -4.584  -7.024  1.00 0.00 ? 52  SER A CA   1  
ATOM 774   C C    . SER A 1 52  ? 3.920   -3.483  -7.233  1.00 0.00 ? 52  SER A C    1  
ATOM 775   O O    . SER A 1 52  ? 3.845   -2.882  -8.305  1.00 0.00 ? 52  SER A O    1  
ATOM 776   C CB   . SER A 1 52  ? 6.351   -3.972  -6.905  1.00 0.00 ? 52  SER A CB   1  
ATOM 777   O OG   . SER A 1 52  ? 6.391   -2.989  -5.885  1.00 0.00 ? 52  SER A OG   1  
ATOM 778   H H    . SER A 1 52  ? 4.328   -5.378  -8.885  1.00 0.00 ? 52  SER A H    1  
ATOM 779   H HA   . SER A 1 52  ? 4.723   -5.111  -6.111  1.00 0.00 ? 52  SER A HA   1  
ATOM 780   H HB2  . SER A 1 52  ? 7.063   -4.748  -6.668  1.00 0.00 ? 52  SER A HB2  1  
ATOM 781   H HB3  . SER A 1 52  ? 6.620   -3.510  -7.844  1.00 0.00 ? 52  SER A HB3  1  
ATOM 782   H HG   . SER A 1 52  ? 5.722   -2.322  -6.056  1.00 0.00 ? 52  SER A HG   1  
ATOM 783   N N    . ILE A 1 53  ? 3.123   -3.225  -6.202  1.00 0.00 ? 53  ILE A N    1  
ATOM 784   C CA   . ILE A 1 53  ? 2.094   -2.195  -6.271  1.00 0.00 ? 53  ILE A CA   1  
ATOM 785   C C    . ILE A 1 53  ? 2.618   -0.858  -5.759  1.00 0.00 ? 53  ILE A C    1  
ATOM 786   O O    . ILE A 1 53  ? 2.927   -0.712  -4.577  1.00 0.00 ? 53  ILE A O    1  
ATOM 787   C CB   . ILE A 1 53  ? 0.847   -2.590  -5.458  1.00 0.00 ? 53  ILE A CB   1  
ATOM 788   C CG1  . ILE A 1 53  ? 0.381   -3.995  -5.848  1.00 0.00 ? 53  ILE A CG1  1  
ATOM 789   C CG2  . ILE A 1 53  ? -0.268  -1.578  -5.673  1.00 0.00 ? 53  ILE A CG2  1  
ATOM 790   C CD1  . ILE A 1 53  ? -0.417  -4.688  -4.766  1.00 0.00 ? 53  ILE A CD1  1  
ATOM 791   H H    . ILE A 1 53  ? 3.231   -3.738  -5.374  1.00 0.00 ? 53  ILE A H    1  
ATOM 792   H HA   . ILE A 1 53  ? 1.803   -2.084  -7.306  1.00 0.00 ? 53  ILE A HA   1  
ATOM 793   H HB   . ILE A 1 53  ? 1.110   -2.584  -4.411  1.00 0.00 ? 53  ILE A HB   1  
ATOM 794   H HG12 . ILE A 1 53  ? -0.239  -3.931  -6.727  1.00 0.00 ? 53  ILE A HG12 1  
ATOM 795   H HG13 . ILE A 1 53  ? 1.246   -4.605  -6.066  1.00 0.00 ? 53  ILE A HG13 1  
ATOM 796   H HG21 . ILE A 1 53  ? -1.034  -2.014  -6.297  1.00 0.00 ? 53  ILE A HG21 1  
ATOM 797   H HG22 . ILE A 1 53  ? -0.695  -1.305  -4.719  1.00 0.00 ? 53  ILE A HG22 1  
ATOM 798   H HG23 . ILE A 1 53  ? 0.131   -0.698  -6.154  1.00 0.00 ? 53  ILE A HG23 1  
ATOM 799   H HD11 . ILE A 1 53  ? -0.315  -5.758  -4.872  1.00 0.00 ? 53  ILE A HD11 1  
ATOM 800   H HD12 . ILE A 1 53  ? -0.051  -4.385  -3.797  1.00 0.00 ? 53  ILE A HD12 1  
ATOM 801   H HD13 . ILE A 1 53  ? -1.459  -4.417  -4.858  1.00 0.00 ? 53  ILE A HD13 1  
ATOM 802   N N    . PHE A 1 54  ? 2.713   0.117   -6.657  1.00 0.00 ? 54  PHE A N    1  
ATOM 803   C CA   . PHE A 1 54  ? 3.199   1.444   -6.297  1.00 0.00 ? 54  PHE A CA   1  
ATOM 804   C C    . PHE A 1 54  ? 2.061   2.460   -6.305  1.00 0.00 ? 54  PHE A C    1  
ATOM 805   O O    . PHE A 1 54  ? 0.996   2.212   -6.871  1.00 0.00 ? 54  PHE A O    1  
ATOM 806   C CB   . PHE A 1 54  ? 4.300   1.886   -7.262  1.00 0.00 ? 54  PHE A CB   1  
ATOM 807   C CG   . PHE A 1 54  ? 5.540   1.043   -7.184  1.00 0.00 ? 54  PHE A CG   1  
ATOM 808   C CD1  . PHE A 1 54  ? 6.305   1.017   -6.028  1.00 0.00 ? 54  PHE A CD1  1  
ATOM 809   C CD2  . PHE A 1 54  ? 5.943   0.277   -8.266  1.00 0.00 ? 54  PHE A CD2  1  
ATOM 810   C CE1  . PHE A 1 54  ? 7.446   0.241   -5.953  1.00 0.00 ? 54  PHE A CE1  1  
ATOM 811   C CE2  . PHE A 1 54  ? 7.083   -0.501  -8.196  1.00 0.00 ? 54  PHE A CE2  1  
ATOM 812   C CZ   . PHE A 1 54  ? 7.836   -0.518  -7.039  1.00 0.00 ? 54  PHE A CZ   1  
ATOM 813   H H    . PHE A 1 54  ? 2.451   -0.061  -7.585  1.00 0.00 ? 54  PHE A H    1  
ATOM 814   H HA   . PHE A 1 54  ? 3.607   1.387   -5.300  1.00 0.00 ? 54  PHE A HA   1  
ATOM 815   H HB2  . PHE A 1 54  ? 3.926   1.832   -8.274  1.00 0.00 ? 54  PHE A HB2  1  
ATOM 816   H HB3  . PHE A 1 54  ? 4.576   2.906   -7.039  1.00 0.00 ? 54  PHE A HB3  1  
ATOM 817   H HD1  . PHE A 1 54  ? 6.000   1.611   -5.178  1.00 0.00 ? 54  PHE A HD1  1  
ATOM 818   H HD2  . PHE A 1 54  ? 5.355   0.290   -9.173  1.00 0.00 ? 54  PHE A HD2  1  
ATOM 819   H HE1  . PHE A 1 54  ? 8.033   0.231   -5.046  1.00 0.00 ? 54  PHE A HE1  1  
ATOM 820   H HE2  . PHE A 1 54  ? 7.386   -1.093  -9.047  1.00 0.00 ? 54  PHE A HE2  1  
ATOM 821   H HZ   . PHE A 1 54  ? 8.728   -1.125  -6.982  1.00 0.00 ? 54  PHE A HZ   1  
ATOM 822   N N    . VAL A 1 55  ? 2.294   3.606   -5.673  1.00 0.00 ? 55  VAL A N    1  
ATOM 823   C CA   . VAL A 1 55  ? 1.290   4.662   -5.608  1.00 0.00 ? 55  VAL A CA   1  
ATOM 824   C C    . VAL A 1 55  ? 1.646   5.817   -6.536  1.00 0.00 ? 55  VAL A C    1  
ATOM 825   O O    . VAL A 1 55  ? 2.433   6.695   -6.179  1.00 0.00 ? 55  VAL A O    1  
ATOM 826   C CB   . VAL A 1 55  ? 1.134   5.199   -4.173  1.00 0.00 ? 55  VAL A CB   1  
ATOM 827   C CG1  . VAL A 1 55  ? 0.052   6.267   -4.117  1.00 0.00 ? 55  VAL A CG1  1  
ATOM 828   C CG2  . VAL A 1 55  ? 0.824   4.063   -3.210  1.00 0.00 ? 55  VAL A CG2  1  
ATOM 829   H H    . VAL A 1 55  ? 3.163   3.746   -5.242  1.00 0.00 ? 55  VAL A H    1  
ATOM 830   H HA   . VAL A 1 55  ? 0.344   4.242   -5.917  1.00 0.00 ? 55  VAL A HA   1  
ATOM 831   H HB   . VAL A 1 55  ? 2.069   5.650   -3.875  1.00 0.00 ? 55  VAL A HB   1  
ATOM 832   H HG11 . VAL A 1 55  ? -0.104  6.568   -3.092  1.00 0.00 ? 55  VAL A HG11 1  
ATOM 833   H HG12 . VAL A 1 55  ? 0.359   7.121   -4.702  1.00 0.00 ? 55  VAL A HG12 1  
ATOM 834   H HG13 . VAL A 1 55  ? -0.868  5.867   -4.518  1.00 0.00 ? 55  VAL A HG13 1  
ATOM 835   H HG21 . VAL A 1 55  ? 0.929   4.415   -2.194  1.00 0.00 ? 55  VAL A HG21 1  
ATOM 836   H HG22 . VAL A 1 55  ? -0.189  3.722   -3.369  1.00 0.00 ? 55  VAL A HG22 1  
ATOM 837   H HG23 . VAL A 1 55  ? 1.510   3.247   -3.381  1.00 0.00 ? 55  VAL A HG23 1  
ATOM 838   N N    . VAL A 1 56  ? 1.062   5.812   -7.730  1.00 0.00 ? 56  VAL A N    1  
ATOM 839   C CA   . VAL A 1 56  ? 1.316   6.861   -8.710  1.00 0.00 ? 56  VAL A CA   1  
ATOM 840   C C    . VAL A 1 56  ? 0.252   7.951   -8.637  1.00 0.00 ? 56  VAL A C    1  
ATOM 841   O O    . VAL A 1 56  ? 0.070   8.720   -9.579  1.00 0.00 ? 56  VAL A O    1  
ATOM 842   C CB   . VAL A 1 56  ? 1.357   6.294   -10.141 1.00 0.00 ? 56  VAL A CB   1  
ATOM 843   C CG1  . VAL A 1 56  ? 2.311   5.112   -10.220 1.00 0.00 ? 56  VAL A CG1  1  
ATOM 844   C CG2  . VAL A 1 56  ? -0.039  5.895   -10.596 1.00 0.00 ? 56  VAL A CG2  1  
ATOM 845   H H    . VAL A 1 56  ? 0.444   5.086   -7.956  1.00 0.00 ? 56  VAL A H    1  
ATOM 846   H HA   . VAL A 1 56  ? 2.279   7.297   -8.490  1.00 0.00 ? 56  VAL A HA   1  
ATOM 847   H HB   . VAL A 1 56  ? 1.720   7.067   -10.803 1.00 0.00 ? 56  VAL A HB   1  
ATOM 848   H HG11 . VAL A 1 56  ? 3.326   5.474   -10.295 1.00 0.00 ? 56  VAL A HG11 1  
ATOM 849   H HG12 . VAL A 1 56  ? 2.208   4.506   -9.332  1.00 0.00 ? 56  VAL A HG12 1  
ATOM 850   H HG13 . VAL A 1 56  ? 2.076   4.518   -11.091 1.00 0.00 ? 56  VAL A HG13 1  
ATOM 851   H HG21 . VAL A 1 56  ? -0.092  4.821   -10.693 1.00 0.00 ? 56  VAL A HG21 1  
ATOM 852   H HG22 . VAL A 1 56  ? -0.764  6.225   -9.866  1.00 0.00 ? 56  VAL A HG22 1  
ATOM 853   H HG23 . VAL A 1 56  ? -0.253  6.354   -11.549 1.00 0.00 ? 56  VAL A HG23 1  
ATOM 854   N N    . GLY A 1 57  ? -0.450  8.011   -7.509  1.00 0.00 ? 57  GLY A N    1  
ATOM 855   C CA   . GLY A 1 57  ? -1.487  9.010   -7.333  1.00 0.00 ? 57  GLY A CA   1  
ATOM 856   C C    . GLY A 1 57  ? -2.289  8.797   -6.064  1.00 0.00 ? 57  GLY A C    1  
ATOM 857   O O    . GLY A 1 57  ? -2.450  7.664   -5.607  1.00 0.00 ? 57  GLY A O    1  
ATOM 858   H H    . GLY A 1 57  ? -0.261  7.371   -6.790  1.00 0.00 ? 57  GLY A H    1  
ATOM 859   H HA2  . GLY A 1 57  ? -1.029  9.987   -7.296  1.00 0.00 ? 57  GLY A HA2  1  
ATOM 860   H HA3  . GLY A 1 57  ? -2.157  8.970   -8.179  1.00 0.00 ? 57  GLY A HA3  1  
ATOM 861   N N    . ILE A 1 58  ? -2.791  9.886   -5.493  1.00 0.00 ? 58  ILE A N    1  
ATOM 862   C CA   . ILE A 1 58  ? -3.579  9.812   -4.269  1.00 0.00 ? 58  ILE A CA   1  
ATOM 863   C C    . ILE A 1 58  ? -4.844  10.657  -4.378  1.00 0.00 ? 58  ILE A C    1  
ATOM 864   O O    . ILE A 1 58  ? -4.821  11.861  -4.130  1.00 0.00 ? 58  ILE A O    1  
ATOM 865   C CB   . ILE A 1 58  ? -2.767  10.280  -3.047  1.00 0.00 ? 58  ILE A CB   1  
ATOM 866   C CG1  . ILE A 1 58  ? -1.542  9.385   -2.848  1.00 0.00 ? 58  ILE A CG1  1  
ATOM 867   C CG2  . ILE A 1 58  ? -3.638  10.279  -1.800  1.00 0.00 ? 58  ILE A CG2  1  
ATOM 868   C CD1  . ILE A 1 58  ? -0.595  9.885   -1.780  1.00 0.00 ? 58  ILE A CD1  1  
ATOM 869   H H    . ILE A 1 58  ? -2.628  10.760  -5.904  1.00 0.00 ? 58  ILE A H    1  
ATOM 870   H HA   . ILE A 1 58  ? -3.860  8.780   -4.116  1.00 0.00 ? 58  ILE A HA   1  
ATOM 871   H HB   . ILE A 1 58  ? -2.438  11.292  -3.227  1.00 0.00 ? 58  ILE A HB   1  
ATOM 872   H HG12 . ILE A 1 58  ? -1.868  8.396   -2.565  1.00 0.00 ? 58  ILE A HG12 1  
ATOM 873   H HG13 . ILE A 1 58  ? -0.994  9.325   -3.778  1.00 0.00 ? 58  ILE A HG13 1  
ATOM 874   H HG21 . ILE A 1 58  ? -4.220  9.370   -1.768  1.00 0.00 ? 58  ILE A HG21 1  
ATOM 875   H HG22 . ILE A 1 58  ? -3.011  10.334  -0.923  1.00 0.00 ? 58  ILE A HG22 1  
ATOM 876   H HG23 . ILE A 1 58  ? -4.301  11.131  -1.823  1.00 0.00 ? 58  ILE A HG23 1  
ATOM 877   H HD11 . ILE A 1 58  ? -0.454  9.117   -1.034  1.00 0.00 ? 58  ILE A HD11 1  
ATOM 878   H HD12 . ILE A 1 58  ? 0.356   10.131  -2.228  1.00 0.00 ? 58  ILE A HD12 1  
ATOM 879   H HD13 . ILE A 1 58  ? -1.012  10.766  -1.313  1.00 0.00 ? 58  ILE A HD13 1  
ATOM 880   N N    . ASN A 1 59  ? -5.947  10.015  -4.749  1.00 0.00 ? 59  ASN A N    1  
ATOM 881   C CA   . ASN A 1 59  ? -7.223  10.707  -4.890  1.00 0.00 ? 59  ASN A CA   1  
ATOM 882   C C    . ASN A 1 59  ? -7.390  11.766  -3.804  1.00 0.00 ? 59  ASN A C    1  
ATOM 883   O O    . ASN A 1 59  ? -7.375  11.473  -2.608  1.00 0.00 ? 59  ASN A O    1  
ATOM 884   C CB   . ASN A 1 59  ? -8.379  9.707   -4.824  1.00 0.00 ? 59  ASN A CB   1  
ATOM 885   C CG   . ASN A 1 59  ? -9.614  10.203  -5.551  1.00 0.00 ? 59  ASN A CG   1  
ATOM 886   O OD1  . ASN A 1 59  ? -9.519  10.974  -6.506  1.00 0.00 ? 59  ASN A OD1  1  
ATOM 887   N ND2  . ASN A 1 59  ? -10.783 9.760   -5.101  1.00 0.00 ? 59  ASN A ND2  1  
ATOM 888   H H    . ASN A 1 59  ? -5.902  9.054   -4.933  1.00 0.00 ? 59  ASN A H    1  
ATOM 889   H HA   . ASN A 1 59  ? -7.233  11.192  -5.854  1.00 0.00 ? 59  ASN A HA   1  
ATOM 890   H HB2  . ASN A 1 59  ? -8.068  8.776   -5.277  1.00 0.00 ? 59  ASN A HB2  1  
ATOM 891   H HB3  . ASN A 1 59  ? -8.638  9.531   -3.791  1.00 0.00 ? 59  ASN A HB3  1  
ATOM 892   H HD21 . ASN A 1 59  ? -10.783 9.148   -4.336  1.00 0.00 ? 59  ASN A HD21 1  
ATOM 893   H HD22 . ASN A 1 59  ? -11.598 10.065  -5.554  1.00 0.00 ? 59  ASN A HD22 1  
ATOM 894   N N    . PRO A 1 60  ? -7.555  13.028  -4.229  1.00 0.00 ? 60  PRO A N    1  
ATOM 895   C CA   . PRO A 1 60  ? -7.729  14.156  -3.309  1.00 0.00 ? 60  PRO A CA   1  
ATOM 896   C C    . PRO A 1 60  ? -9.075  14.118  -2.593  1.00 0.00 ? 60  PRO A C    1  
ATOM 897   O O    . PRO A 1 60  ? -9.340  14.931  -1.709  1.00 0.00 ? 60  PRO A O    1  
ATOM 898   C CB   . PRO A 1 60  ? -7.646  15.378  -4.227  1.00 0.00 ? 60  PRO A CB   1  
ATOM 899   C CG   . PRO A 1 60  ? -8.061  14.874  -5.567  1.00 0.00 ? 60  PRO A CG   1  
ATOM 900   C CD   . PRO A 1 60  ? -7.583  13.450  -5.639  1.00 0.00 ? 60  PRO A CD   1  
ATOM 901   H HA   . PRO A 1 60  ? -6.935  14.198  -2.578  1.00 0.00 ? 60  PRO A HA   1  
ATOM 902   H HB2  . PRO A 1 60  ? -8.316  16.147  -3.869  1.00 0.00 ? 60  PRO A HB2  1  
ATOM 903   H HB3  . PRO A 1 60  ? -6.634  15.753  -4.243  1.00 0.00 ? 60  PRO A HB3  1  
ATOM 904   H HG2  . PRO A 1 60  ? -9.135  14.915  -5.658  1.00 0.00 ? 60  PRO A HG2  1  
ATOM 905   H HG3  . PRO A 1 60  ? -7.594  15.465  -6.341  1.00 0.00 ? 60  PRO A HG3  1  
ATOM 906   H HD2  . PRO A 1 60  ? -8.277  12.848  -6.208  1.00 0.00 ? 60  PRO A HD2  1  
ATOM 907   H HD3  . PRO A 1 60  ? -6.596  13.404  -6.075  1.00 0.00 ? 60  PRO A HD3  1  
ATOM 908   N N    . GLU A 1 61  ? -9.920  13.168  -2.982  1.00 0.00 ? 61  GLU A N    1  
ATOM 909   C CA   . GLU A 1 61  ? -11.239 13.025  -2.376  1.00 0.00 ? 61  GLU A CA   1  
ATOM 910   C C    . GLU A 1 61  ? -11.273 11.836  -1.420  1.00 0.00 ? 61  GLU A C    1  
ATOM 911   O O    . GLU A 1 61  ? -12.190 11.702  -0.611  1.00 0.00 ? 61  GLU A O    1  
ATOM 912   C CB   . GLU A 1 61  ? -12.306 12.854  -3.459  1.00 0.00 ? 61  GLU A CB   1  
ATOM 913   C CG   . GLU A 1 61  ? -12.427 14.049  -4.389  1.00 0.00 ? 61  GLU A CG   1  
ATOM 914   C CD   . GLU A 1 61  ? -13.167 13.718  -5.671  1.00 0.00 ? 61  GLU A CD   1  
ATOM 915   O OE1  . GLU A 1 61  ? -12.508 13.301  -6.646  1.00 0.00 ? 61  GLU A OE1  1  
ATOM 916   O OE2  . GLU A 1 61  ? -14.405 13.877  -5.698  1.00 0.00 ? 61  GLU A OE2  1  
ATOM 917   H H    . GLU A 1 61  ? -9.651  12.549  -3.692  1.00 0.00 ? 61  GLU A H    1  
ATOM 918   H HA   . GLU A 1 61  ? -11.447 13.926  -1.818  1.00 0.00 ? 61  GLU A HA   1  
ATOM 919   H HB2  . GLU A 1 61  ? -12.063 11.984  -4.052  1.00 0.00 ? 61  GLU A HB2  1  
ATOM 920   H HB3  . GLU A 1 61  ? -13.262 12.697  -2.982  1.00 0.00 ? 61  GLU A HB3  1  
ATOM 921   H HG2  . GLU A 1 61  ? -12.961 14.835  -3.876  1.00 0.00 ? 61  GLU A HG2  1  
ATOM 922   H HG3  . GLU A 1 61  ? -11.435 14.394  -4.642  1.00 0.00 ? 61  GLU A HG3  1  
ATOM 923   N N    . GLY A 1 62  ? -10.265 10.974  -1.521  1.00 0.00 ? 62  GLY A N    1  
ATOM 924   C CA   . GLY A 1 62  ? -10.198 9.807   -0.660  1.00 0.00 ? 62  GLY A CA   1  
ATOM 925   C C    . GLY A 1 62  ? -9.615  10.124  0.702   1.00 0.00 ? 62  GLY A C    1  
ATOM 926   O O    . GLY A 1 62  ? -9.281  11.269  1.008   1.00 0.00 ? 62  GLY A O    1  
ATOM 927   H H    . GLY A 1 62  ? -9.561  11.132  -2.184  1.00 0.00 ? 62  GLY A H    1  
ATOM 928   H HA2  . GLY A 1 62  ? -11.195 9.412   -0.531  1.00 0.00 ? 62  GLY A HA2  1  
ATOM 929   H HA3  . GLY A 1 62  ? -9.584  9.058   -1.137  1.00 0.00 ? 62  GLY A HA3  1  
ATOM 930   N N    . PRO A 1 63  ? -9.485  9.092   1.549   1.00 0.00 ? 63  PRO A N    1  
ATOM 931   C CA   . PRO A 1 63  ? -8.939  9.241   2.901   1.00 0.00 ? 63  PRO A CA   1  
ATOM 932   C C    . PRO A 1 63  ? -7.445  9.548   2.892   1.00 0.00 ? 63  PRO A C    1  
ATOM 933   O O    . PRO A 1 63  ? -6.992  10.494  3.536   1.00 0.00 ? 63  PRO A O    1  
ATOM 934   C CB   . PRO A 1 63  ? -9.200  7.876   3.542   1.00 0.00 ? 63  PRO A CB   1  
ATOM 935   C CG   . PRO A 1 63  ? -9.268  6.926   2.397   1.00 0.00 ? 63  PRO A CG   1  
ATOM 936   C CD   . PRO A 1 63  ? -9.862  7.700   1.252   1.00 0.00 ? 63  PRO A CD   1  
ATOM 937   H HA   . PRO A 1 63  ? -9.459  10.008  3.457   1.00 0.00 ? 63  PRO A HA   1  
ATOM 938   H HB2  . PRO A 1 63  ? -8.390  7.630   4.214   1.00 0.00 ? 63  PRO A HB2  1  
ATOM 939   H HB3  . PRO A 1 63  ? -10.132 7.903   4.088   1.00 0.00 ? 63  PRO A HB3  1  
ATOM 940   H HG2  . PRO A 1 63  ? -8.276  6.585   2.144   1.00 0.00 ? 63  PRO A HG2  1  
ATOM 941   H HG3  . PRO A 1 63  ? -9.901  6.089   2.651   1.00 0.00 ? 63  PRO A HG3  1  
ATOM 942   H HD2  . PRO A 1 63  ? -9.433  7.376   0.315   1.00 0.00 ? 63  PRO A HD2  1  
ATOM 943   H HD3  . PRO A 1 63  ? -10.936 7.587   1.237   1.00 0.00 ? 63  PRO A HD3  1  
ATOM 944   N N    . ALA A 1 64  ? -6.685  8.742   2.158   1.00 0.00 ? 64  ALA A N    1  
ATOM 945   C CA   . ALA A 1 64  ? -5.242  8.930   2.063   1.00 0.00 ? 64  ALA A CA   1  
ATOM 946   C C    . ALA A 1 64  ? -4.891  10.401  1.872   1.00 0.00 ? 64  ALA A C    1  
ATOM 947   O O    . ALA A 1 64  ? -3.870  10.875  2.369   1.00 0.00 ? 64  ALA A O    1  
ATOM 948   C CB   . ALA A 1 64  ? -4.676  8.097   0.923   1.00 0.00 ? 64  ALA A CB   1  
ATOM 949   H H    . ALA A 1 64  ? -7.104  8.005   1.667   1.00 0.00 ? 64  ALA A H    1  
ATOM 950   H HA   . ALA A 1 64  ? -4.799  8.581   2.985   1.00 0.00 ? 64  ALA A HA   1  
ATOM 951   H HB1  . ALA A 1 64  ? -4.884  7.052   1.103   1.00 0.00 ? 64  ALA A HB1  1  
ATOM 952   H HB2  . ALA A 1 64  ? -5.134  8.401   -0.007  1.00 0.00 ? 64  ALA A HB2  1  
ATOM 953   H HB3  . ALA A 1 64  ? -3.608  8.247   0.864   1.00 0.00 ? 64  ALA A HB3  1  
ATOM 954   N N    . ALA A 1 65  ? -5.744  11.119  1.147   1.00 0.00 ? 65  ALA A N    1  
ATOM 955   C CA   . ALA A 1 65  ? -5.524  12.537  0.892   1.00 0.00 ? 65  ALA A CA   1  
ATOM 956   C C    . ALA A 1 65  ? -5.862  13.375  2.120   1.00 0.00 ? 65  ALA A C    1  
ATOM 957   O O    . ALA A 1 65  ? -5.120  14.287  2.484   1.00 0.00 ? 65  ALA A O    1  
ATOM 958   C CB   . ALA A 1 65  ? -6.348  12.992  -0.304  1.00 0.00 ? 65  ALA A CB   1  
ATOM 959   H H    . ALA A 1 65  ? -6.540  10.684  0.777   1.00 0.00 ? 65  ALA A H    1  
ATOM 960   H HA   . ALA A 1 65  ? -4.479  12.674  0.651   1.00 0.00 ? 65  ALA A HA   1  
ATOM 961   H HB1  . ALA A 1 65  ? -7.161  12.298  -0.464  1.00 0.00 ? 65  ALA A HB1  1  
ATOM 962   H HB2  . ALA A 1 65  ? -6.747  13.977  -0.112  1.00 0.00 ? 65  ALA A HB2  1  
ATOM 963   H HB3  . ALA A 1 65  ? -5.721  13.021  -1.182  1.00 0.00 ? 65  ALA A HB3  1  
ATOM 964   N N    . ALA A 1 66  ? -6.986  13.060  2.754   1.00 0.00 ? 66  ALA A N    1  
ATOM 965   C CA   . ALA A 1 66  ? -7.422  13.784  3.942   1.00 0.00 ? 66  ALA A CA   1  
ATOM 966   C C    . ALA A 1 66  ? -6.384  13.686  5.055   1.00 0.00 ? 66  ALA A C    1  
ATOM 967   O O    . ALA A 1 66  ? -5.994  14.695  5.644   1.00 0.00 ? 66  ALA A O    1  
ATOM 968   C CB   . ALA A 1 66  ? -8.765  13.252  4.421   1.00 0.00 ? 66  ALA A CB   1  
ATOM 969   H H    . ALA A 1 66  ? -7.536  12.323  2.416   1.00 0.00 ? 66  ALA A H    1  
ATOM 970   H HA   . ALA A 1 66  ? -7.549  14.822  3.672   1.00 0.00 ? 66  ALA A HA   1  
ATOM 971   H HB1  . ALA A 1 66  ? -9.364  12.970  3.568   1.00 0.00 ? 66  ALA A HB1  1  
ATOM 972   H HB2  . ALA A 1 66  ? -8.606  12.390  5.051   1.00 0.00 ? 66  ALA A HB2  1  
ATOM 973   H HB3  . ALA A 1 66  ? -9.276  14.020  4.982   1.00 0.00 ? 66  ALA A HB3  1  
ATOM 974   N N    . ASP A 1 67  ? -5.942  12.466  5.340   1.00 0.00 ? 67  ASP A N    1  
ATOM 975   C CA   . ASP A 1 67  ? -4.949  12.236  6.383   1.00 0.00 ? 67  ASP A CA   1  
ATOM 976   C C    . ASP A 1 67  ? -3.667  13.011  6.093   1.00 0.00 ? 67  ASP A C    1  
ATOM 977   O O    . ASP A 1 67  ? -3.094  13.638  6.982   1.00 0.00 ? 67  ASP A O    1  
ATOM 978   C CB   . ASP A 1 67  ? -4.642  10.743  6.504   1.00 0.00 ? 67  ASP A CB   1  
ATOM 979   C CG   . ASP A 1 67  ? -3.990  10.392  7.828   1.00 0.00 ? 67  ASP A CG   1  
ATOM 980   O OD1  . ASP A 1 67  ? -4.175  11.153  8.801   1.00 0.00 ? 67  ASP A OD1  1  
ATOM 981   O OD2  . ASP A 1 67  ? -3.297  9.356   7.890   1.00 0.00 ? 67  ASP A OD2  1  
ATOM 982   H H    . ASP A 1 67  ? -6.292  11.701  4.836   1.00 0.00 ? 67  ASP A H    1  
ATOM 983   H HA   . ASP A 1 67  ? -5.363  12.586  7.317   1.00 0.00 ? 67  ASP A HA   1  
ATOM 984   H HB2  . ASP A 1 67  ? -5.562  10.184  6.418   1.00 0.00 ? 67  ASP A HB2  1  
ATOM 985   H HB3  . ASP A 1 67  ? -3.974  10.454  5.707   1.00 0.00 ? 67  ASP A HB3  1  
ATOM 986   N N    . GLY A 1 68  ? -3.222  12.960  4.841   1.00 0.00 ? 68  GLY A N    1  
ATOM 987   C CA   . GLY A 1 68  ? -2.010  13.660  4.456   1.00 0.00 ? 68  GLY A CA   1  
ATOM 988   C C    . GLY A 1 68  ? -0.755  12.925  4.884   1.00 0.00 ? 68  GLY A C    1  
ATOM 989   O O    . GLY A 1 68  ? 0.255   13.547  5.211   1.00 0.00 ? 68  GLY A O    1  
ATOM 990   H H    . GLY A 1 68  ? -3.720  12.444  4.173   1.00 0.00 ? 68  GLY A H    1  
ATOM 991   H HA2  . GLY A 1 68  ? -1.999  13.775  3.382   1.00 0.00 ? 68  GLY A HA2  1  
ATOM 992   H HA3  . GLY A 1 68  ? -2.013  14.639  4.913   1.00 0.00 ? 68  GLY A HA3  1  
ATOM 993   N N    . ARG A 1 69  ? -0.820  11.597  4.884   1.00 0.00 ? 69  ARG A N    1  
ATOM 994   C CA   . ARG A 1 69  ? 0.319   10.777  5.278   1.00 0.00 ? 69  ARG A CA   1  
ATOM 995   C C    . ARG A 1 69  ? 0.898   10.037  4.075   1.00 0.00 ? 69  ARG A C    1  
ATOM 996   O O    . ARG A 1 69  ? 2.101   10.090  3.822   1.00 0.00 ? 69  ARG A O    1  
ATOM 997   C CB   . ARG A 1 69  ? -0.097  9.774   6.356   1.00 0.00 ? 69  ARG A CB   1  
ATOM 998   C CG   . ARG A 1 69  ? -0.414  10.417  7.696   1.00 0.00 ? 69  ARG A CG   1  
ATOM 999   C CD   . ARG A 1 69  ? 0.825   10.522  8.571   1.00 0.00 ? 69  ARG A CD   1  
ATOM 1000  N NE   . ARG A 1 69  ? 1.677   11.642  8.181   1.00 0.00 ? 69  ARG A NE   1  
ATOM 1001  C CZ   . ARG A 1 69  ? 2.803   11.962  8.809   1.00 0.00 ? 69  ARG A CZ   1  
ATOM 1002  N NH1  . ARG A 1 69  ? 3.211   11.250  9.850   1.00 0.00 ? 69  ARG A NH1  1  
ATOM 1003  N NH2  . ARG A 1 69  ? 3.524   12.996  8.395   1.00 0.00 ? 69  ARG A NH2  1  
ATOM 1004  H H    . ARG A 1 69  ? -1.654  11.159  4.613   1.00 0.00 ? 69  ARG A H    1  
ATOM 1005  H HA   . ARG A 1 69  ? 1.076   11.432  5.681   1.00 0.00 ? 69  ARG A HA   1  
ATOM 1006  H HB2  . ARG A 1 69  ? -0.976  9.244   6.019   1.00 0.00 ? 69  ARG A HB2  1  
ATOM 1007  H HB3  . ARG A 1 69  ? 0.706   9.067   6.501   1.00 0.00 ? 69  ARG A HB3  1  
ATOM 1008  H HG2  . ARG A 1 69  ? -0.805  11.409  7.525   1.00 0.00 ? 69  ARG A HG2  1  
ATOM 1009  H HG3  . ARG A 1 69  ? -1.154  9.818   8.205   1.00 0.00 ? 69  ARG A HG3  1  
ATOM 1010  H HD2  . ARG A 1 69  ? 0.515   10.657  9.596   1.00 0.00 ? 69  ARG A HD2  1  
ATOM 1011  H HD3  . ARG A 1 69  ? 1.389   9.605   8.484   1.00 0.00 ? 69  ARG A HD3  1  
ATOM 1012  H HE   . ARG A 1 69  ? 1.395   12.182  7.414   1.00 0.00 ? 69  ARG A HE   1  
ATOM 1013  H HH11 . ARG A 1 69  ? 2.670   10.469  10.164  1.00 0.00 ? 69  ARG A HH11 1  
ATOM 1014  H HH12 . ARG A 1 69  ? 4.060   11.492  10.320  1.00 0.00 ? 69  ARG A HH12 1  
ATOM 1015  H HH21 . ARG A 1 69  ? 3.220   13.535  7.610   1.00 0.00 ? 69  ARG A HH21 1  
ATOM 1016  H HH22 . ARG A 1 69  ? 4.371   13.236  8.868   1.00 0.00 ? 69  ARG A HH22 1  
ATOM 1017  N N    . MET A 1 70  ? 0.033   9.347   3.339   1.00 0.00 ? 70  MET A N    1  
ATOM 1018  C CA   . MET A 1 70  ? 0.458   8.596   2.163   1.00 0.00 ? 70  MET A CA   1  
ATOM 1019  C C    . MET A 1 70  ? 0.961   9.536   1.072   1.00 0.00 ? 70  MET A C    1  
ATOM 1020  O O    . MET A 1 70  ? 0.445   10.641  0.906   1.00 0.00 ? 70  MET A O    1  
ATOM 1021  C CB   . MET A 1 70  ? -0.696  7.746   1.629   1.00 0.00 ? 70  MET A CB   1  
ATOM 1022  C CG   . MET A 1 70  ? -0.751  6.351   2.230   1.00 0.00 ? 70  MET A CG   1  
ATOM 1023  S SD   . MET A 1 70  ? -1.547  5.156   1.138   1.00 0.00 ? 70  MET A SD   1  
ATOM 1024  C CE   . MET A 1 70  ? -0.237  4.853   -0.044  1.00 0.00 ? 70  MET A CE   1  
ATOM 1025  H H    . MET A 1 70  ? -0.914  9.342   3.592   1.00 0.00 ? 70  MET A H    1  
ATOM 1026  H HA   . MET A 1 70  ? 1.266   7.945   2.461   1.00 0.00 ? 70  MET A HA   1  
ATOM 1027  H HB2  . MET A 1 70  ? -1.627  8.246   1.848   1.00 0.00 ? 70  MET A HB2  1  
ATOM 1028  H HB3  . MET A 1 70  ? -0.591  7.650   0.559   1.00 0.00 ? 70  MET A HB3  1  
ATOM 1029  H HG2  . MET A 1 70  ? 0.256   6.018   2.429   1.00 0.00 ? 70  MET A HG2  1  
ATOM 1030  H HG3  . MET A 1 70  ? -1.304  6.395   3.157   1.00 0.00 ? 70  MET A HG3  1  
ATOM 1031  H HE1  . MET A 1 70  ? 0.178   3.870   0.122   1.00 0.00 ? 70  MET A HE1  1  
ATOM 1032  H HE2  . MET A 1 70  ? -0.636  4.910   -1.046  1.00 0.00 ? 70  MET A HE2  1  
ATOM 1033  H HE3  . MET A 1 70  ? 0.538   5.596   0.079   1.00 0.00 ? 70  MET A HE3  1  
ATOM 1034  N N    . ARG A 1 71  ? 1.970   9.089   0.331   1.00 0.00 ? 71  ARG A N    1  
ATOM 1035  C CA   . ARG A 1 71  ? 2.542   9.891   -0.743  1.00 0.00 ? 71  ARG A CA   1  
ATOM 1036  C C    . ARG A 1 71  ? 2.785   9.040   -1.987  1.00 0.00 ? 71  ARG A C    1  
ATOM 1037  O O    . ARG A 1 71  ? 2.577   7.827   -1.971  1.00 0.00 ? 71  ARG A O    1  
ATOM 1038  C CB   . ARG A 1 71  ? 3.854   10.532  -0.287  1.00 0.00 ? 71  ARG A CB   1  
ATOM 1039  C CG   . ARG A 1 71  ? 3.682   11.531  0.845   1.00 0.00 ? 71  ARG A CG   1  
ATOM 1040  C CD   . ARG A 1 71  ? 3.463   12.940  0.316   1.00 0.00 ? 71  ARG A CD   1  
ATOM 1041  N NE   . ARG A 1 71  ? 2.846   13.810  1.313   1.00 0.00 ? 71  ARG A NE   1  
ATOM 1042  C CZ   . ARG A 1 71  ? 2.404   15.034  1.048   1.00 0.00 ? 71  ARG A CZ   1  
ATOM 1043  N NH1  . ARG A 1 71  ? 2.509   15.530  -0.177  1.00 0.00 ? 71  ARG A NH1  1  
ATOM 1044  N NH2  . ARG A 1 71  ? 1.854   15.765  2.009   1.00 0.00 ? 71  ARG A NH2  1  
ATOM 1045  H H    . ARG A 1 71  ? 2.338   8.199   0.512   1.00 0.00 ? 71  ARG A H    1  
ATOM 1046  H HA   . ARG A 1 71  ? 1.837   10.671  -0.988  1.00 0.00 ? 71  ARG A HA   1  
ATOM 1047  H HB2  . ARG A 1 71  ? 4.524   9.754   0.049   1.00 0.00 ? 71  ARG A HB2  1  
ATOM 1048  H HB3  . ARG A 1 71  ? 4.302   11.044  -1.125  1.00 0.00 ? 71  ARG A HB3  1  
ATOM 1049  H HG2  . ARG A 1 71  ? 2.826   11.245  1.439   1.00 0.00 ? 71  ARG A HG2  1  
ATOM 1050  H HG3  . ARG A 1 71  ? 4.569   11.521  1.460   1.00 0.00 ? 71  ARG A HG3  1  
ATOM 1051  H HD2  . ARG A 1 71  ? 4.419   13.356  0.032   1.00 0.00 ? 71  ARG A HD2  1  
ATOM 1052  H HD3  . ARG A 1 71  ? 2.821   12.889  -0.551  1.00 0.00 ? 71  ARG A HD3  1  
ATOM 1053  H HE   . ARG A 1 71  ? 2.758   13.464  2.225   1.00 0.00 ? 71  ARG A HE   1  
ATOM 1054  H HH11 . ARG A 1 71  ? 2.922   14.981  -0.904  1.00 0.00 ? 71  ARG A HH11 1  
ATOM 1055  H HH12 . ARG A 1 71  ? 2.174   16.451  -0.375  1.00 0.00 ? 71  ARG A HH12 1  
ATOM 1056  H HH21 . ARG A 1 71  ? 1.772   15.395  2.934   1.00 0.00 ? 71  ARG A HH21 1  
ATOM 1057  H HH22 . ARG A 1 71  ? 1.521   16.686  1.808   1.00 0.00 ? 71  ARG A HH22 1  
ATOM 1058  N N    . ILE A 1 72  ? 3.226   9.685   -3.062  1.00 0.00 ? 72  ILE A N    1  
ATOM 1059  C CA   . ILE A 1 72  ? 3.498   8.987   -4.312  1.00 0.00 ? 72  ILE A CA   1  
ATOM 1060  C C    . ILE A 1 72  ? 4.833   8.252   -4.253  1.00 0.00 ? 72  ILE A C    1  
ATOM 1061  O O    . ILE A 1 72  ? 5.871   8.851   -3.978  1.00 0.00 ? 72  ILE A O    1  
ATOM 1062  C CB   . ILE A 1 72  ? 3.512   9.959   -5.507  1.00 0.00 ? 72  ILE A CB   1  
ATOM 1063  C CG1  . ILE A 1 72  ? 2.339   10.936  -5.411  1.00 0.00 ? 72  ILE A CG1  1  
ATOM 1064  C CG2  . ILE A 1 72  ? 3.460   9.188   -6.818  1.00 0.00 ? 72  ILE A CG2  1  
ATOM 1065  C CD1  . ILE A 1 72  ? 1.013   10.264  -5.133  1.00 0.00 ? 72  ILE A CD1  1  
ATOM 1066  H H    . ILE A 1 72  ? 3.373   10.652  -3.012  1.00 0.00 ? 72  ILE A H    1  
ATOM 1067  H HA   . ILE A 1 72  ? 2.709   8.266   -4.469  1.00 0.00 ? 72  ILE A HA   1  
ATOM 1068  H HB   . ILE A 1 72  ? 4.437   10.514  -5.480  1.00 0.00 ? 72  ILE A HB   1  
ATOM 1069  H HG12 . ILE A 1 72  ? 2.527   11.639  -4.615  1.00 0.00 ? 72  ILE A HG12 1  
ATOM 1070  H HG13 . ILE A 1 72  ? 2.250   11.473  -6.345  1.00 0.00 ? 72  ILE A HG13 1  
ATOM 1071  H HG21 . ILE A 1 72  ? 3.764   9.834   -7.628  1.00 0.00 ? 72  ILE A HG21 1  
ATOM 1072  H HG22 . ILE A 1 72  ? 4.128   8.341   -6.763  1.00 0.00 ? 72  ILE A HG22 1  
ATOM 1073  H HG23 . ILE A 1 72  ? 2.453   8.841   -6.992  1.00 0.00 ? 72  ILE A HG23 1  
ATOM 1074  H HD11 . ILE A 1 72  ? 1.040   9.804   -4.156  1.00 0.00 ? 72  ILE A HD11 1  
ATOM 1075  H HD12 . ILE A 1 72  ? 0.222   10.998  -5.165  1.00 0.00 ? 72  ILE A HD12 1  
ATOM 1076  H HD13 . ILE A 1 72  ? 0.830   9.506   -5.882  1.00 0.00 ? 72  ILE A HD13 1  
ATOM 1077  N N    . GLY A 1 73  ? 4.797   6.949   -4.516  1.00 0.00 ? 73  GLY A N    1  
ATOM 1078  C CA   . GLY A 1 73  ? 6.010   6.154   -4.489  1.00 0.00 ? 73  GLY A CA   1  
ATOM 1079  C C    . GLY A 1 73  ? 5.924   4.997   -3.514  1.00 0.00 ? 73  GLY A C    1  
ATOM 1080  O O    . GLY A 1 73  ? 6.706   4.049   -3.593  1.00 0.00 ? 73  GLY A O    1  
ATOM 1081  H H    . GLY A 1 73  ? 3.940   6.525   -4.729  1.00 0.00 ? 73  GLY A H    1  
ATOM 1082  H HA2  . GLY A 1 73  ? 6.194   5.764   -5.479  1.00 0.00 ? 73  GLY A HA2  1  
ATOM 1083  H HA3  . GLY A 1 73  ? 6.837   6.788   -4.204  1.00 0.00 ? 73  GLY A HA3  1  
ATOM 1084  N N    . ASP A 1 74  ? 4.972   5.073   -2.590  1.00 0.00 ? 74  ASP A N    1  
ATOM 1085  C CA   . ASP A 1 74  ? 4.786   4.024   -1.595  1.00 0.00 ? 74  ASP A CA   1  
ATOM 1086  C C    . ASP A 1 74  ? 4.487   2.686   -2.264  1.00 0.00 ? 74  ASP A C    1  
ATOM 1087  O O    . ASP A 1 74  ? 3.768   2.628   -3.261  1.00 0.00 ? 74  ASP A O    1  
ATOM 1088  C CB   . ASP A 1 74  ? 3.652   4.395   -0.638  1.00 0.00 ? 74  ASP A CB   1  
ATOM 1089  C CG   . ASP A 1 74  ? 3.948   5.655   0.150   1.00 0.00 ? 74  ASP A CG   1  
ATOM 1090  O OD1  . ASP A 1 74  ? 5.067   5.767   0.693   1.00 0.00 ? 74  ASP A OD1  1  
ATOM 1091  O OD2  . ASP A 1 74  ? 3.061   6.531   0.223   1.00 0.00 ? 74  ASP A OD2  1  
ATOM 1092  H H    . ASP A 1 74  ? 4.379   5.854   -2.579  1.00 0.00 ? 74  ASP A H    1  
ATOM 1093  H HA   . ASP A 1 74  ? 5.703   3.934   -1.033  1.00 0.00 ? 74  ASP A HA   1  
ATOM 1094  H HB2  . ASP A 1 74  ? 2.747   4.552   -1.206  1.00 0.00 ? 74  ASP A HB2  1  
ATOM 1095  H HB3  . ASP A 1 74  ? 3.498   3.584   0.059   1.00 0.00 ? 74  ASP A HB3  1  
ATOM 1096  N N    . GLU A 1 75  ? 5.044   1.615   -1.710  1.00 0.00 ? 75  GLU A N    1  
ATOM 1097  C CA   . GLU A 1 75  ? 4.838   0.278   -2.255  1.00 0.00 ? 75  GLU A CA   1  
ATOM 1098  C C    . GLU A 1 75  ? 4.038   -0.588  -1.286  1.00 0.00 ? 75  GLU A C    1  
ATOM 1099  O O    . GLU A 1 75  ? 4.597   -1.192  -0.369  1.00 0.00 ? 75  GLU A O    1  
ATOM 1100  C CB   . GLU A 1 75  ? 6.182   -0.386  -2.559  1.00 0.00 ? 75  GLU A CB   1  
ATOM 1101  C CG   . GLU A 1 75  ? 6.080   -1.881  -2.808  1.00 0.00 ? 75  GLU A CG   1  
ATOM 1102  C CD   . GLU A 1 75  ? 7.433   -2.529  -3.034  1.00 0.00 ? 75  GLU A CD   1  
ATOM 1103  O OE1  . GLU A 1 75  ? 8.368   -1.817  -3.456  1.00 0.00 ? 75  GLU A OE1  1  
ATOM 1104  O OE2  . GLU A 1 75  ? 7.556   -3.747  -2.790  1.00 0.00 ? 75  GLU A OE2  1  
ATOM 1105  H H    . GLU A 1 75  ? 5.608   1.726   -0.916  1.00 0.00 ? 75  GLU A H    1  
ATOM 1106  H HA   . GLU A 1 75  ? 4.280   0.378   -3.174  1.00 0.00 ? 75  GLU A HA   1  
ATOM 1107  H HB2  . GLU A 1 75  ? 6.609   0.077   -3.437  1.00 0.00 ? 75  GLU A HB2  1  
ATOM 1108  H HB3  . GLU A 1 75  ? 6.846   -0.227  -1.722  1.00 0.00 ? 75  GLU A HB3  1  
ATOM 1109  H HG2  . GLU A 1 75  ? 5.615   -2.345  -1.952  1.00 0.00 ? 75  GLU A HG2  1  
ATOM 1110  H HG3  . GLU A 1 75  ? 5.468   -2.046  -3.683  1.00 0.00 ? 75  GLU A HG3  1  
ATOM 1111  N N    . LEU A 1 76  ? 2.727   -0.642  -1.494  1.00 0.00 ? 76  LEU A N    1  
ATOM 1112  C CA   . LEU A 1 76  ? 1.849   -1.433  -0.639  1.00 0.00 ? 76  LEU A CA   1  
ATOM 1113  C C    . LEU A 1 76  ? 2.400   -2.842  -0.447  1.00 0.00 ? 76  LEU A C    1  
ATOM 1114  O O    . LEU A 1 76  ? 2.907   -3.455  -1.388  1.00 0.00 ? 76  LEU A O    1  
ATOM 1115  C CB   . LEU A 1 76  ? 0.444   -1.500  -1.241  1.00 0.00 ? 76  LEU A CB   1  
ATOM 1116  C CG   . LEU A 1 76  ? -0.359  -0.199  -1.218  1.00 0.00 ? 76  LEU A CG   1  
ATOM 1117  C CD1  . LEU A 1 76  ? -1.701  -0.388  -1.907  1.00 0.00 ? 76  LEU A CD1  1  
ATOM 1118  C CD2  . LEU A 1 76  ? -0.554  0.282   0.213   1.00 0.00 ? 76  LEU A CD2  1  
ATOM 1119  H H    . LEU A 1 76  ? 2.340   -0.139  -2.240  1.00 0.00 ? 76  LEU A H    1  
ATOM 1120  H HA   . LEU A 1 76  ? 1.797   -0.946  0.323   1.00 0.00 ? 76  LEU A HA   1  
ATOM 1121  H HB2  . LEU A 1 76  ? 0.540   -1.811  -2.270  1.00 0.00 ? 76  LEU A HB2  1  
ATOM 1122  H HB3  . LEU A 1 76  ? -0.115  -2.245  -0.692  1.00 0.00 ? 76  LEU A HB3  1  
ATOM 1123  H HG   . LEU A 1 76  ? 0.187   0.564   -1.756  1.00 0.00 ? 76  LEU A HG   1  
ATOM 1124  H HD11 . LEU A 1 76  ? -1.600  -1.112  -2.700  1.00 0.00 ? 76  LEU A HD11 1  
ATOM 1125  H HD12 . LEU A 1 76  ? -2.030  0.555   -2.319  1.00 0.00 ? 76  LEU A HD12 1  
ATOM 1126  H HD13 . LEU A 1 76  ? -2.428  -0.739  -1.189  1.00 0.00 ? 76  LEU A HD13 1  
ATOM 1127  H HD21 . LEU A 1 76  ? -0.284  -0.508  0.898   1.00 0.00 ? 76  LEU A HD21 1  
ATOM 1128  H HD22 . LEU A 1 76  ? -1.590  0.549   0.364   1.00 0.00 ? 76  LEU A HD22 1  
ATOM 1129  H HD23 . LEU A 1 76  ? 0.071   1.144   0.392   1.00 0.00 ? 76  LEU A HD23 1  
ATOM 1130  N N    . LEU A 1 77  ? 2.296   -3.351  0.775   1.00 0.00 ? 77  LEU A N    1  
ATOM 1131  C CA   . LEU A 1 77  ? 2.783   -4.690  1.091   1.00 0.00 ? 77  LEU A CA   1  
ATOM 1132  C C    . LEU A 1 77  ? 1.667   -5.551  1.674   1.00 0.00 ? 77  LEU A C    1  
ATOM 1133  O O    . LEU A 1 77  ? 1.546   -6.731  1.347   1.00 0.00 ? 77  LEU A O    1  
ATOM 1134  C CB   . LEU A 1 77  ? 3.950   -4.611  2.076   1.00 0.00 ? 77  LEU A CB   1  
ATOM 1135  C CG   . LEU A 1 77  ? 5.153   -3.781  1.627   1.00 0.00 ? 77  LEU A CG   1  
ATOM 1136  C CD1  . LEU A 1 77  ? 6.044   -3.447  2.813   1.00 0.00 ? 77  LEU A CD1  1  
ATOM 1137  C CD2  . LEU A 1 77  ? 5.942   -4.522  0.557   1.00 0.00 ? 77  LEU A CD2  1  
ATOM 1138  H H    . LEU A 1 77  ? 1.883   -2.815  1.483   1.00 0.00 ? 77  LEU A H    1  
ATOM 1139  H HA   . LEU A 1 77  ? 3.127   -5.142  0.172   1.00 0.00 ? 77  LEU A HA   1  
ATOM 1140  H HB2  . LEU A 1 77  ? 3.578   -4.184  2.995   1.00 0.00 ? 77  LEU A HB2  1  
ATOM 1141  H HB3  . LEU A 1 77  ? 4.292   -5.619  2.263   1.00 0.00 ? 77  LEU A HB3  1  
ATOM 1142  H HG   . LEU A 1 77  ? 4.802   -2.851  1.201   1.00 0.00 ? 77  LEU A HG   1  
ATOM 1143  H HD11 . LEU A 1 77  ? 6.197   -2.380  2.859   1.00 0.00 ? 77  LEU A HD11 1  
ATOM 1144  H HD12 . LEU A 1 77  ? 6.996   -3.944  2.699   1.00 0.00 ? 77  LEU A HD12 1  
ATOM 1145  H HD13 . LEU A 1 77  ? 5.571   -3.783  3.724   1.00 0.00 ? 77  LEU A HD13 1  
ATOM 1146  H HD21 . LEU A 1 77  ? 6.802   -4.994  1.007   1.00 0.00 ? 77  LEU A HD21 1  
ATOM 1147  H HD22 . LEU A 1 77  ? 6.269   -3.822  -0.198  1.00 0.00 ? 77  LEU A HD22 1  
ATOM 1148  H HD23 . LEU A 1 77  ? 5.314   -5.274  0.103   1.00 0.00 ? 77  LEU A HD23 1  
ATOM 1149  N N    . GLU A 1 78  ? 0.853   -4.951  2.537   1.00 0.00 ? 78  GLU A N    1  
ATOM 1150  C CA   . GLU A 1 78  ? -0.254  -5.664  3.164   1.00 0.00 ? 78  GLU A CA   1  
ATOM 1151  C C    . GLU A 1 78  ? -1.429  -4.725  3.421   1.00 0.00 ? 78  GLU A C    1  
ATOM 1152  O O    . GLU A 1 78  ? -1.246  -3.522  3.611   1.00 0.00 ? 78  GLU A O    1  
ATOM 1153  C CB   . GLU A 1 78  ? 0.201   -6.302  4.478   1.00 0.00 ? 78  GLU A CB   1  
ATOM 1154  C CG   . GLU A 1 78  ? 1.463   -7.136  4.345   1.00 0.00 ? 78  GLU A CG   1  
ATOM 1155  C CD   . GLU A 1 78  ? 1.837   -7.839  5.636   1.00 0.00 ? 78  GLU A CD   1  
ATOM 1156  O OE1  . GLU A 1 78  ? 1.082   -8.738  6.062   1.00 0.00 ? 78  GLU A OE1  1  
ATOM 1157  O OE2  . GLU A 1 78  ? 2.885   -7.490  6.219   1.00 0.00 ? 78  GLU A OE2  1  
ATOM 1158  H H    . GLU A 1 78  ? 1.000   -4.008  2.757   1.00 0.00 ? 78  GLU A H    1  
ATOM 1159  H HA   . GLU A 1 78  ? -0.572  -6.442  2.488   1.00 0.00 ? 78  GLU A HA   1  
ATOM 1160  H HB2  . GLU A 1 78  ? 0.385   -5.519  5.200   1.00 0.00 ? 78  GLU A HB2  1  
ATOM 1161  H HB3  . GLU A 1 78  ? -0.590  -6.939  4.847   1.00 0.00 ? 78  GLU A HB3  1  
ATOM 1162  H HG2  . GLU A 1 78  ? 1.308   -7.882  3.579   1.00 0.00 ? 78  GLU A HG2  1  
ATOM 1163  H HG3  . GLU A 1 78  ? 2.278   -6.489  4.056   1.00 0.00 ? 78  GLU A HG3  1  
ATOM 1164  N N    . ILE A 1 79  ? -2.635  -5.284  3.426   1.00 0.00 ? 79  ILE A N    1  
ATOM 1165  C CA   . ILE A 1 79  ? -3.840  -4.497  3.660   1.00 0.00 ? 79  ILE A CA   1  
ATOM 1166  C C    . ILE A 1 79  ? -4.921  -5.336  4.332   1.00 0.00 ? 79  ILE A C    1  
ATOM 1167  O O    . ILE A 1 79  ? -5.405  -6.314  3.764   1.00 0.00 ? 79  ILE A O    1  
ATOM 1168  C CB   . ILE A 1 79  ? -4.397  -3.917  2.347   1.00 0.00 ? 79  ILE A CB   1  
ATOM 1169  C CG1  . ILE A 1 79  ? -3.368  -2.992  1.695   1.00 0.00 ? 79  ILE A CG1  1  
ATOM 1170  C CG2  . ILE A 1 79  ? -5.697  -3.171  2.608   1.00 0.00 ? 79  ILE A CG2  1  
ATOM 1171  C CD1  . ILE A 1 79  ? -3.904  -2.242  0.496   1.00 0.00 ? 79  ILE A CD1  1  
ATOM 1172  H H    . ILE A 1 79  ? -2.716  -6.247  3.269   1.00 0.00 ? 79  ILE A H    1  
ATOM 1173  H HA   . ILE A 1 79  ? -3.580  -3.676  4.312   1.00 0.00 ? 79  ILE A HA   1  
ATOM 1174  H HB   . ILE A 1 79  ? -4.609  -4.737  1.678   1.00 0.00 ? 79  ILE A HB   1  
ATOM 1175  H HG12 . ILE A 1 79  ? -3.036  -2.266  2.419   1.00 0.00 ? 79  ILE A HG12 1  
ATOM 1176  H HG13 . ILE A 1 79  ? -2.523  -3.581  1.368   1.00 0.00 ? 79  ILE A HG13 1  
ATOM 1177  H HG21 . ILE A 1 79  ? -5.592  -2.144  2.291   1.00 0.00 ? 79  ILE A HG21 1  
ATOM 1178  H HG22 . ILE A 1 79  ? -6.497  -3.638  2.053   1.00 0.00 ? 79  ILE A HG22 1  
ATOM 1179  H HG23 . ILE A 1 79  ? -5.925  -3.201  3.663   1.00 0.00 ? 79  ILE A HG23 1  
ATOM 1180  H HD11 . ILE A 1 79  ? -3.233  -2.373  -0.341  1.00 0.00 ? 79  ILE A HD11 1  
ATOM 1181  H HD12 . ILE A 1 79  ? -4.881  -2.622  0.239   1.00 0.00 ? 79  ILE A HD12 1  
ATOM 1182  H HD13 . ILE A 1 79  ? -3.978  -1.190  0.734   1.00 0.00 ? 79  ILE A HD13 1  
ATOM 1183  N N    . ASN A 1 80  ? -5.297  -4.945  5.546   1.00 0.00 ? 80  ASN A N    1  
ATOM 1184  C CA   . ASN A 1 80  ? -6.324  -5.661  6.295   1.00 0.00 ? 80  ASN A CA   1  
ATOM 1185  C C    . ASN A 1 80  ? -5.906  -7.107  6.545   1.00 0.00 ? 80  ASN A C    1  
ATOM 1186  O O    . ASN A 1 80  ? -6.703  -8.030  6.382   1.00 0.00 ? 80  ASN A O    1  
ATOM 1187  C CB   . ASN A 1 80  ? -7.654  -5.625  5.541   1.00 0.00 ? 80  ASN A CB   1  
ATOM 1188  C CG   . ASN A 1 80  ? -8.811  -6.121  6.386   1.00 0.00 ? 80  ASN A CG   1  
ATOM 1189  O OD1  . ASN A 1 80  ? -9.205  -7.284  6.297   1.00 0.00 ? 80  ASN A OD1  1  
ATOM 1190  N ND2  . ASN A 1 80  ? -9.363  -5.239  7.210   1.00 0.00 ? 80  ASN A ND2  1  
ATOM 1191  H H    . ASN A 1 80  ? -4.875  -4.157  5.947   1.00 0.00 ? 80  ASN A H    1  
ATOM 1192  H HA   . ASN A 1 80  ? -6.446  -5.164  7.246   1.00 0.00 ? 80  ASN A HA   1  
ATOM 1193  H HB2  . ASN A 1 80  ? -7.863  -4.608  5.240   1.00 0.00 ? 80  ASN A HB2  1  
ATOM 1194  H HB3  . ASN A 1 80  ? -7.580  -6.248  4.662   1.00 0.00 ? 80  ASN A HB3  1  
ATOM 1195  H HD21 . ASN A 1 80  ? -8.997  -4.329  7.228   1.00 0.00 ? 80  ASN A HD21 1  
ATOM 1196  H HD22 . ASN A 1 80  ? -10.112 -5.533  7.769   1.00 0.00 ? 80  ASN A HD22 1  
ATOM 1197  N N    . ASN A 1 81  ? -4.652  -7.295  6.941   1.00 0.00 ? 81  ASN A N    1  
ATOM 1198  C CA   . ASN A 1 81  ? -4.128  -8.629  7.214   1.00 0.00 ? 81  ASN A CA   1  
ATOM 1199  C C    . ASN A 1 81  ? -4.127  -9.481  5.949   1.00 0.00 ? 81  ASN A C    1  
ATOM 1200  O O    . ASN A 1 81  ? -4.512  -10.650 5.976   1.00 0.00 ? 81  ASN A O    1  
ATOM 1201  C CB   . ASN A 1 81  ? -4.958  -9.313  8.302   1.00 0.00 ? 81  ASN A CB   1  
ATOM 1202  C CG   . ASN A 1 81  ? -5.037  -8.488  9.573   1.00 0.00 ? 81  ASN A CG   1  
ATOM 1203  O OD1  . ASN A 1 81  ? -4.808  -7.279  9.556   1.00 0.00 ? 81  ASN A OD1  1  
ATOM 1204  N ND2  . ASN A 1 81  ? -5.363  -9.142  10.682  1.00 0.00 ? 81  ASN A ND2  1  
ATOM 1205  H H    . ASN A 1 81  ? -4.064  -6.519  7.053   1.00 0.00 ? 81  ASN A H    1  
ATOM 1206  H HA   . ASN A 1 81  ? -3.112  -8.521  7.563   1.00 0.00 ? 81  ASN A HA   1  
ATOM 1207  H HB2  . ASN A 1 81  ? -5.962  -9.470  7.935   1.00 0.00 ? 81  ASN A HB2  1  
ATOM 1208  H HB3  . ASN A 1 81  ? -4.513  -10.267 8.540   1.00 0.00 ? 81  ASN A HB3  1  
ATOM 1209  H HD21 . ASN A 1 81  ? -5.532  -10.105 10.620  1.00 0.00 ? 81  ASN A HD21 1  
ATOM 1210  H HD22 . ASN A 1 81  ? -5.422  -8.633  11.517  1.00 0.00 ? 81  ASN A HD22 1  
ATOM 1211  N N    . GLN A 1 82  ? -3.690  -8.888  4.842   1.00 0.00 ? 82  GLN A N    1  
ATOM 1212  C CA   . GLN A 1 82  ? -3.639  -9.593  3.567   1.00 0.00 ? 82  GLN A CA   1  
ATOM 1213  C C    . GLN A 1 82  ? -2.441  -9.137  2.741   1.00 0.00 ? 82  GLN A C    1  
ATOM 1214  O O    . GLN A 1 82  ? -2.394  -7.998  2.275   1.00 0.00 ? 82  GLN A O    1  
ATOM 1215  C CB   . GLN A 1 82  ? -4.932  -9.366  2.782   1.00 0.00 ? 82  GLN A CB   1  
ATOM 1216  C CG   . GLN A 1 82  ? -6.014  -10.389 3.083   1.00 0.00 ? 82  GLN A CG   1  
ATOM 1217  C CD   . GLN A 1 82  ? -5.946  -11.597 2.169   1.00 0.00 ? 82  GLN A CD   1  
ATOM 1218  O OE1  . GLN A 1 82  ? -5.738  -12.722 2.623   1.00 0.00 ? 82  GLN A OE1  1  
ATOM 1219  N NE2  . GLN A 1 82  ? -6.123  -11.369 0.873   1.00 0.00 ? 82  GLN A NE2  1  
ATOM 1220  H H    . GLN A 1 82  ? -3.397  -7.954  4.884   1.00 0.00 ? 82  GLN A H    1  
ATOM 1221  H HA   . GLN A 1 82  ? -3.536  -10.647 3.775   1.00 0.00 ? 82  GLN A HA   1  
ATOM 1222  H HB2  . GLN A 1 82  ? -5.316  -8.385  3.020   1.00 0.00 ? 82  GLN A HB2  1  
ATOM 1223  H HB3  . GLN A 1 82  ? -4.710  -9.409  1.726   1.00 0.00 ? 82  GLN A HB3  1  
ATOM 1224  H HG2  . GLN A 1 82  ? -5.902  -10.723 4.104   1.00 0.00 ? 82  GLN A HG2  1  
ATOM 1225  H HG3  . GLN A 1 82  ? -6.979  -9.919  2.963   1.00 0.00 ? 82  GLN A HG3  1  
ATOM 1226  H HE21 . GLN A 1 82  ? -6.284  -10.446 0.583   1.00 0.00 ? 82  GLN A HE21 1  
ATOM 1227  H HE22 . GLN A 1 82  ? -6.083  -12.131 0.260   1.00 0.00 ? 82  GLN A HE22 1  
ATOM 1228  N N    . ILE A 1 83  ? -1.475  -10.032 2.563   1.00 0.00 ? 83  ILE A N    1  
ATOM 1229  C CA   . ILE A 1 83  ? -0.278  -9.721  1.792   1.00 0.00 ? 83  ILE A CA   1  
ATOM 1230  C C    . ILE A 1 83  ? -0.604  -9.557  0.312   1.00 0.00 ? 83  ILE A C    1  
ATOM 1231  O O    . ILE A 1 83  ? -1.272  -10.403 -0.285  1.00 0.00 ? 83  ILE A O    1  
ATOM 1232  C CB   . ILE A 1 83  ? 0.795   -10.814 1.952   1.00 0.00 ? 83  ILE A CB   1  
ATOM 1233  C CG1  . ILE A 1 83  ? 1.101   -11.046 3.433   1.00 0.00 ? 83  ILE A CG1  1  
ATOM 1234  C CG2  . ILE A 1 83  ? 2.059   -10.430 1.198   1.00 0.00 ? 83  ILE A CG2  1  
ATOM 1235  C CD1  . ILE A 1 83  ? 2.123   -12.135 3.676   1.00 0.00 ? 83  ILE A CD1  1  
ATOM 1236  H H    . ILE A 1 83  ? -1.570  -10.923 2.960   1.00 0.00 ? 83  ILE A H    1  
ATOM 1237  H HA   . ILE A 1 83  ? 0.126   -8.791  2.166   1.00 0.00 ? 83  ILE A HA   1  
ATOM 1238  H HB   . ILE A 1 83  ? 0.412   -11.728 1.524   1.00 0.00 ? 83  ILE A HB   1  
ATOM 1239  H HG12 . ILE A 1 83  ? 1.481   -10.133 3.863   1.00 0.00 ? 83  ILE A HG12 1  
ATOM 1240  H HG13 . ILE A 1 83  ? 0.190   -11.327 3.942   1.00 0.00 ? 83  ILE A HG13 1  
ATOM 1241  H HG21 . ILE A 1 83  ? 2.652   -11.315 1.016   1.00 0.00 ? 83  ILE A HG21 1  
ATOM 1242  H HG22 . ILE A 1 83  ? 1.792   -9.977  0.256   1.00 0.00 ? 83  ILE A HG22 1  
ATOM 1243  H HG23 . ILE A 1 83  ? 2.631   -9.729  1.787   1.00 0.00 ? 83  ILE A HG23 1  
ATOM 1244  H HD11 . ILE A 1 83  ? 2.657   -11.930 4.592   1.00 0.00 ? 83  ILE A HD11 1  
ATOM 1245  H HD12 . ILE A 1 83  ? 1.623   -13.088 3.754   1.00 0.00 ? 83  ILE A HD12 1  
ATOM 1246  H HD13 . ILE A 1 83  ? 2.822   -12.162 2.852   1.00 0.00 ? 83  ILE A HD13 1  
ATOM 1247  N N    . LEU A 1 84  ? -0.128  -8.465  -0.276  1.00 0.00 ? 84  LEU A N    1  
ATOM 1248  C CA   . LEU A 1 84  ? -0.368  -8.191  -1.689  1.00 0.00 ? 84  LEU A CA   1  
ATOM 1249  C C    . LEU A 1 84  ? 0.864   -8.524  -2.524  1.00 0.00 ? 84  LEU A C    1  
ATOM 1250  O O    . LEU A 1 84  ? 0.761   -8.785  -3.723  1.00 0.00 ? 84  LEU A O    1  
ATOM 1251  C CB   . LEU A 1 84  ? -0.749  -6.722  -1.886  1.00 0.00 ? 84  LEU A CB   1  
ATOM 1252  C CG   . LEU A 1 84  ? -1.704  -6.132  -0.847  1.00 0.00 ? 84  LEU A CG   1  
ATOM 1253  C CD1  . LEU A 1 84  ? -1.716  -4.614  -0.936  1.00 0.00 ? 84  LEU A CD1  1  
ATOM 1254  C CD2  . LEU A 1 84  ? -3.107  -6.690  -1.035  1.00 0.00 ? 84  LEU A CD2  1  
ATOM 1255  H H    . LEU A 1 84  ? 0.396   -7.828  0.251   1.00 0.00 ? 84  LEU A H    1  
ATOM 1256  H HA   . LEU A 1 84  ? -1.188  -8.814  -2.013  1.00 0.00 ? 84  LEU A HA   1  
ATOM 1257  H HB2  . LEU A 1 84  ? 0.159   -6.140  -1.868  1.00 0.00 ? 84  LEU A HB2  1  
ATOM 1258  H HB3  . LEU A 1 84  ? -1.216  -6.630  -2.856  1.00 0.00 ? 84  LEU A HB3  1  
ATOM 1259  H HG   . LEU A 1 84  ? -1.364  -6.405  0.142   1.00 0.00 ? 84  LEU A HG   1  
ATOM 1260  H HD11 . LEU A 1 84  ? -2.736  -4.263  -0.967  1.00 0.00 ? 84  LEU A HD11 1  
ATOM 1261  H HD12 . LEU A 1 84  ? -1.200  -4.301  -1.832  1.00 0.00 ? 84  LEU A HD12 1  
ATOM 1262  H HD13 . LEU A 1 84  ? -1.218  -4.199  -0.071  1.00 0.00 ? 84  LEU A HD13 1  
ATOM 1263  H HD21 . LEU A 1 84  ? -3.249  -7.535  -0.378  1.00 0.00 ? 84  LEU A HD21 1  
ATOM 1264  H HD22 . LEU A 1 84  ? -3.234  -7.006  -2.060  1.00 0.00 ? 84  LEU A HD22 1  
ATOM 1265  H HD23 . LEU A 1 84  ? -3.833  -5.925  -0.801  1.00 0.00 ? 84  LEU A HD23 1  
ATOM 1266  N N    . TYR A 1 85  ? 2.027   -8.517  -1.883  1.00 0.00 ? 85  TYR A N    1  
ATOM 1267  C CA   . TYR A 1 85  ? 3.279   -8.819  -2.567  1.00 0.00 ? 85  TYR A CA   1  
ATOM 1268  C C    . TYR A 1 85  ? 3.114   -10.011 -3.505  1.00 0.00 ? 85  TYR A C    1  
ATOM 1269  O O    . TYR A 1 85  ? 2.969   -11.149 -3.061  1.00 0.00 ? 85  TYR A O    1  
ATOM 1270  C CB   . TYR A 1 85  ? 4.384   -9.105  -1.550  1.00 0.00 ? 85  TYR A CB   1  
ATOM 1271  C CG   . TYR A 1 85  ? 5.718   -9.436  -2.181  1.00 0.00 ? 85  TYR A CG   1  
ATOM 1272  C CD1  . TYR A 1 85  ? 5.990   -10.716 -2.648  1.00 0.00 ? 85  TYR A CD1  1  
ATOM 1273  C CD2  . TYR A 1 85  ? 6.706   -8.468  -2.311  1.00 0.00 ? 85  TYR A CD2  1  
ATOM 1274  C CE1  . TYR A 1 85  ? 7.207   -11.022 -3.225  1.00 0.00 ? 85  TYR A CE1  1  
ATOM 1275  C CE2  . TYR A 1 85  ? 7.926   -8.765  -2.888  1.00 0.00 ? 85  TYR A CE2  1  
ATOM 1276  C CZ   . TYR A 1 85  ? 8.171   -10.043 -3.343  1.00 0.00 ? 85  TYR A CZ   1  
ATOM 1277  O OH   . TYR A 1 85  ? 9.385   -10.344 -3.917  1.00 0.00 ? 85  TYR A OH   1  
ATOM 1278  H H    . TYR A 1 85  ? 2.045   -8.302  -0.927  1.00 0.00 ? 85  TYR A H    1  
ATOM 1279  H HA   . TYR A 1 85  ? 3.556   -7.952  -3.150  1.00 0.00 ? 85  TYR A HA   1  
ATOM 1280  H HB2  . TYR A 1 85  ? 4.521   -8.238  -0.923  1.00 0.00 ? 85  TYR A HB2  1  
ATOM 1281  H HB3  . TYR A 1 85  ? 4.091   -9.945  -0.937  1.00 0.00 ? 85  TYR A HB3  1  
ATOM 1282  H HD1  . TYR A 1 85  ? 5.232   -11.481 -2.554  1.00 0.00 ? 85  TYR A HD1  1  
ATOM 1283  H HD2  . TYR A 1 85  ? 6.511   -7.467  -1.952  1.00 0.00 ? 85  TYR A HD2  1  
ATOM 1284  H HE1  . TYR A 1 85  ? 7.400   -12.023 -3.582  1.00 0.00 ? 85  TYR A HE1  1  
ATOM 1285  H HE2  . TYR A 1 85  ? 8.681   -7.998  -2.980  1.00 0.00 ? 85  TYR A HE2  1  
ATOM 1286  H HH   . TYR A 1 85  ? 10.092  -9.975  -3.382  1.00 0.00 ? 85  TYR A HH   1  
ATOM 1287  N N    . GLY A 1 86  ? 3.137   -9.739  -4.807  1.00 0.00 ? 86  GLY A N    1  
ATOM 1288  C CA   . GLY A 1 86  ? 2.989   -10.798 -5.788  1.00 0.00 ? 86  GLY A CA   1  
ATOM 1289  C C    . GLY A 1 86  ? 1.707   -10.674 -6.587  1.00 0.00 ? 86  GLY A C    1  
ATOM 1290  O O    . GLY A 1 86  ? 1.691   -10.927 -7.791  1.00 0.00 ? 86  GLY A O    1  
ATOM 1291  H H    . GLY A 1 86  ? 3.255   -8.813  -5.103  1.00 0.00 ? 86  GLY A H    1  
ATOM 1292  H HA2  . GLY A 1 86  ? 3.828   -10.765 -6.466  1.00 0.00 ? 86  GLY A HA2  1  
ATOM 1293  H HA3  . GLY A 1 86  ? 2.990   -11.750 -5.276  1.00 0.00 ? 86  GLY A HA3  1  
ATOM 1294  N N    . ARG A 1 87  ? 0.628   -10.284 -5.915  1.00 0.00 ? 87  ARG A N    1  
ATOM 1295  C CA   . ARG A 1 87  ? -0.665  -10.130 -6.569  1.00 0.00 ? 87  ARG A CA   1  
ATOM 1296  C C    . ARG A 1 87  ? -0.696  -8.863  -7.420  1.00 0.00 ? 87  ARG A C    1  
ATOM 1297  O O    . ARG A 1 87  ? 0.171   -7.998  -7.295  1.00 0.00 ? 87  ARG A O    1  
ATOM 1298  C CB   . ARG A 1 87  ? -1.785  -10.086 -5.528  1.00 0.00 ? 87  ARG A CB   1  
ATOM 1299  C CG   . ARG A 1 87  ? -1.858  -11.330 -4.658  1.00 0.00 ? 87  ARG A CG   1  
ATOM 1300  C CD   . ARG A 1 87  ? -2.713  -11.096 -3.422  1.00 0.00 ? 87  ARG A CD   1  
ATOM 1301  N NE   . ARG A 1 87  ? -4.123  -11.386 -3.669  1.00 0.00 ? 87  ARG A NE   1  
ATOM 1302  C CZ   . ARG A 1 87  ? -4.595  -12.609 -3.881  1.00 0.00 ? 87  ARG A CZ   1  
ATOM 1303  N NH1  . ARG A 1 87  ? -3.775  -13.651 -3.875  1.00 0.00 ? 87  ARG A NH1  1  
ATOM 1304  N NH2  . ARG A 1 87  ? -5.891  -12.792 -4.098  1.00 0.00 ? 87  ARG A NH2  1  
ATOM 1305  H H    . ARG A 1 87  ? 0.704   -10.097 -4.956  1.00 0.00 ? 87  ARG A H    1  
ATOM 1306  H HA   . ARG A 1 87  ? -0.816  -10.985 -7.211  1.00 0.00 ? 87  ARG A HA   1  
ATOM 1307  H HB2  . ARG A 1 87  ? -1.630  -9.232  -4.885  1.00 0.00 ? 87  ARG A HB2  1  
ATOM 1308  H HB3  . ARG A 1 87  ? -2.730  -9.974  -6.039  1.00 0.00 ? 87  ARG A HB3  1  
ATOM 1309  H HG2  . ARG A 1 87  ? -2.289  -12.135 -5.233  1.00 0.00 ? 87  ARG A HG2  1  
ATOM 1310  H HG3  . ARG A 1 87  ? -0.859  -11.600 -4.349  1.00 0.00 ? 87  ARG A HG3  1  
ATOM 1311  H HD2  . ARG A 1 87  ? -2.357  -11.736 -2.629  1.00 0.00 ? 87  ARG A HD2  1  
ATOM 1312  H HD3  . ARG A 1 87  ? -2.614  -10.063 -3.123  1.00 0.00 ? 87  ARG A HD3  1  
ATOM 1313  H HE   . ARG A 1 87  ? -4.746  -10.631 -3.678  1.00 0.00 ? 87  ARG A HE   1  
ATOM 1314  H HH11 . ARG A 1 87  ? -2.798  -13.516 -3.711  1.00 0.00 ? 87  ARG A HH11 1  
ATOM 1315  H HH12 . ARG A 1 87  ? -4.133  -14.571 -4.034  1.00 0.00 ? 87  ARG A HH12 1  
ATOM 1316  H HH21 . ARG A 1 87  ? -6.513  -12.010 -4.103  1.00 0.00 ? 87  ARG A HH21 1  
ATOM 1317  H HH22 . ARG A 1 87  ? -6.246  -13.713 -4.258  1.00 0.00 ? 87  ARG A HH22 1  
ATOM 1318  N N    . SER A 1 88  ? -1.700  -8.762  -8.285  1.00 0.00 ? 88  SER A N    1  
ATOM 1319  C CA   . SER A 1 88  ? -1.842  -7.604  -9.159  1.00 0.00 ? 88  SER A CA   1  
ATOM 1320  C C    . SER A 1 88  ? -2.552  -6.463  -8.438  1.00 0.00 ? 88  SER A C    1  
ATOM 1321  O O    . SER A 1 88  ? -3.492  -6.685  -7.674  1.00 0.00 ? 88  SER A O    1  
ATOM 1322  C CB   . SER A 1 88  ? -2.616  -7.984  -10.423 1.00 0.00 ? 88  SER A CB   1  
ATOM 1323  O OG   . SER A 1 88  ? -1.787  -8.677  -11.340 1.00 0.00 ? 88  SER A OG   1  
ATOM 1324  H H    . SER A 1 88  ? -2.360  -9.485  -8.338  1.00 0.00 ? 88  SER A H    1  
ATOM 1325  H HA   . SER A 1 88  ? -0.852  -7.277  -9.439  1.00 0.00 ? 88  SER A HA   1  
ATOM 1326  H HB2  . SER A 1 88  ? -3.447  -8.620  -10.156 1.00 0.00 ? 88  SER A HB2  1  
ATOM 1327  H HB3  . SER A 1 88  ? -2.987  -7.088  -10.898 1.00 0.00 ? 88  SER A HB3  1  
ATOM 1328  H HG   . SER A 1 88  ? -1.944  -9.621  -11.264 1.00 0.00 ? 88  SER A HG   1  
ATOM 1329  N N    . HIS A 1 89  ? -2.096  -5.239  -8.687  1.00 0.00 ? 89  HIS A N    1  
ATOM 1330  C CA   . HIS A 1 89  ? -2.687  -4.061  -8.062  1.00 0.00 ? 89  HIS A CA   1  
ATOM 1331  C C    . HIS A 1 89  ? -4.207  -4.185  -7.999  1.00 0.00 ? 89  HIS A C    1  
ATOM 1332  O O    . HIS A 1 89  ? -4.824  -3.843  -6.990  1.00 0.00 ? 89  HIS A O    1  
ATOM 1333  C CB   . HIS A 1 89  ? -2.299  -2.799  -8.833  1.00 0.00 ? 89  HIS A CB   1  
ATOM 1334  C CG   . HIS A 1 89  ? -2.614  -2.870  -10.296 1.00 0.00 ? 89  HIS A CG   1  
ATOM 1335  N ND1  . HIS A 1 89  ? -3.828  -2.484  -10.823 1.00 0.00 ? 89  HIS A ND1  1  
ATOM 1336  C CD2  . HIS A 1 89  ? -1.865  -3.284  -11.344 1.00 0.00 ? 89  HIS A CD2  1  
ATOM 1337  C CE1  . HIS A 1 89  ? -3.813  -2.659  -12.133 1.00 0.00 ? 89  HIS A CE1  1  
ATOM 1338  N NE2  . HIS A 1 89  ? -2.632  -3.143  -12.474 1.00 0.00 ? 89  HIS A NE2  1  
ATOM 1339  H H    . HIS A 1 89  ? -1.344  -5.126  -9.305  1.00 0.00 ? 89  HIS A H    1  
ATOM 1340  H HA   . HIS A 1 89  ? -2.302  -3.990  -7.056  1.00 0.00 ? 89  HIS A HA   1  
ATOM 1341  H HB2  . HIS A 1 89  ? -2.830  -1.955  -8.420  1.00 0.00 ? 89  HIS A HB2  1  
ATOM 1342  H HB3  . HIS A 1 89  ? -1.236  -2.635  -8.730  1.00 0.00 ? 89  HIS A HB3  1  
ATOM 1343  H HD1  . HIS A 1 89  ? -4.589  -2.136  -10.313 1.00 0.00 ? 89  HIS A HD1  1  
ATOM 1344  H HD2  . HIS A 1 89  ? -0.851  -3.657  -11.301 1.00 0.00 ? 89  HIS A HD2  1  
ATOM 1345  H HE1  . HIS A 1 89  ? -4.626  -2.443  -12.809 1.00 0.00 ? 89  HIS A HE1  1  
ATOM 1346  H HE2  . HIS A 1 89  ? -2.385  -3.444  -13.373 1.00 0.00 ? 89  HIS A HE2  1  
ATOM 1347  N N    . GLN A 1 90  ? -4.801  -4.675  -9.081  1.00 0.00 ? 90  GLN A N    1  
ATOM 1348  C CA   . GLN A 1 90  ? -6.249  -4.842  -9.148  1.00 0.00 ? 90  GLN A CA   1  
ATOM 1349  C C    . GLN A 1 90  ? -6.771  -5.563  -7.910  1.00 0.00 ? 90  GLN A C    1  
ATOM 1350  O O    . GLN A 1 90  ? -7.778  -5.165  -7.326  1.00 0.00 ? 90  GLN A O    1  
ATOM 1351  C CB   . GLN A 1 90  ? -6.636  -5.619  -10.407 1.00 0.00 ? 90  GLN A CB   1  
ATOM 1352  C CG   . GLN A 1 90  ? -6.174  -4.958  -11.696 1.00 0.00 ? 90  GLN A CG   1  
ATOM 1353  C CD   . GLN A 1 90  ? -5.928  -5.958  -12.809 1.00 0.00 ? 90  GLN A CD   1  
ATOM 1354  O OE1  . GLN A 1 90  ? -5.743  -7.150  -12.558 1.00 0.00 ? 90  GLN A OE1  1  
ATOM 1355  N NE2  . GLN A 1 90  ? -5.924  -5.478  -14.046 1.00 0.00 ? 90  GLN A NE2  1  
ATOM 1356  H H    . GLN A 1 90  ? -4.255  -4.930  -9.853  1.00 0.00 ? 90  GLN A H    1  
ATOM 1357  H HA   . GLN A 1 90  ? -6.694  -3.859  -9.191  1.00 0.00 ? 90  GLN A HA   1  
ATOM 1358  H HB2  . GLN A 1 90  ? -6.199  -6.605  -10.356 1.00 0.00 ? 90  GLN A HB2  1  
ATOM 1359  H HB3  . GLN A 1 90  ? -7.712  -5.712  -10.442 1.00 0.00 ? 90  GLN A HB3  1  
ATOM 1360  H HG2  . GLN A 1 90  ? -6.933  -4.262  -12.021 1.00 0.00 ? 90  GLN A HG2  1  
ATOM 1361  H HG3  . GLN A 1 90  ? -5.256  -4.424  -11.502 1.00 0.00 ? 90  GLN A HG3  1  
ATOM 1362  H HE21 . GLN A 1 90  ? -6.078  -4.517  -14.170 1.00 0.00 ? 90  GLN A HE21 1  
ATOM 1363  H HE22 . GLN A 1 90  ? -5.767  -6.102  -14.785 1.00 0.00 ? 90  GLN A HE22 1  
ATOM 1364  N N    . ASN A 1 91  ? -6.079  -6.627  -7.515  1.00 0.00 ? 91  ASN A N    1  
ATOM 1365  C CA   . ASN A 1 91  ? -6.474  -7.405  -6.346  1.00 0.00 ? 91  ASN A CA   1  
ATOM 1366  C C    . ASN A 1 91  ? -6.525  -6.527  -5.100  1.00 0.00 ? 91  ASN A C    1  
ATOM 1367  O O    . ASN A 1 91  ? -7.537  -6.483  -4.400  1.00 0.00 ? 91  ASN A O    1  
ATOM 1368  C CB   . ASN A 1 91  ? -5.500  -8.565  -6.127  1.00 0.00 ? 91  ASN A CB   1  
ATOM 1369  C CG   . ASN A 1 91  ? -5.368  -9.449  -7.352  1.00 0.00 ? 91  ASN A CG   1  
ATOM 1370  O OD1  . ASN A 1 91  ? -4.784  -9.049  -8.360  1.00 0.00 ? 91  ASN A OD1  1  
ATOM 1371  N ND2  . ASN A 1 91  ? -5.912  -10.657 -7.271  1.00 0.00 ? 91  ASN A ND2  1  
ATOM 1372  H H    . ASN A 1 91  ? -5.284  -6.896  -8.022  1.00 0.00 ? 91  ASN A H    1  
ATOM 1373  H HA   . ASN A 1 91  ? -7.459  -7.805  -6.532  1.00 0.00 ? 91  ASN A HA   1  
ATOM 1374  H HB2  . ASN A 1 91  ? -4.525  -8.167  -5.887  1.00 0.00 ? 91  ASN A HB2  1  
ATOM 1375  H HB3  . ASN A 1 91  ? -5.850  -9.170  -5.304  1.00 0.00 ? 91  ASN A HB3  1  
ATOM 1376  H HD21 . ASN A 1 91  ? -6.362  -10.908 -6.437  1.00 0.00 ? 91  ASN A HD21 1  
ATOM 1377  H HD22 . ASN A 1 91  ? -5.841  -11.250 -8.048  1.00 0.00 ? 91  ASN A HD22 1  
ATOM 1378  N N    . ALA A 1 92  ? -5.428  -5.828  -4.830  1.00 0.00 ? 92  ALA A N    1  
ATOM 1379  C CA   . ALA A 1 92  ? -5.348  -4.948  -3.670  1.00 0.00 ? 92  ALA A CA   1  
ATOM 1380  C C    . ALA A 1 92  ? -6.662  -4.205  -3.454  1.00 0.00 ? 92  ALA A C    1  
ATOM 1381  O O    . ALA A 1 92  ? -7.299  -4.341  -2.409  1.00 0.00 ? 92  ALA A O    1  
ATOM 1382  C CB   . ALA A 1 92  ? -4.202  -3.961  -3.834  1.00 0.00 ? 92  ALA A CB   1  
ATOM 1383  H H    . ALA A 1 92  ? -4.654  -5.904  -5.425  1.00 0.00 ? 92  ALA A H    1  
ATOM 1384  H HA   . ALA A 1 92  ? -5.145  -5.559  -2.802  1.00 0.00 ? 92  ALA A HA   1  
ATOM 1385  H HB1  . ALA A 1 92  ? -4.183  -3.599  -4.851  1.00 0.00 ? 92  ALA A HB1  1  
ATOM 1386  H HB2  . ALA A 1 92  ? -4.343  -3.131  -3.158  1.00 0.00 ? 92  ALA A HB2  1  
ATOM 1387  H HB3  . ALA A 1 92  ? -3.268  -4.455  -3.610  1.00 0.00 ? 92  ALA A HB3  1  
ATOM 1388  N N    . SER A 1 93  ? -7.062  -3.418  -4.448  1.00 0.00 ? 93  SER A N    1  
ATOM 1389  C CA   . SER A 1 93  ? -8.299  -2.650  -4.364  1.00 0.00 ? 93  SER A CA   1  
ATOM 1390  C C    . SER A 1 93  ? -9.455  -3.530  -3.899  1.00 0.00 ? 93  SER A C    1  
ATOM 1391  O O    . SER A 1 93  ? -10.233 -3.142  -3.028  1.00 0.00 ? 93  SER A O    1  
ATOM 1392  C CB   . SER A 1 93  ? -8.630  -2.028  -5.722  1.00 0.00 ? 93  SER A CB   1  
ATOM 1393  O OG   . SER A 1 93  ? -9.023  -3.019  -6.655  1.00 0.00 ? 93  SER A OG   1  
ATOM 1394  H H    . SER A 1 93  ? -6.511  -3.352  -5.256  1.00 0.00 ? 93  SER A H    1  
ATOM 1395  H HA   . SER A 1 93  ? -8.150  -1.860  -3.643  1.00 0.00 ? 93  SER A HA   1  
ATOM 1396  H HB2  . SER A 1 93  ? -9.438  -1.321  -5.604  1.00 0.00 ? 93  SER A HB2  1  
ATOM 1397  H HB3  . SER A 1 93  ? -7.758  -1.517  -6.103  1.00 0.00 ? 93  SER A HB3  1  
ATOM 1398  H HG   . SER A 1 93  ? -9.095  -2.627  -7.528  1.00 0.00 ? 93  SER A HG   1  
ATOM 1399  N N    . ALA A 1 94  ? -9.561  -4.716  -4.488  1.00 0.00 ? 94  ALA A N    1  
ATOM 1400  C CA   . ALA A 1 94  ? -10.620 -5.653  -4.133  1.00 0.00 ? 94  ALA A CA   1  
ATOM 1401  C C    . ALA A 1 94  ? -10.621 -5.940  -2.636  1.00 0.00 ? 94  ALA A C    1  
ATOM 1402  O O    . ALA A 1 94  ? -11.667 -5.902  -1.987  1.00 0.00 ? 94  ALA A O    1  
ATOM 1403  C CB   . ALA A 1 94  ? -10.466 -6.946  -4.920  1.00 0.00 ? 94  ALA A CB   1  
ATOM 1404  H H    . ALA A 1 94  ? -8.910  -4.969  -5.175  1.00 0.00 ? 94  ALA A H    1  
ATOM 1405  H HA   . ALA A 1 94  ? -11.566 -5.205  -4.404  1.00 0.00 ? 94  ALA A HA   1  
ATOM 1406  H HB1  . ALA A 1 94  ? -9.849  -6.766  -5.789  1.00 0.00 ? 94  ALA A HB1  1  
ATOM 1407  H HB2  . ALA A 1 94  ? -10.001 -7.694  -4.296  1.00 0.00 ? 94  ALA A HB2  1  
ATOM 1408  H HB3  . ALA A 1 94  ? -11.439 -7.293  -5.235  1.00 0.00 ? 94  ALA A HB3  1  
ATOM 1409  N N    . ILE A 1 95  ? -9.443  -6.228  -2.092  1.00 0.00 ? 95  ILE A N    1  
ATOM 1410  C CA   . ILE A 1 95  ? -9.309  -6.520  -0.671  1.00 0.00 ? 95  ILE A CA   1  
ATOM 1411  C C    . ILE A 1 95  ? -9.852  -5.377  0.180   1.00 0.00 ? 95  ILE A C    1  
ATOM 1412  O O    . ILE A 1 95  ? -10.565 -5.603  1.158   1.00 0.00 ? 95  ILE A O    1  
ATOM 1413  C CB   . ILE A 1 95  ? -7.840  -6.779  -0.286  1.00 0.00 ? 95  ILE A CB   1  
ATOM 1414  C CG1  . ILE A 1 95  ? -7.257  -7.907  -1.140  1.00 0.00 ? 95  ILE A CG1  1  
ATOM 1415  C CG2  . ILE A 1 95  ? -7.732  -7.117  1.194   1.00 0.00 ? 95  ILE A CG2  1  
ATOM 1416  C CD1  . ILE A 1 95  ? -5.745  -7.915  -1.178  1.00 0.00 ? 95  ILE A CD1  1  
ATOM 1417  H H    . ILE A 1 95  ? -8.645  -6.242  -2.661  1.00 0.00 ? 95  ILE A H    1  
ATOM 1418  H HA   . ILE A 1 95  ? -9.878  -7.414  -0.460  1.00 0.00 ? 95  ILE A HA   1  
ATOM 1419  H HB   . ILE A 1 95  ? -7.280  -5.874  -0.465  1.00 0.00 ? 95  ILE A HB   1  
ATOM 1420  H HG12 . ILE A 1 95  ? -7.583  -8.855  -0.744  1.00 0.00 ? 95  ILE A HG12 1  
ATOM 1421  H HG13 . ILE A 1 95  ? -7.615  -7.802  -2.154  1.00 0.00 ? 95  ILE A HG13 1  
ATOM 1422  H HG21 . ILE A 1 95  ? -6.811  -6.715  1.589   1.00 0.00 ? 95  ILE A HG21 1  
ATOM 1423  H HG22 . ILE A 1 95  ? -8.569  -6.686  1.723   1.00 0.00 ? 95  ILE A HG22 1  
ATOM 1424  H HG23 . ILE A 1 95  ? -7.741  -8.190  1.320   1.00 0.00 ? 95  ILE A HG23 1  
ATOM 1425  H HD11 . ILE A 1 95  ? -5.360  -7.331  -0.355  1.00 0.00 ? 95  ILE A HD11 1  
ATOM 1426  H HD12 . ILE A 1 95  ? -5.387  -8.930  -1.098  1.00 0.00 ? 95  ILE A HD12 1  
ATOM 1427  H HD13 . ILE A 1 95  ? -5.406  -7.487  -2.111  1.00 0.00 ? 95  ILE A HD13 1  
ATOM 1428  N N    . ILE A 1 96  ? -9.512  -4.151  -0.201  1.00 0.00 ? 96  ILE A N    1  
ATOM 1429  C CA   . ILE A 1 96  ? -9.968  -2.972  0.525   1.00 0.00 ? 96  ILE A CA   1  
ATOM 1430  C C    . ILE A 1 96  ? -11.488 -2.857  0.487   1.00 0.00 ? 96  ILE A C    1  
ATOM 1431  O O    . ILE A 1 96  ? -12.126 -2.571  1.501   1.00 0.00 ? 96  ILE A O    1  
ATOM 1432  C CB   . ILE A 1 96  ? -9.353  -1.683  -0.050  1.00 0.00 ? 96  ILE A CB   1  
ATOM 1433  C CG1  . ILE A 1 96  ? -7.837  -1.680  0.156   1.00 0.00 ? 96  ILE A CG1  1  
ATOM 1434  C CG2  . ILE A 1 96  ? -9.983  -0.460  0.598   1.00 0.00 ? 96  ILE A CG2  1  
ATOM 1435  C CD1  . ILE A 1 96  ? -7.110  -0.683  -0.720  1.00 0.00 ? 96  ILE A CD1  1  
ATOM 1436  H H    . ILE A 1 96  ? -8.941  -4.035  -0.989  1.00 0.00 ? 96  ILE A H    1  
ATOM 1437  H HA   . ILE A 1 96  ? -9.651  -3.071  1.554   1.00 0.00 ? 96  ILE A HA   1  
ATOM 1438  H HB   . ILE A 1 96  ? -9.565  -1.650  -1.108  1.00 0.00 ? 96  ILE A HB   1  
ATOM 1439  H HG12 . ILE A 1 96  ? -7.620  -1.436  1.184   1.00 0.00 ? 96  ILE A HG12 1  
ATOM 1440  H HG13 . ILE A 1 96  ? -7.449  -2.663  -0.066  1.00 0.00 ? 96  ILE A HG13 1  
ATOM 1441  H HG21 . ILE A 1 96  ? -10.252 -0.691  1.618   1.00 0.00 ? 96  ILE A HG21 1  
ATOM 1442  H HG22 . ILE A 1 96  ? -9.277  0.356   0.590   1.00 0.00 ? 96  ILE A HG22 1  
ATOM 1443  H HG23 . ILE A 1 96  ? -10.868 -0.176  0.048   1.00 0.00 ? 96  ILE A HG23 1  
ATOM 1444  H HD11 . ILE A 1 96  ? -7.337  -0.883  -1.757  1.00 0.00 ? 96  ILE A HD11 1  
ATOM 1445  H HD12 . ILE A 1 96  ? -7.426  0.317   -0.467  1.00 0.00 ? 96  ILE A HD12 1  
ATOM 1446  H HD13 . ILE A 1 96  ? -6.045  -0.775  -0.562  1.00 0.00 ? 96  ILE A HD13 1  
ATOM 1447  N N    . LYS A 1 97  ? -12.064 -3.085  -0.688  1.00 0.00 ? 97  LYS A N    1  
ATOM 1448  C CA   . LYS A 1 97  ? -13.510 -3.010  -0.860  1.00 0.00 ? 97  LYS A CA   1  
ATOM 1449  C C    . LYS A 1 97  ? -14.225 -3.890  0.161   1.00 0.00 ? 97  LYS A C    1  
ATOM 1450  O O    . LYS A 1 97  ? -15.209 -3.474  0.773   1.00 0.00 ? 97  LYS A O    1  
ATOM 1451  C CB   . LYS A 1 97  ? -13.898 -3.437  -2.278  1.00 0.00 ? 97  LYS A CB   1  
ATOM 1452  C CG   . LYS A 1 97  ? -15.154 -2.756  -2.795  1.00 0.00 ? 97  LYS A CG   1  
ATOM 1453  C CD   . LYS A 1 97  ? -15.299 -2.923  -4.298  1.00 0.00 ? 97  LYS A CD   1  
ATOM 1454  C CE   . LYS A 1 97  ? -14.288 -2.075  -5.054  1.00 0.00 ? 97  LYS A CE   1  
ATOM 1455  N NZ   . LYS A 1 97  ? -14.636 -1.951  -6.497  1.00 0.00 ? 97  LYS A NZ   1  
ATOM 1456  H H    . LYS A 1 97  ? -11.502 -3.309  -1.460  1.00 0.00 ? 97  LYS A H    1  
ATOM 1457  H HA   . LYS A 1 97  ? -13.810 -1.985  -0.707  1.00 0.00 ? 97  LYS A HA   1  
ATOM 1458  H HB2  . LYS A 1 97  ? -13.084 -3.202  -2.947  1.00 0.00 ? 97  LYS A HB2  1  
ATOM 1459  H HB3  . LYS A 1 97  ? -14.064 -4.504  -2.287  1.00 0.00 ? 97  LYS A HB3  1  
ATOM 1460  H HG2  . LYS A 1 97  ? -16.015 -3.191  -2.310  1.00 0.00 ? 97  LYS A HG2  1  
ATOM 1461  H HG3  . LYS A 1 97  ? -15.102 -1.701  -2.563  1.00 0.00 ? 97  LYS A HG3  1  
ATOM 1462  H HD2  . LYS A 1 97  ? -15.144 -3.961  -4.553  1.00 0.00 ? 97  LYS A HD2  1  
ATOM 1463  H HD3  . LYS A 1 97  ? -16.296 -2.624  -4.590  1.00 0.00 ? 97  LYS A HD3  1  
ATOM 1464  H HE2  . LYS A 1 97  ? -14.263 -1.090  -4.613  1.00 0.00 ? 97  LYS A HE2  1  
ATOM 1465  H HE3  . LYS A 1 97  ? -13.315 -2.534  -4.965  1.00 0.00 ? 97  LYS A HE3  1  
ATOM 1466  H HZ1  . LYS A 1 97  ? -14.596 -0.954  -6.789  1.00 0.00 ? 97  LYS A HZ1  1  
ATOM 1467  H HZ2  . LYS A 1 97  ? -15.596 -2.312  -6.665  1.00 0.00 ? 97  LYS A HZ2  1  
ATOM 1468  H HZ3  . LYS A 1 97  ? -13.966 -2.498  -7.074  1.00 0.00 ? 97  LYS A HZ3  1  
ATOM 1469  N N    . THR A 1 98  ? -13.723 -5.108  0.340   1.00 0.00 ? 98  THR A N    1  
ATOM 1470  C CA   . THR A 1 98  ? -14.313 -6.046  1.287   1.00 0.00 ? 98  THR A CA   1  
ATOM 1471  C C    . THR A 1 98  ? -13.953 -5.678  2.722   1.00 0.00 ? 98  THR A C    1  
ATOM 1472  O O    . THR A 1 98  ? -14.671 -6.024  3.660   1.00 0.00 ? 98  THR A O    1  
ATOM 1473  C CB   . THR A 1 98  ? -13.855 -7.489  1.008   1.00 0.00 ? 98  THR A CB   1  
ATOM 1474  O OG1  . THR A 1 98  ? -12.438 -7.597  1.190   1.00 0.00 ? 98  THR A OG1  1  
ATOM 1475  C CG2  . THR A 1 98  ? -14.222 -7.910  -0.407  1.00 0.00 ? 98  THR A CG2  1  
ATOM 1476  H H    . THR A 1 98  ? -12.937 -5.381  -0.178  1.00 0.00 ? 98  THR A H    1  
ATOM 1477  H HA   . THR A 1 98  ? -15.387 -6.003  1.173   1.00 0.00 ? 98  THR A HA   1  
ATOM 1478  H HB   . THR A 1 98  ? -14.351 -8.150  1.705   1.00 0.00 ? 98  THR A HB   1  
ATOM 1479  H HG1  . THR A 1 98  ? -12.223 -7.454  2.115   1.00 0.00 ? 98  THR A HG1  1  
ATOM 1480  H HG21 . THR A 1 98  ? -14.348 -7.032  -1.023  1.00 0.00 ? 98  THR A HG21 1  
ATOM 1481  H HG22 . THR A 1 98  ? -15.145 -8.472  -0.387  1.00 0.00 ? 98  THR A HG22 1  
ATOM 1482  H HG23 . THR A 1 98  ? -13.435 -8.525  -0.815  1.00 0.00 ? 98  THR A HG23 1  
ATOM 1483  N N    . ALA A 1 99  ? -12.837 -4.975  2.886   1.00 0.00 ? 99  ALA A N    1  
ATOM 1484  C CA   . ALA A 1 99  ? -12.384 -4.559  4.207   1.00 0.00 ? 99  ALA A CA   1  
ATOM 1485  C C    . ALA A 1 99  ? -13.332 -3.531  4.814   1.00 0.00 ? 99  ALA A C    1  
ATOM 1486  O O    . ALA A 1 99  ? -13.980 -2.756  4.110   1.00 0.00 ? 99  ALA A O    1  
ATOM 1487  C CB   . ALA A 1 99  ? -10.973 -3.995  4.127   1.00 0.00 ? 99  ALA A CB   1  
ATOM 1488  H H    . ALA A 1 99  ? -12.308 -4.730  2.099   1.00 0.00 ? 99  ALA A H    1  
ATOM 1489  H HA   . ALA A 1 99  ? -12.361 -5.432  4.842   1.00 0.00 ? 99  ALA A HA   1  
ATOM 1490  H HB1  . ALA A 1 99  ? -10.273 -4.801  3.958   1.00 0.00 ? 99  ALA A HB1  1  
ATOM 1491  H HB2  . ALA A 1 99  ? -10.913 -3.289  3.312   1.00 0.00 ? 99  ALA A HB2  1  
ATOM 1492  H HB3  . ALA A 1 99  ? -10.731 -3.497  5.054   1.00 0.00 ? 99  ALA A HB3  1  
ATOM 1493  N N    . PRO A 1 100 ? -13.419 -3.522  6.152   1.00 0.00 ? 100 PRO A N    1  
ATOM 1494  C CA   . PRO A 1 100 ? -14.286 -2.594  6.884   1.00 0.00 ? 100 PRO A CA   1  
ATOM 1495  C C    . PRO A 1 100 ? -13.789 -1.155  6.809   1.00 0.00 ? 100 PRO A C    1  
ATOM 1496  O O    . PRO A 1 100 ? -12.681 -0.894  6.339   1.00 0.00 ? 100 PRO A O    1  
ATOM 1497  C CB   . PRO A 1 100 ? -14.221 -3.108  8.324   1.00 0.00 ? 100 PRO A CB   1  
ATOM 1498  C CG   . PRO A 1 100 ? -12.916 -3.820  8.414   1.00 0.00 ? 100 PRO A CG   1  
ATOM 1499  C CD   . PRO A 1 100 ? -12.676 -4.418  7.055   1.00 0.00 ? 100 PRO A CD   1  
ATOM 1500  H HA   . PRO A 1 100 ? -15.305 -2.640  6.529   1.00 0.00 ? 100 PRO A HA   1  
ATOM 1501  H HB2  . PRO A 1 100 ? -14.265 -2.273  9.009   1.00 0.00 ? 100 PRO A HB2  1  
ATOM 1502  H HB3  . PRO A 1 100 ? -15.049 -3.776  8.509   1.00 0.00 ? 100 PRO A HB3  1  
ATOM 1503  H HG2  . PRO A 1 100 ? -12.132 -3.120  8.659   1.00 0.00 ? 100 PRO A HG2  1  
ATOM 1504  H HG3  . PRO A 1 100 ? -12.973 -4.598  9.160   1.00 0.00 ? 100 PRO A HG3  1  
ATOM 1505  H HD2  . PRO A 1 100 ? -11.622 -4.413  6.821   1.00 0.00 ? 100 PRO A HD2  1  
ATOM 1506  H HD3  . PRO A 1 100 ? -13.070 -5.422  7.010   1.00 0.00 ? 100 PRO A HD3  1  
ATOM 1507  N N    . SER A 1 101 ? -14.614 -0.223  7.276   1.00 0.00 ? 101 SER A N    1  
ATOM 1508  C CA   . SER A 1 101 ? -14.258 1.191   7.259   1.00 0.00 ? 101 SER A CA   1  
ATOM 1509  C C    . SER A 1 101 ? -12.773 1.382   7.553   1.00 0.00 ? 101 SER A C    1  
ATOM 1510  O O    . SER A 1 101 ? -12.033 1.935   6.739   1.00 0.00 ? 101 SER A O    1  
ATOM 1511  C CB   . SER A 1 101 ? -15.095 1.961   8.282   1.00 0.00 ? 101 SER A CB   1  
ATOM 1512  O OG   . SER A 1 101 ? -15.301 3.301   7.868   1.00 0.00 ? 101 SER A OG   1  
ATOM 1513  H H    . SER A 1 101 ? -15.483 -0.493  7.639   1.00 0.00 ? 101 SER A H    1  
ATOM 1514  H HA   . SER A 1 101 ? -14.470 1.574   6.272   1.00 0.00 ? 101 SER A HA   1  
ATOM 1515  H HB2  . SER A 1 101 ? -16.055 1.480   8.394   1.00 0.00 ? 101 SER A HB2  1  
ATOM 1516  H HB3  . SER A 1 101 ? -14.582 1.966   9.233   1.00 0.00 ? 101 SER A HB3  1  
ATOM 1517  H HG   . SER A 1 101 ? -16.035 3.679   8.358   1.00 0.00 ? 101 SER A HG   1  
ATOM 1518  N N    . LYS A 1 102 ? -12.344 0.920   8.722   1.00 0.00 ? 102 LYS A N    1  
ATOM 1519  C CA   . LYS A 1 102 ? -10.948 1.037   9.126   1.00 0.00 ? 102 LYS A CA   1  
ATOM 1520  C C    . LYS A 1 102 ? -10.100 -0.051  8.474   1.00 0.00 ? 102 LYS A C    1  
ATOM 1521  O O    . LYS A 1 102 ? -10.406 -1.239  8.582   1.00 0.00 ? 102 LYS A O    1  
ATOM 1522  C CB   . LYS A 1 102 ? -10.827 0.948   10.649  1.00 0.00 ? 102 LYS A CB   1  
ATOM 1523  C CG   . LYS A 1 102 ? -9.587  1.630   11.201  1.00 0.00 ? 102 LYS A CG   1  
ATOM 1524  C CD   . LYS A 1 102 ? -9.805  2.115   12.625  1.00 0.00 ? 102 LYS A CD   1  
ATOM 1525  C CE   . LYS A 1 102 ? -10.368 3.528   12.653  1.00 0.00 ? 102 LYS A CE   1  
ATOM 1526  N NZ   . LYS A 1 102 ? -10.536 4.031   14.044  1.00 0.00 ? 102 LYS A NZ   1  
ATOM 1527  H H    . LYS A 1 102 ? -12.983 0.488   9.329   1.00 0.00 ? 102 LYS A H    1  
ATOM 1528  H HA   . LYS A 1 102 ? -10.588 2.001   8.800   1.00 0.00 ? 102 LYS A HA   1  
ATOM 1529  H HB2  . LYS A 1 102 ? -11.696 1.410   11.095  1.00 0.00 ? 102 LYS A HB2  1  
ATOM 1530  H HB3  . LYS A 1 102 ? -10.797 -0.093  10.936  1.00 0.00 ? 102 LYS A HB3  1  
ATOM 1531  H HG2  . LYS A 1 102 ? -8.767  0.928   11.193  1.00 0.00 ? 102 LYS A HG2  1  
ATOM 1532  H HG3  . LYS A 1 102 ? -9.345  2.477   10.575  1.00 0.00 ? 102 LYS A HG3  1  
ATOM 1533  H HD2  . LYS A 1 102 ? -10.501 1.453   13.119  1.00 0.00 ? 102 LYS A HD2  1  
ATOM 1534  H HD3  . LYS A 1 102 ? -8.860  2.103   13.149  1.00 0.00 ? 102 LYS A HD3  1  
ATOM 1535  H HE2  . LYS A 1 102 ? -9.691  4.181   12.123  1.00 0.00 ? 102 LYS A HE2  1  
ATOM 1536  H HE3  . LYS A 1 102 ? -11.329 3.528   12.160  1.00 0.00 ? 102 LYS A HE3  1  
ATOM 1537  H HZ1  . LYS A 1 102 ? -9.665  4.504   14.360  1.00 0.00 ? 102 LYS A HZ1  1  
ATOM 1538  H HZ2  . LYS A 1 102 ? -10.739 3.240   14.688  1.00 0.00 ? 102 LYS A HZ2  1  
ATOM 1539  H HZ3  . LYS A 1 102 ? -11.322 4.709   14.087  1.00 0.00 ? 102 LYS A HZ3  1  
ATOM 1540  N N    . VAL A 1 103 ? -9.033  0.363   7.799   1.00 0.00 ? 103 VAL A N    1  
ATOM 1541  C CA   . VAL A 1 103 ? -8.139  -0.577  7.132   1.00 0.00 ? 103 VAL A CA   1  
ATOM 1542  C C    . VAL A 1 103 ? -6.679  -0.220  7.384   1.00 0.00 ? 103 VAL A C    1  
ATOM 1543  O O    . VAL A 1 103 ? -6.265  0.924   7.193   1.00 0.00 ? 103 VAL A O    1  
ATOM 1544  C CB   . VAL A 1 103 ? -8.392  -0.610  5.613   1.00 0.00 ? 103 VAL A CB   1  
ATOM 1545  C CG1  . VAL A 1 103 ? -7.504  -1.649  4.946   1.00 0.00 ? 103 VAL A CG1  1  
ATOM 1546  C CG2  . VAL A 1 103 ? -9.860  -0.887  5.324   1.00 0.00 ? 103 VAL A CG2  1  
ATOM 1547  H H    . VAL A 1 103 ? -8.841  1.322   7.748   1.00 0.00 ? 103 VAL A H    1  
ATOM 1548  H HA   . VAL A 1 103 ? -8.333  -1.562  7.529   1.00 0.00 ? 103 VAL A HA   1  
ATOM 1549  H HB   . VAL A 1 103 ? -8.144  0.359   5.205   1.00 0.00 ? 103 VAL A HB   1  
ATOM 1550  H HG11 . VAL A 1 103 ? -6.628  -1.818  5.555   1.00 0.00 ? 103 VAL A HG11 1  
ATOM 1551  H HG12 . VAL A 1 103 ? -8.051  -2.574  4.835   1.00 0.00 ? 103 VAL A HG12 1  
ATOM 1552  H HG13 . VAL A 1 103 ? -7.200  -1.292  3.973   1.00 0.00 ? 103 VAL A HG13 1  
ATOM 1553  H HG21 . VAL A 1 103 ? -10.314 -1.354  6.185   1.00 0.00 ? 103 VAL A HG21 1  
ATOM 1554  H HG22 . VAL A 1 103 ? -10.367 0.043   5.109   1.00 0.00 ? 103 VAL A HG22 1  
ATOM 1555  H HG23 . VAL A 1 103 ? -9.942  -1.546  4.472   1.00 0.00 ? 103 VAL A HG23 1  
ATOM 1556  N N    . LYS A 1 104 ? -5.900  -1.207  7.815   1.00 0.00 ? 104 LYS A N    1  
ATOM 1557  C CA   . LYS A 1 104 ? -4.484  -0.999  8.094   1.00 0.00 ? 104 LYS A CA   1  
ATOM 1558  C C    . LYS A 1 104 ? -3.648  -1.193  6.833   1.00 0.00 ? 104 LYS A C    1  
ATOM 1559  O O    . LYS A 1 104 ? -3.560  -2.298  6.297   1.00 0.00 ? 104 LYS A O    1  
ATOM 1560  C CB   . LYS A 1 104 ? -4.011  -1.962  9.185   1.00 0.00 ? 104 LYS A CB   1  
ATOM 1561  C CG   . LYS A 1 104 ? -2.719  -1.532  9.857   1.00 0.00 ? 104 LYS A CG   1  
ATOM 1562  C CD   . LYS A 1 104 ? -2.116  -2.660  10.678  1.00 0.00 ? 104 LYS A CD   1  
ATOM 1563  C CE   . LYS A 1 104 ? -1.173  -3.514  9.844   1.00 0.00 ? 104 LYS A CE   1  
ATOM 1564  N NZ   . LYS A 1 104 ? -1.139  -4.926  10.317  1.00 0.00 ? 104 LYS A NZ   1  
ATOM 1565  H H    . LYS A 1 104 ? -6.288  -2.098  7.949   1.00 0.00 ? 104 LYS A H    1  
ATOM 1566  H HA   . LYS A 1 104 ? -4.360  0.015   8.442   1.00 0.00 ? 104 LYS A HA   1  
ATOM 1567  H HB2  . LYS A 1 104 ? -4.779  -2.036  9.941   1.00 0.00 ? 104 LYS A HB2  1  
ATOM 1568  H HB3  . LYS A 1 104 ? -3.856  -2.937  8.745   1.00 0.00 ? 104 LYS A HB3  1  
ATOM 1569  H HG2  . LYS A 1 104 ? -2.010  -1.235  9.099   1.00 0.00 ? 104 LYS A HG2  1  
ATOM 1570  H HG3  . LYS A 1 104 ? -2.925  -0.695  10.509  1.00 0.00 ? 104 LYS A HG3  1  
ATOM 1571  H HD2  . LYS A 1 104 ? -1.563  -2.237  11.504  1.00 0.00 ? 104 LYS A HD2  1  
ATOM 1572  H HD3  . LYS A 1 104 ? -2.913  -3.284  11.058  1.00 0.00 ? 104 LYS A HD3  1  
ATOM 1573  H HE2  . LYS A 1 104 ? -1.505  -3.496  8.818   1.00 0.00 ? 104 LYS A HE2  1  
ATOM 1574  H HE3  . LYS A 1 104 ? -0.179  -3.097  9.909   1.00 0.00 ? 104 LYS A HE3  1  
ATOM 1575  H HZ1  . LYS A 1 104 ? -0.688  -4.977  11.254  1.00 0.00 ? 104 LYS A HZ1  1  
ATOM 1576  H HZ2  . LYS A 1 104 ? -0.597  -5.513  9.652   1.00 0.00 ? 104 LYS A HZ2  1  
ATOM 1577  H HZ3  . LYS A 1 104 ? -2.106  -5.303  10.388  1.00 0.00 ? 104 LYS A HZ3  1  
ATOM 1578  N N    . LEU A 1 105 ? -3.034  -0.112  6.364   1.00 0.00 ? 105 LEU A N    1  
ATOM 1579  C CA   . LEU A 1 105 ? -2.203  -0.163  5.166   1.00 0.00 ? 105 LEU A CA   1  
ATOM 1580  C C    . LEU A 1 105 ? -0.723  -0.222  5.532   1.00 0.00 ? 105 LEU A C    1  
ATOM 1581  O O    . LEU A 1 105 ? -0.211  0.650   6.233   1.00 0.00 ? 105 LEU A O    1  
ATOM 1582  C CB   . LEU A 1 105 ? -2.473  1.056   4.282   1.00 0.00 ? 105 LEU A CB   1  
ATOM 1583  C CG   . LEU A 1 105 ? -3.936  1.314   3.923   1.00 0.00 ? 105 LEU A CG   1  
ATOM 1584  C CD1  . LEU A 1 105 ? -4.180  2.800   3.710   1.00 0.00 ? 105 LEU A CD1  1  
ATOM 1585  C CD2  . LEU A 1 105 ? -4.328  0.524   2.683   1.00 0.00 ? 105 LEU A CD2  1  
ATOM 1586  H H    . LEU A 1 105 ? -3.141  0.741   6.834   1.00 0.00 ? 105 LEU A H    1  
ATOM 1587  H HA   . LEU A 1 105 ? -2.463  -1.058  4.621   1.00 0.00 ? 105 LEU A HA   1  
ATOM 1588  H HB2  . LEU A 1 105 ? -2.101  1.928   4.798   1.00 0.00 ? 105 LEU A HB2  1  
ATOM 1589  H HB3  . LEU A 1 105 ? -1.923  0.923   3.361   1.00 0.00 ? 105 LEU A HB3  1  
ATOM 1590  H HG   . LEU A 1 105 ? -4.564  0.987   4.741   1.00 0.00 ? 105 LEU A HG   1  
ATOM 1591  H HD11 . LEU A 1 105 ? -5.108  2.940   3.176   1.00 0.00 ? 105 LEU A HD11 1  
ATOM 1592  H HD12 . LEU A 1 105 ? -3.367  3.219   3.135   1.00 0.00 ? 105 LEU A HD12 1  
ATOM 1593  H HD13 . LEU A 1 105 ? -4.236  3.296   4.667   1.00 0.00 ? 105 LEU A HD13 1  
ATOM 1594  H HD21 . LEU A 1 105 ? -3.856  0.960   1.815   1.00 0.00 ? 105 LEU A HD21 1  
ATOM 1595  H HD22 . LEU A 1 105 ? -5.402  0.553   2.561   1.00 0.00 ? 105 LEU A HD22 1  
ATOM 1596  H HD23 . LEU A 1 105 ? -4.006  -0.501  2.792   1.00 0.00 ? 105 LEU A HD23 1  
ATOM 1597  N N    . VAL A 1 106 ? -0.041  -1.257  5.051   1.00 0.00 ? 106 VAL A N    1  
ATOM 1598  C CA   . VAL A 1 106 ? 1.381   -1.428  5.325   1.00 0.00 ? 106 VAL A CA   1  
ATOM 1599  C C    . VAL A 1 106 ? 2.203   -1.325  4.045   1.00 0.00 ? 106 VAL A C    1  
ATOM 1600  O O    . VAL A 1 106 ? 2.280   -2.274  3.265   1.00 0.00 ? 106 VAL A O    1  
ATOM 1601  C CB   . VAL A 1 106 ? 1.663   -2.786  5.995   1.00 0.00 ? 106 VAL A CB   1  
ATOM 1602  C CG1  . VAL A 1 106 ? 3.157   -2.975  6.210   1.00 0.00 ? 106 VAL A CG1  1  
ATOM 1603  C CG2  . VAL A 1 106 ? 0.908   -2.898  7.310   1.00 0.00 ? 106 VAL A CG2  1  
ATOM 1604  H H    . VAL A 1 106 ? -0.505  -1.920  4.498   1.00 0.00 ? 106 VAL A H    1  
ATOM 1605  H HA   . VAL A 1 106 ? 1.687   -0.645  6.003   1.00 0.00 ? 106 VAL A HA   1  
ATOM 1606  H HB   . VAL A 1 106 ? 1.316   -3.569  5.336   1.00 0.00 ? 106 VAL A HB   1  
ATOM 1607  H HG11 . VAL A 1 106 ? 3.400   -2.772  7.243   1.00 0.00 ? 106 VAL A HG11 1  
ATOM 1608  H HG12 . VAL A 1 106 ? 3.431   -3.991  5.968   1.00 0.00 ? 106 VAL A HG12 1  
ATOM 1609  H HG13 . VAL A 1 106 ? 3.701   -2.293  5.573   1.00 0.00 ? 106 VAL A HG13 1  
ATOM 1610  H HG21 . VAL A 1 106 ? 1.527   -2.525  8.113   1.00 0.00 ? 106 VAL A HG21 1  
ATOM 1611  H HG22 . VAL A 1 106 ? 0.000   -2.315  7.256   1.00 0.00 ? 106 VAL A HG22 1  
ATOM 1612  H HG23 . VAL A 1 106 ? 0.660   -3.932  7.497   1.00 0.00 ? 106 VAL A HG23 1  
ATOM 1613  N N    . PHE A 1 107 ? 2.817   -0.165  3.835   1.00 0.00 ? 107 PHE A N    1  
ATOM 1614  C CA   . PHE A 1 107 ? 3.634   0.064   2.649   1.00 0.00 ? 107 PHE A CA   1  
ATOM 1615  C C    . PHE A 1 107 ? 5.028   0.551   3.035   1.00 0.00 ? 107 PHE A C    1  
ATOM 1616  O O    . PHE A 1 107 ? 5.350   0.670   4.217   1.00 0.00 ? 107 PHE A O    1  
ATOM 1617  C CB   . PHE A 1 107 ? 2.961   1.086   1.730   1.00 0.00 ? 107 PHE A CB   1  
ATOM 1618  C CG   . PHE A 1 107 ? 2.905   2.470   2.311   1.00 0.00 ? 107 PHE A CG   1  
ATOM 1619  C CD1  . PHE A 1 107 ? 4.034   3.273   2.331   1.00 0.00 ? 107 PHE A CD1  1  
ATOM 1620  C CD2  . PHE A 1 107 ? 1.724   2.968   2.836   1.00 0.00 ? 107 PHE A CD2  1  
ATOM 1621  C CE1  . PHE A 1 107 ? 3.985   4.547   2.866   1.00 0.00 ? 107 PHE A CE1  1  
ATOM 1622  C CE2  . PHE A 1 107 ? 1.669   4.241   3.372   1.00 0.00 ? 107 PHE A CE2  1  
ATOM 1623  C CZ   . PHE A 1 107 ? 2.801   5.031   3.385   1.00 0.00 ? 107 PHE A CZ   1  
ATOM 1624  H H    . PHE A 1 107 ? 2.717   0.555   4.494   1.00 0.00 ? 107 PHE A H    1  
ATOM 1625  H HA   . PHE A 1 107 ? 3.725   -0.874  2.125   1.00 0.00 ? 107 PHE A HA   1  
ATOM 1626  H HB2  . PHE A 1 107 ? 3.508   1.138   0.801   1.00 0.00 ? 107 PHE A HB2  1  
ATOM 1627  H HB3  . PHE A 1 107 ? 1.949   0.767   1.530   1.00 0.00 ? 107 PHE A HB3  1  
ATOM 1628  H HD1  . PHE A 1 107 ? 4.960   2.896   1.924   1.00 0.00 ? 107 PHE A HD1  1  
ATOM 1629  H HD2  . PHE A 1 107 ? 0.837   2.349   2.825   1.00 0.00 ? 107 PHE A HD2  1  
ATOM 1630  H HE1  . PHE A 1 107 ? 4.871   5.163   2.875   1.00 0.00 ? 107 PHE A HE1  1  
ATOM 1631  H HE2  . PHE A 1 107 ? 0.741   4.616   3.777   1.00 0.00 ? 107 PHE A HE2  1  
ATOM 1632  H HZ   . PHE A 1 107 ? 2.760   6.026   3.804   1.00 0.00 ? 107 PHE A HZ   1  
ATOM 1633  N N    . ILE A 1 108 ? 5.850   0.829   2.029   1.00 0.00 ? 108 ILE A N    1  
ATOM 1634  C CA   . ILE A 1 108 ? 7.208   1.303   2.262   1.00 0.00 ? 108 ILE A CA   1  
ATOM 1635  C C    . ILE A 1 108 ? 7.463   2.621   1.538   1.00 0.00 ? 108 ILE A C    1  
ATOM 1636  O O    . ILE A 1 108 ? 6.944   2.851   0.446   1.00 0.00 ? 108 ILE A O    1  
ATOM 1637  C CB   . ILE A 1 108 ? 8.252   0.268   1.803   1.00 0.00 ? 108 ILE A CB   1  
ATOM 1638  C CG1  . ILE A 1 108 ? 9.664   0.749   2.144   1.00 0.00 ? 108 ILE A CG1  1  
ATOM 1639  C CG2  . ILE A 1 108 ? 8.121   0.011   0.309   1.00 0.00 ? 108 ILE A CG2  1  
ATOM 1640  C CD1  . ILE A 1 108 ? 10.648  -0.377  2.370   1.00 0.00 ? 108 ILE A CD1  1  
ATOM 1641  H H    . ILE A 1 108 ? 5.535   0.714   1.108   1.00 0.00 ? 108 ILE A H    1  
ATOM 1642  H HA   . ILE A 1 108 ? 7.329   1.459   3.325   1.00 0.00 ? 108 ILE A HA   1  
ATOM 1643  H HB   . ILE A 1 108 ? 8.060   -0.658  2.321   1.00 0.00 ? 108 ILE A HB   1  
ATOM 1644  H HG12 . ILE A 1 108 ? 10.036  1.356   1.334   1.00 0.00 ? 108 ILE A HG12 1  
ATOM 1645  H HG13 . ILE A 1 108 ? 9.625   1.344   3.045   1.00 0.00 ? 108 ILE A HG13 1  
ATOM 1646  H HG21 . ILE A 1 108 ? 7.743   0.898   -0.177  1.00 0.00 ? 108 ILE A HG21 1  
ATOM 1647  H HG22 . ILE A 1 108 ? 9.089   -0.238  -0.100  1.00 0.00 ? 108 ILE A HG22 1  
ATOM 1648  H HG23 . ILE A 1 108 ? 7.438   -0.809  0.143   1.00 0.00 ? 108 ILE A HG23 1  
ATOM 1649  H HD11 . ILE A 1 108 ? 10.527  -0.766  3.371   1.00 0.00 ? 108 ILE A HD11 1  
ATOM 1650  H HD12 . ILE A 1 108 ? 10.467  -1.163  1.653   1.00 0.00 ? 108 ILE A HD12 1  
ATOM 1651  H HD13 . ILE A 1 108 ? 11.655  -0.005  2.250   1.00 0.00 ? 108 ILE A HD13 1  
ATOM 1652  N N    . ARG A 1 109 ? 8.266   3.483   2.154   1.00 0.00 ? 109 ARG A N    1  
ATOM 1653  C CA   . ARG A 1 109 ? 8.590   4.778   1.569   1.00 0.00 ? 109 ARG A CA   1  
ATOM 1654  C C    . ARG A 1 109 ? 10.021  4.792   1.039   1.00 0.00 ? 109 ARG A C    1  
ATOM 1655  O O    . ARG A 1 109 ? 10.978  4.735   1.808   1.00 0.00 ? 109 ARG A O    1  
ATOM 1656  C CB   . ARG A 1 109 ? 8.407   5.890   2.603   1.00 0.00 ? 109 ARG A CB   1  
ATOM 1657  C CG   . ARG A 1 109 ? 8.419   7.287   2.005   1.00 0.00 ? 109 ARG A CG   1  
ATOM 1658  C CD   . ARG A 1 109 ? 7.743   8.292   2.924   1.00 0.00 ? 109 ARG A CD   1  
ATOM 1659  N NE   . ARG A 1 109 ? 7.201   9.430   2.186   1.00 0.00 ? 109 ARG A NE   1  
ATOM 1660  C CZ   . ARG A 1 109 ? 7.926   10.483  1.823   1.00 0.00 ? 109 ARG A CZ   1  
ATOM 1661  N NH1  . ARG A 1 109 ? 9.215   10.542  2.128   1.00 0.00 ? 109 ARG A NH1  1  
ATOM 1662  N NH2  . ARG A 1 109 ? 7.361   11.480  1.153   1.00 0.00 ? 109 ARG A NH2  1  
ATOM 1663  H H    . ARG A 1 109 ? 8.648   3.242   3.024   1.00 0.00 ? 109 ARG A H    1  
ATOM 1664  H HA   . ARG A 1 109 ? 7.912   4.949   0.746   1.00 0.00 ? 109 ARG A HA   1  
ATOM 1665  H HB2  . ARG A 1 109 ? 7.462   5.746   3.106   1.00 0.00 ? 109 ARG A HB2  1  
ATOM 1666  H HB3  . ARG A 1 109 ? 9.204   5.825   3.328   1.00 0.00 ? 109 ARG A HB3  1  
ATOM 1667  H HG2  . ARG A 1 109 ? 9.443   7.592   1.847   1.00 0.00 ? 109 ARG A HG2  1  
ATOM 1668  H HG3  . ARG A 1 109 ? 7.897   7.268   1.060   1.00 0.00 ? 109 ARG A HG3  1  
ATOM 1669  H HD2  . ARG A 1 109 ? 6.937   7.798   3.446   1.00 0.00 ? 109 ARG A HD2  1  
ATOM 1670  H HD3  . ARG A 1 109 ? 8.469   8.651   3.638   1.00 0.00 ? 109 ARG A HD3  1  
ATOM 1671  H HE   . ARG A 1 109 ? 6.251   9.408   1.950   1.00 0.00 ? 109 ARG A HE   1  
ATOM 1672  H HH11 . ARG A 1 109 ? 9.643   9.792   2.632   1.00 0.00 ? 109 ARG A HH11 1  
ATOM 1673  H HH12 . ARG A 1 109 ? 9.758   11.335  1.853   1.00 0.00 ? 109 ARG A HH12 1  
ATOM 1674  H HH21 . ARG A 1 109 ? 6.390   11.439  0.921   1.00 0.00 ? 109 ARG A HH21 1  
ATOM 1675  H HH22 . ARG A 1 109 ? 7.907   12.271  0.881   1.00 0.00 ? 109 ARG A HH22 1  
ATOM 1676  N N    . ASN A 1 110 ? 10.156  4.868   -0.281  1.00 0.00 ? 110 ASN A N    1  
ATOM 1677  C CA   . ASN A 1 110 ? 11.470  4.888   -0.915  1.00 0.00 ? 110 ASN A CA   1  
ATOM 1678  C C    . ASN A 1 110 ? 11.543  5.977   -1.980  1.00 0.00 ? 110 ASN A C    1  
ATOM 1679  O O    . ASN A 1 110 ? 10.746  5.996   -2.918  1.00 0.00 ? 110 ASN A O    1  
ATOM 1680  C CB   . ASN A 1 110 ? 11.780  3.526   -1.539  1.00 0.00 ? 110 ASN A CB   1  
ATOM 1681  C CG   . ASN A 1 110 ? 13.198  3.442   -2.069  1.00 0.00 ? 110 ASN A CG   1  
ATOM 1682  O OD1  . ASN A 1 110 ? 13.956  4.410   -2.002  1.00 0.00 ? 110 ASN A OD1  1  
ATOM 1683  N ND2  . ASN A 1 110 ? 13.563  2.281   -2.601  1.00 0.00 ? 110 ASN A ND2  1  
ATOM 1684  H H    . ASN A 1 110 ? 9.355   4.911   -0.843  1.00 0.00 ? 110 ASN A H    1  
ATOM 1685  H HA   . ASN A 1 110 ? 12.203  5.099   -0.150  1.00 0.00 ? 110 ASN A HA   1  
ATOM 1686  H HB2  . ASN A 1 110 ? 11.649  2.757   -0.792  1.00 0.00 ? 110 ASN A HB2  1  
ATOM 1687  H HB3  . ASN A 1 110 ? 11.098  3.348   -2.356  1.00 0.00 ? 110 ASN A HB3  1  
ATOM 1688  H HD21 . ASN A 1 110 ? 12.906  1.554   -2.621  1.00 0.00 ? 110 ASN A HD21 1  
ATOM 1689  H HD22 . ASN A 1 110 ? 14.474  2.199   -2.951  1.00 0.00 ? 110 ASN A HD22 1  
ATOM 1690  N N    . GLU A 1 111 ? 12.506  6.882   -1.830  1.00 0.00 ? 111 GLU A N    1  
ATOM 1691  C CA   . GLU A 1 111 ? 12.682  7.974   -2.779  1.00 0.00 ? 111 GLU A CA   1  
ATOM 1692  C C    . GLU A 1 111 ? 13.056  7.440   -4.159  1.00 0.00 ? 111 GLU A C    1  
ATOM 1693  O O    . GLU A 1 111 ? 13.062  8.181   -5.143  1.00 0.00 ? 111 GLU A O    1  
ATOM 1694  C CB   . GLU A 1 111 ? 13.761  8.940   -2.285  1.00 0.00 ? 111 GLU A CB   1  
ATOM 1695  C CG   . GLU A 1 111 ? 15.159  8.344   -2.287  1.00 0.00 ? 111 GLU A CG   1  
ATOM 1696  C CD   . GLU A 1 111 ? 15.428  7.484   -1.067  1.00 0.00 ? 111 GLU A CD   1  
ATOM 1697  O OE1  . GLU A 1 111 ? 15.666  8.053   0.019   1.00 0.00 ? 111 GLU A OE1  1  
ATOM 1698  O OE2  . GLU A 1 111 ? 15.400  6.242   -1.198  1.00 0.00 ? 111 GLU A OE2  1  
ATOM 1699  H H    . GLU A 1 111 ? 13.111  6.814   -1.062  1.00 0.00 ? 111 GLU A H    1  
ATOM 1700  H HA   . GLU A 1 111 ? 11.745  8.504   -2.854  1.00 0.00 ? 111 GLU A HA   1  
ATOM 1701  H HB2  . GLU A 1 111 ? 13.764  9.814   -2.920  1.00 0.00 ? 111 GLU A HB2  1  
ATOM 1702  H HB3  . GLU A 1 111 ? 13.523  9.241   -1.276  1.00 0.00 ? 111 GLU A HB3  1  
ATOM 1703  H HG2  . GLU A 1 111 ? 15.276  7.734   -3.170  1.00 0.00 ? 111 GLU A HG2  1  
ATOM 1704  H HG3  . GLU A 1 111 ? 15.880  9.148   -2.308  1.00 0.00 ? 111 GLU A HG3  1  
ATOM 1705  N N    . ASP A 1 112 ? 13.367  6.150   -4.223  1.00 0.00 ? 112 ASP A N    1  
ATOM 1706  C CA   . ASP A 1 112 ? 13.742  5.516   -5.482  1.00 0.00 ? 112 ASP A CA   1  
ATOM 1707  C C    . ASP A 1 112 ? 12.543  4.817   -6.116  1.00 0.00 ? 112 ASP A C    1  
ATOM 1708  O O    . ASP A 1 112 ? 12.542  4.528   -7.312  1.00 0.00 ? 112 ASP A O    1  
ATOM 1709  C CB   . ASP A 1 112 ? 14.872  4.511   -5.254  1.00 0.00 ? 112 ASP A CB   1  
ATOM 1710  C CG   . ASP A 1 112 ? 16.227  5.180   -5.140  1.00 0.00 ? 112 ASP A CG   1  
ATOM 1711  O OD1  . ASP A 1 112 ? 16.339  6.170   -4.387  1.00 0.00 ? 112 ASP A OD1  1  
ATOM 1712  O OD2  . ASP A 1 112 ? 17.177  4.713   -5.803  1.00 0.00 ? 112 ASP A OD2  1  
ATOM 1713  H H    . ASP A 1 112 ? 13.344  5.612   -3.405  1.00 0.00 ? 112 ASP A H    1  
ATOM 1714  H HA   . ASP A 1 112 ? 14.088  6.287   -6.152  1.00 0.00 ? 112 ASP A HA   1  
ATOM 1715  H HB2  . ASP A 1 112 ? 14.682  3.966   -4.341  1.00 0.00 ? 112 ASP A HB2  1  
ATOM 1716  H HB3  . ASP A 1 112 ? 14.901  3.818   -6.083  1.00 0.00 ? 112 ASP A HB3  1  
ATOM 1717  N N    . ALA A 1 113 ? 11.525  4.548   -5.305  1.00 0.00 ? 113 ALA A N    1  
ATOM 1718  C CA   . ALA A 1 113 ? 10.320  3.884   -5.787  1.00 0.00 ? 113 ALA A CA   1  
ATOM 1719  C C    . ALA A 1 113 ? 9.777   4.570   -7.037  1.00 0.00 ? 113 ALA A C    1  
ATOM 1720  O O    . ALA A 1 113 ? 9.525   3.922   -8.053  1.00 0.00 ? 113 ALA A O    1  
ATOM 1721  C CB   . ALA A 1 113 ? 9.260   3.857   -4.696  1.00 0.00 ? 113 ALA A CB   1  
ATOM 1722  H H    . ALA A 1 113 ? 11.585  4.803   -4.361  1.00 0.00 ? 113 ALA A H    1  
ATOM 1723  H HA   . ALA A 1 113 ? 10.576  2.863   -6.031  1.00 0.00 ? 113 ALA A HA   1  
ATOM 1724  H HB1  . ALA A 1 113 ? 9.652   3.349   -3.827  1.00 0.00 ? 113 ALA A HB1  1  
ATOM 1725  H HB2  . ALA A 1 113 ? 8.990   4.869   -4.431  1.00 0.00 ? 113 ALA A HB2  1  
ATOM 1726  H HB3  . ALA A 1 113 ? 8.387   3.334   -5.055  1.00 0.00 ? 113 ALA A HB3  1  
ATOM 1727  N N    . VAL A 1 114 ? 9.599   5.884   -6.955  1.00 0.00 ? 114 VAL A N    1  
ATOM 1728  C CA   . VAL A 1 114 ? 9.087   6.658   -8.079  1.00 0.00 ? 114 VAL A CA   1  
ATOM 1729  C C    . VAL A 1 114 ? 9.814   6.298   -9.370  1.00 0.00 ? 114 VAL A C    1  
ATOM 1730  O O    . VAL A 1 114 ? 9.239   6.362   -10.456 1.00 0.00 ? 114 VAL A O    1  
ATOM 1731  C CB   . VAL A 1 114 ? 9.227   8.171   -7.830  1.00 0.00 ? 114 VAL A CB   1  
ATOM 1732  C CG1  . VAL A 1 114 ? 8.358   8.602   -6.658  1.00 0.00 ? 114 VAL A CG1  1  
ATOM 1733  C CG2  . VAL A 1 114 ? 10.683  8.539   -7.587  1.00 0.00 ? 114 VAL A CG2  1  
ATOM 1734  H H    . VAL A 1 114 ? 9.818   6.345   -6.118  1.00 0.00 ? 114 VAL A H    1  
ATOM 1735  H HA   . VAL A 1 114 ? 8.038   6.429   -8.192  1.00 0.00 ? 114 VAL A HA   1  
ATOM 1736  H HB   . VAL A 1 114 ? 8.888   8.694   -8.712  1.00 0.00 ? 114 VAL A HB   1  
ATOM 1737  H HG11 . VAL A 1 114 ? 8.205   9.671   -6.698  1.00 0.00 ? 114 VAL A HG11 1  
ATOM 1738  H HG12 . VAL A 1 114 ? 7.403   8.099   -6.714  1.00 0.00 ? 114 VAL A HG12 1  
ATOM 1739  H HG13 . VAL A 1 114 ? 8.848   8.343   -5.732  1.00 0.00 ? 114 VAL A HG13 1  
ATOM 1740  H HG21 . VAL A 1 114 ? 11.320  7.885   -8.164  1.00 0.00 ? 114 VAL A HG21 1  
ATOM 1741  H HG22 . VAL A 1 114 ? 10.852  9.562   -7.888  1.00 0.00 ? 114 VAL A HG22 1  
ATOM 1742  H HG23 . VAL A 1 114 ? 10.912  8.430   -6.537  1.00 0.00 ? 114 VAL A HG23 1  
ATOM 1743  N N    . ASN A 1 115 ? 11.081  5.917   -9.244  1.00 0.00 ? 115 ASN A N    1  
ATOM 1744  C CA   . ASN A 1 115 ? 11.887  5.546   -10.401 1.00 0.00 ? 115 ASN A CA   1  
ATOM 1745  C C    . ASN A 1 115 ? 11.607  4.106   -10.819 1.00 0.00 ? 115 ASN A C    1  
ATOM 1746  O O    . ASN A 1 115 ? 11.773  3.745   -11.984 1.00 0.00 ? 115 ASN A O    1  
ATOM 1747  C CB   . ASN A 1 115 ? 13.375  5.719   -10.089 1.00 0.00 ? 115 ASN A CB   1  
ATOM 1748  C CG   . ASN A 1 115 ? 13.722  7.142   -9.695  1.00 0.00 ? 115 ASN A CG   1  
ATOM 1749  O OD1  . ASN A 1 115 ? 13.083  8.095   -10.143 1.00 0.00 ? 115 ASN A OD1  1  
ATOM 1750  N ND2  . ASN A 1 115 ? 14.738  7.292   -8.854  1.00 0.00 ? 115 ASN A ND2  1  
ATOM 1751  H H    . ASN A 1 115 ? 11.484  5.886   -8.351  1.00 0.00 ? 115 ASN A H    1  
ATOM 1752  H HA   . ASN A 1 115 ? 11.620  6.203   -11.215 1.00 0.00 ? 115 ASN A HA   1  
ATOM 1753  H HB2  . ASN A 1 115 ? 13.643  5.065   -9.272  1.00 0.00 ? 115 ASN A HB2  1  
ATOM 1754  H HB3  . ASN A 1 115 ? 13.953  5.454   -10.961 1.00 0.00 ? 115 ASN A HB3  1  
ATOM 1755  H HD21 . ASN A 1 115 ? 15.201  6.487   -8.539  1.00 0.00 ? 115 ASN A HD21 1  
ATOM 1756  H HD22 . ASN A 1 115 ? 14.983  8.201   -8.583  1.00 0.00 ? 115 ASN A HD22 1  
ATOM 1757  N N    . GLN A 1 116 ? 11.182  3.289   -9.861  1.00 0.00 ? 116 GLN A N    1  
ATOM 1758  C CA   . GLN A 1 116 ? 10.880  1.888   -10.130 1.00 0.00 ? 116 GLN A CA   1  
ATOM 1759  C C    . GLN A 1 116 ? 9.484   1.738   -10.727 1.00 0.00 ? 116 GLN A C    1  
ATOM 1760  O O    . GLN A 1 116 ? 9.314   1.139   -11.788 1.00 0.00 ? 116 GLN A O    1  
ATOM 1761  C CB   . GLN A 1 116 ? 10.990  1.065   -8.846  1.00 0.00 ? 116 GLN A CB   1  
ATOM 1762  C CG   . GLN A 1 116 ? 12.388  1.053   -8.249  1.00 0.00 ? 116 GLN A CG   1  
ATOM 1763  C CD   . GLN A 1 116 ? 12.564  -0.024  -7.197  1.00 0.00 ? 116 GLN A CD   1  
ATOM 1764  O OE1  . GLN A 1 116 ? 11.803  -0.991  -7.148  1.00 0.00 ? 116 GLN A OE1  1  
ATOM 1765  N NE2  . GLN A 1 116 ? 13.572  0.137   -6.347  1.00 0.00 ? 116 GLN A NE2  1  
ATOM 1766  H H    . GLN A 1 116 ? 11.069  3.636   -8.952  1.00 0.00 ? 116 GLN A H    1  
ATOM 1767  H HA   . GLN A 1 116 ? 11.603  1.524   -10.844 1.00 0.00 ? 116 GLN A HA   1  
ATOM 1768  H HB2  . GLN A 1 116 ? 10.311  1.472   -8.112  1.00 0.00 ? 116 GLN A HB2  1  
ATOM 1769  H HB3  . GLN A 1 116 ? 10.705  0.045   -9.061  1.00 0.00 ? 116 GLN A HB3  1  
ATOM 1770  H HG2  . GLN A 1 116 ? 13.102  0.881   -9.041  1.00 0.00 ? 116 GLN A HG2  1  
ATOM 1771  H HG3  . GLN A 1 116 ? 12.580  2.014   -7.795  1.00 0.00 ? 116 GLN A HG3  1  
ATOM 1772  H HE21 . GLN A 1 116 ? 14.136  0.933   -6.445  1.00 0.00 ? 116 GLN A HE21 1  
ATOM 1773  H HE22 . GLN A 1 116 ? 13.708  -0.543  -5.657  1.00 0.00 ? 116 GLN A HE22 1  
ATOM 1774  N N    . MET A 1 117 ? 8.489   2.284   -10.036 1.00 0.00 ? 117 MET A N    1  
ATOM 1775  C CA   . MET A 1 117 ? 7.108   2.211   -10.499 1.00 0.00 ? 117 MET A CA   1  
ATOM 1776  C C    . MET A 1 117 ? 7.022   2.474   -11.999 1.00 0.00 ? 117 MET A C    1  
ATOM 1777  O O    . MET A 1 117 ? 7.976   2.955   -12.610 1.00 0.00 ? 117 MET A O    1  
ATOM 1778  C CB   . MET A 1 117 ? 6.240   3.219   -9.743  1.00 0.00 ? 117 MET A CB   1  
ATOM 1779  C CG   . MET A 1 117 ? 6.919   4.560   -9.521  1.00 0.00 ? 117 MET A CG   1  
ATOM 1780  S SD   . MET A 1 117 ? 5.750   5.932   -9.476  1.00 0.00 ? 117 MET A SD   1  
ATOM 1781  C CE   . MET A 1 117 ? 5.385   6.008   -7.724  1.00 0.00 ? 117 MET A CE   1  
ATOM 1782  H H    . MET A 1 117 ? 8.687   2.749   -9.196  1.00 0.00 ? 117 MET A H    1  
ATOM 1783  H HA   . MET A 1 117 ? 6.744   1.214   -10.299 1.00 0.00 ? 117 MET A HA   1  
ATOM 1784  H HB2  . MET A 1 117 ? 5.333   3.387   -10.304 1.00 0.00 ? 117 MET A HB2  1  
ATOM 1785  H HB3  . MET A 1 117 ? 5.986   2.805   -8.778  1.00 0.00 ? 117 MET A HB3  1  
ATOM 1786  H HG2  . MET A 1 117 ? 7.451   4.529   -8.582  1.00 0.00 ? 117 MET A HG2  1  
ATOM 1787  H HG3  . MET A 1 117 ? 7.621   4.729   -10.325 1.00 0.00 ? 117 MET A HG3  1  
ATOM 1788  H HE1  . MET A 1 117 ? 6.043   6.721   -7.250  1.00 0.00 ? 117 MET A HE1  1  
ATOM 1789  H HE2  . MET A 1 117 ? 4.360   6.315   -7.583  1.00 0.00 ? 117 MET A HE2  1  
ATOM 1790  H HE3  . MET A 1 117 ? 5.534   5.033   -7.283  1.00 0.00 ? 117 MET A HE3  1  
ATOM 1791  N N    . ALA A 1 118 ? 5.874   2.154   -12.587 1.00 0.00 ? 118 ALA A N    1  
ATOM 1792  C CA   . ALA A 1 118 ? 5.664   2.357   -14.015 1.00 0.00 ? 118 ALA A CA   1  
ATOM 1793  C C    . ALA A 1 118 ? 5.022   3.713   -14.288 1.00 0.00 ? 118 ALA A C    1  
ATOM 1794  O O    . ALA A 1 118 ? 5.225   4.304   -15.348 1.00 0.00 ? 118 ALA A O    1  
ATOM 1795  C CB   . ALA A 1 118 ? 4.805   1.239   -14.587 1.00 0.00 ? 118 ALA A CB   1  
ATOM 1796  H H    . ALA A 1 118 ? 5.150   1.773   -12.047 1.00 0.00 ? 118 ALA A H    1  
ATOM 1797  H HA   . ALA A 1 118 ? 6.628   2.322   -14.502 1.00 0.00 ? 118 ALA A HA   1  
ATOM 1798  H HB1  . ALA A 1 118 ? 4.040   0.973   -13.871 1.00 0.00 ? 118 ALA A HB1  1  
ATOM 1799  H HB2  . ALA A 1 118 ? 4.340   1.575   -15.502 1.00 0.00 ? 118 ALA A HB2  1  
ATOM 1800  H HB3  . ALA A 1 118 ? 5.423   0.378   -14.790 1.00 0.00 ? 118 ALA A HB3  1  
ATOM 1801  N N    . SER A 1 119 ? 4.246   4.200   -13.325 1.00 0.00 ? 119 SER A N    1  
ATOM 1802  C CA   . SER A 1 119 ? 3.571   5.485   -13.464 1.00 0.00 ? 119 SER A CA   1  
ATOM 1803  C C    . SER A 1 119 ? 2.703   5.510   -14.719 1.00 0.00 ? 119 SER A C    1  
ATOM 1804  O O    . SER A 1 119 ? 2.831   6.400   -15.558 1.00 0.00 ? 119 SER A O    1  
ATOM 1805  C CB   . SER A 1 119 ? 4.595   6.620   -13.515 1.00 0.00 ? 119 SER A CB   1  
ATOM 1806  O OG   . SER A 1 119 ? 3.986   7.869   -13.232 1.00 0.00 ? 119 SER A OG   1  
ATOM 1807  H H    . SER A 1 119 ? 4.124   3.681   -12.502 1.00 0.00 ? 119 SER A H    1  
ATOM 1808  H HA   . SER A 1 119 ? 2.938   5.621   -12.600 1.00 0.00 ? 119 SER A HA   1  
ATOM 1809  H HB2  . SER A 1 119 ? 5.369   6.437   -12.786 1.00 0.00 ? 119 SER A HB2  1  
ATOM 1810  H HB3  . SER A 1 119 ? 5.032   6.662   -14.502 1.00 0.00 ? 119 SER A HB3  1  
ATOM 1811  H HG   . SER A 1 119 ? 4.598   8.417   -12.735 1.00 0.00 ? 119 SER A HG   1  
ATOM 1812  N N    . GLY A 1 120 ? 1.819   4.524   -14.839 1.00 0.00 ? 120 GLY A N    1  
ATOM 1813  C CA   . GLY A 1 120 ? 0.943   4.450   -15.993 1.00 0.00 ? 120 GLY A CA   1  
ATOM 1814  C C    . GLY A 1 120 ? -0.228  3.513   -15.773 1.00 0.00 ? 120 GLY A C    1  
ATOM 1815  O O    . GLY A 1 120 ? -0.213  2.356   -16.195 1.00 0.00 ? 120 GLY A O    1  
ATOM 1816  H H    . GLY A 1 120 ? 1.761   3.841   -14.138 1.00 0.00 ? 120 GLY A H    1  
ATOM 1817  H HA2  . GLY A 1 120 ? 0.565   5.438   -16.208 1.00 0.00 ? 120 GLY A HA2  1  
ATOM 1818  H HA3  . GLY A 1 120 ? 1.513   4.101   -16.842 1.00 0.00 ? 120 GLY A HA3  1  
ATOM 1819  N N    . PRO A 1 121 ? -1.273  4.014   -15.096 1.00 0.00 ? 121 PRO A N    1  
ATOM 1820  C CA   . PRO A 1 121 ? -2.476  3.230   -14.805 1.00 0.00 ? 121 PRO A CA   1  
ATOM 1821  C C    . PRO A 1 121 ? -3.299  2.944   -16.056 1.00 0.00 ? 121 PRO A C    1  
ATOM 1822  O O    . PRO A 1 121 ? -4.086  1.998   -16.090 1.00 0.00 ? 121 PRO A O    1  
ATOM 1823  C CB   . PRO A 1 121 ? -3.260  4.127   -13.843 1.00 0.00 ? 121 PRO A CB   1  
ATOM 1824  C CG   . PRO A 1 121 ? -2.800  5.509   -14.156 1.00 0.00 ? 121 PRO A CG   1  
ATOM 1825  C CD   . PRO A 1 121 ? -1.359  5.384   -14.564 1.00 0.00 ? 121 PRO A CD   1  
ATOM 1826  H HA   . PRO A 1 121 ? -2.234  2.298   -14.314 1.00 0.00 ? 121 PRO A HA   1  
ATOM 1827  H HB2  . PRO A 1 121 ? -4.319  4.012   -14.022 1.00 0.00 ? 121 PRO A HB2  1  
ATOM 1828  H HB3  . PRO A 1 121 ? -3.029  3.856   -12.824 1.00 0.00 ? 121 PRO A HB3  1  
ATOM 1829  H HG2  . PRO A 1 121 ? -3.386  5.916   -14.966 1.00 0.00 ? 121 PRO A HG2  1  
ATOM 1830  H HG3  . PRO A 1 121 ? -2.888  6.132   -13.278 1.00 0.00 ? 121 PRO A HG3  1  
ATOM 1831  H HD2  . PRO A 1 121 ? -1.118  6.110   -15.327 1.00 0.00 ? 121 PRO A HD2  1  
ATOM 1832  H HD3  . PRO A 1 121 ? -0.712  5.506   -13.708 1.00 0.00 ? 121 PRO A HD3  1  
ATOM 1833  N N    . SER A 1 122 ? -3.112  3.767   -17.083 1.00 0.00 ? 122 SER A N    1  
ATOM 1834  C CA   . SER A 1 122 ? -3.840  3.604   -18.336 1.00 0.00 ? 122 SER A CA   1  
ATOM 1835  C C    . SER A 1 122 ? -5.338  3.472   -18.080 1.00 0.00 ? 122 SER A C    1  
ATOM 1836  O O    . SER A 1 122 ? -5.980  2.534   -18.554 1.00 0.00 ? 122 SER A O    1  
ATOM 1837  C CB   . SER A 1 122 ? -3.330  2.375   -19.090 1.00 0.00 ? 122 SER A CB   1  
ATOM 1838  O OG   . SER A 1 122 ? -2.145  2.673   -19.809 1.00 0.00 ? 122 SER A OG   1  
ATOM 1839  H H    . SER A 1 122 ? -2.471  4.503   -16.994 1.00 0.00 ? 122 SER A H    1  
ATOM 1840  H HA   . SER A 1 122 ? -3.665  4.483   -18.938 1.00 0.00 ? 122 SER A HA   1  
ATOM 1841  H HB2  . SER A 1 122 ? -3.120  1.584   -18.386 1.00 0.00 ? 122 SER A HB2  1  
ATOM 1842  H HB3  . SER A 1 122 ? -4.086  2.044   -19.787 1.00 0.00 ? 122 SER A HB3  1  
ATOM 1843  H HG   . SER A 1 122 ? -2.216  2.325   -20.701 1.00 0.00 ? 122 SER A HG   1  
ATOM 1844  N N    . SER A 1 123 ? -5.889  4.420   -17.328 1.00 0.00 ? 123 SER A N    1  
ATOM 1845  C CA   . SER A 1 123 ? -7.312  4.409   -17.006 1.00 0.00 ? 123 SER A CA   1  
ATOM 1846  C C    . SER A 1 123 ? -8.135  4.974   -18.160 1.00 0.00 ? 123 SER A C    1  
ATOM 1847  O O    . SER A 1 123 ? -9.150  4.400   -18.552 1.00 0.00 ? 123 SER A O    1  
ATOM 1848  C CB   . SER A 1 123 ? -7.574  5.217   -15.734 1.00 0.00 ? 123 SER A CB   1  
ATOM 1849  O OG   . SER A 1 123 ? -7.320  6.595   -15.944 1.00 0.00 ? 123 SER A OG   1  
ATOM 1850  H H    . SER A 1 123 ? -5.325  5.142   -16.980 1.00 0.00 ? 123 SER A H    1  
ATOM 1851  H HA   . SER A 1 123 ? -7.606  3.384   -16.838 1.00 0.00 ? 123 SER A HA   1  
ATOM 1852  H HB2  . SER A 1 123 ? -8.605  5.094   -15.438 1.00 0.00 ? 123 SER A HB2  1  
ATOM 1853  H HB3  . SER A 1 123 ? -6.928  4.860   -14.944 1.00 0.00 ? 123 SER A HB3  1  
ATOM 1854  H HG   . SER A 1 123 ? -8.071  7.110   -15.639 1.00 0.00 ? 123 SER A HG   1  
ATOM 1855  N N    . GLY A 1 124 ? -7.688  6.104   -18.699 1.00 0.00 ? 124 GLY A N    1  
ATOM 1856  C CA   . GLY A 1 124 ? -8.394  6.729   -19.802 1.00 0.00 ? 124 GLY A CA   1  
ATOM 1857  C C    . GLY A 1 124 ? -7.480  7.052   -20.967 1.00 0.00 ? 124 GLY A C    1  
ATOM 1858  O O    . GLY A 1 124 ? -7.600  8.109   -21.585 1.00 0.00 ? 124 GLY A O    1  
ATOM 1859  H H    . GLY A 1 124 ? -6.873  6.517   -18.345 1.00 0.00 ? 124 GLY A H    1  
ATOM 1860  H HA2  . GLY A 1 124 ? -9.172  6.061   -20.142 1.00 0.00 ? 124 GLY A HA2  1  
ATOM 1861  H HA3  . GLY A 1 124 ? -8.848  7.645   -19.452 1.00 0.00 ? 124 GLY A HA3  1  
ATOM 1862  N N    . GLY A 1 1   ? 8.615   -30.512 23.572  1.00 0.00 ? 1   GLY A N    2  
ATOM 1863  C CA   . GLY A 1 1   ? 8.712   -29.644 24.730  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1864  C C    . GLY A 1 1   ? 8.748   -28.176 24.353  1.00 0.00 ? 1   GLY A C    2  
ATOM 1865  O O    . GLY A 1 1   ? 7.943   -27.382 24.841  1.00 0.00 ? 1   GLY A O    2  
ATOM 1866  H H1   . GLY A 1 1   ? 7.938   -30.337 22.885  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1867  H HA2  . GLY A 1 1   ? 7.860   -29.819 25.370  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1868  H HA3  . GLY A 1 1   ? 9.613   -29.886 25.273  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1869  N N    . SER A 1 2   ? 9.684   -27.813 23.482  1.00 0.00 ? 2   SER A N    2  
ATOM 1870  C CA   . SER A 1 2   ? 9.825   -26.430 23.043  1.00 0.00 ? 2   SER A CA   2  
ATOM 1871  C C    . SER A 1 2   ? 8.459   -25.784 22.835  1.00 0.00 ? 2   SER A C    2  
ATOM 1872  O O    . SER A 1 2   ? 7.488   -26.456 22.488  1.00 0.00 ? 2   SER A O    2  
ATOM 1873  C CB   . SER A 1 2   ? 10.636  -26.364 21.747  1.00 0.00 ? 2   SER A CB   2  
ATOM 1874  O OG   . SER A 1 2   ? 11.879  -27.028 21.889  1.00 0.00 ? 2   SER A OG   2  
ATOM 1875  H H    . SER A 1 2   ? 10.296  -28.493 23.128  1.00 0.00 ? 2   SER A H    2  
ATOM 1876  H HA   . SER A 1 2   ? 10.352  -25.890 23.815  1.00 0.00 ? 2   SER A HA   2  
ATOM 1877  H HB2  . SER A 1 2   ? 10.078  -26.835 20.952  1.00 0.00 ? 2   SER A HB2  2  
ATOM 1878  H HB3  . SER A 1 2   ? 10.821  -25.330 21.494  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1879  H HG   . SER A 1 2   ? 11.976  -27.680 21.191  1.00 0.00 ? 2   SER A HG   2  
ATOM 1880  N N    . SER A 1 3   ? 8.392   -24.474 23.050  1.00 0.00 ? 3   SER A N    2  
ATOM 1881  C CA   . SER A 1 3   ? 7.145   -23.735 22.891  1.00 0.00 ? 3   SER A CA   2  
ATOM 1882  C C    . SER A 1 3   ? 7.335   -22.543 21.957  1.00 0.00 ? 3   SER A C    2  
ATOM 1883  O O    . SER A 1 3   ? 8.241   -21.732 22.145  1.00 0.00 ? 3   SER A O    2  
ATOM 1884  C CB   . SER A 1 3   ? 6.633   -23.256 24.251  1.00 0.00 ? 3   SER A CB   2  
ATOM 1885  O OG   . SER A 1 3   ? 5.301   -22.783 24.157  1.00 0.00 ? 3   SER A OG   2  
ATOM 1886  H H    . SER A 1 3   ? 9.201   -23.993 23.326  1.00 0.00 ? 3   SER A H    2  
ATOM 1887  H HA   . SER A 1 3   ? 6.417   -24.405 22.457  1.00 0.00 ? 3   SER A HA   2  
ATOM 1888  H HB2  . SER A 1 3   ? 6.663   -24.076 24.952  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1889  H HB3  . SER A 1 3   ? 7.264   -22.454 24.607  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1890  H HG   . SER A 1 3   ? 4.863   -22.889 25.005  1.00 0.00 ? 3   SER A HG   2  
ATOM 1891  N N    . GLY A 1 4   ? 6.472   -22.445 20.950  1.00 0.00 ? 4   GLY A N    2  
ATOM 1892  C CA   . GLY A 1 4   ? 6.561   -21.350 20.002  1.00 0.00 ? 4   GLY A CA   2  
ATOM 1893  C C    . GLY A 1 4   ? 5.199   -20.817 19.603  1.00 0.00 ? 4   GLY A C    2  
ATOM 1894  O O    . GLY A 1 4   ? 4.356   -21.561 19.103  1.00 0.00 ? 4   GLY A O    2  
ATOM 1895  H H    . GLY A 1 4   ? 5.770   -23.121 20.851  1.00 0.00 ? 4   GLY A H    2  
ATOM 1896  H HA2  . GLY A 1 4   ? 7.134   -20.549 20.446  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1897  H HA3  . GLY A 1 4   ? 7.072   -21.697 19.116  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1898  N N    . SER A 1 5   ? 4.983   -19.524 19.826  1.00 0.00 ? 5   SER A N    2  
ATOM 1899  C CA   . SER A 1 5   ? 3.712   -18.893 19.491  1.00 0.00 ? 5   SER A CA   2  
ATOM 1900  C C    . SER A 1 5   ? 3.571   -18.723 17.982  1.00 0.00 ? 5   SER A C    2  
ATOM 1901  O O    . SER A 1 5   ? 4.334   -17.988 17.355  1.00 0.00 ? 5   SER A O    2  
ATOM 1902  C CB   . SER A 1 5   ? 3.596   -17.533 20.183  1.00 0.00 ? 5   SER A CB   2  
ATOM 1903  O OG   . SER A 1 5   ? 3.330   -17.685 21.566  1.00 0.00 ? 5   SER A OG   2  
ATOM 1904  H H    . SER A 1 5   ? 5.695   -18.983 20.228  1.00 0.00 ? 5   SER A H    2  
ATOM 1905  H HA   . SER A 1 5   ? 2.919   -19.536 19.845  1.00 0.00 ? 5   SER A HA   2  
ATOM 1906  H HB2  . SER A 1 5   ? 4.521   -16.992 20.064  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1907  H HB3  . SER A 1 5   ? 2.789   -16.972 19.733  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1908  H HG   . SER A 1 5   ? 2.416   -17.952 21.689  1.00 0.00 ? 5   SER A HG   2  
ATOM 1909  N N    . SER A 1 6   ? 2.589   -19.408 17.404  1.00 0.00 ? 6   SER A N    2  
ATOM 1910  C CA   . SER A 1 6   ? 2.349   -19.336 15.968  1.00 0.00 ? 6   SER A CA   2  
ATOM 1911  C C    . SER A 1 6   ? 1.123   -18.480 15.664  1.00 0.00 ? 6   SER A C    2  
ATOM 1912  O O    . SER A 1 6   ? 0.243   -18.314 16.508  1.00 0.00 ? 6   SER A O    2  
ATOM 1913  C CB   . SER A 1 6   ? 2.161   -20.740 15.390  1.00 0.00 ? 6   SER A CB   2  
ATOM 1914  O OG   . SER A 1 6   ? 3.352   -21.500 15.499  1.00 0.00 ? 6   SER A OG   2  
ATOM 1915  H H    . SER A 1 6   ? 2.014   -19.977 17.958  1.00 0.00 ? 6   SER A H    2  
ATOM 1916  H HA   . SER A 1 6   ? 3.214   -18.881 15.510  1.00 0.00 ? 6   SER A HA   2  
ATOM 1917  H HB2  . SER A 1 6   ? 1.375   -21.246 15.930  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1918  H HB3  . SER A 1 6   ? 1.890   -20.664 14.347  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1919  H HG   . SER A 1 6   ? 3.170   -22.415 15.273  1.00 0.00 ? 6   SER A HG   2  
ATOM 1920  N N    . GLY A 1 7   ? 1.073   -17.939 14.450  1.00 0.00 ? 7   GLY A N    2  
ATOM 1921  C CA   . GLY A 1 7   ? -0.048  -17.106 14.055  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1922  C C    . GLY A 1 7   ? 0.226   -15.630 14.259  1.00 0.00 ? 7   GLY A C    2  
ATOM 1923  O O    . GLY A 1 7   ? -0.425  -14.781 13.649  1.00 0.00 ? 7   GLY A O    2  
ATOM 1924  H H    . GLY A 1 7   ? 1.803   -18.106 13.819  1.00 0.00 ? 7   GLY A H    2  
ATOM 1925  H HA2  . GLY A 1 7   ? -0.262  -17.282 13.011  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1926  H HA3  . GLY A 1 7   ? -0.912  -17.384 14.641  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1927  N N    . ASP A 1 8   ? 1.191   -15.322 15.118  1.00 0.00 ? 8   ASP A N    2  
ATOM 1928  C CA   . ASP A 1 8   ? 1.549   -13.937 15.401  1.00 0.00 ? 8   ASP A CA   2  
ATOM 1929  C C    . ASP A 1 8   ? 2.669   -13.466 14.478  1.00 0.00 ? 8   ASP A C    2  
ATOM 1930  O O    . ASP A 1 8   ? 3.575   -12.749 14.901  1.00 0.00 ? 8   ASP A O    2  
ATOM 1931  C CB   . ASP A 1 8   ? 1.979   -13.787 16.862  1.00 0.00 ? 8   ASP A CB   2  
ATOM 1932  C CG   . ASP A 1 8   ? 1.127   -14.616 17.803  1.00 0.00 ? 8   ASP A CG   2  
ATOM 1933  O OD1  . ASP A 1 8   ? 0.002   -14.180 18.126  1.00 0.00 ? 8   ASP A OD1  2  
ATOM 1934  O OD2  . ASP A 1 8   ? 1.586   -15.701 18.217  1.00 0.00 ? 8   ASP A OD2  2  
ATOM 1935  H H    . ASP A 1 8   ? 1.674   -16.043 15.573  1.00 0.00 ? 8   ASP A H    2  
ATOM 1936  H HA   . ASP A 1 8   ? 0.676   -13.326 15.228  1.00 0.00 ? 8   ASP A HA   2  
ATOM 1937  H HB2  . ASP A 1 8   ? 3.007   -14.104 16.963  1.00 0.00 ? 8   ASP A HB2  2  
ATOM 1938  H HB3  . ASP A 1 8   ? 1.896   -12.749 17.150  1.00 0.00 ? 8   ASP A HB3  2  
ATOM 1939  N N    . ALA A 1 9   ? 2.600   -13.875 13.216  1.00 0.00 ? 9   ALA A N    2  
ATOM 1940  C CA   . ALA A 1 9   ? 3.607   -13.495 12.233  1.00 0.00 ? 9   ALA A CA   2  
ATOM 1941  C C    . ALA A 1 9   ? 3.229   -12.192 11.537  1.00 0.00 ? 9   ALA A C    2  
ATOM 1942  O O    . ALA A 1 9   ? 4.038   -11.603 10.819  1.00 0.00 ? 9   ALA A O    2  
ATOM 1943  C CB   . ALA A 1 9   ? 3.794   -14.607 11.211  1.00 0.00 ? 9   ALA A CB   2  
ATOM 1944  H H    . ALA A 1 9   ? 1.853   -14.446 12.939  1.00 0.00 ? 9   ALA A H    2  
ATOM 1945  H HA   . ALA A 1 9   ? 4.544   -13.355 12.752  1.00 0.00 ? 9   ALA A HA   2  
ATOM 1946  H HB1  . ALA A 1 9   ? 3.073   -14.487 10.415  1.00 0.00 ? 9   ALA A HB1  2  
ATOM 1947  H HB2  . ALA A 1 9   ? 4.792   -14.557 10.804  1.00 0.00 ? 9   ALA A HB2  2  
ATOM 1948  H HB3  . ALA A 1 9   ? 3.647   -15.563 11.690  1.00 0.00 ? 9   ALA A HB3  2  
ATOM 1949  N N    . PHE A 1 10  ? 1.996   -11.747 11.752  1.00 0.00 ? 10  PHE A N    2  
ATOM 1950  C CA   . PHE A 1 10  ? 1.510   -10.514 11.144  1.00 0.00 ? 10  PHE A CA   2  
ATOM 1951  C C    . PHE A 1 10  ? 1.616   -9.347  12.121  1.00 0.00 ? 10  PHE A C    2  
ATOM 1952  O O    . PHE A 1 10  ? 1.041   -8.281  11.898  1.00 0.00 ? 10  PHE A O    2  
ATOM 1953  C CB   . PHE A 1 10  ? 0.060   -10.682 10.687  1.00 0.00 ? 10  PHE A CB   2  
ATOM 1954  C CG   . PHE A 1 10  ? -0.098  -11.617 9.522   1.00 0.00 ? 10  PHE A CG   2  
ATOM 1955  C CD1  . PHE A 1 10  ? -0.036  -11.142 8.222   1.00 0.00 ? 10  PHE A CD1  2  
ATOM 1956  C CD2  . PHE A 1 10  ? -0.306  -12.971 9.727   1.00 0.00 ? 10  PHE A CD2  2  
ATOM 1957  C CE1  . PHE A 1 10  ? -0.181  -12.000 7.149   1.00 0.00 ? 10  PHE A CE1  2  
ATOM 1958  C CE2  . PHE A 1 10  ? -0.452  -13.834 8.658   1.00 0.00 ? 10  PHE A CE2  2  
ATOM 1959  C CZ   . PHE A 1 10  ? -0.388  -13.348 7.367   1.00 0.00 ? 10  PHE A CZ   2  
ATOM 1960  H H    . PHE A 1 10  ? 1.397   -12.261 12.335  1.00 0.00 ? 10  PHE A H    2  
ATOM 1961  H HA   . PHE A 1 10  ? 2.128   -10.304 10.284  1.00 0.00 ? 10  PHE A HA   2  
ATOM 1962  H HB2  . PHE A 1 10  ? -0.525  -11.072 11.507  1.00 0.00 ? 10  PHE A HB2  2  
ATOM 1963  H HB3  . PHE A 1 10  ? -0.332  -9.719  10.397  1.00 0.00 ? 10  PHE A HB3  2  
ATOM 1964  H HD1  . PHE A 1 10  ? 0.127   -10.088 8.050   1.00 0.00 ? 10  PHE A HD1  2  
ATOM 1965  H HD2  . PHE A 1 10  ? -0.356  -13.353 10.738  1.00 0.00 ? 10  PHE A HD2  2  
ATOM 1966  H HE1  . PHE A 1 10  ? -0.131  -11.617 6.140   1.00 0.00 ? 10  PHE A HE1  2  
ATOM 1967  H HE2  . PHE A 1 10  ? -0.613  -14.888 8.832   1.00 0.00 ? 10  PHE A HE2  2  
ATOM 1968  H HZ   . PHE A 1 10  ? -0.502  -14.020 6.530   1.00 0.00 ? 10  PHE A HZ   2  
ATOM 1969  N N    . THR A 1 11  ? 2.354   -9.556  13.207  1.00 0.00 ? 11  THR A N    2  
ATOM 1970  C CA   . THR A 1 11  ? 2.534   -8.524  14.220  1.00 0.00 ? 11  THR A CA   2  
ATOM 1971  C C    . THR A 1 11  ? 3.474   -7.429  13.728  1.00 0.00 ? 11  THR A C    2  
ATOM 1972  O O    . THR A 1 11  ? 4.462   -7.705  13.048  1.00 0.00 ? 11  THR A O    2  
ATOM 1973  C CB   . THR A 1 11  ? 3.092   -9.113  15.529  1.00 0.00 ? 11  THR A CB   2  
ATOM 1974  O OG1  . THR A 1 11  ? 4.289   -9.853  15.263  1.00 0.00 ? 11  THR A OG1  2  
ATOM 1975  C CG2  . THR A 1 11  ? 2.067   -10.020 16.195  1.00 0.00 ? 11  THR A CG2  2  
ATOM 1976  H H    . THR A 1 11  ? 2.787   -10.427 13.328  1.00 0.00 ? 11  THR A H    2  
ATOM 1977  H HA   . THR A 1 11  ? 1.568   -8.089  14.428  1.00 0.00 ? 11  THR A HA   2  
ATOM 1978  H HB   . THR A 1 11  ? 3.323   -8.300  16.203  1.00 0.00 ? 11  THR A HB   2  
ATOM 1979  H HG1  . THR A 1 11  ? 5.022   -9.244  15.147  1.00 0.00 ? 11  THR A HG1  2  
ATOM 1980  H HG21 . THR A 1 11  ? 2.572   -10.854 16.658  1.00 0.00 ? 11  THR A HG21 2  
ATOM 1981  H HG22 . THR A 1 11  ? 1.374   -10.385 15.452  1.00 0.00 ? 11  THR A HG22 2  
ATOM 1982  H HG23 . THR A 1 11  ? 1.529   -9.462  16.946  1.00 0.00 ? 11  THR A HG23 2  
ATOM 1983  N N    . ASP A 1 12  ? 3.160   -6.186  14.076  1.00 0.00 ? 12  ASP A N    2  
ATOM 1984  C CA   . ASP A 1 12  ? 3.978   -5.049  13.671  1.00 0.00 ? 12  ASP A CA   2  
ATOM 1985  C C    . ASP A 1 12  ? 5.462   -5.394  13.743  1.00 0.00 ? 12  ASP A C    2  
ATOM 1986  O O    . ASP A 1 12  ? 6.188   -5.259  12.758  1.00 0.00 ? 12  ASP A O    2  
ATOM 1987  C CB   . ASP A 1 12  ? 3.680   -3.838  14.557  1.00 0.00 ? 12  ASP A CB   2  
ATOM 1988  C CG   . ASP A 1 12  ? 3.323   -4.233  15.977  1.00 0.00 ? 12  ASP A CG   2  
ATOM 1989  O OD1  . ASP A 1 12  ? 3.751   -5.322  16.415  1.00 0.00 ? 12  ASP A OD1  2  
ATOM 1990  O OD2  . ASP A 1 12  ? 2.616   -3.454  16.650  1.00 0.00 ? 12  ASP A OD2  2  
ATOM 1991  H H    . ASP A 1 12  ? 2.359   -6.030  14.620  1.00 0.00 ? 12  ASP A H    2  
ATOM 1992  H HA   . ASP A 1 12  ? 3.726   -4.806  12.650  1.00 0.00 ? 12  ASP A HA   2  
ATOM 1993  H HB2  . ASP A 1 12  ? 4.551   -3.201  14.589  1.00 0.00 ? 12  ASP A HB2  2  
ATOM 1994  H HB3  . ASP A 1 12  ? 2.851   -3.288  14.137  1.00 0.00 ? 12  ASP A HB3  2  
ATOM 1995  N N    . GLN A 1 13  ? 5.905   -5.839  14.914  1.00 0.00 ? 13  GLN A N    2  
ATOM 1996  C CA   . GLN A 1 13  ? 7.303   -6.202  15.114  1.00 0.00 ? 13  GLN A CA   2  
ATOM 1997  C C    . GLN A 1 13  ? 7.778   -7.159  14.025  1.00 0.00 ? 13  GLN A C    2  
ATOM 1998  O O    . GLN A 1 13  ? 8.924   -7.090  13.579  1.00 0.00 ? 13  GLN A O    2  
ATOM 1999  C CB   . GLN A 1 13  ? 7.495   -6.841  16.490  1.00 0.00 ? 13  GLN A CB   2  
ATOM 2000  C CG   . GLN A 1 13  ? 6.740   -8.149  16.664  1.00 0.00 ? 13  GLN A CG   2  
ATOM 2001  C CD   . GLN A 1 13  ? 7.022   -8.812  17.998  1.00 0.00 ? 13  GLN A CD   2  
ATOM 2002  O OE1  . GLN A 1 13  ? 8.174   -8.923  18.418  1.00 0.00 ? 13  GLN A OE1  2  
ATOM 2003  N NE2  . GLN A 1 13  ? 5.968   -9.257  18.672  1.00 0.00 ? 13  GLN A NE2  2  
ATOM 2004  H H    . GLN A 1 13  ? 5.278   -5.925  15.661  1.00 0.00 ? 13  GLN A H    2  
ATOM 2005  H HA   . GLN A 1 13  ? 7.891   -5.298  15.062  1.00 0.00 ? 13  GLN A HA   2  
ATOM 2006  H HB2  . GLN A 1 13  ? 8.547   -7.034  16.641  1.00 0.00 ? 13  GLN A HB2  2  
ATOM 2007  H HB3  . GLN A 1 13  ? 7.152   -6.149  17.246  1.00 0.00 ? 13  GLN A HB3  2  
ATOM 2008  H HG2  . GLN A 1 13  ? 5.681   -7.950  16.595  1.00 0.00 ? 13  GLN A HG2  2  
ATOM 2009  H HG3  . GLN A 1 13  ? 7.031   -8.825  15.873  1.00 0.00 ? 13  GLN A HG3  2  
ATOM 2010  H HE21 . GLN A 1 13  ? 5.080   -9.135  18.275  1.00 0.00 ? 13  GLN A HE21 2  
ATOM 2011  H HE22 . GLN A 1 13  ? 6.121   -9.691  19.536  1.00 0.00 ? 13  GLN A HE22 2  
ATOM 2012  N N    . LYS A 1 14  ? 6.891   -8.052  13.601  1.00 0.00 ? 14  LYS A N    2  
ATOM 2013  C CA   . LYS A 1 14  ? 7.218   -9.023  12.564  1.00 0.00 ? 14  LYS A CA   2  
ATOM 2014  C C    . LYS A 1 14  ? 7.207   -8.371  11.185  1.00 0.00 ? 14  LYS A C    2  
ATOM 2015  O O    . LYS A 1 14  ? 8.035   -8.690  10.331  1.00 0.00 ? 14  LYS A O    2  
ATOM 2016  C CB   . LYS A 1 14  ? 6.226   -10.188 12.596  1.00 0.00 ? 14  LYS A CB   2  
ATOM 2017  C CG   . LYS A 1 14  ? 6.543   -11.228 13.657  1.00 0.00 ? 14  LYS A CG   2  
ATOM 2018  C CD   . LYS A 1 14  ? 7.744   -12.073 13.267  1.00 0.00 ? 14  LYS A CD   2  
ATOM 2019  C CE   . LYS A 1 14  ? 8.169   -12.995 14.399  1.00 0.00 ? 14  LYS A CE   2  
ATOM 2020  N NZ   . LYS A 1 14  ? 9.192   -13.983 13.957  1.00 0.00 ? 14  LYS A NZ   2  
ATOM 2021  H H    . LYS A 1 14  ? 5.993   -8.057  13.995  1.00 0.00 ? 14  LYS A H    2  
ATOM 2022  H HA   . LYS A 1 14  ? 8.209   -9.400  12.763  1.00 0.00 ? 14  LYS A HA   2  
ATOM 2023  H HB2  . LYS A 1 14  ? 5.237   -9.798  12.789  1.00 0.00 ? 14  LYS A HB2  2  
ATOM 2024  H HB3  . LYS A 1 14  ? 6.229   -10.675 11.632  1.00 0.00 ? 14  LYS A HB3  2  
ATOM 2025  H HG2  . LYS A 1 14  ? 6.758   -10.726 14.588  1.00 0.00 ? 14  LYS A HG2  2  
ATOM 2026  H HG3  . LYS A 1 14  ? 5.686   -11.874 13.783  1.00 0.00 ? 14  LYS A HG3  2  
ATOM 2027  H HD2  . LYS A 1 14  ? 7.487   -12.674 12.406  1.00 0.00 ? 14  LYS A HD2  2  
ATOM 2028  H HD3  . LYS A 1 14  ? 8.568   -11.419 13.018  1.00 0.00 ? 14  LYS A HD3  2  
ATOM 2029  H HE2  . LYS A 1 14  ? 8.580   -12.397 15.198  1.00 0.00 ? 14  LYS A HE2  2  
ATOM 2030  H HE3  . LYS A 1 14  ? 7.300   -13.526 14.758  1.00 0.00 ? 14  LYS A HE3  2  
ATOM 2031  H HZ1  . LYS A 1 14  ? 8.739   -14.748 13.417  1.00 0.00 ? 14  LYS A HZ1  2  
ATOM 2032  H HZ2  . LYS A 1 14  ? 9.672   -14.394 14.782  1.00 0.00 ? 14  LYS A HZ2  2  
ATOM 2033  H HZ3  . LYS A 1 14  ? 9.900   -13.519 13.353  1.00 0.00 ? 14  LYS A HZ3  2  
ATOM 2034  N N    . ILE A 1 15  ? 6.267   -7.456  10.976  1.00 0.00 ? 15  ILE A N    2  
ATOM 2035  C CA   . ILE A 1 15  ? 6.151   -6.758  9.701   1.00 0.00 ? 15  ILE A CA   2  
ATOM 2036  C C    . ILE A 1 15  ? 7.372   -5.883  9.441   1.00 0.00 ? 15  ILE A C    2  
ATOM 2037  O O    . ILE A 1 15  ? 8.010   -5.984  8.393   1.00 0.00 ? 15  ILE A O    2  
ATOM 2038  C CB   . ILE A 1 15  ? 4.886   -5.882  9.652   1.00 0.00 ? 15  ILE A CB   2  
ATOM 2039  C CG1  . ILE A 1 15  ? 3.637   -6.737  9.877   1.00 0.00 ? 15  ILE A CG1  2  
ATOM 2040  C CG2  . ILE A 1 15  ? 4.800   -5.150  8.321   1.00 0.00 ? 15  ILE A CG2  2  
ATOM 2041  C CD1  . ILE A 1 15  ? 2.371   -5.927  10.045  1.00 0.00 ? 15  ILE A CD1  2  
ATOM 2042  H H    . ILE A 1 15  ? 5.636   -7.245  11.695  1.00 0.00 ? 15  ILE A H    2  
ATOM 2043  H HA   . ILE A 1 15  ? 6.081   -7.501  8.920   1.00 0.00 ? 15  ILE A HA   2  
ATOM 2044  H HB   . ILE A 1 15  ? 4.954   -5.144  10.437  1.00 0.00 ? 15  ILE A HB   2  
ATOM 2045  H HG12 . ILE A 1 15  ? 3.501   -7.393  9.032   1.00 0.00 ? 15  ILE A HG12 2  
ATOM 2046  H HG13 . ILE A 1 15  ? 3.773   -7.331  10.770  1.00 0.00 ? 15  ILE A HG13 2  
ATOM 2047  H HG21 . ILE A 1 15  ? 5.768   -5.160  7.842   1.00 0.00 ? 15  ILE A HG21 2  
ATOM 2048  H HG22 . ILE A 1 15  ? 4.079   -5.643  7.686   1.00 0.00 ? 15  ILE A HG22 2  
ATOM 2049  H HG23 . ILE A 1 15  ? 4.492   -4.129  8.490   1.00 0.00 ? 15  ILE A HG23 2  
ATOM 2050  H HD11 . ILE A 1 15  ? 2.485   -4.974  9.549   1.00 0.00 ? 15  ILE A HD11 2  
ATOM 2051  H HD12 . ILE A 1 15  ? 1.540   -6.463  9.613   1.00 0.00 ? 15  ILE A HD12 2  
ATOM 2052  H HD13 . ILE A 1 15  ? 2.186   -5.763  11.097  1.00 0.00 ? 15  ILE A HD13 2  
ATOM 2053  N N    . ARG A 1 16  ? 7.694   -5.024  10.404  1.00 0.00 ? 16  ARG A N    2  
ATOM 2054  C CA   . ARG A 1 16  ? 8.839   -4.131  10.280  1.00 0.00 ? 16  ARG A CA   2  
ATOM 2055  C C    . ARG A 1 16  ? 10.130  -4.924  10.096  1.00 0.00 ? 16  ARG A C    2  
ATOM 2056  O O    . ARG A 1 16  ? 11.058  -4.470  9.428   1.00 0.00 ? 16  ARG A O    2  
ATOM 2057  C CB   . ARG A 1 16  ? 8.950   -3.235  11.514  1.00 0.00 ? 16  ARG A CB   2  
ATOM 2058  C CG   . ARG A 1 16  ? 9.248   -3.997  12.795  1.00 0.00 ? 16  ARG A CG   2  
ATOM 2059  C CD   . ARG A 1 16  ? 9.495   -3.052  13.961  1.00 0.00 ? 16  ARG A CD   2  
ATOM 2060  N NE   . ARG A 1 16  ? 10.876  -2.578  13.999  1.00 0.00 ? 16  ARG A NE   2  
ATOM 2061  C CZ   . ARG A 1 16  ? 11.406  -1.942  15.037  1.00 0.00 ? 16  ARG A CZ   2  
ATOM 2062  N NH1  . ARG A 1 16  ? 10.676  -1.705  16.118  1.00 0.00 ? 16  ARG A NH1  2  
ATOM 2063  N NH2  . ARG A 1 16  ? 12.671  -1.542  14.996  1.00 0.00 ? 16  ARG A NH2  2  
ATOM 2064  H H    . ARG A 1 16  ? 7.147   -4.990  11.216  1.00 0.00 ? 16  ARG A H    2  
ATOM 2065  H HA   . ARG A 1 16  ? 8.684   -3.511  9.409   1.00 0.00 ? 16  ARG A HA   2  
ATOM 2066  H HB2  . ARG A 1 16  ? 9.744   -2.519  11.355  1.00 0.00 ? 16  ARG A HB2  2  
ATOM 2067  H HB3  . ARG A 1 16  ? 8.019   -2.705  11.644  1.00 0.00 ? 16  ARG A HB3  2  
ATOM 2068  H HG2  . ARG A 1 16  ? 8.404   -4.629  13.031  1.00 0.00 ? 16  ARG A HG2  2  
ATOM 2069  H HG3  . ARG A 1 16  ? 10.126  -4.606  12.645  1.00 0.00 ? 16  ARG A HG3  2  
ATOM 2070  H HD2  . ARG A 1 16  ? 8.835   -2.202  13.865  1.00 0.00 ? 16  ARG A HD2  2  
ATOM 2071  H HD3  . ARG A 1 16  ? 9.277   -3.573  14.881  1.00 0.00 ? 16  ARG A HD3  2  
ATOM 2072  H HE   . ARG A 1 16  ? 11.433  -2.743  13.211  1.00 0.00 ? 16  ARG A HE   2  
ATOM 2073  H HH11 . ARG A 1 16  ? 9.723   -2.006  16.152  1.00 0.00 ? 16  ARG A HH11 2  
ATOM 2074  H HH12 . ARG A 1 16  ? 11.078  -1.227  16.898  1.00 0.00 ? 16  ARG A HH12 2  
ATOM 2075  H HH21 . ARG A 1 16  ? 13.225  -1.719  14.183  1.00 0.00 ? 16  ARG A HH21 2  
ATOM 2076  H HH22 . ARG A 1 16  ? 13.069  -1.063  15.777  1.00 0.00 ? 16  ARG A HH22 2  
ATOM 2077  N N    . GLN A 1 17  ? 10.179  -6.110  10.694  1.00 0.00 ? 17  GLN A N    2  
ATOM 2078  C CA   . GLN A 1 17  ? 11.356  -6.965  10.597  1.00 0.00 ? 17  GLN A CA   2  
ATOM 2079  C C    . GLN A 1 17  ? 11.332  -7.781  9.308   1.00 0.00 ? 17  GLN A C    2  
ATOM 2080  O O    . GLN A 1 17  ? 12.380  -8.129  8.763   1.00 0.00 ? 17  GLN A O    2  
ATOM 2081  C CB   . GLN A 1 17  ? 11.434  -7.901  11.805  1.00 0.00 ? 17  GLN A CB   2  
ATOM 2082  C CG   . GLN A 1 17  ? 12.113  -7.278  13.014  1.00 0.00 ? 17  GLN A CG   2  
ATOM 2083  C CD   . GLN A 1 17  ? 12.759  -8.311  13.916  1.00 0.00 ? 17  GLN A CD   2  
ATOM 2084  O OE1  . GLN A 1 17  ? 12.680  -9.513  13.660  1.00 0.00 ? 17  GLN A OE1  2  
ATOM 2085  N NE2  . GLN A 1 17  ? 13.403  -7.847  14.981  1.00 0.00 ? 17  GLN A NE2  2  
ATOM 2086  H H    . GLN A 1 17  ? 9.407   -6.417  11.212  1.00 0.00 ? 17  GLN A H    2  
ATOM 2087  H HA   . GLN A 1 17  ? 12.228  -6.329  10.589  1.00 0.00 ? 17  GLN A HA   2  
ATOM 2088  H HB2  . GLN A 1 17  ? 10.432  -8.187  12.088  1.00 0.00 ? 17  GLN A HB2  2  
ATOM 2089  H HB3  . GLN A 1 17  ? 11.987  -8.786  11.525  1.00 0.00 ? 17  GLN A HB3  2  
ATOM 2090  H HG2  . GLN A 1 17  ? 12.876  -6.596  12.670  1.00 0.00 ? 17  GLN A HG2  2  
ATOM 2091  H HG3  . GLN A 1 17  ? 11.375  -6.734  13.584  1.00 0.00 ? 17  GLN A HG3  2  
ATOM 2092  H HE21 . GLN A 1 17  ? 13.424  -6.877  15.123  1.00 0.00 ? 17  GLN A HE21 2  
ATOM 2093  H HE22 . GLN A 1 17  ? 13.829  -8.492  15.582  1.00 0.00 ? 17  GLN A HE22 2  
ATOM 2094  N N    . ARG A 1 18  ? 10.131  -8.081  8.826   1.00 0.00 ? 18  ARG A N    2  
ATOM 2095  C CA   . ARG A 1 18  ? 9.971   -8.856  7.602   1.00 0.00 ? 18  ARG A CA   2  
ATOM 2096  C C    . ARG A 1 18  ? 10.372  -8.034  6.381   1.00 0.00 ? 18  ARG A C    2  
ATOM 2097  O O    . ARG A 1 18  ? 11.021  -8.540  5.465   1.00 0.00 ? 18  ARG A O    2  
ATOM 2098  C CB   . ARG A 1 18  ? 8.523   -9.330  7.459   1.00 0.00 ? 18  ARG A CB   2  
ATOM 2099  C CG   . ARG A 1 18  ? 8.215   -9.947  6.104   1.00 0.00 ? 18  ARG A CG   2  
ATOM 2100  C CD   . ARG A 1 18  ? 6.997   -10.854 6.169   1.00 0.00 ? 18  ARG A CD   2  
ATOM 2101  N NE   . ARG A 1 18  ? 7.310   -12.151 6.765   1.00 0.00 ? 18  ARG A NE   2  
ATOM 2102  C CZ   . ARG A 1 18  ? 6.387   -13.017 7.168   1.00 0.00 ? 18  ARG A CZ   2  
ATOM 2103  N NH1  . ARG A 1 18  ? 5.100   -12.726 7.041   1.00 0.00 ? 18  ARG A NH1  2  
ATOM 2104  N NH2  . ARG A 1 18  ? 6.752   -14.176 7.700   1.00 0.00 ? 18  ARG A NH2  2  
ATOM 2105  H H    . ARG A 1 18  ? 9.333   -7.774  9.305   1.00 0.00 ? 18  ARG A H    2  
ATOM 2106  H HA   . ARG A 1 18  ? 10.617  -9.719  7.669   1.00 0.00 ? 18  ARG A HA   2  
ATOM 2107  H HB2  . ARG A 1 18  ? 8.320   -10.068 8.220   1.00 0.00 ? 18  ARG A HB2  2  
ATOM 2108  H HB3  . ARG A 1 18  ? 7.865   -8.486  7.603   1.00 0.00 ? 18  ARG A HB3  2  
ATOM 2109  H HG2  . ARG A 1 18  ? 8.024   -9.157  5.393   1.00 0.00 ? 18  ARG A HG2  2  
ATOM 2110  H HG3  . ARG A 1 18  ? 9.068   -10.526 5.781   1.00 0.00 ? 18  ARG A HG3  2  
ATOM 2111  H HD2  . ARG A 1 18  ? 6.236   -10.371 6.764   1.00 0.00 ? 18  ARG A HD2  2  
ATOM 2112  H HD3  . ARG A 1 18  ? 6.626   -11.009 5.167   1.00 0.00 ? 18  ARG A HD3  2  
ATOM 2113  H HE   . ARG A 1 18  ? 8.256   -12.386 6.868   1.00 0.00 ? 18  ARG A HE   2  
ATOM 2114  H HH11 . ARG A 1 18  ? 4.823   -11.853 6.639   1.00 0.00 ? 18  ARG A HH11 2  
ATOM 2115  H HH12 . ARG A 1 18  ? 4.407   -13.380 7.344   1.00 0.00 ? 18  ARG A HH12 2  
ATOM 2116  H HH21 . ARG A 1 18  ? 7.721   -14.399 7.798   1.00 0.00 ? 18  ARG A HH21 2  
ATOM 2117  H HH22 . ARG A 1 18  ? 6.056   -14.827 8.004   1.00 0.00 ? 18  ARG A HH22 2  
ATOM 2118  N N    . TYR A 1 19  ? 9.980   -6.765  6.375   1.00 0.00 ? 19  TYR A N    2  
ATOM 2119  C CA   . TYR A 1 19  ? 10.296  -5.873  5.265   1.00 0.00 ? 19  TYR A CA   2  
ATOM 2120  C C    . TYR A 1 19  ? 11.437  -4.930  5.632   1.00 0.00 ? 19  TYR A C    2  
ATOM 2121  O O    . TYR A 1 19  ? 11.697  -3.951  4.933   1.00 0.00 ? 19  TYR A O    2  
ATOM 2122  C CB   . TYR A 1 19  ? 9.060   -5.065  4.865   1.00 0.00 ? 19  TYR A CB   2  
ATOM 2123  C CG   . TYR A 1 19  ? 7.956   -5.905  4.264   1.00 0.00 ? 19  TYR A CG   2  
ATOM 2124  C CD1  . TYR A 1 19  ? 8.053   -6.390  2.966   1.00 0.00 ? 19  TYR A CD1  2  
ATOM 2125  C CD2  . TYR A 1 19  ? 6.815   -6.214  4.995   1.00 0.00 ? 19  TYR A CD2  2  
ATOM 2126  C CE1  . TYR A 1 19  ? 7.046   -7.157  2.413   1.00 0.00 ? 19  TYR A CE1  2  
ATOM 2127  C CE2  . TYR A 1 19  ? 5.804   -6.981  4.450   1.00 0.00 ? 19  TYR A CE2  2  
ATOM 2128  C CZ   . TYR A 1 19  ? 5.923   -7.450  3.159   1.00 0.00 ? 19  TYR A CZ   2  
ATOM 2129  O OH   . TYR A 1 19  ? 4.919   -8.214  2.612   1.00 0.00 ? 19  TYR A OH   2  
ATOM 2130  H H    . TYR A 1 19  ? 9.465   -6.419  7.133   1.00 0.00 ? 19  TYR A H    2  
ATOM 2131  H HA   . TYR A 1 19  ? 10.602  -6.482  4.427   1.00 0.00 ? 19  TYR A HA   2  
ATOM 2132  H HB2  . TYR A 1 19  ? 8.663   -4.572  5.739   1.00 0.00 ? 19  TYR A HB2  2  
ATOM 2133  H HB3  . TYR A 1 19  ? 9.345   -4.321  4.136   1.00 0.00 ? 19  TYR A HB3  2  
ATOM 2134  H HD1  . TYR A 1 19  ? 8.934   -6.159  2.384   1.00 0.00 ? 19  TYR A HD1  2  
ATOM 2135  H HD2  . TYR A 1 19  ? 6.724   -5.845  6.007   1.00 0.00 ? 19  TYR A HD2  2  
ATOM 2136  H HE1  . TYR A 1 19  ? 7.140   -7.524  1.401   1.00 0.00 ? 19  TYR A HE1  2  
ATOM 2137  H HE2  . TYR A 1 19  ? 4.924   -7.211  5.034   1.00 0.00 ? 19  TYR A HE2  2  
ATOM 2138  H HH   . TYR A 1 19  ? 4.684   -7.865  1.749   1.00 0.00 ? 19  TYR A HH   2  
ATOM 2139  N N    . ALA A 1 20  ? 12.116  -5.234  6.733   1.00 0.00 ? 20  ALA A N    2  
ATOM 2140  C CA   . ALA A 1 20  ? 13.231  -4.416  7.193   1.00 0.00 ? 20  ALA A CA   2  
ATOM 2141  C C    . ALA A 1 20  ? 14.369  -4.419  6.178   1.00 0.00 ? 20  ALA A C    2  
ATOM 2142  O O    . ALA A 1 20  ? 15.169  -3.484  6.124   1.00 0.00 ? 20  ALA A O    2  
ATOM 2143  C CB   . ALA A 1 20  ? 13.726  -4.910  8.545   1.00 0.00 ? 20  ALA A CB   2  
ATOM 2144  H H    . ALA A 1 20  ? 11.861  -6.027  7.248   1.00 0.00 ? 20  ALA A H    2  
ATOM 2145  H HA   . ALA A 1 20  ? 12.875  -3.403  7.316   1.00 0.00 ? 20  ALA A HA   2  
ATOM 2146  H HB1  . ALA A 1 20  ? 13.148  -5.772  8.846   1.00 0.00 ? 20  ALA A HB1  2  
ATOM 2147  H HB2  . ALA A 1 20  ? 14.768  -5.183  8.469   1.00 0.00 ? 20  ALA A HB2  2  
ATOM 2148  H HB3  . ALA A 1 20  ? 13.611  -4.125  9.278   1.00 0.00 ? 20  ALA A HB3  2  
ATOM 2149  N N    . ASP A 1 21  ? 14.437  -5.476  5.376   1.00 0.00 ? 21  ASP A N    2  
ATOM 2150  C CA   . ASP A 1 21  ? 15.478  -5.600  4.362   1.00 0.00 ? 21  ASP A CA   2  
ATOM 2151  C C    . ASP A 1 21  ? 15.275  -4.579  3.247   1.00 0.00 ? 21  ASP A C    2  
ATOM 2152  O O    . ASP A 1 21  ? 16.223  -4.201  2.557   1.00 0.00 ? 21  ASP A O    2  
ATOM 2153  C CB   . ASP A 1 21  ? 15.485  -7.014  3.779   1.00 0.00 ? 21  ASP A CB   2  
ATOM 2154  C CG   . ASP A 1 21  ? 15.783  -8.070  4.826   1.00 0.00 ? 21  ASP A CG   2  
ATOM 2155  O OD1  . ASP A 1 21  ? 15.467  -7.837  6.011   1.00 0.00 ? 21  ASP A OD1  2  
ATOM 2156  O OD2  . ASP A 1 21  ? 16.333  -9.130  4.459   1.00 0.00 ? 21  ASP A OD2  2  
ATOM 2157  H H    . ASP A 1 21  ? 13.771  -6.189  5.468   1.00 0.00 ? 21  ASP A H    2  
ATOM 2158  H HA   . ASP A 1 21  ? 16.429  -5.412  4.837   1.00 0.00 ? 21  ASP A HA   2  
ATOM 2159  H HB2  . ASP A 1 21  ? 14.517  -7.225  3.349   1.00 0.00 ? 21  ASP A HB2  2  
ATOM 2160  H HB3  . ASP A 1 21  ? 16.239  -7.075  3.008   1.00 0.00 ? 21  ASP A HB3  2  
ATOM 2161  N N    . LEU A 1 22  ? 14.035  -4.136  3.076   1.00 0.00 ? 22  LEU A N    2  
ATOM 2162  C CA   . LEU A 1 22  ? 13.707  -3.158  2.044   1.00 0.00 ? 22  LEU A CA   2  
ATOM 2163  C C    . LEU A 1 22  ? 14.551  -1.898  2.200   1.00 0.00 ? 22  LEU A C    2  
ATOM 2164  O O    . LEU A 1 22  ? 14.990  -1.546  3.296   1.00 0.00 ? 22  LEU A O    2  
ATOM 2165  C CB   . LEU A 1 22  ? 12.221  -2.801  2.106   1.00 0.00 ? 22  LEU A CB   2  
ATOM 2166  C CG   . LEU A 1 22  ? 11.243  -3.967  1.951   1.00 0.00 ? 22  LEU A CG   2  
ATOM 2167  C CD1  . LEU A 1 22  ? 9.831   -3.452  1.719   1.00 0.00 ? 22  LEU A CD1  2  
ATOM 2168  C CD2  . LEU A 1 22  ? 11.675  -4.877  0.810   1.00 0.00 ? 22  LEU A CD2  2  
ATOM 2169  H H    . LEU A 1 22  ? 13.322  -4.473  3.657   1.00 0.00 ? 22  LEU A H    2  
ATOM 2170  H HA   . LEU A 1 22  ? 13.922  -3.605  1.085   1.00 0.00 ? 22  LEU A HA   2  
ATOM 2171  H HB2  . LEU A 1 22  ? 12.032  -2.336  3.061   1.00 0.00 ? 22  LEU A HB2  2  
ATOM 2172  H HB3  . LEU A 1 22  ? 12.019  -2.091  1.316   1.00 0.00 ? 22  LEU A HB3  2  
ATOM 2173  H HG   . LEU A 1 22  ? 11.240  -4.549  2.862   1.00 0.00 ? 22  LEU A HG   2  
ATOM 2174  H HD11 . LEU A 1 22  ? 9.512   -2.877  2.575   1.00 0.00 ? 22  LEU A HD11 2  
ATOM 2175  H HD12 . LEU A 1 22  ? 9.162   -4.288  1.577   1.00 0.00 ? 22  LEU A HD12 2  
ATOM 2176  H HD13 . LEU A 1 22  ? 9.816   -2.826  0.839   1.00 0.00 ? 22  LEU A HD13 2  
ATOM 2177  H HD21 . LEU A 1 22  ? 12.105  -4.281  0.018   1.00 0.00 ? 22  LEU A HD21 2  
ATOM 2178  H HD22 . LEU A 1 22  ? 10.816  -5.412  0.432   1.00 0.00 ? 22  LEU A HD22 2  
ATOM 2179  H HD23 . LEU A 1 22  ? 12.410  -5.581  1.171   1.00 0.00 ? 22  LEU A HD23 2  
ATOM 2180  N N    . PRO A 1 23  ? 14.784  -1.198  1.079   1.00 0.00 ? 23  PRO A N    2  
ATOM 2181  C CA   . PRO A 1 23  ? 15.575  0.036   1.066   1.00 0.00 ? 23  PRO A CA   2  
ATOM 2182  C C    . PRO A 1 23  ? 14.858  1.192   1.755   1.00 0.00 ? 23  PRO A C    2  
ATOM 2183  O O    . PRO A 1 23  ? 15.430  1.872   2.605   1.00 0.00 ? 23  PRO A O    2  
ATOM 2184  C CB   . PRO A 1 23  ? 15.750  0.329   -0.426  1.00 0.00 ? 23  PRO A CB   2  
ATOM 2185  C CG   . PRO A 1 23  ? 14.587  -0.333  -1.081  1.00 0.00 ? 23  PRO A CG   2  
ATOM 2186  C CD   . PRO A 1 23  ? 14.292  -1.558  -0.261  1.00 0.00 ? 23  PRO A CD   2  
ATOM 2187  H HA   . PRO A 1 23  ? 16.543  -0.109  1.522   1.00 0.00 ? 23  PRO A HA   2  
ATOM 2188  H HB2  . PRO A 1 23  ? 15.741  1.398   -0.589  1.00 0.00 ? 23  PRO A HB2  2  
ATOM 2189  H HB3  . PRO A 1 23  ? 16.685  -0.086  -0.771  1.00 0.00 ? 23  PRO A HB3  2  
ATOM 2190  H HG2  . PRO A 1 23  ? 13.737  0.333   -1.080  1.00 0.00 ? 23  PRO A HG2  2  
ATOM 2191  H HG3  . PRO A 1 23  ? 14.845  -0.612  -2.092  1.00 0.00 ? 23  PRO A HG3  2  
ATOM 2192  H HD2  . PRO A 1 23  ? 13.230  -1.753  -0.243  1.00 0.00 ? 23  PRO A HD2  2  
ATOM 2193  H HD3  . PRO A 1 23  ? 14.827  -2.411  -0.651  1.00 0.00 ? 23  PRO A HD3  2  
ATOM 2194  N N    . GLY A 1 24  ? 13.599  1.408   1.383   1.00 0.00 ? 24  GLY A N    2  
ATOM 2195  C CA   . GLY A 1 24  ? 12.825  2.482   1.976   1.00 0.00 ? 24  GLY A CA   2  
ATOM 2196  C C    . GLY A 1 24  ? 12.504  2.228   3.436   1.00 0.00 ? 24  GLY A C    2  
ATOM 2197  O O    . GLY A 1 24  ? 13.073  1.330   4.055   1.00 0.00 ? 24  GLY A O    2  
ATOM 2198  H H    . GLY A 1 24  ? 13.194  0.833   0.700   1.00 0.00 ? 24  GLY A H    2  
ATOM 2199  H HA2  . GLY A 1 24  ? 13.384  3.402   1.896   1.00 0.00 ? 24  GLY A HA2  2  
ATOM 2200  H HA3  . GLY A 1 24  ? 11.899  2.587   1.430   1.00 0.00 ? 24  GLY A HA3  2  
ATOM 2201  N N    . GLU A 1 25  ? 11.592  3.023   3.987   1.00 0.00 ? 25  GLU A N    2  
ATOM 2202  C CA   . GLU A 1 25  ? 11.200  2.881   5.384   1.00 0.00 ? 25  GLU A CA   2  
ATOM 2203  C C    . GLU A 1 25  ? 9.737   2.463   5.499   1.00 0.00 ? 25  GLU A C    2  
ATOM 2204  O O    . GLU A 1 25  ? 8.851   3.093   4.918   1.00 0.00 ? 25  GLU A O    2  
ATOM 2205  C CB   . GLU A 1 25  ? 11.426  4.194   6.137   1.00 0.00 ? 25  GLU A CB   2  
ATOM 2206  C CG   . GLU A 1 25  ? 11.715  4.005   7.617   1.00 0.00 ? 25  GLU A CG   2  
ATOM 2207  C CD   . GLU A 1 25  ? 13.038  3.308   7.869   1.00 0.00 ? 25  GLU A CD   2  
ATOM 2208  O OE1  . GLU A 1 25  ? 14.083  3.991   7.838   1.00 0.00 ? 25  GLU A OE1  2  
ATOM 2209  O OE2  . GLU A 1 25  ? 13.028  2.080   8.096   1.00 0.00 ? 25  GLU A OE2  2  
ATOM 2210  H H    . GLU A 1 25  ? 11.174  3.721   3.441   1.00 0.00 ? 25  GLU A H    2  
ATOM 2211  H HA   . GLU A 1 25  ? 11.817  2.113   5.825   1.00 0.00 ? 25  GLU A HA   2  
ATOM 2212  H HB2  . GLU A 1 25  ? 12.263  4.711   5.691   1.00 0.00 ? 25  GLU A HB2  2  
ATOM 2213  H HB3  . GLU A 1 25  ? 10.543  4.807   6.039   1.00 0.00 ? 25  GLU A HB3  2  
ATOM 2214  H HG2  . GLU A 1 25  ? 11.740  4.974   8.092   1.00 0.00 ? 25  GLU A HG2  2  
ATOM 2215  H HG3  . GLU A 1 25  ? 10.924  3.412   8.052   1.00 0.00 ? 25  GLU A HG3  2  
ATOM 2216  N N    . LEU A 1 26  ? 9.490   1.395   6.250   1.00 0.00 ? 26  LEU A N    2  
ATOM 2217  C CA   . LEU A 1 26  ? 8.134   0.891   6.441   1.00 0.00 ? 26  LEU A CA   2  
ATOM 2218  C C    . LEU A 1 26  ? 7.274   1.909   7.182   1.00 0.00 ? 26  LEU A C    2  
ATOM 2219  O O    . LEU A 1 26  ? 7.658   2.408   8.240   1.00 0.00 ? 26  LEU A O    2  
ATOM 2220  C CB   . LEU A 1 26  ? 8.164   -0.429  7.215   1.00 0.00 ? 26  LEU A CB   2  
ATOM 2221  C CG   . LEU A 1 26  ? 6.905   -1.290  7.121   1.00 0.00 ? 26  LEU A CG   2  
ATOM 2222  C CD1  . LEU A 1 26  ? 6.943   -2.156  5.871   1.00 0.00 ? 26  LEU A CD1  2  
ATOM 2223  C CD2  . LEU A 1 26  ? 6.755   -2.154  8.365   1.00 0.00 ? 26  LEU A CD2  2  
ATOM 2224  H H    . LEU A 1 26  ? 10.236  0.935   6.687   1.00 0.00 ? 26  LEU A H    2  
ATOM 2225  H HA   . LEU A 1 26  ? 7.705   0.717   5.465   1.00 0.00 ? 26  LEU A HA   2  
ATOM 2226  H HB2  . LEU A 1 26  ? 8.992   -1.012  6.842   1.00 0.00 ? 26  LEU A HB2  2  
ATOM 2227  H HB3  . LEU A 1 26  ? 8.330   -0.196  8.257   1.00 0.00 ? 26  LEU A HB3  2  
ATOM 2228  H HG   . LEU A 1 26  ? 6.039   -0.646  7.053   1.00 0.00 ? 26  LEU A HG   2  
ATOM 2229  H HD11 . LEU A 1 26  ? 6.735   -3.181  6.137   1.00 0.00 ? 26  LEU A HD11 2  
ATOM 2230  H HD12 . LEU A 1 26  ? 7.921   -2.092  5.418   1.00 0.00 ? 26  LEU A HD12 2  
ATOM 2231  H HD13 . LEU A 1 26  ? 6.199   -1.808  5.169   1.00 0.00 ? 26  LEU A HD13 2  
ATOM 2232  H HD21 . LEU A 1 26  ? 7.399   -1.775  9.145   1.00 0.00 ? 26  LEU A HD21 2  
ATOM 2233  H HD22 . LEU A 1 26  ? 7.032   -3.172  8.132   1.00 0.00 ? 26  LEU A HD22 2  
ATOM 2234  H HD23 . LEU A 1 26  ? 5.729   -2.127  8.700   1.00 0.00 ? 26  LEU A HD23 2  
ATOM 2235  N N    . HIS A 1 27  ? 6.107   2.211   6.621   1.00 0.00 ? 27  HIS A N    2  
ATOM 2236  C CA   . HIS A 1 27  ? 5.191   3.167   7.230   1.00 0.00 ? 27  HIS A CA   2  
ATOM 2237  C C    . HIS A 1 27  ? 3.768   2.616   7.257   1.00 0.00 ? 27  HIS A C    2  
ATOM 2238  O O    . HIS A 1 27  ? 3.095   2.561   6.227   1.00 0.00 ? 27  HIS A O    2  
ATOM 2239  C CB   . HIS A 1 27  ? 5.222   4.493   6.469   1.00 0.00 ? 27  HIS A CB   2  
ATOM 2240  C CG   . HIS A 1 27  ? 6.251   5.454   6.980   1.00 0.00 ? 27  HIS A CG   2  
ATOM 2241  N ND1  . HIS A 1 27  ? 5.986   6.389   7.958   1.00 0.00 ? 27  HIS A ND1  2  
ATOM 2242  C CD2  . HIS A 1 27  ? 7.552   5.619   6.646   1.00 0.00 ? 27  HIS A CD2  2  
ATOM 2243  C CE1  . HIS A 1 27  ? 7.079   7.090   8.201   1.00 0.00 ? 27  HIS A CE1  2  
ATOM 2244  N NE2  . HIS A 1 27  ? 8.044   6.642   7.419   1.00 0.00 ? 27  HIS A NE2  2  
ATOM 2245  H H    . HIS A 1 27  ? 5.857   1.780   5.777   1.00 0.00 ? 27  HIS A H    2  
ATOM 2246  H HA   . HIS A 1 27  ? 5.516   3.338   8.245   1.00 0.00 ? 27  HIS A HA   2  
ATOM 2247  H HB2  . HIS A 1 27  ? 5.440   4.298   5.429   1.00 0.00 ? 27  HIS A HB2  2  
ATOM 2248  H HB3  . HIS A 1 27  ? 4.255   4.968   6.546   1.00 0.00 ? 27  HIS A HB3  2  
ATOM 2249  H HD1  . HIS A 1 27  ? 5.124   6.521   8.405   1.00 0.00 ? 27  HIS A HD1  2  
ATOM 2250  H HD2  . HIS A 1 27  ? 8.102   5.052   5.908   1.00 0.00 ? 27  HIS A HD2  2  
ATOM 2251  H HE1  . HIS A 1 27  ? 7.169   7.892   8.919   1.00 0.00 ? 27  HIS A HE1  2  
ATOM 2252  H HE2  . HIS A 1 27  ? 8.934   7.042   7.335   1.00 0.00 ? 27  HIS A HE2  2  
ATOM 2253  N N    . ILE A 1 28  ? 3.319   2.208   8.439   1.00 0.00 ? 28  ILE A N    2  
ATOM 2254  C CA   . ILE A 1 28  ? 1.977   1.662   8.598   1.00 0.00 ? 28  ILE A CA   2  
ATOM 2255  C C    . ILE A 1 28  ? 1.009   2.722   9.112   1.00 0.00 ? 28  ILE A C    2  
ATOM 2256  O O    . ILE A 1 28  ? 1.168   3.238   10.219  1.00 0.00 ? 28  ILE A O    2  
ATOM 2257  C CB   . ILE A 1 28  ? 1.968   0.463   9.565   1.00 0.00 ? 28  ILE A CB   2  
ATOM 2258  C CG1  . ILE A 1 28  ? 2.973   -0.596  9.108   1.00 0.00 ? 28  ILE A CG1  2  
ATOM 2259  C CG2  . ILE A 1 28  ? 0.571   -0.131  9.660   1.00 0.00 ? 28  ILE A CG2  2  
ATOM 2260  C CD1  . ILE A 1 28  ? 3.518   -1.440  10.238  1.00 0.00 ? 28  ILE A CD1  2  
ATOM 2261  H H    . ILE A 1 28  ? 3.903   2.278   9.222   1.00 0.00 ? 28  ILE A H    2  
ATOM 2262  H HA   . ILE A 1 28  ? 1.639   1.320   7.630   1.00 0.00 ? 28  ILE A HA   2  
ATOM 2263  H HB   . ILE A 1 28  ? 2.250   0.818   10.545  1.00 0.00 ? 28  ILE A HB   2  
ATOM 2264  H HG12 . ILE A 1 28  ? 2.495   -1.257  8.402   1.00 0.00 ? 28  ILE A HG12 2  
ATOM 2265  H HG13 . ILE A 1 28  ? 3.808   -0.106  8.627   1.00 0.00 ? 28  ILE A HG13 2  
ATOM 2266  H HG21 . ILE A 1 28  ? 0.495   -0.980  8.998   1.00 0.00 ? 28  ILE A HG21 2  
ATOM 2267  H HG22 . ILE A 1 28  ? 0.384   -0.449  10.675  1.00 0.00 ? 28  ILE A HG22 2  
ATOM 2268  H HG23 . ILE A 1 28  ? -0.157  0.614   9.376   1.00 0.00 ? 28  ILE A HG23 2  
ATOM 2269  H HD11 . ILE A 1 28  ? 3.329   -2.484  10.033  1.00 0.00 ? 28  ILE A HD11 2  
ATOM 2270  H HD12 . ILE A 1 28  ? 4.581   -1.278  10.330  1.00 0.00 ? 28  ILE A HD12 2  
ATOM 2271  H HD13 . ILE A 1 28  ? 3.031   -1.162  11.162  1.00 0.00 ? 28  ILE A HD13 2  
ATOM 2272  N N    . ILE A 1 29  ? 0.005   3.041   8.302   1.00 0.00 ? 29  ILE A N    2  
ATOM 2273  C CA   . ILE A 1 29  ? -0.991  4.037   8.676   1.00 0.00 ? 29  ILE A CA   2  
ATOM 2274  C C    . ILE A 1 29  ? -2.405  3.523   8.426   1.00 0.00 ? 29  ILE A C    2  
ATOM 2275  O O    . ILE A 1 29  ? -2.678  2.906   7.397   1.00 0.00 ? 29  ILE A O    2  
ATOM 2276  C CB   . ILE A 1 29  ? -0.791  5.352   7.900   1.00 0.00 ? 29  ILE A CB   2  
ATOM 2277  C CG1  . ILE A 1 29  ? -0.977  5.118   6.399   1.00 0.00 ? 29  ILE A CG1  2  
ATOM 2278  C CG2  . ILE A 1 29  ? 0.587   5.931   8.184   1.00 0.00 ? 29  ILE A CG2  2  
ATOM 2279  C CD1  . ILE A 1 29  ? -0.947  6.389   5.581   1.00 0.00 ? 29  ILE A CD1  2  
ATOM 2280  H H    . ILE A 1 29  ? -0.068  2.595   7.433   1.00 0.00 ? 29  ILE A H    2  
ATOM 2281  H HA   . ILE A 1 29  ? -0.876  4.244   9.731   1.00 0.00 ? 29  ILE A HA   2  
ATOM 2282  H HB   . ILE A 1 29  ? -1.530  6.062   8.240   1.00 0.00 ? 29  ILE A HB   2  
ATOM 2283  H HG12 . ILE A 1 29  ? -0.188  4.475   6.041   1.00 0.00 ? 29  ILE A HG12 2  
ATOM 2284  H HG13 . ILE A 1 29  ? -1.930  4.637   6.233   1.00 0.00 ? 29  ILE A HG13 2  
ATOM 2285  H HG21 . ILE A 1 29  ? 1.311   5.477   7.524   1.00 0.00 ? 29  ILE A HG21 2  
ATOM 2286  H HG22 . ILE A 1 29  ? 0.570   6.998   8.019   1.00 0.00 ? 29  ILE A HG22 2  
ATOM 2287  H HG23 . ILE A 1 29  ? 0.858   5.729   9.210   1.00 0.00 ? 29  ILE A HG23 2  
ATOM 2288  H HD11 . ILE A 1 29  ? -0.140  6.338   4.865   1.00 0.00 ? 29  ILE A HD11 2  
ATOM 2289  H HD12 . ILE A 1 29  ? -1.886  6.504   5.060   1.00 0.00 ? 29  ILE A HD12 2  
ATOM 2290  H HD13 . ILE A 1 29  ? -0.794  7.235   6.235   1.00 0.00 ? 29  ILE A HD13 2  
ATOM 2291  N N    . GLU A 1 30  ? -3.299  3.783   9.375   1.00 0.00 ? 30  GLU A N    2  
ATOM 2292  C CA   . GLU A 1 30  ? -4.685  3.346   9.256   1.00 0.00 ? 30  GLU A CA   2  
ATOM 2293  C C    . GLU A 1 30  ? -5.554  4.449   8.658   1.00 0.00 ? 30  GLU A C    2  
ATOM 2294  O O    . GLU A 1 30  ? -5.649  5.547   9.208   1.00 0.00 ? 30  GLU A O    2  
ATOM 2295  C CB   . GLU A 1 30  ? -5.233  2.936   10.625  1.00 0.00 ? 30  GLU A CB   2  
ATOM 2296  C CG   . GLU A 1 30  ? -5.003  1.472   10.959  1.00 0.00 ? 30  GLU A CG   2  
ATOM 2297  C CD   . GLU A 1 30  ? -4.872  1.227   12.450  1.00 0.00 ? 30  GLU A CD   2  
ATOM 2298  O OE1  . GLU A 1 30  ? -4.370  2.126   13.157  1.00 0.00 ? 30  GLU A OE1  2  
ATOM 2299  O OE2  . GLU A 1 30  ? -5.272  0.137   12.909  1.00 0.00 ? 30  GLU A OE2  2  
ATOM 2300  H H    . GLU A 1 30  ? -3.020  4.279   10.172  1.00 0.00 ? 30  GLU A H    2  
ATOM 2301  H HA   . GLU A 1 30  ? -4.709  2.490   8.599   1.00 0.00 ? 30  GLU A HA   2  
ATOM 2302  H HB2  . GLU A 1 30  ? -4.756  3.537   11.385  1.00 0.00 ? 30  GLU A HB2  2  
ATOM 2303  H HB3  . GLU A 1 30  ? -6.296  3.126   10.645  1.00 0.00 ? 30  GLU A HB3  2  
ATOM 2304  H HG2  . GLU A 1 30  ? -5.838  0.896   10.588  1.00 0.00 ? 30  GLU A HG2  2  
ATOM 2305  H HG3  . GLU A 1 30  ? -4.096  1.143   10.474  1.00 0.00 ? 30  GLU A HG3  2  
ATOM 2306  N N    . LEU A 1 31  ? -6.185  4.149   7.528   1.00 0.00 ? 31  LEU A N    2  
ATOM 2307  C CA   . LEU A 1 31  ? -7.046  5.115   6.854   1.00 0.00 ? 31  LEU A CA   2  
ATOM 2308  C C    . LEU A 1 31  ? -8.471  4.584   6.735   1.00 0.00 ? 31  LEU A C    2  
ATOM 2309  O O    . LEU A 1 31  ? -8.707  3.546   6.119   1.00 0.00 ? 31  LEU A O    2  
ATOM 2310  C CB   . LEU A 1 31  ? -6.493  5.438   5.464   1.00 0.00 ? 31  LEU A CB   2  
ATOM 2311  C CG   . LEU A 1 31  ? -5.009  5.801   5.401   1.00 0.00 ? 31  LEU A CG   2  
ATOM 2312  C CD1  . LEU A 1 31  ? -4.565  5.982   3.957   1.00 0.00 ? 31  LEU A CD1  2  
ATOM 2313  C CD2  . LEU A 1 31  ? -4.734  7.062   6.207   1.00 0.00 ? 31  LEU A CD2  2  
ATOM 2314  H H    . LEU A 1 31  ? -6.070  3.258   7.138   1.00 0.00 ? 31  LEU A H    2  
ATOM 2315  H HA   . LEU A 1 31  ? -7.059  6.018   7.446   1.00 0.00 ? 31  LEU A HA   2  
ATOM 2316  H HB2  . LEU A 1 31  ? -6.648  4.573   4.838   1.00 0.00 ? 31  LEU A HB2  2  
ATOM 2317  H HB3  . LEU A 1 31  ? -7.056  6.272   5.071   1.00 0.00 ? 31  LEU A HB3  2  
ATOM 2318  H HG   . LEU A 1 31  ? -4.429  4.996   5.829   1.00 0.00 ? 31  LEU A HG   2  
ATOM 2319  H HD11 . LEU A 1 31  ? -3.855  6.793   3.898   1.00 0.00 ? 31  LEU A HD11 2  
ATOM 2320  H HD12 . LEU A 1 31  ? -5.424  6.209   3.343   1.00 0.00 ? 31  LEU A HD12 2  
ATOM 2321  H HD13 . LEU A 1 31  ? -4.103  5.071   3.606   1.00 0.00 ? 31  LEU A HD13 2  
ATOM 2322  H HD21 . LEU A 1 31  ? -4.008  6.846   6.976   1.00 0.00 ? 31  LEU A HD21 2  
ATOM 2323  H HD22 . LEU A 1 31  ? -5.651  7.404   6.664   1.00 0.00 ? 31  LEU A HD22 2  
ATOM 2324  H HD23 . LEU A 1 31  ? -4.348  7.830   5.553   1.00 0.00 ? 31  LEU A HD23 2  
ATOM 2325  N N    . GLU A 1 32  ? -9.417  5.306   7.328   1.00 0.00 ? 32  GLU A N    2  
ATOM 2326  C CA   . GLU A 1 32  ? -10.819 4.907   7.288   1.00 0.00 ? 32  GLU A CA   2  
ATOM 2327  C C    . GLU A 1 32  ? -11.429 5.201   5.920   1.00 0.00 ? 32  GLU A C    2  
ATOM 2328  O O    . GLU A 1 32  ? -11.517 6.356   5.501   1.00 0.00 ? 32  GLU A O    2  
ATOM 2329  C CB   . GLU A 1 32  ? -11.611 5.634   8.378   1.00 0.00 ? 32  GLU A CB   2  
ATOM 2330  C CG   . GLU A 1 32  ? -12.798 4.841   8.898   1.00 0.00 ? 32  GLU A CG   2  
ATOM 2331  C CD   . GLU A 1 32  ? -13.734 5.681   9.745   1.00 0.00 ? 32  GLU A CD   2  
ATOM 2332  O OE1  . GLU A 1 32  ? -14.358 6.612   9.194   1.00 0.00 ? 32  GLU A OE1  2  
ATOM 2333  O OE2  . GLU A 1 32  ? -13.841 5.409   10.959  1.00 0.00 ? 32  GLU A OE2  2  
ATOM 2334  H H    . GLU A 1 32  ? -9.166  6.125   7.805   1.00 0.00 ? 32  GLU A H    2  
ATOM 2335  H HA   . GLU A 1 32  ? -10.867 3.844   7.469   1.00 0.00 ? 32  GLU A HA   2  
ATOM 2336  H HB2  . GLU A 1 32  ? -10.951 5.842   9.207   1.00 0.00 ? 32  GLU A HB2  2  
ATOM 2337  H HB3  . GLU A 1 32  ? -11.976 6.568   7.978   1.00 0.00 ? 32  GLU A HB3  2  
ATOM 2338  H HG2  . GLU A 1 32  ? -13.351 4.451   8.057   1.00 0.00 ? 32  GLU A HG2  2  
ATOM 2339  H HG3  . GLU A 1 32  ? -12.432 4.021   9.498   1.00 0.00 ? 32  GLU A HG3  2  
ATOM 2340  N N    . LYS A 1 33  ? -11.848 4.148   5.227   1.00 0.00 ? 33  LYS A N    2  
ATOM 2341  C CA   . LYS A 1 33  ? -12.450 4.290   3.907   1.00 0.00 ? 33  LYS A CA   2  
ATOM 2342  C C    . LYS A 1 33  ? -13.452 5.440   3.887   1.00 0.00 ? 33  LYS A C    2  
ATOM 2343  O O    . LYS A 1 33  ? -14.410 5.455   4.661   1.00 0.00 ? 33  LYS A O    2  
ATOM 2344  C CB   . LYS A 1 33  ? -13.143 2.989   3.497   1.00 0.00 ? 33  LYS A CB   2  
ATOM 2345  C CG   . LYS A 1 33  ? -12.178 1.873   3.136   1.00 0.00 ? 33  LYS A CG   2  
ATOM 2346  C CD   . LYS A 1 33  ? -12.772 0.935   2.099   1.00 0.00 ? 33  LYS A CD   2  
ATOM 2347  C CE   . LYS A 1 33  ? -13.563 -0.189  2.752   1.00 0.00 ? 33  LYS A CE   2  
ATOM 2348  N NZ   . LYS A 1 33  ? -14.680 -0.656  1.886   1.00 0.00 ? 33  LYS A NZ   2  
ATOM 2349  H H    . LYS A 1 33  ? -11.751 3.252   5.614   1.00 0.00 ? 33  LYS A H    2  
ATOM 2350  H HA   . LYS A 1 33  ? -11.660 4.505   3.204   1.00 0.00 ? 33  LYS A HA   2  
ATOM 2351  H HB2  . LYS A 1 33  ? -13.762 2.650   4.316   1.00 0.00 ? 33  LYS A HB2  2  
ATOM 2352  H HB3  . LYS A 1 33  ? -13.771 3.184   2.640   1.00 0.00 ? 33  LYS A HB3  2  
ATOM 2353  H HG2  . LYS A 1 33  ? -11.273 2.307   2.736   1.00 0.00 ? 33  LYS A HG2  2  
ATOM 2354  H HG3  . LYS A 1 33  ? -11.945 1.308   4.028   1.00 0.00 ? 33  LYS A HG3  2  
ATOM 2355  H HD2  . LYS A 1 33  ? -13.432 1.496   1.454   1.00 0.00 ? 33  LYS A HD2  2  
ATOM 2356  H HD3  . LYS A 1 33  ? -11.971 0.506   1.513   1.00 0.00 ? 33  LYS A HD3  2  
ATOM 2357  H HE2  . LYS A 1 33  ? -12.897 -1.016  2.944   1.00 0.00 ? 33  LYS A HE2  2  
ATOM 2358  H HE3  . LYS A 1 33  ? -13.968 0.171   3.687   1.00 0.00 ? 33  LYS A HE3  2  
ATOM 2359  H HZ1  . LYS A 1 33  ? -15.048 0.135   1.320   1.00 0.00 ? 33  LYS A HZ1  2  
ATOM 2360  H HZ2  . LYS A 1 33  ? -15.451 -1.036  2.472   1.00 0.00 ? 33  LYS A HZ2  2  
ATOM 2361  H HZ3  . LYS A 1 33  ? -14.347 -1.403  1.244   1.00 0.00 ? 33  LYS A HZ3  2  
ATOM 2362  N N    . ASP A 1 34  ? -13.226 6.400   2.997   1.00 0.00 ? 34  ASP A N    2  
ATOM 2363  C CA   . ASP A 1 34  ? -14.111 7.553   2.875   1.00 0.00 ? 34  ASP A CA   2  
ATOM 2364  C C    . ASP A 1 34  ? -15.377 7.187   2.105   1.00 0.00 ? 34  ASP A C    2  
ATOM 2365  O O    . ASP A 1 34  ? -15.517 6.066   1.616   1.00 0.00 ? 34  ASP A O    2  
ATOM 2366  C CB   . ASP A 1 34  ? -13.389 8.705   2.176   1.00 0.00 ? 34  ASP A CB   2  
ATOM 2367  C CG   . ASP A 1 34  ? -14.116 10.026  2.335   1.00 0.00 ? 34  ASP A CG   2  
ATOM 2368  O OD1  . ASP A 1 34  ? -14.697 10.257  3.416   1.00 0.00 ? 34  ASP A OD1  2  
ATOM 2369  O OD2  . ASP A 1 34  ? -14.103 10.829  1.379   1.00 0.00 ? 34  ASP A OD2  2  
ATOM 2370  H H    . ASP A 1 34  ? -12.446 6.331   2.408   1.00 0.00 ? 34  ASP A H    2  
ATOM 2371  H HA   . ASP A 1 34  ? -14.388 7.865   3.870   1.00 0.00 ? 34  ASP A HA   2  
ATOM 2372  H HB2  . ASP A 1 34  ? -12.398 8.808   2.595   1.00 0.00 ? 34  ASP A HB2  2  
ATOM 2373  H HB3  . ASP A 1 34  ? -13.308 8.484   1.122   1.00 0.00 ? 34  ASP A HB3  2  
ATOM 2374  N N    . LYS A 1 35  ? -16.296 8.141   2.002   1.00 0.00 ? 35  LYS A N    2  
ATOM 2375  C CA   . LYS A 1 35  ? -17.551 7.921   1.292   1.00 0.00 ? 35  LYS A CA   2  
ATOM 2376  C C    . LYS A 1 35  ? -17.345 6.993   0.099   1.00 0.00 ? 35  LYS A C    2  
ATOM 2377  O O    . LYS A 1 35  ? -18.199 6.162   -0.207  1.00 0.00 ? 35  LYS A O    2  
ATOM 2378  C CB   . LYS A 1 35  ? -18.134 9.255   0.820   1.00 0.00 ? 35  LYS A CB   2  
ATOM 2379  C CG   . LYS A 1 35  ? -19.414 9.108   0.016   1.00 0.00 ? 35  LYS A CG   2  
ATOM 2380  C CD   . LYS A 1 35  ? -19.707 10.357  -0.798  1.00 0.00 ? 35  LYS A CD   2  
ATOM 2381  C CE   . LYS A 1 35  ? -18.956 10.349  -2.121  1.00 0.00 ? 35  LYS A CE   2  
ATOM 2382  N NZ   . LYS A 1 35  ? -19.091 11.644  -2.843  1.00 0.00 ? 35  LYS A NZ   2  
ATOM 2383  H H    . LYS A 1 35  ? -16.127 9.015   2.414   1.00 0.00 ? 35  LYS A H    2  
ATOM 2384  H HA   . LYS A 1 35  ? -18.243 7.457   1.978   1.00 0.00 ? 35  LYS A HA   2  
ATOM 2385  H HB2  . LYS A 1 35  ? -18.345 9.868   1.684   1.00 0.00 ? 35  LYS A HB2  2  
ATOM 2386  H HB3  . LYS A 1 35  ? -17.402 9.756   0.204   1.00 0.00 ? 35  LYS A HB3  2  
ATOM 2387  H HG2  . LYS A 1 35  ? -19.312 8.269   -0.656  1.00 0.00 ? 35  LYS A HG2  2  
ATOM 2388  H HG3  . LYS A 1 35  ? -20.236 8.930   0.694   1.00 0.00 ? 35  LYS A HG3  2  
ATOM 2389  H HD2  . LYS A 1 35  ? -20.767 10.405  -1.000  1.00 0.00 ? 35  LYS A HD2  2  
ATOM 2390  H HD3  . LYS A 1 35  ? -19.407 11.226  -0.229  1.00 0.00 ? 35  LYS A HD3  2  
ATOM 2391  H HE2  . LYS A 1 35  ? -17.911 10.163  -1.926  1.00 0.00 ? 35  LYS A HE2  2  
ATOM 2392  H HE3  . LYS A 1 35  ? -19.353 9.558   -2.740  1.00 0.00 ? 35  LYS A HE3  2  
ATOM 2393  H HZ1  . LYS A 1 35  ? -18.707 12.418  -2.263  1.00 0.00 ? 35  LYS A HZ1  2  
ATOM 2394  H HZ2  . LYS A 1 35  ? -20.092 11.840  -3.043  1.00 0.00 ? 35  LYS A HZ2  2  
ATOM 2395  H HZ3  . LYS A 1 35  ? -18.570 11.608  -3.743  1.00 0.00 ? 35  LYS A HZ3  2  
ATOM 2396  N N    . ASN A 1 36  ? -16.206 7.140   -0.569  1.00 0.00 ? 36  ASN A N    2  
ATOM 2397  C CA   . ASN A 1 36  ? -15.888 6.314   -1.729  1.00 0.00 ? 36  ASN A CA   2  
ATOM 2398  C C    . ASN A 1 36  ? -14.879 5.230   -1.364  1.00 0.00 ? 36  ASN A C    2  
ATOM 2399  O O    . ASN A 1 36  ? -14.823 4.179   -2.001  1.00 0.00 ? 36  ASN A O    2  
ATOM 2400  C CB   . ASN A 1 36  ? -15.336 7.180   -2.862  1.00 0.00 ? 36  ASN A CB   2  
ATOM 2401  C CG   . ASN A 1 36  ? -16.302 8.272   -3.279  1.00 0.00 ? 36  ASN A CG   2  
ATOM 2402  O OD1  . ASN A 1 36  ? -16.048 9.457   -3.061  1.00 0.00 ? 36  ASN A OD1  2  
ATOM 2403  N ND2  . ASN A 1 36  ? -17.418 7.877   -3.880  1.00 0.00 ? 36  ASN A ND2  2  
ATOM 2404  H H    . ASN A 1 36  ? -15.564 7.820   -0.277  1.00 0.00 ? 36  ASN A H    2  
ATOM 2405  H HA   . ASN A 1 36  ? -16.801 5.842   -2.060  1.00 0.00 ? 36  ASN A HA   2  
ATOM 2406  H HB2  . ASN A 1 36  ? -14.417 7.645   -2.537  1.00 0.00 ? 36  ASN A HB2  2  
ATOM 2407  H HB3  . ASN A 1 36  ? -15.135 6.556   -3.720  1.00 0.00 ? 36  ASN A HB3  2  
ATOM 2408  H HD21 . ASN A 1 36  ? -17.554 6.917   -4.020  1.00 0.00 ? 36  ASN A HD21 2  
ATOM 2409  H HD22 . ASN A 1 36  ? -18.060 8.563   -4.160  1.00 0.00 ? 36  ASN A HD22 2  
ATOM 2410  N N    . GLY A 1 37  ? -14.082 5.493   -0.333  1.00 0.00 ? 37  GLY A N    2  
ATOM 2411  C CA   . GLY A 1 37  ? -13.085 4.531   0.100   1.00 0.00 ? 37  GLY A CA   2  
ATOM 2412  C C    . GLY A 1 37  ? -11.674 4.963   -0.246  1.00 0.00 ? 37  GLY A C    2  
ATOM 2413  O O    . GLY A 1 37  ? -11.475 5.935   -0.976  1.00 0.00 ? 37  GLY A O    2  
ATOM 2414  H H    . GLY A 1 37  ? -14.171 6.348   0.138   1.00 0.00 ? 37  GLY A H    2  
ATOM 2415  H HA2  . GLY A 1 37  ? -13.161 4.407   1.170   1.00 0.00 ? 37  GLY A HA2  2  
ATOM 2416  H HA3  . GLY A 1 37  ? -13.286 3.583   -0.377  1.00 0.00 ? 37  GLY A HA3  2  
ATOM 2417  N N    . LEU A 1 38  ? -10.691 4.241   0.279   1.00 0.00 ? 38  LEU A N    2  
ATOM 2418  C CA   . LEU A 1 38  ? -9.289  4.555   0.023   1.00 0.00 ? 38  LEU A CA   2  
ATOM 2419  C C    . LEU A 1 38  ? -9.069  4.902   -1.446  1.00 0.00 ? 38  LEU A C    2  
ATOM 2420  O O    . LEU A 1 38  ? -9.197  4.048   -2.322  1.00 0.00 ? 38  LEU A O    2  
ATOM 2421  C CB   . LEU A 1 38  ? -8.401  3.375   0.419   1.00 0.00 ? 38  LEU A CB   2  
ATOM 2422  C CG   . LEU A 1 38  ? -8.827  2.603   1.669   1.00 0.00 ? 38  LEU A CG   2  
ATOM 2423  C CD1  . LEU A 1 38  ? -7.768  1.581   2.052   1.00 0.00 ? 38  LEU A CD1  2  
ATOM 2424  C CD2  . LEU A 1 38  ? -9.090  3.560   2.822   1.00 0.00 ? 38  LEU A CD2  2  
ATOM 2425  H H    . LEU A 1 38  ? -10.911 3.478   0.853   1.00 0.00 ? 38  LEU A H    2  
ATOM 2426  H HA   . LEU A 1 38  ? -9.026  5.411   0.626   1.00 0.00 ? 38  LEU A HA   2  
ATOM 2427  H HB2  . LEU A 1 38  ? -8.384  2.681   -0.408  1.00 0.00 ? 38  LEU A HB2  2  
ATOM 2428  H HB3  . LEU A 1 38  ? -7.403  3.755   0.588   1.00 0.00 ? 38  LEU A HB3  2  
ATOM 2429  H HG   . LEU A 1 38  ? -9.744  2.070   1.459   1.00 0.00 ? 38  LEU A HG   2  
ATOM 2430  H HD11 . LEU A 1 38  ? -8.166  0.586   1.925   1.00 0.00 ? 38  LEU A HD11 2  
ATOM 2431  H HD12 . LEU A 1 38  ? -7.485  1.726   3.084   1.00 0.00 ? 38  LEU A HD12 2  
ATOM 2432  H HD13 . LEU A 1 38  ? -6.902  1.706   1.420   1.00 0.00 ? 38  LEU A HD13 2  
ATOM 2433  H HD21 . LEU A 1 38  ? -8.158  4.003   3.141   1.00 0.00 ? 38  LEU A HD21 2  
ATOM 2434  H HD22 . LEU A 1 38  ? -9.530  3.018   3.646   1.00 0.00 ? 38  LEU A HD22 2  
ATOM 2435  H HD23 . LEU A 1 38  ? -9.766  4.337   2.499   1.00 0.00 ? 38  LEU A HD23 2  
ATOM 2436  N N    . GLY A 1 39  ? -8.734  6.162   -1.708  1.00 0.00 ? 39  GLY A N    2  
ATOM 2437  C CA   . GLY A 1 39  ? -8.498  6.599   -3.071  1.00 0.00 ? 39  GLY A CA   2  
ATOM 2438  C C    . GLY A 1 39  ? -7.022  6.728   -3.392  1.00 0.00 ? 39  GLY A C    2  
ATOM 2439  O O    . GLY A 1 39  ? -6.373  7.692   -2.985  1.00 0.00 ? 39  GLY A O    2  
ATOM 2440  H H    . GLY A 1 39  ? -8.646  6.799   -0.969  1.00 0.00 ? 39  GLY A H    2  
ATOM 2441  H HA2  . GLY A 1 39  ? -8.942  5.884   -3.749  1.00 0.00 ? 39  GLY A HA2  2  
ATOM 2442  H HA3  . GLY A 1 39  ? -8.971  7.559   -3.216  1.00 0.00 ? 39  GLY A HA3  2  
ATOM 2443  N N    . LEU A 1 40  ? -6.490  5.755   -4.123  1.00 0.00 ? 40  LEU A N    2  
ATOM 2444  C CA   . LEU A 1 40  ? -5.080  5.763   -4.497  1.00 0.00 ? 40  LEU A CA   2  
ATOM 2445  C C    . LEU A 1 40  ? -4.878  5.131   -5.871  1.00 0.00 ? 40  LEU A C    2  
ATOM 2446  O O    . LEU A 1 40  ? -5.447  4.082   -6.173  1.00 0.00 ? 40  LEU A O    2  
ATOM 2447  C CB   . LEU A 1 40  ? -4.251  5.014   -3.452  1.00 0.00 ? 40  LEU A CB   2  
ATOM 2448  C CG   . LEU A 1 40  ? -4.384  5.507   -2.011  1.00 0.00 ? 40  LEU A CG   2  
ATOM 2449  C CD1  . LEU A 1 40  ? -4.173  4.361   -1.033  1.00 0.00 ? 40  LEU A CD1  2  
ATOM 2450  C CD2  . LEU A 1 40  ? -3.396  6.632   -1.738  1.00 0.00 ? 40  LEU A CD2  2  
ATOM 2451  H H    . LEU A 1 40  ? -7.058  5.013   -4.418  1.00 0.00 ? 40  LEU A H    2  
ATOM 2452  H HA   . LEU A 1 40  ? -4.753  6.791   -4.535  1.00 0.00 ? 40  LEU A HA   2  
ATOM 2453  H HB2  . LEU A 1 40  ? -4.547  3.977   -3.476  1.00 0.00 ? 40  LEU A HB2  2  
ATOM 2454  H HB3  . LEU A 1 40  ? -3.211  5.096   -3.736  1.00 0.00 ? 40  LEU A HB3  2  
ATOM 2455  H HG   . LEU A 1 40  ? -5.383  5.894   -1.860  1.00 0.00 ? 40  LEU A HG   2  
ATOM 2456  H HD11 . LEU A 1 40  ? -3.605  4.712   -0.185  1.00 0.00 ? 40  LEU A HD11 2  
ATOM 2457  H HD12 . LEU A 1 40  ? -3.634  3.564   -1.524  1.00 0.00 ? 40  LEU A HD12 2  
ATOM 2458  H HD13 . LEU A 1 40  ? -5.132  3.993   -0.698  1.00 0.00 ? 40  LEU A HD13 2  
ATOM 2459  H HD21 . LEU A 1 40  ? -3.864  7.377   -1.111  1.00 0.00 ? 40  LEU A HD21 2  
ATOM 2460  H HD22 . LEU A 1 40  ? -3.098  7.084   -2.673  1.00 0.00 ? 40  LEU A HD22 2  
ATOM 2461  H HD23 . LEU A 1 40  ? -2.527  6.234   -1.237  1.00 0.00 ? 40  LEU A HD23 2  
ATOM 2462  N N    . SER A 1 41  ? -4.062  5.776   -6.699  1.00 0.00 ? 41  SER A N    2  
ATOM 2463  C CA   . SER A 1 41  ? -3.785  5.279   -8.041  1.00 0.00 ? 41  SER A CA   2  
ATOM 2464  C C    . SER A 1 41  ? -2.619  4.295   -8.027  1.00 0.00 ? 41  SER A C    2  
ATOM 2465  O O    . SER A 1 41  ? -1.487  4.661   -7.709  1.00 0.00 ? 41  SER A O    2  
ATOM 2466  C CB   . SER A 1 41  ? -3.474  6.442   -8.985  1.00 0.00 ? 41  SER A CB   2  
ATOM 2467  O OG   . SER A 1 41  ? -4.629  7.227   -9.225  1.00 0.00 ? 41  SER A OG   2  
ATOM 2468  H H    . SER A 1 41  ? -3.638  6.608   -6.400  1.00 0.00 ? 41  SER A H    2  
ATOM 2469  H HA   . SER A 1 41  ? -4.668  4.767   -8.393  1.00 0.00 ? 41  SER A HA   2  
ATOM 2470  H HB2  . SER A 1 41  ? -2.714  7.068   -8.542  1.00 0.00 ? 41  SER A HB2  2  
ATOM 2471  H HB3  . SER A 1 41  ? -3.116  6.052   -9.927  1.00 0.00 ? 41  SER A HB3  2  
ATOM 2472  H HG   . SER A 1 41  ? -4.972  7.556   -8.391  1.00 0.00 ? 41  SER A HG   2  
ATOM 2473  N N    . LEU A 1 42  ? -2.904  3.044   -8.372  1.00 0.00 ? 42  LEU A N    2  
ATOM 2474  C CA   . LEU A 1 42  ? -1.880  2.006   -8.400  1.00 0.00 ? 42  LEU A CA   2  
ATOM 2475  C C    . LEU A 1 42  ? -1.406  1.746   -9.826  1.00 0.00 ? 42  LEU A C    2  
ATOM 2476  O O    . LEU A 1 42  ? -2.152  1.944   -10.784 1.00 0.00 ? 42  LEU A O    2  
ATOM 2477  C CB   . LEU A 1 42  ? -2.420  0.713   -7.786  1.00 0.00 ? 42  LEU A CB   2  
ATOM 2478  C CG   . LEU A 1 42  ? -3.161  0.860   -6.456  1.00 0.00 ? 42  LEU A CG   2  
ATOM 2479  C CD1  . LEU A 1 42  ? -3.644  -0.495  -5.962  1.00 0.00 ? 42  LEU A CD1  2  
ATOM 2480  C CD2  . LEU A 1 42  ? -2.266  1.520   -5.417  1.00 0.00 ? 42  LEU A CD2  2  
ATOM 2481  H H    . LEU A 1 42  ? -3.824  2.813   -8.615  1.00 0.00 ? 42  LEU A H    2  
ATOM 2482  H HA   . LEU A 1 42  ? -1.042  2.351   -7.812  1.00 0.00 ? 42  LEU A HA   2  
ATOM 2483  H HB2  . LEU A 1 42  ? -3.101  0.269   -8.496  1.00 0.00 ? 42  LEU A HB2  2  
ATOM 2484  H HB3  . LEU A 1 42  ? -1.583  0.048   -7.628  1.00 0.00 ? 42  LEU A HB3  2  
ATOM 2485  H HG   . LEU A 1 42  ? -4.027  1.490   -6.601  1.00 0.00 ? 42  LEU A HG   2  
ATOM 2486  H HD11 . LEU A 1 42  ? -4.450  -0.841  -6.592  1.00 0.00 ? 42  LEU A HD11 2  
ATOM 2487  H HD12 . LEU A 1 42  ? -3.996  -0.402  -4.945  1.00 0.00 ? 42  LEU A HD12 2  
ATOM 2488  H HD13 . LEU A 1 42  ? -2.829  -1.203  -5.997  1.00 0.00 ? 42  LEU A HD13 2  
ATOM 2489  H HD21 . LEU A 1 42  ? -2.867  1.854   -4.585  1.00 0.00 ? 42  LEU A HD21 2  
ATOM 2490  H HD22 . LEU A 1 42  ? -1.764  2.367   -5.861  1.00 0.00 ? 42  LEU A HD22 2  
ATOM 2491  H HD23 . LEU A 1 42  ? -1.533  0.808   -5.069  1.00 0.00 ? 42  LEU A HD23 2  
ATOM 2492  N N    . ALA A 1 43  ? -0.162  1.298   -9.958  1.00 0.00 ? 43  ALA A N    2  
ATOM 2493  C CA   . ALA A 1 43  ? 0.410   1.007   -11.267 1.00 0.00 ? 43  ALA A CA   2  
ATOM 2494  C C    . ALA A 1 43  ? 1.514   -0.041  -11.163 1.00 0.00 ? 43  ALA A C    2  
ATOM 2495  O O    . ALA A 1 43  ? 2.324   -0.012  -10.238 1.00 0.00 ? 43  ALA A O    2  
ATOM 2496  C CB   . ALA A 1 43  ? 0.947   2.280   -11.904 1.00 0.00 ? 43  ALA A CB   2  
ATOM 2497  H H    . ALA A 1 43  ? 0.384   1.160   -9.157  1.00 0.00 ? 43  ALA A H    2  
ATOM 2498  H HA   . ALA A 1 43  ? -0.379  0.622   -11.898 1.00 0.00 ? 43  ALA A HA   2  
ATOM 2499  H HB1  . ALA A 1 43  ? 1.888   2.543   -11.443 1.00 0.00 ? 43  ALA A HB1  2  
ATOM 2500  H HB2  . ALA A 1 43  ? 1.095   2.118   -12.961 1.00 0.00 ? 43  ALA A HB2  2  
ATOM 2501  H HB3  . ALA A 1 43  ? 0.238   3.081   -11.758 1.00 0.00 ? 43  ALA A HB3  2  
ATOM 2502  N N    . GLY A 1 44  ? 1.538   -0.965  -12.118 1.00 0.00 ? 44  GLY A N    2  
ATOM 2503  C CA   . GLY A 1 44  ? 2.546   -2.009  -12.114 1.00 0.00 ? 44  GLY A CA   2  
ATOM 2504  C C    . GLY A 1 44  ? 3.943   -1.468  -12.343 1.00 0.00 ? 44  GLY A C    2  
ATOM 2505  O O    . GLY A 1 44  ? 4.111   -0.374  -12.881 1.00 0.00 ? 44  GLY A O    2  
ATOM 2506  H H    . GLY A 1 44  ? 0.866   -0.938  -12.831 1.00 0.00 ? 44  GLY A H    2  
ATOM 2507  H HA2  . GLY A 1 44  ? 2.519   -2.517  -11.161 1.00 0.00 ? 44  GLY A HA2  2  
ATOM 2508  H HA3  . GLY A 1 44  ? 2.315   -2.719  -12.895 1.00 0.00 ? 44  GLY A HA3  2  
ATOM 2509  N N    . ASN A 1 45  ? 4.948   -2.234  -11.933 1.00 0.00 ? 45  ASN A N    2  
ATOM 2510  C CA   . ASN A 1 45  ? 6.338   -1.823  -12.095 1.00 0.00 ? 45  ASN A CA   2  
ATOM 2511  C C    . ASN A 1 45  ? 6.681   -1.632  -13.569 1.00 0.00 ? 45  ASN A C    2  
ATOM 2512  O O    . ASN A 1 45  ? 6.164   -2.339  -14.435 1.00 0.00 ? 45  ASN A O    2  
ATOM 2513  C CB   . ASN A 1 45  ? 7.274   -2.861  -11.472 1.00 0.00 ? 45  ASN A CB   2  
ATOM 2514  C CG   . ASN A 1 45  ? 8.722   -2.412  -11.480 1.00 0.00 ? 45  ASN A CG   2  
ATOM 2515  O OD1  . ASN A 1 45  ? 9.222   -1.909  -12.486 1.00 0.00 ? 45  ASN A OD1  2  
ATOM 2516  N ND2  . ASN A 1 45  ? 9.404   -2.594  -10.355 1.00 0.00 ? 45  ASN A ND2  2  
ATOM 2517  H H    . ASN A 1 45  ? 4.751   -3.097  -11.511 1.00 0.00 ? 45  ASN A H    2  
ATOM 2518  H HA   . ASN A 1 45  ? 6.467   -0.882  -11.582 1.00 0.00 ? 45  ASN A HA   2  
ATOM 2519  H HB2  . ASN A 1 45  ? 6.977   -3.036  -10.448 1.00 0.00 ? 45  ASN A HB2  2  
ATOM 2520  H HB3  . ASN A 1 45  ? 7.199   -3.784  -12.027 1.00 0.00 ? 45  ASN A HB3  2  
ATOM 2521  H HD21 . ASN A 1 45  ? 8.941   -3.002  -9.594  1.00 0.00 ? 45  ASN A HD21 2  
ATOM 2522  H HD22 . ASN A 1 45  ? 10.342  -2.312  -10.333 1.00 0.00 ? 45  ASN A HD22 2  
ATOM 2523  N N    . LYS A 1 46  ? 7.556   -0.672  -13.848 1.00 0.00 ? 46  LYS A N    2  
ATOM 2524  C CA   . LYS A 1 46  ? 7.971   -0.388  -15.216 1.00 0.00 ? 46  LYS A CA   2  
ATOM 2525  C C    . LYS A 1 46  ? 8.027   -1.668  -16.045 1.00 0.00 ? 46  LYS A C    2  
ATOM 2526  O O    . LYS A 1 46  ? 7.499   -1.722  -17.156 1.00 0.00 ? 46  LYS A O    2  
ATOM 2527  C CB   . LYS A 1 46  ? 9.338   0.298   -15.224 1.00 0.00 ? 46  LYS A CB   2  
ATOM 2528  C CG   . LYS A 1 46  ? 9.261   1.811   -15.119 1.00 0.00 ? 46  LYS A CG   2  
ATOM 2529  C CD   . LYS A 1 46  ? 10.617  2.418   -14.803 1.00 0.00 ? 46  LYS A CD   2  
ATOM 2530  C CE   . LYS A 1 46  ? 10.581  3.937   -14.887 1.00 0.00 ? 46  LYS A CE   2  
ATOM 2531  N NZ   . LYS A 1 46  ? 10.489  4.412   -16.295 1.00 0.00 ? 46  LYS A NZ   2  
ATOM 2532  H H    . LYS A 1 46  ? 7.933   -0.142  -13.114 1.00 0.00 ? 46  LYS A H    2  
ATOM 2533  H HA   . LYS A 1 46  ? 7.241   0.277   -15.653 1.00 0.00 ? 46  LYS A HA   2  
ATOM 2534  H HB2  . LYS A 1 46  ? 9.918   -0.071  -14.391 1.00 0.00 ? 46  LYS A HB2  2  
ATOM 2535  H HB3  . LYS A 1 46  ? 9.848   0.048   -16.144 1.00 0.00 ? 46  LYS A HB3  2  
ATOM 2536  H HG2  . LYS A 1 46  ? 8.910   2.211   -16.059 1.00 0.00 ? 46  LYS A HG2  2  
ATOM 2537  H HG3  . LYS A 1 46  ? 8.567   2.073   -14.333 1.00 0.00 ? 46  LYS A HG3  2  
ATOM 2538  H HD2  . LYS A 1 46  ? 10.906  2.132   -13.802 1.00 0.00 ? 46  LYS A HD2  2  
ATOM 2539  H HD3  . LYS A 1 46  ? 11.343  2.044   -15.510 1.00 0.00 ? 46  LYS A HD3  2  
ATOM 2540  H HE2  . LYS A 1 46  ? 9.724   4.295   -14.338 1.00 0.00 ? 46  LYS A HE2  2  
ATOM 2541  H HE3  . LYS A 1 46  ? 11.483  4.330   -14.441 1.00 0.00 ? 46  LYS A HE3  2  
ATOM 2542  H HZ1  . LYS A 1 46  ? 10.700  5.430   -16.342 1.00 0.00 ? 46  LYS A HZ1  2  
ATOM 2543  H HZ2  . LYS A 1 46  ? 9.530   4.251   -16.664 1.00 0.00 ? 46  LYS A HZ2  2  
ATOM 2544  H HZ3  . LYS A 1 46  ? 11.169  3.900   -16.891 1.00 0.00 ? 46  LYS A HZ3  2  
ATOM 2545  N N    . ASP A 1 47  ? 8.667   -2.694  -15.496 1.00 0.00 ? 47  ASP A N    2  
ATOM 2546  C CA   . ASP A 1 47  ? 8.790   -3.974  -16.184 1.00 0.00 ? 47  ASP A CA   2  
ATOM 2547  C C    . ASP A 1 47  ? 7.639   -4.904  -15.811 1.00 0.00 ? 47  ASP A C    2  
ATOM 2548  O O    . ASP A 1 47  ? 7.596   -5.442  -14.705 1.00 0.00 ? 47  ASP A O    2  
ATOM 2549  C CB   . ASP A 1 47  ? 10.126  -4.635  -15.842 1.00 0.00 ? 47  ASP A CB   2  
ATOM 2550  C CG   . ASP A 1 47  ? 11.306  -3.903  -16.451 1.00 0.00 ? 47  ASP A CG   2  
ATOM 2551  O OD1  . ASP A 1 47  ? 11.225  -3.533  -17.641 1.00 0.00 ? 47  ASP A OD1  2  
ATOM 2552  O OD2  . ASP A 1 47  ? 12.311  -3.701  -15.738 1.00 0.00 ? 47  ASP A OD2  2  
ATOM 2553  H H    . ASP A 1 47  ? 9.067   -2.589  -14.607 1.00 0.00 ? 47  ASP A H    2  
ATOM 2554  H HA   . ASP A 1 47  ? 8.753   -3.785  -17.246 1.00 0.00 ? 47  ASP A HA   2  
ATOM 2555  H HB2  . ASP A 1 47  ? 10.250  -4.649  -14.769 1.00 0.00 ? 47  ASP A HB2  2  
ATOM 2556  H HB3  . ASP A 1 47  ? 10.124  -5.649  -16.214 1.00 0.00 ? 47  ASP A HB3  2  
ATOM 2557  N N    . ARG A 1 48  ? 6.707   -5.086  -16.741 1.00 0.00 ? 48  ARG A N    2  
ATOM 2558  C CA   . ARG A 1 48  ? 5.555   -5.948  -16.510 1.00 0.00 ? 48  ARG A CA   2  
ATOM 2559  C C    . ARG A 1 48  ? 5.975   -7.246  -15.827 1.00 0.00 ? 48  ARG A C    2  
ATOM 2560  O O    . ARG A 1 48  ? 5.433   -7.615  -14.785 1.00 0.00 ? 48  ARG A O    2  
ATOM 2561  C CB   . ARG A 1 48  ? 4.850   -6.260  -17.831 1.00 0.00 ? 48  ARG A CB   2  
ATOM 2562  C CG   . ARG A 1 48  ? 3.370   -6.569  -17.674 1.00 0.00 ? 48  ARG A CG   2  
ATOM 2563  C CD   . ARG A 1 48  ? 2.528   -5.303  -17.725 1.00 0.00 ? 48  ARG A CD   2  
ATOM 2564  N NE   . ARG A 1 48  ? 1.185   -5.518  -17.193 1.00 0.00 ? 48  ARG A NE   2  
ATOM 2565  C CZ   . ARG A 1 48  ? 0.182   -4.664  -17.363 1.00 0.00 ? 48  ARG A CZ   2  
ATOM 2566  N NH1  . ARG A 1 48  ? 0.370   -3.543  -18.046 1.00 0.00 ? 48  ARG A NH1  2  
ATOM 2567  N NH2  . ARG A 1 48  ? -1.012  -4.929  -16.848 1.00 0.00 ? 48  ARG A NH2  2  
ATOM 2568  H H    . ARG A 1 48  ? 6.797   -4.629  -17.604 1.00 0.00 ? 48  ARG A H    2  
ATOM 2569  H HA   . ARG A 1 48  ? 4.870   -5.420  -15.863 1.00 0.00 ? 48  ARG A HA   2  
ATOM 2570  H HB2  . ARG A 1 48  ? 4.949   -5.408  -18.488 1.00 0.00 ? 48  ARG A HB2  2  
ATOM 2571  H HB3  . ARG A 1 48  ? 5.328   -7.114  -18.287 1.00 0.00 ? 48  ARG A HB3  2  
ATOM 2572  H HG2  . ARG A 1 48  ? 3.062   -7.225  -18.475 1.00 0.00 ? 48  ARG A HG2  2  
ATOM 2573  H HG3  . ARG A 1 48  ? 3.213   -7.058  -16.725 1.00 0.00 ? 48  ARG A HG3  2  
ATOM 2574  H HD2  . ARG A 1 48  ? 3.018   -4.538  -17.142 1.00 0.00 ? 48  ARG A HD2  2  
ATOM 2575  H HD3  . ARG A 1 48  ? 2.452   -4.979  -18.752 1.00 0.00 ? 48  ARG A HD3  2  
ATOM 2576  H HE   . ARG A 1 48  ? 1.024   -6.340  -16.685 1.00 0.00 ? 48  ARG A HE   2  
ATOM 2577  H HH11 . ARG A 1 48  ? 1.269   -3.341  -18.436 1.00 0.00 ? 48  ARG A HH11 2  
ATOM 2578  H HH12 . ARG A 1 48  ? -0.387  -2.902  -18.174 1.00 0.00 ? 48  ARG A HH12 2  
ATOM 2579  H HH21 . ARG A 1 48  ? -1.157  -5.773  -16.333 1.00 0.00 ? 48  ARG A HH21 2  
ATOM 2580  H HH22 . ARG A 1 48  ? -1.765  -4.286  -16.976 1.00 0.00 ? 48  ARG A HH22 2  
ATOM 2581  N N    . SER A 1 49  ? 6.945   -7.934  -16.421 1.00 0.00 ? 49  SER A N    2  
ATOM 2582  C CA   . SER A 1 49  ? 7.435   -9.193  -15.873 1.00 0.00 ? 49  SER A CA   2  
ATOM 2583  C C    . SER A 1 49  ? 7.422   -9.163  -14.347 1.00 0.00 ? 49  SER A C    2  
ATOM 2584  O O    . SER A 1 49  ? 7.081   -10.153 -13.699 1.00 0.00 ? 49  SER A O    2  
ATOM 2585  C CB   . SER A 1 49  ? 8.852   -9.476  -16.376 1.00 0.00 ? 49  SER A CB   2  
ATOM 2586  O OG   . SER A 1 49  ? 9.310   -10.739 -15.928 1.00 0.00 ? 49  SER A OG   2  
ATOM 2587  H H    . SER A 1 49  ? 7.338   -7.588  -17.249 1.00 0.00 ? 49  SER A H    2  
ATOM 2588  H HA   . SER A 1 49  ? 6.779   -9.981  -16.211 1.00 0.00 ? 49  SER A HA   2  
ATOM 2589  H HB2  . SER A 1 49  ? 8.856   -9.467  -17.455 1.00 0.00 ? 49  SER A HB2  2  
ATOM 2590  H HB3  . SER A 1 49  ? 9.521   -8.712  -16.007 1.00 0.00 ? 49  SER A HB3  2  
ATOM 2591  H HG   . SER A 1 49  ? 8.963   -10.913 -15.049 1.00 0.00 ? 49  SER A HG   2  
ATOM 2592  N N    . ARG A 1 50  ? 7.795   -8.020  -13.781 1.00 0.00 ? 50  ARG A N    2  
ATOM 2593  C CA   . ARG A 1 50  ? 7.828   -7.861  -12.332 1.00 0.00 ? 50  ARG A CA   2  
ATOM 2594  C C    . ARG A 1 50  ? 6.432   -7.575  -11.785 1.00 0.00 ? 50  ARG A C    2  
ATOM 2595  O O    . ARG A 1 50  ? 5.671   -6.805  -12.370 1.00 0.00 ? 50  ARG A O    2  
ATOM 2596  C CB   . ARG A 1 50  ? 8.781   -6.729  -11.944 1.00 0.00 ? 50  ARG A CB   2  
ATOM 2597  C CG   . ARG A 1 50  ? 10.211  -7.189  -11.715 1.00 0.00 ? 50  ARG A CG   2  
ATOM 2598  C CD   . ARG A 1 50  ? 11.061  -6.083  -11.108 1.00 0.00 ? 50  ARG A CD   2  
ATOM 2599  N NE   . ARG A 1 50  ? 12.128  -6.614  -10.263 1.00 0.00 ? 50  ARG A NE   2  
ATOM 2600  C CZ   . ARG A 1 50  ? 11.912  -7.217  -9.099  1.00 0.00 ? 50  ARG A CZ   2  
ATOM 2601  N NH1  . ARG A 1 50  ? 10.675  -7.365  -8.645  1.00 0.00 ? 50  ARG A NH1  2  
ATOM 2602  N NH2  . ARG A 1 50  ? 12.935  -7.674  -8.388  1.00 0.00 ? 50  ARG A NH2  2  
ATOM 2603  H H    . ARG A 1 50  ? 8.056   -7.267  -14.351 1.00 0.00 ? 50  ARG A H    2  
ATOM 2604  H HA   . ARG A 1 50  ? 8.187   -8.785  -11.904 1.00 0.00 ? 50  ARG A HA   2  
ATOM 2605  H HB2  . ARG A 1 50  ? 8.785   -5.991  -12.733 1.00 0.00 ? 50  ARG A HB2  2  
ATOM 2606  H HB3  . ARG A 1 50  ? 8.423   -6.270  -11.034 1.00 0.00 ? 50  ARG A HB3  2  
ATOM 2607  H HG2  . ARG A 1 50  ? 10.205  -8.033  -11.041 1.00 0.00 ? 50  ARG A HG2  2  
ATOM 2608  H HG3  . ARG A 1 50  ? 10.641  -7.483  -12.661 1.00 0.00 ? 50  ARG A HG3  2  
ATOM 2609  H HD2  . ARG A 1 50  ? 11.502  -5.506  -11.907 1.00 0.00 ? 50  ARG A HD2  2  
ATOM 2610  H HD3  . ARG A 1 50  ? 10.426  -5.445  -10.512 1.00 0.00 ? 50  ARG A HD3  2  
ATOM 2611  H HE   . ARG A 1 50  ? 13.049  -6.516  -10.580 1.00 0.00 ? 50  ARG A HE   2  
ATOM 2612  H HH11 . ARG A 1 50  ? 9.903   -7.023  -9.179  1.00 0.00 ? 50  ARG A HH11 2  
ATOM 2613  H HH12 . ARG A 1 50  ? 10.515  -7.820  -7.769  1.00 0.00 ? 50  ARG A HH12 2  
ATOM 2614  H HH21 . ARG A 1 50  ? 13.868  -7.564  -8.727  1.00 0.00 ? 50  ARG A HH21 2  
ATOM 2615  H HH22 . ARG A 1 50  ? 12.771  -8.127  -7.512  1.00 0.00 ? 50  ARG A HH22 2  
ATOM 2616  N N    . MET A 1 51  ? 6.104   -8.202  -10.660 1.00 0.00 ? 51  MET A N    2  
ATOM 2617  C CA   . MET A 1 51  ? 4.800   -8.014  -10.034 1.00 0.00 ? 51  MET A CA   2  
ATOM 2618  C C    . MET A 1 51  ? 4.925   -7.202  -8.749  1.00 0.00 ? 51  MET A C    2  
ATOM 2619  O O    . MET A 1 51  ? 5.342   -7.721  -7.714  1.00 0.00 ? 51  MET A O    2  
ATOM 2620  C CB   . MET A 1 51  ? 4.155   -9.369  -9.734  1.00 0.00 ? 51  MET A CB   2  
ATOM 2621  C CG   . MET A 1 51  ? 2.713   -9.264  -9.265  1.00 0.00 ? 51  MET A CG   2  
ATOM 2622  S SD   . MET A 1 51  ? 1.689   -8.285  -10.380 1.00 0.00 ? 51  MET A SD   2  
ATOM 2623  C CE   . MET A 1 51  ? 1.675   -9.331  -11.834 1.00 0.00 ? 51  MET A CE   2  
ATOM 2624  H H    . MET A 1 51  ? 6.753   -8.804  -10.240 1.00 0.00 ? 51  MET A H    2  
ATOM 2625  H HA   . MET A 1 51  ? 4.174   -7.474  -10.728 1.00 0.00 ? 51  MET A HA   2  
ATOM 2626  H HB2  . MET A 1 51  ? 4.177   -9.971  -10.630 1.00 0.00 ? 51  MET A HB2  2  
ATOM 2627  H HB3  . MET A 1 51  ? 4.726   -9.864  -8.963  1.00 0.00 ? 51  MET A HB3  2  
ATOM 2628  H HG2  . MET A 1 51  ? 2.296   -10.259 -9.199  1.00 0.00 ? 51  MET A HG2  2  
ATOM 2629  H HG3  . MET A 1 51  ? 2.699   -8.805  -8.288  1.00 0.00 ? 51  MET A HG3  2  
ATOM 2630  H HE1  . MET A 1 51  ? 2.032   -10.316 -11.573 1.00 0.00 ? 51  MET A HE1  2  
ATOM 2631  H HE2  . MET A 1 51  ? 0.667   -9.403  -12.216 1.00 0.00 ? 51  MET A HE2  2  
ATOM 2632  H HE3  . MET A 1 51  ? 2.317   -8.903  -12.591 1.00 0.00 ? 51  MET A HE3  2  
ATOM 2633  N N    . SER A 1 52  ? 4.562   -5.925  -8.824  1.00 0.00 ? 52  SER A N    2  
ATOM 2634  C CA   . SER A 1 52  ? 4.639   -5.040  -7.667  1.00 0.00 ? 52  SER A CA   2  
ATOM 2635  C C    . SER A 1 52  ? 3.589   -3.937  -7.758  1.00 0.00 ? 52  SER A C    2  
ATOM 2636  O O    . SER A 1 52  ? 3.220   -3.504  -8.850  1.00 0.00 ? 52  SER A O    2  
ATOM 2637  C CB   . SER A 1 52  ? 6.035   -4.425  -7.561  1.00 0.00 ? 52  SER A CB   2  
ATOM 2638  O OG   . SER A 1 52  ? 6.892   -5.236  -6.776  1.00 0.00 ? 52  SER A OG   2  
ATOM 2639  H H    . SER A 1 52  ? 4.238   -5.570  -9.678  1.00 0.00 ? 52  SER A H    2  
ATOM 2640  H HA   . SER A 1 52  ? 4.447   -5.632  -6.784  1.00 0.00 ? 52  SER A HA   2  
ATOM 2641  H HB2  . SER A 1 52  ? 6.458   -4.326  -8.549  1.00 0.00 ? 52  SER A HB2  2  
ATOM 2642  H HB3  . SER A 1 52  ? 5.961   -3.449  -7.102  1.00 0.00 ? 52  SER A HB3  2  
ATOM 2643  H HG   . SER A 1 52  ? 7.746   -5.311  -7.208  1.00 0.00 ? 52  SER A HG   2  
ATOM 2644  N N    . ILE A 1 53  ? 3.113   -3.486  -6.602  1.00 0.00 ? 53  ILE A N    2  
ATOM 2645  C CA   . ILE A 1 53  ? 2.107   -2.432  -6.550  1.00 0.00 ? 53  ILE A CA   2  
ATOM 2646  C C    . ILE A 1 53  ? 2.676   -1.159  -5.934  1.00 0.00 ? 53  ILE A C    2  
ATOM 2647  O O    . ILE A 1 53  ? 3.366   -1.204  -4.915  1.00 0.00 ? 53  ILE A O    2  
ATOM 2648  C CB   . ILE A 1 53  ? 0.872   -2.873  -5.742  1.00 0.00 ? 53  ILE A CB   2  
ATOM 2649  C CG1  . ILE A 1 53  ? 0.332   -4.200  -6.278  1.00 0.00 ? 53  ILE A CG1  2  
ATOM 2650  C CG2  . ILE A 1 53  ? -0.204  -1.798  -5.792  1.00 0.00 ? 53  ILE A CG2  2  
ATOM 2651  C CD1  . ILE A 1 53  ? -0.454  -4.990  -5.255  1.00 0.00 ? 53  ILE A CD1  2  
ATOM 2652  H H    . ILE A 1 53  ? 3.446   -3.870  -5.765  1.00 0.00 ? 53  ILE A H    2  
ATOM 2653  H HA   . ILE A 1 53  ? 1.794   -2.221  -7.562  1.00 0.00 ? 53  ILE A HA   2  
ATOM 2654  H HB   . ILE A 1 53  ? 1.170   -3.002  -4.713  1.00 0.00 ? 53  ILE A HB   2  
ATOM 2655  H HG12 . ILE A 1 53  ? -0.318  -4.005  -7.116  1.00 0.00 ? 53  ILE A HG12 2  
ATOM 2656  H HG13 . ILE A 1 53  ? 1.161   -4.812  -6.605  1.00 0.00 ? 53  ILE A HG13 2  
ATOM 2657  H HG21 . ILE A 1 53  ? -0.854  -1.899  -4.935  1.00 0.00 ? 53  ILE A HG21 2  
ATOM 2658  H HG22 . ILE A 1 53  ? 0.260   -0.824  -5.778  1.00 0.00 ? 53  ILE A HG22 2  
ATOM 2659  H HG23 . ILE A 1 53  ? -0.782  -1.909  -6.697  1.00 0.00 ? 53  ILE A HG23 2  
ATOM 2660  H HD11 . ILE A 1 53  ? -1.142  -5.651  -5.760  1.00 0.00 ? 53  ILE A HD11 2  
ATOM 2661  H HD12 . ILE A 1 53  ? 0.225   -5.571  -4.649  1.00 0.00 ? 53  ILE A HD12 2  
ATOM 2662  H HD13 . ILE A 1 53  ? -1.008  -4.310  -4.623  1.00 0.00 ? 53  ILE A HD13 2  
ATOM 2663  N N    . PHE A 1 54  ? 2.381   -0.023  -6.557  1.00 0.00 ? 54  PHE A N    2  
ATOM 2664  C CA   . PHE A 1 54  ? 2.862   1.264   -6.069  1.00 0.00 ? 54  PHE A CA   2  
ATOM 2665  C C    . PHE A 1 54  ? 1.729   2.284   -6.016  1.00 0.00 ? 54  PHE A C    2  
ATOM 2666  O O    . PHE A 1 54  ? 0.591   1.984   -6.379  1.00 0.00 ? 54  PHE A O    2  
ATOM 2667  C CB   . PHE A 1 54  ? 3.989   1.784   -6.965  1.00 0.00 ? 54  PHE A CB   2  
ATOM 2668  C CG   . PHE A 1 54  ? 5.169   0.858   -7.041  1.00 0.00 ? 54  PHE A CG   2  
ATOM 2669  C CD1  . PHE A 1 54  ? 6.021   0.709   -5.958  1.00 0.00 ? 54  PHE A CD1  2  
ATOM 2670  C CD2  . PHE A 1 54  ? 5.427   0.136   -8.195  1.00 0.00 ? 54  PHE A CD2  2  
ATOM 2671  C CE1  . PHE A 1 54  ? 7.108   -0.142  -6.024  1.00 0.00 ? 54  PHE A CE1  2  
ATOM 2672  C CE2  . PHE A 1 54  ? 6.512   -0.717  -8.267  1.00 0.00 ? 54  PHE A CE2  2  
ATOM 2673  C CZ   . PHE A 1 54  ? 7.354   -0.855  -7.181  1.00 0.00 ? 54  PHE A CZ   2  
ATOM 2674  H H    . PHE A 1 54  ? 1.826   -0.051  -7.365  1.00 0.00 ? 54  PHE A H    2  
ATOM 2675  H HA   . PHE A 1 54  ? 3.245   1.117   -5.071  1.00 0.00 ? 54  PHE A HA   2  
ATOM 2676  H HB2  . PHE A 1 54  ? 3.610   1.919   -7.966  1.00 0.00 ? 54  PHE A HB2  2  
ATOM 2677  H HB3  . PHE A 1 54  ? 4.334   2.733   -6.583  1.00 0.00 ? 54  PHE A HB3  2  
ATOM 2678  H HD1  . PHE A 1 54  ? 5.829   1.268   -5.052  1.00 0.00 ? 54  PHE A HD1  2  
ATOM 2679  H HD2  . PHE A 1 54  ? 4.770   0.244   -9.046  1.00 0.00 ? 54  PHE A HD2  2  
ATOM 2680  H HE1  . PHE A 1 54  ? 7.764   -0.247  -5.173  1.00 0.00 ? 54  PHE A HE1  2  
ATOM 2681  H HE2  . PHE A 1 54  ? 6.703   -1.273  -9.173  1.00 0.00 ? 54  PHE A HE2  2  
ATOM 2682  H HZ   . PHE A 1 54  ? 8.202   -1.521  -7.235  1.00 0.00 ? 54  PHE A HZ   2  
ATOM 2683  N N    . VAL A 1 55  ? 2.048   3.491   -5.561  1.00 0.00 ? 55  VAL A N    2  
ATOM 2684  C CA   . VAL A 1 55  ? 1.057   4.557   -5.460  1.00 0.00 ? 55  VAL A CA   2  
ATOM 2685  C C    . VAL A 1 55  ? 1.433   5.741   -6.343  1.00 0.00 ? 55  VAL A C    2  
ATOM 2686  O O    . VAL A 1 55  ? 2.102   6.674   -5.899  1.00 0.00 ? 55  VAL A O    2  
ATOM 2687  C CB   . VAL A 1 55  ? 0.902   5.043   -4.007  1.00 0.00 ? 55  VAL A CB   2  
ATOM 2688  C CG1  . VAL A 1 55  ? 0.043   6.297   -3.952  1.00 0.00 ? 55  VAL A CG1  2  
ATOM 2689  C CG2  . VAL A 1 55  ? 0.312   3.943   -3.137  1.00 0.00 ? 55  VAL A CG2  2  
ATOM 2690  H H    . VAL A 1 55  ? 2.971   3.670   -5.287  1.00 0.00 ? 55  VAL A H    2  
ATOM 2691  H HA   . VAL A 1 55  ? 0.107   4.162   -5.788  1.00 0.00 ? 55  VAL A HA   2  
ATOM 2692  H HB   . VAL A 1 55  ? 1.882   5.289   -3.624  1.00 0.00 ? 55  VAL A HB   2  
ATOM 2693  H HG11 . VAL A 1 55  ? -0.421  6.457   -4.914  1.00 0.00 ? 55  VAL A HG11 2  
ATOM 2694  H HG12 . VAL A 1 55  ? -0.721  6.177   -3.198  1.00 0.00 ? 55  VAL A HG12 2  
ATOM 2695  H HG13 . VAL A 1 55  ? 0.662   7.147   -3.706  1.00 0.00 ? 55  VAL A HG13 2  
ATOM 2696  H HG21 . VAL A 1 55  ? -0.711  4.188   -2.894  1.00 0.00 ? 55  VAL A HG21 2  
ATOM 2697  H HG22 . VAL A 1 55  ? 0.340   3.006   -3.673  1.00 0.00 ? 55  VAL A HG22 2  
ATOM 2698  H HG23 . VAL A 1 55  ? 0.887   3.855   -2.228  1.00 0.00 ? 55  VAL A HG23 2  
ATOM 2699  N N    . VAL A 1 56  ? 0.996   5.698   -7.598  1.00 0.00 ? 56  VAL A N    2  
ATOM 2700  C CA   . VAL A 1 56  ? 1.285   6.769   -8.545  1.00 0.00 ? 56  VAL A CA   2  
ATOM 2701  C C    . VAL A 1 56  ? 0.239   7.874   -8.460  1.00 0.00 ? 56  VAL A C    2  
ATOM 2702  O O    . VAL A 1 56  ? 0.050   8.639   -9.405  1.00 0.00 ? 56  VAL A O    2  
ATOM 2703  C CB   . VAL A 1 56  ? 1.340   6.240   -9.991  1.00 0.00 ? 56  VAL A CB   2  
ATOM 2704  C CG1  . VAL A 1 56  ? 2.312   5.075   -10.097 1.00 0.00 ? 56  VAL A CG1  2  
ATOM 2705  C CG2  . VAL A 1 56  ? -0.048  5.831   -10.461 1.00 0.00 ? 56  VAL A CG2  2  
ATOM 2706  H H    . VAL A 1 56  ? 0.467   4.928   -7.894  1.00 0.00 ? 56  VAL A H    2  
ATOM 2707  H HA   . VAL A 1 56  ? 2.252   7.181   -8.298  1.00 0.00 ? 56  VAL A HA   2  
ATOM 2708  H HB   . VAL A 1 56  ? 1.694   7.035   -10.630 1.00 0.00 ? 56  VAL A HB   2  
ATOM 2709  H HG11 . VAL A 1 56  ? 3.318   5.455   -10.201 1.00 0.00 ? 56  VAL A HG11 2  
ATOM 2710  H HG12 . VAL A 1 56  ? 2.246   4.468   -9.206  1.00 0.00 ? 56  VAL A HG12 2  
ATOM 2711  H HG13 . VAL A 1 56  ? 2.063   4.476   -10.960 1.00 0.00 ? 56  VAL A HG13 2  
ATOM 2712  H HG21 . VAL A 1 56  ? -0.130  4.754   -10.445 1.00 0.00 ? 56  VAL A HG21 2  
ATOM 2713  H HG22 . VAL A 1 56  ? -0.792  6.258   -9.804  1.00 0.00 ? 56  VAL A HG22 2  
ATOM 2714  H HG23 . VAL A 1 56  ? -0.208  6.190   -11.467 1.00 0.00 ? 56  VAL A HG23 2  
ATOM 2715  N N    . GLY A 1 57  ? -0.439  7.954   -7.318  1.00 0.00 ? 57  GLY A N    2  
ATOM 2716  C CA   . GLY A 1 57  ? -1.458  8.970   -7.130  1.00 0.00 ? 57  GLY A CA   2  
ATOM 2717  C C    . GLY A 1 57  ? -2.229  8.785   -5.838  1.00 0.00 ? 57  GLY A C    2  
ATOM 2718  O O    . GLY A 1 57  ? -2.390  7.662   -5.359  1.00 0.00 ? 57  GLY A O    2  
ATOM 2719  H H    . GLY A 1 57  ? -0.245  7.317   -6.599  1.00 0.00 ? 57  GLY A H    2  
ATOM 2720  H HA2  . GLY A 1 57  ? -0.985  9.941   -7.119  1.00 0.00 ? 57  GLY A HA2  2  
ATOM 2721  H HA3  . GLY A 1 57  ? -2.150  8.927   -7.958  1.00 0.00 ? 57  GLY A HA3  2  
ATOM 2722  N N    . ILE A 1 58  ? -2.705  9.889   -5.272  1.00 0.00 ? 58  ILE A N    2  
ATOM 2723  C CA   . ILE A 1 58  ? -3.462  9.843   -4.027  1.00 0.00 ? 58  ILE A CA   2  
ATOM 2724  C C    . ILE A 1 58  ? -4.741  10.667  -4.131  1.00 0.00 ? 58  ILE A C    2  
ATOM 2725  O O    . ILE A 1 58  ? -4.735  11.874  -3.894  1.00 0.00 ? 58  ILE A O    2  
ATOM 2726  C CB   . ILE A 1 58  ? -2.627  10.359  -2.841  1.00 0.00 ? 58  ILE A CB   2  
ATOM 2727  C CG1  . ILE A 1 58  ? -1.387  9.485   -2.643  1.00 0.00 ? 58  ILE A CG1  2  
ATOM 2728  C CG2  . ILE A 1 58  ? -3.469  10.389  -1.574  1.00 0.00 ? 58  ILE A CG2  2  
ATOM 2729  C CD1  . ILE A 1 58  ? -0.454  9.995   -1.567  1.00 0.00 ? 58  ILE A CD1  2  
ATOM 2730  H H    . ILE A 1 58  ? -2.543  10.754  -5.702  1.00 0.00 ? 58  ILE A H    2  
ATOM 2731  H HA   . ILE A 1 58  ? -3.725  8.813   -3.835  1.00 0.00 ? 58  ILE A HA   2  
ATOM 2732  H HB   . ILE A 1 58  ? -2.316  11.369  -3.061  1.00 0.00 ? 58  ILE A HB   2  
ATOM 2733  H HG12 . ILE A 1 58  ? -1.696  8.489   -2.368  1.00 0.00 ? 58  ILE A HG12 2  
ATOM 2734  H HG13 . ILE A 1 58  ? -0.834  9.443   -3.570  1.00 0.00 ? 58  ILE A HG13 2  
ATOM 2735  H HG21 . ILE A 1 58  ? -2.829  10.258  -0.713  1.00 0.00 ? 58  ILE A HG21 2  
ATOM 2736  H HG22 . ILE A 1 58  ? -3.977  11.338  -1.502  1.00 0.00 ? 58  ILE A HG22 2  
ATOM 2737  H HG23 . ILE A 1 58  ? -4.196  9.592   -1.606  1.00 0.00 ? 58  ILE A HG23 2  
ATOM 2738  H HD11 . ILE A 1 58  ? -0.761  10.984  -1.262  1.00 0.00 ? 58  ILE A HD11 2  
ATOM 2739  H HD12 . ILE A 1 58  ? -0.485  9.329   -0.717  1.00 0.00 ? 58  ILE A HD12 2  
ATOM 2740  H HD13 . ILE A 1 58  ? 0.554   10.036  -1.954  1.00 0.00 ? 58  ILE A HD13 2  
ATOM 2741  N N    . ASN A 1 59  ? -5.838  10.005  -4.486  1.00 0.00 ? 59  ASN A N    2  
ATOM 2742  C CA   . ASN A 1 59  ? -7.126  10.676  -4.620  1.00 0.00 ? 59  ASN A CA   2  
ATOM 2743  C C    . ASN A 1 59  ? -7.271  11.787  -3.585  1.00 0.00 ? 59  ASN A C    2  
ATOM 2744  O O    . ASN A 1 59  ? -7.245  11.551  -2.377  1.00 0.00 ? 59  ASN A O    2  
ATOM 2745  C CB   . ASN A 1 59  ? -8.267  9.669   -4.467  1.00 0.00 ? 59  ASN A CB   2  
ATOM 2746  C CG   . ASN A 1 59  ? -9.521  10.101  -5.202  1.00 0.00 ? 59  ASN A CG   2  
ATOM 2747  O OD1  . ASN A 1 59  ? -9.451  10.774  -6.230  1.00 0.00 ? 59  ASN A OD1  2  
ATOM 2748  N ND2  . ASN A 1 59  ? -10.678 9.713   -4.677  1.00 0.00 ? 59  ASN A ND2  2  
ATOM 2749  H H    . ASN A 1 59  ? -5.780  9.043   -4.662  1.00 0.00 ? 59  ASN A H    2  
ATOM 2750  H HA   . ASN A 1 59  ? -7.171  11.111  -5.607  1.00 0.00 ? 59  ASN A HA   2  
ATOM 2751  H HB2  . ASN A 1 59  ? -7.952  8.714   -4.863  1.00 0.00 ? 59  ASN A HB2  2  
ATOM 2752  H HB3  . ASN A 1 59  ? -8.505  9.559   -3.420  1.00 0.00 ? 59  ASN A HB3  2  
ATOM 2753  H HD21 . ASN A 1 59  ? -10.658 9.178   -3.856  1.00 0.00 ? 59  ASN A HD21 2  
ATOM 2754  H HD22 . ASN A 1 59  ? -11.504 9.978   -5.132  1.00 0.00 ? 59  ASN A HD22 2  
ATOM 2755  N N    . PRO A 1 60  ? -7.427  13.029  -4.067  1.00 0.00 ? 60  PRO A N    2  
ATOM 2756  C CA   . PRO A 1 60  ? -7.581  14.201  -3.201  1.00 0.00 ? 60  PRO A CA   2  
ATOM 2757  C C    . PRO A 1 60  ? -8.919  14.211  -2.470  1.00 0.00 ? 60  PRO A C    2  
ATOM 2758  O O    . PRO A 1 60  ? -9.164  15.063  -1.616  1.00 0.00 ? 60  PRO A O    2  
ATOM 2759  C CB   . PRO A 1 60  ? -7.496  15.377  -4.177  1.00 0.00 ? 60  PRO A CB   2  
ATOM 2760  C CG   . PRO A 1 60  ? -7.929  14.815  -5.486  1.00 0.00 ? 60  PRO A CG   2  
ATOM 2761  C CD   . PRO A 1 60  ? -7.467  13.384  -5.496  1.00 0.00 ? 60  PRO A CD   2  
ATOM 2762  H HA   . PRO A 1 60  ? -6.778  14.270  -2.481  1.00 0.00 ? 60  PRO A HA   2  
ATOM 2763  H HB2  . PRO A 1 60  ? -8.154  16.169  -3.848  1.00 0.00 ? 60  PRO A HB2  2  
ATOM 2764  H HB3  . PRO A 1 60  ? -6.480  15.741  -4.220  1.00 0.00 ? 60  PRO A HB3  2  
ATOM 2765  H HG2  . PRO A 1 60  ? -9.004  14.862  -5.568  1.00 0.00 ? 60  PRO A HG2  2  
ATOM 2766  H HG3  . PRO A 1 60  ? -7.465  15.363  -6.293  1.00 0.00 ? 60  PRO A HG3  2  
ATOM 2767  H HD2  . PRO A 1 60  ? -8.172  12.763  -6.028  1.00 0.00 ? 60  PRO A HD2  2  
ATOM 2768  H HD3  . PRO A 1 60  ? -6.485  13.307  -5.939  1.00 0.00 ? 60  PRO A HD3  2  
ATOM 2769  N N    . GLU A 1 61  ? -9.781  13.258  -2.811  1.00 0.00 ? 61  GLU A N    2  
ATOM 2770  C CA   . GLU A 1 61  ? -11.095 13.159  -2.186  1.00 0.00 ? 61  GLU A CA   2  
ATOM 2771  C C    . GLU A 1 61  ? -11.166 11.950  -1.257  1.00 0.00 ? 61  GLU A C    2  
ATOM 2772  O O    . GLU A 1 61  ? -12.130 11.782  -0.513  1.00 0.00 ? 61  GLU A O    2  
ATOM 2773  C CB   . GLU A 1 61  ? -12.186 13.059  -3.255  1.00 0.00 ? 61  GLU A CB   2  
ATOM 2774  C CG   . GLU A 1 61  ? -12.200 14.231  -4.221  1.00 0.00 ? 61  GLU A CG   2  
ATOM 2775  C CD   . GLU A 1 61  ? -13.062 13.971  -5.442  1.00 0.00 ? 61  GLU A CD   2  
ATOM 2776  O OE1  . GLU A 1 61  ? -14.274 13.725  -5.270  1.00 0.00 ? 61  GLU A OE1  2  
ATOM 2777  O OE2  . GLU A 1 61  ? -12.525 14.012  -6.568  1.00 0.00 ? 61  GLU A OE2  2  
ATOM 2778  H H    . GLU A 1 61  ? -9.528  12.608  -3.499  1.00 0.00 ? 61  GLU A H    2  
ATOM 2779  H HA   . GLU A 1 61  ? -11.255 14.054  -1.605  1.00 0.00 ? 61  GLU A HA   2  
ATOM 2780  H HB2  . GLU A 1 61  ? -12.035 12.152  -3.822  1.00 0.00 ? 61  GLU A HB2  2  
ATOM 2781  H HB3  . GLU A 1 61  ? -13.148 13.011  -2.766  1.00 0.00 ? 61  GLU A HB3  2  
ATOM 2782  H HG2  . GLU A 1 61  ? -12.584 15.100  -3.708  1.00 0.00 ? 61  GLU A HG2  2  
ATOM 2783  H HG3  . GLU A 1 61  ? -11.189 14.425  -4.547  1.00 0.00 ? 61  GLU A HG3  2  
ATOM 2784  N N    . GLY A 1 62  ? -10.136 11.111  -1.308  1.00 0.00 ? 62  GLY A N    2  
ATOM 2785  C CA   . GLY A 1 62  ? -10.100 9.929   -0.467  1.00 0.00 ? 62  GLY A CA   2  
ATOM 2786  C C    . GLY A 1 62  ? -9.525  10.211  0.907   1.00 0.00 ? 62  GLY A C    2  
ATOM 2787  O O    . GLY A 1 62  ? -9.099  11.326  1.208   1.00 0.00 ? 62  GLY A O    2  
ATOM 2788  H H    . GLY A 1 62  ? -9.394  11.296  -1.921  1.00 0.00 ? 62  GLY A H    2  
ATOM 2789  H HA2  . GLY A 1 62  ? -11.105 9.550   -0.354  1.00 0.00 ? 62  GLY A HA2  2  
ATOM 2790  H HA3  . GLY A 1 62  ? -9.495  9.176   -0.950  1.00 0.00 ? 62  GLY A HA3  2  
ATOM 2791  N N    . PRO A 1 63  ? -9.508  9.183   1.768   1.00 0.00 ? 63  PRO A N    2  
ATOM 2792  C CA   . PRO A 1 63  ? -8.984  9.302   3.132   1.00 0.00 ? 63  PRO A CA   2  
ATOM 2793  C C    . PRO A 1 63  ? -7.469  9.475   3.158   1.00 0.00 ? 63  PRO A C    2  
ATOM 2794  O O    . PRO A 1 63  ? -6.936  10.238  3.963   1.00 0.00 ? 63  PRO A O    2  
ATOM 2795  C CB   . PRO A 1 63  ? -9.382  7.974   3.782   1.00 0.00 ? 63  PRO A CB   2  
ATOM 2796  C CG   . PRO A 1 63  ? -9.505  7.018   2.646   1.00 0.00 ? 63  PRO A CG   2  
ATOM 2797  C CD   . PRO A 1 63  ? -10.000 7.826   1.477   1.00 0.00 ? 63  PRO A CD   2  
ATOM 2798  H HA   . PRO A 1 63  ? -9.448  10.119  3.666   1.00 0.00 ? 63  PRO A HA   2  
ATOM 2799  H HB2  . PRO A 1 63  ? -8.613  7.666   4.476   1.00 0.00 ? 63  PRO A HB2  2  
ATOM 2800  H HB3  . PRO A 1 63  ? -10.320 8.091   4.303   1.00 0.00 ? 63  PRO A HB3  2  
ATOM 2801  H HG2  . PRO A 1 63  ? -8.541  6.587   2.422   1.00 0.00 ? 63  PRO A HG2  2  
ATOM 2802  H HG3  . PRO A 1 63  ? -10.216 6.244   2.893   1.00 0.00 ? 63  PRO A HG3  2  
ATOM 2803  H HD2  . PRO A 1 63  ? -9.579  7.453   0.555   1.00 0.00 ? 63  PRO A HD2  2  
ATOM 2804  H HD3  . PRO A 1 63  ? -11.079 7.808   1.436   1.00 0.00 ? 63  PRO A HD3  2  
ATOM 2805  N N    . ALA A 1 64  ? -6.782  8.762   2.272   1.00 0.00 ? 64  ALA A N    2  
ATOM 2806  C CA   . ALA A 1 64  ? -5.328  8.840   2.192   1.00 0.00 ? 64  ALA A CA   2  
ATOM 2807  C C    . ALA A 1 64  ? -4.863  10.284  2.037   1.00 0.00 ? 64  ALA A C    2  
ATOM 2808  O O    . ALA A 1 64  ? -3.833  10.675  2.584   1.00 0.00 ? 64  ALA A O    2  
ATOM 2809  C CB   . ALA A 1 64  ? -4.817  7.992   1.036   1.00 0.00 ? 64  ALA A CB   2  
ATOM 2810  H H    . ALA A 1 64  ? -7.263  8.172   1.656   1.00 0.00 ? 64  ALA A H    2  
ATOM 2811  H HA   . ALA A 1 64  ? -4.922  8.437   3.109   1.00 0.00 ? 64  ALA A HA   2  
ATOM 2812  H HB1  . ALA A 1 64  ? -3.867  8.379   0.700   1.00 0.00 ? 64  ALA A HB1  2  
ATOM 2813  H HB2  . ALA A 1 64  ? -4.694  6.971   1.366   1.00 0.00 ? 64  ALA A HB2  2  
ATOM 2814  H HB3  . ALA A 1 64  ? -5.528  8.025   0.224   1.00 0.00 ? 64  ALA A HB3  2  
ATOM 2815  N N    . ALA A 1 65  ? -5.629  11.070  1.288   1.00 0.00 ? 65  ALA A N    2  
ATOM 2816  C CA   . ALA A 1 65  ? -5.295  12.471  1.063   1.00 0.00 ? 65  ALA A CA   2  
ATOM 2817  C C    . ALA A 1 65  ? -5.572  13.308  2.307   1.00 0.00 ? 65  ALA A C    2  
ATOM 2818  O O    . ALA A 1 65  ? -4.790  14.191  2.659   1.00 0.00 ? 65  ALA A O    2  
ATOM 2819  C CB   . ALA A 1 65  ? -6.075  13.015  -0.125  1.00 0.00 ? 65  ALA A CB   2  
ATOM 2820  H H    . ALA A 1 65  ? -6.438  10.700  0.879   1.00 0.00 ? 65  ALA A H    2  
ATOM 2821  H HA   . ALA A 1 65  ? -4.242  12.530  0.828   1.00 0.00 ? 65  ALA A HA   2  
ATOM 2822  H HB1  . ALA A 1 65  ? -5.430  13.049  -0.992  1.00 0.00 ? 65  ALA A HB1  2  
ATOM 2823  H HB2  . ALA A 1 65  ? -6.917  12.370  -0.328  1.00 0.00 ? 65  ALA A HB2  2  
ATOM 2824  H HB3  . ALA A 1 65  ? -6.428  14.009  0.101   1.00 0.00 ? 65  ALA A HB3  2  
ATOM 2825  N N    . ALA A 1 66  ? -6.689  13.025  2.969   1.00 0.00 ? 66  ALA A N    2  
ATOM 2826  C CA   . ALA A 1 66  ? -7.067  13.751  4.175   1.00 0.00 ? 66  ALA A CA   2  
ATOM 2827  C C    . ALA A 1 66  ? -5.983  13.646  5.242   1.00 0.00 ? 66  ALA A C    2  
ATOM 2828  O O    . ALA A 1 66  ? -5.501  14.657  5.753   1.00 0.00 ? 66  ALA A O    2  
ATOM 2829  C CB   . ALA A 1 66  ? -8.392  13.229  4.711   1.00 0.00 ? 66  ALA A CB   2  
ATOM 2830  H H    . ALA A 1 66  ? -7.271  12.310  2.639   1.00 0.00 ? 66  ALA A H    2  
ATOM 2831  H HA   . ALA A 1 66  ? -7.198  14.791  3.911   1.00 0.00 ? 66  ALA A HA   2  
ATOM 2832  H HB1  . ALA A 1 66  ? -8.447  12.162  4.554   1.00 0.00 ? 66  ALA A HB1  2  
ATOM 2833  H HB2  . ALA A 1 66  ? -8.461  13.442  5.768   1.00 0.00 ? 66  ALA A HB2  2  
ATOM 2834  H HB3  . ALA A 1 66  ? -9.206  13.713  4.193   1.00 0.00 ? 66  ALA A HB3  2  
ATOM 2835  N N    . ASP A 1 67  ? -5.605  12.416  5.575   1.00 0.00 ? 67  ASP A N    2  
ATOM 2836  C CA   . ASP A 1 67  ? -4.577  12.179  6.582   1.00 0.00 ? 67  ASP A CA   2  
ATOM 2837  C C    . ASP A 1 67  ? -3.313  12.970  6.265   1.00 0.00 ? 67  ASP A C    2  
ATOM 2838  O O    . ASP A 1 67  ? -2.692  13.552  7.154   1.00 0.00 ? 67  ASP A O    2  
ATOM 2839  C CB   . ASP A 1 67  ? -4.253  10.687  6.668   1.00 0.00 ? 67  ASP A CB   2  
ATOM 2840  C CG   . ASP A 1 67  ? -3.684  10.295  8.017   1.00 0.00 ? 67  ASP A CG   2  
ATOM 2841  O OD1  . ASP A 1 67  ? -2.859  11.061  8.558   1.00 0.00 ? 67  ASP A OD1  2  
ATOM 2842  O OD2  . ASP A 1 67  ? -4.062  9.222   8.532   1.00 0.00 ? 67  ASP A OD2  2  
ATOM 2843  H H    . ASP A 1 67  ? -6.027  11.650  5.132   1.00 0.00 ? 67  ASP A H    2  
ATOM 2844  H HA   . ASP A 1 67  ? -4.964  12.509  7.534   1.00 0.00 ? 67  ASP A HA   2  
ATOM 2845  H HB2  . ASP A 1 67  ? -5.156  10.118  6.500   1.00 0.00 ? 67  ASP A HB2  2  
ATOM 2846  H HB3  . ASP A 1 67  ? -3.529  10.438  5.906   1.00 0.00 ? 67  ASP A HB3  2  
ATOM 2847  N N    . GLY A 1 68  ? -2.935  12.987  4.990   1.00 0.00 ? 68  GLY A N    2  
ATOM 2848  C CA   . GLY A 1 68  ? -1.745  13.708  4.578   1.00 0.00 ? 68  GLY A CA   2  
ATOM 2849  C C    . GLY A 1 68  ? -0.468  13.000  4.984   1.00 0.00 ? 68  GLY A C    2  
ATOM 2850  O O    . GLY A 1 68  ? 0.487   13.635  5.432   1.00 0.00 ? 68  GLY A O    2  
ATOM 2851  H H    . GLY A 1 68  ? -3.469  12.505  4.324   1.00 0.00 ? 68  GLY A H    2  
ATOM 2852  H HA2  . GLY A 1 68  ? -1.758  13.818  3.504   1.00 0.00 ? 68  GLY A HA2  2  
ATOM 2853  H HA3  . GLY A 1 68  ? -1.758  14.689  5.030   1.00 0.00 ? 68  GLY A HA3  2  
ATOM 2854  N N    . ARG A 1 69  ? -0.450  11.680  4.829   1.00 0.00 ? 69  ARG A N    2  
ATOM 2855  C CA   . ARG A 1 69  ? 0.719   10.885  5.186   1.00 0.00 ? 69  ARG A CA   2  
ATOM 2856  C C    . ARG A 1 69  ? 1.233   10.103  3.980   1.00 0.00 ? 69  ARG A C    2  
ATOM 2857  O O    . ARG A 1 69  ? 2.416   10.166  3.646   1.00 0.00 ? 69  ARG A O    2  
ATOM 2858  C CB   . ARG A 1 69  ? 0.378   9.921   6.324   1.00 0.00 ? 69  ARG A CB   2  
ATOM 2859  C CG   . ARG A 1 69  ? 0.161   10.611  7.661   1.00 0.00 ? 69  ARG A CG   2  
ATOM 2860  C CD   . ARG A 1 69  ? 0.294   9.634   8.819   1.00 0.00 ? 69  ARG A CD   2  
ATOM 2861  N NE   . ARG A 1 69  ? -0.977  8.992   9.143   1.00 0.00 ? 69  ARG A NE   2  
ATOM 2862  C CZ   . ARG A 1 69  ? -1.187  8.295   10.254  1.00 0.00 ? 69  ARG A CZ   2  
ATOM 2863  N NH1  . ARG A 1 69  ? -0.214  8.151   11.143  1.00 0.00 ? 69  ARG A NH1  2  
ATOM 2864  N NH2  . ARG A 1 69  ? -2.371  7.741   10.477  1.00 0.00 ? 69  ARG A NH2  2  
ATOM 2865  H H    . ARG A 1 69  ? -1.242  11.230  4.467   1.00 0.00 ? 69  ARG A H    2  
ATOM 2866  H HA   . ARG A 1 69  ? 1.492   11.561  5.518   1.00 0.00 ? 69  ARG A HA   2  
ATOM 2867  H HB2  . ARG A 1 69  ? -0.525  9.386   6.069   1.00 0.00 ? 69  ARG A HB2  2  
ATOM 2868  H HB3  . ARG A 1 69  ? 1.187   9.215   6.435   1.00 0.00 ? 69  ARG A HB3  2  
ATOM 2869  H HG2  . ARG A 1 69  ? 0.898   11.392  7.777   1.00 0.00 ? 69  ARG A HG2  2  
ATOM 2870  H HG3  . ARG A 1 69  ? -0.829  11.042  7.677   1.00 0.00 ? 69  ARG A HG3  2  
ATOM 2871  H HD2  . ARG A 1 69  ? 1.012   8.874   8.551   1.00 0.00 ? 69  ARG A HD2  2  
ATOM 2872  H HD3  . ARG A 1 69  ? 0.647   10.172  9.687   1.00 0.00 ? 69  ARG A HD3  2  
ATOM 2873  H HE   . ARG A 1 69  ? -1.710  9.086   8.499   1.00 0.00 ? 69  ARG A HE   2  
ATOM 2874  H HH11 . ARG A 1 69  ? 0.679   8.568   10.978  1.00 0.00 ? 69  ARG A HH11 2  
ATOM 2875  H HH12 . ARG A 1 69  ? -0.375  7.626   11.980  1.00 0.00 ? 69  ARG A HH12 2  
ATOM 2876  H HH21 . ARG A 1 69  ? -3.107  7.847   9.809   1.00 0.00 ? 69  ARG A HH21 2  
ATOM 2877  H HH22 . ARG A 1 69  ? -2.528  7.216   11.314  1.00 0.00 ? 69  ARG A HH22 2  
ATOM 2878  N N    . MET A 1 70  ? 0.336   9.368   3.332   1.00 0.00 ? 70  MET A N    2  
ATOM 2879  C CA   . MET A 1 70  ? 0.699   8.575   2.163   1.00 0.00 ? 70  MET A CA   2  
ATOM 2880  C C    . MET A 1 70  ? 1.232   9.466   1.046   1.00 0.00 ? 70  MET A C    2  
ATOM 2881  O O    . MET A 1 70  ? 0.687   10.537  0.780   1.00 0.00 ? 70  MET A O    2  
ATOM 2882  C CB   . MET A 1 70  ? -0.508  7.779   1.665   1.00 0.00 ? 70  MET A CB   2  
ATOM 2883  C CG   . MET A 1 70  ? -0.619  6.393   2.280   1.00 0.00 ? 70  MET A CG   2  
ATOM 2884  S SD   . MET A 1 70  ? -1.393  5.201   1.171   1.00 0.00 ? 70  MET A SD   2  
ATOM 2885  C CE   . MET A 1 70  ? 0.015   4.687   0.190   1.00 0.00 ? 70  MET A CE   2  
ATOM 2886  H H    . MET A 1 70  ? -0.593  9.358   3.646   1.00 0.00 ? 70  MET A H    2  
ATOM 2887  H HA   . MET A 1 70  ? 1.476   7.885   2.460   1.00 0.00 ? 70  MET A HA   2  
ATOM 2888  H HB2  . MET A 1 70  ? -1.408  8.327   1.901   1.00 0.00 ? 70  MET A HB2  2  
ATOM 2889  H HB3  . MET A 1 70  ? -0.435  7.668   0.593   1.00 0.00 ? 70  MET A HB3  2  
ATOM 2890  H HG2  . MET A 1 70  ? 0.372   6.043   2.527   1.00 0.00 ? 70  MET A HG2  2  
ATOM 2891  H HG3  . MET A 1 70  ? -1.209  6.461   3.182   1.00 0.00 ? 70  MET A HG3  2  
ATOM 2892  H HE1  . MET A 1 70  ? 0.918   5.107   0.609   1.00 0.00 ? 70  MET A HE1  2  
ATOM 2893  H HE2  . MET A 1 70  ? 0.083   3.609   0.196   1.00 0.00 ? 70  MET A HE2  2  
ATOM 2894  H HE3  . MET A 1 70  ? -0.107  5.036   -0.825  1.00 0.00 ? 70  MET A HE3  2  
ATOM 2895  N N    . ARG A 1 71  ? 2.301   9.017   0.395   1.00 0.00 ? 71  ARG A N    2  
ATOM 2896  C CA   . ARG A 1 71  ? 2.908   9.774   -0.692  1.00 0.00 ? 71  ARG A CA   2  
ATOM 2897  C C    . ARG A 1 71  ? 2.974   8.938   -1.967  1.00 0.00 ? 71  ARG A C    2  
ATOM 2898  O O    . ARG A 1 71  ? 2.645   7.752   -1.960  1.00 0.00 ? 71  ARG A O    2  
ATOM 2899  C CB   . ARG A 1 71  ? 4.312   10.236  -0.298  1.00 0.00 ? 71  ARG A CB   2  
ATOM 2900  C CG   . ARG A 1 71  ? 4.319   11.405  0.674   1.00 0.00 ? 71  ARG A CG   2  
ATOM 2901  C CD   . ARG A 1 71  ? 4.331   12.738  -0.058  1.00 0.00 ? 71  ARG A CD   2  
ATOM 2902  N NE   . ARG A 1 71  ? 2.998   13.128  -0.507  1.00 0.00 ? 71  ARG A NE   2  
ATOM 2903  C CZ   . ARG A 1 71  ? 2.756   14.210  -1.239  1.00 0.00 ? 71  ARG A CZ   2  
ATOM 2904  N NH1  . ARG A 1 71  ? 3.753   15.005  -1.603  1.00 0.00 ? 71  ARG A NH1  2  
ATOM 2905  N NH2  . ARG A 1 71  ? 1.515   14.498  -1.609  1.00 0.00 ? 71  ARG A NH2  2  
ATOM 2906  H H    . ARG A 1 71  ? 2.691   8.155   0.654   1.00 0.00 ? 71  ARG A H    2  
ATOM 2907  H HA   . ARG A 1 71  ? 2.292   10.642  -0.876  1.00 0.00 ? 71  ARG A HA   2  
ATOM 2908  H HB2  . ARG A 1 71  ? 4.834   9.410   0.162   1.00 0.00 ? 71  ARG A HB2  2  
ATOM 2909  H HB3  . ARG A 1 71  ? 4.843   10.535  -1.190  1.00 0.00 ? 71  ARG A HB3  2  
ATOM 2910  H HG2  . ARG A 1 71  ? 3.434   11.353  1.290   1.00 0.00 ? 71  ARG A HG2  2  
ATOM 2911  H HG3  . ARG A 1 71  ? 5.198   11.337  1.297   1.00 0.00 ? 71  ARG A HG3  2  
ATOM 2912  H HD2  . ARG A 1 71  ? 4.712   13.496  0.610   1.00 0.00 ? 71  ARG A HD2  2  
ATOM 2913  H HD3  . ARG A 1 71  ? 4.981   12.656  -0.916  1.00 0.00 ? 71  ARG A HD3  2  
ATOM 2914  H HE   . ARG A 1 71  ? 2.246   12.555  -0.250  1.00 0.00 ? 71  ARG A HE   2  
ATOM 2915  H HH11 . ARG A 1 71  ? 4.690   14.789  -1.326  1.00 0.00 ? 71  ARG A HH11 2  
ATOM 2916  H HH12 . ARG A 1 71  ? 3.569   15.818  -2.155  1.00 0.00 ? 71  ARG A HH12 2  
ATOM 2917  H HH21 . ARG A 1 71  ? 0.761   13.901  -1.338  1.00 0.00 ? 71  ARG A HH21 2  
ATOM 2918  H HH22 . ARG A 1 71  ? 1.334   15.313  -2.160  1.00 0.00 ? 71  ARG A HH22 2  
ATOM 2919  N N    . ILE A 1 72  ? 3.401   9.565   -3.057  1.00 0.00 ? 72  ILE A N    2  
ATOM 2920  C CA   . ILE A 1 72  ? 3.511   8.878   -4.339  1.00 0.00 ? 72  ILE A CA   2  
ATOM 2921  C C    . ILE A 1 72  ? 4.785   8.042   -4.407  1.00 0.00 ? 72  ILE A C    2  
ATOM 2922  O O    . ILE A 1 72  ? 5.880   8.537   -4.145  1.00 0.00 ? 72  ILE A O    2  
ATOM 2923  C CB   . ILE A 1 72  ? 3.501   9.874   -5.514  1.00 0.00 ? 72  ILE A CB   2  
ATOM 2924  C CG1  . ILE A 1 72  ? 2.369   10.889  -5.341  1.00 0.00 ? 72  ILE A CG1  2  
ATOM 2925  C CG2  . ILE A 1 72  ? 3.358   9.133   -6.835  1.00 0.00 ? 72  ILE A CG2  2  
ATOM 2926  C CD1  . ILE A 1 72  ? 1.041   10.258  -4.983  1.00 0.00 ? 72  ILE A CD1  2  
ATOM 2927  H H    . ILE A 1 72  ? 3.649   10.511  -2.999  1.00 0.00 ? 72  ILE A H    2  
ATOM 2928  H HA   . ILE A 1 72  ? 2.657   8.224   -4.440  1.00 0.00 ? 72  ILE A HA   2  
ATOM 2929  H HB   . ILE A 1 72  ? 4.445   10.397  -5.522  1.00 0.00 ? 72  ILE A HB   2  
ATOM 2930  H HG12 . ILE A 1 72  ? 2.629   11.579  -4.555  1.00 0.00 ? 72  ILE A HG12 2  
ATOM 2931  H HG13 . ILE A 1 72  ? 2.240   11.433  -6.265  1.00 0.00 ? 72  ILE A HG13 2  
ATOM 2932  H HG21 . ILE A 1 72  ? 2.329   8.834   -6.970  1.00 0.00 ? 72  ILE A HG21 2  
ATOM 2933  H HG22 . ILE A 1 72  ? 3.653   9.783   -7.645  1.00 0.00 ? 72  ILE A HG22 2  
ATOM 2934  H HG23 . ILE A 1 72  ? 3.990   8.258   -6.827  1.00 0.00 ? 72  ILE A HG23 2  
ATOM 2935  H HD11 . ILE A 1 72  ? 0.768   9.539   -5.741  1.00 0.00 ? 72  ILE A HD11 2  
ATOM 2936  H HD12 . ILE A 1 72  ? 1.124   9.761   -4.028  1.00 0.00 ? 72  ILE A HD12 2  
ATOM 2937  H HD13 . ILE A 1 72  ? 0.282   11.025  -4.926  1.00 0.00 ? 72  ILE A HD13 2  
ATOM 2938  N N    . GLY A 1 73  ? 4.632   6.770   -4.762  1.00 0.00 ? 73  GLY A N    2  
ATOM 2939  C CA   . GLY A 1 73  ? 5.778   5.885   -4.861  1.00 0.00 ? 73  GLY A CA   2  
ATOM 2940  C C    . GLY A 1 73  ? 5.698   4.723   -3.891  1.00 0.00 ? 73  GLY A C    2  
ATOM 2941  O O    . GLY A 1 73  ? 6.251   3.653   -4.147  1.00 0.00 ? 73  GLY A O    2  
ATOM 2942  H H    . GLY A 1 73  ? 3.735   6.430   -4.960  1.00 0.00 ? 73  GLY A H    2  
ATOM 2943  H HA2  . GLY A 1 73  ? 5.835   5.498   -5.867  1.00 0.00 ? 73  GLY A HA2  2  
ATOM 2944  H HA3  . GLY A 1 73  ? 6.675   6.451   -4.653  1.00 0.00 ? 73  GLY A HA3  2  
ATOM 2945  N N    . ASP A 1 74  ? 5.010   4.933   -2.774  1.00 0.00 ? 74  ASP A N    2  
ATOM 2946  C CA   . ASP A 1 74  ? 4.860   3.894   -1.762  1.00 0.00 ? 74  ASP A CA   2  
ATOM 2947  C C    . ASP A 1 74  ? 4.474   2.564   -2.401  1.00 0.00 ? 74  ASP A C    2  
ATOM 2948  O O    . ASP A 1 74  ? 3.679   2.523   -3.339  1.00 0.00 ? 74  ASP A O    2  
ATOM 2949  C CB   . ASP A 1 74  ? 3.806   4.304   -0.732  1.00 0.00 ? 74  ASP A CB   2  
ATOM 2950  C CG   . ASP A 1 74  ? 4.259   5.466   0.129   1.00 0.00 ? 74  ASP A CG   2  
ATOM 2951  O OD1  . ASP A 1 74  ? 5.392   5.410   0.653   1.00 0.00 ? 74  ASP A OD1  2  
ATOM 2952  O OD2  . ASP A 1 74  ? 3.482   6.432   0.278   1.00 0.00 ? 74  ASP A OD2  2  
ATOM 2953  H H    . ASP A 1 74  ? 4.592   5.807   -2.627  1.00 0.00 ? 74  ASP A H    2  
ATOM 2954  H HA   . ASP A 1 74  ? 5.811   3.777   -1.263  1.00 0.00 ? 74  ASP A HA   2  
ATOM 2955  H HB2  . ASP A 1 74  ? 2.902   4.593   -1.248  1.00 0.00 ? 74  ASP A HB2  2  
ATOM 2956  H HB3  . ASP A 1 74  ? 3.595   3.462   -0.088  1.00 0.00 ? 74  ASP A HB3  2  
ATOM 2957  N N    . GLU A 1 75  ? 5.045   1.478   -1.888  1.00 0.00 ? 75  GLU A N    2  
ATOM 2958  C CA   . GLU A 1 75  ? 4.762   0.147   -2.411  1.00 0.00 ? 75  GLU A CA   2  
ATOM 2959  C C    . GLU A 1 75  ? 3.965   -0.676  -1.402  1.00 0.00 ? 75  GLU A C    2  
ATOM 2960  O O    . GLU A 1 75  ? 4.519   -1.201  -0.436  1.00 0.00 ? 75  GLU A O    2  
ATOM 2961  C CB   . GLU A 1 75  ? 6.064   -0.576  -2.759  1.00 0.00 ? 75  GLU A CB   2  
ATOM 2962  C CG   . GLU A 1 75  ? 5.880   -2.057  -3.045  1.00 0.00 ? 75  GLU A CG   2  
ATOM 2963  C CD   . GLU A 1 75  ? 7.194   -2.813  -3.073  1.00 0.00 ? 75  GLU A CD   2  
ATOM 2964  O OE1  . GLU A 1 75  ? 8.154   -2.311  -3.694  1.00 0.00 ? 75  GLU A OE1  2  
ATOM 2965  O OE2  . GLU A 1 75  ? 7.263   -3.907  -2.475  1.00 0.00 ? 75  GLU A OE2  2  
ATOM 2966  H H    . GLU A 1 75  ? 5.671   1.575   -1.140  1.00 0.00 ? 75  GLU A H    2  
ATOM 2967  H HA   . GLU A 1 75  ? 4.173   0.262   -3.308  1.00 0.00 ? 75  GLU A HA   2  
ATOM 2968  H HB2  . GLU A 1 75  ? 6.496   -0.113  -3.634  1.00 0.00 ? 75  GLU A HB2  2  
ATOM 2969  H HB3  . GLU A 1 75  ? 6.751   -0.473  -1.932  1.00 0.00 ? 75  GLU A HB3  2  
ATOM 2970  H HG2  . GLU A 1 75  ? 5.254   -2.484  -2.277  1.00 0.00 ? 75  GLU A HG2  2  
ATOM 2971  H HG3  . GLU A 1 75  ? 5.397   -2.168  -4.005  1.00 0.00 ? 75  GLU A HG3  2  
ATOM 2972  N N    . LEU A 1 76  ? 2.661   -0.782  -1.633  1.00 0.00 ? 76  LEU A N    2  
ATOM 2973  C CA   . LEU A 1 76  ? 1.786   -1.540  -0.746  1.00 0.00 ? 76  LEU A CA   2  
ATOM 2974  C C    . LEU A 1 76  ? 2.327   -2.948  -0.520  1.00 0.00 ? 76  LEU A C    2  
ATOM 2975  O O    . LEU A 1 76  ? 2.750   -3.621  -1.461  1.00 0.00 ? 76  LEU A O    2  
ATOM 2976  C CB   . LEU A 1 76  ? 0.373   -1.612  -1.329  1.00 0.00 ? 76  LEU A CB   2  
ATOM 2977  C CG   . LEU A 1 76  ? -0.407  -0.297  -1.360  1.00 0.00 ? 76  LEU A CG   2  
ATOM 2978  C CD1  . LEU A 1 76  ? -1.712  -0.469  -2.123  1.00 0.00 ? 76  LEU A CD1  2  
ATOM 2979  C CD2  . LEU A 1 76  ? -0.675  0.198   0.053   1.00 0.00 ? 76  LEU A CD2  2  
ATOM 2980  H H    . LEU A 1 76  ? 2.277   -0.342  -2.419  1.00 0.00 ? 76  LEU A H    2  
ATOM 2981  H HA   . LEU A 1 76  ? 1.750   -1.025  0.203   1.00 0.00 ? 76  LEU A HA   2  
ATOM 2982  H HB2  . LEU A 1 76  ? 0.452   -1.974  -2.342  1.00 0.00 ? 76  LEU A HB2  2  
ATOM 2983  H HB3  . LEU A 1 76  ? -0.192  -2.319  -0.738  1.00 0.00 ? 76  LEU A HB3  2  
ATOM 2984  H HG   . LEU A 1 76  ? 0.182   0.452   -1.872  1.00 0.00 ? 76  LEU A HG   2  
ATOM 2985  H HD11 . LEU A 1 76  ? -1.589  -1.230  -2.878  1.00 0.00 ? 76  LEU A HD11 2  
ATOM 2986  H HD12 . LEU A 1 76  ? -1.979  0.465   -2.593  1.00 0.00 ? 76  LEU A HD12 2  
ATOM 2987  H HD13 . LEU A 1 76  ? -2.493  -0.764  -1.437  1.00 0.00 ? 76  LEU A HD13 2  
ATOM 2988  H HD21 . LEU A 1 76  ? -1.635  0.692   0.085   1.00 0.00 ? 76  LEU A HD21 2  
ATOM 2989  H HD22 . LEU A 1 76  ? 0.098   0.896   0.343   1.00 0.00 ? 76  LEU A HD22 2  
ATOM 2990  H HD23 . LEU A 1 76  ? -0.678  -0.640  0.734   1.00 0.00 ? 76  LEU A HD23 2  
ATOM 2991  N N    . LEU A 1 77  ? 2.309   -3.389  0.733   1.00 0.00 ? 77  LEU A N    2  
ATOM 2992  C CA   . LEU A 1 77  ? 2.796   -4.719  1.084   1.00 0.00 ? 77  LEU A CA   2  
ATOM 2993  C C    . LEU A 1 77  ? 1.673   -5.575  1.661   1.00 0.00 ? 77  LEU A C    2  
ATOM 2994  O O    . LEU A 1 77  ? 1.514   -6.738  1.292   1.00 0.00 ? 77  LEU A O    2  
ATOM 2995  C CB   . LEU A 1 77  ? 3.943   -4.615  2.090   1.00 0.00 ? 77  LEU A CB   2  
ATOM 2996  C CG   . LEU A 1 77  ? 5.168   -3.823  1.632   1.00 0.00 ? 77  LEU A CG   2  
ATOM 2997  C CD1  . LEU A 1 77  ? 5.966   -3.334  2.831   1.00 0.00 ? 77  LEU A CD1  2  
ATOM 2998  C CD2  . LEU A 1 77  ? 6.040   -4.670  0.718   1.00 0.00 ? 77  LEU A CD2  2  
ATOM 2999  H H    . LEU A 1 77  ? 1.960   -2.808  1.440   1.00 0.00 ? 77  LEU A H    2  
ATOM 3000  H HA   . LEU A 1 77  ? 3.160   -5.186  0.181   1.00 0.00 ? 77  LEU A HA   2  
ATOM 3001  H HB2  . LEU A 1 77  ? 3.559   -4.144  2.982   1.00 0.00 ? 77  LEU A HB2  2  
ATOM 3002  H HB3  . LEU A 1 77  ? 4.266   -5.619  2.327   1.00 0.00 ? 77  LEU A HB3  2  
ATOM 3003  H HG   . LEU A 1 77  ? 4.840   -2.956  1.075   1.00 0.00 ? 77  LEU A HG   2  
ATOM 3004  H HD11 . LEU A 1 77  ? 6.646   -4.110  3.151   1.00 0.00 ? 77  LEU A HD11 2  
ATOM 3005  H HD12 . LEU A 1 77  ? 5.291   -3.091  3.638   1.00 0.00 ? 77  LEU A HD12 2  
ATOM 3006  H HD13 . LEU A 1 77  ? 6.528   -2.454  2.555   1.00 0.00 ? 77  LEU A HD13 2  
ATOM 3007  H HD21 . LEU A 1 77  ? 7.071   -4.592  1.030   1.00 0.00 ? 77  LEU A HD21 2  
ATOM 3008  H HD22 . LEU A 1 77  ? 5.944   -4.318  -0.299  1.00 0.00 ? 77  LEU A HD22 2  
ATOM 3009  H HD23 . LEU A 1 77  ? 5.724   -5.701  0.774   1.00 0.00 ? 77  LEU A HD23 2  
ATOM 3010  N N    . GLU A 1 78  ? 0.897   -4.990  2.568   1.00 0.00 ? 78  GLU A N    2  
ATOM 3011  C CA   . GLU A 1 78  ? -0.212  -5.700  3.195   1.00 0.00 ? 78  GLU A CA   2  
ATOM 3012  C C    . GLU A 1 78  ? -1.408  -4.774  3.394   1.00 0.00 ? 78  GLU A C    2  
ATOM 3013  O O    . GLU A 1 78  ? -1.251  -3.560  3.525   1.00 0.00 ? 78  GLU A O    2  
ATOM 3014  C CB   . GLU A 1 78  ? 0.223   -6.285  4.541   1.00 0.00 ? 78  GLU A CB   2  
ATOM 3015  C CG   . GLU A 1 78  ? 1.556   -7.013  4.485   1.00 0.00 ? 78  GLU A CG   2  
ATOM 3016  C CD   . GLU A 1 78  ? 1.934   -7.640  5.814   1.00 0.00 ? 78  GLU A CD   2  
ATOM 3017  O OE1  . GLU A 1 78  ? 1.457   -8.758  6.100   1.00 0.00 ? 78  GLU A OE1  2  
ATOM 3018  O OE2  . GLU A 1 78  ? 2.707   -7.011  6.567   1.00 0.00 ? 78  GLU A OE2  2  
ATOM 3019  H H    . GLU A 1 78  ? 1.074   -4.061  2.822   1.00 0.00 ? 78  GLU A H    2  
ATOM 3020  H HA   . GLU A 1 78  ? -0.502  -6.507  2.540   1.00 0.00 ? 78  GLU A HA   2  
ATOM 3021  H HB2  . GLU A 1 78  ? 0.304   -5.482  5.259   1.00 0.00 ? 78  GLU A HB2  2  
ATOM 3022  H HB3  . GLU A 1 78  ? -0.530  -6.982  4.877   1.00 0.00 ? 78  GLU A HB3  2  
ATOM 3023  H HG2  . GLU A 1 78  ? 1.495   -7.793  3.742   1.00 0.00 ? 78  GLU A HG2  2  
ATOM 3024  H HG3  . GLU A 1 78  ? 2.325   -6.309  4.204   1.00 0.00 ? 78  GLU A HG3  2  
ATOM 3025  N N    . ILE A 1 79  ? -2.603  -5.356  3.415   1.00 0.00 ? 79  ILE A N    2  
ATOM 3026  C CA   . ILE A 1 79  ? -3.825  -4.584  3.598   1.00 0.00 ? 79  ILE A CA   2  
ATOM 3027  C C    . ILE A 1 79  ? -4.927  -5.437  4.217   1.00 0.00 ? 79  ILE A C    2  
ATOM 3028  O O    . ILE A 1 79  ? -5.151  -6.574  3.804   1.00 0.00 ? 79  ILE A O    2  
ATOM 3029  C CB   . ILE A 1 79  ? -4.329  -4.003  2.264   1.00 0.00 ? 79  ILE A CB   2  
ATOM 3030  C CG1  . ILE A 1 79  ? -3.266  -3.094  1.644   1.00 0.00 ? 79  ILE A CG1  2  
ATOM 3031  C CG2  . ILE A 1 79  ? -5.629  -3.240  2.475   1.00 0.00 ? 79  ILE A CG2  2  
ATOM 3032  C CD1  . ILE A 1 79  ? -3.713  -2.429  0.360   1.00 0.00 ? 79  ILE A CD1  2  
ATOM 3033  H H    . ILE A 1 79  ? -2.663  -6.328  3.306   1.00 0.00 ? 79  ILE A H    2  
ATOM 3034  H HA   . ILE A 1 79  ? -3.603  -3.762  4.264   1.00 0.00 ? 79  ILE A HA   2  
ATOM 3035  H HB   . ILE A 1 79  ? -4.527  -4.824  1.591   1.00 0.00 ? 79  ILE A HB   2  
ATOM 3036  H HG12 . ILE A 1 79  ? -3.011  -2.317  2.347   1.00 0.00 ? 79  ILE A HG12 2  
ATOM 3037  H HG13 . ILE A 1 79  ? -2.385  -3.680  1.425   1.00 0.00 ? 79  ILE A HG13 2  
ATOM 3038  H HG21 . ILE A 1 79  ? -5.907  -3.286  3.518   1.00 0.00 ? 79  ILE A HG21 2  
ATOM 3039  H HG22 . ILE A 1 79  ? -5.491  -2.209  2.185   1.00 0.00 ? 79  ILE A HG22 2  
ATOM 3040  H HG23 . ILE A 1 79  ? -6.408  -3.683  1.874   1.00 0.00 ? 79  ILE A HG23 2  
ATOM 3041  H HD11 . ILE A 1 79  ? -4.772  -2.591  0.221   1.00 0.00 ? 79  ILE A HD11 2  
ATOM 3042  H HD12 . ILE A 1 79  ? -3.514  -1.370  0.415   1.00 0.00 ? 79  ILE A HD12 2  
ATOM 3043  H HD13 . ILE A 1 79  ? -3.172  -2.855  -0.473  1.00 0.00 ? 79  ILE A HD13 2  
ATOM 3044  N N    . ASN A 1 80  ? -5.613  -4.879  5.209   1.00 0.00 ? 80  ASN A N    2  
ATOM 3045  C CA   . ASN A 1 80  ? -6.693  -5.588  5.885   1.00 0.00 ? 80  ASN A CA   2  
ATOM 3046  C C    . ASN A 1 80  ? -6.283  -7.021  6.210   1.00 0.00 ? 80  ASN A C    2  
ATOM 3047  O O    . ASN A 1 80  ? -7.093  -7.943  6.125   1.00 0.00 ? 80  ASN A O    2  
ATOM 3048  C CB   . ASN A 1 80  ? -7.952  -5.591  5.015   1.00 0.00 ? 80  ASN A CB   2  
ATOM 3049  C CG   . ASN A 1 80  ? -9.153  -6.170  5.738   1.00 0.00 ? 80  ASN A CG   2  
ATOM 3050  O OD1  . ASN A 1 80  ? -9.621  -7.261  5.411   1.00 0.00 ? 80  ASN A OD1  2  
ATOM 3051  N ND2  . ASN A 1 80  ? -9.658  -5.440  6.725   1.00 0.00 ? 80  ASN A ND2  2  
ATOM 3052  H H    . ASN A 1 80  ? -5.388  -3.968  5.494   1.00 0.00 ? 80  ASN A H    2  
ATOM 3053  H HA   . ASN A 1 80  ? -6.905  -5.068  6.807   1.00 0.00 ? 80  ASN A HA   2  
ATOM 3054  H HB2  . ASN A 1 80  ? -8.185  -4.576  4.727   1.00 0.00 ? 80  ASN A HB2  2  
ATOM 3055  H HB3  . ASN A 1 80  ? -7.769  -6.179  4.129   1.00 0.00 ? 80  ASN A HB3  2  
ATOM 3056  H HD21 . ASN A 1 80  ? -9.234  -4.581  6.930   1.00 0.00 ? 80  ASN A HD21 2  
ATOM 3057  H HD22 . ASN A 1 80  ? -10.434 -5.792  7.210   1.00 0.00 ? 80  ASN A HD22 2  
ATOM 3058  N N    . ASN A 1 81  ? -5.020  -7.199  6.583   1.00 0.00 ? 81  ASN A N    2  
ATOM 3059  C CA   . ASN A 1 81  ? -4.502  -8.520  6.922   1.00 0.00 ? 81  ASN A CA   2  
ATOM 3060  C C    . ASN A 1 81  ? -4.443  -9.414  5.687   1.00 0.00 ? 81  ASN A C    2  
ATOM 3061  O O    . ASN A 1 81  ? -4.868  -10.568 5.724   1.00 0.00 ? 81  ASN A O    2  
ATOM 3062  C CB   . ASN A 1 81  ? -5.374  -9.173  7.996   1.00 0.00 ? 81  ASN A CB   2  
ATOM 3063  C CG   . ASN A 1 81  ? -5.598  -8.264  9.189   1.00 0.00 ? 81  ASN A CG   2  
ATOM 3064  O OD1  . ASN A 1 81  ? -6.643  -7.624  9.309   1.00 0.00 ? 81  ASN A OD1  2  
ATOM 3065  N ND2  . ASN A 1 81  ? -4.615  -8.204  10.080  1.00 0.00 ? 81  ASN A ND2  2  
ATOM 3066  H H    . ASN A 1 81  ? -4.422  -6.424  6.632   1.00 0.00 ? 81  ASN A H    2  
ATOM 3067  H HA   . ASN A 1 81  ? -3.503  -8.394  7.309   1.00 0.00 ? 81  ASN A HA   2  
ATOM 3068  H HB2  . ASN A 1 81  ? -6.336  -9.419  7.570   1.00 0.00 ? 81  ASN A HB2  2  
ATOM 3069  H HB3  . ASN A 1 81  ? -4.895  -10.077 8.340   1.00 0.00 ? 81  ASN A HB3  2  
ATOM 3070  H HD21 . ASN A 1 81  ? -3.812  -8.742  9.920   1.00 0.00 ? 81  ASN A HD21 2  
ATOM 3071  H HD22 . ASN A 1 81  ? -4.734  -7.625  10.862  1.00 0.00 ? 81  ASN A HD22 2  
ATOM 3072  N N    . GLN A 1 82  ? -3.912  -8.871  4.595   1.00 0.00 ? 82  GLN A N    2  
ATOM 3073  C CA   . GLN A 1 82  ? -3.798  -9.620  3.349   1.00 0.00 ? 82  GLN A CA   2  
ATOM 3074  C C    . GLN A 1 82  ? -2.557  -9.195  2.571   1.00 0.00 ? 82  GLN A C    2  
ATOM 3075  O O    . GLN A 1 82  ? -2.518  -8.111  1.989   1.00 0.00 ? 82  GLN A O    2  
ATOM 3076  C CB   . GLN A 1 82  ? -5.047  -9.416  2.490   1.00 0.00 ? 82  GLN A CB   2  
ATOM 3077  C CG   . GLN A 1 82  ? -6.206  -10.319 2.879   1.00 0.00 ? 82  GLN A CG   2  
ATOM 3078  C CD   . GLN A 1 82  ? -6.188  -11.643 2.140   1.00 0.00 ? 82  GLN A CD   2  
ATOM 3079  O OE1  . GLN A 1 82  ? -5.804  -12.672 2.695   1.00 0.00 ? 82  GLN A OE1  2  
ATOM 3080  N NE2  . GLN A 1 82  ? -6.605  -11.622 0.879   1.00 0.00 ? 82  GLN A NE2  2  
ATOM 3081  H H    . GLN A 1 82  ? -3.591  -7.947  4.629   1.00 0.00 ? 82  GLN A H    2  
ATOM 3082  H HA   . GLN A 1 82  ? -3.710  -10.666 3.598   1.00 0.00 ? 82  GLN A HA   2  
ATOM 3083  H HB2  . GLN A 1 82  ? -5.371  -8.390  2.584   1.00 0.00 ? 82  GLN A HB2  2  
ATOM 3084  H HB3  . GLN A 1 82  ? -4.796  -9.613  1.459   1.00 0.00 ? 82  GLN A HB3  2  
ATOM 3085  H HG2  . GLN A 1 82  ? -6.153  -10.517 3.939   1.00 0.00 ? 82  GLN A HG2  2  
ATOM 3086  H HG3  . GLN A 1 82  ? -7.132  -9.811  2.655   1.00 0.00 ? 82  GLN A HG3  2  
ATOM 3087  H HE21 . GLN A 1 82  ? -6.895  -10.765 0.502   1.00 0.00 ? 82  GLN A HE21 2  
ATOM 3088  H HE22 . GLN A 1 82  ? -6.603  -12.463 0.377   1.00 0.00 ? 82  GLN A HE22 2  
ATOM 3089  N N    . ILE A 1 83  ? -1.544  -10.056 2.566   1.00 0.00 ? 83  ILE A N    2  
ATOM 3090  C CA   . ILE A 1 83  ? -0.302  -9.769  1.859   1.00 0.00 ? 83  ILE A CA   2  
ATOM 3091  C C    . ILE A 1 83  ? -0.533  -9.689  0.354   1.00 0.00 ? 83  ILE A C    2  
ATOM 3092  O O    . ILE A 1 83  ? -1.058  -10.622 -0.256  1.00 0.00 ? 83  ILE A O    2  
ATOM 3093  C CB   . ILE A 1 83  ? 0.769   -10.838 2.147   1.00 0.00 ? 83  ILE A CB   2  
ATOM 3094  C CG1  . ILE A 1 83  ? 1.034   -10.933 3.651   1.00 0.00 ? 83  ILE A CG1  2  
ATOM 3095  C CG2  . ILE A 1 83  ? 2.052   -10.517 1.396   1.00 0.00 ? 83  ILE A CG2  2  
ATOM 3096  C CD1  . ILE A 1 83  ? 2.177   -11.859 4.005   1.00 0.00 ? 83  ILE A CD1  2  
ATOM 3097  H H    . ILE A 1 83  ? -1.635  -10.903 3.049   1.00 0.00 ? 83  ILE A H    2  
ATOM 3098  H HA   . ILE A 1 83  ? 0.067   -8.815  2.208   1.00 0.00 ? 83  ILE A HA   2  
ATOM 3099  H HB   . ILE A 1 83  ? 0.401   -11.789 1.793   1.00 0.00 ? 83  ILE A HB   2  
ATOM 3100  H HG12 . ILE A 1 83  ? 1.272   -9.953  4.031   1.00 0.00 ? 83  ILE A HG12 2  
ATOM 3101  H HG13 . ILE A 1 83  ? 0.145   -11.299 4.143   1.00 0.00 ? 83  ILE A HG13 2  
ATOM 3102  H HG21 . ILE A 1 83  ? 2.778   -10.106 2.083   1.00 0.00 ? 83  ILE A HG21 2  
ATOM 3103  H HG22 . ILE A 1 83  ? 2.447   -11.420 0.956   1.00 0.00 ? 83  ILE A HG22 2  
ATOM 3104  H HG23 . ILE A 1 83  ? 1.845   -9.797  0.619   1.00 0.00 ? 83  ILE A HG23 2  
ATOM 3105  H HD11 . ILE A 1 83  ? 2.901   -11.861 3.204   1.00 0.00 ? 83  ILE A HD11 2  
ATOM 3106  H HD12 . ILE A 1 83  ? 2.647   -11.519 4.916   1.00 0.00 ? 83  ILE A HD12 2  
ATOM 3107  H HD13 . ILE A 1 83  ? 1.797   -12.861 4.148   1.00 0.00 ? 83  ILE A HD13 2  
ATOM 3108  N N    . LEU A 1 84  ? -0.135  -8.570  -0.241  1.00 0.00 ? 84  LEU A N    2  
ATOM 3109  C CA   . LEU A 1 84  ? -0.296  -8.367  -1.677  1.00 0.00 ? 84  LEU A CA   2  
ATOM 3110  C C    . LEU A 1 84  ? 0.951   -8.813  -2.433  1.00 0.00 ? 84  LEU A C    2  
ATOM 3111  O O    . LEU A 1 84  ? 0.865   -9.298  -3.561  1.00 0.00 ? 84  LEU A O    2  
ATOM 3112  C CB   . LEU A 1 84  ? -0.589  -6.896  -1.975  1.00 0.00 ? 84  LEU A CB   2  
ATOM 3113  C CG   . LEU A 1 84  ? -1.563  -6.199  -1.024  1.00 0.00 ? 84  LEU A CG   2  
ATOM 3114  C CD1  . LEU A 1 84  ? -1.558  -4.697  -1.261  1.00 0.00 ? 84  LEU A CD1  2  
ATOM 3115  C CD2  . LEU A 1 84  ? -2.967  -6.763  -1.193  1.00 0.00 ? 84  LEU A CD2  2  
ATOM 3116  H H    . LEU A 1 84  ? 0.276   -7.862  0.297   1.00 0.00 ? 84  LEU A H    2  
ATOM 3117  H HA   . LEU A 1 84  ? -1.134  -8.966  -2.003  1.00 0.00 ? 84  LEU A HA   2  
ATOM 3118  H HB2  . LEU A 1 84  ? 0.347   -6.359  -1.940  1.00 0.00 ? 84  LEU A HB2  2  
ATOM 3119  H HB3  . LEU A 1 84  ? -0.999  -6.836  -2.973  1.00 0.00 ? 84  LEU A HB3  2  
ATOM 3120  H HG   . LEU A 1 84  ? -1.251  -6.377  -0.004  1.00 0.00 ? 84  LEU A HG   2  
ATOM 3121  H HD11 . LEU A 1 84  ? -1.525  -4.183  -0.313  1.00 0.00 ? 84  LEU A HD11 2  
ATOM 3122  H HD12 . LEU A 1 84  ? -2.454  -4.413  -1.793  1.00 0.00 ? 84  LEU A HD12 2  
ATOM 3123  H HD13 . LEU A 1 84  ? -0.692  -4.428  -1.848  1.00 0.00 ? 84  LEU A HD13 2  
ATOM 3124  H HD21 . LEU A 1 84  ? -3.021  -7.324  -2.114  1.00 0.00 ? 84  LEU A HD21 2  
ATOM 3125  H HD22 . LEU A 1 84  ? -3.679  -5.951  -1.224  1.00 0.00 ? 84  LEU A HD22 2  
ATOM 3126  H HD23 . LEU A 1 84  ? -3.196  -7.412  -0.361  1.00 0.00 ? 84  LEU A HD23 2  
ATOM 3127  N N    . TYR A 1 85  ? 2.109   -8.647  -1.803  1.00 0.00 ? 85  TYR A N    2  
ATOM 3128  C CA   . TYR A 1 85  ? 3.374   -9.032  -2.416  1.00 0.00 ? 85  TYR A CA   2  
ATOM 3129  C C    . TYR A 1 85  ? 3.211   -10.295 -3.257  1.00 0.00 ? 85  TYR A C    2  
ATOM 3130  O O    . TYR A 1 85  ? 3.211   -11.408 -2.733  1.00 0.00 ? 85  TYR A O    2  
ATOM 3131  C CB   . TYR A 1 85  ? 4.439   -9.257  -1.340  1.00 0.00 ? 85  TYR A CB   2  
ATOM 3132  C CG   . TYR A 1 85  ? 5.819   -9.519  -1.900  1.00 0.00 ? 85  TYR A CG   2  
ATOM 3133  C CD1  . TYR A 1 85  ? 6.229   -10.809 -2.213  1.00 0.00 ? 85  TYR A CD1  2  
ATOM 3134  C CD2  . TYR A 1 85  ? 6.713   -8.477  -2.114  1.00 0.00 ? 85  TYR A CD2  2  
ATOM 3135  C CE1  . TYR A 1 85  ? 7.489   -11.054 -2.724  1.00 0.00 ? 85  TYR A CE1  2  
ATOM 3136  C CE2  . TYR A 1 85  ? 7.974   -8.712  -2.625  1.00 0.00 ? 85  TYR A CE2  2  
ATOM 3137  C CZ   . TYR A 1 85  ? 8.358   -10.002 -2.929  1.00 0.00 ? 85  TYR A CZ   2  
ATOM 3138  O OH   . TYR A 1 85  ? 9.614   -10.240 -3.437  1.00 0.00 ? 85  TYR A OH   2  
ATOM 3139  H H    . TYR A 1 85  ? 2.113   -8.255  -0.905  1.00 0.00 ? 85  TYR A H    2  
ATOM 3140  H HA   . TYR A 1 85  ? 3.691   -8.224  -3.059  1.00 0.00 ? 85  TYR A HA   2  
ATOM 3141  H HB2  . TYR A 1 85  ? 4.497   -8.381  -0.713  1.00 0.00 ? 85  TYR A HB2  2  
ATOM 3142  H HB3  . TYR A 1 85  ? 4.158   -10.108 -0.738  1.00 0.00 ? 85  TYR A HB3  2  
ATOM 3143  H HD1  . TYR A 1 85  ? 5.546   -11.631 -2.052  1.00 0.00 ? 85  TYR A HD1  2  
ATOM 3144  H HD2  . TYR A 1 85  ? 6.409   -7.468  -1.875  1.00 0.00 ? 85  TYR A HD2  2  
ATOM 3145  H HE1  . TYR A 1 85  ? 7.790   -12.063 -2.962  1.00 0.00 ? 85  TYR A HE1  2  
ATOM 3146  H HE2  . TYR A 1 85  ? 8.655   -7.889  -2.785  1.00 0.00 ? 85  TYR A HE2  2  
ATOM 3147  H HH   . TYR A 1 85  ? 9.672   -11.152 -3.732  1.00 0.00 ? 85  TYR A HH   2  
ATOM 3148  N N    . GLY A 1 86  ? 3.071   -10.112 -4.566  1.00 0.00 ? 86  GLY A N    2  
ATOM 3149  C CA   . GLY A 1 86  ? 2.909   -11.244 -5.460  1.00 0.00 ? 86  GLY A CA   2  
ATOM 3150  C C    . GLY A 1 86  ? 1.570   -11.234 -6.171  1.00 0.00 ? 86  GLY A C    2  
ATOM 3151  O O    . GLY A 1 86  ? 1.161   -12.239 -6.752  1.00 0.00 ? 86  GLY A O    2  
ATOM 3152  H H    . GLY A 1 86  ? 3.079   -9.201  -4.928  1.00 0.00 ? 86  GLY A H    2  
ATOM 3153  H HA2  . GLY A 1 86  ? 3.697   -11.221 -6.198  1.00 0.00 ? 86  GLY A HA2  2  
ATOM 3154  H HA3  . GLY A 1 86  ? 2.992   -12.155 -4.887  1.00 0.00 ? 86  GLY A HA3  2  
ATOM 3155  N N    . ARG A 1 87  ? 0.885   -10.096 -6.123  1.00 0.00 ? 87  ARG A N    2  
ATOM 3156  C CA   . ARG A 1 87  ? -0.417  -9.961  -6.765  1.00 0.00 ? 87  ARG A CA   2  
ATOM 3157  C C    . ARG A 1 87  ? -0.465  -8.711  -7.639  1.00 0.00 ? 87  ARG A C    2  
ATOM 3158  O O    . ARG A 1 87  ? 0.460   -7.900  -7.630  1.00 0.00 ? 87  ARG A O    2  
ATOM 3159  C CB   . ARG A 1 87  ? -1.525  -9.903  -5.711  1.00 0.00 ? 87  ARG A CB   2  
ATOM 3160  C CG   . ARG A 1 87  ? -1.622  -11.158 -4.860  1.00 0.00 ? 87  ARG A CG   2  
ATOM 3161  C CD   . ARG A 1 87  ? -2.774  -11.073 -3.871  1.00 0.00 ? 87  ARG A CD   2  
ATOM 3162  N NE   . ARG A 1 87  ? -4.030  -11.541 -4.452  1.00 0.00 ? 87  ARG A NE   2  
ATOM 3163  C CZ   . ARG A 1 87  ? -4.260  -12.807 -4.781  1.00 0.00 ? 87  ARG A CZ   2  
ATOM 3164  N NH1  . ARG A 1 87  ? -3.325  -13.727 -4.586  1.00 0.00 ? 87  ARG A NH1  2  
ATOM 3165  N NH2  . ARG A 1 87  ? -5.428  -13.156 -5.305  1.00 0.00 ? 87  ARG A NH2  2  
ATOM 3166  H H    . ARG A 1 87  ? 1.263   -9.329  -5.644  1.00 0.00 ? 87  ARG A H    2  
ATOM 3167  H HA   . ARG A 1 87  ? -0.571  -10.829 -7.389  1.00 0.00 ? 87  ARG A HA   2  
ATOM 3168  H HB2  . ARG A 1 87  ? -1.340  -9.064  -5.057  1.00 0.00 ? 87  ARG A HB2  2  
ATOM 3169  H HB3  . ARG A 1 87  ? -2.472  -9.759  -6.210  1.00 0.00 ? 87  ARG A HB3  2  
ATOM 3170  H HG2  . ARG A 1 87  ? -1.779  -12.009 -5.505  1.00 0.00 ? 87  ARG A HG2  2  
ATOM 3171  H HG3  . ARG A 1 87  ? -0.699  -11.283 -4.314  1.00 0.00 ? 87  ARG A HG3  2  
ATOM 3172  H HD2  . ARG A 1 87  ? -2.539  -11.681 -3.010  1.00 0.00 ? 87  ARG A HD2  2  
ATOM 3173  H HD3  . ARG A 1 87  ? -2.892  -10.044 -3.564  1.00 0.00 ? 87  ARG A HD3  2  
ATOM 3174  H HE   . ARG A 1 87  ? -4.734  -10.878 -4.605  1.00 0.00 ? 87  ARG A HE   2  
ATOM 3175  H HH11 . ARG A 1 87  ? -2.445  -13.467 -4.190  1.00 0.00 ? 87  ARG A HH11 2  
ATOM 3176  H HH12 . ARG A 1 87  ? -3.502  -14.680 -4.834  1.00 0.00 ? 87  ARG A HH12 2  
ATOM 3177  H HH21 . ARG A 1 87  ? -6.136  -12.465 -5.453  1.00 0.00 ? 87  ARG A HH21 2  
ATOM 3178  H HH22 . ARG A 1 87  ? -5.601  -14.108 -5.552  1.00 0.00 ? 87  ARG A HH22 2  
ATOM 3179  N N    . SER A 1 88  ? -1.550  -8.564  -8.392  1.00 0.00 ? 88  SER A N    2  
ATOM 3180  C CA   . SER A 1 88  ? -1.718  -7.416  -9.275  1.00 0.00 ? 88  SER A CA   2  
ATOM 3181  C C    . SER A 1 88  ? -2.397  -6.262  -8.543  1.00 0.00 ? 88  SER A C    2  
ATOM 3182  O O    . SER A 1 88  ? -3.206  -6.475  -7.640  1.00 0.00 ? 88  SER A O    2  
ATOM 3183  C CB   . SER A 1 88  ? -2.538  -7.807  -10.506 1.00 0.00 ? 88  SER A CB   2  
ATOM 3184  O OG   . SER A 1 88  ? -2.670  -6.715  -11.399 1.00 0.00 ? 88  SER A OG   2  
ATOM 3185  H H    . SER A 1 88  ? -2.254  -9.245  -8.355  1.00 0.00 ? 88  SER A H    2  
ATOM 3186  H HA   . SER A 1 88  ? -0.736  -7.097  -9.594  1.00 0.00 ? 88  SER A HA   2  
ATOM 3187  H HB2  . SER A 1 88  ? -2.046  -8.619  -11.020 1.00 0.00 ? 88  SER A HB2  2  
ATOM 3188  H HB3  . SER A 1 88  ? -3.523  -8.122  -10.193 1.00 0.00 ? 88  SER A HB3  2  
ATOM 3189  H HG   . SER A 1 88  ? -3.465  -6.826  -11.926 1.00 0.00 ? 88  SER A HG   2  
ATOM 3190  N N    . HIS A 1 89  ? -2.060  -5.038  -8.940  1.00 0.00 ? 89  HIS A N    2  
ATOM 3191  C CA   . HIS A 1 89  ? -2.637  -3.849  -8.323  1.00 0.00 ? 89  HIS A CA   2  
ATOM 3192  C C    . HIS A 1 89  ? -4.162  -3.915  -8.337  1.00 0.00 ? 89  HIS A C    2  
ATOM 3193  O O    . HIS A 1 89  ? -4.824  -3.343  -7.472  1.00 0.00 ? 89  HIS A O    2  
ATOM 3194  C CB   . HIS A 1 89  ? -2.162  -2.590  -9.049  1.00 0.00 ? 89  HIS A CB   2  
ATOM 3195  C CG   . HIS A 1 89  ? -2.448  -2.604  -10.519 1.00 0.00 ? 89  HIS A CG   2  
ATOM 3196  N ND1  . HIS A 1 89  ? -3.660  -2.223  -11.054 1.00 0.00 ? 89  HIS A ND1  2  
ATOM 3197  C CD2  . HIS A 1 89  ? -1.668  -2.953  -11.569 1.00 0.00 ? 89  HIS A CD2  2  
ATOM 3198  C CE1  . HIS A 1 89  ? -3.615  -2.340  -12.369 1.00 0.00 ? 89  HIS A CE1  2  
ATOM 3199  N NE2  . HIS A 1 89  ? -2.416  -2.780  -12.707 1.00 0.00 ? 89  HIS A NE2  2  
ATOM 3200  H H    . HIS A 1 89  ? -1.410  -4.933  -9.665  1.00 0.00 ? 89  HIS A H    2  
ATOM 3201  H HA   . HIS A 1 89  ? -2.301  -3.811  -7.298  1.00 0.00 ? 89  HIS A HA   2  
ATOM 3202  H HB2  . HIS A 1 89  ? -2.657  -1.729  -8.624  1.00 0.00 ? 89  HIS A HB2  2  
ATOM 3203  H HB3  . HIS A 1 89  ? -1.095  -2.488  -8.918  1.00 0.00 ? 89  HIS A HB3  2  
ATOM 3204  H HD1  . HIS A 1 89  ? -4.439  -1.915  -10.546 1.00 0.00 ? 89  HIS A HD1  2  
ATOM 3205  H HD2  . HIS A 1 89  ? -0.646  -3.303  -11.521 1.00 0.00 ? 89  HIS A HD2  2  
ATOM 3206  H HE1  . HIS A 1 89  ? -4.420  -2.113  -13.052 1.00 0.00 ? 89  HIS A HE1  2  
ATOM 3207  H HE2  . HIS A 1 89  ? -2.144  -3.035  -13.613 1.00 0.00 ? 89  HIS A HE2  2  
ATOM 3208  N N    . GLN A 1 90  ? -4.710  -4.615  -9.325  1.00 0.00 ? 90  GLN A N    2  
ATOM 3209  C CA   . GLN A 1 90  ? -6.156  -4.753  -9.452  1.00 0.00 ? 90  GLN A CA   2  
ATOM 3210  C C    . GLN A 1 90  ? -6.736  -5.517  -8.266  1.00 0.00 ? 90  GLN A C    2  
ATOM 3211  O O    . GLN A 1 90  ? -7.828  -5.209  -7.792  1.00 0.00 ? 90  GLN A O    2  
ATOM 3212  C CB   . GLN A 1 90  ? -6.508  -5.469  -10.757 1.00 0.00 ? 90  GLN A CB   2  
ATOM 3213  C CG   . GLN A 1 90  ? -6.652  -4.533  -11.946 1.00 0.00 ? 90  GLN A CG   2  
ATOM 3214  C CD   . GLN A 1 90  ? -8.038  -3.928  -12.047 1.00 0.00 ? 90  GLN A CD   2  
ATOM 3215  O OE1  . GLN A 1 90  ? -8.977  -4.572  -12.516 1.00 0.00 ? 90  GLN A OE1  2  
ATOM 3216  N NE2  . GLN A 1 90  ? -8.175  -2.682  -11.607 1.00 0.00 ? 90  GLN A NE2  2  
ATOM 3217  H H    . GLN A 1 90  ? -4.128  -5.047  -9.984  1.00 0.00 ? 90  GLN A H    2  
ATOM 3218  H HA   . GLN A 1 90  ? -6.583  -3.762  -9.470  1.00 0.00 ? 90  GLN A HA   2  
ATOM 3219  H HB2  . GLN A 1 90  ? -5.732  -6.185  -10.982 1.00 0.00 ? 90  GLN A HB2  2  
ATOM 3220  H HB3  . GLN A 1 90  ? -7.443  -5.994  -10.625 1.00 0.00 ? 90  GLN A HB3  2  
ATOM 3221  H HG2  . GLN A 1 90  ? -5.934  -3.732  -11.846 1.00 0.00 ? 90  GLN A HG2  2  
ATOM 3222  H HG3  . GLN A 1 90  ? -6.449  -5.086  -12.850 1.00 0.00 ? 90  GLN A HG3  2  
ATOM 3223  H HE21 . GLN A 1 90  ? -7.383  -2.230  -11.247 1.00 0.00 ? 90  GLN A HE21 2  
ATOM 3224  H HE22 . GLN A 1 90  ? -9.060  -2.267  -11.661 1.00 0.00 ? 90  GLN A HE22 2  
ATOM 3225  N N    . ASN A 1 91  ? -5.997  -6.514  -7.793  1.00 0.00 ? 91  ASN A N    2  
ATOM 3226  C CA   . ASN A 1 91  ? -6.438  -7.323  -6.662  1.00 0.00 ? 91  ASN A CA   2  
ATOM 3227  C C    . ASN A 1 91  ? -6.417  -6.511  -5.371  1.00 0.00 ? 91  ASN A C    2  
ATOM 3228  O O    . ASN A 1 91  ? -7.348  -6.577  -4.569  1.00 0.00 ? 91  ASN A O    2  
ATOM 3229  C CB   . ASN A 1 91  ? -5.550  -8.560  -6.515  1.00 0.00 ? 91  ASN A CB   2  
ATOM 3230  C CG   . ASN A 1 91  ? -5.743  -9.549  -7.648  1.00 0.00 ? 91  ASN A CG   2  
ATOM 3231  O OD1  . ASN A 1 91  ? -6.385  -9.241  -8.653  1.00 0.00 ? 91  ASN A OD1  2  
ATOM 3232  N ND2  . ASN A 1 91  ? -5.186  -10.744 -7.491  1.00 0.00 ? 91  ASN A ND2  2  
ATOM 3233  H H    . ASN A 1 91  ? -5.134  -6.712  -8.213  1.00 0.00 ? 91  ASN A H    2  
ATOM 3234  H HA   . ASN A 1 91  ? -7.452  -7.640  -6.858  1.00 0.00 ? 91  ASN A HA   2  
ATOM 3235  H HB2  . ASN A 1 91  ? -4.514  -8.252  -6.504  1.00 0.00 ? 91  ASN A HB2  2  
ATOM 3236  H HB3  . ASN A 1 91  ? -5.783  -9.055  -5.585  1.00 0.00 ? 91  ASN A HB3  2  
ATOM 3237  H HD21 . ASN A 1 91  ? -4.689  -10.919 -6.665  1.00 0.00 ? 91  ASN A HD21 2  
ATOM 3238  H HD22 . ASN A 1 91  ? -5.295  -11.403 -8.209  1.00 0.00 ? 91  ASN A HD22 2  
ATOM 3239  N N    . ALA A 1 92  ? -5.349  -5.744  -5.178  1.00 0.00 ? 92  ALA A N    2  
ATOM 3240  C CA   . ALA A 1 92  ? -5.207  -4.917  -3.986  1.00 0.00 ? 92  ALA A CA   2  
ATOM 3241  C C    . ALA A 1 92  ? -6.503  -4.177  -3.674  1.00 0.00 ? 92  ALA A C    2  
ATOM 3242  O O    . ALA A 1 92  ? -7.079  -4.340  -2.599  1.00 0.00 ? 92  ALA A O    2  
ATOM 3243  C CB   . ALA A 1 92  ? -4.063  -3.930  -4.162  1.00 0.00 ? 92  ALA A CB   2  
ATOM 3244  H H    . ALA A 1 92  ? -4.640  -5.734  -5.854  1.00 0.00 ? 92  ALA A H    2  
ATOM 3245  H HA   . ALA A 1 92  ? -4.966  -5.566  -3.157  1.00 0.00 ? 92  ALA A HA   2  
ATOM 3246  H HB1  . ALA A 1 92  ? -3.864  -3.795  -5.215  1.00 0.00 ? 92  ALA A HB1  2  
ATOM 3247  H HB2  . ALA A 1 92  ? -4.334  -2.982  -3.722  1.00 0.00 ? 92  ALA A HB2  2  
ATOM 3248  H HB3  . ALA A 1 92  ? -3.179  -4.314  -3.675  1.00 0.00 ? 92  ALA A HB3  2  
ATOM 3249  N N    . SER A 1 93  ? -6.957  -3.363  -4.622  1.00 0.00 ? 93  SER A N    2  
ATOM 3250  C CA   . SER A 1 93  ? -8.184  -2.594  -4.446  1.00 0.00 ? 93  SER A CA   2  
ATOM 3251  C C    . SER A 1 93  ? -9.341  -3.503  -4.044  1.00 0.00 ? 93  SER A C    2  
ATOM 3252  O O    . SER A 1 93  ? -10.150 -3.153  -3.185  1.00 0.00 ? 93  SER A O    2  
ATOM 3253  C CB   . SER A 1 93  ? -8.531  -1.846  -5.734  1.00 0.00 ? 93  SER A CB   2  
ATOM 3254  O OG   . SER A 1 93  ? -8.979  -2.740  -6.738  1.00 0.00 ? 93  SER A OG   2  
ATOM 3255  H H    . SER A 1 93  ? -6.453  -3.275  -5.458  1.00 0.00 ? 93  SER A H    2  
ATOM 3256  H HA   . SER A 1 93  ? -8.014  -1.876  -3.657  1.00 0.00 ? 93  SER A HA   2  
ATOM 3257  H HB2  . SER A 1 93  ? -9.312  -1.129  -5.532  1.00 0.00 ? 93  SER A HB2  2  
ATOM 3258  H HB3  . SER A 1 93  ? -7.653  -1.329  -6.095  1.00 0.00 ? 93  SER A HB3  2  
ATOM 3259  H HG   . SER A 1 93  ? -9.311  -2.239  -7.487  1.00 0.00 ? 93  SER A HG   2  
ATOM 3260  N N    . ALA A 1 94  ? -9.414  -4.671  -4.674  1.00 0.00 ? 94  ALA A N    2  
ATOM 3261  C CA   . ALA A 1 94  ? -10.471 -5.631  -4.382  1.00 0.00 ? 94  ALA A CA   2  
ATOM 3262  C C    . ALA A 1 94  ? -10.500 -5.982  -2.898  1.00 0.00 ? 94  ALA A C    2  
ATOM 3263  O O    . ALA A 1 94  ? -11.567 -6.051  -2.288  1.00 0.00 ? 94  ALA A O    2  
ATOM 3264  C CB   . ALA A 1 94  ? -10.288 -6.888  -5.219  1.00 0.00 ? 94  ALA A CB   2  
ATOM 3265  H H    . ALA A 1 94  ? -8.740  -4.892  -5.349  1.00 0.00 ? 94  ALA A H    2  
ATOM 3266  H HA   . ALA A 1 94  ? -11.415 -5.182  -4.653  1.00 0.00 ? 94  ALA A HA   2  
ATOM 3267  H HB1  . ALA A 1 94  ? -9.440  -6.762  -5.877  1.00 0.00 ? 94  ALA A HB1  2  
ATOM 3268  H HB2  . ALA A 1 94  ? -10.117 -7.733  -4.569  1.00 0.00 ? 94  ALA A HB2  2  
ATOM 3269  H HB3  . ALA A 1 94  ? -11.177 -7.061  -5.808  1.00 0.00 ? 94  ALA A HB3  2  
ATOM 3270  N N    . ILE A 1 95  ? -9.322  -6.202  -2.324  1.00 0.00 ? 95  ILE A N    2  
ATOM 3271  C CA   . ILE A 1 95  ? -9.213  -6.545  -0.911  1.00 0.00 ? 95  ILE A CA   2  
ATOM 3272  C C    . ILE A 1 95  ? -9.742  -5.419  -0.030  1.00 0.00 ? 95  ILE A C    2  
ATOM 3273  O O    . ILE A 1 95  ? -10.443 -5.663  0.953   1.00 0.00 ? 95  ILE A O    2  
ATOM 3274  C CB   . ILE A 1 95  ? -7.756  -6.849  -0.516  1.00 0.00 ? 95  ILE A CB   2  
ATOM 3275  C CG1  . ILE A 1 95  ? -7.205  -7.999  -1.362  1.00 0.00 ? 95  ILE A CG1  2  
ATOM 3276  C CG2  . ILE A 1 95  ? -7.667  -7.184  0.965   1.00 0.00 ? 95  ILE A CG2  2  
ATOM 3277  C CD1  . ILE A 1 95  ? -5.696  -8.105  -1.328  1.00 0.00 ? 95  ILE A CD1  2  
ATOM 3278  H H    . ILE A 1 95  ? -8.507  -6.132  -2.863  1.00 0.00 ? 95  ILE A H    2  
ATOM 3279  H HA   . ILE A 1 95  ? -9.805  -7.432  -0.738  1.00 0.00 ? 95  ILE A HA   2  
ATOM 3280  H HB   . ILE A 1 95  ? -7.165  -5.964  -0.697  1.00 0.00 ? 95  ILE A HB   2  
ATOM 3281  H HG12 . ILE A 1 95  ? -7.611  -8.930  -1.001  1.00 0.00 ? 95  ILE A HG12 2  
ATOM 3282  H HG13 . ILE A 1 95  ? -7.504  -7.855  -2.390  1.00 0.00 ? 95  ILE A HG13 2  
ATOM 3283  H HG21 . ILE A 1 95  ? -8.565  -6.849  1.464   1.00 0.00 ? 95  ILE A HG21 2  
ATOM 3284  H HG22 . ILE A 1 95  ? -7.567  -8.252  1.086   1.00 0.00 ? 95  ILE A HG22 2  
ATOM 3285  H HG23 . ILE A 1 95  ? -6.810  -6.690  1.396   1.00 0.00 ? 95  ILE A HG23 2  
ATOM 3286  H HD11 . ILE A 1 95  ? -5.303  -7.980  -2.326  1.00 0.00 ? 95  ILE A HD11 2  
ATOM 3287  H HD12 . ILE A 1 95  ? -5.295  -7.338  -0.682  1.00 0.00 ? 95  ILE A HD12 2  
ATOM 3288  H HD13 . ILE A 1 95  ? -5.413  -9.077  -0.950  1.00 0.00 ? 95  ILE A HD13 2  
ATOM 3289  N N    . ILE A 1 96  ? -9.404  -4.185  -0.389  1.00 0.00 ? 96  ILE A N    2  
ATOM 3290  C CA   . ILE A 1 96  ? -9.848  -3.021  0.367   1.00 0.00 ? 96  ILE A CA   2  
ATOM 3291  C C    . ILE A 1 96  ? -11.366 -2.881  0.321   1.00 0.00 ? 96  ILE A C    2  
ATOM 3292  O O    . ILE A 1 96  ? -12.009 -2.622  1.338   1.00 0.00 ? 96  ILE A O    2  
ATOM 3293  C CB   . ILE A 1 96  ? -9.208  -1.726  -0.166  1.00 0.00 ? 96  ILE A CB   2  
ATOM 3294  C CG1  . ILE A 1 96  ? -7.712  -1.701  0.154   1.00 0.00 ? 96  ILE A CG1  2  
ATOM 3295  C CG2  . ILE A 1 96  ? -9.902  -0.509  0.428   1.00 0.00 ? 96  ILE A CG2  2  
ATOM 3296  C CD1  . ILE A 1 96  ? -6.938  -0.685  -0.655  1.00 0.00 ? 96  ILE A CD1  2  
ATOM 3297  H H    . ILE A 1 96  ? -8.844  -4.055  -1.183  1.00 0.00 ? 96  ILE A H    2  
ATOM 3298  H HA   . ILE A 1 96  ? -9.541  -3.155  1.394   1.00 0.00 ? 96  ILE A HA   2  
ATOM 3299  H HB   . ILE A 1 96  ? -9.341  -1.699  -1.237  1.00 0.00 ? 96  ILE A HB   2  
ATOM 3300  H HG12 . ILE A 1 96  ? -7.577  -1.466  1.198   1.00 0.00 ? 96  ILE A HG12 2  
ATOM 3301  H HG13 . ILE A 1 96  ? -7.293  -2.677  -0.048  1.00 0.00 ? 96  ILE A HG13 2  
ATOM 3302  H HG21 . ILE A 1 96  ? -9.979  -0.626  1.499   1.00 0.00 ? 96  ILE A HG21 2  
ATOM 3303  H HG22 . ILE A 1 96  ? -9.327  0.377   0.204   1.00 0.00 ? 96  ILE A HG22 2  
ATOM 3304  H HG23 . ILE A 1 96  ? -10.890 -0.414  0.003   1.00 0.00 ? 96  ILE A HG23 2  
ATOM 3305  H HD11 . ILE A 1 96  ? -7.202  -0.777  -1.698  1.00 0.00 ? 96  ILE A HD11 2  
ATOM 3306  H HD12 . ILE A 1 96  ? -7.177  0.309   -0.309  1.00 0.00 ? 96  ILE A HD12 2  
ATOM 3307  H HD13 . ILE A 1 96  ? -5.878  -0.862  -0.536  1.00 0.00 ? 96  ILE A HD13 2  
ATOM 3308  N N    . LYS A 1 97  ? -11.935 -3.056  -0.868  1.00 0.00 ? 97  LYS A N    2  
ATOM 3309  C CA   . LYS A 1 97  ? -13.378 -2.952  -1.048  1.00 0.00 ? 97  LYS A CA   2  
ATOM 3310  C C    . LYS A 1 97  ? -14.115 -3.872  -0.080  1.00 0.00 ? 97  LYS A C    2  
ATOM 3311  O O    . LYS A 1 97  ? -15.119 -3.485  0.519   1.00 0.00 ? 97  LYS A O    2  
ATOM 3312  C CB   . LYS A 1 97  ? -13.758 -3.301  -2.489  1.00 0.00 ? 97  LYS A CB   2  
ATOM 3313  C CG   . LYS A 1 97  ? -15.000 -2.579  -2.982  1.00 0.00 ? 97  LYS A CG   2  
ATOM 3314  C CD   . LYS A 1 97  ? -15.178 -2.736  -4.483  1.00 0.00 ? 97  LYS A CD   2  
ATOM 3315  C CE   . LYS A 1 97  ? -14.194 -1.870  -5.255  1.00 0.00 ? 97  LYS A CE   2  
ATOM 3316  N NZ   . LYS A 1 97  ? -14.721 -1.494  -6.596  1.00 0.00 ? 97  LYS A NZ   2  
ATOM 3317  H H    . LYS A 1 97  ? -11.369 -3.260  -1.642  1.00 0.00 ? 97  LYS A H    2  
ATOM 3318  H HA   . LYS A 1 97  ? -13.665 -1.932  -0.846  1.00 0.00 ? 97  LYS A HA   2  
ATOM 3319  H HB2  . LYS A 1 97  ? -12.935 -3.043  -3.139  1.00 0.00 ? 97  LYS A HB2  2  
ATOM 3320  H HB3  . LYS A 1 97  ? -13.937 -4.365  -2.554  1.00 0.00 ? 97  LYS A HB3  2  
ATOM 3321  H HG2  . LYS A 1 97  ? -15.866 -2.988  -2.483  1.00 0.00 ? 97  LYS A HG2  2  
ATOM 3322  H HG3  . LYS A 1 97  ? -14.910 -1.527  -2.748  1.00 0.00 ? 97  LYS A HG3  2  
ATOM 3323  H HD2  . LYS A 1 97  ? -15.015 -3.770  -4.749  1.00 0.00 ? 97  LYS A HD2  2  
ATOM 3324  H HD3  . LYS A 1 97  ? -16.185 -2.448  -4.750  1.00 0.00 ? 97  LYS A HD3  2  
ATOM 3325  H HE2  . LYS A 1 97  ? -14.003 -0.972  -4.688  1.00 0.00 ? 97  LYS A HE2  2  
ATOM 3326  H HE3  . LYS A 1 97  ? -13.273 -2.419  -5.381  1.00 0.00 ? 97  LYS A HE3  2  
ATOM 3327  H HZ1  . LYS A 1 97  ? -14.922 -0.473  -6.627  1.00 0.00 ? 97  LYS A HZ1  2  
ATOM 3328  H HZ2  . LYS A 1 97  ? -15.599 -2.014  -6.794  1.00 0.00 ? 97  LYS A HZ2  2  
ATOM 3329  H HZ3  . LYS A 1 97  ? -14.022 -1.721  -7.331  1.00 0.00 ? 97  LYS A HZ3  2  
ATOM 3330  N N    . THR A 1 98  ? -13.609 -5.093  0.071   1.00 0.00 ? 98  THR A N    2  
ATOM 3331  C CA   . THR A 1 98  ? -14.219 -6.067  0.967   1.00 0.00 ? 98  THR A CA   2  
ATOM 3332  C C    . THR A 1 98  ? -13.923 -5.734  2.425   1.00 0.00 ? 98  THR A C    2  
ATOM 3333  O O    . THR A 1 98  ? -14.671 -6.119  3.323   1.00 0.00 ? 98  THR A O    2  
ATOM 3334  C CB   . THR A 1 98  ? -13.722 -7.494  0.667   1.00 0.00 ? 98  THR A CB   2  
ATOM 3335  O OG1  . THR A 1 98  ? -12.313 -7.583  0.910   1.00 0.00 ? 98  THR A OG1  2  
ATOM 3336  C CG2  . THR A 1 98  ? -14.018 -7.878  -0.775  1.00 0.00 ? 98  THR A CG2  2  
ATOM 3337  H H    . THR A 1 98  ? -12.807 -5.342  -0.434  1.00 0.00 ? 98  THR A H    2  
ATOM 3338  H HA   . THR A 1 98  ? -15.287 -6.041  0.811   1.00 0.00 ? 98  THR A HA   2  
ATOM 3339  H HB   . THR A 1 98  ? -14.237 -8.183  1.321   1.00 0.00 ? 98  THR A HB   2  
ATOM 3340  H HG1  . THR A 1 98  ? -11.866 -6.855  0.472   1.00 0.00 ? 98  THR A HG1  2  
ATOM 3341  H HG21 . THR A 1 98  ? -13.244 -8.538  -1.138  1.00 0.00 ? 98  THR A HG21 2  
ATOM 3342  H HG22 . THR A 1 98  ? -14.049 -6.988  -1.385  1.00 0.00 ? 98  THR A HG22 2  
ATOM 3343  H HG23 . THR A 1 98  ? -14.972 -8.382  -0.823  1.00 0.00 ? 98  THR A HG23 2  
ATOM 3344  N N    . ALA A 1 99  ? -12.828 -5.016  2.653   1.00 0.00 ? 99  ALA A N    2  
ATOM 3345  C CA   . ALA A 1 99  ? -12.435 -4.629  4.002   1.00 0.00 ? 99  ALA A CA   2  
ATOM 3346  C C    . ALA A 1 99  ? -13.385 -3.581  4.571   1.00 0.00 ? 99  ALA A C    2  
ATOM 3347  O O    . ALA A 1 99  ? -13.991 -2.796  3.841   1.00 0.00 ? 99  ALA A O    2  
ATOM 3348  C CB   . ALA A 1 99  ? -11.006 -4.108  4.007   1.00 0.00 ? 99  ALA A CB   2  
ATOM 3349  H H    . ALA A 1 99  ? -12.272 -4.739  1.895   1.00 0.00 ? 99  ALA A H    2  
ATOM 3350  H HA   . ALA A 1 99  ? -12.473 -5.511  4.626   1.00 0.00 ? 99  ALA A HA   2  
ATOM 3351  H HB1  . ALA A 1 99  ? -10.343 -4.875  3.634   1.00 0.00 ? 99  ALA A HB1  2  
ATOM 3352  H HB2  . ALA A 1 99  ? -10.940 -3.235  3.374   1.00 0.00 ? 99  ALA A HB2  2  
ATOM 3353  H HB3  . ALA A 1 99  ? -10.723 -3.844  5.015   1.00 0.00 ? 99  ALA A HB3  2  
ATOM 3354  N N    . PRO A 1 100 ? -13.521 -3.565  5.905   1.00 0.00 ? 100 PRO A N    2  
ATOM 3355  C CA   . PRO A 1 100 ? -14.396 -2.617  6.601   1.00 0.00 ? 100 PRO A CA   2  
ATOM 3356  C C    . PRO A 1 100 ? -13.868 -1.188  6.540   1.00 0.00 ? 100 PRO A C    2  
ATOM 3357  O O    . PRO A 1 100 ? -12.753 -0.947  6.076   1.00 0.00 ? 100 PRO A O    2  
ATOM 3358  C CB   . PRO A 1 100 ? -14.394 -3.127  8.044   1.00 0.00 ? 100 PRO A CB   2  
ATOM 3359  C CG   . PRO A 1 100 ? -13.107 -3.863  8.184   1.00 0.00 ? 100 PRO A CG   2  
ATOM 3360  C CD   . PRO A 1 100 ? -12.829 -4.471  6.837   1.00 0.00 ? 100 PRO A CD   2  
ATOM 3361  H HA   . PRO A 1 100 ? -15.402 -2.645  6.209   1.00 0.00 ? 100 PRO A HA   2  
ATOM 3362  H HB2  . PRO A 1 100 ? -14.446 -2.288  8.725   1.00 0.00 ? 100 PRO A HB2  2  
ATOM 3363  H HB3  . PRO A 1 100 ? -15.240 -3.778  8.201   1.00 0.00 ? 100 PRO A HB3  2  
ATOM 3364  H HG2  . PRO A 1 100 ? -12.319 -3.178  8.456   1.00 0.00 ? 100 PRO A HG2  2  
ATOM 3365  H HG3  . PRO A 1 100 ? -13.206 -4.637  8.931   1.00 0.00 ? 100 PRO A HG3  2  
ATOM 3366  H HD2  . PRO A 1 100 ? -11.767 -4.488  6.642   1.00 0.00 ? 100 PRO A HD2  2  
ATOM 3367  H HD3  . PRO A 1 100 ? -13.240 -5.468  6.781   1.00 0.00 ? 100 PRO A HD3  2  
ATOM 3368  N N    . SER A 1 101 ? -14.676 -0.243  7.010   1.00 0.00 ? 101 SER A N    2  
ATOM 3369  C CA   . SER A 1 101 ? -14.291 1.163   7.006   1.00 0.00 ? 101 SER A CA   2  
ATOM 3370  C C    . SER A 1 101 ? -12.823 1.326   7.390   1.00 0.00 ? 101 SER A C    2  
ATOM 3371  O O    . SER A 1 101 ? -12.000 1.752   6.579   1.00 0.00 ? 101 SER A O    2  
ATOM 3372  C CB   . SER A 1 101 ? -15.173 1.959   7.970   1.00 0.00 ? 101 SER A CB   2  
ATOM 3373  O OG   . SER A 1 101 ? -16.361 2.394   7.332   1.00 0.00 ? 101 SER A OG   2  
ATOM 3374  H H    . SER A 1 101 ? -15.552 -0.498  7.367   1.00 0.00 ? 101 SER A H    2  
ATOM 3375  H HA   . SER A 1 101 ? -14.433 1.543   6.005   1.00 0.00 ? 101 SER A HA   2  
ATOM 3376  H HB2  . SER A 1 101 ? -15.438 1.335   8.810   1.00 0.00 ? 101 SER A HB2  2  
ATOM 3377  H HB3  . SER A 1 101 ? -14.629 2.824   8.321   1.00 0.00 ? 101 SER A HB3  2  
ATOM 3378  H HG   . SER A 1 101 ? -17.085 2.387   7.963   1.00 0.00 ? 101 SER A HG   2  
ATOM 3379  N N    . LYS A 1 102 ? -12.502 0.984   8.633   1.00 0.00 ? 102 LYS A N    2  
ATOM 3380  C CA   . LYS A 1 102 ? -11.134 1.089   9.127   1.00 0.00 ? 102 LYS A CA   2  
ATOM 3381  C C    . LYS A 1 102 ? -10.257 -0.011  8.539   1.00 0.00 ? 102 LYS A C    2  
ATOM 3382  O O    . LYS A 1 102 ? -10.469 -1.195  8.801   1.00 0.00 ? 102 LYS A O    2  
ATOM 3383  C CB   . LYS A 1 102 ? -11.115 1.010   10.655  1.00 0.00 ? 102 LYS A CB   2  
ATOM 3384  C CG   . LYS A 1 102 ? -9.810  1.481   11.272  1.00 0.00 ? 102 LYS A CG   2  
ATOM 3385  C CD   . LYS A 1 102 ? -10.019 2.017   12.679  1.00 0.00 ? 102 LYS A CD   2  
ATOM 3386  C CE   . LYS A 1 102 ? -10.376 3.495   12.665  1.00 0.00 ? 102 LYS A CE   2  
ATOM 3387  N NZ   . LYS A 1 102 ? -11.207 3.877   13.840  1.00 0.00 ? 102 LYS A NZ   2  
ATOM 3388  H H    . LYS A 1 102 ? -13.203 0.650   9.233   1.00 0.00 ? 102 LYS A H    2  
ATOM 3389  H HA   . LYS A 1 102 ? -10.744 2.048   8.820   1.00 0.00 ? 102 LYS A HA   2  
ATOM 3390  H HB2  . LYS A 1 102 ? -11.915 1.621   11.046  1.00 0.00 ? 102 LYS A HB2  2  
ATOM 3391  H HB3  . LYS A 1 102 ? -11.280 -0.016  10.952  1.00 0.00 ? 102 LYS A HB3  2  
ATOM 3392  H HG2  . LYS A 1 102 ? -9.121  0.650   11.314  1.00 0.00 ? 102 LYS A HG2  2  
ATOM 3393  H HG3  . LYS A 1 102 ? -9.393  2.265   10.656  1.00 0.00 ? 102 LYS A HG3  2  
ATOM 3394  H HD2  . LYS A 1 102 ? -10.823 1.469   13.148  1.00 0.00 ? 102 LYS A HD2  2  
ATOM 3395  H HD3  . LYS A 1 102 ? -9.109  1.880   13.246  1.00 0.00 ? 102 LYS A HD3  2  
ATOM 3396  H HE2  . LYS A 1 102 ? -9.464  4.072   12.677  1.00 0.00 ? 102 LYS A HE2  2  
ATOM 3397  H HE3  . LYS A 1 102 ? -10.926 3.711   11.760  1.00 0.00 ? 102 LYS A HE3  2  
ATOM 3398  H HZ1  . LYS A 1 102 ? -10.602 4.012   14.676  1.00 0.00 ? 102 LYS A HZ1  2  
ATOM 3399  H HZ2  . LYS A 1 102 ? -11.900 3.129   14.045  1.00 0.00 ? 102 LYS A HZ2  2  
ATOM 3400  H HZ3  . LYS A 1 102 ? -11.715 4.763   13.646  1.00 0.00 ? 102 LYS A HZ3  2  
ATOM 3401  N N    . VAL A 1 103 ? -9.269  0.388   7.744   1.00 0.00 ? 103 VAL A N    2  
ATOM 3402  C CA   . VAL A 1 103 ? -8.357  -0.564  7.121   1.00 0.00 ? 103 VAL A CA   2  
ATOM 3403  C C    . VAL A 1 103 ? -6.906  -0.228  7.445   1.00 0.00 ? 103 VAL A C    2  
ATOM 3404  O O    . VAL A 1 103 ? -6.533  0.942   7.535   1.00 0.00 ? 103 VAL A O    2  
ATOM 3405  C CB   . VAL A 1 103 ? -8.536  -0.594  5.592   1.00 0.00 ? 103 VAL A CB   2  
ATOM 3406  C CG1  . VAL A 1 103 ? -7.678  -1.689  4.975   1.00 0.00 ? 103 VAL A CG1  2  
ATOM 3407  C CG2  . VAL A 1 103 ? -10.001 -0.787  5.231   1.00 0.00 ? 103 VAL A CG2  2  
ATOM 3408  H H    . VAL A 1 103 ? -9.150  1.346   7.573   1.00 0.00 ? 103 VAL A H    2  
ATOM 3409  H HA   . VAL A 1 103 ? -8.584  -1.547  7.509   1.00 0.00 ? 103 VAL A HA   2  
ATOM 3410  H HB   . VAL A 1 103 ? -8.211  0.355   5.193   1.00 0.00 ? 103 VAL A HB   2  
ATOM 3411  H HG11 . VAL A 1 103 ? -7.762  -1.647  3.899   1.00 0.00 ? 103 VAL A HG11 2  
ATOM 3412  H HG12 . VAL A 1 103 ? -6.647  -1.544  5.263   1.00 0.00 ? 103 VAL A HG12 2  
ATOM 3413  H HG13 . VAL A 1 103 ? -8.018  -2.652  5.325   1.00 0.00 ? 103 VAL A HG13 2  
ATOM 3414  H HG21 . VAL A 1 103 ? -10.176 -0.422  4.230   1.00 0.00 ? 103 VAL A HG21 2  
ATOM 3415  H HG22 . VAL A 1 103 ? -10.249 -1.838  5.279   1.00 0.00 ? 103 VAL A HG22 2  
ATOM 3416  H HG23 . VAL A 1 103 ? -10.619 -0.240  5.927   1.00 0.00 ? 103 VAL A HG23 2  
ATOM 3417  N N    . LYS A 1 104 ? -6.090  -1.262  7.620   1.00 0.00 ? 104 LYS A N    2  
ATOM 3418  C CA   . LYS A 1 104 ? -4.678  -1.078  7.933   1.00 0.00 ? 104 LYS A CA   2  
ATOM 3419  C C    . LYS A 1 104 ? -3.814  -1.293  6.694   1.00 0.00 ? 104 LYS A C    2  
ATOM 3420  O O    . LYS A 1 104 ? -3.790  -2.384  6.123   1.00 0.00 ? 104 LYS A O    2  
ATOM 3421  C CB   . LYS A 1 104 ? -4.249  -2.044  9.040   1.00 0.00 ? 104 LYS A CB   2  
ATOM 3422  C CG   . LYS A 1 104 ? -2.752  -2.051  9.296   1.00 0.00 ? 104 LYS A CG   2  
ATOM 3423  C CD   . LYS A 1 104 ? -2.313  -3.322  10.004  1.00 0.00 ? 104 LYS A CD   2  
ATOM 3424  C CE   . LYS A 1 104 ? -0.818  -3.317  10.283  1.00 0.00 ? 104 LYS A CE   2  
ATOM 3425  N NZ   . LYS A 1 104 ? -0.452  -4.276  11.361  1.00 0.00 ? 104 LYS A NZ   2  
ATOM 3426  H H    . LYS A 1 104 ? -6.446  -2.172  7.536   1.00 0.00 ? 104 LYS A H    2  
ATOM 3427  H HA   . LYS A 1 104 ? -4.543  -0.065  8.279   1.00 0.00 ? 104 LYS A HA   2  
ATOM 3428  H HB2  . LYS A 1 104 ? -4.749  -1.766  9.957   1.00 0.00 ? 104 LYS A HB2  2  
ATOM 3429  H HB3  . LYS A 1 104 ? -4.551  -3.045  8.765   1.00 0.00 ? 104 LYS A HB3  2  
ATOM 3430  H HG2  . LYS A 1 104 ? -2.234  -1.981  8.351   1.00 0.00 ? 104 LYS A HG2  2  
ATOM 3431  H HG3  . LYS A 1 104 ? -2.498  -1.201  9.912   1.00 0.00 ? 104 LYS A HG3  2  
ATOM 3432  H HD2  . LYS A 1 104 ? -2.843  -3.403  10.941  1.00 0.00 ? 104 LYS A HD2  2  
ATOM 3433  H HD3  . LYS A 1 104 ? -2.551  -4.172  9.379   1.00 0.00 ? 104 LYS A HD3  2  
ATOM 3434  H HE2  . LYS A 1 104 ? -0.295  -3.588  9.379   1.00 0.00 ? 104 LYS A HE2  2  
ATOM 3435  H HE3  . LYS A 1 104 ? -0.525  -2.321  10.584  1.00 0.00 ? 104 LYS A HE3  2  
ATOM 3436  H HZ1  . LYS A 1 104 ? 0.533   -4.588  11.243  1.00 0.00 ? 104 LYS A HZ1  2  
ATOM 3437  H HZ2  . LYS A 1 104 ? -1.074  -5.109  11.325  1.00 0.00 ? 104 LYS A HZ2  2  
ATOM 3438  H HZ3  . LYS A 1 104 ? -0.552  -3.823  12.292  1.00 0.00 ? 104 LYS A HZ3  2  
ATOM 3439  N N    . LEU A 1 105 ? -3.104  -0.248  6.285   1.00 0.00 ? 105 LEU A N    2  
ATOM 3440  C CA   . LEU A 1 105 ? -2.236  -0.323  5.115   1.00 0.00 ? 105 LEU A CA   2  
ATOM 3441  C C    . LEU A 1 105 ? -0.768  -0.362  5.526   1.00 0.00 ? 105 LEU A C    2  
ATOM 3442  O O    . LEU A 1 105 ? -0.314  0.459   6.324   1.00 0.00 ? 105 LEU A O    2  
ATOM 3443  C CB   . LEU A 1 105 ? -2.487  0.872   4.192   1.00 0.00 ? 105 LEU A CB   2  
ATOM 3444  C CG   . LEU A 1 105 ? -3.951  1.181   3.877   1.00 0.00 ? 105 LEU A CG   2  
ATOM 3445  C CD1  . LEU A 1 105 ? -4.138  2.666   3.611   1.00 0.00 ? 105 LEU A CD1  2  
ATOM 3446  C CD2  . LEU A 1 105 ? -4.425  0.360   2.686   1.00 0.00 ? 105 LEU A CD2  2  
ATOM 3447  H H    . LEU A 1 105 ? -3.164  0.595   6.781   1.00 0.00 ? 105 LEU A H    2  
ATOM 3448  H HA   . LEU A 1 105 ? -2.474  -1.233  4.584   1.00 0.00 ? 105 LEU A HA   2  
ATOM 3449  H HB2  . LEU A 1 105 ? -2.058  1.745   4.658   1.00 0.00 ? 105 LEU A HB2  2  
ATOM 3450  H HB3  . LEU A 1 105 ? -1.980  0.679   3.257   1.00 0.00 ? 105 LEU A HB3  2  
ATOM 3451  H HG   . LEU A 1 105 ? -4.560  0.916   4.731   1.00 0.00 ? 105 LEU A HG   2  
ATOM 3452  H HD11 . LEU A 1 105 ? -3.248  3.064   3.147   1.00 0.00 ? 105 LEU A HD11 2  
ATOM 3453  H HD12 . LEU A 1 105 ? -4.317  3.179   4.545   1.00 0.00 ? 105 LEU A HD12 2  
ATOM 3454  H HD13 . LEU A 1 105 ? -4.983  2.811   2.954   1.00 0.00 ? 105 LEU A HD13 2  
ATOM 3455  H HD21 . LEU A 1 105 ? -4.442  0.983   1.804   1.00 0.00 ? 105 LEU A HD21 2  
ATOM 3456  H HD22 . LEU A 1 105 ? -5.420  -0.015  2.881   1.00 0.00 ? 105 LEU A HD22 2  
ATOM 3457  H HD23 . LEU A 1 105 ? -3.751  -0.469  2.529   1.00 0.00 ? 105 LEU A HD23 2  
ATOM 3458  N N    . VAL A 1 106 ? -0.030  -1.320  4.976   1.00 0.00 ? 106 VAL A N    2  
ATOM 3459  C CA   . VAL A 1 106 ? 1.388   -1.465  5.283   1.00 0.00 ? 106 VAL A CA   2  
ATOM 3460  C C    . VAL A 1 106 ? 2.240   -1.322  4.027   1.00 0.00 ? 106 VAL A C    2  
ATOM 3461  O O    . VAL A 1 106 ? 2.374   -2.263  3.244   1.00 0.00 ? 106 VAL A O    2  
ATOM 3462  C CB   . VAL A 1 106 ? 1.684   -2.827  5.938   1.00 0.00 ? 106 VAL A CB   2  
ATOM 3463  C CG1  . VAL A 1 106 ? 3.177   -2.988  6.185   1.00 0.00 ? 106 VAL A CG1  2  
ATOM 3464  C CG2  . VAL A 1 106 ? 0.902   -2.975  7.235   1.00 0.00 ? 106 VAL A CG2  2  
ATOM 3465  H H    . VAL A 1 106 ? -0.449  -1.945  4.347   1.00 0.00 ? 106 VAL A H    2  
ATOM 3466  H HA   . VAL A 1 106 ? 1.660   -0.686  5.981   1.00 0.00 ? 106 VAL A HA   2  
ATOM 3467  H HB   . VAL A 1 106 ? 1.368   -3.606  5.261   1.00 0.00 ? 106 VAL A HB   2  
ATOM 3468  H HG11 . VAL A 1 106 ? 3.719   -2.272  5.585   1.00 0.00 ? 106 VAL A HG11 2  
ATOM 3469  H HG12 . VAL A 1 106 ? 3.390   -2.818  7.230   1.00 0.00 ? 106 VAL A HG12 2  
ATOM 3470  H HG13 . VAL A 1 106 ? 3.480   -3.988  5.913   1.00 0.00 ? 106 VAL A HG13 2  
ATOM 3471  H HG21 . VAL A 1 106 ? 0.235   -2.133  7.350   1.00 0.00 ? 106 VAL A HG21 2  
ATOM 3472  H HG22 . VAL A 1 106 ? 0.327   -3.889  7.207   1.00 0.00 ? 106 VAL A HG22 2  
ATOM 3473  H HG23 . VAL A 1 106 ? 1.588   -3.007  8.068   1.00 0.00 ? 106 VAL A HG23 2  
ATOM 3474  N N    . PHE A 1 107 ? 2.814   -0.139  3.839   1.00 0.00 ? 107 PHE A N    2  
ATOM 3475  C CA   . PHE A 1 107 ? 3.654   0.129   2.677   1.00 0.00 ? 107 PHE A CA   2  
ATOM 3476  C C    . PHE A 1 107 ? 5.000   0.709   3.101   1.00 0.00 ? 107 PHE A C    2  
ATOM 3477  O O    . PHE A 1 107 ? 5.189   1.086   4.257   1.00 0.00 ? 107 PHE A O    2  
ATOM 3478  C CB   . PHE A 1 107 ? 2.948   1.093   1.722   1.00 0.00 ? 107 PHE A CB   2  
ATOM 3479  C CG   . PHE A 1 107 ? 2.725   2.459   2.307   1.00 0.00 ? 107 PHE A CG   2  
ATOM 3480  C CD1  . PHE A 1 107 ? 3.743   3.399   2.312   1.00 0.00 ? 107 PHE A CD1  2  
ATOM 3481  C CD2  . PHE A 1 107 ? 1.498   2.803   2.849   1.00 0.00 ? 107 PHE A CD2  2  
ATOM 3482  C CE1  . PHE A 1 107 ? 3.541   4.656   2.850   1.00 0.00 ? 107 PHE A CE1  2  
ATOM 3483  C CE2  . PHE A 1 107 ? 1.290   4.059   3.388   1.00 0.00 ? 107 PHE A CE2  2  
ATOM 3484  C CZ   . PHE A 1 107 ? 2.313   4.987   3.387   1.00 0.00 ? 107 PHE A CZ   2  
ATOM 3485  H H    . PHE A 1 107 ? 2.670   0.573   4.499   1.00 0.00 ? 107 PHE A H    2  
ATOM 3486  H HA   . PHE A 1 107 ? 3.823   -0.808  2.169   1.00 0.00 ? 107 PHE A HA   2  
ATOM 3487  H HB2  . PHE A 1 107 ? 3.545   1.208   0.831   1.00 0.00 ? 107 PHE A HB2  2  
ATOM 3488  H HB3  . PHE A 1 107 ? 1.985   0.684   1.456   1.00 0.00 ? 107 PHE A HB3  2  
ATOM 3489  H HD1  . PHE A 1 107 ? 4.704   3.142   1.891   1.00 0.00 ? 107 PHE A HD1  2  
ATOM 3490  H HD2  . PHE A 1 107 ? 0.696   2.078   2.850   1.00 0.00 ? 107 PHE A HD2  2  
ATOM 3491  H HE1  . PHE A 1 107 ? 4.343   5.380   2.848   1.00 0.00 ? 107 PHE A HE1  2  
ATOM 3492  H HE2  . PHE A 1 107 ? 0.328   4.315   3.807   1.00 0.00 ? 107 PHE A HE2  2  
ATOM 3493  H HZ   . PHE A 1 107 ? 2.153   5.968   3.808   1.00 0.00 ? 107 PHE A HZ   2  
ATOM 3494  N N    . ILE A 1 108 ? 5.932   0.776   2.156   1.00 0.00 ? 108 ILE A N    2  
ATOM 3495  C CA   . ILE A 1 108 ? 7.260   1.310   2.430   1.00 0.00 ? 108 ILE A CA   2  
ATOM 3496  C C    . ILE A 1 108 ? 7.527   2.568   1.611   1.00 0.00 ? 108 ILE A C    2  
ATOM 3497  O O    . ILE A 1 108 ? 7.300   2.593   0.402   1.00 0.00 ? 108 ILE A O    2  
ATOM 3498  C CB   . ILE A 1 108 ? 8.358   0.272   2.128   1.00 0.00 ? 108 ILE A CB   2  
ATOM 3499  C CG1  . ILE A 1 108 ? 9.743   0.901   2.292   1.00 0.00 ? 108 ILE A CG1  2  
ATOM 3500  C CG2  . ILE A 1 108 ? 8.186   -0.286  0.723   1.00 0.00 ? 108 ILE A CG2  2  
ATOM 3501  C CD1  . ILE A 1 108 ? 10.826  -0.102  2.625   1.00 0.00 ? 108 ILE A CD1  2  
ATOM 3502  H H    . ILE A 1 108 ? 5.721   0.459   1.253   1.00 0.00 ? 108 ILE A H    2  
ATOM 3503  H HA   . ILE A 1 108 ? 7.308   1.560   3.480   1.00 0.00 ? 108 ILE A HA   2  
ATOM 3504  H HB   . ILE A 1 108 ? 8.255   -0.542  2.828   1.00 0.00 ? 108 ILE A HB   2  
ATOM 3505  H HG12 . ILE A 1 108 ? 10.019  1.393   1.373   1.00 0.00 ? 108 ILE A HG12 2  
ATOM 3506  H HG13 . ILE A 1 108 ? 9.708   1.629   3.089   1.00 0.00 ? 108 ILE A HG13 2  
ATOM 3507  H HG21 . ILE A 1 108 ? 9.154   -0.541  0.317   1.00 0.00 ? 108 ILE A HG21 2  
ATOM 3508  H HG22 . ILE A 1 108 ? 7.569   -1.171  0.761   1.00 0.00 ? 108 ILE A HG22 2  
ATOM 3509  H HG23 . ILE A 1 108 ? 7.715   0.455   0.096   1.00 0.00 ? 108 ILE A HG23 2  
ATOM 3510  H HD11 . ILE A 1 108 ? 11.754  0.204   2.165   1.00 0.00 ? 108 ILE A HD11 2  
ATOM 3511  H HD12 . ILE A 1 108 ? 10.953  -0.152  3.696   1.00 0.00 ? 108 ILE A HD12 2  
ATOM 3512  H HD13 . ILE A 1 108 ? 10.543  -1.075  2.250   1.00 0.00 ? 108 ILE A HD13 2  
ATOM 3513  N N    . ARG A 1 109 ? 8.011   3.611   2.279   1.00 0.00 ? 109 ARG A N    2  
ATOM 3514  C CA   . ARG A 1 109 ? 8.309   4.873   1.613   1.00 0.00 ? 109 ARG A CA   2  
ATOM 3515  C C    . ARG A 1 109 ? 9.728   4.870   1.053   1.00 0.00 ? 109 ARG A C    2  
ATOM 3516  O O    . ARG A 1 109 ? 10.663  5.335   1.703   1.00 0.00 ? 109 ARG A O    2  
ATOM 3517  C CB   . ARG A 1 109 ? 8.135   6.041   2.586   1.00 0.00 ? 109 ARG A CB   2  
ATOM 3518  C CG   . ARG A 1 109 ? 8.582   7.378   2.018   1.00 0.00 ? 109 ARG A CG   2  
ATOM 3519  C CD   . ARG A 1 109 ? 7.442   8.091   1.308   1.00 0.00 ? 109 ARG A CD   2  
ATOM 3520  N NE   . ARG A 1 109 ? 6.689   8.955   2.214   1.00 0.00 ? 109 ARG A NE   2  
ATOM 3521  C CZ   . ARG A 1 109 ? 7.194   10.046  2.778   1.00 0.00 ? 109 ARG A CZ   2  
ATOM 3522  N NH1  . ARG A 1 109 ? 8.447   10.404  2.532   1.00 0.00 ? 109 ARG A NH1  2  
ATOM 3523  N NH2  . ARG A 1 109 ? 6.446   10.781  3.591   1.00 0.00 ? 109 ARG A NH2  2  
ATOM 3524  H H    . ARG A 1 109 ? 8.170   3.529   3.243   1.00 0.00 ? 109 ARG A H    2  
ATOM 3525  H HA   . ARG A 1 109 ? 7.613   4.990   0.796   1.00 0.00 ? 109 ARG A HA   2  
ATOM 3526  H HB2  . ARG A 1 109 ? 7.092   6.119   2.854   1.00 0.00 ? 109 ARG A HB2  2  
ATOM 3527  H HB3  . ARG A 1 109 ? 8.713   5.841   3.476   1.00 0.00 ? 109 ARG A HB3  2  
ATOM 3528  H HG2  . ARG A 1 109 ? 8.935   8.002   2.826   1.00 0.00 ? 109 ARG A HG2  2  
ATOM 3529  H HG3  . ARG A 1 109 ? 9.384   7.209   1.314   1.00 0.00 ? 109 ARG A HG3  2  
ATOM 3530  H HD2  . ARG A 1 109 ? 7.852   8.692   0.511   1.00 0.00 ? 109 ARG A HD2  2  
ATOM 3531  H HD3  . ARG A 1 109 ? 6.774   7.350   0.894   1.00 0.00 ? 109 ARG A HD3  2  
ATOM 3532  H HE   . ARG A 1 109 ? 5.761   8.708   2.410   1.00 0.00 ? 109 ARG A HE   2  
ATOM 3533  H HH11 . ARG A 1 109 ? 9.012   9.853   1.919   1.00 0.00 ? 109 ARG A HH11 2  
ATOM 3534  H HH12 . ARG A 1 109 ? 8.824   11.227  2.957   1.00 0.00 ? 109 ARG A HH12 2  
ATOM 3535  H HH21 . ARG A 1 109 ? 5.502   10.514  3.779   1.00 0.00 ? 109 ARG A HH21 2  
ATOM 3536  H HH22 . ARG A 1 109 ? 6.827   11.601  4.016   1.00 0.00 ? 109 ARG A HH22 2  
ATOM 3537  N N    . ASN A 1 110 ? 9.881   4.341   -0.157  1.00 0.00 ? 110 ASN A N    2  
ATOM 3538  C CA   . ASN A 1 110 ? 11.186  4.276   -0.804  1.00 0.00 ? 110 ASN A CA   2  
ATOM 3539  C C    . ASN A 1 110 ? 11.308  5.341   -1.890  1.00 0.00 ? 110 ASN A C    2  
ATOM 3540  O O    . ASN A 1 110 ? 10.491  5.400   -2.808  1.00 0.00 ? 110 ASN A O    2  
ATOM 3541  C CB   . ASN A 1 110 ? 11.411  2.888   -1.407  1.00 0.00 ? 110 ASN A CB   2  
ATOM 3542  C CG   . ASN A 1 110 ? 12.669  2.822   -2.251  1.00 0.00 ? 110 ASN A CG   2  
ATOM 3543  O OD1  . ASN A 1 110 ? 13.417  3.795   -2.349  1.00 0.00 ? 110 ASN A OD1  2  
ATOM 3544  N ND2  . ASN A 1 110 ? 12.907  1.670   -2.868  1.00 0.00 ? 110 ASN A ND2  2  
ATOM 3545  H H    . ASN A 1 110 ? 9.097   3.986   -0.626  1.00 0.00 ? 110 ASN A H    2  
ATOM 3546  H HA   . ASN A 1 110 ? 11.938  4.459   -0.051  1.00 0.00 ? 110 ASN A HA   2  
ATOM 3547  H HB2  . ASN A 1 110 ? 11.499  2.166   -0.608  1.00 0.00 ? 110 ASN A HB2  2  
ATOM 3548  H HB3  . ASN A 1 110 ? 10.567  2.631   -2.028  1.00 0.00 ? 110 ASN A HB3  2  
ATOM 3549  H HD21 . ASN A 1 110 ? 12.268  0.938   -2.745  1.00 0.00 ? 110 ASN A HD21 2  
ATOM 3550  H HD22 . ASN A 1 110 ? 13.714  1.600   -3.420  1.00 0.00 ? 110 ASN A HD22 2  
ATOM 3551  N N    . GLU A 1 111 ? 12.334  6.178   -1.778  1.00 0.00 ? 111 GLU A N    2  
ATOM 3552  C CA   . GLU A 1 111 ? 12.563  7.240   -2.751  1.00 0.00 ? 111 GLU A CA   2  
ATOM 3553  C C    . GLU A 1 111 ? 12.760  6.663   -4.150  1.00 0.00 ? 111 GLU A C    2  
ATOM 3554  O O    . GLU A 1 111 ? 12.255  7.206   -5.133  1.00 0.00 ? 111 GLU A O    2  
ATOM 3555  C CB   . GLU A 1 111 ? 13.784  8.072   -2.354  1.00 0.00 ? 111 GLU A CB   2  
ATOM 3556  C CG   . GLU A 1 111 ? 15.091  7.299   -2.409  1.00 0.00 ? 111 GLU A CG   2  
ATOM 3557  C CD   . GLU A 1 111 ? 16.294  8.163   -2.082  1.00 0.00 ? 111 GLU A CD   2  
ATOM 3558  O OE1  . GLU A 1 111 ? 16.288  8.808   -1.013  1.00 0.00 ? 111 GLU A OE1  2  
ATOM 3559  O OE2  . GLU A 1 111 ? 17.241  8.193   -2.896  1.00 0.00 ? 111 GLU A OE2  2  
ATOM 3560  H H    . GLU A 1 111 ? 12.952  6.080   -1.023  1.00 0.00 ? 111 GLU A H    2  
ATOM 3561  H HA   . GLU A 1 111 ? 11.691  7.877   -2.757  1.00 0.00 ? 111 GLU A HA   2  
ATOM 3562  H HB2  . GLU A 1 111 ? 13.861  8.918   -3.021  1.00 0.00 ? 111 GLU A HB2  2  
ATOM 3563  H HB3  . GLU A 1 111 ? 13.646  8.432   -1.345  1.00 0.00 ? 111 GLU A HB3  2  
ATOM 3564  H HG2  . GLU A 1 111 ? 15.045  6.488   -1.698  1.00 0.00 ? 111 GLU A HG2  2  
ATOM 3565  H HG3  . GLU A 1 111 ? 15.215  6.897   -3.404  1.00 0.00 ? 111 GLU A HG3  2  
ATOM 3566  N N    . ASP A 1 112 ? 13.496  5.561   -4.230  1.00 0.00 ? 112 ASP A N    2  
ATOM 3567  C CA   . ASP A 1 112 ? 13.760  4.909   -5.508  1.00 0.00 ? 112 ASP A CA   2  
ATOM 3568  C C    . ASP A 1 112 ? 12.474  4.351   -6.109  1.00 0.00 ? 112 ASP A C    2  
ATOM 3569  O O    . ASP A 1 112 ? 12.387  4.130   -7.316  1.00 0.00 ? 112 ASP A O    2  
ATOM 3570  C CB   . ASP A 1 112 ? 14.784  3.787   -5.330  1.00 0.00 ? 112 ASP A CB   2  
ATOM 3571  C CG   . ASP A 1 112 ? 16.207  4.307   -5.265  1.00 0.00 ? 112 ASP A CG   2  
ATOM 3572  O OD1  . ASP A 1 112 ? 16.829  4.469   -6.336  1.00 0.00 ? 112 ASP A OD1  2  
ATOM 3573  O OD2  . ASP A 1 112 ? 16.699  4.550   -4.143  1.00 0.00 ? 112 ASP A OD2  2  
ATOM 3574  H H    . ASP A 1 112 ? 13.871  5.176   -3.410  1.00 0.00 ? 112 ASP A H    2  
ATOM 3575  H HA   . ASP A 1 112 ? 14.165  5.650   -6.181  1.00 0.00 ? 112 ASP A HA   2  
ATOM 3576  H HB2  . ASP A 1 112 ? 14.572  3.257   -4.413  1.00 0.00 ? 112 ASP A HB2  2  
ATOM 3577  H HB3  . ASP A 1 112 ? 14.707  3.103   -6.163  1.00 0.00 ? 112 ASP A HB3  2  
ATOM 3578  N N    . ALA A 1 113 ? 11.479  4.123   -5.258  1.00 0.00 ? 113 ALA A N    2  
ATOM 3579  C CA   . ALA A 1 113 ? 10.198  3.592   -5.705  1.00 0.00 ? 113 ALA A CA   2  
ATOM 3580  C C    . ALA A 1 113 ? 9.661   4.381   -6.894  1.00 0.00 ? 113 ALA A C    2  
ATOM 3581  O O    . ALA A 1 113 ? 9.383   3.817   -7.952  1.00 0.00 ? 113 ALA A O    2  
ATOM 3582  C CB   . ALA A 1 113 ? 9.193   3.605   -4.563  1.00 0.00 ? 113 ALA A CB   2  
ATOM 3583  H H    . ALA A 1 113 ? 11.610  4.319   -4.307  1.00 0.00 ? 113 ALA A H    2  
ATOM 3584  H HA   . ALA A 1 113 ? 10.350  2.565   -6.006  1.00 0.00 ? 113 ALA A HA   2  
ATOM 3585  H HB1  . ALA A 1 113 ? 8.486   2.800   -4.697  1.00 0.00 ? 113 ALA A HB1  2  
ATOM 3586  H HB2  . ALA A 1 113 ? 9.713   3.476   -3.625  1.00 0.00 ? 113 ALA A HB2  2  
ATOM 3587  H HB3  . ALA A 1 113 ? 8.668   4.549   -4.557  1.00 0.00 ? 113 ALA A HB3  2  
ATOM 3588  N N    . VAL A 1 114 ? 9.516   5.690   -6.713  1.00 0.00 ? 114 VAL A N    2  
ATOM 3589  C CA   . VAL A 1 114 ? 9.012   6.557   -7.771  1.00 0.00 ? 114 VAL A CA   2  
ATOM 3590  C C    . VAL A 1 114 ? 9.642   6.208   -9.114  1.00 0.00 ? 114 VAL A C    2  
ATOM 3591  O O    . VAL A 1 114 ? 8.981   6.252   -10.151 1.00 0.00 ? 114 VAL A O    2  
ATOM 3592  C CB   . VAL A 1 114 ? 9.285   8.040   -7.459  1.00 0.00 ? 114 VAL A CB   2  
ATOM 3593  C CG1  . VAL A 1 114 ? 8.581   8.455   -6.176  1.00 0.00 ? 114 VAL A CG1  2  
ATOM 3594  C CG2  . VAL A 1 114 ? 10.781  8.297   -7.362  1.00 0.00 ? 114 VAL A CG2  2  
ATOM 3595  H H    . VAL A 1 114 ? 9.754   6.082   -5.847  1.00 0.00 ? 114 VAL A H    2  
ATOM 3596  H HA   . VAL A 1 114 ? 7.943   6.416   -7.838  1.00 0.00 ? 114 VAL A HA   2  
ATOM 3597  H HB   . VAL A 1 114 ? 8.890   8.637   -8.268  1.00 0.00 ? 114 VAL A HB   2  
ATOM 3598  H HG11 . VAL A 1 114 ? 8.321   9.502   -6.230  1.00 0.00 ? 114 VAL A HG11 2  
ATOM 3599  H HG12 . VAL A 1 114 ? 7.683   7.866   -6.051  1.00 0.00 ? 114 VAL A HG12 2  
ATOM 3600  H HG13 . VAL A 1 114 ? 9.239   8.291   -5.335  1.00 0.00 ? 114 VAL A HG13 2  
ATOM 3601  H HG21 . VAL A 1 114 ? 11.288  7.378   -7.110  1.00 0.00 ? 114 VAL A HG21 2  
ATOM 3602  H HG22 . VAL A 1 114 ? 11.147  8.661   -8.311  1.00 0.00 ? 114 VAL A HG22 2  
ATOM 3603  H HG23 . VAL A 1 114 ? 10.972  9.035   -6.597  1.00 0.00 ? 114 VAL A HG23 2  
ATOM 3604  N N    . ASN A 1 115 ? 10.924  5.860   -9.088  1.00 0.00 ? 115 ASN A N    2  
ATOM 3605  C CA   . ASN A 1 115 ? 11.645  5.502   -10.304 1.00 0.00 ? 115 ASN A CA   2  
ATOM 3606  C C    . ASN A 1 115 ? 11.174  4.153   -10.839 1.00 0.00 ? 115 ASN A C    2  
ATOM 3607  O O    . ASN A 1 115 ? 11.158  3.926   -12.048 1.00 0.00 ? 115 ASN A O    2  
ATOM 3608  C CB   . ASN A 1 115 ? 13.151  5.459   -10.037 1.00 0.00 ? 115 ASN A CB   2  
ATOM 3609  C CG   . ASN A 1 115 ? 13.720  6.828   -9.718  1.00 0.00 ? 115 ASN A CG   2  
ATOM 3610  O OD1  . ASN A 1 115 ? 14.179  7.545   -10.608 1.00 0.00 ? 115 ASN A OD1  2  
ATOM 3611  N ND2  . ASN A 1 115 ? 13.694  7.197   -8.442  1.00 0.00 ? 115 ASN A ND2  2  
ATOM 3612  H H    . ASN A 1 115 ? 11.398  5.843   -8.230  1.00 0.00 ? 115 ASN A H    2  
ATOM 3613  H HA   . ASN A 1 115 ? 11.441  6.261   -11.045 1.00 0.00 ? 115 ASN A HA   2  
ATOM 3614  H HB2  . ASN A 1 115 ? 13.342  4.807   -9.197  1.00 0.00 ? 115 ASN A HB2  2  
ATOM 3615  H HB3  . ASN A 1 115 ? 13.655  5.074   -10.910 1.00 0.00 ? 115 ASN A HB3  2  
ATOM 3616  H HD21 . ASN A 1 115 ? 13.314  6.575   -7.788  1.00 0.00 ? 115 ASN A HD21 2  
ATOM 3617  H HD22 . ASN A 1 115 ? 14.055  8.078   -8.208  1.00 0.00 ? 115 ASN A HD22 2  
ATOM 3618  N N    . GLN A 1 116 ? 10.790  3.263   -9.929  1.00 0.00 ? 116 GLN A N    2  
ATOM 3619  C CA   . GLN A 1 116 ? 10.319  1.937   -10.310 1.00 0.00 ? 116 GLN A CA   2  
ATOM 3620  C C    . GLN A 1 116 ? 8.905   2.004   -10.878 1.00 0.00 ? 116 GLN A C    2  
ATOM 3621  O O    . GLN A 1 116 ? 8.685   1.724   -12.056 1.00 0.00 ? 116 GLN A O    2  
ATOM 3622  C CB   . GLN A 1 116 ? 10.352  0.996   -9.105  1.00 0.00 ? 116 GLN A CB   2  
ATOM 3623  C CG   . GLN A 1 116 ? 11.747  0.784   -8.537  1.00 0.00 ? 116 GLN A CG   2  
ATOM 3624  C CD   . GLN A 1 116 ? 12.757  0.400   -9.600  1.00 0.00 ? 116 GLN A CD   2  
ATOM 3625  O OE1  . GLN A 1 116 ? 12.520  -0.504  -10.402 1.00 0.00 ? 116 GLN A OE1  2  
ATOM 3626  N NE2  . GLN A 1 116 ? 13.894  1.087   -9.612  1.00 0.00 ? 116 GLN A NE2  2  
ATOM 3627  H H    . GLN A 1 116 ? 10.826  3.504   -8.981  1.00 0.00 ? 116 GLN A H    2  
ATOM 3628  H HA   . GLN A 1 116 ? 10.981  1.556   -11.072 1.00 0.00 ? 116 GLN A HA   2  
ATOM 3629  H HB2  . GLN A 1 116 ? 9.728   1.405   -8.325  1.00 0.00 ? 116 GLN A HB2  2  
ATOM 3630  H HB3  . GLN A 1 116 ? 9.959   0.035   -9.403  1.00 0.00 ? 116 GLN A HB3  2  
ATOM 3631  H HG2  . GLN A 1 116 ? 12.073  1.699   -8.066  1.00 0.00 ? 116 GLN A HG2  2  
ATOM 3632  H HG3  . GLN A 1 116 ? 11.705  -0.004  -7.799  1.00 0.00 ? 116 GLN A HG3  2  
ATOM 3633  H HE21 . GLN A 1 116 ? 14.015  1.792   -8.942  1.00 0.00 ? 116 GLN A HE21 2  
ATOM 3634  H HE22 . GLN A 1 116 ? 14.565  0.859   -10.287 1.00 0.00 ? 116 GLN A HE22 2  
ATOM 3635  N N    . MET A 1 117 ? 7.950   2.377   -10.032 1.00 0.00 ? 117 MET A N    2  
ATOM 3636  C CA   . MET A 1 117 ? 6.557   2.482   -10.451 1.00 0.00 ? 117 MET A CA   2  
ATOM 3637  C C    . MET A 1 117 ? 6.450   3.133   -11.827 1.00 0.00 ? 117 MET A C    2  
ATOM 3638  O O    . MET A 1 117 ? 7.008   4.205   -12.061 1.00 0.00 ? 117 MET A O    2  
ATOM 3639  C CB   . MET A 1 117 ? 5.753   3.288   -9.429  1.00 0.00 ? 117 MET A CB   2  
ATOM 3640  C CG   . MET A 1 117 ? 6.462   4.546   -8.955  1.00 0.00 ? 117 MET A CG   2  
ATOM 3641  S SD   . MET A 1 117 ? 6.069   5.987   -9.964  1.00 0.00 ? 117 MET A SD   2  
ATOM 3642  C CE   . MET A 1 117 ? 5.371   7.084   -8.732  1.00 0.00 ? 117 MET A CE   2  
ATOM 3643  H H    . MET A 1 117 ? 8.187   2.588   -9.105  1.00 0.00 ? 117 MET A H    2  
ATOM 3644  H HA   . MET A 1 117 ? 6.152   1.482   -10.507 1.00 0.00 ? 117 MET A HA   2  
ATOM 3645  H HB2  . MET A 1 117 ? 4.813   3.576   -9.874  1.00 0.00 ? 117 MET A HB2  2  
ATOM 3646  H HB3  . MET A 1 117 ? 5.559   2.664   -8.569  1.00 0.00 ? 117 MET A HB3  2  
ATOM 3647  H HG2  . MET A 1 117 ? 6.167   4.747   -7.936  1.00 0.00 ? 117 MET A HG2  2  
ATOM 3648  H HG3  . MET A 1 117 ? 7.528   4.377   -8.992  1.00 0.00 ? 117 MET A HG3  2  
ATOM 3649  H HE1  . MET A 1 117 ? 4.533   6.600   -8.253  1.00 0.00 ? 117 MET A HE1  2  
ATOM 3650  H HE2  . MET A 1 117 ? 6.122   7.318   -7.992  1.00 0.00 ? 117 MET A HE2  2  
ATOM 3651  H HE3  . MET A 1 117 ? 5.038   7.994   -9.208  1.00 0.00 ? 117 MET A HE3  2  
ATOM 3652  N N    . ALA A 1 118 ? 5.731   2.479   -12.732 1.00 0.00 ? 118 ALA A N    2  
ATOM 3653  C CA   . ALA A 1 118 ? 5.550   2.995   -14.083 1.00 0.00 ? 118 ALA A CA   2  
ATOM 3654  C C    . ALA A 1 118 ? 5.053   4.437   -14.058 1.00 0.00 ? 118 ALA A C    2  
ATOM 3655  O O    . ALA A 1 118 ? 5.559   5.291   -14.785 1.00 0.00 ? 118 ALA A O    2  
ATOM 3656  C CB   . ALA A 1 118 ? 4.583   2.115   -14.860 1.00 0.00 ? 118 ALA A CB   2  
ATOM 3657  H H    . ALA A 1 118 ? 5.310   1.629   -12.485 1.00 0.00 ? 118 ALA A H    2  
ATOM 3658  H HA   . ALA A 1 118 ? 6.508   2.964   -14.583 1.00 0.00 ? 118 ALA A HA   2  
ATOM 3659  H HB1  . ALA A 1 118 ? 3.701   1.935   -14.262 1.00 0.00 ? 118 ALA A HB1  2  
ATOM 3660  H HB2  . ALA A 1 118 ? 4.301   2.611   -15.777 1.00 0.00 ? 118 ALA A HB2  2  
ATOM 3661  H HB3  . ALA A 1 118 ? 5.059   1.174   -15.091 1.00 0.00 ? 118 ALA A HB3  2  
ATOM 3662  N N    . SER A 1 119 ? 4.058   4.700   -13.216 1.00 0.00 ? 119 SER A N    2  
ATOM 3663  C CA   . SER A 1 119 ? 3.489   6.037   -13.099 1.00 0.00 ? 119 SER A CA   2  
ATOM 3664  C C    . SER A 1 119 ? 2.606   6.359   -14.301 1.00 0.00 ? 119 SER A C    2  
ATOM 3665  O O    . SER A 1 119 ? 2.601   7.484   -14.799 1.00 0.00 ? 119 SER A O    2  
ATOM 3666  C CB   . SER A 1 119 ? 4.603   7.079   -12.977 1.00 0.00 ? 119 SER A CB   2  
ATOM 3667  O OG   . SER A 1 119 ? 4.128   8.263   -12.358 1.00 0.00 ? 119 SER A OG   2  
ATOM 3668  H H    . SER A 1 119 ? 3.697   3.976   -12.662 1.00 0.00 ? 119 SER A H    2  
ATOM 3669  H HA   . SER A 1 119 ? 2.884   6.063   -12.206 1.00 0.00 ? 119 SER A HA   2  
ATOM 3670  H HB2  . SER A 1 119 ? 5.407   6.674   -12.382 1.00 0.00 ? 119 SER A HB2  2  
ATOM 3671  H HB3  . SER A 1 119 ? 4.971   7.325   -13.962 1.00 0.00 ? 119 SER A HB3  2  
ATOM 3672  H HG   . SER A 1 119 ? 3.405   8.046   -11.766 1.00 0.00 ? 119 SER A HG   2  
ATOM 3673  N N    . GLY A 1 120 ? 1.859   5.360   -14.763 1.00 0.00 ? 120 GLY A N    2  
ATOM 3674  C CA   . GLY A 1 120 ? 0.982   5.556   -15.903 1.00 0.00 ? 120 GLY A CA   2  
ATOM 3675  C C    . GLY A 1 120 ? -0.192  4.597   -15.902 1.00 0.00 ? 120 GLY A C    2  
ATOM 3676  O O    . GLY A 1 120 ? -0.159  3.540   -16.531 1.00 0.00 ? 120 GLY A O    2  
ATOM 3677  H H    . GLY A 1 120 ? 1.904   4.484   -14.326 1.00 0.00 ? 120 GLY A H    2  
ATOM 3678  H HA2  . GLY A 1 120 ? 0.607   6.568   -15.886 1.00 0.00 ? 120 GLY A HA2  2  
ATOM 3679  H HA3  . GLY A 1 120 ? 1.551   5.408   -16.809 1.00 0.00 ? 120 GLY A HA3  2  
ATOM 3680  N N    . PRO A 1 121 ? -1.261  4.965   -15.179 1.00 0.00 ? 121 PRO A N    2  
ATOM 3681  C CA   . PRO A 1 121 ? -2.471  4.144   -15.080 1.00 0.00 ? 121 PRO A CA   2  
ATOM 3682  C C    . PRO A 1 121 ? -3.250  4.099   -16.390 1.00 0.00 ? 121 PRO A C    2  
ATOM 3683  O O    . PRO A 1 121 ? -3.583  5.137   -16.961 1.00 0.00 ? 121 PRO A O    2  
ATOM 3684  C CB   . PRO A 1 121 ? -3.290  4.848   -13.995 1.00 0.00 ? 121 PRO A CB   2  
ATOM 3685  C CG   . PRO A 1 121 ? -2.825  6.263   -14.028 1.00 0.00 ? 121 PRO A CG   2  
ATOM 3686  C CD   . PRO A 1 121 ? -1.370  6.212   -14.404 1.00 0.00 ? 121 PRO A CD   2  
ATOM 3687  H HA   . PRO A 1 121 ? -2.241  3.137   -14.764 1.00 0.00 ? 121 PRO A HA   2  
ATOM 3688  H HB2  . PRO A 1 121 ? -4.342  4.770   -14.228 1.00 0.00 ? 121 PRO A HB2  2  
ATOM 3689  H HB3  . PRO A 1 121 ? -3.093  4.390   -13.037 1.00 0.00 ? 121 PRO A HB3  2  
ATOM 3690  H HG2  . PRO A 1 121 ? -3.385  6.815   -14.768 1.00 0.00 ? 121 PRO A HG2  2  
ATOM 3691  H HG3  . PRO A 1 121 ? -2.945  6.711   -13.053 1.00 0.00 ? 121 PRO A HG3  2  
ATOM 3692  H HD2  . PRO A 1 121 ? -1.107  7.067   -15.009 1.00 0.00 ? 121 PRO A HD2  2  
ATOM 3693  H HD3  . PRO A 1 121 ? -0.753  6.170   -13.518 1.00 0.00 ? 121 PRO A HD3  2  
ATOM 3694  N N    . SER A 1 122 ? -3.537  2.889   -16.861 1.00 0.00 ? 122 SER A N    2  
ATOM 3695  C CA   . SER A 1 122 ? -4.274  2.709   -18.106 1.00 0.00 ? 122 SER A CA   2  
ATOM 3696  C C    . SER A 1 122 ? -5.752  3.036   -17.915 1.00 0.00 ? 122 SER A C    2  
ATOM 3697  O O    . SER A 1 122 ? -6.267  3.001   -16.797 1.00 0.00 ? 122 SER A O    2  
ATOM 3698  C CB   . SER A 1 122 ? -4.119  1.274   -18.612 1.00 0.00 ? 122 SER A CB   2  
ATOM 3699  O OG   . SER A 1 122 ? -2.919  1.121   -19.351 1.00 0.00 ? 122 SER A OG   2  
ATOM 3700  H H    . SER A 1 122 ? -3.244  2.099   -16.360 1.00 0.00 ? 122 SER A H    2  
ATOM 3701  H HA   . SER A 1 122 ? -3.860  3.387   -18.838 1.00 0.00 ? 122 SER A HA   2  
ATOM 3702  H HB2  . SER A 1 122 ? -4.098  0.598   -17.771 1.00 0.00 ? 122 SER A HB2  2  
ATOM 3703  H HB3  . SER A 1 122 ? -4.955  1.028   -19.251 1.00 0.00 ? 122 SER A HB3  2  
ATOM 3704  H HG   . SER A 1 122 ? -2.499  0.292   -19.112 1.00 0.00 ? 122 SER A HG   2  
ATOM 3705  N N    . SER A 1 123 ? -6.429  3.352   -19.014 1.00 0.00 ? 123 SER A N    2  
ATOM 3706  C CA   . SER A 1 123 ? -7.847  3.689   -18.968 1.00 0.00 ? 123 SER A CA   2  
ATOM 3707  C C    . SER A 1 123 ? -8.418  3.830   -20.376 1.00 0.00 ? 123 SER A C    2  
ATOM 3708  O O    . SER A 1 123 ? -7.782  4.401   -21.261 1.00 0.00 ? 123 SER A O    2  
ATOM 3709  C CB   . SER A 1 123 ? -8.060  4.987   -18.187 1.00 0.00 ? 123 SER A CB   2  
ATOM 3710  O OG   . SER A 1 123 ? -9.438  5.228   -17.962 1.00 0.00 ? 123 SER A OG   2  
ATOM 3711  H H    . SER A 1 123 ? -5.962  3.362   -19.876 1.00 0.00 ? 123 SER A H    2  
ATOM 3712  H HA   . SER A 1 123 ? -8.362  2.886   -18.462 1.00 0.00 ? 123 SER A HA   2  
ATOM 3713  H HB2  . SER A 1 123 ? -7.559  4.917   -17.233 1.00 0.00 ? 123 SER A HB2  2  
ATOM 3714  H HB3  . SER A 1 123 ? -7.649  5.814   -18.749 1.00 0.00 ? 123 SER A HB3  2  
ATOM 3715  H HG   . SER A 1 123 ? -9.850  5.519   -18.778 1.00 0.00 ? 123 SER A HG   2  
ATOM 3716  N N    . GLY A 1 124 ? -9.623  3.306   -20.574 1.00 0.00 ? 124 GLY A N    2  
ATOM 3717  C CA   . GLY A 1 124 ? -10.261 3.383   -21.876 1.00 0.00 ? 124 GLY A CA   2  
ATOM 3718  C C    . GLY A 1 124 ? -10.908 2.074   -22.283 1.00 0.00 ? 124 GLY A C    2  
ATOM 3719  O O    . GLY A 1 124 ? -11.546 1.989   -23.332 1.00 0.00 ? 124 GLY A O    2  
ATOM 3720  H H    . GLY A 1 124 ? -10.083 2.862   -19.831 1.00 0.00 ? 124 GLY A H    2  
ATOM 3721  H HA2  . GLY A 1 124 ? -11.017 4.153   -21.849 1.00 0.00 ? 124 GLY A HA2  2  
ATOM 3722  H HA3  . GLY A 1 124 ? -9.517  3.647   -22.613 1.00 0.00 ? 124 GLY A HA3  2  
ATOM 3723  N N    . GLY A 1 1   ? -0.207  -25.207 22.997  1.00 0.00 ? 1   GLY A N    3  
ATOM 3724  C CA   . GLY A 1 1   ? -0.507  -23.821 22.691  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3725  C C    . GLY A 1 1   ? -0.922  -23.033 23.918  1.00 0.00 ? 1   GLY A C    3  
ATOM 3726  O O    . GLY A 1 1   ? -1.685  -23.524 24.751  1.00 0.00 ? 1   GLY A O    3  
ATOM 3727  H H1   . GLY A 1 1   ? -0.202  -25.512 23.929  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3728  H HA2  . GLY A 1 1   ? 0.370   -23.360 22.261  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3729  H HA3  . GLY A 1 1   ? -1.310  -23.789 21.969  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3730  N N    . SER A 1 2   ? -0.419  -21.808 24.032  1.00 0.00 ? 2   SER A N    3  
ATOM 3731  C CA   . SER A 1 2   ? -0.738  -20.953 25.169  1.00 0.00 ? 2   SER A CA   3  
ATOM 3732  C C    . SER A 1 2   ? -1.543  -19.736 24.725  1.00 0.00 ? 2   SER A C    3  
ATOM 3733  O O    . SER A 1 2   ? -1.664  -19.460 23.532  1.00 0.00 ? 2   SER A O    3  
ATOM 3734  C CB   . SER A 1 2   ? 0.545   -20.502 25.871  1.00 0.00 ? 2   SER A CB   3  
ATOM 3735  O OG   . SER A 1 2   ? 0.317   -20.266 27.249  1.00 0.00 ? 2   SER A OG   3  
ATOM 3736  H H    . SER A 1 2   ? 0.184   -21.473 23.335  1.00 0.00 ? 2   SER A H    3  
ATOM 3737  H HA   . SER A 1 2   ? -1.332  -21.531 25.862  1.00 0.00 ? 2   SER A HA   3  
ATOM 3738  H HB2  . SER A 1 2   ? 1.297   -21.270 25.769  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3739  H HB3  . SER A 1 2   ? 0.899   -19.589 25.415  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3740  H HG   . SER A 1 2   ? 0.779   -20.928 27.769  1.00 0.00 ? 2   SER A HG   3  
ATOM 3741  N N    . SER A 1 3   ? -2.092  -19.012 25.695  1.00 0.00 ? 3   SER A N    3  
ATOM 3742  C CA   . SER A 1 3   ? -2.889  -17.826 25.405  1.00 0.00 ? 3   SER A CA   3  
ATOM 3743  C C    . SER A 1 3   ? -2.306  -17.054 24.226  1.00 0.00 ? 3   SER A C    3  
ATOM 3744  O O    . SER A 1 3   ? -1.112  -17.140 23.943  1.00 0.00 ? 3   SER A O    3  
ATOM 3745  C CB   . SER A 1 3   ? -2.962  -16.921 26.636  1.00 0.00 ? 3   SER A CB   3  
ATOM 3746  O OG   . SER A 1 3   ? -1.773  -16.164 26.783  1.00 0.00 ? 3   SER A OG   3  
ATOM 3747  H H    . SER A 1 3   ? -1.959  -19.283 26.627  1.00 0.00 ? 3   SER A H    3  
ATOM 3748  H HA   . SER A 1 3   ? -3.887  -18.151 25.149  1.00 0.00 ? 3   SER A HA   3  
ATOM 3749  H HB2  . SER A 1 3   ? -3.795  -16.243 26.533  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3750  H HB3  . SER A 1 3   ? -3.099  -17.529 27.519  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3751  H HG   . SER A 1 3   ? -1.056  -16.742 27.052  1.00 0.00 ? 3   SER A HG   3  
ATOM 3752  N N    . GLY A 1 4   ? -3.159  -16.298 23.540  1.00 0.00 ? 4   GLY A N    3  
ATOM 3753  C CA   . GLY A 1 4   ? -2.711  -15.521 22.399  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3754  C C    . GLY A 1 4   ? -3.489  -15.841 21.139  1.00 0.00 ? 4   GLY A C    3  
ATOM 3755  O O    . GLY A 1 4   ? -4.715  -15.951 21.169  1.00 0.00 ? 4   GLY A O    3  
ATOM 3756  H H    . GLY A 1 4   ? -4.100  -16.268 23.812  1.00 0.00 ? 4   GLY A H    3  
ATOM 3757  H HA2  . GLY A 1 4   ? -2.825  -14.472 22.625  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3758  H HA3  . GLY A 1 4   ? -1.665  -15.729 22.225  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3759  N N    . SER A 1 5   ? -2.777  -15.988 20.026  1.00 0.00 ? 5   SER A N    3  
ATOM 3760  C CA   . SER A 1 5   ? -3.409  -16.291 18.748  1.00 0.00 ? 5   SER A CA   3  
ATOM 3761  C C    . SER A 1 5   ? -2.527  -17.211 17.910  1.00 0.00 ? 5   SER A C    3  
ATOM 3762  O O    . SER A 1 5   ? -1.327  -16.976 17.765  1.00 0.00 ? 5   SER A O    3  
ATOM 3763  C CB   . SER A 1 5   ? -3.696  -15.000 17.978  1.00 0.00 ? 5   SER A CB   3  
ATOM 3764  O OG   . SER A 1 5   ? -4.624  -14.186 18.674  1.00 0.00 ? 5   SER A OG   3  
ATOM 3765  H H    . SER A 1 5   ? -1.802  -15.887 20.066  1.00 0.00 ? 5   SER A H    3  
ATOM 3766  H HA   . SER A 1 5   ? -4.343  -16.793 18.951  1.00 0.00 ? 5   SER A HA   3  
ATOM 3767  H HB2  . SER A 1 5   ? -2.777  -14.448 17.850  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3768  H HB3  . SER A 1 5   ? -4.106  -15.246 17.009  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3769  H HG   . SER A 1 5   ? -4.621  -14.421 19.605  1.00 0.00 ? 5   SER A HG   3  
ATOM 3770  N N    . SER A 1 6   ? -3.131  -18.259 17.359  1.00 0.00 ? 6   SER A N    3  
ATOM 3771  C CA   . SER A 1 6   ? -2.400  -19.218 16.538  1.00 0.00 ? 6   SER A CA   3  
ATOM 3772  C C    . SER A 1 6   ? -1.971  -18.587 15.218  1.00 0.00 ? 6   SER A C    3  
ATOM 3773  O O    . SER A 1 6   ? -2.587  -18.817 14.178  1.00 0.00 ? 6   SER A O    3  
ATOM 3774  C CB   . SER A 1 6   ? -3.263  -20.453 16.270  1.00 0.00 ? 6   SER A CB   3  
ATOM 3775  O OG   . SER A 1 6   ? -3.319  -21.293 17.410  1.00 0.00 ? 6   SER A OG   3  
ATOM 3776  H H    . SER A 1 6   ? -4.090  -18.392 17.511  1.00 0.00 ? 6   SER A H    3  
ATOM 3777  H HA   . SER A 1 6   ? -1.518  -19.517 17.084  1.00 0.00 ? 6   SER A HA   3  
ATOM 3778  H HB2  . SER A 1 6   ? -4.265  -20.141 16.018  1.00 0.00 ? 6   SER A HB2  3  
ATOM 3779  H HB3  . SER A 1 6   ? -2.841  -21.010 15.446  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3780  H HG   . SER A 1 6   ? -3.348  -22.211 17.129  1.00 0.00 ? 6   SER A HG   3  
ATOM 3781  N N    . GLY A 1 7   ? -0.909  -17.788 15.268  1.00 0.00 ? 7   GLY A N    3  
ATOM 3782  C CA   . GLY A 1 7   ? -0.415  -17.135 14.070  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3783  C C    . GLY A 1 7   ? -0.176  -15.652 14.275  1.00 0.00 ? 7   GLY A C    3  
ATOM 3784  O O    . GLY A 1 7   ? -0.857  -14.818 13.678  1.00 0.00 ? 7   GLY A O    3  
ATOM 3785  H H    . GLY A 1 7   ? -0.458  -17.641 16.126  1.00 0.00 ? 7   GLY A H    3  
ATOM 3786  H HA2  . GLY A 1 7   ? 0.513   -17.601 13.776  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3787  H HA3  . GLY A 1 7   ? -1.138  -17.265 13.278  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3788  N N    . ASP A 1 8   ? 0.793   -15.322 15.122  1.00 0.00 ? 8   ASP A N    3  
ATOM 3789  C CA   . ASP A 1 8   ? 1.119   -13.929 15.405  1.00 0.00 ? 8   ASP A CA   3  
ATOM 3790  C C    . ASP A 1 8   ? 2.226   -13.432 14.480  1.00 0.00 ? 8   ASP A C    3  
ATOM 3791  O O    . ASP A 1 8   ? 2.913   -12.458 14.786  1.00 0.00 ? 8   ASP A O    3  
ATOM 3792  C CB   . ASP A 1 8   ? 1.548   -13.770 16.865  1.00 0.00 ? 8   ASP A CB   3  
ATOM 3793  C CG   . ASP A 1 8   ? 2.209   -15.019 17.413  1.00 0.00 ? 8   ASP A CG   3  
ATOM 3794  O OD1  . ASP A 1 8   ? 3.366   -15.294 17.033  1.00 0.00 ? 8   ASP A OD1  3  
ATOM 3795  O OD2  . ASP A 1 8   ? 1.569   -15.723 18.223  1.00 0.00 ? 8   ASP A OD2  3  
ATOM 3796  H H    . ASP A 1 8   ? 1.300   -16.032 15.568  1.00 0.00 ? 8   ASP A H    3  
ATOM 3797  H HA   . ASP A 1 8   ? 0.232   -13.339 15.234  1.00 0.00 ? 8   ASP A HA   3  
ATOM 3798  H HB2  . ASP A 1 8   ? 2.250   -12.952 16.940  1.00 0.00 ? 8   ASP A HB2  3  
ATOM 3799  H HB3  . ASP A 1 8   ? 0.679   -13.550 17.467  1.00 0.00 ? 8   ASP A HB3  3  
ATOM 3800  N N    . ALA A 1 9   ? 2.392   -14.108 13.348  1.00 0.00 ? 9   ALA A N    3  
ATOM 3801  C CA   . ALA A 1 9   ? 3.413   -13.734 12.378  1.00 0.00 ? 9   ALA A CA   3  
ATOM 3802  C C    . ALA A 1 9   ? 3.027   -12.458 11.638  1.00 0.00 ? 9   ALA A C    3  
ATOM 3803  O O    . ALA A 1 9   ? 3.782   -11.960 10.803  1.00 0.00 ? 9   ALA A O    3  
ATOM 3804  C CB   . ALA A 1 9   ? 3.644   -14.869 11.391  1.00 0.00 ? 9   ALA A CB   3  
ATOM 3805  H H    . ALA A 1 9   ? 1.812   -14.875 13.160  1.00 0.00 ? 9   ALA A H    3  
ATOM 3806  H HA   . ALA A 1 9   ? 4.336   -13.563 12.914  1.00 0.00 ? 9   ALA A HA   3  
ATOM 3807  H HB1  . ALA A 1 9   ? 4.498   -14.637 10.771  1.00 0.00 ? 9   ALA A HB1  3  
ATOM 3808  H HB2  . ALA A 1 9   ? 3.830   -15.784 11.933  1.00 0.00 ? 9   ALA A HB2  3  
ATOM 3809  H HB3  . ALA A 1 9   ? 2.770   -14.989 10.770  1.00 0.00 ? 9   ALA A HB3  3  
ATOM 3810  N N    . PHE A 1 10  ? 1.847   -11.933 11.950  1.00 0.00 ? 10  PHE A N    3  
ATOM 3811  C CA   . PHE A 1 10  ? 1.360   -10.714 11.313  1.00 0.00 ? 10  PHE A CA   3  
ATOM 3812  C C    . PHE A 1 10  ? 1.427   -9.533  12.276  1.00 0.00 ? 10  PHE A C    3  
ATOM 3813  O O    . PHE A 1 10  ? 0.703   -8.549  12.123  1.00 0.00 ? 10  PHE A O    3  
ATOM 3814  C CB   . PHE A 1 10  ? -0.077  -10.908 10.825  1.00 0.00 ? 10  PHE A CB   3  
ATOM 3815  C CG   . PHE A 1 10  ? -0.185  -11.789 9.613   1.00 0.00 ? 10  PHE A CG   3  
ATOM 3816  C CD1  . PHE A 1 10  ? -0.097  -11.251 8.339   1.00 0.00 ? 10  PHE A CD1  3  
ATOM 3817  C CD2  . PHE A 1 10  ? -0.374  -13.155 9.748   1.00 0.00 ? 10  PHE A CD2  3  
ATOM 3818  C CE1  . PHE A 1 10  ? -0.197  -12.059 7.223   1.00 0.00 ? 10  PHE A CE1  3  
ATOM 3819  C CE2  . PHE A 1 10  ? -0.474  -13.968 8.634   1.00 0.00 ? 10  PHE A CE2  3  
ATOM 3820  C CZ   . PHE A 1 10  ? -0.384  -13.419 7.370   1.00 0.00 ? 10  PHE A CZ   3  
ATOM 3821  H H    . PHE A 1 10  ? 1.290   -12.376 12.624  1.00 0.00 ? 10  PHE A H    3  
ATOM 3822  H HA   . PHE A 1 10  ? 1.994   -10.508 10.465  1.00 0.00 ? 10  PHE A HA   3  
ATOM 3823  H HB2  . PHE A 1 10  ? -0.660  -11.358 11.614  1.00 0.00 ? 10  PHE A HB2  3  
ATOM 3824  H HB3  . PHE A 1 10  ? -0.498  -9.946  10.576  1.00 0.00 ? 10  PHE A HB3  3  
ATOM 3825  H HD1  . PHE A 1 10  ? 0.051   -10.187 8.222   1.00 0.00 ? 10  PHE A HD1  3  
ATOM 3826  H HD2  . PHE A 1 10  ? -0.444  -13.585 10.737  1.00 0.00 ? 10  PHE A HD2  3  
ATOM 3827  H HE1  . PHE A 1 10  ? -0.126  -11.628 6.235   1.00 0.00 ? 10  PHE A HE1  3  
ATOM 3828  H HE2  . PHE A 1 10  ? -0.621  -15.031 8.754   1.00 0.00 ? 10  PHE A HE2  3  
ATOM 3829  H HZ   . PHE A 1 10  ? -0.463  -14.053 6.499   1.00 0.00 ? 10  PHE A HZ   3  
ATOM 3830  N N    . THR A 1 11  ? 2.302   -9.638  13.272  1.00 0.00 ? 11  THR A N    3  
ATOM 3831  C CA   . THR A 1 11  ? 2.464   -8.580  14.262  1.00 0.00 ? 11  THR A CA   3  
ATOM 3832  C C    . THR A 1 11  ? 3.410   -7.496  13.759  1.00 0.00 ? 11  THR A C    3  
ATOM 3833  O O    . THR A 1 11  ? 4.385   -7.784  13.063  1.00 0.00 ? 11  THR A O    3  
ATOM 3834  C CB   . THR A 1 11  ? 2.999   -9.136  15.595  1.00 0.00 ? 11  THR A CB   3  
ATOM 3835  O OG1  . THR A 1 11  ? 4.134   -9.975  15.355  1.00 0.00 ? 11  THR A OG1  3  
ATOM 3836  C CG2  . THR A 1 11  ? 1.922   -9.926  16.323  1.00 0.00 ? 11  THR A CG2  3  
ATOM 3837  H H    . THR A 1 11  ? 2.851   -10.446 13.341  1.00 0.00 ? 11  THR A H    3  
ATOM 3838  H HA   . THR A 1 11  ? 1.493   -8.141  14.442  1.00 0.00 ? 11  THR A HA   3  
ATOM 3839  H HB   . THR A 1 11  ? 3.299   -8.306  16.219  1.00 0.00 ? 11  THR A HB   3  
ATOM 3840  H HG1  . THR A 1 11  ? 4.896   -9.430  15.144  1.00 0.00 ? 11  THR A HG1  3  
ATOM 3841  H HG21 . THR A 1 11  ? 1.263   -9.245  16.840  1.00 0.00 ? 11  THR A HG21 3  
ATOM 3842  H HG22 . THR A 1 11  ? 2.385   -10.591 17.037  1.00 0.00 ? 11  THR A HG22 3  
ATOM 3843  H HG23 . THR A 1 11  ? 1.355   -10.503 15.608  1.00 0.00 ? 11  THR A HG23 3  
ATOM 3844  N N    . ASP A 1 12  ? 3.119   -6.251  14.116  1.00 0.00 ? 12  ASP A N    3  
ATOM 3845  C CA   . ASP A 1 12  ? 3.946   -5.123  13.703  1.00 0.00 ? 12  ASP A CA   3  
ATOM 3846  C C    . ASP A 1 12  ? 5.427   -5.487  13.756  1.00 0.00 ? 12  ASP A C    3  
ATOM 3847  O O    . ASP A 1 12  ? 6.106   -5.514  12.730  1.00 0.00 ? 12  ASP A O    3  
ATOM 3848  C CB   . ASP A 1 12  ? 3.674   -3.910  14.593  1.00 0.00 ? 12  ASP A CB   3  
ATOM 3849  C CG   . ASP A 1 12  ? 3.354   -4.300  16.022  1.00 0.00 ? 12  ASP A CG   3  
ATOM 3850  O OD1  . ASP A 1 12  ? 4.302   -4.562  16.792  1.00 0.00 ? 12  ASP A OD1  3  
ATOM 3851  O OD2  . ASP A 1 12  ? 2.156   -4.345  16.371  1.00 0.00 ? 12  ASP A OD2  3  
ATOM 3852  H H    . ASP A 1 12  ? 2.328   -6.085  14.672  1.00 0.00 ? 12  ASP A H    3  
ATOM 3853  H HA   . ASP A 1 12  ? 3.686   -4.877  12.684  1.00 0.00 ? 12  ASP A HA   3  
ATOM 3854  H HB2  . ASP A 1 12  ? 4.547   -3.273  14.600  1.00 0.00 ? 12  ASP A HB2  3  
ATOM 3855  H HB3  . ASP A 1 12  ? 2.835   -3.359  14.193  1.00 0.00 ? 12  ASP A HB3  3  
ATOM 3856  N N    . GLN A 1 13  ? 5.919   -5.765  14.959  1.00 0.00 ? 13  GLN A N    3  
ATOM 3857  C CA   . GLN A 1 13  ? 7.320   -6.125  15.145  1.00 0.00 ? 13  GLN A CA   3  
ATOM 3858  C C    . GLN A 1 13  ? 7.788   -7.075  14.048  1.00 0.00 ? 13  GLN A C    3  
ATOM 3859  O O    . GLN A 1 13  ? 8.904   -6.954  13.541  1.00 0.00 ? 13  GLN A O    3  
ATOM 3860  C CB   . GLN A 1 13  ? 7.524   -6.771  16.517  1.00 0.00 ? 13  GLN A CB   3  
ATOM 3861  C CG   . GLN A 1 13  ? 6.701   -8.032  16.724  1.00 0.00 ? 13  GLN A CG   3  
ATOM 3862  C CD   . GLN A 1 13  ? 6.508   -8.369  18.189  1.00 0.00 ? 13  GLN A CD   3  
ATOM 3863  O OE1  . GLN A 1 13  ? 7.309   -9.092  18.782  1.00 0.00 ? 13  GLN A OE1  3  
ATOM 3864  N NE2  . GLN A 1 13  ? 5.441   -7.846  18.782  1.00 0.00 ? 13  GLN A NE2  3  
ATOM 3865  H H    . GLN A 1 13  ? 5.328   -5.726  15.738  1.00 0.00 ? 13  GLN A H    3  
ATOM 3866  H HA   . GLN A 1 13  ? 7.905   -5.219  15.093  1.00 0.00 ? 13  GLN A HA   3  
ATOM 3867  H HB2  . GLN A 1 13  ? 8.567   -7.025  16.630  1.00 0.00 ? 13  GLN A HB2  3  
ATOM 3868  H HB3  . GLN A 1 13  ? 7.250   -6.059  17.281  1.00 0.00 ? 13  GLN A HB3  3  
ATOM 3869  H HG2  . GLN A 1 13  ? 5.730   -7.891  16.272  1.00 0.00 ? 13  GLN A HG2  3  
ATOM 3870  H HG3  . GLN A 1 13  ? 7.204   -8.858  16.242  1.00 0.00 ? 13  GLN A HG3  3  
ATOM 3871  H HE21 . GLN A 1 13  ? 4.846   -7.280  18.246  1.00 0.00 ? 13  GLN A HE21 3  
ATOM 3872  H HE22 . GLN A 1 13  ? 5.292   -8.048  19.728  1.00 0.00 ? 13  GLN A HE22 3  
ATOM 3873  N N    . LYS A 1 14  ? 6.929   -8.021  13.685  1.00 0.00 ? 14  LYS A N    3  
ATOM 3874  C CA   . LYS A 1 14  ? 7.253   -8.992  12.646  1.00 0.00 ? 14  LYS A CA   3  
ATOM 3875  C C    . LYS A 1 14  ? 7.192   -8.352  11.264  1.00 0.00 ? 14  LYS A C    3  
ATOM 3876  O O    . LYS A 1 14  ? 7.992   -8.673  10.384  1.00 0.00 ? 14  LYS A O    3  
ATOM 3877  C CB   . LYS A 1 14  ? 6.292   -10.181 12.712  1.00 0.00 ? 14  LYS A CB   3  
ATOM 3878  C CG   . LYS A 1 14  ? 6.612   -11.161 13.828  1.00 0.00 ? 14  LYS A CG   3  
ATOM 3879  C CD   . LYS A 1 14  ? 7.821   -12.017 13.488  1.00 0.00 ? 14  LYS A CD   3  
ATOM 3880  C CE   . LYS A 1 14  ? 7.455   -13.144 12.534  1.00 0.00 ? 14  LYS A CE   3  
ATOM 3881  N NZ   . LYS A 1 14  ? 8.641   -13.967 12.167  1.00 0.00 ? 14  LYS A NZ   3  
ATOM 3882  H H    . LYS A 1 14  ? 6.054   -8.067  14.125  1.00 0.00 ? 14  LYS A H    3  
ATOM 3883  H HA   . LYS A 1 14  ? 8.259   -9.343  12.823  1.00 0.00 ? 14  LYS A HA   3  
ATOM 3884  H HB2  . LYS A 1 14  ? 5.289   -9.809  12.865  1.00 0.00 ? 14  LYS A HB2  3  
ATOM 3885  H HB3  . LYS A 1 14  ? 6.330   -10.712 11.772  1.00 0.00 ? 14  LYS A HB3  3  
ATOM 3886  H HG2  . LYS A 1 14  ? 6.818   -10.609 14.732  1.00 0.00 ? 14  LYS A HG2  3  
ATOM 3887  H HG3  . LYS A 1 14  ? 5.758   -11.806 13.984  1.00 0.00 ? 14  LYS A HG3  3  
ATOM 3888  H HD2  . LYS A 1 14  ? 8.571   -11.396 13.022  1.00 0.00 ? 14  LYS A HD2  3  
ATOM 3889  H HD3  . LYS A 1 14  ? 8.217   -12.442 14.399  1.00 0.00 ? 14  LYS A HD3  3  
ATOM 3890  H HE2  . LYS A 1 14  ? 6.722   -13.776 13.009  1.00 0.00 ? 14  LYS A HE2  3  
ATOM 3891  H HE3  . LYS A 1 14  ? 7.034   -12.715 11.636  1.00 0.00 ? 14  LYS A HE3  3  
ATOM 3892  H HZ1  . LYS A 1 14  ? 9.370   -13.892 12.906  1.00 0.00 ? 14  LYS A HZ1  3  
ATOM 3893  H HZ2  . LYS A 1 14  ? 9.042   -13.635 11.267  1.00 0.00 ? 14  LYS A HZ2  3  
ATOM 3894  H HZ3  . LYS A 1 14  ? 8.367   -14.964 12.066  1.00 0.00 ? 14  LYS A HZ3  3  
ATOM 3895  N N    . ILE A 1 15  ? 6.240   -7.443  11.079  1.00 0.00 ? 15  ILE A N    3  
ATOM 3896  C CA   . ILE A 1 15  ? 6.077   -6.756  9.804   1.00 0.00 ? 15  ILE A CA   3  
ATOM 3897  C C    . ILE A 1 15  ? 7.282   -5.873  9.498   1.00 0.00 ? 15  ILE A C    3  
ATOM 3898  O O    . ILE A 1 15  ? 7.840   -5.925  8.401   1.00 0.00 ? 15  ILE A O    3  
ATOM 3899  C CB   . ILE A 1 15  ? 4.803   -5.891  9.789   1.00 0.00 ? 15  ILE A CB   3  
ATOM 3900  C CG1  . ILE A 1 15  ? 3.564   -6.765  9.994   1.00 0.00 ? 15  ILE A CG1  3  
ATOM 3901  C CG2  . ILE A 1 15  ? 4.703   -5.118  8.483   1.00 0.00 ? 15  ILE A CG2  3  
ATOM 3902  C CD1  . ILE A 1 15  ? 2.282   -5.974  10.127  1.00 0.00 ? 15  ILE A CD1  3  
ATOM 3903  H H    . ILE A 1 15  ? 5.633   -7.230  11.818  1.00 0.00 ? 15  ILE A H    3  
ATOM 3904  H HA   . ILE A 1 15  ? 5.988   -7.506  9.031   1.00 0.00 ? 15  ILE A HA   3  
ATOM 3905  H HB   . ILE A 1 15  ? 4.870   -5.178  10.597  1.00 0.00 ? 15  ILE A HB   3  
ATOM 3906  H HG12 . ILE A 1 15  ? 3.457   -7.430  9.152   1.00 0.00 ? 15  ILE A HG12 3  
ATOM 3907  H HG13 . ILE A 1 15  ? 3.690   -7.349  10.895  1.00 0.00 ? 15  ILE A HG13 3  
ATOM 3908  H HG21 . ILE A 1 15  ? 4.467   -4.085  8.693   1.00 0.00 ? 15  ILE A HG21 3  
ATOM 3909  H HG22 . ILE A 1 15  ? 5.646   -5.172  7.960   1.00 0.00 ? 15  ILE A HG22 3  
ATOM 3910  H HG23 . ILE A 1 15  ? 3.925   -5.547  7.869   1.00 0.00 ? 15  ILE A HG23 3  
ATOM 3911  H HD11 . ILE A 1 15  ? 2.089   -5.772  11.171  1.00 0.00 ? 15  ILE A HD11 3  
ATOM 3912  H HD12 . ILE A 1 15  ? 2.376   -5.042  9.591   1.00 0.00 ? 15  ILE A HD12 3  
ATOM 3913  H HD13 . ILE A 1 15  ? 1.462   -6.545  9.715   1.00 0.00 ? 15  ILE A HD13 3  
ATOM 3914  N N    . ARG A 1 16  ? 7.679   -5.064  10.474  1.00 0.00 ? 16  ARG A N    3  
ATOM 3915  C CA   . ARG A 1 16  ? 8.819   -4.170  10.310  1.00 0.00 ? 16  ARG A CA   3  
ATOM 3916  C C    . ARG A 1 16  ? 10.107  -4.962  10.109  1.00 0.00 ? 16  ARG A C    3  
ATOM 3917  O O    . ARG A 1 16  ? 10.944  -4.603  9.281   1.00 0.00 ? 16  ARG A O    3  
ATOM 3918  C CB   . ARG A 1 16  ? 8.955   -3.254  11.528  1.00 0.00 ? 16  ARG A CB   3  
ATOM 3919  C CG   . ARG A 1 16  ? 9.142   -4.004  12.836  1.00 0.00 ? 16  ARG A CG   3  
ATOM 3920  C CD   . ARG A 1 16  ? 9.217   -3.051  14.019  1.00 0.00 ? 16  ARG A CD   3  
ATOM 3921  N NE   . ARG A 1 16  ? 9.969   -3.621  15.134  1.00 0.00 ? 16  ARG A NE   3  
ATOM 3922  C CZ   . ARG A 1 16  ? 10.225  -2.964  16.260  1.00 0.00 ? 16  ARG A CZ   3  
ATOM 3923  N NH1  . ARG A 1 16  ? 9.790   -1.722  16.420  1.00 0.00 ? 16  ARG A NH1  3  
ATOM 3924  N NH2  . ARG A 1 16  ? 10.916  -3.550  17.229  1.00 0.00 ? 16  ARG A NH2  3  
ATOM 3925  H H    . ARG A 1 16  ? 7.194   -5.068  11.326  1.00 0.00 ? 16  ARG A H    3  
ATOM 3926  H HA   . ARG A 1 16  ? 8.641   -3.565  9.433   1.00 0.00 ? 16  ARG A HA   3  
ATOM 3927  H HB2  . ARG A 1 16  ? 9.809   -2.608  11.384  1.00 0.00 ? 16  ARG A HB2  3  
ATOM 3928  H HB3  . ARG A 1 16  ? 8.065   -2.648  11.609  1.00 0.00 ? 16  ARG A HB3  3  
ATOM 3929  H HG2  . ARG A 1 16  ? 8.306   -4.672  12.980  1.00 0.00 ? 16  ARG A HG2  3  
ATOM 3930  H HG3  . ARG A 1 16  ? 10.057  -4.575  12.785  1.00 0.00 ? 16  ARG A HG3  3  
ATOM 3931  H HD2  . ARG A 1 16  ? 9.701   -2.140  13.700  1.00 0.00 ? 16  ARG A HD2  3  
ATOM 3932  H HD3  . ARG A 1 16  ? 8.214   -2.829  14.349  1.00 0.00 ? 16  ARG A HD3  3  
ATOM 3933  H HE   . ARG A 1 16  ? 10.300  -4.538  15.037  1.00 0.00 ? 16  ARG A HE   3  
ATOM 3934  H HH11 . ARG A 1 16  ? 9.268   -1.278  15.692  1.00 0.00 ? 16  ARG A HH11 3  
ATOM 3935  H HH12 . ARG A 1 16  ? 9.982   -1.230  17.269  1.00 0.00 ? 16  ARG A HH12 3  
ATOM 3936  H HH21 . ARG A 1 16  ? 11.245  -4.487  17.112  1.00 0.00 ? 16  ARG A HH21 3  
ATOM 3937  H HH22 . ARG A 1 16  ? 11.107  -3.056  18.076  1.00 0.00 ? 16  ARG A HH22 3  
ATOM 3938  N N    . GLN A 1 17  ? 10.259  -6.039  10.873  1.00 0.00 ? 17  GLN A N    3  
ATOM 3939  C CA   . GLN A 1 17  ? 11.446  -6.880  10.779  1.00 0.00 ? 17  GLN A CA   3  
ATOM 3940  C C    . GLN A 1 17  ? 11.423  -7.714  9.502   1.00 0.00 ? 17  GLN A C    3  
ATOM 3941  O O    . GLN A 1 17  ? 12.470  -8.084  8.972   1.00 0.00 ? 17  GLN A O    3  
ATOM 3942  C CB   . GLN A 1 17  ? 11.544  -7.798  11.999  1.00 0.00 ? 17  GLN A CB   3  
ATOM 3943  C CG   . GLN A 1 17  ? 12.299  -7.181  13.165  1.00 0.00 ? 17  GLN A CG   3  
ATOM 3944  C CD   . GLN A 1 17  ? 12.953  -8.221  14.053  1.00 0.00 ? 17  GLN A CD   3  
ATOM 3945  O OE1  . GLN A 1 17  ? 12.649  -9.411  13.963  1.00 0.00 ? 17  GLN A OE1  3  
ATOM 3946  N NE2  . GLN A 1 17  ? 13.858  -7.777  14.917  1.00 0.00 ? 17  GLN A NE2  3  
ATOM 3947  H H    . GLN A 1 17  ? 9.556   -6.273  11.514  1.00 0.00 ? 17  GLN A H    3  
ATOM 3948  H HA   . GLN A 1 17  ? 12.309  -6.233  10.756  1.00 0.00 ? 17  GLN A HA   3  
ATOM 3949  H HB2  . GLN A 1 17  ? 10.547  -8.042  12.332  1.00 0.00 ? 17  GLN A HB2  3  
ATOM 3950  H HB3  . GLN A 1 17  ? 12.051  -8.707  11.711  1.00 0.00 ? 17  GLN A HB3  3  
ATOM 3951  H HG2  . GLN A 1 17  ? 13.066  -6.528  12.776  1.00 0.00 ? 17  GLN A HG2  3  
ATOM 3952  H HG3  . GLN A 1 17  ? 11.606  -6.604  13.761  1.00 0.00 ? 17  GLN A HG3  3  
ATOM 3953  H HE21 . GLN A 1 17  ? 14.049  -6.815  14.934  1.00 0.00 ? 17  GLN A HE21 3  
ATOM 3954  H HE22 . GLN A 1 17  ? 14.296  -8.427  15.504  1.00 0.00 ? 17  GLN A HE22 3  
ATOM 3955  N N    . ARG A 1 18  ? 10.222  -8.005  9.013   1.00 0.00 ? 18  ARG A N    3  
ATOM 3956  C CA   . ARG A 1 18  ? 10.063  -8.796  7.798   1.00 0.00 ? 18  ARG A CA   3  
ATOM 3957  C C    . ARG A 1 18  ? 10.445  -7.982  6.565   1.00 0.00 ? 18  ARG A C    3  
ATOM 3958  O O    . ARG A 1 18  ? 11.064  -8.499  5.635   1.00 0.00 ? 18  ARG A O    3  
ATOM 3959  C CB   . ARG A 1 18  ? 8.620   -9.288  7.670   1.00 0.00 ? 18  ARG A CB   3  
ATOM 3960  C CG   . ARG A 1 18  ? 8.285   -9.843  6.295   1.00 0.00 ? 18  ARG A CG   3  
ATOM 3961  C CD   . ARG A 1 18  ? 7.123   -10.821 6.357   1.00 0.00 ? 18  ARG A CD   3  
ATOM 3962  N NE   . ARG A 1 18  ? 7.410   -11.959 7.226   1.00 0.00 ? 18  ARG A NE   3  
ATOM 3963  C CZ   . ARG A 1 18  ? 6.598   -13.001 7.365   1.00 0.00 ? 18  ARG A CZ   3  
ATOM 3964  N NH1  . ARG A 1 18  ? 5.455   -13.049 6.695   1.00 0.00 ? 18  ARG A NH1  3  
ATOM 3965  N NH2  . ARG A 1 18  ? 6.930   -13.999 8.175   1.00 0.00 ? 18  ARG A NH2  3  
ATOM 3966  H H    . ARG A 1 18  ? 9.423   -7.681  9.480   1.00 0.00 ? 18  ARG A H    3  
ATOM 3967  H HA   . ARG A 1 18  ? 10.720  -9.649  7.870   1.00 0.00 ? 18  ARG A HA   3  
ATOM 3968  H HB2  . ARG A 1 18  ? 8.452   -10.068 8.399   1.00 0.00 ? 18  ARG A HB2  3  
ATOM 3969  H HB3  . ARG A 1 18  ? 7.952   -8.465  7.875   1.00 0.00 ? 18  ARG A HB3  3  
ATOM 3970  H HG2  . ARG A 1 18  ? 8.019   -9.025  5.643   1.00 0.00 ? 18  ARG A HG2  3  
ATOM 3971  H HG3  . ARG A 1 18  ? 9.153   -10.352 5.902   1.00 0.00 ? 18  ARG A HG3  3  
ATOM 3972  H HD2  . ARG A 1 18  ? 6.253   -10.303 6.734   1.00 0.00 ? 18  ARG A HD2  3  
ATOM 3973  H HD3  . ARG A 1 18  ? 6.921   -11.183 5.360   1.00 0.00 ? 18  ARG A HD3  3  
ATOM 3974  H HE   . ARG A 1 18  ? 8.250   -11.944 7.731   1.00 0.00 ? 18  ARG A HE   3  
ATOM 3975  H HH11 . ARG A 1 18  ? 5.203   -12.300 6.083   1.00 0.00 ? 18  ARG A HH11 3  
ATOM 3976  H HH12 . ARG A 1 18  ? 4.846   -13.836 6.801   1.00 0.00 ? 18  ARG A HH12 3  
ATOM 3977  H HH21 . ARG A 1 18  ? 7.791   -13.966 8.682   1.00 0.00 ? 18  ARG A HH21 3  
ATOM 3978  H HH22 . ARG A 1 18  ? 6.318   -14.782 8.279   1.00 0.00 ? 18  ARG A HH22 3  
ATOM 3979  N N    . TYR A 1 19  ? 10.070  -6.707  6.565   1.00 0.00 ? 19  TYR A N    3  
ATOM 3980  C CA   . TYR A 1 19  ? 10.371  -5.823  5.446   1.00 0.00 ? 19  TYR A CA   3  
ATOM 3981  C C    . TYR A 1 19  ? 11.495  -4.855  5.803   1.00 0.00 ? 19  TYR A C    3  
ATOM 3982  O O    . TYR A 1 19  ? 11.737  -3.879  5.094   1.00 0.00 ? 19  TYR A O    3  
ATOM 3983  C CB   . TYR A 1 19  ? 9.121   -5.041  5.036   1.00 0.00 ? 19  TYR A CB   3  
ATOM 3984  C CG   . TYR A 1 19  ? 8.000   -5.918  4.524   1.00 0.00 ? 19  TYR A CG   3  
ATOM 3985  C CD1  . TYR A 1 19  ? 8.094   -6.550  3.291   1.00 0.00 ? 19  TYR A CD1  3  
ATOM 3986  C CD2  . TYR A 1 19  ? 6.848   -6.114  5.275   1.00 0.00 ? 19  TYR A CD2  3  
ATOM 3987  C CE1  . TYR A 1 19  ? 7.072   -7.350  2.819   1.00 0.00 ? 19  TYR A CE1  3  
ATOM 3988  C CE2  . TYR A 1 19  ? 5.821   -6.914  4.812   1.00 0.00 ? 19  TYR A CE2  3  
ATOM 3989  C CZ   . TYR A 1 19  ? 5.938   -7.529  3.583   1.00 0.00 ? 19  TYR A CZ   3  
ATOM 3990  O OH   . TYR A 1 19  ? 4.918   -8.327  3.117   1.00 0.00 ? 19  TYR A OH   3  
ATOM 3991  H H    . TYR A 1 19  ? 9.579   -6.353  7.335   1.00 0.00 ? 19  TYR A H    3  
ATOM 3992  H HA   . TYR A 1 19  ? 10.689  -6.435  4.615   1.00 0.00 ? 19  TYR A HA   3  
ATOM 3993  H HB2  . TYR A 1 19  ? 8.751   -4.495  5.890   1.00 0.00 ? 19  TYR A HB2  3  
ATOM 3994  H HB3  . TYR A 1 19  ? 9.382   -4.344  4.253   1.00 0.00 ? 19  TYR A HB3  3  
ATOM 3995  H HD1  . TYR A 1 19  ? 8.984   -6.408  2.695   1.00 0.00 ? 19  TYR A HD1  3  
ATOM 3996  H HD2  . TYR A 1 19  ? 6.759   -5.630  6.237   1.00 0.00 ? 19  TYR A HD2  3  
ATOM 3997  H HE1  . TYR A 1 19  ? 7.163   -7.833  1.857   1.00 0.00 ? 19  TYR A HE1  3  
ATOM 3998  H HE2  . TYR A 1 19  ? 4.932   -7.054  5.410   1.00 0.00 ? 19  TYR A HE2  3  
ATOM 3999  H HH   . TYR A 1 19  ? 4.700   -8.075  2.217   1.00 0.00 ? 19  TYR A HH   3  
ATOM 4000  N N    . ALA A 1 20  ? 12.179  -5.135  6.907   1.00 0.00 ? 20  ALA A N    3  
ATOM 4001  C CA   . ALA A 1 20  ? 13.280  -4.292  7.358   1.00 0.00 ? 20  ALA A CA   3  
ATOM 4002  C C    . ALA A 1 20  ? 14.423  -4.295  6.349   1.00 0.00 ? 20  ALA A C    3  
ATOM 4003  O O    . ALA A 1 20  ? 15.253  -3.386  6.334   1.00 0.00 ? 20  ALA A O    3  
ATOM 4004  C CB   . ALA A 1 20  ? 13.775  -4.754  8.721   1.00 0.00 ? 20  ALA A CB   3  
ATOM 4005  H H    . ALA A 1 20  ? 11.939  -5.928  7.430   1.00 0.00 ? 20  ALA A H    3  
ATOM 4006  H HA   . ALA A 1 20  ? 12.907  -3.283  7.461   1.00 0.00 ? 20  ALA A HA   3  
ATOM 4007  H HB1  . ALA A 1 20  ? 13.604  -3.974  9.448   1.00 0.00 ? 20  ALA A HB1  3  
ATOM 4008  H HB2  . ALA A 1 20  ? 13.239  -5.645  9.015   1.00 0.00 ? 20  ALA A HB2  3  
ATOM 4009  H HB3  . ALA A 1 20  ? 14.831  -4.970  8.665   1.00 0.00 ? 20  ALA A HB3  3  
ATOM 4010  N N    . ASP A 1 21  ? 14.461  -5.323  5.508   1.00 0.00 ? 21  ASP A N    3  
ATOM 4011  C CA   . ASP A 1 21  ? 15.503  -5.445  4.495   1.00 0.00 ? 21  ASP A CA   3  
ATOM 4012  C C    . ASP A 1 21  ? 15.289  -4.434  3.373   1.00 0.00 ? 21  ASP A C    3  
ATOM 4013  O O    . ASP A 1 21  ? 16.240  -4.017  2.709   1.00 0.00 ? 21  ASP A O    3  
ATOM 4014  C CB   . ASP A 1 21  ? 15.525  -6.863  3.924   1.00 0.00 ? 21  ASP A CB   3  
ATOM 4015  C CG   . ASP A 1 21  ? 15.628  -7.921  5.005   1.00 0.00 ? 21  ASP A CG   3  
ATOM 4016  O OD1  . ASP A 1 21  ? 14.722  -7.983  5.863   1.00 0.00 ? 21  ASP A OD1  3  
ATOM 4017  O OD2  . ASP A 1 21  ? 16.613  -8.688  4.993   1.00 0.00 ? 21  ASP A OD2  3  
ATOM 4018  H H    . ASP A 1 21  ? 13.771  -6.017  5.570   1.00 0.00 ? 21  ASP A H    3  
ATOM 4019  H HA   . ASP A 1 21  ? 16.451  -5.242  4.969   1.00 0.00 ? 21  ASP A HA   3  
ATOM 4020  H HB2  . ASP A 1 21  ? 14.617  -7.034  3.364   1.00 0.00 ? 21  ASP A HB2  3  
ATOM 4021  H HB3  . ASP A 1 21  ? 16.374  -6.965  3.264   1.00 0.00 ? 21  ASP A HB3  3  
ATOM 4022  N N    . LEU A 1 22  ? 14.036  -4.045  3.165   1.00 0.00 ? 22  LEU A N    3  
ATOM 4023  C CA   . LEU A 1 22  ? 13.697  -3.083  2.121   1.00 0.00 ? 22  LEU A CA   3  
ATOM 4024  C C    . LEU A 1 22  ? 14.519  -1.807  2.269   1.00 0.00 ? 22  LEU A C    3  
ATOM 4025  O O    . LEU A 1 22  ? 14.938  -1.432  3.364   1.00 0.00 ? 22  LEU A O    3  
ATOM 4026  C CB   . LEU A 1 22  ? 12.205  -2.751  2.172   1.00 0.00 ? 22  LEU A CB   3  
ATOM 4027  C CG   . LEU A 1 22  ? 11.249  -3.942  2.092   1.00 0.00 ? 22  LEU A CG   3  
ATOM 4028  C CD1  . LEU A 1 22  ? 9.818   -3.466  1.897   1.00 0.00 ? 22  LEU A CD1  3  
ATOM 4029  C CD2  . LEU A 1 22  ? 11.659  -4.880  0.965   1.00 0.00 ? 22  LEU A CD2  3  
ATOM 4030  H H    . LEU A 1 22  ? 13.322  -4.411  3.725   1.00 0.00 ? 22  LEU A H    3  
ATOM 4031  H HA   . LEU A 1 22  ? 13.925  -3.535  1.167   1.00 0.00 ? 22  LEU A HA   3  
ATOM 4032  H HB2  . LEU A 1 22  ? 12.012  -2.235  3.099   1.00 0.00 ? 22  LEU A HB2  3  
ATOM 4033  H HB3  . LEU A 1 22  ? 11.985  -2.093  1.343   1.00 0.00 ? 22  LEU A HB3  3  
ATOM 4034  H HG   . LEU A 1 22  ? 11.293  -4.494  3.020   1.00 0.00 ? 22  LEU A HG   3  
ATOM 4035  H HD11 . LEU A 1 22  ? 9.747   -2.907  0.976   1.00 0.00 ? 22  LEU A HD11 3  
ATOM 4036  H HD12 . LEU A 1 22  ? 9.534   -2.833  2.725   1.00 0.00 ? 22  LEU A HD12 3  
ATOM 4037  H HD13 . LEU A 1 22  ? 9.158   -4.319  1.854   1.00 0.00 ? 22  LEU A HD13 3  
ATOM 4038  H HD21 . LEU A 1 22  ? 12.396  -5.580  1.331   1.00 0.00 ? 22  LEU A HD21 3  
ATOM 4039  H HD22 . LEU A 1 22  ? 12.080  -4.305  0.153   1.00 0.00 ? 22  LEU A HD22 3  
ATOM 4040  H HD23 . LEU A 1 22  ? 10.792  -5.419  0.613   1.00 0.00 ? 22  LEU A HD23 3  
ATOM 4041  N N    . PRO A 1 23  ? 14.755  -1.121  1.140   1.00 0.00 ? 23  PRO A N    3  
ATOM 4042  C CA   . PRO A 1 23  ? 15.527  0.126   1.119   1.00 0.00 ? 23  PRO A CA   3  
ATOM 4043  C C    . PRO A 1 23  ? 14.781  1.280   1.780   1.00 0.00 ? 23  PRO A C    3  
ATOM 4044  O O    . PRO A 1 23  ? 15.329  1.978   2.633   1.00 0.00 ? 23  PRO A O    3  
ATOM 4045  C CB   . PRO A 1 23  ? 15.717  0.399   -0.376  1.00 0.00 ? 23  PRO A CB   3  
ATOM 4046  C CG   . PRO A 1 23  ? 14.574  -0.292  -1.036  1.00 0.00 ? 23  PRO A CG   3  
ATOM 4047  C CD   . PRO A 1 23  ? 14.287  -1.509  -0.201  1.00 0.00 ? 23  PRO A CD   3  
ATOM 4048  H HA   . PRO A 1 23  ? 16.491  0.004   1.590   1.00 0.00 ? 23  PRO A HA   3  
ATOM 4049  H HB2  . PRO A 1 23  ? 15.693  1.464   -0.555  1.00 0.00 ? 23  PRO A HB2  3  
ATOM 4050  H HB3  . PRO A 1 23  ? 16.663  -0.006  -0.701  1.00 0.00 ? 23  PRO A HB3  3  
ATOM 4051  H HG2  . PRO A 1 23  ? 13.713  0.360   -1.056  1.00 0.00 ? 23  PRO A HG2  3  
ATOM 4052  H HG3  . PRO A 1 23  ? 14.850  -0.582  -2.038  1.00 0.00 ? 23  PRO A HG3  3  
ATOM 4053  H HD2  . PRO A 1 23  ? 13.229  -1.721  -0.193  1.00 0.00 ? 23  PRO A HD2  3  
ATOM 4054  H HD3  . PRO A 1 23  ? 14.842  -2.359  -0.570  1.00 0.00 ? 23  PRO A HD3  3  
ATOM 4055  N N    . GLY A 1 24  ? 13.528  1.475   1.382   1.00 0.00 ? 24  GLY A N    3  
ATOM 4056  C CA   . GLY A 1 24  ? 12.728  2.546   1.947   1.00 0.00 ? 24  GLY A CA   3  
ATOM 4057  C C    . GLY A 1 24  ? 12.368  2.297   3.398   1.00 0.00 ? 24  GLY A C    3  
ATOM 4058  O O    . GLY A 1 24  ? 12.781  1.296   3.983   1.00 0.00 ? 24  GLY A O    3  
ATOM 4059  H H    . GLY A 1 24  ? 13.143  0.887   0.698   1.00 0.00 ? 24  GLY A H    3  
ATOM 4060  H HA2  . GLY A 1 24  ? 13.283  3.470   1.879   1.00 0.00 ? 24  GLY A HA2  3  
ATOM 4061  H HA3  . GLY A 1 24  ? 11.818  2.641   1.374   1.00 0.00 ? 24  GLY A HA3  3  
ATOM 4062  N N    . GLU A 1 25  ? 11.597  3.210   3.980   1.00 0.00 ? 25  GLU A N    3  
ATOM 4063  C CA   . GLU A 1 25  ? 11.184  3.084   5.373   1.00 0.00 ? 25  GLU A CA   3  
ATOM 4064  C C    . GLU A 1 25  ? 9.724   2.651   5.471   1.00 0.00 ? 25  GLU A C    3  
ATOM 4065  O O    . GLU A 1 25  ? 8.854   3.202   4.794   1.00 0.00 ? 25  GLU A O    3  
ATOM 4066  C CB   . GLU A 1 25  ? 11.384  4.410   6.110   1.00 0.00 ? 25  GLU A CB   3  
ATOM 4067  C CG   . GLU A 1 25  ? 11.624  4.248   7.601   1.00 0.00 ? 25  GLU A CG   3  
ATOM 4068  C CD   . GLU A 1 25  ? 12.966  3.614   7.911   1.00 0.00 ? 25  GLU A CD   3  
ATOM 4069  O OE1  . GLU A 1 25  ? 13.958  4.361   8.041   1.00 0.00 ? 25  GLU A OE1  3  
ATOM 4070  O OE2  . GLU A 1 25  ? 13.024  2.372   8.023   1.00 0.00 ? 25  GLU A OE2  3  
ATOM 4071  H H    . GLU A 1 25  ? 11.299  3.986   3.462   1.00 0.00 ? 25  GLU A H    3  
ATOM 4072  H HA   . GLU A 1 25  ? 11.802  2.329   5.836   1.00 0.00 ? 25  GLU A HA   3  
ATOM 4073  H HB2  . GLU A 1 25  ? 12.235  4.921   5.682   1.00 0.00 ? 25  GLU A HB2  3  
ATOM 4074  H HB3  . GLU A 1 25  ? 10.504  5.021   5.972   1.00 0.00 ? 25  GLU A HB3  3  
ATOM 4075  H HG2  . GLU A 1 25  ? 11.587  5.222   8.067   1.00 0.00 ? 25  GLU A HG2  3  
ATOM 4076  H HG3  . GLU A 1 25  ? 10.844  3.624   8.012   1.00 0.00 ? 25  GLU A HG3  3  
ATOM 4077  N N    . LEU A 1 26  ? 9.462   1.661   6.317   1.00 0.00 ? 26  LEU A N    3  
ATOM 4078  C CA   . LEU A 1 26  ? 8.107   1.153   6.503   1.00 0.00 ? 26  LEU A CA   3  
ATOM 4079  C C    . LEU A 1 26  ? 7.220   2.199   7.171   1.00 0.00 ? 26  LEU A C    3  
ATOM 4080  O O    . LEU A 1 26  ? 7.595   2.792   8.182   1.00 0.00 ? 26  LEU A O    3  
ATOM 4081  C CB   . LEU A 1 26  ? 8.132   -0.124  7.346   1.00 0.00 ? 26  LEU A CB   3  
ATOM 4082  C CG   . LEU A 1 26  ? 6.928   -1.054  7.191   1.00 0.00 ? 26  LEU A CG   3  
ATOM 4083  C CD1  . LEU A 1 26  ? 7.098   -1.947  5.971   1.00 0.00 ? 26  LEU A CD1  3  
ATOM 4084  C CD2  . LEU A 1 26  ? 6.737   -1.893  8.446   1.00 0.00 ? 26  LEU A CD2  3  
ATOM 4085  H H    . LEU A 1 26  ? 10.195  1.262   6.828   1.00 0.00 ? 26  LEU A H    3  
ATOM 4086  H HA   . LEU A 1 26  ? 7.702   0.923   5.529   1.00 0.00 ? 26  LEU A HA   3  
ATOM 4087  H HB2  . LEU A 1 26  ? 9.016   -0.680  7.077   1.00 0.00 ? 26  LEU A HB2  3  
ATOM 4088  H HB3  . LEU A 1 26  ? 8.194   0.168   8.385   1.00 0.00 ? 26  LEU A HB3  3  
ATOM 4089  H HG   . LEU A 1 26  ? 6.037   -0.459  7.046   1.00 0.00 ? 26  LEU A HG   3  
ATOM 4090  H HD11 . LEU A 1 26  ? 7.913   -1.579  5.367   1.00 0.00 ? 26  LEU A HD11 3  
ATOM 4091  H HD12 . LEU A 1 26  ? 6.187   -1.940  5.391   1.00 0.00 ? 26  LEU A HD12 3  
ATOM 4092  H HD13 . LEU A 1 26  ? 7.312   -2.956  6.291   1.00 0.00 ? 26  LEU A HD13 3  
ATOM 4093  H HD21 . LEU A 1 26  ? 5.684   -1.964  8.674   1.00 0.00 ? 26  LEU A HD21 3  
ATOM 4094  H HD22 . LEU A 1 26  ? 7.254   -1.426  9.273   1.00 0.00 ? 26  LEU A HD22 3  
ATOM 4095  H HD23 . LEU A 1 26  ? 7.138   -2.882  8.282   1.00 0.00 ? 26  LEU A HD23 3  
ATOM 4096  N N    . HIS A 1 27  ? 6.040   2.419   6.598   1.00 0.00 ? 27  HIS A N    3  
ATOM 4097  C CA   . HIS A 1 27  ? 5.098   3.392   7.139   1.00 0.00 ? 27  HIS A CA   3  
ATOM 4098  C C    . HIS A 1 27  ? 3.695   2.799   7.225   1.00 0.00 ? 27  HIS A C    3  
ATOM 4099  O O    . HIS A 1 27  ? 2.943   2.815   6.250   1.00 0.00 ? 27  HIS A O    3  
ATOM 4100  C CB   . HIS A 1 27  ? 5.080   4.652   6.274   1.00 0.00 ? 27  HIS A CB   3  
ATOM 4101  C CG   . HIS A 1 27  ? 6.152   5.637   6.626   1.00 0.00 ? 27  HIS A CG   3  
ATOM 4102  N ND1  . HIS A 1 27  ? 5.990   6.614   7.585   1.00 0.00 ? 27  HIS A ND1  3  
ATOM 4103  C CD2  . HIS A 1 27  ? 7.407   5.789   6.142   1.00 0.00 ? 27  HIS A CD2  3  
ATOM 4104  C CE1  . HIS A 1 27  ? 7.099   7.327   7.675   1.00 0.00 ? 27  HIS A CE1  3  
ATOM 4105  N NE2  . HIS A 1 27  ? 7.975   6.846   6.810   1.00 0.00 ? 27  HIS A NE2  3  
ATOM 4106  H H    . HIS A 1 27  ? 5.798   1.915   5.794   1.00 0.00 ? 27  HIS A H    3  
ATOM 4107  H HA   . HIS A 1 27  ? 5.426   3.654   8.134   1.00 0.00 ? 27  HIS A HA   3  
ATOM 4108  H HB2  . HIS A 1 27  ? 5.214   4.372   5.239   1.00 0.00 ? 27  HIS A HB2  3  
ATOM 4109  H HB3  . HIS A 1 27  ? 4.125   5.145   6.387   1.00 0.00 ? 27  HIS A HB3  3  
ATOM 4110  H HD1  . HIS A 1 27  ? 5.183   6.764   8.119   1.00 0.00 ? 27  HIS A HD1  3  
ATOM 4111  H HD2  . HIS A 1 27  ? 7.876   5.191   5.373   1.00 0.00 ? 27  HIS A HD2  3  
ATOM 4112  H HE1  . HIS A 1 27  ? 7.263   8.160   8.342   1.00 0.00 ? 27  HIS A HE1  3  
ATOM 4113  H HE2  . HIS A 1 27  ? 8.847   7.244   6.611   1.00 0.00 ? 27  HIS A HE2  3  
ATOM 4114  N N    . ILE A 1 28  ? 3.349   2.277   8.397   1.00 0.00 ? 28  ILE A N    3  
ATOM 4115  C CA   . ILE A 1 28  ? 2.037   1.680   8.610   1.00 0.00 ? 28  ILE A CA   3  
ATOM 4116  C C    . ILE A 1 28  ? 1.044   2.708   9.140   1.00 0.00 ? 28  ILE A C    3  
ATOM 4117  O O    . ILE A 1 28  ? 1.138   3.141   10.290  1.00 0.00 ? 28  ILE A O    3  
ATOM 4118  C CB   . ILE A 1 28  ? 2.109   0.497   9.594   1.00 0.00 ? 28  ILE A CB   3  
ATOM 4119  C CG1  . ILE A 1 28  ? 3.118   -0.543  9.102   1.00 0.00 ? 28  ILE A CG1  3  
ATOM 4120  C CG2  . ILE A 1 28  ? 0.734   -0.131  9.768   1.00 0.00 ? 28  ILE A CG2  3  
ATOM 4121  C CD1  . ILE A 1 28  ? 3.615   -1.465  10.193  1.00 0.00 ? 28  ILE A CD1  3  
ATOM 4122  H H    . ILE A 1 28  ? 3.992   2.294   9.137   1.00 0.00 ? 28  ILE A H    3  
ATOM 4123  H HA   . ILE A 1 28  ? 1.681   1.310   7.659   1.00 0.00 ? 28  ILE A HA   3  
ATOM 4124  H HB   . ILE A 1 28  ? 2.430   0.875   10.552  1.00 0.00 ? 28  ILE A HB   3  
ATOM 4125  H HG12 . ILE A 1 28  ? 2.656   -1.151  8.340   1.00 0.00 ? 28  ILE A HG12 3  
ATOM 4126  H HG13 . ILE A 1 28  ? 3.972   -0.033  8.682   1.00 0.00 ? 28  ILE A HG13 3  
ATOM 4127  H HG21 . ILE A 1 28  ? 0.387   0.038   10.777  1.00 0.00 ? 28  ILE A HG21 3  
ATOM 4128  H HG22 . ILE A 1 28  ? 0.043   0.317   9.070   1.00 0.00 ? 28  ILE A HG22 3  
ATOM 4129  H HG23 . ILE A 1 28  ? 0.797   -1.193  9.582   1.00 0.00 ? 28  ILE A HG23 3  
ATOM 4130  H HD11 . ILE A 1 28  ? 3.506   -2.491  9.876   1.00 0.00 ? 28  ILE A HD11 3  
ATOM 4131  H HD12 . ILE A 1 28  ? 4.656   -1.257  10.394  1.00 0.00 ? 28  ILE A HD12 3  
ATOM 4132  H HD13 . ILE A 1 28  ? 3.037   -1.304  11.092  1.00 0.00 ? 28  ILE A HD13 3  
ATOM 4133  N N    . ILE A 1 29  ? 0.093   3.094   8.297   1.00 0.00 ? 29  ILE A N    3  
ATOM 4134  C CA   . ILE A 1 29  ? -0.919  4.070   8.682   1.00 0.00 ? 29  ILE A CA   3  
ATOM 4135  C C    . ILE A 1 29  ? -2.324  3.508   8.495   1.00 0.00 ? 29  ILE A C    3  
ATOM 4136  O O    . ILE A 1 29  ? -2.605  2.829   7.508   1.00 0.00 ? 29  ILE A O    3  
ATOM 4137  C CB   . ILE A 1 29  ? -0.786  5.371   7.868   1.00 0.00 ? 29  ILE A CB   3  
ATOM 4138  C CG1  . ILE A 1 29  ? -1.147  5.120   6.403   1.00 0.00 ? 29  ILE A CG1  3  
ATOM 4139  C CG2  . ILE A 1 29  ? 0.625   5.926   7.984   1.00 0.00 ? 29  ILE A CG2  3  
ATOM 4140  C CD1  . ILE A 1 29  ? -1.136  6.372   5.555   1.00 0.00 ? 29  ILE A CD1  3  
ATOM 4141  H H    . ILE A 1 29  ? 0.071   2.714   7.395   1.00 0.00 ? 29  ILE A H    3  
ATOM 4142  H HA   . ILE A 1 29  ? -0.774  4.306   9.727   1.00 0.00 ? 29  ILE A HA   3  
ATOM 4143  H HB   . ILE A 1 29  ? -1.469  6.098   8.280   1.00 0.00 ? 29  ILE A HB   3  
ATOM 4144  H HG12 . ILE A 1 29  ? -0.440  4.426   5.978   1.00 0.00 ? 29  ILE A HG12 3  
ATOM 4145  H HG13 . ILE A 1 29  ? -2.139  4.693   6.352   1.00 0.00 ? 29  ILE A HG13 3  
ATOM 4146  H HG21 . ILE A 1 29  ? 0.800   6.635   7.188   1.00 0.00 ? 29  ILE A HG21 3  
ATOM 4147  H HG22 . ILE A 1 29  ? 0.740   6.421   8.937   1.00 0.00 ? 29  ILE A HG22 3  
ATOM 4148  H HG23 . ILE A 1 29  ? 1.337   5.118   7.910   1.00 0.00 ? 29  ILE A HG23 3  
ATOM 4149  H HD11 . ILE A 1 29  ? -2.027  6.404   4.946   1.00 0.00 ? 29  ILE A HD11 3  
ATOM 4150  H HD12 . ILE A 1 29  ? -1.105  7.241   6.195   1.00 0.00 ? 29  ILE A HD12 3  
ATOM 4151  H HD13 . ILE A 1 29  ? -0.264  6.366   4.916   1.00 0.00 ? 29  ILE A HD13 3  
ATOM 4152  N N    . GLU A 1 30  ? -3.204  3.797   9.449   1.00 0.00 ? 30  GLU A N    3  
ATOM 4153  C CA   . GLU A 1 30  ? -4.581  3.321   9.388   1.00 0.00 ? 30  GLU A CA   3  
ATOM 4154  C C    . GLU A 1 30  ? -5.478  4.338   8.690   1.00 0.00 ? 30  GLU A C    3  
ATOM 4155  O O    . GLU A 1 30  ? -5.599  5.482   9.131   1.00 0.00 ? 30  GLU A O    3  
ATOM 4156  C CB   . GLU A 1 30  ? -5.109  3.040   10.796  1.00 0.00 ? 30  GLU A CB   3  
ATOM 4157  C CG   . GLU A 1 30  ? -4.856  1.618   11.269  1.00 0.00 ? 30  GLU A CG   3  
ATOM 4158  C CD   . GLU A 1 30  ? -4.691  1.524   12.774  1.00 0.00 ? 30  GLU A CD   3  
ATOM 4159  O OE1  . GLU A 1 30  ? -5.636  1.903   13.498  1.00 0.00 ? 30  GLU A OE1  3  
ATOM 4160  O OE2  . GLU A 1 30  ? -3.619  1.073   13.227  1.00 0.00 ? 30  GLU A OE2  3  
ATOM 4161  H H    . GLU A 1 30  ? -2.920  4.343   10.212  1.00 0.00 ? 30  GLU A H    3  
ATOM 4162  H HA   . GLU A 1 30  ? -4.589  2.402   8.821   1.00 0.00 ? 30  GLU A HA   3  
ATOM 4163  H HB2  . GLU A 1 30  ? -4.634  3.718   11.489  1.00 0.00 ? 30  GLU A HB2  3  
ATOM 4164  H HB3  . GLU A 1 30  ? -6.175  3.216   10.809  1.00 0.00 ? 30  GLU A HB3  3  
ATOM 4165  H HG2  . GLU A 1 30  ? -5.690  1.000   10.975  1.00 0.00 ? 30  GLU A HG2  3  
ATOM 4166  H HG3  . GLU A 1 30  ? -3.954  1.252   10.800  1.00 0.00 ? 30  GLU A HG3  3  
ATOM 4167  N N    . LEU A 1 31  ? -6.105  3.914   7.598   1.00 0.00 ? 31  LEU A N    3  
ATOM 4168  C CA   . LEU A 1 31  ? -6.991  4.788   6.837   1.00 0.00 ? 31  LEU A CA   3  
ATOM 4169  C C    . LEU A 1 31  ? -8.418  4.249   6.837   1.00 0.00 ? 31  LEU A C    3  
ATOM 4170  O O    . LEU A 1 31  ? -8.646  3.069   6.574   1.00 0.00 ? 31  LEU A O    3  
ATOM 4171  C CB   . LEU A 1 31  ? -6.488  4.931   5.399   1.00 0.00 ? 31  LEU A CB   3  
ATOM 4172  C CG   . LEU A 1 31  ? -5.064  5.462   5.236   1.00 0.00 ? 31  LEU A CG   3  
ATOM 4173  C CD1  . LEU A 1 31  ? -4.739  5.678   3.766   1.00 0.00 ? 31  LEU A CD1  3  
ATOM 4174  C CD2  . LEU A 1 31  ? -4.883  6.754   6.020   1.00 0.00 ? 31  LEU A CD2  3  
ATOM 4175  H H    . LEU A 1 31  ? -5.969  2.993   7.296   1.00 0.00 ? 31  LEU A H    3  
ATOM 4176  H HA   . LEU A 1 31  ? -6.986  5.759   7.310   1.00 0.00 ? 31  LEU A HA   3  
ATOM 4177  H HB2  . LEU A 1 31  ? -6.533  3.957   4.935   1.00 0.00 ? 31  LEU A HB2  3  
ATOM 4178  H HB3  . LEU A 1 31  ? -7.155  5.605   4.882   1.00 0.00 ? 31  LEU A HB3  3  
ATOM 4179  H HG   . LEU A 1 31  ? -4.367  4.733   5.628   1.00 0.00 ? 31  LEU A HG   3  
ATOM 4180  H HD11 . LEU A 1 31  ? -4.103  6.543   3.662   1.00 0.00 ? 31  LEU A HD11 3  
ATOM 4181  H HD12 . LEU A 1 31  ? -5.655  5.835   3.215   1.00 0.00 ? 31  LEU A HD12 3  
ATOM 4182  H HD13 . LEU A 1 31  ? -4.231  4.807   3.378   1.00 0.00 ? 31  LEU A HD13 3  
ATOM 4183  H HD21 . LEU A 1 31  ? -5.851  7.191   6.219   1.00 0.00 ? 31  LEU A HD21 3  
ATOM 4184  H HD22 . LEU A 1 31  ? -4.288  7.445   5.441   1.00 0.00 ? 31  LEU A HD22 3  
ATOM 4185  H HD23 . LEU A 1 31  ? -4.384  6.542   6.953   1.00 0.00 ? 31  LEU A HD23 3  
ATOM 4186  N N    . GLU A 1 32  ? -9.375  5.123   7.133   1.00 0.00 ? 32  GLU A N    3  
ATOM 4187  C CA   . GLU A 1 32  ? -10.780 4.734   7.165   1.00 0.00 ? 32  GLU A CA   3  
ATOM 4188  C C    . GLU A 1 32  ? -11.450 5.000   5.820   1.00 0.00 ? 32  GLU A C    3  
ATOM 4189  O O    . GLU A 1 32  ? -11.487 6.135   5.345   1.00 0.00 ? 32  GLU A O    3  
ATOM 4190  C CB   . GLU A 1 32  ? -11.517 5.493   8.272   1.00 0.00 ? 32  GLU A CB   3  
ATOM 4191  C CG   . GLU A 1 32  ? -12.686 4.723   8.862   1.00 0.00 ? 32  GLU A CG   3  
ATOM 4192  C CD   . GLU A 1 32  ? -13.965 4.906   8.069   1.00 0.00 ? 32  GLU A CD   3  
ATOM 4193  O OE1  . GLU A 1 32  ? -13.982 4.533   6.877   1.00 0.00 ? 32  GLU A OE1  3  
ATOM 4194  O OE2  . GLU A 1 32  ? -14.949 5.422   8.639   1.00 0.00 ? 32  GLU A OE2  3  
ATOM 4195  H H    . GLU A 1 32  ? -9.131  6.051   7.334   1.00 0.00 ? 32  GLU A H    3  
ATOM 4196  H HA   . GLU A 1 32  ? -10.827 3.676   7.375   1.00 0.00 ? 32  GLU A HA   3  
ATOM 4197  H HB2  . GLU A 1 32  ? -10.819 5.713   9.066   1.00 0.00 ? 32  GLU A HB2  3  
ATOM 4198  H HB3  . GLU A 1 32  ? -11.892 6.421   7.867   1.00 0.00 ? 32  GLU A HB3  3  
ATOM 4199  H HG2  . GLU A 1 32  ? -12.438 3.673   8.878   1.00 0.00 ? 32  GLU A HG2  3  
ATOM 4200  H HG3  . GLU A 1 32  ? -12.854 5.068   9.872   1.00 0.00 ? 32  GLU A HG3  3  
ATOM 4201  N N    . LYS A 1 33  ? -11.978 3.944   5.210   1.00 0.00 ? 33  LYS A N    3  
ATOM 4202  C CA   . LYS A 1 33  ? -12.647 4.060   3.920   1.00 0.00 ? 33  LYS A CA   3  
ATOM 4203  C C    . LYS A 1 33  ? -13.648 5.211   3.928   1.00 0.00 ? 33  LYS A C    3  
ATOM 4204  O O    . LYS A 1 33  ? -14.653 5.168   4.637   1.00 0.00 ? 33  LYS A O    3  
ATOM 4205  C CB   . LYS A 1 33  ? -13.361 2.752   3.573   1.00 0.00 ? 33  LYS A CB   3  
ATOM 4206  C CG   . LYS A 1 33  ? -12.414 1.608   3.253   1.00 0.00 ? 33  LYS A CG   3  
ATOM 4207  C CD   . LYS A 1 33  ? -13.031 0.634   2.263   1.00 0.00 ? 33  LYS A CD   3  
ATOM 4208  C CE   . LYS A 1 33  ? -13.819 -0.457  2.972   1.00 0.00 ? 33  LYS A CE   3  
ATOM 4209  N NZ   . LYS A 1 33  ? -14.948 -0.956  2.140   1.00 0.00 ? 33  LYS A NZ   3  
ATOM 4210  H H    . LYS A 1 33  ? -11.917 3.064   5.639   1.00 0.00 ? 33  LYS A H    3  
ATOM 4211  H HA   . LYS A 1 33  ? -11.894 4.258   3.172   1.00 0.00 ? 33  LYS A HA   3  
ATOM 4212  H HB2  . LYS A 1 33  ? -13.977 2.458   4.411   1.00 0.00 ? 33  LYS A HB2  3  
ATOM 4213  H HB3  . LYS A 1 33  ? -13.994 2.918   2.713   1.00 0.00 ? 33  LYS A HB3  3  
ATOM 4214  H HG2  . LYS A 1 33  ? -11.508 2.012   2.827   1.00 0.00 ? 33  LYS A HG2  3  
ATOM 4215  H HG3  . LYS A 1 33  ? -12.181 1.080   4.167   1.00 0.00 ? 33  LYS A HG3  3  
ATOM 4216  H HD2  . LYS A 1 33  ? -13.696 1.174   1.607   1.00 0.00 ? 33  LYS A HD2  3  
ATOM 4217  H HD3  . LYS A 1 33  ? -12.242 0.176   1.683   1.00 0.00 ? 33  LYS A HD3  3  
ATOM 4218  H HE2  . LYS A 1 33  ? -13.154 -1.279  3.191   1.00 0.00 ? 33  LYS A HE2  3  
ATOM 4219  H HE3  . LYS A 1 33  ? -14.212 -0.057  3.895   1.00 0.00 ? 33  LYS A HE3  3  
ATOM 4220  H HZ1  . LYS A 1 33  ? -15.349 -0.177  1.579   1.00 0.00 ? 33  LYS A HZ1  3  
ATOM 4221  H HZ2  . LYS A 1 33  ? -15.694 -1.349  2.748   1.00 0.00 ? 33  LYS A HZ2  3  
ATOM 4222  H HZ3  . LYS A 1 33  ? -14.615 -1.699  1.493   1.00 0.00 ? 33  LYS A HZ3  3  
ATOM 4223  N N    . ASP A 1 34  ? -13.367 6.238   3.133   1.00 0.00 ? 34  ASP A N    3  
ATOM 4224  C CA   . ASP A 1 34  ? -14.244 7.400   3.047   1.00 0.00 ? 34  ASP A CA   3  
ATOM 4225  C C    . ASP A 1 34  ? -15.534 7.054   2.309   1.00 0.00 ? 34  ASP A C    3  
ATOM 4226  O O    . ASP A 1 34  ? -15.722 5.921   1.864   1.00 0.00 ? 34  ASP A O    3  
ATOM 4227  C CB   . ASP A 1 34  ? -13.531 8.553   2.339   1.00 0.00 ? 34  ASP A CB   3  
ATOM 4228  C CG   . ASP A 1 34  ? -13.677 8.485   0.831   1.00 0.00 ? 34  ASP A CG   3  
ATOM 4229  O OD1  . ASP A 1 34  ? -13.136 7.537   0.225   1.00 0.00 ? 34  ASP A OD1  3  
ATOM 4230  O OD2  . ASP A 1 34  ? -14.332 9.381   0.258   1.00 0.00 ? 34  ASP A OD2  3  
ATOM 4231  H H    . ASP A 1 34  ? -12.550 6.214   2.592   1.00 0.00 ? 34  ASP A H    3  
ATOM 4232  H HA   . ASP A 1 34  ? -14.490 7.705   4.053   1.00 0.00 ? 34  ASP A HA   3  
ATOM 4233  H HB2  . ASP A 1 34  ? -13.947 9.489   2.680   1.00 0.00 ? 34  ASP A HB2  3  
ATOM 4234  H HB3  . ASP A 1 34  ? -12.479 8.520   2.582   1.00 0.00 ? 34  ASP A HB3  3  
ATOM 4235  N N    . LYS A 1 35  ? -16.420 8.036   2.185   1.00 0.00 ? 35  LYS A N    3  
ATOM 4236  C CA   . LYS A 1 35  ? -17.692 7.836   1.501   1.00 0.00 ? 35  LYS A CA   3  
ATOM 4237  C C    . LYS A 1 35  ? -17.504 7.017   0.229   1.00 0.00 ? 35  LYS A C    3  
ATOM 4238  O O    . LYS A 1 35  ? -18.410 6.305   -0.202  1.00 0.00 ? 35  LYS A O    3  
ATOM 4239  C CB   . LYS A 1 35  ? -18.329 9.186   1.162   1.00 0.00 ? 35  LYS A CB   3  
ATOM 4240  C CG   . LYS A 1 35  ? -17.453 10.071  0.293   1.00 0.00 ? 35  LYS A CG   3  
ATOM 4241  C CD   . LYS A 1 35  ? -17.954 11.505  0.274   1.00 0.00 ? 35  LYS A CD   3  
ATOM 4242  C CE   . LYS A 1 35  ? -17.614 12.197  -1.038  1.00 0.00 ? 35  LYS A CE   3  
ATOM 4243  N NZ   . LYS A 1 35  ? -16.152 12.452  -1.167  1.00 0.00 ? 35  LYS A NZ   3  
ATOM 4244  H H    . LYS A 1 35  ? -16.212 8.917   2.561   1.00 0.00 ? 35  LYS A H    3  
ATOM 4245  H HA   . LYS A 1 35  ? -18.347 7.297   2.169   1.00 0.00 ? 35  LYS A HA   3  
ATOM 4246  H HB2  . LYS A 1 35  ? -19.258 9.011   0.640   1.00 0.00 ? 35  LYS A HB2  3  
ATOM 4247  H HB3  . LYS A 1 35  ? -18.537 9.713   2.082   1.00 0.00 ? 35  LYS A HB3  3  
ATOM 4248  H HG2  . LYS A 1 35  ? -16.446 10.058  0.682   1.00 0.00 ? 35  LYS A HG2  3  
ATOM 4249  H HG3  . LYS A 1 35  ? -17.456 9.684   -0.716  1.00 0.00 ? 35  LYS A HG3  3  
ATOM 4250  H HD2  . LYS A 1 35  ? -19.027 11.504  0.399   1.00 0.00 ? 35  LYS A HD2  3  
ATOM 4251  H HD3  . LYS A 1 35  ? -17.495 12.049  1.087   1.00 0.00 ? 35  LYS A HD3  3  
ATOM 4252  H HE2  . LYS A 1 35  ? -17.934 11.569  -1.855  1.00 0.00 ? 35  LYS A HE2  3  
ATOM 4253  H HE3  . LYS A 1 35  ? -18.141 13.139  -1.080  1.00 0.00 ? 35  LYS A HE3  3  
ATOM 4254  H HZ1  . LYS A 1 35  ? -15.767 11.920  -1.973  1.00 0.00 ? 35  LYS A HZ1  3  
ATOM 4255  H HZ2  . LYS A 1 35  ? -15.660 12.154  -0.301  1.00 0.00 ? 35  LYS A HZ2  3  
ATOM 4256  H HZ3  . LYS A 1 35  ? -15.979 13.466  -1.320  1.00 0.00 ? 35  LYS A HZ3  3  
ATOM 4257  N N    . ASN A 1 36  ? -16.321 7.122   -0.367  1.00 0.00 ? 36  ASN A N    3  
ATOM 4258  C CA   . ASN A 1 36  ? -16.014 6.389   -1.591  1.00 0.00 ? 36  ASN A CA   3  
ATOM 4259  C C    . ASN A 1 36  ? -14.960 5.316   -1.332  1.00 0.00 ? 36  ASN A C    3  
ATOM 4260  O O    . ASN A 1 36  ? -14.759 4.419   -2.150  1.00 0.00 ? 36  ASN A O    3  
ATOM 4261  C CB   . ASN A 1 36  ? -15.524 7.350   -2.676  1.00 0.00 ? 36  ASN A CB   3  
ATOM 4262  C CG   . ASN A 1 36  ? -14.710 6.648   -3.746  1.00 0.00 ? 36  ASN A CG   3  
ATOM 4263  O OD1  . ASN A 1 36  ? -13.590 7.054   -4.055  1.00 0.00 ? 36  ASN A OD1  3  
ATOM 4264  N ND2  . ASN A 1 36  ? -15.272 5.588   -4.316  1.00 0.00 ? 36  ASN A ND2  3  
ATOM 4265  H H    . ASN A 1 36  ? -15.638 7.705   0.024   1.00 0.00 ? 36  ASN A H    3  
ATOM 4266  H HA   . ASN A 1 36  ? -16.921 5.912   -1.928  1.00 0.00 ? 36  ASN A HA   3  
ATOM 4267  H HB2  . ASN A 1 36  ? -16.378 7.815   -3.148  1.00 0.00 ? 36  ASN A HB2  3  
ATOM 4268  H HB3  . ASN A 1 36  ? -14.908 8.112   -2.223  1.00 0.00 ? 36  ASN A HB3  3  
ATOM 4269  H HD21 . ASN A 1 36  ? -16.167 5.322   -4.019  1.00 0.00 ? 36  ASN A HD21 3  
ATOM 4270  H HD22 . ASN A 1 36  ? -14.767 5.115   -5.010  1.00 0.00 ? 36  ASN A HD22 3  
ATOM 4271  N N    . GLY A 1 37  ? -14.290 5.416   -0.188  1.00 0.00 ? 37  GLY A N    3  
ATOM 4272  C CA   . GLY A 1 37  ? -13.265 4.448   0.158   1.00 0.00 ? 37  GLY A CA   3  
ATOM 4273  C C    . GLY A 1 37  ? -11.870 4.935   -0.179  1.00 0.00 ? 37  GLY A C    3  
ATOM 4274  O O    . GLY A 1 37  ? -11.706 5.947   -0.862  1.00 0.00 ? 37  GLY A O    3  
ATOM 4275  H H    . GLY A 1 37  ? -14.492 6.153   0.426   1.00 0.00 ? 37  GLY A H    3  
ATOM 4276  H HA2  . GLY A 1 37  ? -13.319 4.247   1.218   1.00 0.00 ? 37  GLY A HA2  3  
ATOM 4277  H HA3  . GLY A 1 37  ? -13.454 3.532   -0.382  1.00 0.00 ? 37  GLY A HA3  3  
ATOM 4278  N N    . LEU A 1 38  ? -10.862 4.215   0.300   1.00 0.00 ? 38  LEU A N    3  
ATOM 4279  C CA   . LEU A 1 38  ? -9.472  4.581   0.047   1.00 0.00 ? 38  LEU A CA   3  
ATOM 4280  C C    . LEU A 1 38  ? -9.247  4.871   -1.433  1.00 0.00 ? 38  LEU A C    3  
ATOM 4281  O O    . LEU A 1 38  ? -9.478  4.016   -2.287  1.00 0.00 ? 38  LEU A O    3  
ATOM 4282  C CB   . LEU A 1 38  ? -8.538  3.460   0.507   1.00 0.00 ? 38  LEU A CB   3  
ATOM 4283  C CG   . LEU A 1 38  ? -8.874  2.815   1.851   1.00 0.00 ? 38  LEU A CG   3  
ATOM 4284  C CD1  . LEU A 1 38  ? -7.772  1.856   2.274   1.00 0.00 ? 38  LEU A CD1  3  
ATOM 4285  C CD2  . LEU A 1 38  ? -9.093  3.881   2.915   1.00 0.00 ? 38  LEU A CD2  3  
ATOM 4286  H H    . LEU A 1 38  ? -11.055 3.419   0.838   1.00 0.00 ? 38  LEU A H    3  
ATOM 4287  H HA   . LEU A 1 38  ? -9.256  5.474   0.614   1.00 0.00 ? 38  LEU A HA   3  
ATOM 4288  H HB2  . LEU A 1 38  ? -8.556  2.686   -0.245  1.00 0.00 ? 38  LEU A HB2  3  
ATOM 4289  H HB3  . LEU A 1 38  ? -7.540  3.870   0.575   1.00 0.00 ? 38  LEU A HB3  3  
ATOM 4290  H HG   . LEU A 1 38  ? -9.790  2.247   1.752   1.00 0.00 ? 38  LEU A HG   3  
ATOM 4291  H HD11 . LEU A 1 38  ? -6.977  1.878   1.545   1.00 0.00 ? 38  LEU A HD11 3  
ATOM 4292  H HD12 . LEU A 1 38  ? -8.172  0.854   2.339   1.00 0.00 ? 38  LEU A HD12 3  
ATOM 4293  H HD13 . LEU A 1 38  ? -7.387  2.153   3.238   1.00 0.00 ? 38  LEU A HD13 3  
ATOM 4294  H HD21 . LEU A 1 38  ? -9.583  3.440   3.770   1.00 0.00 ? 38  LEU A HD21 3  
ATOM 4295  H HD22 . LEU A 1 38  ? -9.712  4.669   2.512   1.00 0.00 ? 38  LEU A HD22 3  
ATOM 4296  H HD23 . LEU A 1 38  ? -8.140  4.289   3.216   1.00 0.00 ? 38  LEU A HD23 3  
ATOM 4297  N N    . GLY A 1 39  ? -8.792  6.085   -1.730  1.00 0.00 ? 39  GLY A N    3  
ATOM 4298  C CA   . GLY A 1 39  ? -8.541  6.466   -3.108  1.00 0.00 ? 39  GLY A CA   3  
ATOM 4299  C C    . GLY A 1 39  ? -7.063  6.628   -3.404  1.00 0.00 ? 39  GLY A C    3  
ATOM 4300  O O    . GLY A 1 39  ? -6.413  7.535   -2.882  1.00 0.00 ? 39  GLY A O    3  
ATOM 4301  H H    . GLY A 1 39  ? -8.626  6.727   -1.008  1.00 0.00 ? 39  GLY A H    3  
ATOM 4302  H HA2  . GLY A 1 39  ? -8.947  5.707   -3.760  1.00 0.00 ? 39  GLY A HA2  3  
ATOM 4303  H HA3  . GLY A 1 39  ? -9.041  7.403   -3.307  1.00 0.00 ? 39  GLY A HA3  3  
ATOM 4304  N N    . LEU A 1 40  ? -6.530  5.748   -4.244  1.00 0.00 ? 40  LEU A N    3  
ATOM 4305  C CA   . LEU A 1 40  ? -5.118  5.796   -4.608  1.00 0.00 ? 40  LEU A CA   3  
ATOM 4306  C C    . LEU A 1 40  ? -4.904  5.284   -6.029  1.00 0.00 ? 40  LEU A C    3  
ATOM 4307  O O    . LEU A 1 40  ? -5.513  4.297   -6.442  1.00 0.00 ? 40  LEU A O    3  
ATOM 4308  C CB   . LEU A 1 40  ? -4.289  4.967   -3.625  1.00 0.00 ? 40  LEU A CB   3  
ATOM 4309  C CG   . LEU A 1 40  ? -4.418  5.348   -2.150  1.00 0.00 ? 40  LEU A CG   3  
ATOM 4310  C CD1  . LEU A 1 40  ? -4.150  4.143   -1.262  1.00 0.00 ? 40  LEU A CD1  3  
ATOM 4311  C CD2  . LEU A 1 40  ? -3.468  6.487   -1.808  1.00 0.00 ? 40  LEU A CD2  3  
ATOM 4312  H H    . LEU A 1 40  ? -7.097  5.048   -4.628  1.00 0.00 ? 40  LEU A H    3  
ATOM 4313  H HA   . LEU A 1 40  ? -4.798  6.826   -4.557  1.00 0.00 ? 40  LEU A HA   3  
ATOM 4314  H HB2  . LEU A 1 40  ? -4.589  3.936   -3.727  1.00 0.00 ? 40  LEU A HB2  3  
ATOM 4315  H HB3  . LEU A 1 40  ? -3.249  5.067   -3.904  1.00 0.00 ? 40  LEU A HB3  3  
ATOM 4316  H HG   . LEU A 1 40  ? -5.428  5.685   -1.959  1.00 0.00 ? 40  LEU A HG   3  
ATOM 4317  H HD11 . LEU A 1 40  ? -3.350  4.373   -0.575  1.00 0.00 ? 40  LEU A HD11 3  
ATOM 4318  H HD12 . LEU A 1 40  ? -3.867  3.300   -1.875  1.00 0.00 ? 40  LEU A HD12 3  
ATOM 4319  H HD13 . LEU A 1 40  ? -5.044  3.899   -0.707  1.00 0.00 ? 40  LEU A HD13 3  
ATOM 4320  H HD21 . LEU A 1 40  ? -2.612  6.451   -2.466  1.00 0.00 ? 40  LEU A HD21 3  
ATOM 4321  H HD22 . LEU A 1 40  ? -3.139  6.385   -0.784  1.00 0.00 ? 40  LEU A HD22 3  
ATOM 4322  H HD23 . LEU A 1 40  ? -3.978  7.430   -1.931  1.00 0.00 ? 40  LEU A HD23 3  
ATOM 4323  N N    . SER A 1 41  ? -4.034  5.961   -6.772  1.00 0.00 ? 41  SER A N    3  
ATOM 4324  C CA   . SER A 1 41  ? -3.741  5.576   -8.147  1.00 0.00 ? 41  SER A CA   3  
ATOM 4325  C C    . SER A 1 41  ? -2.605  4.558   -8.196  1.00 0.00 ? 41  SER A C    3  
ATOM 4326  O O    . SER A 1 41  ? -1.432  4.913   -8.070  1.00 0.00 ? 41  SER A O    3  
ATOM 4327  C CB   . SER A 1 41  ? -3.373  6.808   -8.977  1.00 0.00 ? 41  SER A CB   3  
ATOM 4328  O OG   . SER A 1 41  ? -4.511  7.616   -9.220  1.00 0.00 ? 41  SER A OG   3  
ATOM 4329  H H    . SER A 1 41  ? -3.580  6.739   -6.386  1.00 0.00 ? 41  SER A H    3  
ATOM 4330  H HA   . SER A 1 41  ? -4.630  5.125   -8.562  1.00 0.00 ? 41  SER A HA   3  
ATOM 4331  H HB2  . SER A 1 41  ? -2.639  7.392   -8.443  1.00 0.00 ? 41  SER A HB2  3  
ATOM 4332  H HB3  . SER A 1 41  ? -2.962  6.490   -9.924  1.00 0.00 ? 41  SER A HB3  3  
ATOM 4333  H HG   . SER A 1 41  ? -5.091  7.592   -8.455  1.00 0.00 ? 41  SER A HG   3  
ATOM 4334  N N    . LEU A 1 42  ? -2.962  3.292   -8.380  1.00 0.00 ? 42  LEU A N    3  
ATOM 4335  C CA   . LEU A 1 42  ? -1.973  2.221   -8.446  1.00 0.00 ? 42  LEU A CA   3  
ATOM 4336  C C    . LEU A 1 42  ? -1.501  2.003   -9.880  1.00 0.00 ? 42  LEU A C    3  
ATOM 4337  O O    . LEU A 1 42  ? -2.223  2.295   -10.833 1.00 0.00 ? 42  LEU A O    3  
ATOM 4338  C CB   . LEU A 1 42  ? -2.561  0.923   -7.888  1.00 0.00 ? 42  LEU A CB   3  
ATOM 4339  C CG   . LEU A 1 42  ? -3.316  1.043   -6.564  1.00 0.00 ? 42  LEU A CG   3  
ATOM 4340  C CD1  . LEU A 1 42  ? -4.020  -0.263  -6.231  1.00 0.00 ? 42  LEU A CD1  3  
ATOM 4341  C CD2  . LEU A 1 42  ? -2.367  1.440   -5.443  1.00 0.00 ? 42  LEU A CD2  3  
ATOM 4342  H H    . LEU A 1 42  ? -3.911  3.071   -8.474  1.00 0.00 ? 42  LEU A H    3  
ATOM 4343  H HA   . LEU A 1 42  ? -1.128  2.513   -7.841  1.00 0.00 ? 42  LEU A HA   3  
ATOM 4344  H HB2  . LEU A 1 42  ? -3.244  0.527   -8.623  1.00 0.00 ? 42  LEU A HB2  3  
ATOM 4345  H HB3  . LEU A 1 42  ? -1.746  0.228   -7.744  1.00 0.00 ? 42  LEU A HB3  3  
ATOM 4346  H HG   . LEU A 1 42  ? -4.069  1.814   -6.655  1.00 0.00 ? 42  LEU A HG   3  
ATOM 4347  H HD11 . LEU A 1 42  ? -4.998  -0.271  -6.688  1.00 0.00 ? 42  LEU A HD11 3  
ATOM 4348  H HD12 . LEU A 1 42  ? -4.123  -0.354  -5.160  1.00 0.00 ? 42  LEU A HD12 3  
ATOM 4349  H HD13 . LEU A 1 42  ? -3.439  -1.092  -6.608  1.00 0.00 ? 42  LEU A HD13 3  
ATOM 4350  H HD21 . LEU A 1 42  ? -2.319  2.517   -5.377  1.00 0.00 ? 42  LEU A HD21 3  
ATOM 4351  H HD22 . LEU A 1 42  ? -1.382  1.048   -5.650  1.00 0.00 ? 42  LEU A HD22 3  
ATOM 4352  H HD23 . LEU A 1 42  ? -2.726  1.037   -4.507  1.00 0.00 ? 42  LEU A HD23 3  
ATOM 4353  N N    . ALA A 1 43  ? -0.285  1.487   -10.025 1.00 0.00 ? 43  ALA A N    3  
ATOM 4354  C CA   . ALA A 1 43  ? 0.282   1.227   -11.342 1.00 0.00 ? 43  ALA A CA   3  
ATOM 4355  C C    . ALA A 1 43  ? 1.372   0.162   -11.270 1.00 0.00 ? 43  ALA A C    3  
ATOM 4356  O O    . ALA A 1 43  ? 2.350   0.310   -10.539 1.00 0.00 ? 43  ALA A O    3  
ATOM 4357  C CB   . ALA A 1 43  ? 0.835   2.511   -11.942 1.00 0.00 ? 43  ALA A CB   3  
ATOM 4358  H H    . ALA A 1 43  ? 0.243   1.276   -9.227  1.00 0.00 ? 43  ALA A H    3  
ATOM 4359  H HA   . ALA A 1 43  ? -0.512  0.871   -11.983 1.00 0.00 ? 43  ALA A HA   3  
ATOM 4360  H HB1  . ALA A 1 43  ? 1.914   2.502   -11.876 1.00 0.00 ? 43  ALA A HB1  3  
ATOM 4361  H HB2  . ALA A 1 43  ? 0.538   2.581   -12.978 1.00 0.00 ? 43  ALA A HB2  3  
ATOM 4362  H HB3  . ALA A 1 43  ? 0.448   3.358   -11.397 1.00 0.00 ? 43  ALA A HB3  3  
ATOM 4363  N N    . GLY A 1 44  ? 1.195   -0.912  -12.033 1.00 0.00 ? 44  GLY A N    3  
ATOM 4364  C CA   . GLY A 1 44  ? 2.171   -1.986  -12.040 1.00 0.00 ? 44  GLY A CA   3  
ATOM 4365  C C    . GLY A 1 44  ? 3.561   -1.505  -12.406 1.00 0.00 ? 44  GLY A C    3  
ATOM 4366  O O    . GLY A 1 44  ? 3.723   -0.687  -13.311 1.00 0.00 ? 44  GLY A O    3  
ATOM 4367  H H    . GLY A 1 44  ? 0.395   -0.976  -12.596 1.00 0.00 ? 44  GLY A H    3  
ATOM 4368  H HA2  . GLY A 1 44  ? 2.204   -2.434  -11.058 1.00 0.00 ? 44  GLY A HA2  3  
ATOM 4369  H HA3  . GLY A 1 44  ? 1.861   -2.734  -12.755 1.00 0.00 ? 44  GLY A HA3  3  
ATOM 4370  N N    . ASN A 1 45  ? 4.566   -2.011  -11.700 1.00 0.00 ? 45  ASN A N    3  
ATOM 4371  C CA   . ASN A 1 45  ? 5.949   -1.626  -11.955 1.00 0.00 ? 45  ASN A CA   3  
ATOM 4372  C C    . ASN A 1 45  ? 6.180   -1.378  -13.443 1.00 0.00 ? 45  ASN A C    3  
ATOM 4373  O O    . ASN A 1 45  ? 5.534   -1.991  -14.293 1.00 0.00 ? 45  ASN A O    3  
ATOM 4374  C CB   . ASN A 1 45  ? 6.904   -2.711  -11.453 1.00 0.00 ? 45  ASN A CB   3  
ATOM 4375  C CG   . ASN A 1 45  ? 8.354   -2.268  -11.490 1.00 0.00 ? 45  ASN A CG   3  
ATOM 4376  O OD1  . ASN A 1 45  ? 8.872   -1.889  -12.540 1.00 0.00 ? 45  ASN A OD1  3  
ATOM 4377  N ND2  . ASN A 1 45  ? 9.016   -2.315  -10.340 1.00 0.00 ? 45  ASN A ND2  3  
ATOM 4378  H H    . ASN A 1 45  ? 4.374   -2.660  -10.991 1.00 0.00 ? 45  ASN A H    3  
ATOM 4379  H HA   . ASN A 1 45  ? 6.143   -0.711  -11.415 1.00 0.00 ? 45  ASN A HA   3  
ATOM 4380  H HB2  . ASN A 1 45  ? 6.650   -2.962  -10.433 1.00 0.00 ? 45  ASN A HB2  3  
ATOM 4381  H HB3  . ASN A 1 45  ? 6.799   -3.589  -12.072 1.00 0.00 ? 45  ASN A HB3  3  
ATOM 4382  H HD21 . ASN A 1 45  ? 8.539   -2.628  -9.543  1.00 0.00 ? 45  ASN A HD21 3  
ATOM 4383  H HD22 . ASN A 1 45  ? 9.954   -2.033  -10.335 1.00 0.00 ? 45  ASN A HD22 3  
ATOM 4384  N N    . LYS A 1 46  ? 7.106   -0.476  -13.750 1.00 0.00 ? 46  LYS A N    3  
ATOM 4385  C CA   . LYS A 1 46  ? 7.425   -0.148  -15.134 1.00 0.00 ? 46  LYS A CA   3  
ATOM 4386  C C    . LYS A 1 46  ? 7.599   -1.413  -15.968 1.00 0.00 ? 46  LYS A C    3  
ATOM 4387  O O    . LYS A 1 46  ? 7.122   -1.493  -17.100 1.00 0.00 ? 46  LYS A O    3  
ATOM 4388  C CB   . LYS A 1 46  ? 8.699   0.697   -15.199 1.00 0.00 ? 46  LYS A CB   3  
ATOM 4389  C CG   . LYS A 1 46  ? 8.480   2.157   -14.841 1.00 0.00 ? 46  LYS A CG   3  
ATOM 4390  C CD   . LYS A 1 46  ? 9.793   2.919   -14.776 1.00 0.00 ? 46  LYS A CD   3  
ATOM 4391  C CE   . LYS A 1 46  ? 9.574   4.376   -14.400 1.00 0.00 ? 46  LYS A CE   3  
ATOM 4392  N NZ   . LYS A 1 46  ? 8.934   5.144   -15.503 1.00 0.00 ? 46  LYS A NZ   3  
ATOM 4393  H H    . LYS A 1 46  ? 7.588   -0.021  -13.027 1.00 0.00 ? 46  LYS A H    3  
ATOM 4394  H HA   . LYS A 1 46  ? 6.603   0.424   -15.537 1.00 0.00 ? 46  LYS A HA   3  
ATOM 4395  H HB2  . LYS A 1 46  ? 9.425   0.285   -14.513 1.00 0.00 ? 46  LYS A HB2  3  
ATOM 4396  H HB3  . LYS A 1 46  ? 9.098   0.650   -16.202 1.00 0.00 ? 46  LYS A HB3  3  
ATOM 4397  H HG2  . LYS A 1 46  ? 7.850   2.611   -15.591 1.00 0.00 ? 46  LYS A HG2  3  
ATOM 4398  H HG3  . LYS A 1 46  ? 7.994   2.213   -13.877 1.00 0.00 ? 46  LYS A HG3  3  
ATOM 4399  H HD2  . LYS A 1 46  ? 10.430  2.459   -14.035 1.00 0.00 ? 46  LYS A HD2  3  
ATOM 4400  H HD3  . LYS A 1 46  ? 10.273  2.874   -15.743 1.00 0.00 ? 46  LYS A HD3  3  
ATOM 4401  H HE2  . LYS A 1 46  ? 8.939   4.418   -13.528 1.00 0.00 ? 46  LYS A HE2  3  
ATOM 4402  H HE3  . LYS A 1 46  ? 10.531  4.822   -14.169 1.00 0.00 ? 46  LYS A HE3  3  
ATOM 4403  H HZ1  . LYS A 1 46  ? 8.137   4.605   -15.898 1.00 0.00 ? 46  LYS A HZ1  3  
ATOM 4404  H HZ2  . LYS A 1 46  ? 9.625   5.324   -16.260 1.00 0.00 ? 46  LYS A HZ2  3  
ATOM 4405  H HZ3  . LYS A 1 46  ? 8.581   6.055   -15.147 1.00 0.00 ? 46  LYS A HZ3  3  
ATOM 4406  N N    . ASP A 1 47  ? 8.284   -2.400  -15.400 1.00 0.00 ? 47  ASP A N    3  
ATOM 4407  C CA   . ASP A 1 47  ? 8.518   -3.663  -16.090 1.00 0.00 ? 47  ASP A CA   3  
ATOM 4408  C C    . ASP A 1 47  ? 7.368   -4.636  -15.849 1.00 0.00 ? 47  ASP A C    3  
ATOM 4409  O O    . ASP A 1 47  ? 7.057   -4.974  -14.707 1.00 0.00 ? 47  ASP A O    3  
ATOM 4410  C CB   . ASP A 1 47  ? 9.835   -4.286  -15.625 1.00 0.00 ? 47  ASP A CB   3  
ATOM 4411  C CG   . ASP A 1 47  ? 11.013  -3.851  -16.475 1.00 0.00 ? 47  ASP A CG   3  
ATOM 4412  O OD1  . ASP A 1 47  ? 11.151  -4.363  -17.605 1.00 0.00 ? 47  ASP A OD1  3  
ATOM 4413  O OD2  . ASP A 1 47  ? 11.797  -2.997  -16.009 1.00 0.00 ? 47  ASP A OD2  3  
ATOM 4414  H H    . ASP A 1 47  ? 8.639   -2.277  -14.495 1.00 0.00 ? 47  ASP A H    3  
ATOM 4415  H HA   . ASP A 1 47  ? 8.582   -3.457  -17.148 1.00 0.00 ? 47  ASP A HA   3  
ATOM 4416  H HB2  . ASP A 1 47  ? 10.024  -3.992  -14.603 1.00 0.00 ? 47  ASP A HB2  3  
ATOM 4417  H HB3  . ASP A 1 47  ? 9.755   -5.362  -15.677 1.00 0.00 ? 47  ASP A HB3  3  
ATOM 4418  N N    . ARG A 1 48  ? 6.739   -5.082  -16.932 1.00 0.00 ? 48  ARG A N    3  
ATOM 4419  C CA   . ARG A 1 48  ? 5.622   -6.014  -16.837 1.00 0.00 ? 48  ARG A CA   3  
ATOM 4420  C C    . ARG A 1 48  ? 6.029   -7.275  -16.081 1.00 0.00 ? 48  ARG A C    3  
ATOM 4421  O O    . ARG A 1 48  ? 5.326   -7.721  -15.174 1.00 0.00 ? 48  ARG A O    3  
ATOM 4422  C CB   . ARG A 1 48  ? 5.119   -6.383  -18.234 1.00 0.00 ? 48  ARG A CB   3  
ATOM 4423  C CG   . ARG A 1 48  ? 3.659   -6.805  -18.264 1.00 0.00 ? 48  ARG A CG   3  
ATOM 4424  C CD   . ARG A 1 48  ? 3.330   -7.586  -19.527 1.00 0.00 ? 48  ARG A CD   3  
ATOM 4425  N NE   . ARG A 1 48  ? 1.897   -7.832  -19.660 1.00 0.00 ? 48  ARG A NE   3  
ATOM 4426  C CZ   . ARG A 1 48  ? 1.347   -8.417  -20.719 1.00 0.00 ? 48  ARG A CZ   3  
ATOM 4427  N NH1  . ARG A 1 48  ? 2.107   -8.812  -21.731 1.00 0.00 ? 48  ARG A NH1  3  
ATOM 4428  N NH2  . ARG A 1 48  ? 0.035   -8.606  -20.767 1.00 0.00 ? 48  ARG A NH2  3  
ATOM 4429  H H    . ARG A 1 48  ? 7.033   -4.776  -17.815 1.00 0.00 ? 48  ARG A H    3  
ATOM 4430  H HA   . ARG A 1 48  ? 4.827   -5.524  -16.296 1.00 0.00 ? 48  ARG A HA   3  
ATOM 4431  H HB2  . ARG A 1 48  ? 5.238   -5.529  -18.885 1.00 0.00 ? 48  ARG A HB2  3  
ATOM 4432  H HB3  . ARG A 1 48  ? 5.715   -7.200  -18.613 1.00 0.00 ? 48  ARG A HB3  3  
ATOM 4433  H HG2  . ARG A 1 48  ? 3.456   -7.428  -17.406 1.00 0.00 ? 48  ARG A HG2  3  
ATOM 4434  H HG3  . ARG A 1 48  ? 3.039   -5.922  -18.225 1.00 0.00 ? 48  ARG A HG3  3  
ATOM 4435  H HD2  . ARG A 1 48  ? 3.670   -7.021  -20.382 1.00 0.00 ? 48  ARG A HD2  3  
ATOM 4436  H HD3  . ARG A 1 48  ? 3.848   -8.533  -19.493 1.00 0.00 ? 48  ARG A HD3  3  
ATOM 4437  H HE   . ARG A 1 48  ? 1.317   -7.548  -18.924 1.00 0.00 ? 48  ARG A HE   3  
ATOM 4438  H HH11 . ARG A 1 48  ? 3.096   -8.671  -21.697 1.00 0.00 ? 48  ARG A HH11 3  
ATOM 4439  H HH12 . ARG A 1 48  ? 1.691   -9.253  -22.527 1.00 0.00 ? 48  ARG A HH12 3  
ATOM 4440  H HH21 . ARG A 1 48  ? -0.541  -8.310  -20.005 1.00 0.00 ? 48  ARG A HH21 3  
ATOM 4441  H HH22 . ARG A 1 48  ? -0.378  -9.046  -21.564 1.00 0.00 ? 48  ARG A HH22 3  
ATOM 4442  N N    . SER A 1 49  ? 7.167   -7.846  -16.462 1.00 0.00 ? 49  SER A N    3  
ATOM 4443  C CA   . SER A 1 49  ? 7.665   -9.059  -15.823 1.00 0.00 ? 49  SER A CA   3  
ATOM 4444  C C    . SER A 1 49  ? 7.626   -8.927  -14.303 1.00 0.00 ? 49  SER A C    3  
ATOM 4445  O O    . SER A 1 49  ? 7.485   -9.919  -13.587 1.00 0.00 ? 49  SER A O    3  
ATOM 4446  C CB   . SER A 1 49  ? 9.094   -9.353  -16.283 1.00 0.00 ? 49  SER A CB   3  
ATOM 4447  O OG   . SER A 1 49  ? 9.108   -9.874  -17.601 1.00 0.00 ? 49  SER A OG   3  
ATOM 4448  H H    . SER A 1 49  ? 7.683   -7.443  -17.191 1.00 0.00 ? 49  SER A H    3  
ATOM 4449  H HA   . SER A 1 49  ? 7.025   -9.876  -16.119 1.00 0.00 ? 49  SER A HA   3  
ATOM 4450  H HB2  . SER A 1 49  ? 9.671   -8.441  -16.264 1.00 0.00 ? 49  SER A HB2  3  
ATOM 4451  H HB3  . SER A 1 49  ? 9.542   -10.077 -15.618 1.00 0.00 ? 49  SER A HB3  3  
ATOM 4452  H HG   . SER A 1 49  ? 8.392   -10.505 -17.704 1.00 0.00 ? 49  SER A HG   3  
ATOM 4453  N N    . ARG A 1 50  ? 7.751   -7.696  -13.818 1.00 0.00 ? 50  ARG A N    3  
ATOM 4454  C CA   . ARG A 1 50  ? 7.731   -7.434  -12.384 1.00 0.00 ? 50  ARG A CA   3  
ATOM 4455  C C    . ARG A 1 50  ? 6.318   -7.578  -11.825 1.00 0.00 ? 50  ARG A C    3  
ATOM 4456  O O    . ARG A 1 50  ? 5.335   -7.425  -12.549 1.00 0.00 ? 50  ARG A O    3  
ATOM 4457  C CB   . ARG A 1 50  ? 8.266   -6.031  -12.093 1.00 0.00 ? 50  ARG A CB   3  
ATOM 4458  C CG   . ARG A 1 50  ? 9.711   -5.830  -12.520 1.00 0.00 ? 50  ARG A CG   3  
ATOM 4459  C CD   . ARG A 1 50  ? 10.677  -6.187  -11.401 1.00 0.00 ? 50  ARG A CD   3  
ATOM 4460  N NE   . ARG A 1 50  ? 11.986  -6.581  -11.913 1.00 0.00 ? 50  ARG A NE   3  
ATOM 4461  C CZ   . ARG A 1 50  ? 12.242  -7.774  -12.438 1.00 0.00 ? 50  ARG A CZ   3  
ATOM 4462  N NH1  . ARG A 1 50  ? 11.282  -8.685  -12.520 1.00 0.00 ? 50  ARG A NH1  3  
ATOM 4463  N NH2  . ARG A 1 50  ? 13.459  -8.057  -12.883 1.00 0.00 ? 50  ARG A NH2  3  
ATOM 4464  H H    . ARG A 1 50  ? 7.860   -6.946  -14.440 1.00 0.00 ? 50  ARG A H    3  
ATOM 4465  H HA   . ARG A 1 50  ? 8.370   -8.160  -11.905 1.00 0.00 ? 50  ARG A HA   3  
ATOM 4466  H HB2  . ARG A 1 50  ? 7.656   -5.310  -12.617 1.00 0.00 ? 50  ARG A HB2  3  
ATOM 4467  H HB3  . ARG A 1 50  ? 8.197   -5.846  -11.032 1.00 0.00 ? 50  ARG A HB3  3  
ATOM 4468  H HG2  . ARG A 1 50  ? 9.916   -6.460  -13.372 1.00 0.00 ? 50  ARG A HG2  3  
ATOM 4469  H HG3  . ARG A 1 50  ? 9.855   -4.795  -12.791 1.00 0.00 ? 50  ARG A HG3  3  
ATOM 4470  H HD2  . ARG A 1 50  ? 10.796  -5.328  -10.758 1.00 0.00 ? 50  ARG A HD2  3  
ATOM 4471  H HD3  . ARG A 1 50  ? 10.261  -7.006  -10.833 1.00 0.00 ? 50  ARG A HD3  3  
ATOM 4472  H HE   . ARG A 1 50  ? 12.710  -5.922  -11.862 1.00 0.00 ? 50  ARG A HE   3  
ATOM 4473  H HH11 . ARG A 1 50  ? 10.364  -8.474  -12.186 1.00 0.00 ? 50  ARG A HH11 3  
ATOM 4474  H HH12 . ARG A 1 50  ? 11.477  -9.582  -12.917 1.00 0.00 ? 50  ARG A HH12 3  
ATOM 4475  H HH21 . ARG A 1 50  ? 14.185  -7.373  -12.823 1.00 0.00 ? 50  ARG A HH21 3  
ATOM 4476  H HH22 . ARG A 1 50  ? 13.651  -8.955  -13.278 1.00 0.00 ? 50  ARG A HH22 3  
ATOM 4477  N N    . MET A 1 51  ? 6.226   -7.873  -10.533 1.00 0.00 ? 51  MET A N    3  
ATOM 4478  C CA   . MET A 1 51  ? 4.934   -8.036  -9.877  1.00 0.00 ? 51  MET A CA   3  
ATOM 4479  C C    . MET A 1 51  ? 4.908   -7.308  -8.537  1.00 0.00 ? 51  MET A C    3  
ATOM 4480  O O    . MET A 1 51  ? 5.310   -7.859  -7.512  1.00 0.00 ? 51  MET A O    3  
ATOM 4481  C CB   . MET A 1 51  ? 4.627   -9.521  -9.669  1.00 0.00 ? 51  MET A CB   3  
ATOM 4482  C CG   . MET A 1 51  ? 3.200   -9.790  -9.222  1.00 0.00 ? 51  MET A CG   3  
ATOM 4483  S SD   . MET A 1 51  ? 2.073   -10.040 -10.607 1.00 0.00 ? 51  MET A SD   3  
ATOM 4484  C CE   . MET A 1 51  ? 1.710   -8.346  -11.059 1.00 0.00 ? 51  MET A CE   3  
ATOM 4485  H H    . MET A 1 51  ? 7.046   -7.983  -10.007 1.00 0.00 ? 51  MET A H    3  
ATOM 4486  H HA   . MET A 1 51  ? 4.180   -7.609  -10.520 1.00 0.00 ? 51  MET A HA   3  
ATOM 4487  H HB2  . MET A 1 51  ? 4.795   -10.044 -10.598 1.00 0.00 ? 51  MET A HB2  3  
ATOM 4488  H HB3  . MET A 1 51  ? 5.297   -9.913  -8.918  1.00 0.00 ? 51  MET A HB3  3  
ATOM 4489  H HG2  . MET A 1 51  ? 3.190   -10.676 -8.605  1.00 0.00 ? 51  MET A HG2  3  
ATOM 4490  H HG3  . MET A 1 51  ? 2.854   -8.946  -8.642  1.00 0.00 ? 51  MET A HG3  3  
ATOM 4491  H HE1  . MET A 1 51  ? 2.407   -8.017  -11.816 1.00 0.00 ? 51  MET A HE1  3  
ATOM 4492  H HE2  . MET A 1 51  ? 0.704   -8.284  -11.446 1.00 0.00 ? 51  MET A HE2  3  
ATOM 4493  H HE3  . MET A 1 51  ? 1.801   -7.714  -10.188 1.00 0.00 ? 51  MET A HE3  3  
ATOM 4494  N N    . SER A 1 52  ? 4.435   -6.066  -8.552  1.00 0.00 ? 52  SER A N    3  
ATOM 4495  C CA   . SER A 1 52  ? 4.361   -5.260  -7.339  1.00 0.00 ? 52  SER A CA   3  
ATOM 4496  C C    . SER A 1 52  ? 3.378   -4.107  -7.511  1.00 0.00 ? 52  SER A C    3  
ATOM 4497  O O    . SER A 1 52  ? 3.014   -3.750  -8.632  1.00 0.00 ? 52  SER A O    3  
ATOM 4498  C CB   . SER A 1 52  ? 5.745   -4.716  -6.978  1.00 0.00 ? 52  SER A CB   3  
ATOM 4499  O OG   . SER A 1 52  ? 5.880   -4.557  -5.576  1.00 0.00 ? 52  SER A OG   3  
ATOM 4500  H H    . SER A 1 52  ? 4.130   -5.681  -9.401  1.00 0.00 ? 52  SER A H    3  
ATOM 4501  H HA   . SER A 1 52  ? 4.014   -5.897  -6.539  1.00 0.00 ? 52  SER A HA   3  
ATOM 4502  H HB2  . SER A 1 52  ? 6.501   -5.404  -7.325  1.00 0.00 ? 52  SER A HB2  3  
ATOM 4503  H HB3  . SER A 1 52  ? 5.886   -3.756  -7.453  1.00 0.00 ? 52  SER A HB3  3  
ATOM 4504  H HG   . SER A 1 52  ? 5.222   -3.934  -5.260  1.00 0.00 ? 52  SER A HG   3  
ATOM 4505  N N    . ILE A 1 53  ? 2.952   -3.529  -6.393  1.00 0.00 ? 53  ILE A N    3  
ATOM 4506  C CA   . ILE A 1 53  ? 2.011   -2.416  -6.420  1.00 0.00 ? 53  ILE A CA   3  
ATOM 4507  C C    . ILE A 1 53  ? 2.667   -1.130  -5.928  1.00 0.00 ? 53  ILE A C    3  
ATOM 4508  O O    . ILE A 1 53  ? 3.353   -1.122  -4.905  1.00 0.00 ? 53  ILE A O    3  
ATOM 4509  C CB   . ILE A 1 53  ? 0.769   -2.707  -5.558  1.00 0.00 ? 53  ILE A CB   3  
ATOM 4510  C CG1  . ILE A 1 53  ? 0.156   -4.054  -5.947  1.00 0.00 ? 53  ILE A CG1  3  
ATOM 4511  C CG2  . ILE A 1 53  ? -0.254  -1.591  -5.707  1.00 0.00 ? 53  ILE A CG2  3  
ATOM 4512  C CD1  . ILE A 1 53  ? -0.655  -4.691  -4.840  1.00 0.00 ? 53  ILE A CD1  3  
ATOM 4513  H H    . ILE A 1 53  ? 3.278   -3.859  -5.530  1.00 0.00 ? 53  ILE A H    3  
ATOM 4514  H HA   . ILE A 1 53  ? 1.690   -2.275  -7.442  1.00 0.00 ? 53  ILE A HA   3  
ATOM 4515  H HB   . ILE A 1 53  ? 1.077   -2.745  -4.524  1.00 0.00 ? 53  ILE A HB   3  
ATOM 4516  H HG12 . ILE A 1 53  ? -0.495  -3.915  -6.795  1.00 0.00 ? 53  ILE A HG12 3  
ATOM 4517  H HG13 . ILE A 1 53  ? 0.949   -4.738  -6.214  1.00 0.00 ? 53  ILE A HG13 3  
ATOM 4518  H HG21 . ILE A 1 53  ? -1.112  -1.804  -5.087  1.00 0.00 ? 53  ILE A HG21 3  
ATOM 4519  H HG22 . ILE A 1 53  ? 0.188   -0.655  -5.399  1.00 0.00 ? 53  ILE A HG22 3  
ATOM 4520  H HG23 . ILE A 1 53  ? -0.563  -1.521  -6.739  1.00 0.00 ? 53  ILE A HG23 3  
ATOM 4521  H HD11 . ILE A 1 53  ? -1.675  -4.341  -4.893  1.00 0.00 ? 53  ILE A HD11 3  
ATOM 4522  H HD12 . ILE A 1 53  ? -0.636  -5.765  -4.951  1.00 0.00 ? 53  ILE A HD12 3  
ATOM 4523  H HD13 . ILE A 1 53  ? -0.232  -4.421  -3.883  1.00 0.00 ? 53  ILE A HD13 3  
ATOM 4524  N N    . PHE A 1 54  ? 2.452   -0.044  -6.662  1.00 0.00 ? 54  PHE A N    3  
ATOM 4525  C CA   . PHE A 1 54  ? 3.021   1.249   -6.300  1.00 0.00 ? 54  PHE A CA   3  
ATOM 4526  C C    . PHE A 1 54  ? 1.962   2.345   -6.356  1.00 0.00 ? 54  PHE A C    3  
ATOM 4527  O O    . PHE A 1 54  ? 0.900   2.168   -6.954  1.00 0.00 ? 54  PHE A O    3  
ATOM 4528  C CB   . PHE A 1 54  ? 4.182   1.598   -7.233  1.00 0.00 ? 54  PHE A CB   3  
ATOM 4529  C CG   . PHE A 1 54  ? 5.341   0.647   -7.131  1.00 0.00 ? 54  PHE A CG   3  
ATOM 4530  C CD1  . PHE A 1 54  ? 6.087   0.567   -5.966  1.00 0.00 ? 54  PHE A CD1  3  
ATOM 4531  C CD2  . PHE A 1 54  ? 5.683   -0.166  -8.199  1.00 0.00 ? 54  PHE A CD2  3  
ATOM 4532  C CE1  . PHE A 1 54  ? 7.154   -0.307  -5.868  1.00 0.00 ? 54  PHE A CE1  3  
ATOM 4533  C CE2  . PHE A 1 54  ? 6.748   -1.042  -8.107  1.00 0.00 ? 54  PHE A CE2  3  
ATOM 4534  C CZ   . PHE A 1 54  ? 7.485   -1.112  -6.940  1.00 0.00 ? 54  PHE A CZ   3  
ATOM 4535  H H    . PHE A 1 54  ? 1.897   -0.113  -7.467  1.00 0.00 ? 54  PHE A H    3  
ATOM 4536  H HA   . PHE A 1 54  ? 3.393   1.175   -5.290  1.00 0.00 ? 54  PHE A HA   3  
ATOM 4537  H HB2  . PHE A 1 54  ? 3.831   1.583   -8.254  1.00 0.00 ? 54  PHE A HB2  3  
ATOM 4538  H HB3  . PHE A 1 54  ? 4.541   2.588   -6.995  1.00 0.00 ? 54  PHE A HB3  3  
ATOM 4539  H HD1  . PHE A 1 54  ? 5.829   1.197   -5.127  1.00 0.00 ? 54  PHE A HD1  3  
ATOM 4540  H HD2  . PHE A 1 54  ? 5.109   -0.112  -9.112  1.00 0.00 ? 54  PHE A HD2  3  
ATOM 4541  H HE1  . PHE A 1 54  ? 7.727   -0.358  -4.955  1.00 0.00 ? 54  PHE A HE1  3  
ATOM 4542  H HE2  . PHE A 1 54  ? 7.006   -1.670  -8.946  1.00 0.00 ? 54  PHE A HE2  3  
ATOM 4543  H HZ   . PHE A 1 54  ? 8.317   -1.796  -6.866  1.00 0.00 ? 54  PHE A HZ   3  
ATOM 4544  N N    . VAL A 1 55  ? 2.257   3.479   -5.728  1.00 0.00 ? 55  VAL A N    3  
ATOM 4545  C CA   . VAL A 1 55  ? 1.331   4.605   -5.706  1.00 0.00 ? 55  VAL A CA   3  
ATOM 4546  C C    . VAL A 1 55  ? 1.844   5.754   -6.567  1.00 0.00 ? 55  VAL A C    3  
ATOM 4547  O O    . VAL A 1 55  ? 2.784   6.454   -6.191  1.00 0.00 ? 55  VAL A O    3  
ATOM 4548  C CB   . VAL A 1 55  ? 1.102   5.115   -4.271  1.00 0.00 ? 55  VAL A CB   3  
ATOM 4549  C CG1  . VAL A 1 55  ? 0.335   6.429   -4.288  1.00 0.00 ? 55  VAL A CG1  3  
ATOM 4550  C CG2  . VAL A 1 55  ? 0.368   4.070   -3.446  1.00 0.00 ? 55  VAL A CG2  3  
ATOM 4551  H H    . VAL A 1 55  ? 3.119   3.560   -5.269  1.00 0.00 ? 55  VAL A H    3  
ATOM 4552  H HA   . VAL A 1 55  ? 0.385   4.266   -6.101  1.00 0.00 ? 55  VAL A HA   3  
ATOM 4553  H HB   . VAL A 1 55  ? 2.065   5.292   -3.816  1.00 0.00 ? 55  VAL A HB   3  
ATOM 4554  H HG11 . VAL A 1 55  ? 0.945   7.196   -4.741  1.00 0.00 ? 55  VAL A HG11 3  
ATOM 4555  H HG12 . VAL A 1 55  ? -0.575  6.307   -4.857  1.00 0.00 ? 55  VAL A HG12 3  
ATOM 4556  H HG13 . VAL A 1 55  ? 0.091   6.715   -3.275  1.00 0.00 ? 55  VAL A HG13 3  
ATOM 4557  H HG21 . VAL A 1 55  ? 0.989   3.767   -2.616  1.00 0.00 ? 55  VAL A HG21 3  
ATOM 4558  H HG22 . VAL A 1 55  ? -0.555  4.489   -3.070  1.00 0.00 ? 55  VAL A HG22 3  
ATOM 4559  H HG23 . VAL A 1 55  ? 0.147   3.212   -4.063  1.00 0.00 ? 55  VAL A HG23 3  
ATOM 4560  N N    . VAL A 1 56  ? 1.218   5.944   -7.725  1.00 0.00 ? 56  VAL A N    3  
ATOM 4561  C CA   . VAL A 1 56  ? 1.609   7.010   -8.639  1.00 0.00 ? 56  VAL A CA   3  
ATOM 4562  C C    . VAL A 1 56  ? 0.666   8.202   -8.529  1.00 0.00 ? 56  VAL A C    3  
ATOM 4563  O O    . VAL A 1 56  ? 0.770   9.163   -9.291  1.00 0.00 ? 56  VAL A O    3  
ATOM 4564  C CB   . VAL A 1 56  ? 1.630   6.518   -10.099 1.00 0.00 ? 56  VAL A CB   3  
ATOM 4565  C CG1  . VAL A 1 56  ? 2.498   5.276   -10.231 1.00 0.00 ? 56  VAL A CG1  3  
ATOM 4566  C CG2  . VAL A 1 56  ? 0.216   6.246   -10.588 1.00 0.00 ? 56  VAL A CG2  3  
ATOM 4567  H H    . VAL A 1 56  ? 0.476   5.354   -7.969  1.00 0.00 ? 56  VAL A H    3  
ATOM 4568  H HA   . VAL A 1 56  ? 2.608   7.328   -8.374  1.00 0.00 ? 56  VAL A HA   3  
ATOM 4569  H HB   . VAL A 1 56  ? 2.058   7.297   -10.713 1.00 0.00 ? 56  VAL A HB   3  
ATOM 4570  H HG11 . VAL A 1 56  ? 1.957   4.516   -10.775 1.00 0.00 ? 56  VAL A HG11 3  
ATOM 4571  H HG12 . VAL A 1 56  ? 3.404   5.525   -10.763 1.00 0.00 ? 56  VAL A HG12 3  
ATOM 4572  H HG13 . VAL A 1 56  ? 2.748   4.905   -9.248  1.00 0.00 ? 56  VAL A HG13 3  
ATOM 4573  H HG21 . VAL A 1 56  ? 0.082   6.688   -11.564 1.00 0.00 ? 56  VAL A HG21 3  
ATOM 4574  H HG22 . VAL A 1 56  ? 0.056   5.179   -10.651 1.00 0.00 ? 56  VAL A HG22 3  
ATOM 4575  H HG23 . VAL A 1 56  ? -0.494  6.675   -9.898  1.00 0.00 ? 56  VAL A HG23 3  
ATOM 4576  N N    . GLY A 1 57  ? -0.258  8.134   -7.575  1.00 0.00 ? 57  GLY A N    3  
ATOM 4577  C CA   . GLY A 1 57  ? -1.207  9.214   -7.382  1.00 0.00 ? 57  GLY A CA   3  
ATOM 4578  C C    . GLY A 1 57  ? -2.066  9.018   -6.148  1.00 0.00 ? 57  GLY A C    3  
ATOM 4579  O O    . GLY A 1 57  ? -2.346  7.886   -5.753  1.00 0.00 ? 57  GLY A O    3  
ATOM 4580  H H    . GLY A 1 57  ? -0.294  7.343   -6.997  1.00 0.00 ? 57  GLY A H    3  
ATOM 4581  H HA2  . GLY A 1 57  ? -0.665  10.143  -7.287  1.00 0.00 ? 57  GLY A HA2  3  
ATOM 4582  H HA3  . GLY A 1 57  ? -1.850  9.271   -8.248  1.00 0.00 ? 57  GLY A HA3  3  
ATOM 4583  N N    . ILE A 1 58  ? -2.483  10.122  -5.538  1.00 0.00 ? 58  ILE A N    3  
ATOM 4584  C CA   . ILE A 1 58  ? -3.315  10.066  -4.342  1.00 0.00 ? 58  ILE A CA   3  
ATOM 4585  C C    . ILE A 1 58  ? -4.507  11.009  -4.457  1.00 0.00 ? 58  ILE A C    3  
ATOM 4586  O O    . ILE A 1 58  ? -4.369  12.222  -4.307  1.00 0.00 ? 58  ILE A O    3  
ATOM 4587  C CB   . ILE A 1 58  ? -2.509  10.425  -3.080  1.00 0.00 ? 58  ILE A CB   3  
ATOM 4588  C CG1  . ILE A 1 58  ? -1.341  9.453   -2.899  1.00 0.00 ? 58  ILE A CG1  3  
ATOM 4589  C CG2  . ILE A 1 58  ? -3.411  10.412  -1.855  1.00 0.00 ? 58  ILE A CG2  3  
ATOM 4590  C CD1  . ILE A 1 58  ? -0.420  9.821   -1.757  1.00 0.00 ? 58  ILE A CD1  3  
ATOM 4591  H H    . ILE A 1 58  ? -2.227  10.995  -5.902  1.00 0.00 ? 58  ILE A H    3  
ATOM 4592  H HA   . ILE A 1 58  ? -3.678  9.054   -4.237  1.00 0.00 ? 58  ILE A HA   3  
ATOM 4593  H HB   . ILE A 1 58  ? -2.121  11.425  -3.200  1.00 0.00 ? 58  ILE A HB   3  
ATOM 4594  H HG12 . ILE A 1 58  ? -1.730  8.466   -2.706  1.00 0.00 ? 58  ILE A HG12 3  
ATOM 4595  H HG13 . ILE A 1 58  ? -0.755  9.434   -3.807  1.00 0.00 ? 58  ILE A HG13 3  
ATOM 4596  H HG21 . ILE A 1 58  ? -2.840  10.701  -0.984  1.00 0.00 ? 58  ILE A HG21 3  
ATOM 4597  H HG22 . ILE A 1 58  ? -4.223  11.109  -1.998  1.00 0.00 ? 58  ILE A HG22 3  
ATOM 4598  H HG23 . ILE A 1 58  ? -3.809  9.419   -1.711  1.00 0.00 ? 58  ILE A HG23 3  
ATOM 4599  H HD11 . ILE A 1 58  ? -0.461  9.053   -0.999  1.00 0.00 ? 58  ILE A HD11 3  
ATOM 4600  H HD12 . ILE A 1 58  ? 0.591   9.912   -2.125  1.00 0.00 ? 58  ILE A HD12 3  
ATOM 4601  H HD13 . ILE A 1 58  ? -0.734  10.764  -1.331  1.00 0.00 ? 58  ILE A HD13 3  
ATOM 4602  N N    . ASN A 1 59  ? -5.680  10.442  -4.722  1.00 0.00 ? 59  ASN A N    3  
ATOM 4603  C CA   . ASN A 1 59  ? -6.898  11.232  -4.855  1.00 0.00 ? 59  ASN A CA   3  
ATOM 4604  C C    . ASN A 1 59  ? -6.997  12.272  -3.743  1.00 0.00 ? 59  ASN A C    3  
ATOM 4605  O O    . ASN A 1 59  ? -7.001  11.948  -2.555  1.00 0.00 ? 59  ASN A O    3  
ATOM 4606  C CB   . ASN A 1 59  ? -8.127  10.321  -4.827  1.00 0.00 ? 59  ASN A CB   3  
ATOM 4607  C CG   . ASN A 1 59  ? -9.316  10.931  -5.545  1.00 0.00 ? 59  ASN A CG   3  
ATOM 4608  O OD1  . ASN A 1 59  ? -9.212  11.344  -6.700  1.00 0.00 ? 59  ASN A OD1  3  
ATOM 4609  N ND2  . ASN A 1 59  ? -10.452 10.992  -4.861  1.00 0.00 ? 59  ASN A ND2  3  
ATOM 4610  H H    . ASN A 1 59  ? -5.727  9.469   -4.831  1.00 0.00 ? 59  ASN A H    3  
ATOM 4611  H HA   . ASN A 1 59  ? -6.860  11.742  -5.806  1.00 0.00 ? 59  ASN A HA   3  
ATOM 4612  H HB2  . ASN A 1 59  ? -7.884  9.384   -5.307  1.00 0.00 ? 59  ASN A HB2  3  
ATOM 4613  H HB3  . ASN A 1 59  ? -8.406  10.134  -3.801  1.00 0.00 ? 59  ASN A HB3  3  
ATOM 4614  H HD21 . ASN A 1 59  ? -10.461 10.644  -3.945  1.00 0.00 ? 59  ASN A HD21 3  
ATOM 4615  H HD22 . ASN A 1 59  ? -11.237 11.381  -5.301  1.00 0.00 ? 59  ASN A HD22 3  
ATOM 4616  N N    . PRO A 1 60  ? -7.079  13.552  -4.135  1.00 0.00 ? 60  PRO A N    3  
ATOM 4617  C CA   . PRO A 1 60  ? -7.180  14.665  -3.187  1.00 0.00 ? 60  PRO A CA   3  
ATOM 4618  C C    . PRO A 1 60  ? -8.526  14.696  -2.471  1.00 0.00 ? 60  PRO A C    3  
ATOM 4619  O O    . PRO A 1 60  ? -8.704  15.428  -1.498  1.00 0.00 ? 60  PRO A O    3  
ATOM 4620  C CB   . PRO A 1 60  ? -7.018  15.902  -4.074  1.00 0.00 ? 60  PRO A CB   3  
ATOM 4621  C CG   . PRO A 1 60  ? -7.463  15.460  -5.425  1.00 0.00 ? 60  PRO A CG   3  
ATOM 4622  C CD   . PRO A 1 60  ? -7.080  14.010  -5.534  1.00 0.00 ? 60  PRO A CD   3  
ATOM 4623  H HA   . PRO A 1 60  ? -6.385  14.637  -2.456  1.00 0.00 ? 60  PRO A HA   3  
ATOM 4624  H HB2  . PRO A 1 60  ? -7.637  16.703  -3.695  1.00 0.00 ? 60  PRO A HB2  3  
ATOM 4625  H HB3  . PRO A 1 60  ? -5.984  16.211  -4.081  1.00 0.00 ? 60  PRO A HB3  3  
ATOM 4626  H HG2  . PRO A 1 60  ? -8.533  15.573  -5.514  1.00 0.00 ? 60  PRO A HG2  3  
ATOM 4627  H HG3  . PRO A 1 60  ? -6.959  16.039  -6.185  1.00 0.00 ? 60  PRO A HG3  3  
ATOM 4628  H HD2  . PRO A 1 60  ? -7.810  13.470  -6.117  1.00 0.00 ? 60  PRO A HD2  3  
ATOM 4629  H HD3  . PRO A 1 60  ? -6.097  13.912  -5.972  1.00 0.00 ? 60  PRO A HD3  3  
ATOM 4630  N N    . GLU A 1 61  ? -9.469  13.896  -2.958  1.00 0.00 ? 61  GLU A N    3  
ATOM 4631  C CA   . GLU A 1 61  ? -10.799 13.834  -2.363  1.00 0.00 ? 61  GLU A CA   3  
ATOM 4632  C C    . GLU A 1 61  ? -10.935 12.609  -1.464  1.00 0.00 ? 61  GLU A C    3  
ATOM 4633  O O    . GLU A 1 61  ? -11.841 12.531  -0.635  1.00 0.00 ? 61  GLU A O    3  
ATOM 4634  C CB   . GLU A 1 61  ? -11.870 13.799  -3.456  1.00 0.00 ? 61  GLU A CB   3  
ATOM 4635  C CG   . GLU A 1 61  ? -11.789 14.968  -4.424  1.00 0.00 ? 61  GLU A CG   3  
ATOM 4636  C CD   . GLU A 1 61  ? -12.721 14.808  -5.610  1.00 0.00 ? 61  GLU A CD   3  
ATOM 4637  O OE1  . GLU A 1 61  ? -12.980 13.654  -6.010  1.00 0.00 ? 61  GLU A OE1  3  
ATOM 4638  O OE2  . GLU A 1 61  ? -13.191 15.838  -6.137  1.00 0.00 ? 61  GLU A OE2  3  
ATOM 4639  H H    . GLU A 1 61  ? -9.266  13.336  -3.736  1.00 0.00 ? 61  GLU A H    3  
ATOM 4640  H HA   . GLU A 1 61  ? -10.937 14.722  -1.765  1.00 0.00 ? 61  GLU A HA   3  
ATOM 4641  H HB2  . GLU A 1 61  ? -11.763 12.884  -4.019  1.00 0.00 ? 61  GLU A HB2  3  
ATOM 4642  H HB3  . GLU A 1 61  ? -12.843 13.813  -2.989  1.00 0.00 ? 61  GLU A HB3  3  
ATOM 4643  H HG2  . GLU A 1 61  ? -12.053 15.873  -3.898  1.00 0.00 ? 61  GLU A HG2  3  
ATOM 4644  H HG3  . GLU A 1 61  ? -10.776 15.047  -4.789  1.00 0.00 ? 61  GLU A HG3  3  
ATOM 4645  N N    . GLY A 1 62  ? -10.028 11.652  -1.635  1.00 0.00 ? 62  GLY A N    3  
ATOM 4646  C CA   . GLY A 1 62  ? -10.064 10.443  -0.833  1.00 0.00 ? 62  GLY A CA   3  
ATOM 4647  C C    . GLY A 1 62  ? -9.471  10.645  0.548   1.00 0.00 ? 62  GLY A C    3  
ATOM 4648  O O    . GLY A 1 62  ? -8.951  11.712  0.873   1.00 0.00 ? 62  GLY A O    3  
ATOM 4649  H H    . GLY A 1 62  ? -9.328  11.768  -2.311  1.00 0.00 ? 62  GLY A H    3  
ATOM 4650  H HA2  . GLY A 1 62  ? -11.090 10.124  -0.729  1.00 0.00 ? 62  GLY A HA2  3  
ATOM 4651  H HA3  . GLY A 1 62  ? -9.507  9.670   -1.342  1.00 0.00 ? 62  GLY A HA3  3  
ATOM 4652  N N    . PRO A 1 63  ? -9.547  9.602   1.387   1.00 0.00 ? 63  PRO A N    3  
ATOM 4653  C CA   . PRO A 1 63  ? -9.019  9.645   2.754   1.00 0.00 ? 63  PRO A CA   3  
ATOM 4654  C C    . PRO A 1 63  ? -7.495  9.686   2.786   1.00 0.00 ? 63  PRO A C    3  
ATOM 4655  O O    . PRO A 1 63  ? -6.900  10.372  3.616   1.00 0.00 ? 63  PRO A O    3  
ATOM 4656  C CB   . PRO A 1 63  ? -9.532  8.344   3.374   1.00 0.00 ? 63  PRO A CB   3  
ATOM 4657  C CG   . PRO A 1 63  ? -9.735  7.427   2.218   1.00 0.00 ? 63  PRO A CG   3  
ATOM 4658  C CD   . PRO A 1 63  ? -10.153 8.299   1.066   1.00 0.00 ? 63  PRO A CD   3  
ATOM 4659  H HA   . PRO A 1 63  ? -9.411  10.488  3.304   1.00 0.00 ? 63  PRO A HA   3  
ATOM 4660  H HB2  . PRO A 1 63  ? -8.796  7.955   4.063   1.00 0.00 ? 63  PRO A HB2  3  
ATOM 4661  H HB3  . PRO A 1 63  ? -10.459 8.530   3.896   1.00 0.00 ? 63  PRO A HB3  3  
ATOM 4662  H HG2  . PRO A 1 63  ? -8.811  6.918   1.986   1.00 0.00 ? 63  PRO A HG2  3  
ATOM 4663  H HG3  . PRO A 1 63  ? -10.511 6.712   2.448   1.00 0.00 ? 63  PRO A HG3  3  
ATOM 4664  H HD2  . PRO A 1 63  ? -9.763  7.910   0.137   1.00 0.00 ? 63  PRO A HD2  3  
ATOM 4665  H HD3  . PRO A 1 63  ? -11.229 8.376   1.023   1.00 0.00 ? 63  PRO A HD3  3  
ATOM 4666  N N    . ALA A 1 64  ? -6.869  8.946   1.876   1.00 0.00 ? 64  ALA A N    3  
ATOM 4667  C CA   . ALA A 1 64  ? -5.414  8.899   1.799   1.00 0.00 ? 64  ALA A CA   3  
ATOM 4668  C C    . ALA A 1 64  ? -4.822  10.304  1.743   1.00 0.00 ? 64  ALA A C    3  
ATOM 4669  O O    . ALA A 1 64  ? -3.727  10.547  2.250   1.00 0.00 ? 64  ALA A O    3  
ATOM 4670  C CB   . ALA A 1 64  ? -4.975  8.091   0.587   1.00 0.00 ? 64  ALA A CB   3  
ATOM 4671  H H    . ALA A 1 64  ? -7.398  8.420   1.241   1.00 0.00 ? 64  ALA A H    3  
ATOM 4672  H HA   . ALA A 1 64  ? -5.048  8.401   2.685   1.00 0.00 ? 64  ALA A HA   3  
ATOM 4673  H HB1  . ALA A 1 64  ? -3.896  8.068   0.542   1.00 0.00 ? 64  ALA A HB1  3  
ATOM 4674  H HB2  . ALA A 1 64  ? -5.354  7.083   0.671   1.00 0.00 ? 64  ALA A HB2  3  
ATOM 4675  H HB3  . ALA A 1 64  ? -5.363  8.549   -0.310  1.00 0.00 ? 64  ALA A HB3  3  
ATOM 4676  N N    . ALA A 1 65  ? -5.553  11.224  1.123   1.00 0.00 ? 65  ALA A N    3  
ATOM 4677  C CA   . ALA A 1 65  ? -5.100  12.605  1.002   1.00 0.00 ? 65  ALA A CA   3  
ATOM 4678  C C    . ALA A 1 65  ? -5.274  13.357  2.317   1.00 0.00 ? 65  ALA A C    3  
ATOM 4679  O O    . ALA A 1 65  ? -4.461  14.212  2.666   1.00 0.00 ? 65  ALA A O    3  
ATOM 4680  C CB   . ALA A 1 65  ? -5.854  13.311  -0.115  1.00 0.00 ? 65  ALA A CB   3  
ATOM 4681  H H    . ALA A 1 65  ? -6.418  10.969  0.740   1.00 0.00 ? 65  ALA A H    3  
ATOM 4682  H HA   . ALA A 1 65  ? -4.051  12.590  0.743   1.00 0.00 ? 65  ALA A HA   3  
ATOM 4683  H HB1  . ALA A 1 65  ? -5.192  13.458  -0.957  1.00 0.00 ? 65  ALA A HB1  3  
ATOM 4684  H HB2  . ALA A 1 65  ? -6.695  12.707  -0.419  1.00 0.00 ? 65  ALA A HB2  3  
ATOM 4685  H HB3  . ALA A 1 65  ? -6.206  14.269  0.238   1.00 0.00 ? 65  ALA A HB3  3  
ATOM 4686  N N    . ALA A 1 66  ? -6.339  13.032  3.043   1.00 0.00 ? 66  ALA A N    3  
ATOM 4687  C CA   . ALA A 1 66  ? -6.618  13.676  4.321   1.00 0.00 ? 66  ALA A CA   3  
ATOM 4688  C C    . ALA A 1 66  ? -5.479  13.452  5.309   1.00 0.00 ? 66  ALA A C    3  
ATOM 4689  O O    . ALA A 1 66  ? -5.044  14.381  5.990   1.00 0.00 ? 66  ALA A O    3  
ATOM 4690  C CB   . ALA A 1 66  ? -7.928  13.160  4.897   1.00 0.00 ? 66  ALA A CB   3  
ATOM 4691  H H    . ALA A 1 66  ? -6.951  12.342  2.712   1.00 0.00 ? 66  ALA A H    3  
ATOM 4692  H HA   . ALA A 1 66  ? -6.725  14.737  4.143   1.00 0.00 ? 66  ALA A HA   3  
ATOM 4693  H HB1  . ALA A 1 66  ? -7.722  12.529  5.750   1.00 0.00 ? 66  ALA A HB1  3  
ATOM 4694  H HB2  . ALA A 1 66  ? -8.540  13.995  5.205   1.00 0.00 ? 66  ALA A HB2  3  
ATOM 4695  H HB3  . ALA A 1 66  ? -8.451  12.588  4.145   1.00 0.00 ? 66  ALA A HB3  3  
ATOM 4696  N N    . ASP A 1 67  ? -5.000  12.215  5.382   1.00 0.00 ? 67  ASP A N    3  
ATOM 4697  C CA   . ASP A 1 67  ? -3.910  11.870  6.288   1.00 0.00 ? 67  ASP A CA   3  
ATOM 4698  C C    . ASP A 1 67  ? -2.640  12.632  5.924   1.00 0.00 ? 67  ASP A C    3  
ATOM 4699  O O    . ASP A 1 67  ? -2.030  13.283  6.772   1.00 0.00 ? 67  ASP A O    3  
ATOM 4700  C CB   . ASP A 1 67  ? -3.645  10.364  6.249   1.00 0.00 ? 67  ASP A CB   3  
ATOM 4701  C CG   . ASP A 1 67  ? -3.041  9.849   7.541   1.00 0.00 ? 67  ASP A CG   3  
ATOM 4702  O OD1  . ASP A 1 67  ? -2.642  10.682  8.382   1.00 0.00 ? 67  ASP A OD1  3  
ATOM 4703  O OD2  . ASP A 1 67  ? -2.967  8.614   7.711   1.00 0.00 ? 67  ASP A OD2  3  
ATOM 4704  H H    . ASP A 1 67  ? -5.388  11.518  4.813   1.00 0.00 ? 67  ASP A H    3  
ATOM 4705  H HA   . ASP A 1 67  ? -4.208  12.148  7.287   1.00 0.00 ? 67  ASP A HA   3  
ATOM 4706  H HB2  . ASP A 1 67  ? -4.577  9.845   6.078   1.00 0.00 ? 67  ASP A HB2  3  
ATOM 4707  H HB3  . ASP A 1 67  ? -2.962  10.146  5.442   1.00 0.00 ? 67  ASP A HB3  3  
ATOM 4708  N N    . GLY A 1 68  ? -2.244  12.544  4.658   1.00 0.00 ? 68  GLY A N    3  
ATOM 4709  C CA   . GLY A 1 68  ? -1.048  13.229  4.205   1.00 0.00 ? 68  GLY A CA   3  
ATOM 4710  C C    . GLY A 1 68  ? 0.199   12.381  4.359   1.00 0.00 ? 68  GLY A C    3  
ATOM 4711  O O    . GLY A 1 68  ? 1.239   12.683  3.774   1.00 0.00 ? 68  GLY A O    3  
ATOM 4712  H H    . GLY A 1 68  ? -2.770  12.010  4.026   1.00 0.00 ? 68  GLY A H    3  
ATOM 4713  H HA2  . GLY A 1 68  ? -1.167  13.489  3.164   1.00 0.00 ? 68  GLY A HA2  3  
ATOM 4714  H HA3  . GLY A 1 68  ? -0.926  14.135  4.780   1.00 0.00 ? 68  GLY A HA3  3  
ATOM 4715  N N    . ARG A 1 69  ? 0.096   11.318  5.150   1.00 0.00 ? 69  ARG A N    3  
ATOM 4716  C CA   . ARG A 1 69  ? 1.225   10.426  5.382   1.00 0.00 ? 69  ARG A CA   3  
ATOM 4717  C C    . ARG A 1 69  ? 1.601   9.681   4.105   1.00 0.00 ? 69  ARG A C    3  
ATOM 4718  O O    . ARG A 1 69  ? 2.780   9.502   3.803   1.00 0.00 ? 69  ARG A O    3  
ATOM 4719  C CB   . ARG A 1 69  ? 0.892   9.425   6.490   1.00 0.00 ? 69  ARG A CB   3  
ATOM 4720  C CG   . ARG A 1 69  ? 1.277   9.904   7.880   1.00 0.00 ? 69  ARG A CG   3  
ATOM 4721  C CD   . ARG A 1 69  ? 2.669   9.431   8.267   1.00 0.00 ? 69  ARG A CD   3  
ATOM 4722  N NE   . ARG A 1 69  ? 3.713   10.286  7.708   1.00 0.00 ? 69  ARG A NE   3  
ATOM 4723  C CZ   . ARG A 1 69  ? 4.928   10.400  8.233   1.00 0.00 ? 69  ARG A CZ   3  
ATOM 4724  N NH1  . ARG A 1 69  ? 5.250   9.717   9.322   1.00 0.00 ? 69  ARG A NH1  3  
ATOM 4725  N NH2  . ARG A 1 69  ? 5.824   11.199  7.666   1.00 0.00 ? 69  ARG A NH2  3  
ATOM 4726  H H    . ARG A 1 69  ? -0.760  11.130  5.589   1.00 0.00 ? 69  ARG A H    3  
ATOM 4727  H HA   . ARG A 1 69  ? 2.065   11.028  5.694   1.00 0.00 ? 69  ARG A HA   3  
ATOM 4728  H HB2  . ARG A 1 69  ? -0.171  9.235   6.480   1.00 0.00 ? 69  ARG A HB2  3  
ATOM 4729  H HB3  . ARG A 1 69  ? 1.416   8.502   6.293   1.00 0.00 ? 69  ARG A HB3  3  
ATOM 4730  H HG2  . ARG A 1 69  ? 1.258   10.984  7.896   1.00 0.00 ? 69  ARG A HG2  3  
ATOM 4731  H HG3  . ARG A 1 69  ? 0.563   9.519   8.593   1.00 0.00 ? 69  ARG A HG3  3  
ATOM 4732  H HD2  . ARG A 1 69  ? 2.750   9.437   9.344   1.00 0.00 ? 69  ARG A HD2  3  
ATOM 4733  H HD3  . ARG A 1 69  ? 2.807   8.424   7.901   1.00 0.00 ? 69  ARG A HD3  3  
ATOM 4734  H HE   . ARG A 1 69  ? 3.496   10.799  6.903   1.00 0.00 ? 69  ARG A HE   3  
ATOM 4735  H HH11 . ARG A 1 69  ? 4.578   9.114   9.750   1.00 0.00 ? 69  ARG A HH11 3  
ATOM 4736  H HH12 . ARG A 1 69  ? 6.167   9.804   9.714   1.00 0.00 ? 69  ARG A HH12 3  
ATOM 4737  H HH21 . ARG A 1 69  ? 5.584   11.715  6.845   1.00 0.00 ? 69  ARG A HH21 3  
ATOM 4738  H HH22 . ARG A 1 69  ? 6.738   11.284  8.061   1.00 0.00 ? 69  ARG A HH22 3  
ATOM 4739  N N    . MET A 1 70  ? 0.590   9.249   3.358   1.00 0.00 ? 70  MET A N    3  
ATOM 4740  C CA   . MET A 1 70  ? 0.814   8.524   2.113   1.00 0.00 ? 70  MET A CA   3  
ATOM 4741  C C    . MET A 1 70  ? 1.335   9.459   1.026   1.00 0.00 ? 70  MET A C    3  
ATOM 4742  O O    . MET A 1 70  ? 0.838   10.574  0.863   1.00 0.00 ? 70  MET A O    3  
ATOM 4743  C CB   . MET A 1 70  ? -0.479  7.853   1.648   1.00 0.00 ? 70  MET A CB   3  
ATOM 4744  C CG   . MET A 1 70  ? -0.661  6.444   2.189   1.00 0.00 ? 70  MET A CG   3  
ATOM 4745  S SD   . MET A 1 70  ? -1.602  5.387   1.071   1.00 0.00 ? 70  MET A SD   3  
ATOM 4746  C CE   . MET A 1 70  ? -0.278  4.554   0.198   1.00 0.00 ? 70  MET A CE   3  
ATOM 4747  H H    . MET A 1 70  ? -0.330  9.422   3.651   1.00 0.00 ? 70  MET A H    3  
ATOM 4748  H HA   . MET A 1 70  ? 1.556   7.763   2.302   1.00 0.00 ? 70  MET A HA   3  
ATOM 4749  H HB2  . MET A 1 70  ? -1.318  8.451   1.973   1.00 0.00 ? 70  MET A HB2  3  
ATOM 4750  H HB3  . MET A 1 70  ? -0.478  7.804   0.570   1.00 0.00 ? 70  MET A HB3  3  
ATOM 4751  H HG2  . MET A 1 70  ? 0.312   6.003   2.343   1.00 0.00 ? 70  MET A HG2  3  
ATOM 4752  H HG3  . MET A 1 70  ? -1.182  6.500   3.133   1.00 0.00 ? 70  MET A HG3  3  
ATOM 4753  H HE1  . MET A 1 70  ? 0.669   4.991   0.478   1.00 0.00 ? 70  MET A HE1  3  
ATOM 4754  H HE2  . MET A 1 70  ? -0.281  3.506   0.457   1.00 0.00 ? 70  MET A HE2  3  
ATOM 4755  H HE3  . MET A 1 70  ? -0.424  4.664   -0.866  1.00 0.00 ? 70  MET A HE3  3  
ATOM 4756  N N    . ARG A 1 71  ? 2.337   8.999   0.286   1.00 0.00 ? 71  ARG A N    3  
ATOM 4757  C CA   . ARG A 1 71  ? 2.926   9.795   -0.785  1.00 0.00 ? 71  ARG A CA   3  
ATOM 4758  C C    . ARG A 1 71  ? 3.080   8.967   -2.057  1.00 0.00 ? 71  ARG A C    3  
ATOM 4759  O O    . ARG A 1 71  ? 2.883   7.751   -2.045  1.00 0.00 ? 71  ARG A O    3  
ATOM 4760  C CB   . ARG A 1 71  ? 4.286   10.344  -0.352  1.00 0.00 ? 71  ARG A CB   3  
ATOM 4761  C CG   . ARG A 1 71  ? 4.206   11.334  0.799   1.00 0.00 ? 71  ARG A CG   3  
ATOM 4762  C CD   . ARG A 1 71  ? 4.041   12.760  0.296   1.00 0.00 ? 71  ARG A CD   3  
ATOM 4763  N NE   . ARG A 1 71  ? 5.252   13.256  -0.352  1.00 0.00 ? 71  ARG A NE   3  
ATOM 4764  C CZ   . ARG A 1 71  ? 6.332   13.649  0.314   1.00 0.00 ? 71  ARG A CZ   3  
ATOM 4765  N NH1  . ARG A 1 71  ? 6.352   13.605  1.638   1.00 0.00 ? 71  ARG A NH1  3  
ATOM 4766  N NH2  . ARG A 1 71  ? 7.396   14.088  -0.347  1.00 0.00 ? 71  ARG A NH2  3  
ATOM 4767  H H    . ARG A 1 71  ? 2.691   8.102   0.464   1.00 0.00 ? 71  ARG A H    3  
ATOM 4768  H HA   . ARG A 1 71  ? 2.261   10.622  -0.986  1.00 0.00 ? 71  ARG A HA   3  
ATOM 4769  H HB2  . ARG A 1 71  ? 4.913   9.520   -0.045  1.00 0.00 ? 71  ARG A HB2  3  
ATOM 4770  H HB3  . ARG A 1 71  ? 4.745   10.840  -1.194  1.00 0.00 ? 71  ARG A HB3  3  
ATOM 4771  H HG2  . ARG A 1 71  ? 3.358   11.082  1.419   1.00 0.00 ? 71  ARG A HG2  3  
ATOM 4772  H HG3  . ARG A 1 71  ? 5.113   11.269  1.381   1.00 0.00 ? 71  ARG A HG3  3  
ATOM 4773  H HD2  . ARG A 1 71  ? 3.228   12.785  -0.414  1.00 0.00 ? 71  ARG A HD2  3  
ATOM 4774  H HD3  . ARG A 1 71  ? 3.805   13.397  1.135   1.00 0.00 ? 71  ARG A HD3  3  
ATOM 4775  H HE   . ARG A 1 71  ? 5.259   13.297  -1.330  1.00 0.00 ? 71  ARG A HE   3  
ATOM 4776  H HH11 . ARG A 1 71  ? 5.553   13.274  2.139   1.00 0.00 ? 71  ARG A HH11 3  
ATOM 4777  H HH12 . ARG A 1 71  ? 7.168   13.901  2.137   1.00 0.00 ? 71  ARG A HH12 3  
ATOM 4778  H HH21 . ARG A 1 71  ? 7.385   14.123  -1.346  1.00 0.00 ? 71  ARG A HH21 3  
ATOM 4779  H HH22 . ARG A 1 71  ? 8.209   14.385  0.154   1.00 0.00 ? 71  ARG A HH22 3  
ATOM 4780  N N    . ILE A 1 72  ? 3.433   9.632   -3.151  1.00 0.00 ? 72  ILE A N    3  
ATOM 4781  C CA   . ILE A 1 72  ? 3.615   8.958   -4.430  1.00 0.00 ? 72  ILE A CA   3  
ATOM 4782  C C    . ILE A 1 72  ? 4.915   8.160   -4.451  1.00 0.00 ? 72  ILE A C    3  
ATOM 4783  O O    . ILE A 1 72  ? 5.999   8.717   -4.287  1.00 0.00 ? 72  ILE A O    3  
ATOM 4784  C CB   . ILE A 1 72  ? 3.621   9.960   -5.599  1.00 0.00 ? 72  ILE A CB   3  
ATOM 4785  C CG1  . ILE A 1 72  ? 2.467   10.954  -5.454  1.00 0.00 ? 72  ILE A CG1  3  
ATOM 4786  C CG2  . ILE A 1 72  ? 3.529   9.224   -6.928  1.00 0.00 ? 72  ILE A CG2  3  
ATOM 4787  C CD1  . ILE A 1 72  ? 1.169   10.313  -5.017  1.00 0.00 ? 72  ILE A CD1  3  
ATOM 4788  H H    . ILE A 1 72  ? 3.576   10.600  -3.096  1.00 0.00 ? 72  ILE A H    3  
ATOM 4789  H HA   . ILE A 1 72  ? 2.786   8.278   -4.569  1.00 0.00 ? 72  ILE A HA   3  
ATOM 4790  H HB   . ILE A 1 72  ? 4.556   10.498  -5.578  1.00 0.00 ? 72  ILE A HB   3  
ATOM 4791  H HG12 . ILE A 1 72  ? 2.732   11.699  -4.720  1.00 0.00 ? 72  ILE A HG12 3  
ATOM 4792  H HG13 . ILE A 1 72  ? 2.296   11.437  -6.405  1.00 0.00 ? 72  ILE A HG13 3  
ATOM 4793  H HG21 . ILE A 1 72  ? 3.952   9.838   -7.709  1.00 0.00 ? 72  ILE A HG21 3  
ATOM 4794  H HG22 . ILE A 1 72  ? 4.078   8.297   -6.864  1.00 0.00 ? 72  ILE A HG22 3  
ATOM 4795  H HG23 . ILE A 1 72  ? 2.494   9.016   -7.154  1.00 0.00 ? 72  ILE A HG23 3  
ATOM 4796  H HD11 . ILE A 1 72  ? 1.270   9.945   -4.007  1.00 0.00 ? 72  ILE A HD11 3  
ATOM 4797  H HD12 . ILE A 1 72  ? 0.375   11.043  -5.057  1.00 0.00 ? 72  ILE A HD12 3  
ATOM 4798  H HD13 . ILE A 1 72  ? 0.934   9.490   -5.677  1.00 0.00 ? 72  ILE A HD13 3  
ATOM 4799  N N    . GLY A 1 73  ? 4.797   6.852   -4.657  1.00 0.00 ? 73  GLY A N    3  
ATOM 4800  C CA   . GLY A 1 73  ? 5.970   5.999   -4.699  1.00 0.00 ? 73  GLY A CA   3  
ATOM 4801  C C    . GLY A 1 73  ? 5.878   4.839   -3.727  1.00 0.00 ? 73  GLY A C    3  
ATOM 4802  O O    . GLY A 1 73  ? 6.625   3.867   -3.839  1.00 0.00 ? 73  GLY A O    3  
ATOM 4803  H H    . GLY A 1 73  ? 3.906   6.463   -4.782  1.00 0.00 ? 73  GLY A H    3  
ATOM 4804  H HA2  . GLY A 1 73  ? 6.084   5.609   -5.699  1.00 0.00 ? 73  GLY A HA2  3  
ATOM 4805  H HA3  . GLY A 1 73  ? 6.840   6.591   -4.453  1.00 0.00 ? 73  GLY A HA3  3  
ATOM 4806  N N    . ASP A 1 74  ? 4.962   4.942   -2.771  1.00 0.00 ? 74  ASP A N    3  
ATOM 4807  C CA   . ASP A 1 74  ? 4.775   3.893   -1.775  1.00 0.00 ? 74  ASP A CA   3  
ATOM 4808  C C    . ASP A 1 74  ? 4.542   2.542   -2.445  1.00 0.00 ? 74  ASP A C    3  
ATOM 4809  O O    . ASP A 1 74  ? 4.060   2.475   -3.576  1.00 0.00 ? 74  ASP A O    3  
ATOM 4810  C CB   . ASP A 1 74  ? 3.597   4.232   -0.861  1.00 0.00 ? 74  ASP A CB   3  
ATOM 4811  C CG   . ASP A 1 74  ? 3.809   5.527   -0.101  1.00 0.00 ? 74  ASP A CG   3  
ATOM 4812  O OD1  . ASP A 1 74  ? 4.902   5.705   0.477   1.00 0.00 ? 74  ASP A OD1  3  
ATOM 4813  O OD2  . ASP A 1 74  ? 2.882   6.363   -0.084  1.00 0.00 ? 74  ASP A OD2  3  
ATOM 4814  H H    . ASP A 1 74  ? 4.397   5.742   -2.735  1.00 0.00 ? 74  ASP A H    3  
ATOM 4815  H HA   . ASP A 1 74  ? 5.675   3.835   -1.182  1.00 0.00 ? 74  ASP A HA   3  
ATOM 4816  H HB2  . ASP A 1 74  ? 2.702   4.330   -1.458  1.00 0.00 ? 74  ASP A HB2  3  
ATOM 4817  H HB3  . ASP A 1 74  ? 3.463   3.434   -0.146  1.00 0.00 ? 74  ASP A HB3  3  
ATOM 4818  N N    . GLU A 1 75  ? 4.889   1.470   -1.741  1.00 0.00 ? 75  GLU A N    3  
ATOM 4819  C CA   . GLU A 1 75  ? 4.719   0.122   -2.269  1.00 0.00 ? 75  GLU A CA   3  
ATOM 4820  C C    . GLU A 1 75  ? 3.913   -0.744  -1.304  1.00 0.00 ? 75  GLU A C    3  
ATOM 4821  O O    . GLU A 1 75  ? 4.462   -1.321  -0.364  1.00 0.00 ? 75  GLU A O    3  
ATOM 4822  C CB   . GLU A 1 75  ? 6.081   -0.522  -2.533  1.00 0.00 ? 75  GLU A CB   3  
ATOM 4823  C CG   . GLU A 1 75  ? 6.005   -2.012  -2.821  1.00 0.00 ? 75  GLU A CG   3  
ATOM 4824  C CD   . GLU A 1 75  ? 7.374   -2.656  -2.929  1.00 0.00 ? 75  GLU A CD   3  
ATOM 4825  O OE1  . GLU A 1 75  ? 7.964   -2.613  -4.029  1.00 0.00 ? 75  GLU A OE1  3  
ATOM 4826  O OE2  . GLU A 1 75  ? 7.854   -3.205  -1.915  1.00 0.00 ? 75  GLU A OE2  3  
ATOM 4827  H H    . GLU A 1 75  ? 5.268   1.588   -0.845  1.00 0.00 ? 75  GLU A H    3  
ATOM 4828  H HA   . GLU A 1 75  ? 4.180   0.196   -3.201  1.00 0.00 ? 75  GLU A HA   3  
ATOM 4829  H HB2  . GLU A 1 75  ? 6.538   -0.035  -3.382  1.00 0.00 ? 75  GLU A HB2  3  
ATOM 4830  H HB3  . GLU A 1 75  ? 6.708   -0.377  -1.666  1.00 0.00 ? 75  GLU A HB3  3  
ATOM 4831  H HG2  . GLU A 1 75  ? 5.460   -2.493  -2.022  1.00 0.00 ? 75  GLU A HG2  3  
ATOM 4832  H HG3  . GLU A 1 75  ? 5.479   -2.159  -3.753  1.00 0.00 ? 75  GLU A HG3  3  
ATOM 4833  N N    . LEU A 1 76  ? 2.609   -0.828  -1.542  1.00 0.00 ? 76  LEU A N    3  
ATOM 4834  C CA   . LEU A 1 76  ? 1.727   -1.622  -0.694  1.00 0.00 ? 76  LEU A CA   3  
ATOM 4835  C C    . LEU A 1 76  ? 2.271   -3.035  -0.514  1.00 0.00 ? 76  LEU A C    3  
ATOM 4836  O O    . LEU A 1 76  ? 2.585   -3.720  -1.489  1.00 0.00 ? 76  LEU A O    3  
ATOM 4837  C CB   . LEU A 1 76  ? 0.322   -1.677  -1.297  1.00 0.00 ? 76  LEU A CB   3  
ATOM 4838  C CG   . LEU A 1 76  ? -0.414  -0.341  -1.409  1.00 0.00 ? 76  LEU A CG   3  
ATOM 4839  C CD1  . LEU A 1 76  ? -1.686  -0.499  -2.226  1.00 0.00 ? 76  LEU A CD1  3  
ATOM 4840  C CD2  . LEU A 1 76  ? -0.731  0.210   -0.026  1.00 0.00 ? 76  LEU A CD2  3  
ATOM 4841  H H    . LEU A 1 76  ? 2.230   -0.345  -2.305  1.00 0.00 ? 76  LEU A H    3  
ATOM 4842  H HA   . LEU A 1 76  ? 1.676   -1.143  0.272   1.00 0.00 ? 76  LEU A HA   3  
ATOM 4843  H HB2  . LEU A 1 76  ? 0.404   -2.093  -2.289  1.00 0.00 ? 76  LEU A HB2  3  
ATOM 4844  H HB3  . LEU A 1 76  ? -0.276  -2.335  -0.681  1.00 0.00 ? 76  LEU A HB3  3  
ATOM 4845  H HG   . LEU A 1 76  ? 0.222   0.371   -1.916  1.00 0.00 ? 76  LEU A HG   3  
ATOM 4846  H HD11 . LEU A 1 76  ? -1.489  -1.127  -3.081  1.00 0.00 ? 76  LEU A HD11 3  
ATOM 4847  H HD12 . LEU A 1 76  ? -2.021  0.471   -2.562  1.00 0.00 ? 76  LEU A HD12 3  
ATOM 4848  H HD13 . LEU A 1 76  ? -2.453  -0.953  -1.615  1.00 0.00 ? 76  LEU A HD13 3  
ATOM 4849  H HD21 . LEU A 1 76  ? -1.556  -0.341  0.400   1.00 0.00 ? 76  LEU A HD21 3  
ATOM 4850  H HD22 . LEU A 1 76  ? -0.999  1.254   -0.108  1.00 0.00 ? 76  LEU A HD22 3  
ATOM 4851  H HD23 . LEU A 1 76  ? 0.136   0.109   0.609   1.00 0.00 ? 76  LEU A HD23 3  
ATOM 4852  N N    . LEU A 1 77  ? 2.378   -3.467  0.738   1.00 0.00 ? 77  LEU A N    3  
ATOM 4853  C CA   . LEU A 1 77  ? 2.883   -4.801  1.046   1.00 0.00 ? 77  LEU A CA   3  
ATOM 4854  C C    . LEU A 1 77  ? 1.762   -5.703  1.553   1.00 0.00 ? 77  LEU A C    3  
ATOM 4855  O O    . LEU A 1 77  ? 1.652   -6.859  1.147   1.00 0.00 ? 77  LEU A O    3  
ATOM 4856  C CB   . LEU A 1 77  ? 3.997   -4.717  2.090   1.00 0.00 ? 77  LEU A CB   3  
ATOM 4857  C CG   . LEU A 1 77  ? 5.210   -3.867  1.710   1.00 0.00 ? 77  LEU A CG   3  
ATOM 4858  C CD1  . LEU A 1 77  ? 5.913   -3.353  2.957   1.00 0.00 ? 77  LEU A CD1  3  
ATOM 4859  C CD2  . LEU A 1 77  ? 6.173   -4.668  0.845   1.00 0.00 ? 77  LEU A CD2  3  
ATOM 4860  H H    . LEU A 1 77  ? 2.112   -2.877  1.472   1.00 0.00 ? 77  LEU A H    3  
ATOM 4861  H HA   . LEU A 1 77  ? 3.284   -5.222  0.136   1.00 0.00 ? 77  LEU A HA   3  
ATOM 4862  H HB2  . LEU A 1 77  ? 3.574   -4.304  2.993   1.00 0.00 ? 77  LEU A HB2  3  
ATOM 4863  H HB3  . LEU A 1 77  ? 4.344   -5.723  2.284   1.00 0.00 ? 77  LEU A HB3  3  
ATOM 4864  H HG   . LEU A 1 77  ? 4.878   -3.012  1.139   1.00 0.00 ? 77  LEU A HG   3  
ATOM 4865  H HD11 . LEU A 1 77  ? 6.402   -4.174  3.459   1.00 0.00 ? 77  LEU A HD11 3  
ATOM 4866  H HD12 . LEU A 1 77  ? 5.188   -2.906  3.621   1.00 0.00 ? 77  LEU A HD12 3  
ATOM 4867  H HD13 . LEU A 1 77  ? 6.648   -2.613  2.676   1.00 0.00 ? 77  LEU A HD13 3  
ATOM 4868  H HD21 . LEU A 1 77  ? 6.292   -4.177  -0.109  1.00 0.00 ? 77  LEU A HD21 3  
ATOM 4869  H HD22 . LEU A 1 77  ? 5.777   -5.662  0.692   1.00 0.00 ? 77  LEU A HD22 3  
ATOM 4870  H HD23 . LEU A 1 77  ? 7.131   -4.733  1.339   1.00 0.00 ? 77  LEU A HD23 3  
ATOM 4871  N N    . GLU A 1 78  ? 0.933   -5.165  2.442   1.00 0.00 ? 78  GLU A N    3  
ATOM 4872  C CA   . GLU A 1 78  ? -0.180  -5.922  3.003   1.00 0.00 ? 78  GLU A CA   3  
ATOM 4873  C C    . GLU A 1 78  ? -1.372  -5.011  3.283   1.00 0.00 ? 78  GLU A C    3  
ATOM 4874  O O    . GLU A 1 78  ? -1.211  -3.807  3.487   1.00 0.00 ? 78  GLU A O    3  
ATOM 4875  C CB   . GLU A 1 78  ? 0.251   -6.627  4.291   1.00 0.00 ? 78  GLU A CB   3  
ATOM 4876  C CG   . GLU A 1 78  ? 1.644   -7.229  4.218   1.00 0.00 ? 78  GLU A CG   3  
ATOM 4877  C CD   . GLU A 1 78  ? 1.928   -8.182  5.363   1.00 0.00 ? 78  GLU A CD   3  
ATOM 4878  O OE1  . GLU A 1 78  ? 0.965   -8.771  5.898   1.00 0.00 ? 78  GLU A OE1  3  
ATOM 4879  O OE2  . GLU A 1 78  ? 3.113   -8.339  5.723   1.00 0.00 ? 78  GLU A OE2  3  
ATOM 4880  H H    . GLU A 1 78  ? 1.073   -4.238  2.727   1.00 0.00 ? 78  GLU A H    3  
ATOM 4881  H HA   . GLU A 1 78  ? -0.474  -6.666  2.278   1.00 0.00 ? 78  GLU A HA   3  
ATOM 4882  H HB2  . GLU A 1 78  ? 0.231   -5.913  5.102   1.00 0.00 ? 78  GLU A HB2  3  
ATOM 4883  H HB3  . GLU A 1 78  ? -0.451  -7.420  4.505   1.00 0.00 ? 78  GLU A HB3  3  
ATOM 4884  H HG2  . GLU A 1 78  ? 1.741   -7.769  3.288   1.00 0.00 ? 78  GLU A HG2  3  
ATOM 4885  H HG3  . GLU A 1 78  ? 2.370   -6.429  4.247   1.00 0.00 ? 78  GLU A HG3  3  
ATOM 4886  N N    . ILE A 1 79  ? -2.566  -5.593  3.290   1.00 0.00 ? 79  ILE A N    3  
ATOM 4887  C CA   . ILE A 1 79  ? -3.784  -4.835  3.546   1.00 0.00 ? 79  ILE A CA   3  
ATOM 4888  C C    . ILE A 1 79  ? -4.851  -5.710  4.194   1.00 0.00 ? 79  ILE A C    3  
ATOM 4889  O O    . ILE A 1 79  ? -4.985  -6.888  3.866   1.00 0.00 ? 79  ILE A O    3  
ATOM 4890  C CB   . ILE A 1 79  ? -4.351  -4.228  2.249   1.00 0.00 ? 79  ILE A CB   3  
ATOM 4891  C CG1  . ILE A 1 79  ? -3.343  -3.257  1.631   1.00 0.00 ? 79  ILE A CG1  3  
ATOM 4892  C CG2  . ILE A 1 79  ? -5.671  -3.524  2.527   1.00 0.00 ? 79  ILE A CG2  3  
ATOM 4893  C CD1  . ILE A 1 79  ? -3.766  -2.728  0.278   1.00 0.00 ? 79  ILE A CD1  3  
ATOM 4894  H H    . ILE A 1 79  ? -2.629  -6.556  3.121   1.00 0.00 ? 79  ILE A H    3  
ATOM 4895  H HA   . ILE A 1 79  ? -3.538  -4.027  4.220   1.00 0.00 ? 79  ILE A HA   3  
ATOM 4896  H HB   . ILE A 1 79  ? -4.539  -5.032  1.554   1.00 0.00 ? 79  ILE A HB   3  
ATOM 4897  H HG12 . ILE A 1 79  ? -3.214  -2.414  2.290   1.00 0.00 ? 79  ILE A HG12 3  
ATOM 4898  H HG13 . ILE A 1 79  ? -2.396  -3.762  1.509   1.00 0.00 ? 79  ILE A HG13 3  
ATOM 4899  H HG21 . ILE A 1 79  ? -6.005  -3.018  1.633   1.00 0.00 ? 79  ILE A HG21 3  
ATOM 4900  H HG22 . ILE A 1 79  ? -6.411  -4.251  2.825   1.00 0.00 ? 79  ILE A HG22 3  
ATOM 4901  H HG23 . ILE A 1 79  ? -5.535  -2.803  3.319   1.00 0.00 ? 79  ILE A HG23 3  
ATOM 4902  H HD11 . ILE A 1 79  ? -4.410  -1.871  0.411   1.00 0.00 ? 79  ILE A HD11 3  
ATOM 4903  H HD12 . ILE A 1 79  ? -2.891  -2.438  -0.285  1.00 0.00 ? 79  ILE A HD12 3  
ATOM 4904  H HD13 . ILE A 1 79  ? -4.300  -3.498  -0.259  1.00 0.00 ? 79  ILE A HD13 3  
ATOM 4905  N N    . ASN A 1 80  ? -5.610  -5.125  5.114   1.00 0.00 ? 80  ASN A N    3  
ATOM 4906  C CA   . ASN A 1 80  ? -6.668  -5.851  5.808   1.00 0.00 ? 80  ASN A CA   3  
ATOM 4907  C C    . ASN A 1 80  ? -6.267  -7.305  6.041   1.00 0.00 ? 80  ASN A C    3  
ATOM 4908  O O    . ASN A 1 80  ? -7.022  -8.225  5.732   1.00 0.00 ? 80  ASN A O    3  
ATOM 4909  C CB   . ASN A 1 80  ? -7.968  -5.792  5.004   1.00 0.00 ? 80  ASN A CB   3  
ATOM 4910  C CG   . ASN A 1 80  ? -9.153  -6.332  5.780   1.00 0.00 ? 80  ASN A CG   3  
ATOM 4911  O OD1  . ASN A 1 80  ? -9.670  -7.408  5.478   1.00 0.00 ? 80  ASN A OD1  3  
ATOM 4912  N ND2  . ASN A 1 80  ? -9.590  -5.585  6.788   1.00 0.00 ? 80  ASN A ND2  3  
ATOM 4913  H H    . ASN A 1 80  ? -5.456  -4.182  5.333   1.00 0.00 ? 80  ASN A H    3  
ATOM 4914  H HA   . ASN A 1 80  ? -6.824  -5.375  6.764   1.00 0.00 ? 80  ASN A HA   3  
ATOM 4915  H HB2  . ASN A 1 80  ? -8.174  -4.765  4.739   1.00 0.00 ? 80  ASN A HB2  3  
ATOM 4916  H HB3  . ASN A 1 80  ? -7.854  -6.376  4.103   1.00 0.00 ? 80  ASN A HB3  3  
ATOM 4917  H HD21 . ASN A 1 80  ? -9.130  -4.740  6.971   1.00 0.00 ? 80  ASN A HD21 3  
ATOM 4918  H HD22 . ASN A 1 80  ? -10.355 -5.911  7.307   1.00 0.00 ? 80  ASN A HD22 3  
ATOM 4919  N N    . ASN A 1 81  ? -5.072  -7.502  6.589   1.00 0.00 ? 81  ASN A N    3  
ATOM 4920  C CA   . ASN A 1 81  ? -4.570  -8.844  6.864   1.00 0.00 ? 81  ASN A CA   3  
ATOM 4921  C C    . ASN A 1 81  ? -4.521  -9.678  5.588   1.00 0.00 ? 81  ASN A C    3  
ATOM 4922  O O    . ASN A 1 81  ? -5.082  -10.772 5.529   1.00 0.00 ? 81  ASN A O    3  
ATOM 4923  C CB   . ASN A 1 81  ? -5.450  -9.536  7.907   1.00 0.00 ? 81  ASN A CB   3  
ATOM 4924  C CG   . ASN A 1 81  ? -5.017  -9.226  9.327   1.00 0.00 ? 81  ASN A CG   3  
ATOM 4925  O OD1  . ASN A 1 81  ? -4.872  -8.062  9.703   1.00 0.00 ? 81  ASN A OD1  3  
ATOM 4926  N ND2  . ASN A 1 81  ? -4.809  -10.268 10.123  1.00 0.00 ? 81  ASN A ND2  3  
ATOM 4927  H H    . ASN A 1 81  ? -4.515  -6.728  6.814   1.00 0.00 ? 81  ASN A H    3  
ATOM 4928  H HA   . ASN A 1 81  ? -3.569  -8.749  7.257   1.00 0.00 ? 81  ASN A HA   3  
ATOM 4929  H HB2  . ASN A 1 81  ? -6.471  -9.208  7.782   1.00 0.00 ? 81  ASN A HB2  3  
ATOM 4930  H HB3  . ASN A 1 81  ? -5.399  -10.605 7.760   1.00 0.00 ? 81  ASN A HB3  3  
ATOM 4931  H HD21 . ASN A 1 81  ? -4.944  -11.166 9.755   1.00 0.00 ? 81  ASN A HD21 3  
ATOM 4932  H HD22 . ASN A 1 81  ? -4.529  -10.095 11.046  1.00 0.00 ? 81  ASN A HD22 3  
ATOM 4933  N N    . GLN A 1 82  ? -3.846  -9.154  4.570   1.00 0.00 ? 82  GLN A N    3  
ATOM 4934  C CA   . GLN A 1 82  ? -3.724  -9.852  3.296   1.00 0.00 ? 82  GLN A CA   3  
ATOM 4935  C C    . GLN A 1 82  ? -2.498  -9.370  2.527   1.00 0.00 ? 82  GLN A C    3  
ATOM 4936  O O    . GLN A 1 82  ? -2.496  -8.274  1.966   1.00 0.00 ? 82  GLN A O    3  
ATOM 4937  C CB   . GLN A 1 82  ? -4.984  -9.642  2.453   1.00 0.00 ? 82  GLN A CB   3  
ATOM 4938  C CG   . GLN A 1 82  ? -6.156  -10.508 2.887   1.00 0.00 ? 82  GLN A CG   3  
ATOM 4939  C CD   . GLN A 1 82  ? -7.192  -10.678 1.793   1.00 0.00 ? 82  GLN A CD   3  
ATOM 4940  O OE1  . GLN A 1 82  ? -6.852  -10.848 0.622   1.00 0.00 ? 82  GLN A OE1  3  
ATOM 4941  N NE2  . GLN A 1 82  ? -8.464  -10.633 2.170   1.00 0.00 ? 82  GLN A NE2  3  
ATOM 4942  H H    . GLN A 1 82  ? -3.420  -8.279  4.679   1.00 0.00 ? 82  GLN A H    3  
ATOM 4943  H HA   . GLN A 1 82  ? -3.612  -10.905 3.503   1.00 0.00 ? 82  GLN A HA   3  
ATOM 4944  H HB2  . GLN A 1 82  ? -5.282  -8.607  2.524   1.00 0.00 ? 82  GLN A HB2  3  
ATOM 4945  H HB3  . GLN A 1 82  ? -4.756  -9.873  1.423   1.00 0.00 ? 82  GLN A HB3  3  
ATOM 4946  H HG2  . GLN A 1 82  ? -5.784  -11.483 3.164   1.00 0.00 ? 82  GLN A HG2  3  
ATOM 4947  H HG3  . GLN A 1 82  ? -6.629  -10.048 3.742   1.00 0.00 ? 82  GLN A HG3  3  
ATOM 4948  H HE21 . GLN A 1 82  ? -8.660  -10.493 3.120   1.00 0.00 ? 82  GLN A HE21 3  
ATOM 4949  H HE22 . GLN A 1 82  ? -9.154  -10.739 1.484   1.00 0.00 ? 82  GLN A HE22 3  
ATOM 4950  N N    . ILE A 1 83  ? -1.458  -10.196 2.505   1.00 0.00 ? 83  ILE A N    3  
ATOM 4951  C CA   . ILE A 1 83  ? -0.226  -9.854  1.804   1.00 0.00 ? 83  ILE A CA   3  
ATOM 4952  C C    . ILE A 1 83  ? -0.461  -9.745  0.301   1.00 0.00 ? 83  ILE A C    3  
ATOM 4953  O O    . ILE A 1 83  ? -1.029  -10.647 -0.317  1.00 0.00 ? 83  ILE A O    3  
ATOM 4954  C CB   . ILE A 1 83  ? 0.878   -10.895 2.065   1.00 0.00 ? 83  ILE A CB   3  
ATOM 4955  C CG1  . ILE A 1 83  ? 1.179   -10.987 3.563   1.00 0.00 ? 83  ILE A CG1  3  
ATOM 4956  C CG2  . ILE A 1 83  ? 2.137   -10.539 1.288   1.00 0.00 ? 83  ILE A CG2  3  
ATOM 4957  C CD1  . ILE A 1 83  ? 2.355   -11.880 3.889   1.00 0.00 ? 83  ILE A CD1  3  
ATOM 4958  H H    . ILE A 1 83  ? -1.520  -11.056 2.970   1.00 0.00 ? 83  ILE A H    3  
ATOM 4959  H HA   . ILE A 1 83  ? 0.113   -8.898  2.175   1.00 0.00 ? 83  ILE A HA   3  
ATOM 4960  H HB   . ILE A 1 83  ? 0.528   -11.854 1.716   1.00 0.00 ? 83  ILE A HB   3  
ATOM 4961  H HG12 . ILE A 1 83  ? 1.397   -10.001 3.941   1.00 0.00 ? 83  ILE A HG12 3  
ATOM 4962  H HG13 . ILE A 1 83  ? 0.311   -11.380 4.073   1.00 0.00 ? 83  ILE A HG13 3  
ATOM 4963  H HG21 . ILE A 1 83  ? 2.510   -11.419 0.785   1.00 0.00 ? 83  ILE A HG21 3  
ATOM 4964  H HG22 . ILE A 1 83  ? 1.905   -9.779  0.557   1.00 0.00 ? 83  ILE A HG22 3  
ATOM 4965  H HG23 . ILE A 1 83  ? 2.887   -10.167 1.969   1.00 0.00 ? 83  ILE A HG23 3  
ATOM 4966  H HD11 . ILE A 1 83  ? 2.012   -12.897 4.015   1.00 0.00 ? 83  ILE A HD11 3  
ATOM 4967  H HD12 . ILE A 1 83  ? 3.074   -11.839 3.085   1.00 0.00 ? 83  ILE A HD12 3  
ATOM 4968  H HD13 . ILE A 1 83  ? 2.820   -11.543 4.805   1.00 0.00 ? 83  ILE A HD13 3  
ATOM 4969  N N    . LEU A 1 84  ? -0.019  -8.636  -0.282  1.00 0.00 ? 84  LEU A N    3  
ATOM 4970  C CA   . LEU A 1 84  ? -0.179  -8.409  -1.714  1.00 0.00 ? 84  LEU A CA   3  
ATOM 4971  C C    . LEU A 1 84  ? 1.092   -8.783  -2.470  1.00 0.00 ? 84  LEU A C    3  
ATOM 4972  O O    . LEU A 1 84  ? 1.038   -9.206  -3.625  1.00 0.00 ? 84  LEU A O    3  
ATOM 4973  C CB   . LEU A 1 84  ? -0.533  -6.946  -1.982  1.00 0.00 ? 84  LEU A CB   3  
ATOM 4974  C CG   . LEU A 1 84  ? -1.557  -6.319  -1.035  1.00 0.00 ? 84  LEU A CG   3  
ATOM 4975  C CD1  . LEU A 1 84  ? -1.525  -4.802  -1.142  1.00 0.00 ? 84  LEU A CD1  3  
ATOM 4976  C CD2  . LEU A 1 84  ? -2.952  -6.847  -1.333  1.00 0.00 ? 84  LEU A CD2  3  
ATOM 4977  H H    . LEU A 1 84  ? 0.426   -7.954  0.262   1.00 0.00 ? 84  LEU A H    3  
ATOM 4978  H HA   . LEU A 1 84  ? -0.987  -9.036  -2.061  1.00 0.00 ? 84  LEU A HA   3  
ATOM 4979  H HB2  . LEU A 1 84  ? 0.376   -6.368  -1.916  1.00 0.00 ? 84  LEU A HB2  3  
ATOM 4980  H HB3  . LEU A 1 84  ? -0.927  -6.880  -2.987  1.00 0.00 ? 84  LEU A HB3  3  
ATOM 4981  H HG   . LEU A 1 84  ? -1.307  -6.586  -0.017  1.00 0.00 ? 84  LEU A HG   3  
ATOM 4982  H HD11 . LEU A 1 84  ? -1.141  -4.384  -0.224  1.00 0.00 ? 84  LEU A HD11 3  
ATOM 4983  H HD12 . LEU A 1 84  ? -2.525  -4.432  -1.316  1.00 0.00 ? 84  LEU A HD12 3  
ATOM 4984  H HD13 . LEU A 1 84  ? -0.887  -4.513  -1.965  1.00 0.00 ? 84  LEU A HD13 3  
ATOM 4985  H HD21 . LEU A 1 84  ? -3.680  -6.074  -1.132  1.00 0.00 ? 84  LEU A HD21 3  
ATOM 4986  H HD22 . LEU A 1 84  ? -3.155  -7.703  -0.705  1.00 0.00 ? 84  LEU A HD22 3  
ATOM 4987  H HD23 . LEU A 1 84  ? -3.013  -7.138  -2.371  1.00 0.00 ? 84  LEU A HD23 3  
ATOM 4988  N N    . TYR A 1 85  ? 2.234   -8.626  -1.811  1.00 0.00 ? 85  TYR A N    3  
ATOM 4989  C CA   . TYR A 1 85  ? 3.520   -8.947  -2.420  1.00 0.00 ? 85  TYR A CA   3  
ATOM 4990  C C    . TYR A 1 85  ? 3.403   -10.169 -3.325  1.00 0.00 ? 85  TYR A C    3  
ATOM 4991  O O    . TYR A 1 85  ? 3.405   -11.306 -2.855  1.00 0.00 ? 85  TYR A O    3  
ATOM 4992  C CB   . TYR A 1 85  ? 4.572   -9.197  -1.339  1.00 0.00 ? 85  TYR A CB   3  
ATOM 4993  C CG   . TYR A 1 85  ? 5.959   -9.443  -1.889  1.00 0.00 ? 85  TYR A CG   3  
ATOM 4994  C CD1  . TYR A 1 85  ? 6.350   -10.712 -2.297  1.00 0.00 ? 85  TYR A CD1  3  
ATOM 4995  C CD2  . TYR A 1 85  ? 6.878   -8.407  -2.000  1.00 0.00 ? 85  TYR A CD2  3  
ATOM 4996  C CE1  . TYR A 1 85  ? 7.616   -10.942 -2.800  1.00 0.00 ? 85  TYR A CE1  3  
ATOM 4997  C CE2  . TYR A 1 85  ? 8.146   -8.628  -2.503  1.00 0.00 ? 85  TYR A CE2  3  
ATOM 4998  C CZ   . TYR A 1 85  ? 8.510   -9.897  -2.902  1.00 0.00 ? 85  TYR A CZ   3  
ATOM 4999  O OH   . TYR A 1 85  ? 9.772   -10.121 -3.402  1.00 0.00 ? 85  TYR A OH   3  
ATOM 5000  H H    . TYR A 1 85  ? 2.213   -8.284  -0.892  1.00 0.00 ? 85  TYR A H    3  
ATOM 5001  H HA   . TYR A 1 85  ? 3.825   -8.099  -3.017  1.00 0.00 ? 85  TYR A HA   3  
ATOM 5002  H HB2  . TYR A 1 85  ? 4.622   -8.337  -0.689  1.00 0.00 ? 85  TYR A HB2  3  
ATOM 5003  H HB3  . TYR A 1 85  ? 4.286   -10.063 -0.761  1.00 0.00 ? 85  TYR A HB3  3  
ATOM 5004  H HD1  . TYR A 1 85  ? 5.648   -11.529 -2.217  1.00 0.00 ? 85  TYR A HD1  3  
ATOM 5005  H HD2  . TYR A 1 85  ? 6.589   -7.414  -1.687  1.00 0.00 ? 85  TYR A HD2  3  
ATOM 5006  H HE1  . TYR A 1 85  ? 7.902   -11.936 -3.113  1.00 0.00 ? 85  TYR A HE1  3  
ATOM 5007  H HE2  . TYR A 1 85  ? 8.846   -7.809  -2.582  1.00 0.00 ? 85  TYR A HE2  3  
ATOM 5008  H HH   . TYR A 1 85  ? 10.372  -10.321 -2.679  1.00 0.00 ? 85  TYR A HH   3  
ATOM 5009  N N    . GLY A 1 86  ? 3.304   -9.926  -4.628  1.00 0.00 ? 86  GLY A N    3  
ATOM 5010  C CA   . GLY A 1 86  ? 3.189   -11.016 -5.580  1.00 0.00 ? 86  GLY A CA   3  
ATOM 5011  C C    . GLY A 1 86  ? 1.813   -11.091 -6.211  1.00 0.00 ? 86  GLY A C    3  
ATOM 5012  O O    . GLY A 1 86  ? 1.374   -12.161 -6.633  1.00 0.00 ? 86  GLY A O    3  
ATOM 5013  H H    . GLY A 1 86  ? 3.308   -8.999  -4.946  1.00 0.00 ? 86  GLY A H    3  
ATOM 5014  H HA2  . GLY A 1 86  ? 3.924   -10.878 -6.359  1.00 0.00 ? 86  GLY A HA2  3  
ATOM 5015  H HA3  . GLY A 1 86  ? 3.389   -11.946 -5.070  1.00 0.00 ? 86  GLY A HA3  3  
ATOM 5016  N N    . ARG A 1 87  ? 1.129   -9.953  -6.275  1.00 0.00 ? 87  ARG A N    3  
ATOM 5017  C CA   . ARG A 1 87  ? -0.206  -9.896  -6.857  1.00 0.00 ? 87  ARG A CA   3  
ATOM 5018  C C    . ARG A 1 87  ? -0.349  -8.683  -7.772  1.00 0.00 ? 87  ARG A C    3  
ATOM 5019  O O    . ARG A 1 87  ? 0.611   -7.946  -7.997  1.00 0.00 ? 87  ARG A O    3  
ATOM 5020  C CB   . ARG A 1 87  ? -1.264  -9.842  -5.753  1.00 0.00 ? 87  ARG A CB   3  
ATOM 5021  C CG   . ARG A 1 87  ? -1.212  -11.025 -4.800  1.00 0.00 ? 87  ARG A CG   3  
ATOM 5022  C CD   . ARG A 1 87  ? -2.229  -10.883 -3.679  1.00 0.00 ? 87  ARG A CD   3  
ATOM 5023  N NE   . ARG A 1 87  ? -3.523  -11.458 -4.037  1.00 0.00 ? 87  ARG A NE   3  
ATOM 5024  C CZ   . ARG A 1 87  ? -3.724  -12.758 -4.220  1.00 0.00 ? 87  ARG A CZ   3  
ATOM 5025  N NH1  . ARG A 1 87  ? -2.721  -13.614 -4.078  1.00 0.00 ? 87  ARG A NH1  3  
ATOM 5026  N NH2  . ARG A 1 87  ? -4.930  -13.205 -4.544  1.00 0.00 ? 87  ARG A NH2  3  
ATOM 5027  H H    . ARG A 1 87  ? 1.532   -9.133  -5.922  1.00 0.00 ? 87  ARG A H    3  
ATOM 5028  H HA   . ARG A 1 87  ? -0.353  -10.792 -7.440  1.00 0.00 ? 87  ARG A HA   3  
ATOM 5029  H HB2  . ARG A 1 87  ? -1.122  -8.938  -5.178  1.00 0.00 ? 87  ARG A HB2  3  
ATOM 5030  H HB3  . ARG A 1 87  ? -2.242  -9.818  -6.210  1.00 0.00 ? 87  ARG A HB3  3  
ATOM 5031  H HG2  . ARG A 1 87  ? -1.425  -11.929 -5.352  1.00 0.00 ? 87  ARG A HG2  3  
ATOM 5032  H HG3  . ARG A 1 87  ? -0.223  -11.086 -4.372  1.00 0.00 ? 87  ARG A HG3  3  
ATOM 5033  H HD2  . ARG A 1 87  ? -1.852  -11.388 -2.803  1.00 0.00 ? 87  ARG A HD2  3  
ATOM 5034  H HD3  . ARG A 1 87  ? -2.360  -9.833  -3.461  1.00 0.00 ? 87  ARG A HD3  3  
ATOM 5035  H HE   . ARG A 1 87  ? -4.278  -10.843 -4.147  1.00 0.00 ? 87  ARG A HE   3  
ATOM 5036  H HH11 . ARG A 1 87  ? -1.811  -13.280 -3.833  1.00 0.00 ? 87  ARG A HH11 3  
ATOM 5037  H HH12 . ARG A 1 87  ? -2.875  -14.592 -4.215  1.00 0.00 ? 87  ARG A HH12 3  
ATOM 5038  H HH21 . ARG A 1 87  ? -5.689  -12.563 -4.652  1.00 0.00 ? 87  ARG A HH21 3  
ATOM 5039  H HH22 . ARG A 1 87  ? -5.080  -14.183 -4.682  1.00 0.00 ? 87  ARG A HH22 3  
ATOM 5040  N N    . SER A 1 88  ? -1.553  -8.484  -8.299  1.00 0.00 ? 88  SER A N    3  
ATOM 5041  C CA   . SER A 1 88  ? -1.820  -7.364  -9.193  1.00 0.00 ? 88  SER A CA   3  
ATOM 5042  C C    . SER A 1 88  ? -2.543  -6.241  -8.457  1.00 0.00 ? 88  SER A C    3  
ATOM 5043  O O    . SER A 1 88  ? -3.391  -6.490  -7.599  1.00 0.00 ? 88  SER A O    3  
ATOM 5044  C CB   . SER A 1 88  ? -2.656  -7.827  -10.388 1.00 0.00 ? 88  SER A CB   3  
ATOM 5045  O OG   . SER A 1 88  ? -2.433  -7.000  -11.517 1.00 0.00 ? 88  SER A OG   3  
ATOM 5046  H H    . SER A 1 88  ? -2.278  -9.107  -8.082  1.00 0.00 ? 88  SER A H    3  
ATOM 5047  H HA   . SER A 1 88  ? -0.872  -6.992  -9.551  1.00 0.00 ? 88  SER A HA   3  
ATOM 5048  H HB2  . SER A 1 88  ? -2.387  -8.841  -10.641 1.00 0.00 ? 88  SER A HB2  3  
ATOM 5049  H HB3  . SER A 1 88  ? -3.704  -7.786  -10.128 1.00 0.00 ? 88  SER A HB3  3  
ATOM 5050  H HG   . SER A 1 88  ? -1.685  -7.335  -12.017 1.00 0.00 ? 88  SER A HG   3  
ATOM 5051  N N    . HIS A 1 89  ? -2.202  -5.002  -8.798  1.00 0.00 ? 89  HIS A N    3  
ATOM 5052  C CA   . HIS A 1 89  ? -2.819  -3.839  -8.170  1.00 0.00 ? 89  HIS A CA   3  
ATOM 5053  C C    . HIS A 1 89  ? -4.340  -3.956  -8.185  1.00 0.00 ? 89  HIS A C    3  
ATOM 5054  O O    . HIS A 1 89  ? -5.023  -3.394  -7.329  1.00 0.00 ? 89  HIS A O    3  
ATOM 5055  C CB   . HIS A 1 89  ? -2.387  -2.558  -8.885  1.00 0.00 ? 89  HIS A CB   3  
ATOM 5056  C CG   . HIS A 1 89  ? -2.725  -2.543  -10.344 1.00 0.00 ? 89  HIS A CG   3  
ATOM 5057  N ND1  . HIS A 1 89  ? -3.928  -2.078  -10.833 1.00 0.00 ? 89  HIS A ND1  3  
ATOM 5058  C CD2  . HIS A 1 89  ? -2.009  -2.938  -11.422 1.00 0.00 ? 89  HIS A CD2  3  
ATOM 5059  C CE1  . HIS A 1 89  ? -3.938  -2.190  -12.149 1.00 0.00 ? 89  HIS A CE1  3  
ATOM 5060  N NE2  . HIS A 1 89  ? -2.785  -2.708  -12.532 1.00 0.00 ? 89  HIS A NE2  3  
ATOM 5061  H H    . HIS A 1 89  ? -1.520  -4.867  -9.488  1.00 0.00 ? 89  HIS A H    3  
ATOM 5062  H HA   . HIS A 1 89  ? -2.484  -3.799  -7.144  1.00 0.00 ? 89  HIS A HA   3  
ATOM 5063  H HB2  . HIS A 1 89  ? -2.876  -1.713  -8.423  1.00 0.00 ? 89  HIS A HB2  3  
ATOM 5064  H HB3  . HIS A 1 89  ? -1.316  -2.444  -8.790  1.00 0.00 ? 89  HIS A HB3  3  
ATOM 5065  H HD1  . HIS A 1 89  ? -4.665  -1.722  -10.295 1.00 0.00 ? 89  HIS A HD1  3  
ATOM 5066  H HD2  . HIS A 1 89  ? -1.013  -3.357  -11.413 1.00 0.00 ? 89  HIS A HD2  3  
ATOM 5067  H HE1  . HIS A 1 89  ? -4.749  -1.905  -12.801 1.00 0.00 ? 89  HIS A HE1  3  
ATOM 5068  H HE2  . HIS A 1 89  ? -2.563  -2.976  -13.448 1.00 0.00 ? 89  HIS A HE2  3  
ATOM 5069  N N    . GLN A 1 90  ? -4.863  -4.687  -9.164  1.00 0.00 ? 90  GLN A N    3  
ATOM 5070  C CA   . GLN A 1 90  ? -6.303  -4.876  -9.290  1.00 0.00 ? 90  GLN A CA   3  
ATOM 5071  C C    . GLN A 1 90  ? -6.868  -5.590  -8.067  1.00 0.00 ? 90  GLN A C    3  
ATOM 5072  O O    . GLN A 1 90  ? -8.001  -5.338  -7.658  1.00 0.00 ? 90  GLN A O    3  
ATOM 5073  C CB   . GLN A 1 90  ? -6.625  -5.673  -10.555 1.00 0.00 ? 90  GLN A CB   3  
ATOM 5074  C CG   . GLN A 1 90  ? -6.631  -4.831  -11.821 1.00 0.00 ? 90  GLN A CG   3  
ATOM 5075  C CD   . GLN A 1 90  ? -7.897  -4.012  -11.971 1.00 0.00 ? 90  GLN A CD   3  
ATOM 5076  O OE1  . GLN A 1 90  ? -8.141  -3.078  -11.206 1.00 0.00 ? 90  GLN A OE1  3  
ATOM 5077  N NE2  . GLN A 1 90  ? -8.713  -4.358  -12.960 1.00 0.00 ? 90  GLN A NE2  3  
ATOM 5078  H H    . GLN A 1 90  ? -4.266  -5.110  -9.816  1.00 0.00 ? 90  GLN A H    3  
ATOM 5079  H HA   . GLN A 1 90  ? -6.759  -3.900  -9.365  1.00 0.00 ? 90  GLN A HA   3  
ATOM 5080  H HB2  . GLN A 1 90  ? -5.889  -6.454  -10.671 1.00 0.00 ? 90  GLN A HB2  3  
ATOM 5081  H HB3  . GLN A 1 90  ? -7.601  -6.123  -10.444 1.00 0.00 ? 90  GLN A HB3  3  
ATOM 5082  H HG2  . GLN A 1 90  ? -5.787  -4.158  -11.794 1.00 0.00 ? 90  GLN A HG2  3  
ATOM 5083  H HG3  . GLN A 1 90  ? -6.540  -5.487  -12.674 1.00 0.00 ? 90  GLN A HG3  3  
ATOM 5084  H HE21 . GLN A 1 90  ? -8.454  -5.114  -13.529 1.00 0.00 ? 90  GLN A HE21 3  
ATOM 5085  H HE22 . GLN A 1 90  ? -9.539  -3.846  -13.080 1.00 0.00 ? 90  GLN A HE22 3  
ATOM 5086  N N    . ASN A 1 91  ? -6.071  -6.481  -7.487  1.00 0.00 ? 91  ASN A N    3  
ATOM 5087  C CA   . ASN A 1 91  ? -6.492  -7.233  -6.311  1.00 0.00 ? 91  ASN A CA   3  
ATOM 5088  C C    . ASN A 1 91  ? -6.611  -6.319  -5.095  1.00 0.00 ? 91  ASN A C    3  
ATOM 5089  O O    . ASN A 1 91  ? -7.654  -6.266  -4.445  1.00 0.00 ? 91  ASN A O    3  
ATOM 5090  C CB   . ASN A 1 91  ? -5.502  -8.362  -6.019  1.00 0.00 ? 91  ASN A CB   3  
ATOM 5091  C CG   . ASN A 1 91  ? -5.866  -9.649  -6.733  1.00 0.00 ? 91  ASN A CG   3  
ATOM 5092  O OD1  . ASN A 1 91  ? -7.018  -10.081 -6.709  1.00 0.00 ? 91  ASN A OD1  3  
ATOM 5093  N ND2  . ASN A 1 91  ? -4.881  -10.269 -7.373  1.00 0.00 ? 91  ASN A ND2  3  
ATOM 5094  H H    . ASN A 1 91  ? -5.178  -6.638  -7.860  1.00 0.00 ? 91  ASN A H    3  
ATOM 5095  H HA   . ASN A 1 91  ? -7.461  -7.661  -6.521  1.00 0.00 ? 91  ASN A HA   3  
ATOM 5096  H HB2  . ASN A 1 91  ? -4.516  -8.060  -6.342  1.00 0.00 ? 91  ASN A HB2  3  
ATOM 5097  H HB3  . ASN A 1 91  ? -5.485  -8.553  -4.957  1.00 0.00 ? 91  ASN A HB3  3  
ATOM 5098  H HD21 . ASN A 1 91  ? -3.988  -9.867  -7.349  1.00 0.00 ? 91  ASN A HD21 3  
ATOM 5099  H HD22 . ASN A 1 91  ? -5.089  -11.103 -7.844  1.00 0.00 ? 91  ASN A HD22 3  
ATOM 5100  N N    . ALA A 1 92  ? -5.535  -5.599  -4.795  1.00 0.00 ? 92  ALA A N    3  
ATOM 5101  C CA   . ALA A 1 92  ? -5.519  -4.685  -3.660  1.00 0.00 ? 92  ALA A CA   3  
ATOM 5102  C C    . ALA A 1 92  ? -6.860  -3.976  -3.507  1.00 0.00 ? 92  ALA A C    3  
ATOM 5103  O O    . ALA A 1 92  ? -7.502  -4.061  -2.460  1.00 0.00 ? 92  ALA A O    3  
ATOM 5104  C CB   . ALA A 1 92  ? -4.397  -3.669  -3.816  1.00 0.00 ? 92  ALA A CB   3  
ATOM 5105  H H    . ALA A 1 92  ? -4.733  -5.685  -5.352  1.00 0.00 ? 92  ALA A H    3  
ATOM 5106  H HA   . ALA A 1 92  ? -5.325  -5.264  -2.768  1.00 0.00 ? 92  ALA A HA   3  
ATOM 5107  H HB1  . ALA A 1 92  ? -3.944  -3.483  -2.853  1.00 0.00 ? 92  ALA A HB1  3  
ATOM 5108  H HB2  . ALA A 1 92  ? -3.653  -4.056  -4.496  1.00 0.00 ? 92  ALA A HB2  3  
ATOM 5109  H HB3  . ALA A 1 92  ? -4.799  -2.747  -4.209  1.00 0.00 ? 92  ALA A HB3  3  
ATOM 5110  N N    . SER A 1 93  ? -7.277  -3.277  -4.557  1.00 0.00 ? 93  SER A N    3  
ATOM 5111  C CA   . SER A 1 93  ? -8.541  -2.549  -4.537  1.00 0.00 ? 93  SER A CA   3  
ATOM 5112  C C    . SER A 1 93  ? -9.684  -3.458  -4.097  1.00 0.00 ? 93  SER A C    3  
ATOM 5113  O O    . SER A 1 93  ? -10.545 -3.056  -3.314  1.00 0.00 ? 93  SER A O    3  
ATOM 5114  C CB   . SER A 1 93  ? -8.840  -1.967  -5.920  1.00 0.00 ? 93  SER A CB   3  
ATOM 5115  O OG   . SER A 1 93  ? -10.065 -1.254  -5.919  1.00 0.00 ? 93  SER A OG   3  
ATOM 5116  H H    . SER A 1 93  ? -6.721  -3.247  -5.363  1.00 0.00 ? 93  SER A H    3  
ATOM 5117  H HA   . SER A 1 93  ? -8.446  -1.740  -3.829  1.00 0.00 ? 93  SER A HA   3  
ATOM 5118  H HB2  . SER A 1 93  ? -8.046  -1.294  -6.205  1.00 0.00 ? 93  SER A HB2  3  
ATOM 5119  H HB3  . SER A 1 93  ? -8.906  -2.771  -6.639  1.00 0.00 ? 93  SER A HB3  3  
ATOM 5120  H HG   . SER A 1 93  ? -10.325 -1.063  -6.823  1.00 0.00 ? 93  SER A HG   3  
ATOM 5121  N N    . ALA A 1 94  ? -9.686  -4.685  -4.606  1.00 0.00 ? 94  ALA A N    3  
ATOM 5122  C CA   . ALA A 1 94  ? -10.722 -5.652  -4.265  1.00 0.00 ? 94  ALA A CA   3  
ATOM 5123  C C    . ALA A 1 94  ? -10.687 -5.992  -2.779  1.00 0.00 ? 94  ALA A C    3  
ATOM 5124  O O    . ALA A 1 94  ? -11.727 -6.052  -2.122  1.00 0.00 ? 94  ALA A O    3  
ATOM 5125  C CB   . ALA A 1 94  ? -10.562 -6.914  -5.100  1.00 0.00 ? 94  ALA A CB   3  
ATOM 5126  H H    . ALA A 1 94  ? -8.973  -4.947  -5.225  1.00 0.00 ? 94  ALA A H    3  
ATOM 5127  H HA   . ALA A 1 94  ? -11.680 -5.213  -4.501  1.00 0.00 ? 94  ALA A HA   3  
ATOM 5128  H HB1  . ALA A 1 94  ? -10.845 -6.706  -6.122  1.00 0.00 ? 94  ALA A HB1  3  
ATOM 5129  H HB2  . ALA A 1 94  ? -9.532  -7.237  -5.071  1.00 0.00 ? 94  ALA A HB2  3  
ATOM 5130  H HB3  . ALA A 1 94  ? -11.195 -7.692  -4.702  1.00 0.00 ? 94  ALA A HB3  3  
ATOM 5131  N N    . ILE A 1 95  ? -9.486  -6.215  -2.255  1.00 0.00 ? 95  ILE A N    3  
ATOM 5132  C CA   . ILE A 1 95  ? -9.317  -6.548  -0.846  1.00 0.00 ? 95  ILE A CA   3  
ATOM 5133  C C    . ILE A 1 95  ? -9.859  -5.439  0.050   1.00 0.00 ? 95  ILE A C    3  
ATOM 5134  O O    . ILE A 1 95  ? -10.524 -5.706  1.051   1.00 0.00 ? 95  ILE A O    3  
ATOM 5135  C CB   . ILE A 1 95  ? -7.837  -6.796  -0.500  1.00 0.00 ? 95  ILE A CB   3  
ATOM 5136  C CG1  . ILE A 1 95  ? -7.293  -7.978  -1.304  1.00 0.00 ? 95  ILE A CG1  3  
ATOM 5137  C CG2  . ILE A 1 95  ? -7.677  -7.044  0.992   1.00 0.00 ? 95  ILE A CG2  3  
ATOM 5138  C CD1  . ILE A 1 95  ? -5.803  -8.183  -1.145  1.00 0.00 ? 95  ILE A CD1  3  
ATOM 5139  H H    . ILE A 1 95  ? -8.695  -6.152  -2.830  1.00 0.00 ? 95  ILE A H    3  
ATOM 5140  H HA   . ILE A 1 95  ? -9.869  -7.456  -0.651  1.00 0.00 ? 95  ILE A HA   3  
ATOM 5141  H HB   . ILE A 1 95  ? -7.278  -5.909  -0.755  1.00 0.00 ? 95  ILE A HB   3  
ATOM 5142  H HG12 . ILE A 1 95  ? -7.788  -8.882  -0.983  1.00 0.00 ? 95  ILE A HG12 3  
ATOM 5143  H HG13 . ILE A 1 95  ? -7.496  -7.815  -2.353  1.00 0.00 ? 95  ILE A HG13 3  
ATOM 5144  H HG21 . ILE A 1 95  ? -6.932  -7.810  1.152   1.00 0.00 ? 95  ILE A HG21 3  
ATOM 5145  H HG22 . ILE A 1 95  ? -7.364  -6.132  1.477   1.00 0.00 ? 95  ILE A HG22 3  
ATOM 5146  H HG23 . ILE A 1 95  ? -8.620  -7.368  1.407   1.00 0.00 ? 95  ILE A HG23 3  
ATOM 5147  H HD11 . ILE A 1 95  ? -5.332  -7.240  -0.913  1.00 0.00 ? 95  ILE A HD11 3  
ATOM 5148  H HD12 . ILE A 1 95  ? -5.619  -8.885  -0.345  1.00 0.00 ? 95  ILE A HD12 3  
ATOM 5149  H HD13 . ILE A 1 95  ? -5.393  -8.572  -2.066  1.00 0.00 ? 95  ILE A HD13 3  
ATOM 5150  N N    . ILE A 1 96  ? -9.571  -4.195  -0.318  1.00 0.00 ? 96  ILE A N    3  
ATOM 5151  C CA   . ILE A 1 96  ? -10.032 -3.046  0.451   1.00 0.00 ? 96  ILE A CA   3  
ATOM 5152  C C    . ILE A 1 96  ? -11.553 -2.947  0.434   1.00 0.00 ? 96  ILE A C    3  
ATOM 5153  O O    . ILE A 1 96  ? -12.185 -2.727  1.467   1.00 0.00 ? 96  ILE A O    3  
ATOM 5154  C CB   . ILE A 1 96  ? -9.437  -1.732  -0.089  1.00 0.00 ? 96  ILE A CB   3  
ATOM 5155  C CG1  . ILE A 1 96  ? -7.935  -1.672  0.197   1.00 0.00 ? 96  ILE A CG1  3  
ATOM 5156  C CG2  . ILE A 1 96  ? -10.147 -0.537  0.528   1.00 0.00 ? 96  ILE A CG2  3  
ATOM 5157  C CD1  . ILE A 1 96  ? -7.199  -0.659  -0.652  1.00 0.00 ? 96  ILE A CD1  3  
ATOM 5158  H H    . ILE A 1 96  ? -9.036  -4.047  -1.125  1.00 0.00 ? 96  ILE A H    3  
ATOM 5159  H HA   . ILE A 1 96  ? -9.702  -3.175  1.472   1.00 0.00 ? 96  ILE A HA   3  
ATOM 5160  H HB   . ILE A 1 96  ? -9.595  -1.703  -1.156  1.00 0.00 ? 96  ILE A HB   3  
ATOM 5161  H HG12 . ILE A 1 96  ? -7.781  -1.411  1.232   1.00 0.00 ? 96  ILE A HG12 3  
ATOM 5162  H HG13 . ILE A 1 96  ? -7.501  -2.643  0.006   1.00 0.00 ? 96  ILE A HG13 3  
ATOM 5163  H HG21 . ILE A 1 96  ? -11.136 -0.447  0.104   1.00 0.00 ? 96  ILE A HG21 3  
ATOM 5164  H HG22 . ILE A 1 96  ? -10.226 -0.677  1.596   1.00 0.00 ? 96  ILE A HG22 3  
ATOM 5165  H HG23 . ILE A 1 96  ? -9.584  0.362   0.323   1.00 0.00 ? 96  ILE A HG23 3  
ATOM 5166  H HD11 . ILE A 1 96  ? -7.871  0.143   -0.920  1.00 0.00 ? 96  ILE A HD11 3  
ATOM 5167  H HD12 . ILE A 1 96  ? -6.365  -0.259  -0.094  1.00 0.00 ? 96  ILE A HD12 3  
ATOM 5168  H HD13 . ILE A 1 96  ? -6.835  -1.137  -1.550  1.00 0.00 ? 96  ILE A HD13 3  
ATOM 5169  N N    . LYS A 1 97  ? -12.138 -3.113  -0.748  1.00 0.00 ? 97  LYS A N    3  
ATOM 5170  C CA   . LYS A 1 97  ? -13.586 -3.046  -0.902  1.00 0.00 ? 97  LYS A CA   3  
ATOM 5171  C C    . LYS A 1 97  ? -14.281 -3.993  0.071   1.00 0.00 ? 97  LYS A C    3  
ATOM 5172  O O    . LYS A 1 97  ? -15.264 -3.626  0.716   1.00 0.00 ? 97  LYS A O    3  
ATOM 5173  C CB   . LYS A 1 97  ? -13.983 -3.393  -2.339  1.00 0.00 ? 97  LYS A CB   3  
ATOM 5174  C CG   . LYS A 1 97  ? -15.252 -2.699  -2.803  1.00 0.00 ? 97  LYS A CG   3  
ATOM 5175  C CD   . LYS A 1 97  ? -15.449 -2.842  -4.303  1.00 0.00 ? 97  LYS A CD   3  
ATOM 5176  C CE   . LYS A 1 97  ? -14.501 -1.938  -5.078  1.00 0.00 ? 97  LYS A CE   3  
ATOM 5177  N NZ   . LYS A 1 97  ? -14.695 -2.063  -6.549  1.00 0.00 ? 97  LYS A NZ   3  
ATOM 5178  H H    . LYS A 1 97  ? -11.581 -3.286  -1.536  1.00 0.00 ? 97  LYS A H    3  
ATOM 5179  H HA   . LYS A 1 97  ? -13.896 -2.035  -0.686  1.00 0.00 ? 97  LYS A HA   3  
ATOM 5180  H HB2  . LYS A 1 97  ? -13.179 -3.108  -3.001  1.00 0.00 ? 97  LYS A HB2  3  
ATOM 5181  H HB3  . LYS A 1 97  ? -14.135 -4.460  -2.410  1.00 0.00 ? 97  LYS A HB3  3  
ATOM 5182  H HG2  . LYS A 1 97  ? -16.098 -3.139  -2.297  1.00 0.00 ? 97  LYS A HG2  3  
ATOM 5183  H HG3  . LYS A 1 97  ? -15.188 -1.649  -2.556  1.00 0.00 ? 97  LYS A HG3  3  
ATOM 5184  H HD2  . LYS A 1 97  ? -15.262 -3.867  -4.586  1.00 0.00 ? 97  LYS A HD2  3  
ATOM 5185  H HD3  . LYS A 1 97  ? -16.467 -2.578  -4.551  1.00 0.00 ? 97  LYS A HD3  3  
ATOM 5186  H HE2  . LYS A 1 97  ? -14.681 -0.915  -4.785  1.00 0.00 ? 97  LYS A HE2  3  
ATOM 5187  H HE3  . LYS A 1 97  ? -13.485 -2.210  -4.832  1.00 0.00 ? 97  LYS A HE3  3  
ATOM 5188  H HZ1  . LYS A 1 97  ? -13.778 -1.994  -7.037  1.00 0.00 ? 97  LYS A HZ1  3  
ATOM 5189  H HZ2  . LYS A 1 97  ? -15.315 -1.303  -6.893  1.00 0.00 ? 97  LYS A HZ2  3  
ATOM 5190  H HZ3  . LYS A 1 97  ? -15.128 -2.980  -6.776  1.00 0.00 ? 97  LYS A HZ3  3  
ATOM 5191  N N    . THR A 1 98  ? -13.764 -5.213  0.174   1.00 0.00 ? 98  THR A N    3  
ATOM 5192  C CA   . THR A 1 98  ? -14.334 -6.212  1.069   1.00 0.00 ? 98  THR A CA   3  
ATOM 5193  C C    . THR A 1 98  ? -14.006 -5.898  2.524   1.00 0.00 ? 98  THR A C    3  
ATOM 5194  O O    . THR A 1 98  ? -14.741 -6.283  3.433   1.00 0.00 ? 98  THR A O    3  
ATOM 5195  C CB   . THR A 1 98  ? -13.823 -7.625  0.733   1.00 0.00 ? 98  THR A CB   3  
ATOM 5196  O OG1  . THR A 1 98  ? -12.408 -7.696  0.939   1.00 0.00 ? 98  THR A OG1  3  
ATOM 5197  C CG2  . THR A 1 98  ? -14.150 -7.990  -0.707  1.00 0.00 ? 98  THR A CG2  3  
ATOM 5198  H H    . THR A 1 98  ? -12.980 -5.446  -0.366  1.00 0.00 ? 98  THR A H    3  
ATOM 5199  H HA   . THR A 1 98  ? -15.407 -6.200  0.942   1.00 0.00 ? 98  THR A HA   3  
ATOM 5200  H HB   . THR A 1 98  ? -14.310 -8.333  1.388   1.00 0.00 ? 98  THR A HB   3  
ATOM 5201  H HG1  . THR A 1 98  ? -11.985 -6.941  0.522   1.00 0.00 ? 98  THR A HG1  3  
ATOM 5202  H HG21 . THR A 1 98  ? -14.210 -7.091  -1.302  1.00 0.00 ? 98  THR A HG21 3  
ATOM 5203  H HG22 . THR A 1 98  ? -15.096 -8.509  -0.741  1.00 0.00 ? 98  THR A HG22 3  
ATOM 5204  H HG23 . THR A 1 98  ? -13.374 -8.630  -1.101  1.00 0.00 ? 98  THR A HG23 3  
ATOM 5205  N N    . ALA A 1 99  ? -12.898 -5.196  2.738   1.00 0.00 ? 99  ALA A N    3  
ATOM 5206  C CA   . ALA A 1 99  ? -12.474 -4.828  4.083   1.00 0.00 ? 99  ALA A CA   3  
ATOM 5207  C C    . ALA A 1 99  ? -13.443 -3.833  4.711   1.00 0.00 ? 99  ALA A C    3  
ATOM 5208  O O    . ALA A 1 99  ? -14.127 -3.076  4.022   1.00 0.00 ? 99  ALA A O    3  
ATOM 5209  C CB   . ALA A 1 99  ? -11.066 -4.251  4.054   1.00 0.00 ? 99  ALA A CB   3  
ATOM 5210  H H    . ALA A 1 99  ? -12.353 -4.918  1.972   1.00 0.00 ? 99  ALA A H    3  
ATOM 5211  H HA   . ALA A 1 99  ? -12.456 -5.726  4.685   1.00 0.00 ? 99  ALA A HA   3  
ATOM 5212  H HB1  . ALA A 1 99  ? -10.971 -3.582  3.211   1.00 0.00 ? 99  ALA A HB1  3  
ATOM 5213  H HB2  . ALA A 1 99  ? -10.881 -3.708  4.968   1.00 0.00 ? 99  ALA A HB2  3  
ATOM 5214  H HB3  . ALA A 1 99  ? -10.350 -5.053  3.959   1.00 0.00 ? 99  ALA A HB3  3  
ATOM 5215  N N    . PRO A 1 100 ? -13.506 -3.831  6.051   1.00 0.00 ? 100 PRO A N    3  
ATOM 5216  C CA   . PRO A 1 100 ? -14.389 -2.933  6.801   1.00 0.00 ? 100 PRO A CA   3  
ATOM 5217  C C    . PRO A 1 100 ? -13.938 -1.479  6.723   1.00 0.00 ? 100 PRO A C    3  
ATOM 5218  O O    . PRO A 1 100 ? -12.855 -1.180  6.219   1.00 0.00 ? 100 PRO A O    3  
ATOM 5219  C CB   . PRO A 1 100 ? -14.282 -3.450  8.238   1.00 0.00 ? 100 PRO A CB   3  
ATOM 5220  C CG   . PRO A 1 100 ? -12.953 -4.120  8.302   1.00 0.00 ? 100 PRO A CG   3  
ATOM 5221  C CD   . PRO A 1 100 ? -12.719 -4.706  6.937   1.00 0.00 ? 100 PRO A CD   3  
ATOM 5222  H HA   . PRO A 1 100 ? -15.412 -3.010  6.464   1.00 0.00 ? 100 PRO A HA   3  
ATOM 5223  H HB2  . PRO A 1 100 ? -14.339 -2.619  8.927   1.00 0.00 ? 100 PRO A HB2  3  
ATOM 5224  H HB3  . PRO A 1 100 ? -15.084 -4.144  8.436   1.00 0.00 ? 100 PRO A HB3  3  
ATOM 5225  H HG2  . PRO A 1 100 ? -12.187 -3.397  8.536   1.00 0.00 ? 100 PRO A HG2  3  
ATOM 5226  H HG3  . PRO A 1 100 ? -12.973 -4.903  9.046   1.00 0.00 ? 100 PRO A HG3  3  
ATOM 5227  H HD2  . PRO A 1 100 ? -11.670 -4.667  6.684   1.00 0.00 ? 100 PRO A HD2  3  
ATOM 5228  H HD3  . PRO A 1 100 ? -13.082 -5.722  6.895   1.00 0.00 ? 100 PRO A HD3  3  
ATOM 5229  N N    . SER A 1 101 ? -14.775 -0.577  7.226   1.00 0.00 ? 101 SER A N    3  
ATOM 5230  C CA   . SER A 1 101 ? -14.464 0.848   7.210   1.00 0.00 ? 101 SER A CA   3  
ATOM 5231  C C    . SER A 1 101 ? -12.995 1.087   7.545   1.00 0.00 ? 101 SER A C    3  
ATOM 5232  O O    . SER A 1 101 ? -12.248 1.656   6.749   1.00 0.00 ? 101 SER A O    3  
ATOM 5233  C CB   . SER A 1 101 ? -15.354 1.597   8.203   1.00 0.00 ? 101 SER A CB   3  
ATOM 5234  O OG   . SER A 1 101 ? -16.556 2.026   7.587   1.00 0.00 ? 101 SER A OG   3  
ATOM 5235  H H    . SER A 1 101 ? -15.624 -0.877  7.614   1.00 0.00 ? 101 SER A H    3  
ATOM 5236  H HA   . SER A 1 101 ? -14.658 1.218   6.214   1.00 0.00 ? 101 SER A HA   3  
ATOM 5237  H HB2  . SER A 1 101 ? -15.599 0.944   9.027   1.00 0.00 ? 101 SER A HB2  3  
ATOM 5238  H HB3  . SER A 1 101 ? -14.825 2.463   8.574   1.00 0.00 ? 101 SER A HB3  3  
ATOM 5239  H HG   . SER A 1 101 ? -17.058 2.564   8.204   1.00 0.00 ? 101 SER A HG   3  
ATOM 5240  N N    . LYS A 1 102 ? -12.586 0.647   8.730   1.00 0.00 ? 102 LYS A N    3  
ATOM 5241  C CA   . LYS A 1 102 ? -11.207 0.810   9.174   1.00 0.00 ? 102 LYS A CA   3  
ATOM 5242  C C    . LYS A 1 102 ? -10.314 -0.277  8.585   1.00 0.00 ? 102 LYS A C    3  
ATOM 5243  O O    . LYS A 1 102 ? -10.456 -1.455  8.911   1.00 0.00 ? 102 LYS A O    3  
ATOM 5244  C CB   . LYS A 1 102 ? -11.133 0.774   10.702  1.00 0.00 ? 102 LYS A CB   3  
ATOM 5245  C CG   . LYS A 1 102 ? -9.799  1.240   11.258  1.00 0.00 ? 102 LYS A CG   3  
ATOM 5246  C CD   . LYS A 1 102 ? -9.950  1.834   12.648  1.00 0.00 ? 102 LYS A CD   3  
ATOM 5247  C CE   . LYS A 1 102 ? -10.380 3.292   12.586  1.00 0.00 ? 102 LYS A CE   3  
ATOM 5248  N NZ   . LYS A 1 102 ? -11.072 3.719   13.834  1.00 0.00 ? 102 LYS A NZ   3  
ATOM 5249  H H    . LYS A 1 102 ? -13.229 0.200   9.322   1.00 0.00 ? 102 LYS A H    3  
ATOM 5250  H HA   . LYS A 1 102 ? -10.859 1.772   8.828   1.00 0.00 ? 102 LYS A HA   3  
ATOM 5251  H HB2  . LYS A 1 102 ? -11.908 1.410   11.103  1.00 0.00 ? 102 LYS A HB2  3  
ATOM 5252  H HB3  . LYS A 1 102 ? -11.303 -0.240  11.034  1.00 0.00 ? 102 LYS A HB3  3  
ATOM 5253  H HG2  . LYS A 1 102 ? -9.126  0.396   11.310  1.00 0.00 ? 102 LYS A HG2  3  
ATOM 5254  H HG3  . LYS A 1 102 ? -9.387  1.990   10.598  1.00 0.00 ? 102 LYS A HG3  3  
ATOM 5255  H HD2  . LYS A 1 102 ? -10.697 1.274   13.191  1.00 0.00 ? 102 LYS A HD2  3  
ATOM 5256  H HD3  . LYS A 1 102 ? -9.003  1.769   13.163  1.00 0.00 ? 102 LYS A HD3  3  
ATOM 5257  H HE2  . LYS A 1 102 ? -9.505  3.906   12.442  1.00 0.00 ? 102 LYS A HE2  3  
ATOM 5258  H HE3  . LYS A 1 102 ? -11.052 3.421   11.751  1.00 0.00 ? 102 LYS A HE3  3  
ATOM 5259  H HZ1  . LYS A 1 102 ? -11.741 4.488   13.626  1.00 0.00 ? 102 LYS A HZ1  3  
ATOM 5260  H HZ2  . LYS A 1 102 ? -10.377 4.059   14.529  1.00 0.00 ? 102 LYS A HZ2  3  
ATOM 5261  H HZ3  . LYS A 1 102 ? -11.595 2.920   14.245  1.00 0.00 ? 102 LYS A HZ3  3  
ATOM 5262  N N    . VAL A 1 103 ? -9.392  0.127   7.716   1.00 0.00 ? 103 VAL A N    3  
ATOM 5263  C CA   . VAL A 1 103 ? -8.474  -0.813  7.084   1.00 0.00 ? 103 VAL A CA   3  
ATOM 5264  C C    . VAL A 1 103 ? -7.023  -0.438  7.366   1.00 0.00 ? 103 VAL A C    3  
ATOM 5265  O O    . VAL A 1 103 ? -6.692  0.738   7.517   1.00 0.00 ? 103 VAL A O    3  
ATOM 5266  C CB   . VAL A 1 103 ? -8.690  -0.870  5.560   1.00 0.00 ? 103 VAL A CB   3  
ATOM 5267  C CG1  . VAL A 1 103 ? -7.814  -1.945  4.936   1.00 0.00 ? 103 VAL A CG1  3  
ATOM 5268  C CG2  . VAL A 1 103 ? -10.157 -1.114  5.240   1.00 0.00 ? 103 VAL A CG2  3  
ATOM 5269  H H    . VAL A 1 103 ? -9.328  1.080   7.496   1.00 0.00 ? 103 VAL A H    3  
ATOM 5270  H HA   . VAL A 1 103 ? -8.668  -1.794  7.491   1.00 0.00 ? 103 VAL A HA   3  
ATOM 5271  H HB   . VAL A 1 103 ? -8.406  0.084   5.141   1.00 0.00 ? 103 VAL A HB   3  
ATOM 5272  H HG11 . VAL A 1 103 ? -6.775  -1.675  5.053   1.00 0.00 ? 103 VAL A HG11 3  
ATOM 5273  H HG12 . VAL A 1 103 ? -7.999  -2.890  5.426   1.00 0.00 ? 103 VAL A HG12 3  
ATOM 5274  H HG13 . VAL A 1 103 ? -8.046  -2.032  3.885   1.00 0.00 ? 103 VAL A HG13 3  
ATOM 5275  H HG21 . VAL A 1 103 ? -10.236 -1.661  4.312   1.00 0.00 ? 103 VAL A HG21 3  
ATOM 5276  H HG22 . VAL A 1 103 ? -10.610 -1.688  6.035   1.00 0.00 ? 103 VAL A HG22 3  
ATOM 5277  H HG23 . VAL A 1 103 ? -10.668 -0.167  5.145   1.00 0.00 ? 103 VAL A HG23 3  
ATOM 5278  N N    . LYS A 1 104 ? -6.161  -1.446  7.437   1.00 0.00 ? 104 LYS A N    3  
ATOM 5279  C CA   . LYS A 1 104 ? -4.744  -1.224  7.700   1.00 0.00 ? 104 LYS A CA   3  
ATOM 5280  C C    . LYS A 1 104 ? -3.926  -1.357  6.419   1.00 0.00 ? 104 LYS A C    3  
ATOM 5281  O O    . LYS A 1 104 ? -4.068  -2.330  5.677   1.00 0.00 ? 104 LYS A O    3  
ATOM 5282  C CB   . LYS A 1 104 ? -4.236  -2.218  8.747   1.00 0.00 ? 104 LYS A CB   3  
ATOM 5283  C CG   . LYS A 1 104 ? -2.799  -1.972  9.173   1.00 0.00 ? 104 LYS A CG   3  
ATOM 5284  C CD   . LYS A 1 104 ? -2.405  -2.858  10.343  1.00 0.00 ? 104 LYS A CD   3  
ATOM 5285  C CE   . LYS A 1 104 ? -0.907  -2.807  10.600  1.00 0.00 ? 104 LYS A CE   3  
ATOM 5286  N NZ   . LYS A 1 104 ? -0.479  -3.837  11.587  1.00 0.00 ? 104 LYS A NZ   3  
ATOM 5287  H H    . LYS A 1 104 ? -6.485  -2.362  7.308   1.00 0.00 ? 104 LYS A H    3  
ATOM 5288  H HA   . LYS A 1 104 ? -4.630  -0.221  8.083   1.00 0.00 ? 104 LYS A HA   3  
ATOM 5289  H HB2  . LYS A 1 104 ? -4.866  -2.154  9.622   1.00 0.00 ? 104 LYS A HB2  3  
ATOM 5290  H HB3  . LYS A 1 104 ? -4.302  -3.217  8.339   1.00 0.00 ? 104 LYS A HB3  3  
ATOM 5291  H HG2  . LYS A 1 104 ? -2.145  -2.182  8.340   1.00 0.00 ? 104 LYS A HG2  3  
ATOM 5292  H HG3  . LYS A 1 104 ? -2.693  -0.937  9.465   1.00 0.00 ? 104 LYS A HG3  3  
ATOM 5293  H HD2  . LYS A 1 104 ? -2.923  -2.521  11.229  1.00 0.00 ? 104 LYS A HD2  3  
ATOM 5294  H HD3  . LYS A 1 104 ? -2.690  -3.877  10.124  1.00 0.00 ? 104 LYS A HD3  3  
ATOM 5295  H HE2  . LYS A 1 104 ? -0.389  -2.976  9.669   1.00 0.00 ? 104 LYS A HE2  3  
ATOM 5296  H HE3  . LYS A 1 104 ? -0.653  -1.829  10.981  1.00 0.00 ? 104 LYS A HE3  3  
ATOM 5297  H HZ1  . LYS A 1 104 ? 0.168   -3.417  12.284  1.00 0.00 ? 104 LYS A HZ1  3  
ATOM 5298  H HZ2  . LYS A 1 104 ? 0.011   -4.615  11.101  1.00 0.00 ? 104 LYS A HZ2  3  
ATOM 5299  H HZ3  . LYS A 1 104 ? -1.307  -4.221  12.086  1.00 0.00 ? 104 LYS A HZ3  3  
ATOM 5300  N N    . LEU A 1 105 ? -3.069  -0.374  6.165   1.00 0.00 ? 105 LEU A N    3  
ATOM 5301  C CA   . LEU A 1 105 ? -2.226  -0.381  4.974   1.00 0.00 ? 105 LEU A CA   3  
ATOM 5302  C C    . LEU A 1 105 ? -0.749  -0.351  5.352   1.00 0.00 ? 105 LEU A C    3  
ATOM 5303  O O    . LEU A 1 105 ? -0.283  0.583   6.005   1.00 0.00 ? 105 LEU A O    3  
ATOM 5304  C CB   . LEU A 1 105 ? -2.560  0.815   4.082   1.00 0.00 ? 105 LEU A CB   3  
ATOM 5305  C CG   . LEU A 1 105 ? -4.026  0.957   3.670   1.00 0.00 ? 105 LEU A CG   3  
ATOM 5306  C CD1  . LEU A 1 105 ? -4.355  2.409   3.360   1.00 0.00 ? 105 LEU A CD1  3  
ATOM 5307  C CD2  . LEU A 1 105 ? -4.332  0.071   2.471   1.00 0.00 ? 105 LEU A CD2  3  
ATOM 5308  H H    . LEU A 1 105 ? -3.000  0.375   6.793   1.00 0.00 ? 105 LEU A H    3  
ATOM 5309  H HA   . LEU A 1 105 ? -2.428  -1.293  4.432   1.00 0.00 ? 105 LEU A HA   3  
ATOM 5310  H HB2  . LEU A 1 105 ? -2.278  1.712   4.611   1.00 0.00 ? 105 LEU A HB2  3  
ATOM 5311  H HB3  . LEU A 1 105 ? -1.969  0.730   3.181   1.00 0.00 ? 105 LEU A HB3  3  
ATOM 5312  H HG   . LEU A 1 105 ? -4.656  0.640   4.490   1.00 0.00 ? 105 LEU A HG   3  
ATOM 5313  H HD11 . LEU A 1 105 ? -3.690  2.773   2.593   1.00 0.00 ? 105 LEU A HD11 3  
ATOM 5314  H HD12 . LEU A 1 105 ? -4.235  3.004   4.254   1.00 0.00 ? 105 LEU A HD12 3  
ATOM 5315  H HD13 . LEU A 1 105 ? -5.377  2.481   3.016   1.00 0.00 ? 105 LEU A HD13 3  
ATOM 5316  H HD21 . LEU A 1 105 ? -4.658  -0.899  2.815   1.00 0.00 ? 105 LEU A HD21 3  
ATOM 5317  H HD22 . LEU A 1 105 ? -3.440  -0.041  1.870   1.00 0.00 ? 105 LEU A HD22 3  
ATOM 5318  H HD23 . LEU A 1 105 ? -5.112  0.525   1.878   1.00 0.00 ? 105 LEU A HD23 3  
ATOM 5319  N N    . VAL A 1 106 ? -0.016  -1.379  4.936   1.00 0.00 ? 106 VAL A N    3  
ATOM 5320  C CA   . VAL A 1 106 ? 1.410   -1.469  5.228   1.00 0.00 ? 106 VAL A CA   3  
ATOM 5321  C C    . VAL A 1 106 ? 2.241   -1.325  3.958   1.00 0.00 ? 106 VAL A C    3  
ATOM 5322  O O    . VAL A 1 106 ? 2.358   -2.264  3.170   1.00 0.00 ? 106 VAL A O    3  
ATOM 5323  C CB   . VAL A 1 106 ? 1.760   -2.806  5.908   1.00 0.00 ? 106 VAL A CB   3  
ATOM 5324  C CG1  . VAL A 1 106 ? 3.256   -2.898  6.165   1.00 0.00 ? 106 VAL A CG1  3  
ATOM 5325  C CG2  . VAL A 1 106 ? 0.977   -2.965  7.203   1.00 0.00 ? 106 VAL A CG2  3  
ATOM 5326  H H    . VAL A 1 106 ? -0.444  -2.093  4.419   1.00 0.00 ? 106 VAL A H    3  
ATOM 5327  H HA   . VAL A 1 106 ? 1.663   -0.667  5.905   1.00 0.00 ? 106 VAL A HA   3  
ATOM 5328  H HB   . VAL A 1 106 ? 1.481   -3.609  5.243   1.00 0.00 ? 106 VAL A HB   3  
ATOM 5329  H HG11 . VAL A 1 106 ? 3.449   -2.765  7.220   1.00 0.00 ? 106 VAL A HG11 3  
ATOM 5330  H HG12 . VAL A 1 106 ? 3.616   -3.867  5.852   1.00 0.00 ? 106 VAL A HG12 3  
ATOM 5331  H HG13 . VAL A 1 106 ? 3.766   -2.127  5.607   1.00 0.00 ? 106 VAL A HG13 3  
ATOM 5332  H HG21 . VAL A 1 106 ? -0.024  -3.301  6.979   1.00 0.00 ? 106 VAL A HG21 3  
ATOM 5333  H HG22 . VAL A 1 106 ? 1.468   -3.692  7.834   1.00 0.00 ? 106 VAL A HG22 3  
ATOM 5334  H HG23 . VAL A 1 106 ? 0.933   -2.016  7.716   1.00 0.00 ? 106 VAL A HG23 3  
ATOM 5335  N N    . PHE A 1 107 ? 2.817   -0.143  3.765   1.00 0.00 ? 107 PHE A N    3  
ATOM 5336  C CA   . PHE A 1 107 ? 3.638   0.125   2.590   1.00 0.00 ? 107 PHE A CA   3  
ATOM 5337  C C    . PHE A 1 107 ? 4.988   0.711   2.992   1.00 0.00 ? 107 PHE A C    3  
ATOM 5338  O O    . PHE A 1 107 ? 5.219   1.020   4.161   1.00 0.00 ? 107 PHE A O    3  
ATOM 5339  C CB   . PHE A 1 107 ? 2.913   1.084   1.644   1.00 0.00 ? 107 PHE A CB   3  
ATOM 5340  C CG   . PHE A 1 107 ? 2.715   2.458   2.219   1.00 0.00 ? 107 PHE A CG   3  
ATOM 5341  C CD1  . PHE A 1 107 ? 3.745   3.384   2.204   1.00 0.00 ? 107 PHE A CD1  3  
ATOM 5342  C CD2  . PHE A 1 107 ? 1.499   2.822   2.773   1.00 0.00 ? 107 PHE A CD2  3  
ATOM 5343  C CE1  . PHE A 1 107 ? 3.566   4.648   2.734   1.00 0.00 ? 107 PHE A CE1  3  
ATOM 5344  C CE2  . PHE A 1 107 ? 1.313   4.085   3.304   1.00 0.00 ? 107 PHE A CE2  3  
ATOM 5345  C CZ   . PHE A 1 107 ? 2.348   5.000   3.283   1.00 0.00 ? 107 PHE A CZ   3  
ATOM 5346  H H    . PHE A 1 107 ? 2.687   0.566   4.429   1.00 0.00 ? 107 PHE A H    3  
ATOM 5347  H HA   . PHE A 1 107 ? 3.803   -0.813  2.081   1.00 0.00 ? 107 PHE A HA   3  
ATOM 5348  H HB2  . PHE A 1 107 ? 3.488   1.185   0.735   1.00 0.00 ? 107 PHE A HB2  3  
ATOM 5349  H HB3  . PHE A 1 107 ? 1.941   0.679   1.406   1.00 0.00 ? 107 PHE A HB3  3  
ATOM 5350  H HD1  . PHE A 1 107 ? 4.698   3.112   1.774   1.00 0.00 ? 107 PHE A HD1  3  
ATOM 5351  H HD2  . PHE A 1 107 ? 0.688   2.107   2.789   1.00 0.00 ? 107 PHE A HD2  3  
ATOM 5352  H HE1  . PHE A 1 107 ? 4.376   5.362   2.716   1.00 0.00 ? 107 PHE A HE1  3  
ATOM 5353  H HE2  . PHE A 1 107 ? 0.360   4.356   3.732   1.00 0.00 ? 107 PHE A HE2  3  
ATOM 5354  H HZ   . PHE A 1 107 ? 2.205   5.986   3.697   1.00 0.00 ? 107 PHE A HZ   3  
ATOM 5355  N N    . ILE A 1 108 ? 5.876   0.861   2.014   1.00 0.00 ? 108 ILE A N    3  
ATOM 5356  C CA   . ILE A 1 108 ? 7.202   1.411   2.265   1.00 0.00 ? 108 ILE A CA   3  
ATOM 5357  C C    . ILE A 1 108 ? 7.437   2.675   1.446   1.00 0.00 ? 108 ILE A C    3  
ATOM 5358  O O    . ILE A 1 108 ? 7.133   2.720   0.254   1.00 0.00 ? 108 ILE A O    3  
ATOM 5359  C CB   . ILE A 1 108 ? 8.306   0.388   1.939   1.00 0.00 ? 108 ILE A CB   3  
ATOM 5360  C CG1  . ILE A 1 108 ? 9.680   0.954   2.303   1.00 0.00 ? 108 ILE A CG1  3  
ATOM 5361  C CG2  . ILE A 1 108 ? 8.257   0.008   0.466   1.00 0.00 ? 108 ILE A CG2  3  
ATOM 5362  C CD1  . ILE A 1 108 ? 10.702  -0.109  2.640   1.00 0.00 ? 108 ILE A CD1  3  
ATOM 5363  H H    . ILE A 1 108 ? 5.632   0.597   1.103   1.00 0.00 ? 108 ILE A H    3  
ATOM 5364  H HA   . ILE A 1 108 ? 7.267   1.658   3.315   1.00 0.00 ? 108 ILE A HA   3  
ATOM 5365  H HB   . ILE A 1 108 ? 8.125   -0.502  2.522   1.00 0.00 ? 108 ILE A HB   3  
ATOM 5366  H HG12 . ILE A 1 108 ? 10.059  1.526   1.471   1.00 0.00 ? 108 ILE A HG12 3  
ATOM 5367  H HG13 . ILE A 1 108 ? 9.578   1.601   3.163   1.00 0.00 ? 108 ILE A HG13 3  
ATOM 5368  H HG21 . ILE A 1 108 ? 8.074   -1.052  0.374   1.00 0.00 ? 108 ILE A HG21 3  
ATOM 5369  H HG22 . ILE A 1 108 ? 7.462   0.553   -0.019  1.00 0.00 ? 108 ILE A HG22 3  
ATOM 5370  H HG23 . ILE A 1 108 ? 9.200   0.253   0.000   1.00 0.00 ? 108 ILE A HG23 3  
ATOM 5371  H HD11 . ILE A 1 108 ? 10.703  -0.283  3.706   1.00 0.00 ? 108 ILE A HD11 3  
ATOM 5372  H HD12 . ILE A 1 108 ? 10.453  -1.024  2.125   1.00 0.00 ? 108 ILE A HD12 3  
ATOM 5373  H HD13 . ILE A 1 108 ? 11.682  0.223   2.329   1.00 0.00 ? 108 ILE A HD13 3  
ATOM 5374  N N    . ARG A 1 109 ? 7.983   3.700   2.093   1.00 0.00 ? 109 ARG A N    3  
ATOM 5375  C CA   . ARG A 1 109 ? 8.260   4.965   1.424   1.00 0.00 ? 109 ARG A CA   3  
ATOM 5376  C C    . ARG A 1 109 ? 9.685   4.992   0.881   1.00 0.00 ? 109 ARG A C    3  
ATOM 5377  O O    . ARG A 1 109 ? 10.594  5.521   1.520   1.00 0.00 ? 109 ARG A O    3  
ATOM 5378  C CB   . ARG A 1 109 ? 8.048   6.134   2.389   1.00 0.00 ? 109 ARG A CB   3  
ATOM 5379  C CG   . ARG A 1 109 ? 8.356   7.491   1.778   1.00 0.00 ? 109 ARG A CG   3  
ATOM 5380  C CD   . ARG A 1 109 ? 7.126   8.100   1.124   1.00 0.00 ? 109 ARG A CD   3  
ATOM 5381  N NE   . ARG A 1 109 ? 6.298   8.825   2.084   1.00 0.00 ? 109 ARG A NE   3  
ATOM 5382  C CZ   . ARG A 1 109 ? 6.708   9.905   2.740   1.00 0.00 ? 109 ARG A CZ   3  
ATOM 5383  N NH1  . ARG A 1 109 ? 7.929   10.382  2.541   1.00 0.00 ? 109 ARG A NH1  3  
ATOM 5384  N NH2  . ARG A 1 109 ? 5.896   10.510  3.597   1.00 0.00 ? 109 ARG A NH2  3  
ATOM 5385  H H    . ARG A 1 109 ? 8.203   3.603   3.043   1.00 0.00 ? 109 ARG A H    3  
ATOM 5386  H HA   . ARG A 1 109 ? 7.571   5.063   0.599   1.00 0.00 ? 109 ARG A HA   3  
ATOM 5387  H HB2  . ARG A 1 109 ? 7.018   6.135   2.713   1.00 0.00 ? 109 ARG A HB2  3  
ATOM 5388  H HB3  . ARG A 1 109 ? 8.687   5.996   3.248   1.00 0.00 ? 109 ARG A HB3  3  
ATOM 5389  H HG2  . ARG A 1 109 ? 8.702   8.155   2.557   1.00 0.00 ? 109 ARG A HG2  3  
ATOM 5390  H HG3  . ARG A 1 109 ? 9.129   7.373   1.034   1.00 0.00 ? 109 ARG A HG3  3  
ATOM 5391  H HD2  . ARG A 1 109 ? 7.447   8.783   0.351   1.00 0.00 ? 109 ARG A HD2  3  
ATOM 5392  H HD3  . ARG A 1 109 ? 6.540   7.308   0.683   1.00 0.00 ? 109 ARG A HD3  3  
ATOM 5393  H HE   . ARG A 1 109 ? 5.392   8.490   2.246   1.00 0.00 ? 109 ARG A HE   3  
ATOM 5394  H HH11 . ARG A 1 109 ? 8.543   9.929   1.894   1.00 0.00 ? 109 ARG A HH11 3  
ATOM 5395  H HH12 . ARG A 1 109 ? 8.235   11.196  3.035   1.00 0.00 ? 109 ARG A HH12 3  
ATOM 5396  H HH21 . ARG A 1 109 ? 4.975   10.153  3.750   1.00 0.00 ? 109 ARG A HH21 3  
ATOM 5397  H HH22 . ARG A 1 109 ? 6.206   11.322  4.091   1.00 0.00 ? 109 ARG A HH22 3  
ATOM 5398  N N    . ASN A 1 110 ? 9.873   4.418   -0.303  1.00 0.00 ? 110 ASN A N    3  
ATOM 5399  C CA   . ASN A 1 110 ? 11.188  4.375   -0.932  1.00 0.00 ? 110 ASN A CA   3  
ATOM 5400  C C    . ASN A 1 110 ? 11.299  5.427   -2.032  1.00 0.00 ? 110 ASN A C    3  
ATOM 5401  O O    . ASN A 1 110 ? 10.616  5.346   -3.052  1.00 0.00 ? 110 ASN A O    3  
ATOM 5402  C CB   . ASN A 1 110 ? 11.454  2.985   -1.512  1.00 0.00 ? 110 ASN A CB   3  
ATOM 5403  C CG   . ASN A 1 110 ? 12.772  2.912   -2.258  1.00 0.00 ? 110 ASN A CG   3  
ATOM 5404  O OD1  . ASN A 1 110 ? 13.540  3.874   -2.280  1.00 0.00 ? 110 ASN A OD1  3  
ATOM 5405  N ND2  . ASN A 1 110 ? 13.041  1.766   -2.874  1.00 0.00 ? 110 ASN A ND2  3  
ATOM 5406  H H    . ASN A 1 110 ? 9.109   4.013   -0.765  1.00 0.00 ? 110 ASN A H    3  
ATOM 5407  H HA   . ASN A 1 110 ? 11.925  4.586   -0.173  1.00 0.00 ? 110 ASN A HA   3  
ATOM 5408  H HB2  . ASN A 1 110 ? 11.478  2.264   -0.707  1.00 0.00 ? 110 ASN A HB2  3  
ATOM 5409  H HB3  . ASN A 1 110 ? 10.659  2.727   -2.195  1.00 0.00 ? 110 ASN A HB3  3  
ATOM 5410  H HD21 . ASN A 1 110 ? 12.383  1.042   -2.813  1.00 0.00 ? 110 ASN A HD21 3  
ATOM 5411  H HD22 . ASN A 1 110 ? 13.887  1.691   -3.363  1.00 0.00 ? 110 ASN A HD22 3  
ATOM 5412  N N    . GLU A 1 111 ? 12.165  6.412   -1.816  1.00 0.00 ? 111 GLU A N    3  
ATOM 5413  C CA   . GLU A 1 111 ? 12.366  7.479   -2.789  1.00 0.00 ? 111 GLU A CA   3  
ATOM 5414  C C    . GLU A 1 111 ? 12.668  6.906   -4.171  1.00 0.00 ? 111 GLU A C    3  
ATOM 5415  O O    . GLU A 1 111 ? 12.286  7.480   -5.190  1.00 0.00 ? 111 GLU A O    3  
ATOM 5416  C CB   . GLU A 1 111 ? 13.506  8.397   -2.345  1.00 0.00 ? 111 GLU A CB   3  
ATOM 5417  C CG   . GLU A 1 111 ? 14.887  7.805   -2.571  1.00 0.00 ? 111 GLU A CG   3  
ATOM 5418  C CD   . GLU A 1 111 ? 15.974  8.560   -1.829  1.00 0.00 ? 111 GLU A CD   3  
ATOM 5419  O OE1  . GLU A 1 111 ? 15.667  9.166   -0.782  1.00 0.00 ? 111 GLU A OE1  3  
ATOM 5420  O OE2  . GLU A 1 111 ? 17.131  8.543   -2.297  1.00 0.00 ? 111 GLU A OE2  3  
ATOM 5421  H H    . GLU A 1 111 ? 12.681  6.422   -0.983  1.00 0.00 ? 111 GLU A H    3  
ATOM 5422  H HA   . GLU A 1 111 ? 11.454  8.054   -2.843  1.00 0.00 ? 111 GLU A HA   3  
ATOM 5423  H HB2  . GLU A 1 111 ? 13.440  9.325   -2.895  1.00 0.00 ? 111 GLU A HB2  3  
ATOM 5424  H HB3  . GLU A 1 111 ? 13.395  8.605   -1.291  1.00 0.00 ? 111 GLU A HB3  3  
ATOM 5425  H HG2  . GLU A 1 111 ? 14.886  6.780   -2.230  1.00 0.00 ? 111 GLU A HG2  3  
ATOM 5426  H HG3  . GLU A 1 111 ? 15.108  7.831   -3.628  1.00 0.00 ? 111 GLU A HG3  3  
ATOM 5427  N N    . ASP A 1 112 ? 13.357  5.770   -4.196  1.00 0.00 ? 112 ASP A N    3  
ATOM 5428  C CA   . ASP A 1 112 ? 13.711  5.118   -5.451  1.00 0.00 ? 112 ASP A CA   3  
ATOM 5429  C C    . ASP A 1 112 ? 12.472  4.554   -6.138  1.00 0.00 ? 112 ASP A C    3  
ATOM 5430  O O    . ASP A 1 112 ? 12.439  4.410   -7.360  1.00 0.00 ? 112 ASP A O    3  
ATOM 5431  C CB   . ASP A 1 112 ? 14.724  4.000   -5.201  1.00 0.00 ? 112 ASP A CB   3  
ATOM 5432  C CG   . ASP A 1 112 ? 16.141  4.522   -5.067  1.00 0.00 ? 112 ASP A CG   3  
ATOM 5433  O OD1  . ASP A 1 112 ? 16.355  5.462   -4.272  1.00 0.00 ? 112 ASP A OD1  3  
ATOM 5434  O OD2  . ASP A 1 112 ? 17.037  3.992   -5.756  1.00 0.00 ? 112 ASP A OD2  3  
ATOM 5435  H H    . ASP A 1 112 ? 13.633  5.360   -3.349  1.00 0.00 ? 112 ASP A H    3  
ATOM 5436  H HA   . ASP A 1 112 ? 14.158  5.859   -6.095  1.00 0.00 ? 112 ASP A HA   3  
ATOM 5437  H HB2  . ASP A 1 112 ? 14.463  3.483   -4.289  1.00 0.00 ? 112 ASP A HB2  3  
ATOM 5438  H HB3  . ASP A 1 112 ? 14.693  3.304   -6.026  1.00 0.00 ? 112 ASP A HB3  3  
ATOM 5439  N N    . ALA A 1 113 ? 11.454  4.235   -5.345  1.00 0.00 ? 113 ALA A N    3  
ATOM 5440  C CA   . ALA A 1 113 ? 10.213  3.687   -5.877  1.00 0.00 ? 113 ALA A CA   3  
ATOM 5441  C C    . ALA A 1 113 ? 9.690   4.534   -7.033  1.00 0.00 ? 113 ALA A C    3  
ATOM 5442  O O    . ALA A 1 113 ? 9.429   4.022   -8.122  1.00 0.00 ? 113 ALA A O    3  
ATOM 5443  C CB   . ALA A 1 113 ? 9.166   3.588   -4.777  1.00 0.00 ? 113 ALA A CB   3  
ATOM 5444  H H    . ALA A 1 113 ? 11.541  4.373   -4.379  1.00 0.00 ? 113 ALA A H    3  
ATOM 5445  H HA   . ALA A 1 113 ? 10.416  2.689   -6.238  1.00 0.00 ? 113 ALA A HA   3  
ATOM 5446  H HB1  . ALA A 1 113 ? 8.489   2.775   -4.999  1.00 0.00 ? 113 ALA A HB1  3  
ATOM 5447  H HB2  . ALA A 1 113 ? 9.653   3.403   -3.832  1.00 0.00 ? 113 ALA A HB2  3  
ATOM 5448  H HB3  . ALA A 1 113 ? 8.612   4.513   -4.723  1.00 0.00 ? 113 ALA A HB3  3  
ATOM 5449  N N    . VAL A 1 114 ? 9.539   5.831   -6.788  1.00 0.00 ? 114 VAL A N    3  
ATOM 5450  C CA   . VAL A 1 114 ? 9.047   6.749   -7.809  1.00 0.00 ? 114 VAL A CA   3  
ATOM 5451  C C    . VAL A 1 114 ? 9.675   6.449   -9.166  1.00 0.00 ? 114 VAL A C    3  
ATOM 5452  O O    . VAL A 1 114 ? 9.069   6.692   -10.208 1.00 0.00 ? 114 VAL A O    3  
ATOM 5453  C CB   . VAL A 1 114 ? 9.339   8.214   -7.434  1.00 0.00 ? 114 VAL A CB   3  
ATOM 5454  C CG1  . VAL A 1 114 ? 8.699   8.561   -6.098  1.00 0.00 ? 114 VAL A CG1  3  
ATOM 5455  C CG2  . VAL A 1 114 ? 10.839  8.466   -7.397  1.00 0.00 ? 114 VAL A CG2  3  
ATOM 5456  H H    . VAL A 1 114 ? 9.763   6.180   -5.900  1.00 0.00 ? 114 VAL A H    3  
ATOM 5457  H HA   . VAL A 1 114 ? 7.977   6.625   -7.883  1.00 0.00 ? 114 VAL A HA   3  
ATOM 5458  H HB   . VAL A 1 114 ? 8.906   8.852   -8.191  1.00 0.00 ? 114 VAL A HB   3  
ATOM 5459  H HG11 . VAL A 1 114 ? 9.235   8.064   -5.303  1.00 0.00 ? 114 VAL A HG11 3  
ATOM 5460  H HG12 . VAL A 1 114 ? 8.738   9.630   -5.947  1.00 0.00 ? 114 VAL A HG12 3  
ATOM 5461  H HG13 . VAL A 1 114 ? 7.670   8.234   -6.096  1.00 0.00 ? 114 VAL A HG13 3  
ATOM 5462  H HG21 . VAL A 1 114 ? 11.117  9.097   -8.229  1.00 0.00 ? 114 VAL A HG21 3  
ATOM 5463  H HG22 . VAL A 1 114 ? 11.099  8.957   -6.471  1.00 0.00 ? 114 VAL A HG22 3  
ATOM 5464  H HG23 . VAL A 1 114 ? 11.364  7.526   -7.467  1.00 0.00 ? 114 VAL A HG23 3  
ATOM 5465  N N    . ASN A 1 115 ? 10.893  5.919   -9.144  1.00 0.00 ? 115 ASN A N    3  
ATOM 5466  C CA   . ASN A 1 115 ? 11.603  5.585   -10.373 1.00 0.00 ? 115 ASN A CA   3  
ATOM 5467  C C    . ASN A 1 115 ? 11.193  4.206   -10.881 1.00 0.00 ? 115 ASN A C    3  
ATOM 5468  O O    . ASN A 1 115 ? 10.975  4.015   -12.077 1.00 0.00 ? 115 ASN A O    3  
ATOM 5469  C CB   . ASN A 1 115 ? 13.115  5.626   -10.140 1.00 0.00 ? 115 ASN A CB   3  
ATOM 5470  C CG   . ASN A 1 115 ? 13.633  7.039   -9.951  1.00 0.00 ? 115 ASN A CG   3  
ATOM 5471  O OD1  . ASN A 1 115 ? 13.608  7.850   -10.876 1.00 0.00 ? 115 ASN A OD1  3  
ATOM 5472  N ND2  . ASN A 1 115 ? 14.105  7.339   -8.746  1.00 0.00 ? 115 ASN A ND2  3  
ATOM 5473  H H    . ASN A 1 115 ? 11.325  5.748   -8.281  1.00 0.00 ? 115 ASN A H    3  
ATOM 5474  H HA   . ASN A 1 115 ? 11.343  6.322   -11.117 1.00 0.00 ? 115 ASN A HA   3  
ATOM 5475  H HB2  . ASN A 1 115 ? 13.352  5.055   -9.254  1.00 0.00 ? 115 ASN A HB2  3  
ATOM 5476  H HB3  . ASN A 1 115 ? 13.617  5.189   -10.990 1.00 0.00 ? 115 ASN A HB3  3  
ATOM 5477  H HD21 . ASN A 1 115 ? 14.093  6.642   -8.057  1.00 0.00 ? 115 ASN A HD21 3  
ATOM 5478  H HD22 . ASN A 1 115 ? 14.445  8.246   -8.596  1.00 0.00 ? 115 ASN A HD22 3  
ATOM 5479  N N    . GLN A 1 116 ? 11.090  3.250   -9.964  1.00 0.00 ? 116 GLN A N    3  
ATOM 5480  C CA   . GLN A 1 116 ? 10.706  1.889   -10.319 1.00 0.00 ? 116 GLN A CA   3  
ATOM 5481  C C    . GLN A 1 116 ? 9.253   1.836   -10.780 1.00 0.00 ? 116 GLN A C    3  
ATOM 5482  O O    . GLN A 1 116 ? 8.966   1.463   -11.917 1.00 0.00 ? 116 GLN A O    3  
ATOM 5483  C CB   . GLN A 1 116 ? 10.910  0.951   -9.128  1.00 0.00 ? 116 GLN A CB   3  
ATOM 5484  C CG   . GLN A 1 116 ? 12.367  0.787   -8.726  1.00 0.00 ? 116 GLN A CG   3  
ATOM 5485  C CD   . GLN A 1 116 ? 12.598  -0.429  -7.851  1.00 0.00 ? 116 GLN A CD   3  
ATOM 5486  O OE1  . GLN A 1 116 ? 12.103  -1.519  -8.142  1.00 0.00 ? 116 GLN A OE1  3  
ATOM 5487  N NE2  . GLN A 1 116 ? 13.352  -0.249  -6.773  1.00 0.00 ? 116 GLN A NE2  3  
ATOM 5488  H H    . GLN A 1 116 ? 11.277  3.465   -9.027  1.00 0.00 ? 116 GLN A H    3  
ATOM 5489  H HA   . GLN A 1 116 ? 11.340  1.568   -11.132 1.00 0.00 ? 116 GLN A HA   3  
ATOM 5490  H HB2  . GLN A 1 116 ? 10.366  1.341   -8.281  1.00 0.00 ? 116 GLN A HB2  3  
ATOM 5491  H HB3  . GLN A 1 116 ? 10.518  -0.023  -9.381  1.00 0.00 ? 116 GLN A HB3  3  
ATOM 5492  H HG2  . GLN A 1 116 ? 12.965  0.687   -9.619  1.00 0.00 ? 116 GLN A HG2  3  
ATOM 5493  H HG3  . GLN A 1 116 ? 12.678  1.668   -8.182  1.00 0.00 ? 116 GLN A HG3  3  
ATOM 5494  H HE21 . GLN A 1 116 ? 13.711  0.647   -6.605  1.00 0.00 ? 116 GLN A HE21 3  
ATOM 5495  H HE22 . GLN A 1 116 ? 13.516  -1.018  -6.190  1.00 0.00 ? 116 GLN A HE22 3  
ATOM 5496  N N    . MET A 1 117 ? 8.341   2.211   -9.889  1.00 0.00 ? 117 MET A N    3  
ATOM 5497  C CA   . MET A 1 117 ? 6.917   2.207   -10.205 1.00 0.00 ? 117 MET A CA   3  
ATOM 5498  C C    . MET A 1 117 ? 6.660   2.857   -11.561 1.00 0.00 ? 117 MET A C    3  
ATOM 5499  O O    . MET A 1 117 ? 7.423   3.714   -12.004 1.00 0.00 ? 117 MET A O    3  
ATOM 5500  C CB   . MET A 1 117 ? 6.129   2.940   -9.118  1.00 0.00 ? 117 MET A CB   3  
ATOM 5501  C CG   . MET A 1 117 ? 6.372   4.441   -9.098  1.00 0.00 ? 117 MET A CG   3  
ATOM 5502  S SD   . MET A 1 117 ? 5.146   5.330   -8.121  1.00 0.00 ? 117 MET A SD   3  
ATOM 5503  C CE   . MET A 1 117 ? 5.437   7.012   -8.662  1.00 0.00 ? 117 MET A CE   3  
ATOM 5504  H H    . MET A 1 117 ? 8.631   2.499   -8.998  1.00 0.00 ? 117 MET A H    3  
ATOM 5505  H HA   . MET A 1 117 ? 6.590   1.179   -10.244 1.00 0.00 ? 117 MET A HA   3  
ATOM 5506  H HB2  . MET A 1 117 ? 5.075   2.770   -9.277  1.00 0.00 ? 117 MET A HB2  3  
ATOM 5507  H HB3  . MET A 1 117 ? 6.409   2.540   -8.155  1.00 0.00 ? 117 MET A HB3  3  
ATOM 5508  H HG2  . MET A 1 117 ? 7.350   4.629   -8.680  1.00 0.00 ? 117 MET A HG2  3  
ATOM 5509  H HG3  . MET A 1 117 ? 6.341   4.809   -10.113 1.00 0.00 ? 117 MET A HG3  3  
ATOM 5510  H HE1  . MET A 1 117 ? 5.719   7.619   -7.814  1.00 0.00 ? 117 MET A HE1  3  
ATOM 5511  H HE2  . MET A 1 117 ? 6.231   7.023   -9.393  1.00 0.00 ? 117 MET A HE2  3  
ATOM 5512  H HE3  . MET A 1 117 ? 4.534   7.409   -9.104  1.00 0.00 ? 117 MET A HE3  3  
ATOM 5513  N N    . ALA A 1 118 ? 5.580   2.442   -12.216 1.00 0.00 ? 118 ALA A N    3  
ATOM 5514  C CA   . ALA A 1 118 ? 5.222   2.984   -13.520 1.00 0.00 ? 118 ALA A CA   3  
ATOM 5515  C C    . ALA A 1 118 ? 4.158   4.070   -13.390 1.00 0.00 ? 118 ALA A C    3  
ATOM 5516  O O    . ALA A 1 118 ? 3.384   4.082   -12.433 1.00 0.00 ? 118 ALA A O    3  
ATOM 5517  C CB   . ALA A 1 118 ? 4.735   1.873   -14.438 1.00 0.00 ? 118 ALA A CB   3  
ATOM 5518  H H    . ALA A 1 118 ? 5.010   1.755   -11.811 1.00 0.00 ? 118 ALA A H    3  
ATOM 5519  H HA   . ALA A 1 118 ? 6.111   3.416   -13.958 1.00 0.00 ? 118 ALA A HA   3  
ATOM 5520  H HB1  . ALA A 1 118 ? 3.658   1.807   -14.382 1.00 0.00 ? 118 ALA A HB1  3  
ATOM 5521  H HB2  . ALA A 1 118 ? 5.029   2.091   -15.454 1.00 0.00 ? 118 ALA A HB2  3  
ATOM 5522  H HB3  . ALA A 1 118 ? 5.170   0.935   -14.130 1.00 0.00 ? 118 ALA A HB3  3  
ATOM 5523  N N    . SER A 1 119 ? 4.127   4.980   -14.358 1.00 0.00 ? 119 SER A N    3  
ATOM 5524  C CA   . SER A 1 119 ? 3.161   6.073   -14.349 1.00 0.00 ? 119 SER A CA   3  
ATOM 5525  C C    . SER A 1 119 ? 2.233   5.987   -15.556 1.00 0.00 ? 119 SER A C    3  
ATOM 5526  O O    . SER A 1 119 ? 2.683   5.991   -16.701 1.00 0.00 ? 119 SER A O    3  
ATOM 5527  C CB   . SER A 1 119 ? 3.885   7.421   -14.342 1.00 0.00 ? 119 SER A CB   3  
ATOM 5528  O OG   . SER A 1 119 ? 4.126   7.863   -13.018 1.00 0.00 ? 119 SER A OG   3  
ATOM 5529  H H    . SER A 1 119 ? 4.771   4.917   -15.094 1.00 0.00 ? 119 SER A H    3  
ATOM 5530  H HA   . SER A 1 119 ? 2.571   5.986   -13.448 1.00 0.00 ? 119 SER A HA   3  
ATOM 5531  H HB2  . SER A 1 119 ? 4.830   7.322   -14.853 1.00 0.00 ? 119 SER A HB2  3  
ATOM 5532  H HB3  . SER A 1 119 ? 3.276   8.155   -14.849 1.00 0.00 ? 119 SER A HB3  3  
ATOM 5533  H HG   . SER A 1 119 ? 4.324   7.109   -12.459 1.00 0.00 ? 119 SER A HG   3  
ATOM 5534  N N    . GLY A 1 120 ? 0.932   5.910   -15.290 1.00 0.00 ? 120 GLY A N    3  
ATOM 5535  C CA   . GLY A 1 120 ? -0.041  5.824   -16.364 1.00 0.00 ? 120 GLY A CA   3  
ATOM 5536  C C    . GLY A 1 120 ? -0.996  4.660   -16.189 1.00 0.00 ? 120 GLY A C    3  
ATOM 5537  O O    . GLY A 1 120 ? -0.842  3.605   -16.804 1.00 0.00 ? 120 GLY A O    3  
ATOM 5538  H H    . GLY A 1 120 ? 0.631   5.911   -14.357 1.00 0.00 ? 120 GLY A H    3  
ATOM 5539  H HA2  . GLY A 1 120 ? -0.609  6.742   -16.394 1.00 0.00 ? 120 GLY A HA2  3  
ATOM 5540  H HA3  . GLY A 1 120 ? 0.484   5.706   -17.301 1.00 0.00 ? 120 GLY A HA3  3  
ATOM 5541  N N    . PRO A 1 121 ? -2.010  4.845   -15.330 1.00 0.00 ? 121 PRO A N    3  
ATOM 5542  C CA   . PRO A 1 121 ? -3.013  3.813   -15.056 1.00 0.00 ? 121 PRO A CA   3  
ATOM 5543  C C    . PRO A 1 121 ? -3.936  3.569   -16.245 1.00 0.00 ? 121 PRO A C    3  
ATOM 5544  O O    . PRO A 1 121 ? -4.291  4.500   -16.968 1.00 0.00 ? 121 PRO A O    3  
ATOM 5545  C CB   . PRO A 1 121 ? -3.801  4.389   -13.877 1.00 0.00 ? 121 PRO A CB   3  
ATOM 5546  C CG   . PRO A 1 121 ? -3.629  5.864   -13.991 1.00 0.00 ? 121 PRO A CG   3  
ATOM 5547  C CD   . PRO A 1 121 ? -2.255  6.078   -14.563 1.00 0.00 ? 121 PRO A CD   3  
ATOM 5548  H HA   . PRO A 1 121 ? -2.553  2.881   -14.762 1.00 0.00 ? 121 PRO A HA   3  
ATOM 5549  H HB2  . PRO A 1 121 ? -4.841  4.103   -13.961 1.00 0.00 ? 121 PRO A HB2  3  
ATOM 5550  H HB3  . PRO A 1 121 ? -3.394  4.015   -12.949 1.00 0.00 ? 121 PRO A HB3  3  
ATOM 5551  H HG2  . PRO A 1 121 ? -4.378  6.271   -14.653 1.00 0.00 ? 121 PRO A HG2  3  
ATOM 5552  H HG3  . PRO A 1 121 ? -3.703  6.319   -13.014 1.00 0.00 ? 121 PRO A HG3  3  
ATOM 5553  H HD2  . PRO A 1 121 ? -2.246  6.943   -15.209 1.00 0.00 ? 121 PRO A HD2  3  
ATOM 5554  H HD3  . PRO A 1 121 ? -1.530  6.188   -13.770 1.00 0.00 ? 121 PRO A HD3  3  
ATOM 5555  N N    . SER A 1 122 ? -4.320  2.312   -16.442 1.00 0.00 ? 122 SER A N    3  
ATOM 5556  C CA   . SER A 1 122 ? -5.200  1.946   -17.546 1.00 0.00 ? 122 SER A CA   3  
ATOM 5557  C C    . SER A 1 122 ? -5.806  0.564   -17.323 1.00 0.00 ? 122 SER A C    3  
ATOM 5558  O O    . SER A 1 122 ? -5.379  -0.177  -16.438 1.00 0.00 ? 122 SER A O    3  
ATOM 5559  C CB   . SER A 1 122 ? -4.430  1.970   -18.868 1.00 0.00 ? 122 SER A CB   3  
ATOM 5560  O OG   . SER A 1 122 ? -5.312  2.097   -19.970 1.00 0.00 ? 122 SER A OG   3  
ATOM 5561  H H    . SER A 1 122 ? -4.003  1.614   -15.831 1.00 0.00 ? 122 SER A H    3  
ATOM 5562  H HA   . SER A 1 122 ? -5.997  2.674   -17.591 1.00 0.00 ? 122 SER A HA   3  
ATOM 5563  H HB2  . SER A 1 122 ? -3.748  2.807   -18.870 1.00 0.00 ? 122 SER A HB2  3  
ATOM 5564  H HB3  . SER A 1 122 ? -3.871  1.051   -18.973 1.00 0.00 ? 122 SER A HB3  3  
ATOM 5565  H HG   . SER A 1 122 ? -5.875  2.864   -19.842 1.00 0.00 ? 122 SER A HG   3  
ATOM 5566  N N    . SER A 1 123 ? -6.804  0.225   -18.133 1.00 0.00 ? 123 SER A N    3  
ATOM 5567  C CA   . SER A 1 123 ? -7.473  -1.066  -18.022 1.00 0.00 ? 123 SER A CA   3  
ATOM 5568  C C    . SER A 1 123 ? -6.558  -2.194  -18.489 1.00 0.00 ? 123 SER A C    3  
ATOM 5569  O O    . SER A 1 123 ? -6.175  -2.254  -19.657 1.00 0.00 ? 123 SER A O    3  
ATOM 5570  C CB   . SER A 1 123 ? -8.764  -1.067  -18.844 1.00 0.00 ? 123 SER A CB   3  
ATOM 5571  O OG   . SER A 1 123 ? -9.557  -2.203  -18.546 1.00 0.00 ? 123 SER A OG   3  
ATOM 5572  H H    . SER A 1 123 ? -7.099  0.860   -18.819 1.00 0.00 ? 123 SER A H    3  
ATOM 5573  H HA   . SER A 1 123 ? -7.718  -1.224  -16.982 1.00 0.00 ? 123 SER A HA   3  
ATOM 5574  H HB2  . SER A 1 123 ? -9.332  -0.178  -18.618 1.00 0.00 ? 123 SER A HB2  3  
ATOM 5575  H HB3  . SER A 1 123 ? -8.517  -1.080  -19.896 1.00 0.00 ? 123 SER A HB3  3  
ATOM 5576  H HG   . SER A 1 123 ? -9.015  -2.994  -18.598 1.00 0.00 ? 123 SER A HG   3  
ATOM 5577  N N    . GLY A 1 124 ? -6.211  -3.087  -17.567 1.00 0.00 ? 124 GLY A N    3  
ATOM 5578  C CA   . GLY A 1 124 ? -5.344  -4.201  -17.903 1.00 0.00 ? 124 GLY A CA   3  
ATOM 5579  C C    . GLY A 1 124 ? -5.476  -5.353  -16.927 1.00 0.00 ? 124 GLY A C    3  
ATOM 5580  O O    . GLY A 1 124 ? -4.551  -6.149  -16.766 1.00 0.00 ? 124 GLY A O    3  
ATOM 5581  H H    . GLY A 1 124 ? -6.548  -2.988  -16.652 1.00 0.00 ? 124 GLY A H    3  
ATOM 5582  H HA2  . GLY A 1 124 ? -5.593  -4.551  -18.893 1.00 0.00 ? 124 GLY A HA2  3  
ATOM 5583  H HA3  . GLY A 1 124 ? -4.320  -3.858  -17.900 1.00 0.00 ? 124 GLY A HA3  3  
ATOM 5584  N N    . GLY A 1 1   ? 5.553   -24.615 18.917  1.00 0.00 ? 1   GLY A N    4  
ATOM 5585  C CA   . GLY A 1 1   ? 4.960   -25.226 20.091  1.00 0.00 ? 1   GLY A CA   4  
ATOM 5586  C C    . GLY A 1 1   ? 4.550   -24.204 21.133  1.00 0.00 ? 1   GLY A C    4  
ATOM 5587  O O    . GLY A 1 1   ? 3.373   -23.861 21.247  1.00 0.00 ? 1   GLY A O    4  
ATOM 5588  H H1   . GLY A 1 1   ? 5.987   -25.176 18.241  1.00 0.00 ? 1   GLY A H1   4  
ATOM 5589  H HA2  . GLY A 1 1   ? 4.088   -25.787 19.790  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5590  H HA3  . GLY A 1 1   ? 5.677   -25.904 20.532  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5591  N N    . SER A 1 2   ? 5.523   -23.718 21.897  1.00 0.00 ? 2   SER A N    4  
ATOM 5592  C CA   . SER A 1 2   ? 5.256   -22.733 22.939  1.00 0.00 ? 2   SER A CA   4  
ATOM 5593  C C    . SER A 1 2   ? 6.151   -21.509 22.771  1.00 0.00 ? 2   SER A C    4  
ATOM 5594  O O    . SER A 1 2   ? 7.147   -21.548 22.049  1.00 0.00 ? 2   SER A O    4  
ATOM 5595  C CB   . SER A 1 2   ? 5.472   -23.351 24.322  1.00 0.00 ? 2   SER A CB   4  
ATOM 5596  O OG   . SER A 1 2   ? 4.915   -22.535 25.338  1.00 0.00 ? 2   SER A OG   4  
ATOM 5597  H H    . SER A 1 2   ? 6.441   -24.031 21.758  1.00 0.00 ? 2   SER A H    4  
ATOM 5598  H HA   . SER A 1 2   ? 4.225   -22.426 22.849  1.00 0.00 ? 2   SER A HA   4  
ATOM 5599  H HB2  . SER A 1 2   ? 5.002   -24.321 24.357  1.00 0.00 ? 2   SER A HB2  4  
ATOM 5600  H HB3  . SER A 1 2   ? 6.532   -23.458 24.503  1.00 0.00 ? 2   SER A HB3  4  
ATOM 5601  H HG   . SER A 1 2   ? 5.612   -22.028 25.760  1.00 0.00 ? 2   SER A HG   4  
ATOM 5602  N N    . SER A 1 3   ? 5.787   -20.421 23.444  1.00 0.00 ? 3   SER A N    4  
ATOM 5603  C CA   . SER A 1 3   ? 6.554   -19.183 23.367  1.00 0.00 ? 3   SER A CA   4  
ATOM 5604  C C    . SER A 1 3   ? 6.701   -18.724 21.919  1.00 0.00 ? 3   SER A C    4  
ATOM 5605  O O    . SER A 1 3   ? 7.771   -18.283 21.501  1.00 0.00 ? 3   SER A O    4  
ATOM 5606  C CB   . SER A 1 3   ? 7.935   -19.374 23.996  1.00 0.00 ? 3   SER A CB   4  
ATOM 5607  O OG   . SER A 1 3   ? 7.886   -19.187 25.400  1.00 0.00 ? 3   SER A OG   4  
ATOM 5608  H H    . SER A 1 3   ? 4.983   -20.452 24.003  1.00 0.00 ? 3   SER A H    4  
ATOM 5609  H HA   . SER A 1 3   ? 6.017   -18.426 23.919  1.00 0.00 ? 3   SER A HA   4  
ATOM 5610  H HB2  . SER A 1 3   ? 8.287   -20.373 23.790  1.00 0.00 ? 3   SER A HB2  4  
ATOM 5611  H HB3  . SER A 1 3   ? 8.623   -18.656 23.573  1.00 0.00 ? 3   SER A HB3  4  
ATOM 5612  H HG   . SER A 1 3   ? 7.247   -19.793 25.781  1.00 0.00 ? 3   SER A HG   4  
ATOM 5613  N N    . GLY A 1 4   ? 5.617   -18.832 21.157  1.00 0.00 ? 4   GLY A N    4  
ATOM 5614  C CA   . GLY A 1 4   ? 5.645   -18.425 19.765  1.00 0.00 ? 4   GLY A CA   4  
ATOM 5615  C C    . GLY A 1 4   ? 4.475   -18.979 18.975  1.00 0.00 ? 4   GLY A C    4  
ATOM 5616  O O    . GLY A 1 4   ? 4.660   -19.579 17.917  1.00 0.00 ? 4   GLY A O    4  
ATOM 5617  H H    . GLY A 1 4   ? 4.791   -19.191 21.544  1.00 0.00 ? 4   GLY A H    4  
ATOM 5618  H HA2  . GLY A 1 4   ? 5.621   -17.347 19.716  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5619  H HA3  . GLY A 1 4   ? 6.564   -18.776 19.318  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5620  N N    . SER A 1 5   ? 3.267   -18.778 19.492  1.00 0.00 ? 5   SER A N    4  
ATOM 5621  C CA   . SER A 1 5   ? 2.062   -19.266 18.830  1.00 0.00 ? 5   SER A CA   4  
ATOM 5622  C C    . SER A 1 5   ? 2.087   -18.933 17.342  1.00 0.00 ? 5   SER A C    4  
ATOM 5623  O O    . SER A 1 5   ? 2.360   -17.797 16.953  1.00 0.00 ? 5   SER A O    4  
ATOM 5624  C CB   . SER A 1 5   ? 0.817   -18.660 19.480  1.00 0.00 ? 5   SER A CB   4  
ATOM 5625  O OG   . SER A 1 5   ? 0.572   -19.237 20.751  1.00 0.00 ? 5   SER A OG   4  
ATOM 5626  H H    . SER A 1 5   ? 3.184   -18.292 20.339  1.00 0.00 ? 5   SER A H    4  
ATOM 5627  H HA   . SER A 1 5   ? 2.032   -20.339 18.947  1.00 0.00 ? 5   SER A HA   4  
ATOM 5628  H HB2  . SER A 1 5   ? 0.959   -17.597 19.602  1.00 0.00 ? 5   SER A HB2  4  
ATOM 5629  H HB3  . SER A 1 5   ? -0.040  -18.838 18.846  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5630  H HG   . SER A 1 5   ? 0.446   -18.541 21.400  1.00 0.00 ? 5   SER A HG   4  
ATOM 5631  N N    . SER A 1 6   ? 1.799   -19.932 16.513  1.00 0.00 ? 6   SER A N    4  
ATOM 5632  C CA   . SER A 1 6   ? 1.791   -19.747 15.067  1.00 0.00 ? 6   SER A CA   4  
ATOM 5633  C C    . SER A 1 6   ? 0.533   -19.009 14.620  1.00 0.00 ? 6   SER A C    4  
ATOM 5634  O O    . SER A 1 6   ? -0.541  -19.598 14.513  1.00 0.00 ? 6   SER A O    4  
ATOM 5635  C CB   . SER A 1 6   ? 1.881   -21.100 14.358  1.00 0.00 ? 6   SER A CB   4  
ATOM 5636  O OG   . SER A 1 6   ? 0.803   -21.943 14.730  1.00 0.00 ? 6   SER A OG   4  
ATOM 5637  H H    . SER A 1 6   ? 1.589   -20.815 16.884  1.00 0.00 ? 6   SER A H    4  
ATOM 5638  H HA   . SER A 1 6   ? 2.655   -19.155 14.804  1.00 0.00 ? 6   SER A HA   4  
ATOM 5639  H HB2  . SER A 1 6   ? 1.850   -20.947 13.290  1.00 0.00 ? 6   SER A HB2  4  
ATOM 5640  H HB3  . SER A 1 6   ? 2.809   -21.583 14.627  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5641  H HG   . SER A 1 6   ? 0.095   -21.859 14.088  1.00 0.00 ? 6   SER A HG   4  
ATOM 5642  N N    . GLY A 1 7   ? 0.676   -17.712 14.361  1.00 0.00 ? 7   GLY A N    4  
ATOM 5643  C CA   . GLY A 1 7   ? -0.456  -16.913 13.929  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5644  C C    . GLY A 1 7   ? -0.198  -15.425 14.059  1.00 0.00 ? 7   GLY A C    4  
ATOM 5645  O O    . GLY A 1 7   ? -0.792  -14.620 13.341  1.00 0.00 ? 7   GLY A O    4  
ATOM 5646  H H    . GLY A 1 7   ? 1.557   -17.295 14.464  1.00 0.00 ? 7   GLY A H    4  
ATOM 5647  H HA2  . GLY A 1 7   ? -0.671  -17.142 12.896  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5648  H HA3  . GLY A 1 7   ? -1.315  -17.172 14.531  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5649  N N    . ASP A 1 8   ? 0.687   -15.058 14.979  1.00 0.00 ? 8   ASP A N    4  
ATOM 5650  C CA   . ASP A 1 8   ? 1.022   -13.656 15.202  1.00 0.00 ? 8   ASP A CA   4  
ATOM 5651  C C    . ASP A 1 8   ? 2.150   -13.213 14.275  1.00 0.00 ? 8   ASP A C    4  
ATOM 5652  O O    . ASP A 1 8   ? 2.946   -12.342 14.624  1.00 0.00 ? 8   ASP A O    4  
ATOM 5653  C CB   . ASP A 1 8   ? 1.424   -13.431 16.660  1.00 0.00 ? 8   ASP A CB   4  
ATOM 5654  C CG   . ASP A 1 8   ? 2.058   -14.660 17.282  1.00 0.00 ? 8   ASP A CG   4  
ATOM 5655  O OD1  . ASP A 1 8   ? 3.054   -15.162 16.721  1.00 0.00 ? 8   ASP A OD1  4  
ATOM 5656  O OD2  . ASP A 1 8   ? 1.556   -15.121 18.329  1.00 0.00 ? 8   ASP A OD2  4  
ATOM 5657  H H    . ASP A 1 8   ? 1.127   -15.746 15.521  1.00 0.00 ? 8   ASP A H    4  
ATOM 5658  H HA   . ASP A 1 8   ? 0.143   -13.067 14.985  1.00 0.00 ? 8   ASP A HA   4  
ATOM 5659  H HB2  . ASP A 1 8   ? 2.135   -12.619 16.709  1.00 0.00 ? 8   ASP A HB2  4  
ATOM 5660  H HB3  . ASP A 1 8   ? 0.547   -13.171 17.233  1.00 0.00 ? 8   ASP A HB3  4  
ATOM 5661  N N    . ALA A 1 9   ? 2.212   -13.819 13.094  1.00 0.00 ? 9   ALA A N    4  
ATOM 5662  C CA   . ALA A 1 9   ? 3.241   -13.487 12.118  1.00 0.00 ? 9   ALA A CA   4  
ATOM 5663  C C    . ALA A 1 9   ? 2.877   -12.224 11.344  1.00 0.00 ? 9   ALA A C    4  
ATOM 5664  O O    . ALA A 1 9   ? 3.682   -11.704 10.571  1.00 0.00 ? 9   ALA A O    4  
ATOM 5665  C CB   . ALA A 1 9   ? 3.457   -14.650 11.161  1.00 0.00 ? 9   ALA A CB   4  
ATOM 5666  H H    . ALA A 1 9   ? 1.548   -14.506 12.874  1.00 0.00 ? 9   ALA A H    4  
ATOM 5667  H HA   . ALA A 1 9   ? 4.165   -13.315 12.652  1.00 0.00 ? 9   ALA A HA   4  
ATOM 5668  H HB1  . ALA A 1 9   ? 2.740   -14.591 10.356  1.00 0.00 ? 9   ALA A HB1  4  
ATOM 5669  H HB2  . ALA A 1 9   ? 4.458   -14.603 10.758  1.00 0.00 ? 9   ALA A HB2  4  
ATOM 5670  H HB3  . ALA A 1 9   ? 3.326   -15.581 11.692  1.00 0.00 ? 9   ALA A HB3  4  
ATOM 5671  N N    . PHE A 1 10  ? 1.659   -11.737 11.556  1.00 0.00 ? 10  PHE A N    4  
ATOM 5672  C CA   . PHE A 1 10  ? 1.187   -10.536 10.877  1.00 0.00 ? 10  PHE A CA   4  
ATOM 5673  C C    . PHE A 1 10  ? 1.272   -9.322  11.797  1.00 0.00 ? 10  PHE A C    4  
ATOM 5674  O O    . PHE A 1 10  ? 0.667   -8.282  11.531  1.00 0.00 ? 10  PHE A O    4  
ATOM 5675  C CB   . PHE A 1 10  ? -0.254  -10.728 10.398  1.00 0.00 ? 10  PHE A CB   4  
ATOM 5676  C CG   . PHE A 1 10  ? -0.378  -11.668 9.233   1.00 0.00 ? 10  PHE A CG   4  
ATOM 5677  C CD1  . PHE A 1 10  ? -0.500  -13.033 9.438   1.00 0.00 ? 10  PHE A CD1  4  
ATOM 5678  C CD2  . PHE A 1 10  ? -0.373  -11.187 7.934   1.00 0.00 ? 10  PHE A CD2  4  
ATOM 5679  C CE1  . PHE A 1 10  ? -0.616  -13.901 8.368   1.00 0.00 ? 10  PHE A CE1  4  
ATOM 5680  C CE2  . PHE A 1 10  ? -0.489  -12.049 6.861   1.00 0.00 ? 10  PHE A CE2  4  
ATOM 5681  C CZ   . PHE A 1 10  ? -0.609  -13.408 7.078   1.00 0.00 ? 10  PHE A CZ   4  
ATOM 5682  H H    . PHE A 1 10  ? 1.063   -12.197 12.184  1.00 0.00 ? 10  PHE A H    4  
ATOM 5683  H HA   . PHE A 1 10  ? 1.822   -10.369 10.021  1.00 0.00 ? 10  PHE A HA   4  
ATOM 5684  H HB2  . PHE A 1 10  ? -0.845  -11.125 11.209  1.00 0.00 ? 10  PHE A HB2  4  
ATOM 5685  H HB3  . PHE A 1 10  ? -0.656  -9.772  10.099  1.00 0.00 ? 10  PHE A HB3  4  
ATOM 5686  H HD1  . PHE A 1 10  ? -0.506  -13.419 10.448  1.00 0.00 ? 10  PHE A HD1  4  
ATOM 5687  H HD2  . PHE A 1 10  ? -0.278  -10.124 7.763   1.00 0.00 ? 10  PHE A HD2  4  
ATOM 5688  H HE1  . PHE A 1 10  ? -0.710  -14.962 8.542   1.00 0.00 ? 10  PHE A HE1  4  
ATOM 5689  H HE2  . PHE A 1 10  ? -0.483  -11.662 5.853   1.00 0.00 ? 10  PHE A HE2  4  
ATOM 5690  H HZ   . PHE A 1 10  ? -0.700  -14.084 6.241   1.00 0.00 ? 10  PHE A HZ   4  
ATOM 5691  N N    . THR A 1 11  ? 2.027   -9.461  12.883  1.00 0.00 ? 11  THR A N    4  
ATOM 5692  C CA   . THR A 1 11  ? 2.190   -8.378  13.844  1.00 0.00 ? 11  THR A CA   4  
ATOM 5693  C C    . THR A 1 11  ? 3.240   -7.378  13.372  1.00 0.00 ? 11  THR A C    4  
ATOM 5694  O O    . THR A 1 11  ? 4.290   -7.763  12.857  1.00 0.00 ? 11  THR A O    4  
ATOM 5695  C CB   . THR A 1 11  ? 2.594   -8.914  15.230  1.00 0.00 ? 11  THR A CB   4  
ATOM 5696  O OG1  . THR A 1 11  ? 3.699   -9.816  15.104  1.00 0.00 ? 11  THR A OG1  4  
ATOM 5697  C CG2  . THR A 1 11  ? 1.426   -9.625  15.897  1.00 0.00 ? 11  THR A CG2  4  
ATOM 5698  H H    . THR A 1 11  ? 2.483   -10.314 13.040  1.00 0.00 ? 11  THR A H    4  
ATOM 5699  H HA   . THR A 1 11  ? 1.241   -7.871  13.939  1.00 0.00 ? 11  THR A HA   4  
ATOM 5700  H HB   . THR A 1 11  ? 2.889   -8.079  15.850  1.00 0.00 ? 11  THR A HB   4  
ATOM 5701  H HG1  . THR A 1 11  ? 4.521   -9.335  15.234  1.00 0.00 ? 11  THR A HG1  4  
ATOM 5702  H HG21 . THR A 1 11  ? 0.676   -9.859  15.156  1.00 0.00 ? 11  THR A HG21 4  
ATOM 5703  H HG22 . THR A 1 11  ? 0.998   -8.983  16.652  1.00 0.00 ? 11  THR A HG22 4  
ATOM 5704  H HG23 . THR A 1 11  ? 1.775   -10.537 16.356  1.00 0.00 ? 11  THR A HG23 4  
ATOM 5705  N N    . ASP A 1 12  ? 2.951   -6.094  13.553  1.00 0.00 ? 12  ASP A N    4  
ATOM 5706  C CA   . ASP A 1 12  ? 3.871   -5.039  13.147  1.00 0.00 ? 12  ASP A CA   4  
ATOM 5707  C C    . ASP A 1 12  ? 5.318   -5.451  13.403  1.00 0.00 ? 12  ASP A C    4  
ATOM 5708  O O    . ASP A 1 12  ? 6.113   -5.567  12.471  1.00 0.00 ? 12  ASP A O    4  
ATOM 5709  C CB   . ASP A 1 12  ? 3.557   -3.743  13.897  1.00 0.00 ? 12  ASP A CB   4  
ATOM 5710  C CG   . ASP A 1 12  ? 4.670   -2.720  13.777  1.00 0.00 ? 12  ASP A CG   4  
ATOM 5711  O OD1  . ASP A 1 12  ? 5.658   -2.827  14.533  1.00 0.00 ? 12  ASP A OD1  4  
ATOM 5712  O OD2  . ASP A 1 12  ? 4.554   -1.814  12.926  1.00 0.00 ? 12  ASP A OD2  4  
ATOM 5713  H H    . ASP A 1 12  ? 2.097   -5.851  13.969  1.00 0.00 ? 12  ASP A H    4  
ATOM 5714  H HA   . ASP A 1 12  ? 3.740   -4.872  12.089  1.00 0.00 ? 12  ASP A HA   4  
ATOM 5715  H HB2  . ASP A 1 12  ? 2.653   -3.311  13.493  1.00 0.00 ? 12  ASP A HB2  4  
ATOM 5716  H HB3  . ASP A 1 12  ? 3.409   -3.967  14.943  1.00 0.00 ? 12  ASP A HB3  4  
ATOM 5717  N N    . GLN A 1 13  ? 5.650   -5.670  14.671  1.00 0.00 ? 13  GLN A N    4  
ATOM 5718  C CA   . GLN A 1 13  ? 7.001   -6.068  15.049  1.00 0.00 ? 13  GLN A CA   4  
ATOM 5719  C C    . GLN A 1 13  ? 7.590   -7.034  14.026  1.00 0.00 ? 13  GLN A C    4  
ATOM 5720  O O    . GLN A 1 13  ? 8.769   -6.948  13.681  1.00 0.00 ? 13  GLN A O    4  
ATOM 5721  C CB   . GLN A 1 13  ? 6.996   -6.715  16.435  1.00 0.00 ? 13  GLN A CB   4  
ATOM 5722  C CG   . GLN A 1 13  ? 6.051   -7.900  16.550  1.00 0.00 ? 13  GLN A CG   4  
ATOM 5723  C CD   . GLN A 1 13  ? 5.938   -8.420  17.970  1.00 0.00 ? 13  GLN A CD   4  
ATOM 5724  O OE1  . GLN A 1 13  ? 6.852   -9.069  18.480  1.00 0.00 ? 13  GLN A OE1  4  
ATOM 5725  N NE2  . GLN A 1 13  ? 4.813   -8.137  18.616  1.00 0.00 ? 13  GLN A NE2  4  
ATOM 5726  H H    . GLN A 1 13  ? 4.971   -5.562  15.369  1.00 0.00 ? 13  GLN A H    4  
ATOM 5727  H HA   . GLN A 1 13  ? 7.612   -5.178  15.079  1.00 0.00 ? 13  GLN A HA   4  
ATOM 5728  H HB2  . GLN A 1 13  ? 7.995   -7.054  16.664  1.00 0.00 ? 13  GLN A HB2  4  
ATOM 5729  H HB3  . GLN A 1 13  ? 6.701   -5.974  17.163  1.00 0.00 ? 13  GLN A HB3  4  
ATOM 5730  H HG2  . GLN A 1 13  ? 5.070   -7.595  16.216  1.00 0.00 ? 13  GLN A HG2  4  
ATOM 5731  H HG3  . GLN A 1 13  ? 6.415   -8.696  15.918  1.00 0.00 ? 13  GLN A HG3  4  
ATOM 5732  H HE21 . GLN A 1 13  ? 4.128   -7.616  18.146  1.00 0.00 ? 13  GLN A HE21 4  
ATOM 5733  H HE22 . GLN A 1 13  ? 4.713   -8.462  19.534  1.00 0.00 ? 13  GLN A HE22 4  
ATOM 5734  N N    . LYS A 1 14  ? 6.762   -7.954  13.543  1.00 0.00 ? 14  LYS A N    4  
ATOM 5735  C CA   . LYS A 1 14  ? 7.199   -8.937  12.559  1.00 0.00 ? 14  LYS A CA   4  
ATOM 5736  C C    . LYS A 1 14  ? 7.227   -8.330  11.160  1.00 0.00 ? 14  LYS A C    4  
ATOM 5737  O O    . LYS A 1 14  ? 8.107   -8.640  10.356  1.00 0.00 ? 14  LYS A O    4  
ATOM 5738  C CB   . LYS A 1 14  ? 6.274   -10.156 12.580  1.00 0.00 ? 14  LYS A CB   4  
ATOM 5739  C CG   . LYS A 1 14  ? 6.695   -11.222 13.577  1.00 0.00 ? 14  LYS A CG   4  
ATOM 5740  C CD   . LYS A 1 14  ? 7.762   -12.136 13.000  1.00 0.00 ? 14  LYS A CD   4  
ATOM 5741  C CE   . LYS A 1 14  ? 8.374   -13.025 14.072  1.00 0.00 ? 14  LYS A CE   4  
ATOM 5742  N NZ   . LYS A 1 14  ? 9.220   -14.100 13.484  1.00 0.00 ? 14  LYS A NZ   4  
ATOM 5743  H H    . LYS A 1 14  ? 5.833   -7.972  13.857  1.00 0.00 ? 14  LYS A H    4  
ATOM 5744  H HA   . LYS A 1 14  ? 8.198   -9.249  12.823  1.00 0.00 ? 14  LYS A HA   4  
ATOM 5745  H HB2  . LYS A 1 14  ? 5.276   -9.831  12.831  1.00 0.00 ? 14  LYS A HB2  4  
ATOM 5746  H HB3  . LYS A 1 14  ? 6.262   -10.600 11.594  1.00 0.00 ? 14  LYS A HB3  4  
ATOM 5747  H HG2  . LYS A 1 14  ? 7.088   -10.740 14.460  1.00 0.00 ? 14  LYS A HG2  4  
ATOM 5748  H HG3  . LYS A 1 14  ? 5.831   -11.814 13.842  1.00 0.00 ? 14  LYS A HG3  4  
ATOM 5749  H HD2  . LYS A 1 14  ? 7.316   -12.761 12.241  1.00 0.00 ? 14  LYS A HD2  4  
ATOM 5750  H HD3  . LYS A 1 14  ? 8.542   -11.531 12.558  1.00 0.00 ? 14  LYS A HD3  4  
ATOM 5751  H HE2  . LYS A 1 14  ? 8.982   -12.415 14.722  1.00 0.00 ? 14  LYS A HE2  4  
ATOM 5752  H HE3  . LYS A 1 14  ? 7.577   -13.477 14.643  1.00 0.00 ? 14  LYS A HE3  4  
ATOM 5753  H HZ1  . LYS A 1 14  ? 10.217  -13.950 13.739  1.00 0.00 ? 14  LYS A HZ1  4  
ATOM 5754  H HZ2  . LYS A 1 14  ? 9.134   -14.096 12.448  1.00 0.00 ? 14  LYS A HZ2  4  
ATOM 5755  H HZ3  . LYS A 1 14  ? 8.918   -15.029 13.843  1.00 0.00 ? 14  LYS A HZ3  4  
ATOM 5756  N N    . ILE A 1 15  ? 6.260   -7.464  10.876  1.00 0.00 ? 15  ILE A N    4  
ATOM 5757  C CA   . ILE A 1 15  ? 6.176   -6.813  9.575   1.00 0.00 ? 15  ILE A CA   4  
ATOM 5758  C C    . ILE A 1 15  ? 7.397   -5.936  9.319   1.00 0.00 ? 15  ILE A C    4  
ATOM 5759  O O    . ILE A 1 15  ? 8.029   -6.026  8.267   1.00 0.00 ? 15  ILE A O    4  
ATOM 5760  C CB   . ILE A 1 15  ? 4.906   -5.950  9.458   1.00 0.00 ? 15  ILE A CB   4  
ATOM 5761  C CG1  . ILE A 1 15  ? 3.657   -6.813  9.652   1.00 0.00 ? 15  ILE A CG1  4  
ATOM 5762  C CG2  . ILE A 1 15  ? 4.865   -5.247  8.110   1.00 0.00 ? 15  ILE A CG2  4  
ATOM 5763  C CD1  . ILE A 1 15  ? 2.370   -6.019  9.667   1.00 0.00 ? 15  ILE A CD1  4  
ATOM 5764  H H    . ILE A 1 15  ? 5.587   -7.258  11.558  1.00 0.00 ? 15  ILE A H    4  
ATOM 5765  H HA   . ILE A 1 15  ? 6.135   -7.584  8.819   1.00 0.00 ? 15  ILE A HA   4  
ATOM 5766  H HB   . ILE A 1 15  ? 4.937   -5.196  10.229  1.00 0.00 ? 15  ILE A HB   4  
ATOM 5767  H HG12 . ILE A 1 15  ? 3.594   -7.530  8.849   1.00 0.00 ? 15  ILE A HG12 4  
ATOM 5768  H HG13 . ILE A 1 15  ? 3.735   -7.339  10.593  1.00 0.00 ? 15  ILE A HG13 4  
ATOM 5769  H HG21 . ILE A 1 15  ? 4.206   -4.393  8.169   1.00 0.00 ? 15  ILE A HG21 4  
ATOM 5770  H HG22 . ILE A 1 15  ? 5.859   -4.915  7.847   1.00 0.00 ? 15  ILE A HG22 4  
ATOM 5771  H HG23 . ILE A 1 15  ? 4.503   -5.930  7.357   1.00 0.00 ? 15  ILE A HG23 4  
ATOM 5772  H HD11 . ILE A 1 15  ? 2.523   -5.076  9.164   1.00 0.00 ? 15  ILE A HD11 4  
ATOM 5773  H HD12 . ILE A 1 15  ? 1.596   -6.577  9.161   1.00 0.00 ? 15  ILE A HD12 4  
ATOM 5774  H HD13 . ILE A 1 15  ? 2.072   -5.837  10.689  1.00 0.00 ? 15  ILE A HD13 4  
ATOM 5775  N N    . ARG A 1 16  ? 7.725   -5.090  10.290  1.00 0.00 ? 16  ARG A N    4  
ATOM 5776  C CA   . ARG A 1 16  ? 8.872   -4.197  10.171  1.00 0.00 ? 16  ARG A CA   4  
ATOM 5777  C C    . ARG A 1 16  ? 10.161  -4.991  9.982   1.00 0.00 ? 16  ARG A C    4  
ATOM 5778  O O    . ARG A 1 16  ? 10.998  -4.642  9.150   1.00 0.00 ? 16  ARG A O    4  
ATOM 5779  C CB   . ARG A 1 16  ? 8.984   -3.309  11.411  1.00 0.00 ? 16  ARG A CB   4  
ATOM 5780  C CG   . ARG A 1 16  ? 9.277   -4.080  12.688  1.00 0.00 ? 16  ARG A CG   4  
ATOM 5781  C CD   . ARG A 1 16  ? 9.026   -3.228  13.923  1.00 0.00 ? 16  ARG A CD   4  
ATOM 5782  N NE   . ARG A 1 16  ? 9.894   -3.607  15.034  1.00 0.00 ? 16  ARG A NE   4  
ATOM 5783  C CZ   . ARG A 1 16  ? 11.207  -3.403  15.044  1.00 0.00 ? 16  ARG A CZ   4  
ATOM 5784  N NH1  . ARG A 1 16  ? 11.799  -2.828  14.007  1.00 0.00 ? 16  ARG A NH1  4  
ATOM 5785  N NH2  . ARG A 1 16  ? 11.929  -3.775  16.093  1.00 0.00 ? 16  ARG A NH2  4  
ATOM 5786  H H    . ARG A 1 16  ? 7.183   -5.065  11.106  1.00 0.00 ? 16  ARG A H    4  
ATOM 5787  H HA   . ARG A 1 16  ? 8.717   -3.572  9.304   1.00 0.00 ? 16  ARG A HA   4  
ATOM 5788  H HB2  . ARG A 1 16  ? 9.780   -2.595  11.257  1.00 0.00 ? 16  ARG A HB2  4  
ATOM 5789  H HB3  . ARG A 1 16  ? 8.055   -2.776  11.543  1.00 0.00 ? 16  ARG A HB3  4  
ATOM 5790  H HG2  . ARG A 1 16  ? 8.637   -4.949  12.728  1.00 0.00 ? 16  ARG A HG2  4  
ATOM 5791  H HG3  . ARG A 1 16  ? 10.311  -4.391  12.680  1.00 0.00 ? 16  ARG A HG3  4  
ATOM 5792  H HD2  . ARG A 1 16  ? 9.207   -2.194  13.673  1.00 0.00 ? 16  ARG A HD2  4  
ATOM 5793  H HD3  . ARG A 1 16  ? 7.996   -3.351  14.224  1.00 0.00 ? 16  ARG A HD3  4  
ATOM 5794  H HE   . ARG A 1 16  ? 9.477   -4.034  15.811  1.00 0.00 ? 16  ARG A HE   4  
ATOM 5795  H HH11 . ARG A 1 16  ? 11.257  -2.545  13.216  1.00 0.00 ? 16  ARG A HH11 4  
ATOM 5796  H HH12 . ARG A 1 16  ? 12.788  -2.674  14.017  1.00 0.00 ? 16  ARG A HH12 4  
ATOM 5797  H HH21 . ARG A 1 16  ? 11.486  -4.209  16.876  1.00 0.00 ? 16  ARG A HH21 4  
ATOM 5798  H HH22 . ARG A 1 16  ? 12.917  -3.622  16.099  1.00 0.00 ? 16  ARG A HH22 4  
ATOM 5799  N N    . GLN A 1 17  ? 10.313  -6.058  10.759  1.00 0.00 ? 17  GLN A N    4  
ATOM 5800  C CA   . GLN A 1 17  ? 11.501  -6.899  10.677  1.00 0.00 ? 17  GLN A CA   4  
ATOM 5801  C C    . GLN A 1 17  ? 11.479  -7.751  9.412   1.00 0.00 ? 17  GLN A C    4  
ATOM 5802  O O    . GLN A 1 17  ? 12.527  -8.122  8.884   1.00 0.00 ? 17  GLN A O    4  
ATOM 5803  C CB   . GLN A 1 17  ? 11.600  -7.799  11.910  1.00 0.00 ? 17  GLN A CB   4  
ATOM 5804  C CG   . GLN A 1 17  ? 12.367  -7.170  13.062  1.00 0.00 ? 17  GLN A CG   4  
ATOM 5805  C CD   . GLN A 1 17  ? 13.030  -8.201  13.954  1.00 0.00 ? 17  GLN A CD   4  
ATOM 5806  O OE1  . GLN A 1 17  ? 12.403  -9.178  14.366  1.00 0.00 ? 17  GLN A OE1  4  
ATOM 5807  N NE2  . GLN A 1 17  ? 14.305  -7.989  14.258  1.00 0.00 ? 17  GLN A NE2  4  
ATOM 5808  H H    . GLN A 1 17  ? 9.610   -6.284  11.403  1.00 0.00 ? 17  GLN A H    4  
ATOM 5809  H HA   . GLN A 1 17  ? 12.364  -6.252  10.645  1.00 0.00 ? 17  GLN A HA   4  
ATOM 5810  H HB2  . GLN A 1 17  ? 10.603  -8.031  12.253  1.00 0.00 ? 17  GLN A HB2  4  
ATOM 5811  H HB3  . GLN A 1 17  ? 12.099  -8.716  11.633  1.00 0.00 ? 17  GLN A HB3  4  
ATOM 5812  H HG2  . GLN A 1 17  ? 13.130  -6.522  12.659  1.00 0.00 ? 17  GLN A HG2  4  
ATOM 5813  H HG3  . GLN A 1 17  ? 11.680  -6.588  13.659  1.00 0.00 ? 17  GLN A HG3  4  
ATOM 5814  H HE21 . GLN A 1 17  ? 14.740  -7.189  13.895  1.00 0.00 ? 17  GLN A HE21 4  
ATOM 5815  H HE22 . GLN A 1 17  ? 14.758  -8.639  14.833  1.00 0.00 ? 17  GLN A HE22 4  
ATOM 5816  N N    . ARG A 1 18  ? 10.278  -8.057  8.932   1.00 0.00 ? 18  ARG A N    4  
ATOM 5817  C CA   . ARG A 1 18  ? 10.120  -8.866  7.729   1.00 0.00 ? 18  ARG A CA   4  
ATOM 5818  C C    . ARG A 1 18  ? 10.522  -8.077  6.486   1.00 0.00 ? 18  ARG A C    4  
ATOM 5819  O O    . ARG A 1 18  ? 11.194  -8.600  5.597   1.00 0.00 ? 18  ARG A O    4  
ATOM 5820  C CB   . ARG A 1 18  ? 8.672   -9.344  7.597   1.00 0.00 ? 18  ARG A CB   4  
ATOM 5821  C CG   . ARG A 1 18  ? 8.365   -9.991  6.257   1.00 0.00 ? 18  ARG A CG   4  
ATOM 5822  C CD   . ARG A 1 18  ? 7.073   -10.791 6.308   1.00 0.00 ? 18  ARG A CD   4  
ATOM 5823  N NE   . ARG A 1 18  ? 7.274   -12.121 6.878   1.00 0.00 ? 18  ARG A NE   4  
ATOM 5824  C CZ   . ARG A 1 18  ? 7.876   -13.114 6.232   1.00 0.00 ? 18  ARG A CZ   4  
ATOM 5825  N NH1  . ARG A 1 18  ? 8.333   -12.927 5.001   1.00 0.00 ? 18  ARG A NH1  4  
ATOM 5826  N NH2  . ARG A 1 18  ? 8.022   -14.295 6.817   1.00 0.00 ? 18  ARG A NH2  4  
ATOM 5827  H H    . ARG A 1 18  ? 9.479   -7.731  9.397   1.00 0.00 ? 18  ARG A H    4  
ATOM 5828  H HA   . ARG A 1 18  ? 10.766  -9.726  7.820   1.00 0.00 ? 18  ARG A HA   4  
ATOM 5829  H HB2  . ARG A 1 18  ? 8.471   -10.065 8.375   1.00 0.00 ? 18  ARG A HB2  4  
ATOM 5830  H HB3  . ARG A 1 18  ? 8.014   -8.497  7.723   1.00 0.00 ? 18  ARG A HB3  4  
ATOM 5831  H HG2  . ARG A 1 18  ? 8.268   -9.219  5.508   1.00 0.00 ? 18  ARG A HG2  4  
ATOM 5832  H HG3  . ARG A 1 18  ? 9.177   -10.652 5.993   1.00 0.00 ? 18  ARG A HG3  4  
ATOM 5833  H HD2  . ARG A 1 18  ? 6.357   -10.256 6.914   1.00 0.00 ? 18  ARG A HD2  4  
ATOM 5834  H HD3  . ARG A 1 18  ? 6.689   -10.894 5.305   1.00 0.00 ? 18  ARG A HD3  4  
ATOM 5835  H HE   . ARG A 1 18  ? 6.944   -12.280 7.786   1.00 0.00 ? 18  ARG A HE   4  
ATOM 5836  H HH11 . ARG A 1 18  ? 8.225   -12.038 4.558   1.00 0.00 ? 18  ARG A HH11 4  
ATOM 5837  H HH12 . ARG A 1 18  ? 8.787   -13.676 4.518   1.00 0.00 ? 18  ARG A HH12 4  
ATOM 5838  H HH21 . ARG A 1 18  ? 7.679   -14.439 7.745   1.00 0.00 ? 18  ARG A HH21 4  
ATOM 5839  H HH22 . ARG A 1 18  ? 8.474   -15.042 6.331   1.00 0.00 ? 18  ARG A HH22 4  
ATOM 5840  N N    . TYR A 1 19  ? 10.105  -6.817  6.431   1.00 0.00 ? 19  TYR A N    4  
ATOM 5841  C CA   . TYR A 1 19  ? 10.419  -5.957  5.297   1.00 0.00 ? 19  TYR A CA   4  
ATOM 5842  C C    . TYR A 1 19  ? 11.514  -4.957  5.657   1.00 0.00 ? 19  TYR A C    4  
ATOM 5843  O O    . TYR A 1 19  ? 11.697  -3.949  4.977   1.00 0.00 ? 19  TYR A O    4  
ATOM 5844  C CB   . TYR A 1 19  ? 9.166   -5.213  4.832   1.00 0.00 ? 19  TYR A CB   4  
ATOM 5845  C CG   . TYR A 1 19  ? 8.084   -6.123  4.296   1.00 0.00 ? 19  TYR A CG   4  
ATOM 5846  C CD1  . TYR A 1 19  ? 8.228   -6.758  3.069   1.00 0.00 ? 19  TYR A CD1  4  
ATOM 5847  C CD2  . TYR A 1 19  ? 6.919   -6.350  5.018   1.00 0.00 ? 19  TYR A CD2  4  
ATOM 5848  C CE1  . TYR A 1 19  ? 7.242   -7.590  2.575   1.00 0.00 ? 19  TYR A CE1  4  
ATOM 5849  C CE2  . TYR A 1 19  ? 5.928   -7.181  4.533   1.00 0.00 ? 19  TYR A CE2  4  
ATOM 5850  C CZ   . TYR A 1 19  ? 6.094   -7.799  3.311   1.00 0.00 ? 19  TYR A CZ   4  
ATOM 5851  O OH   . TYR A 1 19  ? 5.110   -8.628  2.824   1.00 0.00 ? 19  TYR A OH   4  
ATOM 5852  H H    . TYR A 1 19  ? 9.572   -6.457  7.171   1.00 0.00 ? 19  TYR A H    4  
ATOM 5853  H HA   . TYR A 1 19  ? 10.772  -6.585  4.492   1.00 0.00 ? 19  TYR A HA   4  
ATOM 5854  H HB2  . TYR A 1 19  ? 8.753   -4.662  5.663   1.00 0.00 ? 19  TYR A HB2  4  
ATOM 5855  H HB3  . TYR A 1 19  ? 9.437   -4.521  4.047   1.00 0.00 ? 19  TYR A HB3  4  
ATOM 5856  H HD1  . TYR A 1 19  ? 9.129   -6.593  2.495   1.00 0.00 ? 19  TYR A HD1  4  
ATOM 5857  H HD2  . TYR A 1 19  ? 6.792   -5.864  5.975   1.00 0.00 ? 19  TYR A HD2  4  
ATOM 5858  H HE1  . TYR A 1 19  ? 7.372   -8.075  1.619   1.00 0.00 ? 19  TYR A HE1  4  
ATOM 5859  H HE2  . TYR A 1 19  ? 5.029   -7.345  5.109   1.00 0.00 ? 19  TYR A HE2  4  
ATOM 5860  H HH   . TYR A 1 19  ? 5.439   -9.530  2.790   1.00 0.00 ? 19  TYR A HH   4  
ATOM 5861  N N    . ALA A 1 20  ? 12.239  -5.247  6.732   1.00 0.00 ? 20  ALA A N    4  
ATOM 5862  C CA   . ALA A 1 20  ? 13.318  -4.376  7.183   1.00 0.00 ? 20  ALA A CA   4  
ATOM 5863  C C    . ALA A 1 20  ? 14.463  -4.354  6.176   1.00 0.00 ? 20  ALA A C    4  
ATOM 5864  O O    . ALA A 1 20  ? 15.267  -3.422  6.156   1.00 0.00 ? 20  ALA A O    4  
ATOM 5865  C CB   . ALA A 1 20  ? 13.821  -4.822  8.547   1.00 0.00 ? 20  ALA A CB   4  
ATOM 5866  H H    . ALA A 1 20  ? 12.045  -6.066  7.233   1.00 0.00 ? 20  ALA A H    4  
ATOM 5867  H HA   . ALA A 1 20  ? 12.920  -3.376  7.282   1.00 0.00 ? 20  ALA A HA   4  
ATOM 5868  H HB1  . ALA A 1 20  ? 13.290  -5.712  8.853   1.00 0.00 ? 20  ALA A HB1  4  
ATOM 5869  H HB2  . ALA A 1 20  ? 14.878  -5.036  8.489   1.00 0.00 ? 20  ALA A HB2  4  
ATOM 5870  H HB3  . ALA A 1 20  ? 13.652  -4.036  9.268   1.00 0.00 ? 20  ALA A HB3  4  
ATOM 5871  N N    . ASP A 1 21  ? 14.531  -5.386  5.342   1.00 0.00 ? 21  ASP A N    4  
ATOM 5872  C CA   . ASP A 1 21  ? 15.578  -5.485  4.331   1.00 0.00 ? 21  ASP A CA   4  
ATOM 5873  C C    . ASP A 1 21  ? 15.399  -4.416  3.258   1.00 0.00 ? 21  ASP A C    4  
ATOM 5874  O O    . ASP A 1 21  ? 16.374  -3.931  2.682   1.00 0.00 ? 21  ASP A O    4  
ATOM 5875  C CB   . ASP A 1 21  ? 15.569  -6.874  3.692   1.00 0.00 ? 21  ASP A CB   4  
ATOM 5876  C CG   . ASP A 1 21  ? 14.442  -7.045  2.692   1.00 0.00 ? 21  ASP A CG   4  
ATOM 5877  O OD1  . ASP A 1 21  ? 13.275  -7.144  3.125   1.00 0.00 ? 21  ASP A OD1  4  
ATOM 5878  O OD2  . ASP A 1 21  ? 14.727  -7.079  1.476   1.00 0.00 ? 21  ASP A OD2  4  
ATOM 5879  H H    . ASP A 1 21  ? 13.860  -6.098  5.407   1.00 0.00 ? 21  ASP A H    4  
ATOM 5880  H HA   . ASP A 1 21  ? 16.527  -5.330  4.821   1.00 0.00 ? 21  ASP A HA   4  
ATOM 5881  H HB2  . ASP A 1 21  ? 16.507  -7.034  3.180   1.00 0.00 ? 21  ASP A HB2  4  
ATOM 5882  H HB3  . ASP A 1 21  ? 15.455  -7.619  4.466   1.00 0.00 ? 21  ASP A HB3  4  
ATOM 5883  N N    . LEU A 1 22  ? 14.149  -4.055  2.992   1.00 0.00 ? 22  LEU A N    4  
ATOM 5884  C CA   . LEU A 1 22  ? 13.842  -3.044  1.986   1.00 0.00 ? 22  LEU A CA   4  
ATOM 5885  C C    . LEU A 1 22  ? 14.674  -1.784  2.209   1.00 0.00 ? 22  LEU A C    4  
ATOM 5886  O O    . LEU A 1 22  ? 15.067  -1.460  3.330   1.00 0.00 ? 22  LEU A O    4  
ATOM 5887  C CB   . LEU A 1 22  ? 12.352  -2.698  2.020   1.00 0.00 ? 22  LEU A CB   4  
ATOM 5888  C CG   . LEU A 1 22  ? 11.387  -3.881  1.943   1.00 0.00 ? 22  LEU A CG   4  
ATOM 5889  C CD1  . LEU A 1 22  ? 9.951   -3.392  1.837   1.00 0.00 ? 22  LEU A CD1  4  
ATOM 5890  C CD2  . LEU A 1 22  ? 11.735  -4.778  0.765   1.00 0.00 ? 22  LEU A CD2  4  
ATOM 5891  H H    . LEU A 1 22  ? 13.414  -4.477  3.483   1.00 0.00 ? 22  LEU A H    4  
ATOM 5892  H HA   . LEU A 1 22  ? 14.086  -3.455  1.018   1.00 0.00 ? 22  LEU A HA   4  
ATOM 5893  H HB2  . LEU A 1 22  ? 12.156  -2.170  2.941   1.00 0.00 ? 22  LEU A HB2  4  
ATOM 5894  H HB3  . LEU A 1 22  ? 12.146  -2.046  1.183   1.00 0.00 ? 22  LEU A HB3  4  
ATOM 5895  H HG   . LEU A 1 22  ? 11.473  -4.467  2.848   1.00 0.00 ? 22  LEU A HG   4  
ATOM 5896  H HD11 . LEU A 1 22  ? 9.276   -4.221  1.986   1.00 0.00 ? 22  LEU A HD11 4  
ATOM 5897  H HD12 . LEU A 1 22  ? 9.787   -2.966  0.858   1.00 0.00 ? 22  LEU A HD12 4  
ATOM 5898  H HD13 . LEU A 1 22  ? 9.770   -2.639  2.591   1.00 0.00 ? 22  LEU A HD13 4  
ATOM 5899  H HD21 . LEU A 1 22  ? 12.465  -5.511  1.074   1.00 0.00 ? 22  LEU A HD21 4  
ATOM 5900  H HD22 . LEU A 1 22  ? 12.145  -4.178  -0.035  1.00 0.00 ? 22  LEU A HD22 4  
ATOM 5901  H HD23 . LEU A 1 22  ? 10.844  -5.280  0.419   1.00 0.00 ? 22  LEU A HD23 4  
ATOM 5902  N N    . PRO A 1 23  ? 14.947  -1.055  1.117   1.00 0.00 ? 23  PRO A N    4  
ATOM 5903  C CA   . PRO A 1 23  ? 15.732  0.182   1.167   1.00 0.00 ? 23  PRO A CA   4  
ATOM 5904  C C    . PRO A 1 23  ? 14.982  1.317   1.858   1.00 0.00 ? 23  PRO A C    4  
ATOM 5905  O O    . PRO A 1 23  ? 15.518  1.979   2.745   1.00 0.00 ? 23  PRO A O    4  
ATOM 5906  C CB   . PRO A 1 23  ? 15.964  0.515   -0.308  1.00 0.00 ? 23  PRO A CB   4  
ATOM 5907  C CG   . PRO A 1 23  ? 14.832  -0.133  -1.026  1.00 0.00 ? 23  PRO A CG   4  
ATOM 5908  C CD   . PRO A 1 23  ? 14.510  -1.381  -0.251  1.00 0.00 ? 23  PRO A CD   4  
ATOM 5909  H HA   . PRO A 1 23  ? 16.682  0.030   1.658   1.00 0.00 ? 23  PRO A HA   4  
ATOM 5910  H HB2  . PRO A 1 23  ? 15.957  1.588   -0.444  1.00 0.00 ? 23  PRO A HB2  4  
ATOM 5911  H HB3  . PRO A 1 23  ? 16.915  0.114   -0.626  1.00 0.00 ? 23  PRO A HB3  4  
ATOM 5912  H HG2  . PRO A 1 23  ? 13.979  0.529   -1.042  1.00 0.00 ? 23  PRO A HG2  4  
ATOM 5913  H HG3  . PRO A 1 23  ? 15.132  -0.385  -2.033  1.00 0.00 ? 23  PRO A HG3  4  
ATOM 5914  H HD2  . PRO A 1 23  ? 13.449  -1.581  -0.280  1.00 0.00 ? 23  PRO A HD2  4  
ATOM 5915  H HD3  . PRO A 1 23  ? 15.065  -2.221  -0.642  1.00 0.00 ? 23  PRO A HD3  4  
ATOM 5916  N N    . GLY A 1 24  ? 13.737  1.535   1.444   1.00 0.00 ? 24  GLY A N    4  
ATOM 5917  C CA   . GLY A 1 24  ? 12.934  2.590   2.034   1.00 0.00 ? 24  GLY A CA   4  
ATOM 5918  C C    . GLY A 1 24  ? 12.635  2.342   3.499   1.00 0.00 ? 24  GLY A C    4  
ATOM 5919  O O    . GLY A 1 24  ? 13.361  1.609   4.170   1.00 0.00 ? 24  GLY A O    4  
ATOM 5920  H H    . GLY A 1 24  ? 13.361  0.976   0.732   1.00 0.00 ? 24  GLY A H    4  
ATOM 5921  H HA2  . GLY A 1 24  ? 13.463  3.527   1.939   1.00 0.00 ? 24  GLY A HA2  4  
ATOM 5922  H HA3  . GLY A 1 24  ? 12.000  2.660   1.495   1.00 0.00 ? 24  GLY A HA3  4  
ATOM 5923  N N    . GLU A 1 25  ? 11.565  2.954   3.996   1.00 0.00 ? 25  GLU A N    4  
ATOM 5924  C CA   . GLU A 1 25  ? 11.175  2.796   5.392   1.00 0.00 ? 25  GLU A CA   4  
ATOM 5925  C C    . GLU A 1 25  ? 9.710   2.385   5.504   1.00 0.00 ? 25  GLU A C    4  
ATOM 5926  O O    . GLU A 1 25  ? 8.832   2.999   4.897   1.00 0.00 ? 25  GLU A O    4  
ATOM 5927  C CB   . GLU A 1 25  ? 11.411  4.098   6.160   1.00 0.00 ? 25  GLU A CB   4  
ATOM 5928  C CG   . GLU A 1 25  ? 11.581  3.899   7.657   1.00 0.00 ? 25  GLU A CG   4  
ATOM 5929  C CD   . GLU A 1 25  ? 12.352  5.029   8.312   1.00 0.00 ? 25  GLU A CD   4  
ATOM 5930  O OE1  . GLU A 1 25  ? 13.596  4.941   8.376   1.00 0.00 ? 25  GLU A OE1  4  
ATOM 5931  O OE2  . GLU A 1 25  ? 11.710  6.002   8.760   1.00 0.00 ? 25  GLU A OE2  4  
ATOM 5932  H H    . GLU A 1 25  ? 11.026  3.525   3.410   1.00 0.00 ? 25  GLU A H    4  
ATOM 5933  H HA   . GLU A 1 25  ? 11.789  2.019   5.822   1.00 0.00 ? 25  GLU A HA   4  
ATOM 5934  H HB2  . GLU A 1 25  ? 12.302  4.573   5.777   1.00 0.00 ? 25  GLU A HB2  4  
ATOM 5935  H HB3  . GLU A 1 25  ? 10.568  4.754   6.000   1.00 0.00 ? 25  GLU A HB3  4  
ATOM 5936  H HG2  . GLU A 1 25  ? 10.605  3.839   8.113   1.00 0.00 ? 25  GLU A HG2  4  
ATOM 5937  H HG3  . GLU A 1 25  ? 12.114  2.975   7.826   1.00 0.00 ? 25  GLU A HG3  4  
ATOM 5938  N N    . LEU A 1 26  ? 9.454   1.340   6.285   1.00 0.00 ? 26  LEU A N    4  
ATOM 5939  C CA   . LEU A 1 26  ? 8.095   0.845   6.477   1.00 0.00 ? 26  LEU A CA   4  
ATOM 5940  C C    . LEU A 1 26  ? 7.245   1.865   7.227   1.00 0.00 ? 26  LEU A C    4  
ATOM 5941  O O    . LEU A 1 26  ? 7.639   2.362   8.282   1.00 0.00 ? 26  LEU A O    4  
ATOM 5942  C CB   . LEU A 1 26  ? 8.118   -0.479  7.244   1.00 0.00 ? 26  LEU A CB   4  
ATOM 5943  C CG   . LEU A 1 26  ? 6.887   -1.371  7.080   1.00 0.00 ? 26  LEU A CG   4  
ATOM 5944  C CD1  . LEU A 1 26  ? 6.995   -2.203  5.812   1.00 0.00 ? 26  LEU A CD1  4  
ATOM 5945  C CD2  . LEU A 1 26  ? 6.713   -2.268  8.297   1.00 0.00 ? 26  LEU A CD2  4  
ATOM 5946  H H    . LEU A 1 26  ? 10.194  0.892   6.742   1.00 0.00 ? 26  LEU A H    4  
ATOM 5947  H HA   . LEU A 1 26  ? 7.662   0.679   5.502   1.00 0.00 ? 26  LEU A HA   4  
ATOM 5948  H HB2  . LEU A 1 26  ? 8.978   -1.039  6.910   1.00 0.00 ? 26  LEU A HB2  4  
ATOM 5949  H HB3  . LEU A 1 26  ? 8.225   -0.250  8.294   1.00 0.00 ? 26  LEU A HB3  4  
ATOM 5950  H HG   . LEU A 1 26  ? 6.007   -0.747  6.995   1.00 0.00 ? 26  LEU A HG   4  
ATOM 5951  H HD11 . LEU A 1 26  ? 6.249   -1.878  5.103   1.00 0.00 ? 26  LEU A HD11 4  
ATOM 5952  H HD12 . LEU A 1 26  ? 6.835   -3.244  6.051   1.00 0.00 ? 26  LEU A HD12 4  
ATOM 5953  H HD13 . LEU A 1 26  ? 7.979   -2.080  5.384   1.00 0.00 ? 26  LEU A HD13 4  
ATOM 5954  H HD21 . LEU A 1 26  ? 7.253   -1.849  9.133   1.00 0.00 ? 26  LEU A HD21 4  
ATOM 5955  H HD22 . LEU A 1 26  ? 7.099   -3.253  8.076   1.00 0.00 ? 26  LEU A HD22 4  
ATOM 5956  H HD23 . LEU A 1 26  ? 5.665   -2.339  8.545   1.00 0.00 ? 26  LEU A HD23 4  
ATOM 5957  N N    . HIS A 1 27  ? 6.074   2.171   6.676   1.00 0.00 ? 27  HIS A N    4  
ATOM 5958  C CA   . HIS A 1 27  ? 5.166   3.130   7.294   1.00 0.00 ? 27  HIS A CA   4  
ATOM 5959  C C    . HIS A 1 27  ? 3.739   2.591   7.315   1.00 0.00 ? 27  HIS A C    4  
ATOM 5960  O O    . HIS A 1 27  ? 3.045   2.605   6.298   1.00 0.00 ? 27  HIS A O    4  
ATOM 5961  C CB   . HIS A 1 27  ? 5.209   4.462   6.545   1.00 0.00 ? 27  HIS A CB   4  
ATOM 5962  C CG   . HIS A 1 27  ? 6.264   5.399   7.049   1.00 0.00 ? 27  HIS A CG   4  
ATOM 5963  N ND1  . HIS A 1 27  ? 6.032   6.331   8.039   1.00 0.00 ? 27  HIS A ND1  4  
ATOM 5964  C CD2  . HIS A 1 27  ? 7.562   5.543   6.695   1.00 0.00 ? 27  HIS A CD2  4  
ATOM 5965  C CE1  . HIS A 1 27  ? 7.142   7.009   8.271   1.00 0.00 ? 27  HIS A CE1  4  
ATOM 5966  N NE2  . HIS A 1 27  ? 8.086   6.550   7.469   1.00 0.00 ? 27  HIS A NE2  4  
ATOM 5967  H H    . HIS A 1 27  ? 5.816   1.742   5.834   1.00 0.00 ? 27  HIS A H    4  
ATOM 5968  H HA   . HIS A 1 27  ? 5.493   3.289   8.311   1.00 0.00 ? 27  HIS A HA   4  
ATOM 5969  H HB2  . HIS A 1 27  ? 5.406   4.273   5.500   1.00 0.00 ? 27  HIS A HB2  4  
ATOM 5970  H HB3  . HIS A 1 27  ? 4.252   4.955   6.643   1.00 0.00 ? 27  HIS A HB3  4  
ATOM 5971  H HD1  . HIS A 1 27  ? 5.180   6.475   8.501   1.00 0.00 ? 27  HIS A HD1  4  
ATOM 5972  H HD2  . HIS A 1 27  ? 8.090   4.973   5.943   1.00 0.00 ? 27  HIS A HD2  4  
ATOM 5973  H HE1  . HIS A 1 27  ? 7.258   7.802   8.993   1.00 0.00 ? 27  HIS A HE1  4  
ATOM 5974  H HE2  . HIS A 1 27  ? 8.982   6.934   7.375   1.00 0.00 ? 27  HIS A HE2  4  
ATOM 5975  N N    . ILE A 1 28  ? 3.308   2.117   8.479   1.00 0.00 ? 28  ILE A N    4  
ATOM 5976  C CA   . ILE A 1 28  ? 1.964   1.574   8.632   1.00 0.00 ? 28  ILE A CA   4  
ATOM 5977  C C    . ILE A 1 28  ? 0.999   2.633   9.153   1.00 0.00 ? 28  ILE A C    4  
ATOM 5978  O O    . ILE A 1 28  ? 1.093   3.061   10.304  1.00 0.00 ? 28  ILE A O    4  
ATOM 5979  C CB   . ILE A 1 28  ? 1.949   0.367   9.589   1.00 0.00 ? 28  ILE A CB   4  
ATOM 5980  C CG1  . ILE A 1 28  ? 2.961   -0.686  9.132   1.00 0.00 ? 28  ILE A CG1  4  
ATOM 5981  C CG2  . ILE A 1 28  ? 0.552   -0.230  9.667   1.00 0.00 ? 28  ILE A CG2  4  
ATOM 5982  C CD1  . ILE A 1 28  ? 3.354   -1.659  10.222  1.00 0.00 ? 28  ILE A CD1  4  
ATOM 5983  H H    . ILE A 1 28  ? 3.908   2.133   9.254   1.00 0.00 ? 28  ILE A H    4  
ATOM 5984  H HA   . ILE A 1 28  ? 1.627   1.241   7.661   1.00 0.00 ? 28  ILE A HA   4  
ATOM 5985  H HB   . ILE A 1 28  ? 2.222   0.714   10.574  1.00 0.00 ? 28  ILE A HB   4  
ATOM 5986  H HG12 . ILE A 1 28  ? 2.537   -1.254  8.319   1.00 0.00 ? 28  ILE A HG12 4  
ATOM 5987  H HG13 . ILE A 1 28  ? 3.857   -0.189  8.790   1.00 0.00 ? 28  ILE A HG13 4  
ATOM 5988  H HG21 . ILE A 1 28  ? 0.566   -1.231  9.261   1.00 0.00 ? 28  ILE A HG21 4  
ATOM 5989  H HG22 . ILE A 1 28  ? 0.233   -0.265  10.698  1.00 0.00 ? 28  ILE A HG22 4  
ATOM 5990  H HG23 . ILE A 1 28  ? -0.133  0.380   9.098   1.00 0.00 ? 28  ILE A HG23 4  
ATOM 5991  H HD11 . ILE A 1 28  ? 4.403   -1.540  10.450  1.00 0.00 ? 28  ILE A HD11 4  
ATOM 5992  H HD12 . ILE A 1 28  ? 2.768   -1.465  11.107  1.00 0.00 ? 28  ILE A HD12 4  
ATOM 5993  H HD13 . ILE A 1 28  ? 3.173   -2.670  9.884   1.00 0.00 ? 28  ILE A HD13 4  
ATOM 5994  N N    . ILE A 1 29  ? 0.070   3.051   8.299   1.00 0.00 ? 29  ILE A N    4  
ATOM 5995  C CA   . ILE A 1 29  ? -0.914  4.058   8.674   1.00 0.00 ? 29  ILE A CA   4  
ATOM 5996  C C    . ILE A 1 29  ? -2.334  3.520   8.530   1.00 0.00 ? 29  ILE A C    4  
ATOM 5997  O O    . ILE A 1 29  ? -2.627  2.756   7.611   1.00 0.00 ? 29  ILE A O    4  
ATOM 5998  C CB   . ILE A 1 29  ? -0.771  5.331   7.819   1.00 0.00 ? 29  ILE A CB   4  
ATOM 5999  C CG1  . ILE A 1 29  ? -1.145  5.041   6.365   1.00 0.00 ? 29  ILE A CG1  4  
ATOM 6000  C CG2  . ILE A 1 29  ? 0.648   5.872   7.909   1.00 0.00 ? 29  ILE A CG2  4  
ATOM 6001  C CD1  . ILE A 1 29  ? -1.364  6.287   5.536   1.00 0.00 ? 29  ILE A CD1  4  
ATOM 6002  H H    . ILE A 1 29  ? 0.047   2.673   7.396   1.00 0.00 ? 29  ILE A H    4  
ATOM 6003  H HA   . ILE A 1 29  ? -0.744  4.322   9.708   1.00 0.00 ? 29  ILE A HA   4  
ATOM 6004  H HB   . ILE A 1 29  ? -1.441  6.080   8.214   1.00 0.00 ? 29  ILE A HB   4  
ATOM 6005  H HG12 . ILE A 1 29  ? -0.354  4.471   5.903   1.00 0.00 ? 29  ILE A HG12 4  
ATOM 6006  H HG13 . ILE A 1 29  ? -2.058  4.463   6.345   1.00 0.00 ? 29  ILE A HG13 4  
ATOM 6007  H HG21 . ILE A 1 29  ? 1.138   5.457   8.778   1.00 0.00 ? 29  ILE A HG21 4  
ATOM 6008  H HG22 . ILE A 1 29  ? 1.196   5.594   7.021   1.00 0.00 ? 29  ILE A HG22 4  
ATOM 6009  H HG23 . ILE A 1 29  ? 0.620   6.948   7.992   1.00 0.00 ? 29  ILE A HG23 4  
ATOM 6010  H HD11 . ILE A 1 29  ? -2.068  6.075   4.745   1.00 0.00 ? 29  ILE A HD11 4  
ATOM 6011  H HD12 . ILE A 1 29  ? -1.754  7.074   6.165   1.00 0.00 ? 29  ILE A HD12 4  
ATOM 6012  H HD13 . ILE A 1 29  ? -0.425  6.602   5.106   1.00 0.00 ? 29  ILE A HD13 4  
ATOM 6013  N N    . GLU A 1 30  ? -3.210  3.926   9.443   1.00 0.00 ? 30  GLU A N    4  
ATOM 6014  C CA   . GLU A 1 30  ? -4.600  3.484   9.417   1.00 0.00 ? 30  GLU A CA   4  
ATOM 6015  C C    . GLU A 1 30  ? -5.494  4.542   8.776   1.00 0.00 ? 30  GLU A C    4  
ATOM 6016  O O    . GLU A 1 30  ? -5.623  5.655   9.288   1.00 0.00 ? 30  GLU A O    4  
ATOM 6017  C CB   . GLU A 1 30  ? -5.088  3.178   10.834  1.00 0.00 ? 30  GLU A CB   4  
ATOM 6018  C CG   . GLU A 1 30  ? -4.860  1.737   11.258  1.00 0.00 ? 30  GLU A CG   4  
ATOM 6019  C CD   . GLU A 1 30  ? -4.672  1.592   12.756  1.00 0.00 ? 30  GLU A CD   4  
ATOM 6020  O OE1  . GLU A 1 30  ? -5.239  2.413   13.506  1.00 0.00 ? 30  GLU A OE1  4  
ATOM 6021  O OE2  . GLU A 1 30  ? -3.958  0.658   13.177  1.00 0.00 ? 30  GLU A OE2  4  
ATOM 6022  H H    . GLU A 1 30  ? -2.915  4.535   10.152  1.00 0.00 ? 30  GLU A H    4  
ATOM 6023  H HA   . GLU A 1 30  ? -4.650  2.582   8.826   1.00 0.00 ? 30  GLU A HA   4  
ATOM 6024  H HB2  . GLU A 1 30  ? -4.569  3.822   11.528  1.00 0.00 ? 30  GLU A HB2  4  
ATOM 6025  H HB3  . GLU A 1 30  ? -6.147  3.384   10.889  1.00 0.00 ? 30  GLU A HB3  4  
ATOM 6026  H HG2  . GLU A 1 30  ? -5.714  1.148   10.960  1.00 0.00 ? 30  GLU A HG2  4  
ATOM 6027  H HG3  . GLU A 1 30  ? -3.976  1.364   10.761  1.00 0.00 ? 30  GLU A HG3  4  
ATOM 6028  N N    . LEU A 1 31  ? -6.109  4.187   7.654   1.00 0.00 ? 31  LEU A N    4  
ATOM 6029  C CA   . LEU A 1 31  ? -6.992  5.104   6.942   1.00 0.00 ? 31  LEU A CA   4  
ATOM 6030  C C    . LEU A 1 31  ? -8.412  4.552   6.874   1.00 0.00 ? 31  LEU A C    4  
ATOM 6031  O O    . LEU A 1 31  ? -8.636  3.451   6.373   1.00 0.00 ? 31  LEU A O    4  
ATOM 6032  C CB   . LEU A 1 31  ? -6.464  5.358   5.529   1.00 0.00 ? 31  LEU A CB   4  
ATOM 6033  C CG   . LEU A 1 31  ? -4.972  5.674   5.417   1.00 0.00 ? 31  LEU A CG   4  
ATOM 6034  C CD1  . LEU A 1 31  ? -4.523  5.623   3.965   1.00 0.00 ? 31  LEU A CD1  4  
ATOM 6035  C CD2  . LEU A 1 31  ? -4.667  7.035   6.024   1.00 0.00 ? 31  LEU A CD2  4  
ATOM 6036  H H    . LEU A 1 31  ? -5.968  3.286   7.295   1.00 0.00 ? 31  LEU A H    4  
ATOM 6037  H HA   . LEU A 1 31  ? -7.007  6.038   7.485   1.00 0.00 ? 31  LEU A HA   4  
ATOM 6038  H HB2  . LEU A 1 31  ? -6.660  4.476   4.939   1.00 0.00 ? 31  LEU A HB2  4  
ATOM 6039  H HB3  . LEU A 1 31  ? -7.012  6.194   5.117   1.00 0.00 ? 31  LEU A HB3  4  
ATOM 6040  H HG   . LEU A 1 31  ? -4.411  4.929   5.965   1.00 0.00 ? 31  LEU A HG   4  
ATOM 6041  H HD11 . LEU A 1 31  ? -3.587  5.090   3.895   1.00 0.00 ? 31  LEU A HD11 4  
ATOM 6042  H HD12 . LEU A 1 31  ? -4.393  6.629   3.593   1.00 0.00 ? 31  LEU A HD12 4  
ATOM 6043  H HD13 . LEU A 1 31  ? -5.272  5.116   3.374   1.00 0.00 ? 31  LEU A HD13 4  
ATOM 6044  H HD21 . LEU A 1 31  ? -4.137  7.640   5.303   1.00 0.00 ? 31  LEU A HD21 4  
ATOM 6045  H HD22 . LEU A 1 31  ? -4.057  6.908   6.906   1.00 0.00 ? 31  LEU A HD22 4  
ATOM 6046  H HD23 . LEU A 1 31  ? -5.592  7.524   6.293   1.00 0.00 ? 31  LEU A HD23 4  
ATOM 6047  N N    . GLU A 1 32  ? -9.367  5.325   7.381   1.00 0.00 ? 32  GLU A N    4  
ATOM 6048  C CA   . GLU A 1 32  ? -10.766 4.913   7.376   1.00 0.00 ? 32  GLU A CA   4  
ATOM 6049  C C    . GLU A 1 32  ? -11.423 5.230   6.036   1.00 0.00 ? 32  GLU A C    4  
ATOM 6050  O O    . GLU A 1 32  ? -11.627 6.395   5.691   1.00 0.00 ? 32  GLU A O    4  
ATOM 6051  C CB   . GLU A 1 32  ? -11.529 5.606   8.507   1.00 0.00 ? 32  GLU A CB   4  
ATOM 6052  C CG   . GLU A 1 32  ? -12.688 4.787   9.051   1.00 0.00 ? 32  GLU A CG   4  
ATOM 6053  C CD   . GLU A 1 32  ? -13.664 5.621   9.857   1.00 0.00 ? 32  GLU A CD   4  
ATOM 6054  O OE1  . GLU A 1 32  ? -13.206 6.420   10.702  1.00 0.00 ? 32  GLU A OE1  4  
ATOM 6055  O OE2  . GLU A 1 32  ? -14.886 5.475   9.644   1.00 0.00 ? 32  GLU A OE2  4  
ATOM 6056  H H    . GLU A 1 32  ? -9.126  6.193   7.767   1.00 0.00 ? 32  GLU A H    4  
ATOM 6057  H HA   . GLU A 1 32  ? -10.797 3.846   7.535   1.00 0.00 ? 32  GLU A HA   4  
ATOM 6058  H HB2  . GLU A 1 32  ? -10.844 5.806   9.318   1.00 0.00 ? 32  GLU A HB2  4  
ATOM 6059  H HB3  . GLU A 1 32  ? -11.920 6.543   8.139   1.00 0.00 ? 32  GLU A HB3  4  
ATOM 6060  H HG2  . GLU A 1 32  ? -13.218 4.342   8.222   1.00 0.00 ? 32  GLU A HG2  4  
ATOM 6061  H HG3  . GLU A 1 32  ? -12.294 4.006   9.685   1.00 0.00 ? 32  GLU A HG3  4  
ATOM 6062  N N    . LYS A 1 33  ? -11.750 4.186   5.282   1.00 0.00 ? 33  LYS A N    4  
ATOM 6063  C CA   . LYS A 1 33  ? -12.384 4.351   3.980   1.00 0.00 ? 33  LYS A CA   4  
ATOM 6064  C C    . LYS A 1 33  ? -13.333 5.545   3.984   1.00 0.00 ? 33  LYS A C    4  
ATOM 6065  O O    . LYS A 1 33  ? -14.264 5.607   4.787   1.00 0.00 ? 33  LYS A O    4  
ATOM 6066  C CB   . LYS A 1 33  ? -13.147 3.081   3.596   1.00 0.00 ? 33  LYS A CB   4  
ATOM 6067  C CG   . LYS A 1 33  ? -12.245 1.894   3.304   1.00 0.00 ? 33  LYS A CG   4  
ATOM 6068  C CD   . LYS A 1 33  ? -12.897 0.923   2.335   1.00 0.00 ? 33  LYS A CD   4  
ATOM 6069  C CE   . LYS A 1 33  ? -13.847 -0.025  3.050   1.00 0.00 ? 33  LYS A CE   4  
ATOM 6070  N NZ   . LYS A 1 33  ? -15.211 0.556   3.190   1.00 0.00 ? 33  LYS A NZ   4  
ATOM 6071  H H    . LYS A 1 33  ? -11.562 3.282   5.611   1.00 0.00 ? 33  LYS A H    4  
ATOM 6072  H HA   . LYS A 1 33  ? -11.607 4.527   3.252   1.00 0.00 ? 33  LYS A HA   4  
ATOM 6073  H HB2  . LYS A 1 33  ? -13.807 2.813   4.408   1.00 0.00 ? 33  LYS A HB2  4  
ATOM 6074  H HB3  . LYS A 1 33  ? -13.738 3.282   2.715   1.00 0.00 ? 33  LYS A HB3  4  
ATOM 6075  H HG2  . LYS A 1 33  ? -11.323 2.253   2.871   1.00 0.00 ? 33  LYS A HG2  4  
ATOM 6076  H HG3  . LYS A 1 33  ? -12.034 1.378   4.229   1.00 0.00 ? 33  LYS A HG3  4  
ATOM 6077  H HD2  . LYS A 1 33  ? -13.454 1.483   1.597   1.00 0.00 ? 33  LYS A HD2  4  
ATOM 6078  H HD3  . LYS A 1 33  ? -12.127 0.345   1.844   1.00 0.00 ? 33  LYS A HD3  4  
ATOM 6079  H HE2  . LYS A 1 33  ? -13.913 -0.942  2.486   1.00 0.00 ? 33  LYS A HE2  4  
ATOM 6080  H HE3  . LYS A 1 33  ? -13.452 -0.235  4.033   1.00 0.00 ? 33  LYS A HE3  4  
ATOM 6081  H HZ1  . LYS A 1 33  ? -15.877 -0.170  3.524   1.00 0.00 ? 33  LYS A HZ1  4  
ATOM 6082  H HZ2  . LYS A 1 33  ? -15.541 0.917   2.272   1.00 0.00 ? 33  LYS A HZ2  4  
ATOM 6083  H HZ3  . LYS A 1 33  ? -15.198 1.340   3.873   1.00 0.00 ? 33  LYS A HZ3  4  
ATOM 6084  N N    . ASP A 1 34  ? -13.093 6.489   3.080   1.00 0.00 ? 34  ASP A N    4  
ATOM 6085  C CA   . ASP A 1 34  ? -13.928 7.680   2.978   1.00 0.00 ? 34  ASP A CA   4  
ATOM 6086  C C    . ASP A 1 34  ? -15.211 7.380   2.208   1.00 0.00 ? 34  ASP A C    4  
ATOM 6087  O O    . ASP A 1 34  ? -15.420 6.260   1.742   1.00 0.00 ? 34  ASP A O    4  
ATOM 6088  C CB   . ASP A 1 34  ? -13.160 8.810   2.292   1.00 0.00 ? 34  ASP A CB   4  
ATOM 6089  C CG   . ASP A 1 34  ? -13.776 10.171  2.554   1.00 0.00 ? 34  ASP A CG   4  
ATOM 6090  O OD1  . ASP A 1 34  ? -14.078 10.470  3.728   1.00 0.00 ? 34  ASP A OD1  4  
ATOM 6091  O OD2  . ASP A 1 34  ? -13.955 10.937  1.584   1.00 0.00 ? 34  ASP A OD2  4  
ATOM 6092  H H    . ASP A 1 34  ? -12.336 6.382   2.467   1.00 0.00 ? 34  ASP A H    4  
ATOM 6093  H HA   . ASP A 1 34  ? -14.188 7.989   3.979   1.00 0.00 ? 34  ASP A HA   4  
ATOM 6094  H HB2  . ASP A 1 34  ? -12.143 8.820   2.658   1.00 0.00 ? 34  ASP A HB2  4  
ATOM 6095  H HB3  . ASP A 1 34  ? -13.153 8.637   1.226   1.00 0.00 ? 34  ASP A HB3  4  
ATOM 6096  N N    . LYS A 1 35  ? -16.068 8.387   2.081   1.00 0.00 ? 35  LYS A N    4  
ATOM 6097  C CA   . LYS A 1 35  ? -17.330 8.233   1.368   1.00 0.00 ? 35  LYS A CA   4  
ATOM 6098  C C    . LYS A 1 35  ? -17.166 7.312   0.163   1.00 0.00 ? 35  LYS A C    4  
ATOM 6099  O O    . LYS A 1 35  ? -18.091 6.593   -0.211  1.00 0.00 ? 35  LYS A O    4  
ATOM 6100  C CB   . LYS A 1 35  ? -17.853 9.597   0.913   1.00 0.00 ? 35  LYS A CB   4  
ATOM 6101  C CG   . LYS A 1 35  ? -18.093 10.569  2.056   1.00 0.00 ? 35  LYS A CG   4  
ATOM 6102  C CD   . LYS A 1 35  ? -19.199 11.556  1.726   1.00 0.00 ? 35  LYS A CD   4  
ATOM 6103  C CE   . LYS A 1 35  ? -20.567 10.892  1.757   1.00 0.00 ? 35  LYS A CE   4  
ATOM 6104  N NZ   . LYS A 1 35  ? -21.667 11.890  1.857   1.00 0.00 ? 35  LYS A NZ   4  
ATOM 6105  H H    . LYS A 1 35  ? -15.845 9.257   2.475   1.00 0.00 ? 35  LYS A H    4  
ATOM 6106  H HA   . LYS A 1 35  ? -18.043 7.792   2.048   1.00 0.00 ? 35  LYS A HA   4  
ATOM 6107  H HB2  . LYS A 1 35  ? -17.134 10.038  0.239   1.00 0.00 ? 35  LYS A HB2  4  
ATOM 6108  H HB3  . LYS A 1 35  ? -18.787 9.455   0.388   1.00 0.00 ? 35  LYS A HB3  4  
ATOM 6109  H HG2  . LYS A 1 35  ? -18.374 10.011  2.938   1.00 0.00 ? 35  LYS A HG2  4  
ATOM 6110  H HG3  . LYS A 1 35  ? -17.180 11.115  2.250   1.00 0.00 ? 35  LYS A HG3  4  
ATOM 6111  H HD2  . LYS A 1 35  ? -19.184 12.356  2.451   1.00 0.00 ? 35  LYS A HD2  4  
ATOM 6112  H HD3  . LYS A 1 35  ? -19.027 11.960  0.738   1.00 0.00 ? 35  LYS A HD3  4  
ATOM 6113  H HE2  . LYS A 1 35  ? -20.694 10.318  0.851   1.00 0.00 ? 35  LYS A HE2  4  
ATOM 6114  H HE3  . LYS A 1 35  ? -20.613 10.231  2.610   1.00 0.00 ? 35  LYS A HE3  4  
ATOM 6115  H HZ1  . LYS A 1 35  ? -22.442 11.635  1.212   1.00 0.00 ? 35  LYS A HZ1  4  
ATOM 6116  H HZ2  . LYS A 1 35  ? -21.316 12.835  1.601   1.00 0.00 ? 35  LYS A HZ2  4  
ATOM 6117  H HZ3  . LYS A 1 35  ? -22.035 11.920  2.829   1.00 0.00 ? 35  LYS A HZ3  4  
ATOM 6118  N N    . ASN A 1 36  ? -15.981 7.340   -0.440  1.00 0.00 ? 36  ASN A N    4  
ATOM 6119  C CA   . ASN A 1 36  ? -15.696 6.507   -1.603  1.00 0.00 ? 36  ASN A CA   4  
ATOM 6120  C C    . ASN A 1 36  ? -14.728 5.385   -1.243  1.00 0.00 ? 36  ASN A C    4  
ATOM 6121  O O    . ASN A 1 36  ? -14.835 4.271   -1.754  1.00 0.00 ? 36  ASN A O    4  
ATOM 6122  C CB   . ASN A 1 36  ? -15.112 7.357   -2.733  1.00 0.00 ? 36  ASN A CB   4  
ATOM 6123  C CG   . ASN A 1 36  ? -16.185 8.064   -3.539  1.00 0.00 ? 36  ASN A CG   4  
ATOM 6124  O OD1  . ASN A 1 36  ? -16.501 7.664   -4.659  1.00 0.00 ? 36  ASN A OD1  4  
ATOM 6125  N ND2  . ASN A 1 36  ? -16.750 9.122   -2.969  1.00 0.00 ? 36  ASN A ND2  4  
ATOM 6126  H H    . ASN A 1 36  ? -15.283 7.935   -0.095  1.00 0.00 ? 36  ASN A H    4  
ATOM 6127  H HA   . ASN A 1 36  ? -16.626 6.072   -1.935  1.00 0.00 ? 36  ASN A HA   4  
ATOM 6128  H HB2  . ASN A 1 36  ? -14.454 8.103   -2.312  1.00 0.00 ? 36  ASN A HB2  4  
ATOM 6129  H HB3  . ASN A 1 36  ? -14.548 6.721   -3.399  1.00 0.00 ? 36  ASN A HB3  4  
ATOM 6130  H HD21 . ASN A 1 36  ? -16.448 9.383   -2.074  1.00 0.00 ? 36  ASN A HD21 4  
ATOM 6131  H HD22 . ASN A 1 36  ? -17.447 9.598   -3.467  1.00 0.00 ? 36  ASN A HD22 4  
ATOM 6132  N N    . GLY A 1 37  ? -13.782 5.687   -0.358  1.00 0.00 ? 37  GLY A N    4  
ATOM 6133  C CA   . GLY A 1 37  ? -12.809 4.693   0.055   1.00 0.00 ? 37  GLY A CA   4  
ATOM 6134  C C    . GLY A 1 37  ? -11.381 5.178   -0.102  1.00 0.00 ? 37  GLY A C    4  
ATOM 6135  O O    . GLY A 1 37  ? -11.145 6.351   -0.396  1.00 0.00 ? 37  GLY A O    4  
ATOM 6136  H H    . GLY A 1 37  ? -13.745 6.592   0.016   1.00 0.00 ? 37  GLY A H    4  
ATOM 6137  H HA2  . GLY A 1 37  ? -12.981 4.445   1.092   1.00 0.00 ? 37  GLY A HA2  4  
ATOM 6138  H HA3  . GLY A 1 37  ? -12.942 3.804   -0.543  1.00 0.00 ? 37  GLY A HA3  4  
ATOM 6139  N N    . LEU A 1 38  ? -10.426 4.277   0.096   1.00 0.00 ? 38  LEU A N    4  
ATOM 6140  C CA   . LEU A 1 38  ? -9.013  4.619   -0.024  1.00 0.00 ? 38  LEU A CA   4  
ATOM 6141  C C    . LEU A 1 38  ? -8.643  4.901   -1.477  1.00 0.00 ? 38  LEU A C    4  
ATOM 6142  O O    . LEU A 1 38  ? -8.168  4.018   -2.190  1.00 0.00 ? 38  LEU A O    4  
ATOM 6143  C CB   . LEU A 1 38  ? -8.145  3.486   0.525   1.00 0.00 ? 38  LEU A CB   4  
ATOM 6144  C CG   . LEU A 1 38  ? -8.614  2.856   1.837   1.00 0.00 ? 38  LEU A CG   4  
ATOM 6145  C CD1  . LEU A 1 38  ? -7.777  1.631   2.170   1.00 0.00 ? 38  LEU A CD1  4  
ATOM 6146  C CD2  . LEU A 1 38  ? -8.551  3.871   2.968   1.00 0.00 ? 38  LEU A CD2  4  
ATOM 6147  H H    . LEU A 1 38  ? -10.676 3.358   0.328   1.00 0.00 ? 38  LEU A H    4  
ATOM 6148  H HA   . LEU A 1 38  ? -8.838  5.511   0.559   1.00 0.00 ? 38  LEU A HA   4  
ATOM 6149  H HB2  . LEU A 1 38  ? -8.107  2.707   -0.221  1.00 0.00 ? 38  LEU A HB2  4  
ATOM 6150  H HB3  . LEU A 1 38  ? -7.150  3.880   0.682   1.00 0.00 ? 38  LEU A HB3  4  
ATOM 6151  H HG   . LEU A 1 38  ? -9.642  2.538   1.728   1.00 0.00 ? 38  LEU A HG   4  
ATOM 6152  H HD11 . LEU A 1 38  ? -7.059  1.460   1.382   1.00 0.00 ? 38  LEU A HD11 4  
ATOM 6153  H HD12 . LEU A 1 38  ? -8.421  0.769   2.263   1.00 0.00 ? 38  LEU A HD12 4  
ATOM 6154  H HD13 . LEU A 1 38  ? -7.257  1.793   3.102   1.00 0.00 ? 38  LEU A HD13 4  
ATOM 6155  H HD21 . LEU A 1 38  ? -8.251  3.375   3.880   1.00 0.00 ? 38  LEU A HD21 4  
ATOM 6156  H HD22 . LEU A 1 38  ? -9.525  4.318   3.106   1.00 0.00 ? 38  LEU A HD22 4  
ATOM 6157  H HD23 . LEU A 1 38  ? -7.833  4.640   2.723   1.00 0.00 ? 38  LEU A HD23 4  
ATOM 6158  N N    . GLY A 1 39  ? -8.862  6.140   -1.909  1.00 0.00 ? 39  GLY A N    4  
ATOM 6159  C CA   . GLY A 1 39  ? -8.544  6.516   -3.274  1.00 0.00 ? 39  GLY A CA   4  
ATOM 6160  C C    . GLY A 1 39  ? -7.051  6.627   -3.511  1.00 0.00 ? 39  GLY A C    4  
ATOM 6161  O O    . GLY A 1 39  ? -6.411  7.576   -3.056  1.00 0.00 ? 39  GLY A O    4  
ATOM 6162  H H    . GLY A 1 39  ? -9.243  6.803   -1.296  1.00 0.00 ? 39  GLY A H    4  
ATOM 6163  H HA2  . GLY A 1 39  ? -8.951  5.774   -3.945  1.00 0.00 ? 39  GLY A HA2  4  
ATOM 6164  H HA3  . GLY A 1 39  ? -9.002  7.471   -3.488  1.00 0.00 ? 39  GLY A HA3  4  
ATOM 6165  N N    . LEU A 1 40  ? -6.493  5.656   -4.225  1.00 0.00 ? 40  LEU A N    4  
ATOM 6166  C CA   . LEU A 1 40  ? -5.065  5.647   -4.521  1.00 0.00 ? 40  LEU A CA   4  
ATOM 6167  C C    . LEU A 1 40  ? -4.800  5.074   -5.910  1.00 0.00 ? 40  LEU A C    4  
ATOM 6168  O O    . LEU A 1 40  ? -5.352  4.038   -6.280  1.00 0.00 ? 40  LEU A O    4  
ATOM 6169  C CB   . LEU A 1 40  ? -4.311  4.832   -3.469  1.00 0.00 ? 40  LEU A CB   4  
ATOM 6170  C CG   . LEU A 1 40  ? -4.325  5.395   -2.047  1.00 0.00 ? 40  LEU A CG   4  
ATOM 6171  C CD1  . LEU A 1 40  ? -3.957  4.315   -1.042  1.00 0.00 ? 40  LEU A CD1  4  
ATOM 6172  C CD2  . LEU A 1 40  ? -3.377  6.579   -1.933  1.00 0.00 ? 40  LEU A CD2  4  
ATOM 6173  H H    . LEU A 1 40  ? -7.054  4.926   -4.561  1.00 0.00 ? 40  LEU A H    4  
ATOM 6174  H HA   . LEU A 1 40  ? -4.715  6.668   -4.494  1.00 0.00 ? 40  LEU A HA   4  
ATOM 6175  H HB2  . LEU A 1 40  ? -4.748  3.846   -3.439  1.00 0.00 ? 40  LEU A HB2  4  
ATOM 6176  H HB3  . LEU A 1 40  ? -3.280  4.758   -3.786  1.00 0.00 ? 40  LEU A HB3  4  
ATOM 6177  H HG   . LEU A 1 40  ? -5.323  5.741   -1.814  1.00 0.00 ? 40  LEU A HG   4  
ATOM 6178  H HD11 . LEU A 1 40  ? -3.854  4.756   -0.062  1.00 0.00 ? 40  LEU A HD11 4  
ATOM 6179  H HD12 . LEU A 1 40  ? -3.022  3.858   -1.331  1.00 0.00 ? 40  LEU A HD12 4  
ATOM 6180  H HD13 . LEU A 1 40  ? -4.733  3.564   -1.020  1.00 0.00 ? 40  LEU A HD13 4  
ATOM 6181  H HD21 . LEU A 1 40  ? -3.905  7.425   -1.518  1.00 0.00 ? 40  LEU A HD21 4  
ATOM 6182  H HD22 . LEU A 1 40  ? -3.001  6.836   -2.913  1.00 0.00 ? 40  LEU A HD22 4  
ATOM 6183  H HD23 . LEU A 1 40  ? -2.552  6.318   -1.287  1.00 0.00 ? 40  LEU A HD23 4  
ATOM 6184  N N    . SER A 1 41  ? -3.951  5.755   -6.674  1.00 0.00 ? 41  SER A N    4  
ATOM 6185  C CA   . SER A 1 41  ? -3.615  5.315   -8.022  1.00 0.00 ? 41  SER A CA   4  
ATOM 6186  C C    . SER A 1 41  ? -2.514  4.258   -7.990  1.00 0.00 ? 41  SER A C    4  
ATOM 6187  O O    . SER A 1 41  ? -1.383  4.535   -7.587  1.00 0.00 ? 41  SER A O    4  
ATOM 6188  C CB   . SER A 1 41  ? -3.170  6.505   -8.874  1.00 0.00 ? 41  SER A CB   4  
ATOM 6189  O OG   . SER A 1 41  ? -4.282  7.276   -9.294  1.00 0.00 ? 41  SER A OG   4  
ATOM 6190  H H    . SER A 1 41  ? -3.544  6.574   -6.322  1.00 0.00 ? 41  SER A H    4  
ATOM 6191  H HA   . SER A 1 41  ? -4.501  4.881   -8.461  1.00 0.00 ? 41  SER A HA   4  
ATOM 6192  H HB2  . SER A 1 41  ? -2.510  7.133   -8.294  1.00 0.00 ? 41  SER A HB2  4  
ATOM 6193  H HB3  . SER A 1 41  ? -2.647  6.144   -9.748  1.00 0.00 ? 41  SER A HB3  4  
ATOM 6194  H HG   . SER A 1 41  ? -5.052  6.708   -9.378  1.00 0.00 ? 41  SER A HG   4  
ATOM 6195  N N    . LEU A 1 42  ? -2.853  3.047   -8.417  1.00 0.00 ? 42  LEU A N    4  
ATOM 6196  C CA   . LEU A 1 42  ? -1.895  1.947   -8.438  1.00 0.00 ? 42  LEU A CA   4  
ATOM 6197  C C    . LEU A 1 42  ? -1.457  1.634   -9.865  1.00 0.00 ? 42  LEU A C    4  
ATOM 6198  O O    . LEU A 1 42  ? -2.249  1.723   -10.802 1.00 0.00 ? 42  LEU A O    4  
ATOM 6199  C CB   . LEU A 1 42  ? -2.505  0.701   -7.794  1.00 0.00 ? 42  LEU A CB   4  
ATOM 6200  C CG   . LEU A 1 42  ? -3.149  0.901   -6.422  1.00 0.00 ? 42  LEU A CG   4  
ATOM 6201  C CD1  . LEU A 1 42  ? -3.845  -0.373  -5.968  1.00 0.00 ? 42  LEU A CD1  4  
ATOM 6202  C CD2  . LEU A 1 42  ? -2.106  1.333   -5.401  1.00 0.00 ? 42  LEU A CD2  4  
ATOM 6203  H H    . LEU A 1 42  ? -3.769  2.887   -8.726  1.00 0.00 ? 42  LEU A H    4  
ATOM 6204  H HA   . LEU A 1 42  ? -1.030  2.251   -7.867  1.00 0.00 ? 42  LEU A HA   4  
ATOM 6205  H HB2  . LEU A 1 42  ? -3.263  0.321   -8.462  1.00 0.00 ? 42  LEU A HB2  4  
ATOM 6206  H HB3  . LEU A 1 42  ? -1.720  -0.034  -7.688  1.00 0.00 ? 42  LEU A HB3  4  
ATOM 6207  H HG   . LEU A 1 42  ? -3.894  1.682   -6.491  1.00 0.00 ? 42  LEU A HG   4  
ATOM 6208  H HD11 . LEU A 1 42  ? -4.885  -0.336  -6.256  1.00 0.00 ? 42  LEU A HD11 4  
ATOM 6209  H HD12 . LEU A 1 42  ? -3.772  -0.460  -4.894  1.00 0.00 ? 42  LEU A HD12 4  
ATOM 6210  H HD13 . LEU A 1 42  ? -3.372  -1.226  -6.431  1.00 0.00 ? 42  LEU A HD13 4  
ATOM 6211  H HD21 . LEU A 1 42  ? -1.936  2.396   -5.489  1.00 0.00 ? 42  LEU A HD21 4  
ATOM 6212  H HD22 . LEU A 1 42  ? -1.182  0.804   -5.585  1.00 0.00 ? 42  LEU A HD22 4  
ATOM 6213  H HD23 . LEU A 1 42  ? -2.459  1.106   -4.407  1.00 0.00 ? 42  LEU A HD23 4  
ATOM 6214  N N    . ALA A 1 43  ? -0.189  1.265   -10.021 1.00 0.00 ? 43  ALA A N    4  
ATOM 6215  C CA   . ALA A 1 43  ? 0.353   0.934   -11.333 1.00 0.00 ? 43  ALA A CA   4  
ATOM 6216  C C    . ALA A 1 43  ? 1.484   -0.083  -11.219 1.00 0.00 ? 43  ALA A C    4  
ATOM 6217  O O    . ALA A 1 43  ? 2.505   0.178   -10.583 1.00 0.00 ? 43  ALA A O    4  
ATOM 6218  C CB   . ALA A 1 43  ? 0.841   2.192   -12.035 1.00 0.00 ? 43  ALA A CB   4  
ATOM 6219  H H    . ALA A 1 43  ? 0.394   1.213   -9.236  1.00 0.00 ? 43  ALA A H    4  
ATOM 6220  H HA   . ALA A 1 43  ? -0.443  0.506   -11.925 1.00 0.00 ? 43  ALA A HA   4  
ATOM 6221  H HB1  . ALA A 1 43  ? 1.395   2.802   -11.336 1.00 0.00 ? 43  ALA A HB1  4  
ATOM 6222  H HB2  . ALA A 1 43  ? 1.481   1.918   -12.861 1.00 0.00 ? 43  ALA A HB2  4  
ATOM 6223  H HB3  . ALA A 1 43  ? -0.006  2.749   -12.405 1.00 0.00 ? 43  ALA A HB3  4  
ATOM 6224  N N    . GLY A 1 44  ? 1.295   -1.244  -11.838 1.00 0.00 ? 44  GLY A N    4  
ATOM 6225  C CA   . GLY A 1 44  ? 2.307   -2.283  -11.793 1.00 0.00 ? 44  GLY A CA   4  
ATOM 6226  C C    . GLY A 1 44  ? 3.701   -1.745  -12.046 1.00 0.00 ? 44  GLY A C    4  
ATOM 6227  O O    . GLY A 1 44  ? 3.863   -0.661  -12.605 1.00 0.00 ? 44  GLY A O    4  
ATOM 6228  H H    . GLY A 1 44  ? 0.461   -1.397  -12.330 1.00 0.00 ? 44  GLY A H    4  
ATOM 6229  H HA2  . GLY A 1 44  ? 2.284   -2.750  -10.820 1.00 0.00 ? 44  GLY A HA2  4  
ATOM 6230  H HA3  . GLY A 1 44  ? 2.079   -3.025  -12.543 1.00 0.00 ? 44  GLY A HA3  4  
ATOM 6231  N N    . ASN A 1 45  ? 4.711   -2.504  -11.633 1.00 0.00 ? 45  ASN A N    4  
ATOM 6232  C CA   . ASN A 1 45  ? 6.099   -2.096  -11.817 1.00 0.00 ? 45  ASN A CA   4  
ATOM 6233  C C    . ASN A 1 45  ? 6.421   -1.910  -13.296 1.00 0.00 ? 45  ASN A C    4  
ATOM 6234  O O    . ASN A 1 45  ? 5.908   -2.635  -14.150 1.00 0.00 ? 45  ASN A O    4  
ATOM 6235  C CB   . ASN A 1 45  ? 7.043   -3.133  -11.205 1.00 0.00 ? 45  ASN A CB   4  
ATOM 6236  C CG   . ASN A 1 45  ? 8.503   -2.781  -11.413 1.00 0.00 ? 45  ASN A CG   4  
ATOM 6237  O OD1  . ASN A 1 45  ? 9.022   -2.873  -12.526 1.00 0.00 ? 45  ASN A OD1  4  
ATOM 6238  N ND2  . ASN A 1 45  ? 9.173   -2.376  -10.341 1.00 0.00 ? 45  ASN A ND2  4  
ATOM 6239  H H    . ASN A 1 45  ? 4.518   -3.359  -11.194 1.00 0.00 ? 45  ASN A H    4  
ATOM 6240  H HA   . ASN A 1 45  ? 6.237   -1.153  -11.309 1.00 0.00 ? 45  ASN A HA   4  
ATOM 6241  H HB2  . ASN A 1 45  ? 6.857   -3.198  -10.142 1.00 0.00 ? 45  ASN A HB2  4  
ATOM 6242  H HB3  . ASN A 1 45  ? 6.854   -4.095  -11.658 1.00 0.00 ? 45  ASN A HB3  4  
ATOM 6243  H HD21 . ASN A 1 45  ? 8.694   -2.327  -9.487  1.00 0.00 ? 45  ASN A HD21 4  
ATOM 6244  H HD22 . ASN A 1 45  ? 10.118  -2.141  -10.448 1.00 0.00 ? 45  ASN A HD22 4  
ATOM 6245  N N    . LYS A 1 46  ? 7.273   -0.935  -13.593 1.00 0.00 ? 46  LYS A N    4  
ATOM 6246  C CA   . LYS A 1 46  ? 7.665   -0.654  -14.969 1.00 0.00 ? 46  LYS A CA   4  
ATOM 6247  C C    . LYS A 1 46  ? 7.797   -1.945  -15.772 1.00 0.00 ? 46  LYS A C    4  
ATOM 6248  O O    . LYS A 1 46  ? 7.252   -2.062  -16.869 1.00 0.00 ? 46  LYS A O    4  
ATOM 6249  C CB   . LYS A 1 46  ? 8.989   0.113   -14.997 1.00 0.00 ? 46  LYS A CB   4  
ATOM 6250  C CG   . LYS A 1 46  ? 8.836   1.600   -14.725 1.00 0.00 ? 46  LYS A CG   4  
ATOM 6251  C CD   . LYS A 1 46  ? 10.178  2.312   -14.748 1.00 0.00 ? 46  LYS A CD   4  
ATOM 6252  C CE   . LYS A 1 46  ? 10.011  3.820   -14.642 1.00 0.00 ? 46  LYS A CE   4  
ATOM 6253  N NZ   . LYS A 1 46  ? 9.722   4.441   -15.964 1.00 0.00 ? 46  LYS A NZ   4  
ATOM 6254  H H    . LYS A 1 46  ? 7.648   -0.392  -12.869 1.00 0.00 ? 46  LYS A H    4  
ATOM 6255  H HA   . LYS A 1 46  ? 6.896   -0.043  -15.416 1.00 0.00 ? 46  LYS A HA   4  
ATOM 6256  H HB2  . LYS A 1 46  ? 9.648   -0.302  -14.249 1.00 0.00 ? 46  LYS A HB2  4  
ATOM 6257  H HB3  . LYS A 1 46  ? 9.442   -0.008  -15.971 1.00 0.00 ? 46  LYS A HB3  4  
ATOM 6258  H HG2  . LYS A 1 46  ? 8.199   2.032   -15.482 1.00 0.00 ? 46  LYS A HG2  4  
ATOM 6259  H HG3  . LYS A 1 46  ? 8.384   1.734   -13.752 1.00 0.00 ? 46  LYS A HG3  4  
ATOM 6260  H HD2  . LYS A 1 46  ? 10.773  1.968   -13.915 1.00 0.00 ? 46  LYS A HD2  4  
ATOM 6261  H HD3  . LYS A 1 46  ? 10.683  2.079   -15.675 1.00 0.00 ? 46  LYS A HD3  4  
ATOM 6262  H HE2  . LYS A 1 46  ? 9.194   4.032   -13.968 1.00 0.00 ? 46  LYS A HE2  4  
ATOM 6263  H HE3  . LYS A 1 46  ? 10.922  4.243   -14.246 1.00 0.00 ? 46  LYS A HE3  4  
ATOM 6264  H HZ1  . LYS A 1 46  ? 10.108  3.850   -16.728 1.00 0.00 ? 46  LYS A HZ1  4  
ATOM 6265  H HZ2  . LYS A 1 46  ? 10.156  5.384   -16.018 1.00 0.00 ? 46  LYS A HZ2  4  
ATOM 6266  H HZ3  . LYS A 1 46  ? 8.695   4.534   -16.098 1.00 0.00 ? 46  LYS A HZ3  4  
ATOM 6267  N N    . ASP A 1 47  ? 8.522   -2.910  -15.217 1.00 0.00 ? 47  ASP A N    4  
ATOM 6268  C CA   . ASP A 1 47  ? 8.723   -4.193  -15.881 1.00 0.00 ? 47  ASP A CA   4  
ATOM 6269  C C    . ASP A 1 47  ? 7.569   -5.145  -15.582 1.00 0.00 ? 47  ASP A C    4  
ATOM 6270  O O    . ASP A 1 47  ? 7.433   -5.639  -14.463 1.00 0.00 ? 47  ASP A O    4  
ATOM 6271  C CB   . ASP A 1 47  ? 10.046  -4.819  -15.437 1.00 0.00 ? 47  ASP A CB   4  
ATOM 6272  C CG   . ASP A 1 47  ? 11.250  -4.083  -15.991 1.00 0.00 ? 47  ASP A CG   4  
ATOM 6273  O OD1  . ASP A 1 47  ? 11.535  -4.237  -17.197 1.00 0.00 ? 47  ASP A OD1  4  
ATOM 6274  O OD2  . ASP A 1 47  ? 11.908  -3.355  -15.219 1.00 0.00 ? 47  ASP A OD2  4  
ATOM 6275  H H    . ASP A 1 47  ? 8.932   -2.756  -14.340 1.00 0.00 ? 47  ASP A H    4  
ATOM 6276  H HA   . ASP A 1 47  ? 8.759   -4.014  -16.945 1.00 0.00 ? 47  ASP A HA   4  
ATOM 6277  H HB2  . ASP A 1 47  ? 10.101  -4.800  -14.358 1.00 0.00 ? 47  ASP A HB2  4  
ATOM 6278  H HB3  . ASP A 1 47  ? 10.083  -5.843  -15.777 1.00 0.00 ? 47  ASP A HB3  4  
ATOM 6279  N N    . ARG A 1 48  ? 6.741   -5.397  -16.591 1.00 0.00 ? 48  ARG A N    4  
ATOM 6280  C CA   . ARG A 1 48  ? 5.597   -6.288  -16.436 1.00 0.00 ? 48  ARG A CA   4  
ATOM 6281  C C    . ARG A 1 48  ? 6.003   -7.573  -15.720 1.00 0.00 ? 48  ARG A C    4  
ATOM 6282  O O    . ARG A 1 48  ? 5.393   -7.959  -14.723 1.00 0.00 ? 48  ARG A O    4  
ATOM 6283  C CB   . ARG A 1 48  ? 4.994   -6.620  -17.801 1.00 0.00 ? 48  ARG A CB   4  
ATOM 6284  C CG   . ARG A 1 48  ? 3.838   -7.605  -17.733 1.00 0.00 ? 48  ARG A CG   4  
ATOM 6285  C CD   . ARG A 1 48  ? 2.510   -6.891  -17.529 1.00 0.00 ? 48  ARG A CD   4  
ATOM 6286  N NE   . ARG A 1 48  ? 1.385   -7.673  -18.036 1.00 0.00 ? 48  ARG A NE   4  
ATOM 6287  C CZ   . ARG A 1 48  ? 0.165   -7.177  -18.208 1.00 0.00 ? 48  ARG A CZ   4  
ATOM 6288  N NH1  . ARG A 1 48  ? -0.087  -5.909  -17.915 1.00 0.00 ? 48  ARG A NH1  4  
ATOM 6289  N NH2  . ARG A 1 48  ? -0.807  -7.952  -18.674 1.00 0.00 ? 48  ARG A NH2  4  
ATOM 6290  H H    . ARG A 1 48  ? 6.901   -4.972  -17.459 1.00 0.00 ? 48  ARG A H    4  
ATOM 6291  H HA   . ARG A 1 48  ? 4.856   -5.776  -15.839 1.00 0.00 ? 48  ARG A HA   4  
ATOM 6292  H HB2  . ARG A 1 48  ? 4.634   -5.708  -18.255 1.00 0.00 ? 48  ARG A HB2  4  
ATOM 6293  H HB3  . ARG A 1 48  ? 5.763   -7.045  -18.428 1.00 0.00 ? 48  ARG A HB3  4  
ATOM 6294  H HG2  . ARG A 1 48  ? 3.796   -8.161  -18.658 1.00 0.00 ? 48  ARG A HG2  4  
ATOM 6295  H HG3  . ARG A 1 48  ? 4.003   -8.283  -16.909 1.00 0.00 ? 48  ARG A HG3  4  
ATOM 6296  H HD2  . ARG A 1 48  ? 2.368   -6.719  -16.472 1.00 0.00 ? 48  ARG A HD2  4  
ATOM 6297  H HD3  . ARG A 1 48  ? 2.542   -5.945  -18.047 1.00 0.00 ? 48  ARG A HD3  4  
ATOM 6298  H HE   . ARG A 1 48  ? 1.549   -8.612  -18.259 1.00 0.00 ? 48  ARG A HE   4  
ATOM 6299  H HH11 . ARG A 1 48  ? 0.643   -5.323  -17.564 1.00 0.00 ? 48  ARG A HH11 4  
ATOM 6300  H HH12 . ARG A 1 48  ? -1.007  -5.538  -18.046 1.00 0.00 ? 48  ARG A HH12 4  
ATOM 6301  H HH21 . ARG A 1 48  ? -0.621  -8.908  -18.896 1.00 0.00 ? 48  ARG A HH21 4  
ATOM 6302  H HH22 . ARG A 1 48  ? -1.725  -7.578  -18.803 1.00 0.00 ? 48  ARG A HH22 4  
ATOM 6303  N N    . SER A 1 49  ? 7.035   -8.232  -16.237 1.00 0.00 ? 49  SER A N    4  
ATOM 6304  C CA   . SER A 1 49  ? 7.519   -9.476  -15.651 1.00 0.00 ? 49  SER A CA   4  
ATOM 6305  C C    . SER A 1 49  ? 7.436   -9.427  -14.128 1.00 0.00 ? 49  SER A C    4  
ATOM 6306  O O    . SER A 1 49  ? 7.104   -10.420 -13.482 1.00 0.00 ? 49  SER A O    4  
ATOM 6307  C CB   . SER A 1 49  ? 8.961   -9.742  -16.086 1.00 0.00 ? 49  SER A CB   4  
ATOM 6308  O OG   . SER A 1 49  ? 9.012   -10.214 -17.421 1.00 0.00 ? 49  SER A OG   4  
ATOM 6309  H H    . SER A 1 49  ? 7.479   -7.873  -17.034 1.00 0.00 ? 49  SER A H    4  
ATOM 6310  H HA   . SER A 1 49  ? 6.890   -10.278 -16.008 1.00 0.00 ? 49  SER A HA   4  
ATOM 6311  H HB2  . SER A 1 49  ? 9.530   -8.827  -16.019 1.00 0.00 ? 49  SER A HB2  4  
ATOM 6312  H HB3  . SER A 1 49  ? 9.399   -10.487 -15.437 1.00 0.00 ? 49  SER A HB3  4  
ATOM 6313  H HG   . SER A 1 49  ? 8.337   -9.774  -17.943 1.00 0.00 ? 49  SER A HG   4  
ATOM 6314  N N    . ARG A 1 50  ? 7.741   -8.264  -13.562 1.00 0.00 ? 50  ARG A N    4  
ATOM 6315  C CA   . ARG A 1 50  ? 7.703   -8.085  -12.116 1.00 0.00 ? 50  ARG A CA   4  
ATOM 6316  C C    . ARG A 1 50  ? 6.276   -7.837  -11.637 1.00 0.00 ? 50  ARG A C    4  
ATOM 6317  O O    . ARG A 1 50  ? 5.488   -7.177  -12.315 1.00 0.00 ? 50  ARG A O    4  
ATOM 6318  C CB   . ARG A 1 50  ? 8.601   -6.918  -11.701 1.00 0.00 ? 50  ARG A CB   4  
ATOM 6319  C CG   . ARG A 1 50  ? 10.074  -7.285  -11.612 1.00 0.00 ? 50  ARG A CG   4  
ATOM 6320  C CD   . ARG A 1 50  ? 10.923  -6.088  -11.214 1.00 0.00 ? 50  ARG A CD   4  
ATOM 6321  N NE   . ARG A 1 50  ? 12.320  -6.456  -10.998 1.00 0.00 ? 50  ARG A NE   4  
ATOM 6322  C CZ   . ARG A 1 50  ? 12.736  -7.187  -9.970  1.00 0.00 ? 50  ARG A CZ   4  
ATOM 6323  N NH1  . ARG A 1 50  ? 11.868  -7.626  -9.070  1.00 0.00 ? 50  ARG A NH1  4  
ATOM 6324  N NH2  . ARG A 1 50  ? 14.024  -7.480  -9.841  1.00 0.00 ? 50  ARG A NH2  4  
ATOM 6325  H H    . ARG A 1 50  ? 7.999   -7.508  -14.131 1.00 0.00 ? 50  ARG A H    4  
ATOM 6326  H HA   . ARG A 1 50  ? 8.071   -8.991  -11.659 1.00 0.00 ? 50  ARG A HA   4  
ATOM 6327  H HB2  . ARG A 1 50  ? 8.495   -6.122  -12.424 1.00 0.00 ? 50  ARG A HB2  4  
ATOM 6328  H HB3  . ARG A 1 50  ? 8.283   -6.560  -10.734 1.00 0.00 ? 50  ARG A HB3  4  
ATOM 6329  H HG2  . ARG A 1 50  ? 10.197  -8.062  -10.871 1.00 0.00 ? 50  ARG A HG2  4  
ATOM 6330  H HG3  . ARG A 1 50  ? 10.404  -7.647  -12.574 1.00 0.00 ? 50  ARG A HG3  4  
ATOM 6331  H HD2  . ARG A 1 50  ? 10.873  -5.351  -12.002 1.00 0.00 ? 50  ARG A HD2  4  
ATOM 6332  H HD3  . ARG A 1 50  ? 10.525  -5.668  -10.303 1.00 0.00 ? 50  ARG A HD3  4  
ATOM 6333  H HE   . ARG A 1 50  ? 12.978  -6.142  -11.651 1.00 0.00 ? 50  ARG A HE   4  
ATOM 6334  H HH11 . ARG A 1 50  ? 10.897  -7.408  -9.165  1.00 0.00 ? 50  ARG A HH11 4  
ATOM 6335  H HH12 . ARG A 1 50  ? 12.184  -8.178  -8.297  1.00 0.00 ? 50  ARG A HH12 4  
ATOM 6336  H HH21 . ARG A 1 50  ? 14.682  -7.151  -10.518 1.00 0.00 ? 50  ARG A HH21 4  
ATOM 6337  H HH22 . ARG A 1 50  ? 14.337  -8.030  -9.068  1.00 0.00 ? 50  ARG A HH22 4  
ATOM 6338  N N    . MET A 1 51  ? 5.950   -8.370  -10.464 1.00 0.00 ? 51  MET A N    4  
ATOM 6339  C CA   . MET A 1 51  ? 4.618   -8.206  -9.894  1.00 0.00 ? 51  MET A CA   4  
ATOM 6340  C C    . MET A 1 51  ? 4.682   -7.447  -8.572  1.00 0.00 ? 51  MET A C    4  
ATOM 6341  O O    . MET A 1 51  ? 4.911   -8.037  -7.517  1.00 0.00 ? 51  MET A O    4  
ATOM 6342  C CB   . MET A 1 51  ? 3.959   -9.570  -9.680  1.00 0.00 ? 51  MET A CB   4  
ATOM 6343  C CG   . MET A 1 51  ? 2.519   -9.482  -9.201  1.00 0.00 ? 51  MET A CG   4  
ATOM 6344  S SD   . MET A 1 51  ? 1.340   -9.387  -10.562 1.00 0.00 ? 51  MET A SD   4  
ATOM 6345  C CE   . MET A 1 51  ? 1.294   -7.619  -10.848 1.00 0.00 ? 51  MET A CE   4  
ATOM 6346  H H    . MET A 1 51  ? 6.621   -8.886  -9.969  1.00 0.00 ? 51  MET A H    4  
ATOM 6347  H HA   . MET A 1 51  ? 4.026   -7.636  -10.594 1.00 0.00 ? 51  MET A HA   4  
ATOM 6348  H HB2  . MET A 1 51  ? 3.973   -10.113 -10.613 1.00 0.00 ? 51  MET A HB2  4  
ATOM 6349  H HB3  . MET A 1 51  ? 4.527   -10.120 -8.944  1.00 0.00 ? 51  MET A HB3  4  
ATOM 6350  H HG2  . MET A 1 51  ? 2.295   -10.358 -8.611  1.00 0.00 ? 51  MET A HG2  4  
ATOM 6351  H HG3  . MET A 1 51  ? 2.412   -8.600  -8.588  1.00 0.00 ? 51  MET A HG3  4  
ATOM 6352  H HE1  . MET A 1 51  ? 2.169   -7.322  -11.408 1.00 0.00 ? 51  MET A HE1  4  
ATOM 6353  H HE2  . MET A 1 51  ? 0.406   -7.368  -11.407 1.00 0.00 ? 51  MET A HE2  4  
ATOM 6354  H HE3  . MET A 1 51  ? 1.282   -7.102  -9.899  1.00 0.00 ? 51  MET A HE3  4  
ATOM 6355  N N    . SER A 1 52  ? 4.478   -6.135  -8.638  1.00 0.00 ? 52  SER A N    4  
ATOM 6356  C CA   . SER A 1 52  ? 4.517   -5.295  -7.447  1.00 0.00 ? 52  SER A CA   4  
ATOM 6357  C C    . SER A 1 52  ? 3.566   -4.109  -7.587  1.00 0.00 ? 52  SER A C    4  
ATOM 6358  O O    . SER A 1 52  ? 3.382   -3.573  -8.680  1.00 0.00 ? 52  SER A O    4  
ATOM 6359  C CB   . SER A 1 52  ? 5.940   -4.794  -7.196  1.00 0.00 ? 52  SER A CB   4  
ATOM 6360  O OG   . SER A 1 52  ? 6.675   -5.718  -6.411  1.00 0.00 ? 52  SER A OG   4  
ATOM 6361  H H    . SER A 1 52  ? 4.300   -5.722  -9.509  1.00 0.00 ? 52  SER A H    4  
ATOM 6362  H HA   . SER A 1 52  ? 4.202   -5.896  -6.607  1.00 0.00 ? 52  SER A HA   4  
ATOM 6363  H HB2  . SER A 1 52  ? 6.445   -4.663  -8.141  1.00 0.00 ? 52  SER A HB2  4  
ATOM 6364  H HB3  . SER A 1 52  ? 5.900   -3.849  -6.674  1.00 0.00 ? 52  SER A HB3  4  
ATOM 6365  H HG   . SER A 1 52  ? 6.130   -6.023  -5.682  1.00 0.00 ? 52  SER A HG   4  
ATOM 6366  N N    . ILE A 1 53  ? 2.966   -3.706  -6.472  1.00 0.00 ? 53  ILE A N    4  
ATOM 6367  C CA   . ILE A 1 53  ? 2.035   -2.584  -6.470  1.00 0.00 ? 53  ILE A CA   4  
ATOM 6368  C C    . ILE A 1 53  ? 2.698   -1.322  -5.928  1.00 0.00 ? 53  ILE A C    4  
ATOM 6369  O O    . ILE A 1 53  ? 3.459   -1.373  -4.961  1.00 0.00 ? 53  ILE A O    4  
ATOM 6370  C CB   . ILE A 1 53  ? 0.782   -2.894  -5.630  1.00 0.00 ? 53  ILE A CB   4  
ATOM 6371  C CG1  . ILE A 1 53  ? 0.129   -4.192  -6.109  1.00 0.00 ? 53  ILE A CG1  4  
ATOM 6372  C CG2  . ILE A 1 53  ? -0.205  -1.738  -5.705  1.00 0.00 ? 53  ILE A CG2  4  
ATOM 6373  C CD1  . ILE A 1 53  ? -0.854  -4.775  -5.118  1.00 0.00 ? 53  ILE A CD1  4  
ATOM 6374  H H    . ILE A 1 53  ? 3.153   -4.173  -5.632  1.00 0.00 ? 53  ILE A H    4  
ATOM 6375  H HA   . ILE A 1 53  ? 1.726   -2.406  -7.490  1.00 0.00 ? 53  ILE A HA   4  
ATOM 6376  H HB   . ILE A 1 53  ? 1.085   -3.010  -4.601  1.00 0.00 ? 53  ILE A HB   4  
ATOM 6377  H HG12 . ILE A 1 53  ? -0.402  -4.002  -7.029  1.00 0.00 ? 53  ILE A HG12 4  
ATOM 6378  H HG13 . ILE A 1 53  ? 0.898   -4.929  -6.287  1.00 0.00 ? 53  ILE A HG13 4  
ATOM 6379  H HG21 . ILE A 1 53  ? -0.216  -1.212  -4.762  1.00 0.00 ? 53  ILE A HG21 4  
ATOM 6380  H HG22 . ILE A 1 53  ? 0.094   -1.060  -6.490  1.00 0.00 ? 53  ILE A HG22 4  
ATOM 6381  H HG23 . ILE A 1 53  ? -1.192  -2.121  -5.916  1.00 0.00 ? 53  ILE A HG23 4  
ATOM 6382  H HD11 . ILE A 1 53  ? -0.467  -5.707  -4.732  1.00 0.00 ? 53  ILE A HD11 4  
ATOM 6383  H HD12 . ILE A 1 53  ? -1.001  -4.081  -4.304  1.00 0.00 ? 53  ILE A HD12 4  
ATOM 6384  H HD13 . ILE A 1 53  ? -1.798  -4.955  -5.611  1.00 0.00 ? 53  ILE A HD13 4  
ATOM 6385  N N    . PHE A 1 54  ? 2.401   -0.188  -6.555  1.00 0.00 ? 54  PHE A N    4  
ATOM 6386  C CA   . PHE A 1 54  ? 2.967   1.088   -6.135  1.00 0.00 ? 54  PHE A CA   4  
ATOM 6387  C C    . PHE A 1 54  ? 1.900   2.179   -6.125  1.00 0.00 ? 54  PHE A C    4  
ATOM 6388  O O    . PHE A 1 54  ? 0.754   1.946   -6.509  1.00 0.00 ? 54  PHE A O    4  
ATOM 6389  C CB   . PHE A 1 54  ? 4.115   1.491   -7.063  1.00 0.00 ? 54  PHE A CB   4  
ATOM 6390  C CG   . PHE A 1 54  ? 5.313   0.591   -6.960  1.00 0.00 ? 54  PHE A CG   4  
ATOM 6391  C CD1  . PHE A 1 54  ? 6.150   0.653   -5.858  1.00 0.00 ? 54  PHE A CD1  4  
ATOM 6392  C CD2  . PHE A 1 54  ? 5.602   -0.317  -7.966  1.00 0.00 ? 54  PHE A CD2  4  
ATOM 6393  C CE1  . PHE A 1 54  ? 7.253   -0.174  -5.760  1.00 0.00 ? 54  PHE A CE1  4  
ATOM 6394  C CE2  . PHE A 1 54  ? 6.703   -1.147  -7.873  1.00 0.00 ? 54  PHE A CE2  4  
ATOM 6395  C CZ   . PHE A 1 54  ? 7.531   -1.075  -6.769  1.00 0.00 ? 54  PHE A CZ   4  
ATOM 6396  H H    . PHE A 1 54  ? 1.788   -0.212  -7.319  1.00 0.00 ? 54  PHE A H    4  
ATOM 6397  H HA   . PHE A 1 54  ? 3.350   0.967   -5.134  1.00 0.00 ? 54  PHE A HA   4  
ATOM 6398  H HB2  . PHE A 1 54  ? 3.769   1.465   -8.085  1.00 0.00 ? 54  PHE A HB2  4  
ATOM 6399  H HB3  . PHE A 1 54  ? 4.430   2.494   -6.819  1.00 0.00 ? 54  PHE A HB3  4  
ATOM 6400  H HD1  . PHE A 1 54  ? 5.934   1.358   -5.067  1.00 0.00 ? 54  PHE A HD1  4  
ATOM 6401  H HD2  . PHE A 1 54  ? 4.957   -0.375  -8.830  1.00 0.00 ? 54  PHE A HD2  4  
ATOM 6402  H HE1  . PHE A 1 54  ? 7.898   -0.114  -4.895  1.00 0.00 ? 54  PHE A HE1  4  
ATOM 6403  H HE2  . PHE A 1 54  ? 6.918   -1.851  -8.663  1.00 0.00 ? 54  PHE A HE2  4  
ATOM 6404  H HZ   . PHE A 1 54  ? 8.391   -1.723  -6.694  1.00 0.00 ? 54  PHE A HZ   4  
ATOM 6405  N N    . VAL A 1 55  ? 2.286   3.372   -5.683  1.00 0.00 ? 55  VAL A N    4  
ATOM 6406  C CA   . VAL A 1 55  ? 1.364   4.500   -5.623  1.00 0.00 ? 55  VAL A CA   4  
ATOM 6407  C C    . VAL A 1 55  ? 1.858   5.660   -6.480  1.00 0.00 ? 55  VAL A C    4  
ATOM 6408  O O    . VAL A 1 55  ? 2.803   6.358   -6.113  1.00 0.00 ? 55  VAL A O    4  
ATOM 6409  C CB   . VAL A 1 55  ? 1.171   4.990   -4.176  1.00 0.00 ? 55  VAL A CB   4  
ATOM 6410  C CG1  . VAL A 1 55  ? 0.256   6.205   -4.141  1.00 0.00 ? 55  VAL A CG1  4  
ATOM 6411  C CG2  . VAL A 1 55  ? 0.620   3.873   -3.303  1.00 0.00 ? 55  VAL A CG2  4  
ATOM 6412  H H    . VAL A 1 55  ? 3.213   3.497   -5.391  1.00 0.00 ? 55  VAL A H    4  
ATOM 6413  H HA   . VAL A 1 55  ? 0.406   4.169   -5.999  1.00 0.00 ? 55  VAL A HA   4  
ATOM 6414  H HB   . VAL A 1 55  ? 2.135   5.282   -3.785  1.00 0.00 ? 55  VAL A HB   4  
ATOM 6415  H HG11 . VAL A 1 55  ? 0.473   6.843   -4.985  1.00 0.00 ? 55  VAL A HG11 4  
ATOM 6416  H HG12 . VAL A 1 55  ? -0.773  5.882   -4.187  1.00 0.00 ? 55  VAL A HG12 4  
ATOM 6417  H HG13 . VAL A 1 55  ? 0.422   6.754   -3.225  1.00 0.00 ? 55  VAL A HG13 4  
ATOM 6418  H HG21 . VAL A 1 55  ? 1.243   3.759   -2.429  1.00 0.00 ? 55  VAL A HG21 4  
ATOM 6419  H HG22 . VAL A 1 55  ? -0.387  4.117   -2.998  1.00 0.00 ? 55  VAL A HG22 4  
ATOM 6420  H HG23 . VAL A 1 55  ? 0.611   2.950   -3.863  1.00 0.00 ? 55  VAL A HG23 4  
ATOM 6421  N N    . VAL A 1 56  ? 1.211   5.861   -7.624  1.00 0.00 ? 56  VAL A N    4  
ATOM 6422  C CA   . VAL A 1 56  ? 1.583   6.938   -8.533  1.00 0.00 ? 56  VAL A CA   4  
ATOM 6423  C C    . VAL A 1 56  ? 0.612   8.108   -8.425  1.00 0.00 ? 56  VAL A C    4  
ATOM 6424  O O    . VAL A 1 56  ? 0.654   9.039   -9.229  1.00 0.00 ? 56  VAL A O    4  
ATOM 6425  C CB   . VAL A 1 56  ? 1.623   6.451   -9.994  1.00 0.00 ? 56  VAL A CB   4  
ATOM 6426  C CG1  . VAL A 1 56  ? 2.432   5.168   -10.107 1.00 0.00 ? 56  VAL A CG1  4  
ATOM 6427  C CG2  . VAL A 1 56  ? 0.212   6.249   -10.526 1.00 0.00 ? 56  VAL A CG2  4  
ATOM 6428  H H    . VAL A 1 56  ? 0.465   5.271   -7.861  1.00 0.00 ? 56  VAL A H    4  
ATOM 6429  H HA   . VAL A 1 56  ? 2.573   7.277   -8.262  1.00 0.00 ? 56  VAL A HA   4  
ATOM 6430  H HB   . VAL A 1 56  ? 2.106   7.209   -10.592 1.00 0.00 ? 56  VAL A HB   4  
ATOM 6431  H HG11 . VAL A 1 56  ? 2.148   4.642   -11.007 1.00 0.00 ? 56  VAL A HG11 4  
ATOM 6432  H HG12 . VAL A 1 56  ? 3.485   5.408   -10.147 1.00 0.00 ? 56  VAL A HG12 4  
ATOM 6433  H HG13 . VAL A 1 56  ? 2.238   4.543   -9.248  1.00 0.00 ? 56  VAL A HG13 4  
ATOM 6434  H HG21 . VAL A 1 56  ? 0.065   6.868   -11.398 1.00 0.00 ? 56  VAL A HG21 4  
ATOM 6435  H HG22 . VAL A 1 56  ? 0.072   5.212   -10.793 1.00 0.00 ? 56  VAL A HG22 4  
ATOM 6436  H HG23 . VAL A 1 56  ? -0.503  6.524   -9.765  1.00 0.00 ? 56  VAL A HG23 4  
ATOM 6437  N N    . GLY A 1 57  ? -0.262  8.055   -7.425  1.00 0.00 ? 57  GLY A N    4  
ATOM 6438  C CA   . GLY A 1 57  ? -1.232  9.117   -7.230  1.00 0.00 ? 57  GLY A CA   4  
ATOM 6439  C C    . GLY A 1 57  ? -2.043  8.935   -5.962  1.00 0.00 ? 57  GLY A C    4  
ATOM 6440  O O    . GLY A 1 57  ? -2.219  7.814   -5.485  1.00 0.00 ? 57  GLY A O    4  
ATOM 6441  H H    . GLY A 1 57  ? -0.249  7.288   -6.815  1.00 0.00 ? 57  GLY A H    4  
ATOM 6442  H HA2  . GLY A 1 57  ? -0.710  10.061  -7.179  1.00 0.00 ? 57  GLY A HA2  4  
ATOM 6443  H HA3  . GLY A 1 57  ? -1.905  9.134   -8.075  1.00 0.00 ? 57  GLY A HA3  4  
ATOM 6444  N N    . ILE A 1 58  ? -2.537  10.040  -5.415  1.00 0.00 ? 58  ILE A N    4  
ATOM 6445  C CA   . ILE A 1 58  ? -3.334  9.997   -4.195  1.00 0.00 ? 58  ILE A CA   4  
ATOM 6446  C C    . ILE A 1 58  ? -4.576  10.873  -4.318  1.00 0.00 ? 58  ILE A C    4  
ATOM 6447  O O    . ILE A 1 58  ? -4.515  12.085  -4.118  1.00 0.00 ? 58  ILE A O    4  
ATOM 6448  C CB   . ILE A 1 58  ? -2.516  10.455  -2.972  1.00 0.00 ? 58  ILE A CB   4  
ATOM 6449  C CG1  . ILE A 1 58  ? -1.316  9.530   -2.759  1.00 0.00 ? 58  ILE A CG1  4  
ATOM 6450  C CG2  . ILE A 1 58  ? -3.394  10.487  -1.730  1.00 0.00 ? 58  ILE A CG2  4  
ATOM 6451  C CD1  . ILE A 1 58  ? -0.384  9.993   -1.661  1.00 0.00 ? 58  ILE A CD1  4  
ATOM 6452  H H    . ILE A 1 58  ? -2.363  10.905  -5.842  1.00 0.00 ? 58  ILE A H    4  
ATOM 6453  H HA   . ILE A 1 58  ? -3.642  8.974   -4.034  1.00 0.00 ? 58  ILE A HA   4  
ATOM 6454  H HB   . ILE A 1 58  ? -2.161  11.457  -3.159  1.00 0.00 ? 58  ILE A HB   4  
ATOM 6455  H HG12 . ILE A 1 58  ? -1.669  8.545   -2.501  1.00 0.00 ? 58  ILE A HG12 4  
ATOM 6456  H HG13 . ILE A 1 58  ? -0.747  9.475   -3.676  1.00 0.00 ? 58  ILE A HG13 4  
ATOM 6457  H HG21 . ILE A 1 58  ? -3.142  9.654   -1.090  1.00 0.00 ? 58  ILE A HG21 4  
ATOM 6458  H HG22 . ILE A 1 58  ? -3.229  11.411  -1.197  1.00 0.00 ? 58  ILE A HG22 4  
ATOM 6459  H HG23 . ILE A 1 58  ? -4.431  10.418  -2.020  1.00 0.00 ? 58  ILE A HG23 4  
ATOM 6460  H HD11 . ILE A 1 58  ? -0.089  9.146   -1.059  1.00 0.00 ? 58  ILE A HD11 4  
ATOM 6461  H HD12 . ILE A 1 58  ? 0.491   10.448  -2.098  1.00 0.00 ? 58  ILE A HD12 4  
ATOM 6462  H HD13 . ILE A 1 58  ? -0.893  10.715  -1.038  1.00 0.00 ? 58  ILE A HD13 4  
ATOM 6463  N N    . ASN A 1 59  ? -5.703  10.250  -4.647  1.00 0.00 ? 59  ASN A N    4  
ATOM 6464  C CA   . ASN A 1 59  ? -6.961  10.972  -4.796  1.00 0.00 ? 59  ASN A CA   4  
ATOM 6465  C C    . ASN A 1 59  ? -7.146  11.980  -3.666  1.00 0.00 ? 59  ASN A C    4  
ATOM 6466  O O    . ASN A 1 59  ? -7.148  11.632  -2.485  1.00 0.00 ? 59  ASN A O    4  
ATOM 6467  C CB   . ASN A 1 59  ? -8.136  9.993   -4.819  1.00 0.00 ? 59  ASN A CB   4  
ATOM 6468  C CG   . ASN A 1 59  ? -9.309  10.516  -5.624  1.00 0.00 ? 59  ASN A CG   4  
ATOM 6469  O OD1  . ASN A 1 59  ? -9.892  11.549  -5.293  1.00 0.00 ? 59  ASN A OD1  4  
ATOM 6470  N ND2  . ASN A 1 59  ? -9.662  9.804   -6.688  1.00 0.00 ? 59  ASN A ND2  4  
ATOM 6471  H H    . ASN A 1 59  ? -5.688  9.281   -4.794  1.00 0.00 ? 59  ASN A H    4  
ATOM 6472  H HA   . ASN A 1 59  ? -6.928  11.504  -5.735  1.00 0.00 ? 59  ASN A HA   4  
ATOM 6473  H HB2  . ASN A 1 59  ? -7.811  9.060   -5.258  1.00 0.00 ? 59  ASN A HB2  4  
ATOM 6474  H HB3  . ASN A 1 59  ? -8.468  9.813   -3.808  1.00 0.00 ? 59  ASN A HB3  4  
ATOM 6475  H HD21 . ASN A 1 59  ? -9.153  8.991   -6.891  1.00 0.00 ? 59  ASN A HD21 4  
ATOM 6476  H HD22 . ASN A 1 59  ? -10.417 10.120  -7.226  1.00 0.00 ? 59  ASN A HD22 4  
ATOM 6477  N N    . PRO A 1 60  ? -7.307  13.259  -4.034  1.00 0.00 ? 60  PRO A N    4  
ATOM 6478  C CA   . PRO A 1 60  ? -7.497  14.344  -3.067  1.00 0.00 ? 60  PRO A CA   4  
ATOM 6479  C C    . PRO A 1 60  ? -8.854  14.271  -2.374  1.00 0.00 ? 60  PRO A C    4  
ATOM 6480  O O    . PRO A 1 60  ? -9.129  15.034  -1.448  1.00 0.00 ? 60  PRO A O    4  
ATOM 6481  C CB   . PRO A 1 60  ? -7.403  15.607  -3.926  1.00 0.00 ? 60  PRO A CB   4  
ATOM 6482  C CG   . PRO A 1 60  ? -7.796  15.165  -5.293  1.00 0.00 ? 60  PRO A CG   4  
ATOM 6483  C CD   . PRO A 1 60  ? -7.315  13.746  -5.424  1.00 0.00 ? 60  PRO A CD   4  
ATOM 6484  H HA   . PRO A 1 60  ? -6.714  14.354  -2.322  1.00 0.00 ? 60  PRO A HA   4  
ATOM 6485  H HB2  . PRO A 1 60  ? -8.080  16.358  -3.543  1.00 0.00 ? 60  PRO A HB2  4  
ATOM 6486  H HB3  . PRO A 1 60  ? -6.392  15.984  -3.909  1.00 0.00 ? 60  PRO A HB3  4  
ATOM 6487  H HG2  . PRO A 1 60  ? -8.869  15.208  -5.399  1.00 0.00 ? 60  PRO A HG2  4  
ATOM 6488  H HG3  . PRO A 1 60  ? -7.319  15.791  -6.033  1.00 0.00 ? 60  PRO A HG3  4  
ATOM 6489  H HD2  . PRO A 1 60  ? -7.999  13.170  -6.030  1.00 0.00 ? 60  PRO A HD2  4  
ATOM 6490  H HD3  . PRO A 1 60  ? -6.321  13.722  -5.846  1.00 0.00 ? 60  PRO A HD3  4  
ATOM 6491  N N    . GLU A 1 61  ? -9.696  13.349  -2.828  1.00 0.00 ? 61  GLU A N    4  
ATOM 6492  C CA   . GLU A 1 61  ? -11.024 13.178  -2.251  1.00 0.00 ? 61  GLU A CA   4  
ATOM 6493  C C    . GLU A 1 61  ? -11.055 11.985  -1.300  1.00 0.00 ? 61  GLU A C    4  
ATOM 6494  O O    . GLU A 1 61  ? -11.979 11.837  -0.501  1.00 0.00 ? 61  GLU A O    4  
ATOM 6495  C CB   . GLU A 1 61  ? -12.065 12.989  -3.357  1.00 0.00 ? 61  GLU A CB   4  
ATOM 6496  C CG   . GLU A 1 61  ? -12.100 14.130  -4.360  1.00 0.00 ? 61  GLU A CG   4  
ATOM 6497  C CD   . GLU A 1 61  ? -12.692 13.715  -5.694  1.00 0.00 ? 61  GLU A CD   4  
ATOM 6498  O OE1  . GLU A 1 61  ? -13.931 13.773  -5.836  1.00 0.00 ? 61  GLU A OE1  4  
ATOM 6499  O OE2  . GLU A 1 61  ? -11.916 13.333  -6.594  1.00 0.00 ? 61  GLU A OE2  4  
ATOM 6500  H H    . GLU A 1 61  ? -9.419  12.770  -3.569  1.00 0.00 ? 61  GLU A H    4  
ATOM 6501  H HA   . GLU A 1 61  ? -11.262 14.072  -1.695  1.00 0.00 ? 61  GLU A HA   4  
ATOM 6502  H HB2  . GLU A 1 61  ? -11.846 12.075  -3.889  1.00 0.00 ? 61  GLU A HB2  4  
ATOM 6503  H HB3  . GLU A 1 61  ? -13.042 12.906  -2.904  1.00 0.00 ? 61  GLU A HB3  4  
ATOM 6504  H HG2  . GLU A 1 61  ? -12.697 14.932  -3.953  1.00 0.00 ? 61  GLU A HG2  4  
ATOM 6505  H HG3  . GLU A 1 61  ? -11.092 14.480  -4.523  1.00 0.00 ? 61  GLU A HG3  4  
ATOM 6506  N N    . GLY A 1 62  ? -10.036 11.135  -1.393  1.00 0.00 ? 62  GLY A N    4  
ATOM 6507  C CA   . GLY A 1 62  ? -9.965  9.966   -0.536  1.00 0.00 ? 62  GLY A CA   4  
ATOM 6508  C C    . GLY A 1 62  ? -9.375  10.278  0.824   1.00 0.00 ? 62  GLY A C    4  
ATOM 6509  O O    . GLY A 1 62  ? -9.004  11.415  1.117   1.00 0.00 ? 62  GLY A O    4  
ATOM 6510  H H    . GLY A 1 62  ? -9.327  11.304  -2.048  1.00 0.00 ? 62  GLY A H    4  
ATOM 6511  H HA2  . GLY A 1 62  ? -10.961 9.570   -0.403  1.00 0.00 ? 62  GLY A HA2  4  
ATOM 6512  H HA3  . GLY A 1 62  ? -9.353  9.217   -1.018  1.00 0.00 ? 62  GLY A HA3  4  
ATOM 6513  N N    . PRO A 1 63  ? -9.282  9.252   1.683   1.00 0.00 ? 63  PRO A N    4  
ATOM 6514  C CA   . PRO A 1 63  ? -8.734  9.399   3.035   1.00 0.00 ? 63  PRO A CA   4  
ATOM 6515  C C    . PRO A 1 63  ? -7.231  9.655   3.027   1.00 0.00 ? 63  PRO A C    4  
ATOM 6516  O O    . PRO A 1 63  ? -6.749  10.594  3.659   1.00 0.00 ? 63  PRO A O    4  
ATOM 6517  C CB   . PRO A 1 63  ? -9.044  8.051   3.691   1.00 0.00 ? 63  PRO A CB   4  
ATOM 6518  C CG   . PRO A 1 63  ? -9.140  7.091   2.556   1.00 0.00 ? 63  PRO A CG   4  
ATOM 6519  C CD   . PRO A 1 63  ? -9.705  7.870   1.401   1.00 0.00 ? 63  PRO A CD   4  
ATOM 6520  H HA   . PRO A 1 63  ? -9.230  10.189  3.581   1.00 0.00 ? 63  PRO A HA   4  
ATOM 6521  H HB2  . PRO A 1 63  ? -8.243  7.785   4.368   1.00 0.00 ? 63  PRO A HB2  4  
ATOM 6522  H HB3  . PRO A 1 63  ? -9.975  8.116   4.234   1.00 0.00 ? 63  PRO A HB3  4  
ATOM 6523  H HG2  . PRO A 1 63  ? -8.160  6.713   2.310   1.00 0.00 ? 63  PRO A HG2  4  
ATOM 6524  H HG3  . PRO A 1 63  ? -9.802  6.278   2.819   1.00 0.00 ? 63  PRO A HG3  4  
ATOM 6525  H HD2  . PRO A 1 63  ? -9.285  7.521   0.469   1.00 0.00 ? 63  PRO A HD2  4  
ATOM 6526  H HD3  . PRO A 1 63  ? -10.782 7.793   1.384   1.00 0.00 ? 63  PRO A HD3  4  
ATOM 6527  N N    . ALA A 1 64  ? -6.496  8.814   2.307   1.00 0.00 ? 64  ALA A N    4  
ATOM 6528  C CA   . ALA A 1 64  ? -5.048  8.952   2.214   1.00 0.00 ? 64  ALA A CA   4  
ATOM 6529  C C    . ALA A 1 64  ? -4.644  10.415  2.064   1.00 0.00 ? 64  ALA A C    4  
ATOM 6530  O O    . ALA A 1 64  ? -3.621  10.843  2.597   1.00 0.00 ? 64  ALA A O    4  
ATOM 6531  C CB   . ALA A 1 64  ? -4.513  8.133   1.049   1.00 0.00 ? 64  ALA A CB   4  
ATOM 6532  H H    . ALA A 1 64  ? -6.939  8.085   1.825   1.00 0.00 ? 64  ALA A H    4  
ATOM 6533  H HA   . ALA A 1 64  ? -4.617  8.561   3.125   1.00 0.00 ? 64  ALA A HA   4  
ATOM 6534  H HB1  . ALA A 1 64  ? -4.135  7.190   1.417   1.00 0.00 ? 64  ALA A HB1  4  
ATOM 6535  H HB2  . ALA A 1 64  ? -5.309  7.950   0.342   1.00 0.00 ? 64  ALA A HB2  4  
ATOM 6536  H HB3  . ALA A 1 64  ? -3.717  8.675   0.563   1.00 0.00 ? 64  ALA A HB3  4  
ATOM 6537  N N    . ALA A 1 65  ? -5.453  11.176  1.335   1.00 0.00 ? 65  ALA A N    4  
ATOM 6538  C CA   . ALA A 1 65  ? -5.180  12.591  1.116   1.00 0.00 ? 65  ALA A CA   4  
ATOM 6539  C C    . ALA A 1 65  ? -5.524  13.414  2.353   1.00 0.00 ? 65  ALA A C    4  
ATOM 6540  O O    . ALA A 1 65  ? -4.801  14.342  2.713   1.00 0.00 ? 65  ALA A O    4  
ATOM 6541  C CB   . ALA A 1 65  ? -5.957  13.098  -0.090  1.00 0.00 ? 65  ALA A CB   4  
ATOM 6542  H H    . ALA A 1 65  ? -6.254  10.776  0.936   1.00 0.00 ? 65  ALA A H    4  
ATOM 6543  H HA   . ALA A 1 65  ? -4.126  12.698  0.906   1.00 0.00 ? 65  ALA A HA   4  
ATOM 6544  H HB1  . ALA A 1 65  ? -6.470  14.012  0.172   1.00 0.00 ? 65  ALA A HB1  4  
ATOM 6545  H HB2  . ALA A 1 65  ? -5.274  13.288  -0.904  1.00 0.00 ? 65  ALA A HB2  4  
ATOM 6546  H HB3  . ALA A 1 65  ? -6.679  12.353  -0.392  1.00 0.00 ? 65  ALA A HB3  4  
ATOM 6547  N N    . ALA A 1 66  ? -6.632  13.067  3.000   1.00 0.00 ? 66  ALA A N    4  
ATOM 6548  C CA   . ALA A 1 66  ? -7.070  13.773  4.197   1.00 0.00 ? 66  ALA A CA   4  
ATOM 6549  C C    . ALA A 1 66  ? -6.078  13.585  5.340   1.00 0.00 ? 66  ALA A C    4  
ATOM 6550  O O    . ALA A 1 66  ? -5.690  14.547  6.003   1.00 0.00 ? 66  ALA A O    4  
ATOM 6551  C CB   . ALA A 1 66  ? -8.454  13.297  4.614   1.00 0.00 ? 66  ALA A CB   4  
ATOM 6552  H H    . ALA A 1 66  ? -7.166  12.318  2.664   1.00 0.00 ? 66  ALA A H    4  
ATOM 6553  H HA   . ALA A 1 66  ? -7.134  14.825  3.960   1.00 0.00 ? 66  ALA A HA   4  
ATOM 6554  H HB1  . ALA A 1 66  ? -9.193  14.015  4.289   1.00 0.00 ? 66  ALA A HB1  4  
ATOM 6555  H HB2  . ALA A 1 66  ? -8.657  12.339  4.159   1.00 0.00 ? 66  ALA A HB2  4  
ATOM 6556  H HB3  . ALA A 1 66  ? -8.493  13.202  5.689   1.00 0.00 ? 66  ALA A HB3  4  
ATOM 6557  N N    . ASP A 1 67  ? -5.671  12.340  5.565   1.00 0.00 ? 67  ASP A N    4  
ATOM 6558  C CA   . ASP A 1 67  ? -4.723  12.026  6.627   1.00 0.00 ? 67  ASP A CA   4  
ATOM 6559  C C    . ASP A 1 67  ? -3.396  12.742  6.401   1.00 0.00 ? 67  ASP A C    4  
ATOM 6560  O O    . ASP A 1 67  ? -2.789  13.259  7.338   1.00 0.00 ? 67  ASP A O    4  
ATOM 6561  C CB   . ASP A 1 67  ? -4.495  10.516  6.706   1.00 0.00 ? 67  ASP A CB   4  
ATOM 6562  C CG   . ASP A 1 67  ? -3.913  10.087  8.039   1.00 0.00 ? 67  ASP A CG   4  
ATOM 6563  O OD1  . ASP A 1 67  ? -3.332  10.945  8.735   1.00 0.00 ? 67  ASP A OD1  4  
ATOM 6564  O OD2  . ASP A 1 67  ? -4.037  8.893   8.384   1.00 0.00 ? 67  ASP A OD2  4  
ATOM 6565  H H    . ASP A 1 67  ? -6.016  11.616  5.002   1.00 0.00 ? 67  ASP A H    4  
ATOM 6566  H HA   . ASP A 1 67  ? -5.146  12.366  7.561   1.00 0.00 ? 67  ASP A HA   4  
ATOM 6567  H HB2  . ASP A 1 67  ? -5.439  10.008  6.567   1.00 0.00 ? 67  ASP A HB2  4  
ATOM 6568  H HB3  . ASP A 1 67  ? -3.813  10.220  5.923   1.00 0.00 ? 67  ASP A HB3  4  
ATOM 6569  N N    . GLY A 1 68  ? -2.949  12.768  5.149   1.00 0.00 ? 68  GLY A N    4  
ATOM 6570  C CA   . GLY A 1 68  ? -1.695  13.422  4.822   1.00 0.00 ? 68  GLY A CA   4  
ATOM 6571  C C    . GLY A 1 68  ? -0.489  12.602  5.233   1.00 0.00 ? 68  GLY A C    4  
ATOM 6572  O O    . GLY A 1 68  ? 0.488   13.140  5.755   1.00 0.00 ? 68  GLY A O    4  
ATOM 6573  H H    . GLY A 1 68  ? -3.475  12.339  4.441   1.00 0.00 ? 68  GLY A H    4  
ATOM 6574  H HA2  . GLY A 1 68  ? -1.657  13.590  3.756   1.00 0.00 ? 68  GLY A HA2  4  
ATOM 6575  H HA3  . GLY A 1 68  ? -1.657  14.375  5.328   1.00 0.00 ? 68  GLY A HA3  4  
ATOM 6576  N N    . ARG A 1 69  ? -0.556  11.295  4.999   1.00 0.00 ? 69  ARG A N    4  
ATOM 6577  C CA   . ARG A 1 69  ? 0.538   10.399  5.352   1.00 0.00 ? 69  ARG A CA   4  
ATOM 6578  C C    . ARG A 1 69  ? 1.124   9.740   4.107   1.00 0.00 ? 69  ARG A C    4  
ATOM 6579  O O    . ARG A 1 69  ? 2.308   9.898   3.808   1.00 0.00 ? 69  ARG A O    4  
ATOM 6580  C CB   . ARG A 1 69  ? 0.053   9.326   6.329   1.00 0.00 ? 69  ARG A CB   4  
ATOM 6581  C CG   . ARG A 1 69  ? -0.413  9.884   7.664   1.00 0.00 ? 69  ARG A CG   4  
ATOM 6582  C CD   . ARG A 1 69  ? 0.738   10.004  8.650   1.00 0.00 ? 69  ARG A CD   4  
ATOM 6583  N NE   . ARG A 1 69  ? 1.703   11.023  8.245   1.00 0.00 ? 69  ARG A NE   4  
ATOM 6584  C CZ   . ARG A 1 69  ? 2.966   11.042  8.653   1.00 0.00 ? 69  ARG A CZ   4  
ATOM 6585  N NH1  . ARG A 1 69  ? 3.416   10.103  9.474   1.00 0.00 ? 69  ARG A NH1  4  
ATOM 6586  N NH2  . ARG A 1 69  ? 3.784   12.002  8.240   1.00 0.00 ? 69  ARG A NH2  4  
ATOM 6587  H H    . ARG A 1 69  ? -1.361  10.925  4.581   1.00 0.00 ? 69  ARG A H    4  
ATOM 6588  H HA   . ARG A 1 69  ? 1.308   10.986  5.830   1.00 0.00 ? 69  ARG A HA   4  
ATOM 6589  H HB2  . ARG A 1 69  ? -0.772  8.793   5.880   1.00 0.00 ? 69  ARG A HB2  4  
ATOM 6590  H HB3  . ARG A 1 69  ? 0.860   8.634   6.515   1.00 0.00 ? 69  ARG A HB3  4  
ATOM 6591  H HG2  . ARG A 1 69  ? -0.839  10.864  7.505   1.00 0.00 ? 69  ARG A HG2  4  
ATOM 6592  H HG3  . ARG A 1 69  ? -1.163  9.226   8.077   1.00 0.00 ? 69  ARG A HG3  4  
ATOM 6593  H HD2  . ARG A 1 69  ? 0.339   10.265  9.619   1.00 0.00 ? 69  ARG A HD2  4  
ATOM 6594  H HD3  . ARG A 1 69  ? 1.240   9.050   8.714   1.00 0.00 ? 69  ARG A HD3  4  
ATOM 6595  H HE   . ARG A 1 69  ? 1.392   11.726  7.638   1.00 0.00 ? 69  ARG A HE   4  
ATOM 6596  H HH11 . ARG A 1 69  ? 2.802   9.378   9.786   1.00 0.00 ? 69  ARG A HH11 4  
ATOM 6597  H HH12 . ARG A 1 69  ? 4.368   10.119  9.780   1.00 0.00 ? 69  ARG A HH12 4  
ATOM 6598  H HH21 . ARG A 1 69  ? 3.449   12.712  7.621   1.00 0.00 ? 69  ARG A HH21 4  
ATOM 6599  H HH22 . ARG A 1 69  ? 4.734   12.016  8.549   1.00 0.00 ? 69  ARG A HH22 4  
ATOM 6600  N N    . MET A 1 70  ? 0.288   9.000   3.386   1.00 0.00 ? 70  MET A N    4  
ATOM 6601  C CA   . MET A 1 70  ? 0.723   8.318   2.173   1.00 0.00 ? 70  MET A CA   4  
ATOM 6602  C C    . MET A 1 70  ? 1.295   9.311   1.166   1.00 0.00 ? 70  MET A C    4  
ATOM 6603  O O    . MET A 1 70  ? 0.906   10.479  1.143   1.00 0.00 ? 70  MET A O    4  
ATOM 6604  C CB   . MET A 1 70  ? -0.444  7.553   1.546   1.00 0.00 ? 70  MET A CB   4  
ATOM 6605  C CG   . MET A 1 70  ? -0.577  6.126   2.053   1.00 0.00 ? 70  MET A CG   4  
ATOM 6606  S SD   . MET A 1 70  ? -1.336  5.026   0.842   1.00 0.00 ? 70  MET A SD   4  
ATOM 6607  C CE   . MET A 1 70  ? 0.115   4.405   -0.006  1.00 0.00 ? 70  MET A CE   4  
ATOM 6608  H H    . MET A 1 70  ? -0.644  8.912   3.675   1.00 0.00 ? 70  MET A H    4  
ATOM 6609  H HA   . MET A 1 70  ? 1.496   7.616   2.447   1.00 0.00 ? 70  MET A HA   4  
ATOM 6610  H HB2  . MET A 1 70  ? -1.362  8.077   1.765   1.00 0.00 ? 70  MET A HB2  4  
ATOM 6611  H HB3  . MET A 1 70  ? -0.304  7.519   0.476   1.00 0.00 ? 70  MET A HB3  4  
ATOM 6612  H HG2  . MET A 1 70  ? 0.406   5.750   2.293   1.00 0.00 ? 70  MET A HG2  4  
ATOM 6613  H HG3  . MET A 1 70  ? -1.186  6.132   2.945   1.00 0.00 ? 70  MET A HG3  4  
ATOM 6614  H HE1  . MET A 1 70  ? 0.983   4.966   0.307   1.00 0.00 ? 70  MET A HE1  4  
ATOM 6615  H HE2  . MET A 1 70  ? 0.254   3.362   0.238   1.00 0.00 ? 70  MET A HE2  4  
ATOM 6616  H HE3  . MET A 1 70  ? -0.019  4.512   -1.072  1.00 0.00 ? 70  MET A HE3  4  
ATOM 6617  N N    . ARG A 1 71  ? 2.219   8.839   0.336   1.00 0.00 ? 71  ARG A N    4  
ATOM 6618  C CA   . ARG A 1 71  ? 2.845   9.687   -0.672  1.00 0.00 ? 71  ARG A CA   4  
ATOM 6619  C C    . ARG A 1 71  ? 3.010   8.934   -1.989  1.00 0.00 ? 71  ARG A C    4  
ATOM 6620  O O    . ARG A 1 71  ? 2.694   7.747   -2.081  1.00 0.00 ? 71  ARG A O    4  
ATOM 6621  C CB   . ARG A 1 71  ? 4.207   10.180  -0.180  1.00 0.00 ? 71  ARG A CB   4  
ATOM 6622  C CG   . ARG A 1 71  ? 4.116   11.236  0.909   1.00 0.00 ? 71  ARG A CG   4  
ATOM 6623  C CD   . ARG A 1 71  ? 5.401   12.042  1.013   1.00 0.00 ? 71  ARG A CD   4  
ATOM 6624  N NE   . ARG A 1 71  ? 5.354   13.010  2.105   1.00 0.00 ? 71  ARG A NE   4  
ATOM 6625  C CZ   . ARG A 1 71  ? 4.648   14.134  2.061   1.00 0.00 ? 71  ARG A CZ   4  
ATOM 6626  N NH1  . ARG A 1 71  ? 3.934   14.431  0.984   1.00 0.00 ? 71  ARG A NH1  4  
ATOM 6627  N NH2  . ARG A 1 71  ? 4.655   14.965  3.096   1.00 0.00 ? 71  ARG A NH2  4  
ATOM 6628  H H    . ARG A 1 71  ? 2.488   7.899   0.403   1.00 0.00 ? 71  ARG A H    4  
ATOM 6629  H HA   . ARG A 1 71  ? 2.202   10.538  -0.836  1.00 0.00 ? 71  ARG A HA   4  
ATOM 6630  H HB2  . ARG A 1 71  ? 4.762   9.339   0.210   1.00 0.00 ? 71  ARG A HB2  4  
ATOM 6631  H HB3  . ARG A 1 71  ? 4.747   10.600  -1.015  1.00 0.00 ? 71  ARG A HB3  4  
ATOM 6632  H HG2  . ARG A 1 71  ? 3.301   11.907  0.679   1.00 0.00 ? 71  ARG A HG2  4  
ATOM 6633  H HG3  . ARG A 1 71  ? 3.928   10.750  1.854   1.00 0.00 ? 71  ARG A HG3  4  
ATOM 6634  H HD2  . ARG A 1 71  ? 6.223   11.363  1.182   1.00 0.00 ? 71  ARG A HD2  4  
ATOM 6635  H HD3  . ARG A 1 71  ? 5.556   12.569  0.083   1.00 0.00 ? 71  ARG A HD3  4  
ATOM 6636  H HE   . ARG A 1 71  ? 5.874   12.810  2.911   1.00 0.00 ? 71  ARG A HE   4  
ATOM 6637  H HH11 . ARG A 1 71  ? 3.926   13.806  0.203   1.00 0.00 ? 71  ARG A HH11 4  
ATOM 6638  H HH12 . ARG A 1 71  ? 3.403   15.277  0.953   1.00 0.00 ? 71  ARG A HH12 4  
ATOM 6639  H HH21 . ARG A 1 71  ? 5.192   14.745  3.909   1.00 0.00 ? 71  ARG A HH21 4  
ATOM 6640  H HH22 . ARG A 1 71  ? 4.124   15.811  3.061   1.00 0.00 ? 71  ARG A HH22 4  
ATOM 6641  N N    . ILE A 1 72  ? 3.505   9.632   -3.006  1.00 0.00 ? 72  ILE A N    4  
ATOM 6642  C CA   . ILE A 1 72  ? 3.711   9.030   -4.317  1.00 0.00 ? 72  ILE A CA   4  
ATOM 6643  C C    . ILE A 1 72  ? 5.020   8.248   -4.362  1.00 0.00 ? 72  ILE A C    4  
ATOM 6644  O O    . ILE A 1 72  ? 6.099   8.812   -4.182  1.00 0.00 ? 72  ILE A O    4  
ATOM 6645  C CB   . ILE A 1 72  ? 3.723   10.094  -5.430  1.00 0.00 ? 72  ILE A CB   4  
ATOM 6646  C CG1  . ILE A 1 72  ? 2.559   11.070  -5.245  1.00 0.00 ? 72  ILE A CG1  4  
ATOM 6647  C CG2  . ILE A 1 72  ? 3.652   9.431   -6.797  1.00 0.00 ? 72  ILE A CG2  4  
ATOM 6648  C CD1  . ILE A 1 72  ? 1.258   10.395  -4.872  1.00 0.00 ? 72  ILE A CD1  4  
ATOM 6649  H H    . ILE A 1 72  ? 3.737   10.574  -2.871  1.00 0.00 ? 72  ILE A H    4  
ATOM 6650  H HA   . ILE A 1 72  ? 2.892   8.350   -4.504  1.00 0.00 ? 72  ILE A HA   4  
ATOM 6651  H HB   . ILE A 1 72  ? 4.653   10.638  -5.368  1.00 0.00 ? 72  ILE A HB   4  
ATOM 6652  H HG12 . ILE A 1 72  ? 2.805   11.769  -4.462  1.00 0.00 ? 72  ILE A HG12 4  
ATOM 6653  H HG13 . ILE A 1 72  ? 2.401   11.610  -6.167  1.00 0.00 ? 72  ILE A HG13 4  
ATOM 6654  H HG21 . ILE A 1 72  ? 4.586   9.582   -7.319  1.00 0.00 ? 72  ILE A HG21 4  
ATOM 6655  H HG22 . ILE A 1 72  ? 3.477   8.373   -6.675  1.00 0.00 ? 72  ILE A HG22 4  
ATOM 6656  H HG23 . ILE A 1 72  ? 2.846   9.867   -7.368  1.00 0.00 ? 72  ILE A HG23 4  
ATOM 6657  H HD11 . ILE A 1 72  ? 0.453   11.114  -4.914  1.00 0.00 ? 72  ILE A HD11 4  
ATOM 6658  H HD12 . ILE A 1 72  ? 1.058   9.590   -5.563  1.00 0.00 ? 72  ILE A HD12 4  
ATOM 6659  H HD13 . ILE A 1 72  ? 1.333   9.998   -3.869  1.00 0.00 ? 72  ILE A HD13 4  
ATOM 6660  N N    . GLY A 1 73  ? 4.917   6.945   -4.607  1.00 0.00 ? 73  GLY A N    4  
ATOM 6661  C CA   . GLY A 1 73  ? 6.100   6.107   -4.674  1.00 0.00 ? 73  GLY A CA   4  
ATOM 6662  C C    . GLY A 1 73  ? 6.023   4.920   -3.736  1.00 0.00 ? 73  GLY A C    4  
ATOM 6663  O O    . GLY A 1 73  ? 6.721   3.923   -3.926  1.00 0.00 ? 73  GLY A O    4  
ATOM 6664  H H    . GLY A 1 73  ? 4.031   6.550   -4.743  1.00 0.00 ? 73  GLY A H    4  
ATOM 6665  H HA2  . GLY A 1 73  ? 6.216   5.747   -5.685  1.00 0.00 ? 73  GLY A HA2  4  
ATOM 6666  H HA3  . GLY A 1 73  ? 6.963   6.702   -4.413  1.00 0.00 ? 73  GLY A HA3  4  
ATOM 6667  N N    . ASP A 1 74  ? 5.175   5.025   -2.719  1.00 0.00 ? 74  ASP A N    4  
ATOM 6668  C CA   . ASP A 1 74  ? 5.009   3.951   -1.747  1.00 0.00 ? 74  ASP A CA   4  
ATOM 6669  C C    . ASP A 1 74  ? 4.700   2.630   -2.443  1.00 0.00 ? 74  ASP A C    4  
ATOM 6670  O O    . ASP A 1 74  ? 4.235   2.613   -3.582  1.00 0.00 ? 74  ASP A O    4  
ATOM 6671  C CB   . ASP A 1 74  ? 3.893   4.295   -0.759  1.00 0.00 ? 74  ASP A CB   4  
ATOM 6672  C CG   . ASP A 1 74  ? 4.243   5.479   0.121   1.00 0.00 ? 74  ASP A CG   4  
ATOM 6673  O OD1  . ASP A 1 74  ? 5.178   5.354   0.939   1.00 0.00 ? 74  ASP A OD1  4  
ATOM 6674  O OD2  . ASP A 1 74  ? 3.583   6.530   -0.009  1.00 0.00 ? 74  ASP A OD2  4  
ATOM 6675  H H    . ASP A 1 74  ? 4.646   5.845   -2.621  1.00 0.00 ? 74  ASP A H    4  
ATOM 6676  H HA   . ASP A 1 74  ? 5.937   3.849   -1.205  1.00 0.00 ? 74  ASP A HA   4  
ATOM 6677  H HB2  . ASP A 1 74  ? 2.995   4.534   -1.310  1.00 0.00 ? 74  ASP A HB2  4  
ATOM 6678  H HB3  . ASP A 1 74  ? 3.705   3.441   -0.126  1.00 0.00 ? 74  ASP A HB3  4  
ATOM 6679  N N    . GLU A 1 75  ? 4.962   1.526   -1.751  1.00 0.00 ? 75  GLU A N    4  
ATOM 6680  C CA   . GLU A 1 75  ? 4.713   0.200   -2.305  1.00 0.00 ? 75  GLU A CA   4  
ATOM 6681  C C    . GLU A 1 75  ? 3.923   -0.661  -1.323  1.00 0.00 ? 75  GLU A C    4  
ATOM 6682  O O    . GLU A 1 75  ? 4.489   -1.244  -0.398  1.00 0.00 ? 75  GLU A O    4  
ATOM 6683  C CB   . GLU A 1 75  ? 6.034   -0.488  -2.655  1.00 0.00 ? 75  GLU A CB   4  
ATOM 6684  C CG   . GLU A 1 75  ? 5.877   -1.950  -3.036  1.00 0.00 ? 75  GLU A CG   4  
ATOM 6685  C CD   . GLU A 1 75  ? 7.208   -2.643  -3.252  1.00 0.00 ? 75  GLU A CD   4  
ATOM 6686  O OE1  . GLU A 1 75  ? 7.867   -2.990  -2.249  1.00 0.00 ? 75  GLU A OE1  4  
ATOM 6687  O OE2  . GLU A 1 75  ? 7.591   -2.839  -4.424  1.00 0.00 ? 75  GLU A OE2  4  
ATOM 6688  H H    . GLU A 1 75  ? 5.332   1.604   -0.847  1.00 0.00 ? 75  GLU A H    4  
ATOM 6689  H HA   . GLU A 1 75  ? 4.131   0.321   -3.207  1.00 0.00 ? 75  GLU A HA   4  
ATOM 6690  H HB2  . GLU A 1 75  ? 6.488   0.033   -3.486  1.00 0.00 ? 75  GLU A HB2  4  
ATOM 6691  H HB3  . GLU A 1 75  ? 6.693   -0.428  -1.802  1.00 0.00 ? 75  GLU A HB3  4  
ATOM 6692  H HG2  . GLU A 1 75  ? 5.348   -2.460  -2.244  1.00 0.00 ? 75  GLU A HG2  4  
ATOM 6693  H HG3  . GLU A 1 75  ? 5.303   -2.012  -3.949  1.00 0.00 ? 75  GLU A HG3  4  
ATOM 6694  N N    . LEU A 1 76  ? 2.613   -0.734  -1.531  1.00 0.00 ? 76  LEU A N    4  
ATOM 6695  C CA   . LEU A 1 76  ? 1.744   -1.523  -0.664  1.00 0.00 ? 76  LEU A CA   4  
ATOM 6696  C C    . LEU A 1 76  ? 2.272   -2.946  -0.513  1.00 0.00 ? 76  LEU A C    4  
ATOM 6697  O O    . LEU A 1 76  ? 2.602   -3.605  -1.499  1.00 0.00 ? 76  LEU A O    4  
ATOM 6698  C CB   . LEU A 1 76  ? 0.322   -1.552  -1.226  1.00 0.00 ? 76  LEU A CB   4  
ATOM 6699  C CG   . LEU A 1 76  ? -0.417  -0.213  -1.253  1.00 0.00 ? 76  LEU A CG   4  
ATOM 6700  C CD1  . LEU A 1 76  ? -1.773  -0.365  -1.924  1.00 0.00 ? 76  LEU A CD1  4  
ATOM 6701  C CD2  . LEU A 1 76  ? -0.577  0.336   0.157   1.00 0.00 ? 76  LEU A CD2  4  
ATOM 6702  H H    . LEU A 1 76  ? 2.220   -0.247  -2.284  1.00 0.00 ? 76  LEU A H    4  
ATOM 6703  H HA   . LEU A 1 76  ? 1.730   -1.052  0.307   1.00 0.00 ? 76  LEU A HA   4  
ATOM 6704  H HB2  . LEU A 1 76  ? 0.373   -1.921  -2.238  1.00 0.00 ? 76  LEU A HB2  4  
ATOM 6705  H HB3  . LEU A 1 76  ? -0.257  -2.238  -0.623  1.00 0.00 ? 76  LEU A HB3  4  
ATOM 6706  H HG   . LEU A 1 76  ? 0.162   0.498   -1.826  1.00 0.00 ? 76  LEU A HG   4  
ATOM 6707  H HD11 . LEU A 1 76  ? -2.225  -1.296  -1.617  1.00 0.00 ? 76  LEU A HD11 4  
ATOM 6708  H HD12 . LEU A 1 76  ? -1.645  -0.364  -2.997  1.00 0.00 ? 76  LEU A HD12 4  
ATOM 6709  H HD13 . LEU A 1 76  ? -2.411  0.458   -1.637  1.00 0.00 ? 76  LEU A HD13 4  
ATOM 6710  H HD21 . LEU A 1 76  ? -1.590  0.683   0.295   1.00 0.00 ? 76  LEU A HD21 4  
ATOM 6711  H HD22 . LEU A 1 76  ? 0.108   1.160   0.302   1.00 0.00 ? 76  LEU A HD22 4  
ATOM 6712  H HD23 . LEU A 1 76  ? -0.361  -0.442  0.874   1.00 0.00 ? 76  LEU A HD23 4  
ATOM 6713  N N    . LEU A 1 77  ? 2.348   -3.414  0.728   1.00 0.00 ? 77  LEU A N    4  
ATOM 6714  C CA   . LEU A 1 77  ? 2.834   -4.761  1.009   1.00 0.00 ? 77  LEU A CA   4  
ATOM 6715  C C    . LEU A 1 77  ? 1.716   -5.639  1.561   1.00 0.00 ? 77  LEU A C    4  
ATOM 6716  O O    . LEU A 1 77  ? 1.601   -6.811  1.203   1.00 0.00 ? 77  LEU A O    4  
ATOM 6717  C CB   . LEU A 1 77  ? 3.994   -4.708  2.005   1.00 0.00 ? 77  LEU A CB   4  
ATOM 6718  C CG   . LEU A 1 77  ? 5.195   -3.856  1.591   1.00 0.00 ? 77  LEU A CG   4  
ATOM 6719  C CD1  . LEU A 1 77  ? 6.028   -3.481  2.807   1.00 0.00 ? 77  LEU A CD1  4  
ATOM 6720  C CD2  . LEU A 1 77  ? 6.046   -4.595  0.568   1.00 0.00 ? 77  LEU A CD2  4  
ATOM 6721  H H    . LEU A 1 77  ? 2.071   -2.842  1.473   1.00 0.00 ? 77  LEU A H    4  
ATOM 6722  H HA   . LEU A 1 77  ? 3.186   -5.186  0.081   1.00 0.00 ? 77  LEU A HA   4  
ATOM 6723  H HB2  . LEU A 1 77  ? 3.614   -4.313  2.935   1.00 0.00 ? 77  LEU A HB2  4  
ATOM 6724  H HB3  . LEU A 1 77  ? 4.342   -5.719  2.160   1.00 0.00 ? 77  LEU A HB3  4  
ATOM 6725  H HG   . LEU A 1 77  ? 4.841   -2.942  1.135   1.00 0.00 ? 77  LEU A HG   4  
ATOM 6726  H HD11 . LEU A 1 77  ? 6.389   -2.470  2.698   1.00 0.00 ? 77  LEU A HD11 4  
ATOM 6727  H HD12 . LEU A 1 77  ? 6.866   -4.156  2.892   1.00 0.00 ? 77  LEU A HD12 4  
ATOM 6728  H HD13 . LEU A 1 77  ? 5.418   -3.552  3.696   1.00 0.00 ? 77  LEU A HD13 4  
ATOM 6729  H HD21 . LEU A 1 77  ? 6.157   -3.984  -0.316  1.00 0.00 ? 77  LEU A HD21 4  
ATOM 6730  H HD22 . LEU A 1 77  ? 5.564   -5.526  0.304   1.00 0.00 ? 77  LEU A HD22 4  
ATOM 6731  H HD23 . LEU A 1 77  ? 7.019   -4.800  0.989   1.00 0.00 ? 77  LEU A HD23 4  
ATOM 6732  N N    . GLU A 1 78  ? 0.892   -5.063  2.431   1.00 0.00 ? 78  GLU A N    4  
ATOM 6733  C CA   . GLU A 1 78  ? -0.218  -5.794  3.030   1.00 0.00 ? 78  GLU A CA   4  
ATOM 6734  C C    . GLU A 1 78  ? -1.401  -4.867  3.294   1.00 0.00 ? 78  GLU A C    4  
ATOM 6735  O O    . GLU A 1 78  ? -1.225  -3.672  3.531   1.00 0.00 ? 78  GLU A O    4  
ATOM 6736  C CB   . GLU A 1 78  ? 0.225   -6.458  4.336   1.00 0.00 ? 78  GLU A CB   4  
ATOM 6737  C CG   . GLU A 1 78  ? 1.559   -7.177  4.231   1.00 0.00 ? 78  GLU A CG   4  
ATOM 6738  C CD   . GLU A 1 78  ? 1.870   -8.012  5.458   1.00 0.00 ? 78  GLU A CD   4  
ATOM 6739  O OE1  . GLU A 1 78  ? 0.949   -8.686  5.966   1.00 0.00 ? 78  GLU A OE1  4  
ATOM 6740  O OE2  . GLU A 1 78  ? 3.034   -7.992  5.910   1.00 0.00 ? 78  GLU A OE2  4  
ATOM 6741  H H    . GLU A 1 78  ? 1.035   -4.125  2.676   1.00 0.00 ? 78  GLU A H    4  
ATOM 6742  H HA   . GLU A 1 78  ? -0.525  -6.560  2.334   1.00 0.00 ? 78  GLU A HA   4  
ATOM 6743  H HB2  . GLU A 1 78  ? 0.306   -5.701  5.101   1.00 0.00 ? 78  GLU A HB2  4  
ATOM 6744  H HB3  . GLU A 1 78  ? -0.525  -7.177  4.632   1.00 0.00 ? 78  GLU A HB3  4  
ATOM 6745  H HG2  . GLU A 1 78  ? 1.537   -7.826  3.369   1.00 0.00 ? 78  GLU A HG2  4  
ATOM 6746  H HG3  . GLU A 1 78  ? 2.341   -6.442  4.107   1.00 0.00 ? 78  GLU A HG3  4  
ATOM 6747  N N    . ILE A 1 79  ? -2.605  -5.427  3.250   1.00 0.00 ? 79  ILE A N    4  
ATOM 6748  C CA   . ILE A 1 79  ? -3.817  -4.651  3.484   1.00 0.00 ? 79  ILE A CA   4  
ATOM 6749  C C    . ILE A 1 79  ? -4.912  -5.515  4.102   1.00 0.00 ? 79  ILE A C    4  
ATOM 6750  O O    . ILE A 1 79  ? -5.197  -6.610  3.620   1.00 0.00 ? 79  ILE A O    4  
ATOM 6751  C CB   . ILE A 1 79  ? -4.346  -4.026  2.180   1.00 0.00 ? 79  ILE A CB   4  
ATOM 6752  C CG1  . ILE A 1 79  ? -3.285  -3.117  1.557   1.00 0.00 ? 79  ILE A CG1  4  
ATOM 6753  C CG2  . ILE A 1 79  ? -5.626  -3.249  2.447   1.00 0.00 ? 79  ILE A CG2  4  
ATOM 6754  C CD1  . ILE A 1 79  ? -3.766  -2.381  0.327   1.00 0.00 ? 79  ILE A CD1  4  
ATOM 6755  H H    . ILE A 1 79  ? -2.680  -6.385  3.056   1.00 0.00 ? 79  ILE A H    4  
ATOM 6756  H HA   . ILE A 1 79  ? -3.573  -3.853  4.170   1.00 0.00 ? 79  ILE A HA   4  
ATOM 6757  H HB   . ILE A 1 79  ? -4.575  -4.825  1.491   1.00 0.00 ? 79  ILE A HB   4  
ATOM 6758  H HG12 . ILE A 1 79  ? -2.978  -2.382  2.284   1.00 0.00 ? 79  ILE A HG12 4  
ATOM 6759  H HG13 . ILE A 1 79  ? -2.431  -3.715  1.274   1.00 0.00 ? 79  ILE A HG13 4  
ATOM 6760  H HG21 . ILE A 1 79  ? -5.931  -3.399  3.472   1.00 0.00 ? 79  ILE A HG21 4  
ATOM 6761  H HG22 . ILE A 1 79  ? -5.451  -2.198  2.274   1.00 0.00 ? 79  ILE A HG22 4  
ATOM 6762  H HG23 . ILE A 1 79  ? -6.404  -3.598  1.785   1.00 0.00 ? 79  ILE A HG23 4  
ATOM 6763  H HD11 . ILE A 1 79  ? -4.845  -2.337  0.332   1.00 0.00 ? 79  ILE A HD11 4  
ATOM 6764  H HD12 . ILE A 1 79  ? -3.364  -1.379  0.326   1.00 0.00 ? 79  ILE A HD12 4  
ATOM 6765  H HD13 . ILE A 1 79  ? -3.433  -2.903  -0.559  1.00 0.00 ? 79  ILE A HD13 4  
ATOM 6766  N N    . ASN A 1 80  ? -5.522  -5.012  5.170   1.00 0.00 ? 80  ASN A N    4  
ATOM 6767  C CA   . ASN A 1 80  ? -6.587  -5.737  5.853   1.00 0.00 ? 80  ASN A CA   4  
ATOM 6768  C C    . ASN A 1 80  ? -6.169  -7.177  6.139   1.00 0.00 ? 80  ASN A C    4  
ATOM 6769  O O    . ASN A 1 80  ? -6.974  -8.101  6.029   1.00 0.00 ? 80  ASN A O    4  
ATOM 6770  C CB   . ASN A 1 80  ? -7.864  -5.723  5.010   1.00 0.00 ? 80  ASN A CB   4  
ATOM 6771  C CG   . ASN A 1 80  ? -9.080  -6.177  5.795   1.00 0.00 ? 80  ASN A CG   4  
ATOM 6772  O OD1  . ASN A 1 80  ? -9.678  -7.210  5.491   1.00 0.00 ? 80  ASN A OD1  4  
ATOM 6773  N ND2  . ASN A 1 80  ? -9.451  -5.406  6.810   1.00 0.00 ? 80  ASN A ND2  4  
ATOM 6774  H H    . ASN A 1 80  ? -5.250  -4.133  5.507   1.00 0.00 ? 80  ASN A H    4  
ATOM 6775  H HA   . ASN A 1 80  ? -6.780  -5.238  6.790   1.00 0.00 ? 80  ASN A HA   4  
ATOM 6776  H HB2  . ASN A 1 80  ? -8.043  -4.718  4.657   1.00 0.00 ? 80  ASN A HB2  4  
ATOM 6777  H HB3  . ASN A 1 80  ? -7.738  -6.381  4.164   1.00 0.00 ? 80  ASN A HB3  4  
ATOM 6778  H HD21 . ASN A 1 80  ? -8.927  -4.598  6.994   1.00 0.00 ? 80  ASN A HD21 4  
ATOM 6779  H HD22 . ASN A 1 80  ? -10.233 -5.677  7.335   1.00 0.00 ? 80  ASN A HD22 4  
ATOM 6780  N N    . ASN A 1 81  ? -4.905  -7.358  6.505   1.00 0.00 ? 81  ASN A N    4  
ATOM 6781  C CA   . ASN A 1 81  ? -4.379  -8.685  6.807   1.00 0.00 ? 81  ASN A CA   4  
ATOM 6782  C C    . ASN A 1 81  ? -4.326  -9.547  5.550   1.00 0.00 ? 81  ASN A C    4  
ATOM 6783  O O    . ASN A 1 81  ? -4.800  -10.683 5.544   1.00 0.00 ? 81  ASN A O    4  
ATOM 6784  C CB   . ASN A 1 81  ? -5.241  -9.368  7.871   1.00 0.00 ? 81  ASN A CB   4  
ATOM 6785  C CG   . ASN A 1 81  ? -5.550  -8.452  9.040   1.00 0.00 ? 81  ASN A CG   4  
ATOM 6786  O OD1  . ASN A 1 81  ? -4.645  -7.921  9.683   1.00 0.00 ? 81  ASN A OD1  4  
ATOM 6787  N ND2  . ASN A 1 81  ? -6.834  -8.264  9.320   1.00 0.00 ? 81  ASN A ND2  4  
ATOM 6788  H H    . ASN A 1 81  ? -4.311  -6.582  6.575   1.00 0.00 ? 81  ASN A H    4  
ATOM 6789  H HA   . ASN A 1 81  ? -3.377  -8.565  7.190   1.00 0.00 ? 81  ASN A HA   4  
ATOM 6790  H HB2  . ASN A 1 81  ? -6.175  -9.677  7.425   1.00 0.00 ? 81  ASN A HB2  4  
ATOM 6791  H HB3  . ASN A 1 81  ? -4.720  -10.236 8.245   1.00 0.00 ? 81  ASN A HB3  4  
ATOM 6792  H HD21 . ASN A 1 81  ? -7.501  -8.719  8.765   1.00 0.00 ? 81  ASN A HD21 4  
ATOM 6793  H HD22 . ASN A 1 81  ? -7.063  -7.676  10.070  1.00 0.00 ? 81  ASN A HD22 4  
ATOM 6794  N N    . GLN A 1 82  ? -3.745  -8.999  4.487   1.00 0.00 ? 82  GLN A N    4  
ATOM 6795  C CA   . GLN A 1 82  ? -3.630  -9.719  3.224   1.00 0.00 ? 82  GLN A CA   4  
ATOM 6796  C C    . GLN A 1 82  ? -2.397  -9.264  2.449   1.00 0.00 ? 82  GLN A C    4  
ATOM 6797  O O    . GLN A 1 82  ? -2.382  -8.177  1.872   1.00 0.00 ? 82  GLN A O    4  
ATOM 6798  C CB   . GLN A 1 82  ? -4.886  -9.509  2.377   1.00 0.00 ? 82  GLN A CB   4  
ATOM 6799  C CG   . GLN A 1 82  ? -6.078  -10.329 2.842   1.00 0.00 ? 82  GLN A CG   4  
ATOM 6800  C CD   . GLN A 1 82  ? -7.114  -10.524 1.753   1.00 0.00 ? 82  GLN A CD   4  
ATOM 6801  O OE1  . GLN A 1 82  ? -6.838  -11.135 0.720   1.00 0.00 ? 82  GLN A OE1  4  
ATOM 6802  N NE2  . GLN A 1 82  ? -8.315  -10.004 1.978   1.00 0.00 ? 82  GLN A NE2  4  
ATOM 6803  H H    . GLN A 1 82  ? -3.386  -8.090  4.554   1.00 0.00 ? 82  GLN A H    4  
ATOM 6804  H HA   . GLN A 1 82  ? -3.530  -10.770 3.450   1.00 0.00 ? 82  GLN A HA   4  
ATOM 6805  H HB2  . GLN A 1 82  ? -5.159  -8.465  2.411   1.00 0.00 ? 82  GLN A HB2  4  
ATOM 6806  H HB3  . GLN A 1 82  ? -4.666  -9.782  1.355   1.00 0.00 ? 82  GLN A HB3  4  
ATOM 6807  H HG2  . GLN A 1 82  ? -5.728  -11.300 3.162   1.00 0.00 ? 82  GLN A HG2  4  
ATOM 6808  H HG3  . GLN A 1 82  ? -6.543  -9.823  3.675   1.00 0.00 ? 82  GLN A HG3  4  
ATOM 6809  H HE21 . GLN A 1 82  ? -8.462  -9.530  2.823   1.00 0.00 ? 82  GLN A HE21 4  
ATOM 6810  H HE22 . GLN A 1 82  ? -9.003  -10.114 1.291   1.00 0.00 ? 82  GLN A HE22 4  
ATOM 6811  N N    . ILE A 1 83  ? -1.367  -10.103 2.441   1.00 0.00 ? 83  ILE A N    4  
ATOM 6812  C CA   . ILE A 1 83  ? -0.131  -9.787  1.736   1.00 0.00 ? 83  ILE A CA   4  
ATOM 6813  C C    . ILE A 1 83  ? -0.366  -9.683  0.233   1.00 0.00 ? 83  ILE A C    4  
ATOM 6814  O O    . ILE A 1 83  ? -0.894  -10.606 -0.389  1.00 0.00 ? 83  ILE A O    4  
ATOM 6815  C CB   . ILE A 1 83  ? 0.956   -10.846 2.003   1.00 0.00 ? 83  ILE A CB   4  
ATOM 6816  C CG1  . ILE A 1 83  ? 1.224   -10.966 3.504   1.00 0.00 ? 83  ILE A CG1  4  
ATOM 6817  C CG2  . ILE A 1 83  ? 2.234   -10.492 1.257   1.00 0.00 ? 83  ILE A CG2  4  
ATOM 6818  C CD1  . ILE A 1 83  ? 2.384   -11.878 3.839   1.00 0.00 ? 83  ILE A CD1  4  
ATOM 6819  H H    . ILE A 1 83  ? -1.440  -10.955 2.919   1.00 0.00 ? 83  ILE A H    4  
ATOM 6820  H HA   . ILE A 1 83  ? 0.226   -8.835  2.101   1.00 0.00 ? 83  ILE A HA   4  
ATOM 6821  H HB   . ILE A 1 83  ? 0.601   -11.795 1.630   1.00 0.00 ? 83  ILE A HB   4  
ATOM 6822  H HG12 . ILE A 1 83  ? 1.444   -9.989  3.904   1.00 0.00 ? 83  ILE A HG12 4  
ATOM 6823  H HG13 . ILE A 1 83  ? 0.342   -11.358 3.989   1.00 0.00 ? 83  ILE A HG13 4  
ATOM 6824  H HG21 . ILE A 1 83  ? 2.001   -9.829  0.438   1.00 0.00 ? 83  ILE A HG21 4  
ATOM 6825  H HG22 . ILE A 1 83  ? 2.920   -10.002 1.932   1.00 0.00 ? 83  ILE A HG22 4  
ATOM 6826  H HG23 . ILE A 1 83  ? 2.688   -11.393 0.873   1.00 0.00 ? 83  ILE A HG23 4  
ATOM 6827  H HD11 . ILE A 1 83  ? 3.110   -11.846 3.040   1.00 0.00 ? 83  ILE A HD11 4  
ATOM 6828  H HD12 . ILE A 1 83  ? 2.845   -11.551 4.759   1.00 0.00 ? 83  ILE A HD12 4  
ATOM 6829  H HD13 . ILE A 1 83  ? 2.024   -12.890 3.957   1.00 0.00 ? 83  ILE A HD13 4  
ATOM 6830  N N    . LEU A 1 84  ? 0.030   -8.555  -0.345  1.00 0.00 ? 84  LEU A N    4  
ATOM 6831  C CA   . LEU A 1 84  ? -0.135  -8.331  -1.777  1.00 0.00 ? 84  LEU A CA   4  
ATOM 6832  C C    . LEU A 1 84  ? 1.128   -8.719  -2.539  1.00 0.00 ? 84  LEU A C    4  
ATOM 6833  O O    . LEU A 1 84  ? 1.072   -9.065  -3.719  1.00 0.00 ? 84  LEU A O    4  
ATOM 6834  C CB   . LEU A 1 84  ? -0.477  -6.864  -2.047  1.00 0.00 ? 84  LEU A CB   4  
ATOM 6835  C CG   . LEU A 1 84  ? -1.472  -6.218  -1.083  1.00 0.00 ? 84  LEU A CG   4  
ATOM 6836  C CD1  . LEU A 1 84  ? -1.547  -4.718  -1.318  1.00 0.00 ? 84  LEU A CD1  4  
ATOM 6837  C CD2  . LEU A 1 84  ? -2.848  -6.852  -1.232  1.00 0.00 ? 84  LEU A CD2  4  
ATOM 6838  H H    . LEU A 1 84  ? 0.444   -7.856  0.202   1.00 0.00 ? 84  LEU A H    4  
ATOM 6839  H HA   . LEU A 1 84  ? -0.951  -8.951  -2.118  1.00 0.00 ? 84  LEU A HA   4  
ATOM 6840  H HB2  . LEU A 1 84  ? 0.440   -6.298  -2.004  1.00 0.00 ? 84  LEU A HB2  4  
ATOM 6841  H HB3  . LEU A 1 84  ? -0.891  -6.800  -3.044  1.00 0.00 ? 84  LEU A HB3  4  
ATOM 6842  H HG   . LEU A 1 84  ? -1.137  -6.380  -0.067  1.00 0.00 ? 84  LEU A HG   4  
ATOM 6843  H HD11 . LEU A 1 84  ? -2.534  -4.457  -1.667  1.00 0.00 ? 84  LEU A HD11 4  
ATOM 6844  H HD12 . LEU A 1 84  ? -0.815  -4.433  -2.059  1.00 0.00 ? 84  LEU A HD12 4  
ATOM 6845  H HD13 . LEU A 1 84  ? -1.342  -4.198  -0.393  1.00 0.00 ? 84  LEU A HD13 4  
ATOM 6846  H HD21 . LEU A 1 84  ? -3.606  -6.087  -1.159  1.00 0.00 ? 84  LEU A HD21 4  
ATOM 6847  H HD22 . LEU A 1 84  ? -2.995  -7.581  -0.447  1.00 0.00 ? 84  LEU A HD22 4  
ATOM 6848  H HD23 . LEU A 1 84  ? -2.918  -7.338  -2.193  1.00 0.00 ? 84  LEU A HD23 4  
ATOM 6849  N N    . TYR A 1 85  ? 2.265   -8.661  -1.856  1.00 0.00 ? 85  TYR A N    4  
ATOM 6850  C CA   . TYR A 1 85  ? 3.543   -9.006  -2.468  1.00 0.00 ? 85  TYR A CA   4  
ATOM 6851  C C    . TYR A 1 85  ? 3.401   -10.223 -3.376  1.00 0.00 ? 85  TYR A C    4  
ATOM 6852  O O    . TYR A 1 85  ? 3.486   -11.364 -2.923  1.00 0.00 ? 85  TYR A O    4  
ATOM 6853  C CB   . TYR A 1 85  ? 4.592   -9.281  -1.389  1.00 0.00 ? 85  TYR A CB   4  
ATOM 6854  C CG   . TYR A 1 85  ? 5.983   -9.498  -1.939  1.00 0.00 ? 85  TYR A CG   4  
ATOM 6855  C CD1  . TYR A 1 85  ? 6.383   -10.747 -2.397  1.00 0.00 ? 85  TYR A CD1  4  
ATOM 6856  C CD2  . TYR A 1 85  ? 6.899   -8.455  -1.999  1.00 0.00 ? 85  TYR A CD2  4  
ATOM 6857  C CE1  . TYR A 1 85  ? 7.654   -10.951 -2.899  1.00 0.00 ? 85  TYR A CE1  4  
ATOM 6858  C CE2  . TYR A 1 85  ? 8.171   -8.649  -2.501  1.00 0.00 ? 85  TYR A CE2  4  
ATOM 6859  C CZ   . TYR A 1 85  ? 8.544   -9.898  -2.950  1.00 0.00 ? 85  TYR A CZ   4  
ATOM 6860  O OH   . TYR A 1 85  ? 9.811   -10.096 -3.449  1.00 0.00 ? 85  TYR A OH   4  
ATOM 6861  H H    . TYR A 1 85  ? 2.246   -8.378  -0.918  1.00 0.00 ? 85  TYR A H    4  
ATOM 6862  H HA   . TYR A 1 85  ? 3.865   -8.163  -3.062  1.00 0.00 ? 85  TYR A HA   4  
ATOM 6863  H HB2  . TYR A 1 85  ? 4.631   -8.441  -0.712  1.00 0.00 ? 85  TYR A HB2  4  
ATOM 6864  H HB3  . TYR A 1 85  ? 4.310   -10.167 -0.840  1.00 0.00 ? 85  TYR A HB3  4  
ATOM 6865  H HD1  . TYR A 1 85  ? 5.684   -11.570 -2.356  1.00 0.00 ? 85  TYR A HD1  4  
ATOM 6866  H HD2  . TYR A 1 85  ? 6.604   -7.477  -1.646  1.00 0.00 ? 85  TYR A HD2  4  
ATOM 6867  H HE1  . TYR A 1 85  ? 7.946   -11.929 -3.251  1.00 0.00 ? 85  TYR A HE1  4  
ATOM 6868  H HE2  . TYR A 1 85  ? 8.868   -7.825  -2.540  1.00 0.00 ? 85  TYR A HE2  4  
ATOM 6869  H HH   . TYR A 1 85  ? 10.412  -9.457  -3.059  1.00 0.00 ? 85  TYR A HH   4  
ATOM 6870  N N    . GLY A 1 86  ? 3.183   -9.971  -4.664  1.00 0.00 ? 86  GLY A N    4  
ATOM 6871  C CA   . GLY A 1 86  ? 3.033   -11.055 -5.617  1.00 0.00 ? 86  GLY A CA   4  
ATOM 6872  C C    . GLY A 1 86  ? 1.642   -11.110 -6.218  1.00 0.00 ? 86  GLY A C    4  
ATOM 6873  O O    . GLY A 1 86  ? 1.155   -12.182 -6.575  1.00 0.00 ? 86  GLY A O    4  
ATOM 6874  H H    . GLY A 1 86  ? 3.125   -9.041  -4.969  1.00 0.00 ? 86  GLY A H    4  
ATOM 6875  H HA2  . GLY A 1 86  ? 3.752   -10.924 -6.411  1.00 0.00 ? 86  GLY A HA2  4  
ATOM 6876  H HA3  . GLY A 1 86  ? 3.232   -11.991 -5.115  1.00 0.00 ? 86  GLY A HA3  4  
ATOM 6877  N N    . ARG A 1 87  ? 1.001   -9.951  -6.329  1.00 0.00 ? 87  ARG A N    4  
ATOM 6878  C CA   . ARG A 1 87  ? -0.343  -9.872  -6.888  1.00 0.00 ? 87  ARG A CA   4  
ATOM 6879  C C    . ARG A 1 87  ? -0.493  -8.635  -7.769  1.00 0.00 ? 87  ARG A C    4  
ATOM 6880  O O    . ARG A 1 87  ? 0.413   -7.807  -7.853  1.00 0.00 ? 87  ARG A O    4  
ATOM 6881  C CB   . ARG A 1 87  ? -1.384  -9.842  -5.767  1.00 0.00 ? 87  ARG A CB   4  
ATOM 6882  C CG   . ARG A 1 87  ? -1.350  -11.069 -4.872  1.00 0.00 ? 87  ARG A CG   4  
ATOM 6883  C CD   . ARG A 1 87  ? -2.315  -10.934 -3.704  1.00 0.00 ? 87  ARG A CD   4  
ATOM 6884  N NE   . ARG A 1 87  ? -3.651  -11.421 -4.038  1.00 0.00 ? 87  ARG A NE   4  
ATOM 6885  C CZ   . ARG A 1 87  ? -4.546  -11.792 -3.130  1.00 0.00 ? 87  ARG A CZ   4  
ATOM 6886  N NH1  . ARG A 1 87  ? -4.250  -11.731 -1.839  1.00 0.00 ? 87  ARG A NH1  4  
ATOM 6887  N NH2  . ARG A 1 87  ? -5.741  -12.224 -3.513  1.00 0.00 ? 87  ARG A NH2  4  
ATOM 6888  H H    . ARG A 1 87  ? 1.442   -9.129  -6.026  1.00 0.00 ? 87  ARG A H    4  
ATOM 6889  H HA   . ARG A 1 87  ? -0.503  -10.752 -7.492  1.00 0.00 ? 87  ARG A HA   4  
ATOM 6890  H HB2  . ARG A 1 87  ? -1.209  -8.971  -5.152  1.00 0.00 ? 87  ARG A HB2  4  
ATOM 6891  H HB3  . ARG A 1 87  ? -2.367  -9.770  -6.207  1.00 0.00 ? 87  ARG A HB3  4  
ATOM 6892  H HG2  . ARG A 1 87  ? -1.627  -11.936 -5.454  1.00 0.00 ? 87  ARG A HG2  4  
ATOM 6893  H HG3  . ARG A 1 87  ? -0.349  -11.196 -4.488  1.00 0.00 ? 87  ARG A HG3  4  
ATOM 6894  H HD2  . ARG A 1 87  ? -1.933  -11.504 -2.870  1.00 0.00 ? 87  ARG A HD2  4  
ATOM 6895  H HD3  . ARG A 1 87  ? -2.380  -9.892  -3.428  1.00 0.00 ? 87  ARG A HD3  4  
ATOM 6896  H HE   . ARG A 1 87  ? -3.890  -11.473 -4.986  1.00 0.00 ? 87  ARG A HE   4  
ATOM 6897  H HH11 . ARG A 1 87  ? -3.351  -11.405 -1.548  1.00 0.00 ? 87  ARG A HH11 4  
ATOM 6898  H HH12 . ARG A 1 87  ? -4.927  -12.010 -1.157  1.00 0.00 ? 87  ARG A HH12 4  
ATOM 6899  H HH21 . ARG A 1 87  ? -5.968  -12.271 -4.485  1.00 0.00 ? 87  ARG A HH21 4  
ATOM 6900  H HH22 . ARG A 1 87  ? -6.414  -12.503 -2.829  1.00 0.00 ? 87  ARG A HH22 4  
ATOM 6901  N N    . SER A 1 88  ? -1.643  -8.519  -8.425  1.00 0.00 ? 88  SER A N    4  
ATOM 6902  C CA   . SER A 1 88  ? -1.911  -7.386  -9.304  1.00 0.00 ? 88  SER A CA   4  
ATOM 6903  C C    . SER A 1 88  ? -2.620  -6.267  -8.547  1.00 0.00 ? 88  SER A C    4  
ATOM 6904  O O    . SER A 1 88  ? -3.477  -6.521  -7.700  1.00 0.00 ? 88  SER A O    4  
ATOM 6905  C CB   . SER A 1 88  ? -2.760  -7.829  -10.497 1.00 0.00 ? 88  SER A CB   4  
ATOM 6906  O OG   . SER A 1 88  ? -3.916  -8.527  -10.069 1.00 0.00 ? 88  SER A OG   4  
ATOM 6907  H H    . SER A 1 88  ? -2.327  -9.213  -8.317  1.00 0.00 ? 88  SER A H    4  
ATOM 6908  H HA   . SER A 1 88  ? -0.963  -7.016  -9.665  1.00 0.00 ? 88  SER A HA   4  
ATOM 6909  H HB2  . SER A 1 88  ? -3.066  -6.960  -11.060 1.00 0.00 ? 88  SER A HB2  4  
ATOM 6910  H HB3  . SER A 1 88  ? -2.174  -8.480  -11.130 1.00 0.00 ? 88  SER A HB3  4  
ATOM 6911  H HG   . SER A 1 88  ? -4.142  -8.255  -9.177  1.00 0.00 ? 88  SER A HG   4  
ATOM 6912  N N    . HIS A 1 89  ? -2.257  -5.027  -8.860  1.00 0.00 ? 89  HIS A N    4  
ATOM 6913  C CA   . HIS A 1 89  ? -2.859  -3.868  -8.210  1.00 0.00 ? 89  HIS A CA   4  
ATOM 6914  C C    . HIS A 1 89  ? -4.380  -3.984  -8.192  1.00 0.00 ? 89  HIS A C    4  
ATOM 6915  O O    . HIS A 1 89  ? -5.024  -3.661  -7.195  1.00 0.00 ? 89  HIS A O    4  
ATOM 6916  C CB   . HIS A 1 89  ? -2.442  -2.583  -8.926  1.00 0.00 ? 89  HIS A CB   4  
ATOM 6917  C CG   . HIS A 1 89  ? -2.693  -2.612  -10.403 1.00 0.00 ? 89  HIS A CG   4  
ATOM 6918  N ND1  . HIS A 1 89  ? -3.910  -2.291  -10.966 1.00 0.00 ? 89  HIS A ND1  4  
ATOM 6919  C CD2  . HIS A 1 89  ? -1.873  -2.924  -11.434 1.00 0.00 ? 89  HIS A CD2  4  
ATOM 6920  C CE1  . HIS A 1 89  ? -3.829  -2.407  -12.279 1.00 0.00 ? 89  HIS A CE1  4  
ATOM 6921  N NE2  . HIS A 1 89  ? -2.603  -2.789  -12.589 1.00 0.00 ? 89  HIS A NE2  4  
ATOM 6922  H H    . HIS A 1 89  ? -1.569  -4.889  -9.543  1.00 0.00 ? 89  HIS A H    4  
ATOM 6923  H HA   . HIS A 1 89  ? -2.501  -3.835  -7.193  1.00 0.00 ? 89  HIS A HA   4  
ATOM 6924  H HB2  . HIS A 1 89  ? -2.996  -1.753  -8.513  1.00 0.00 ? 89  HIS A HB2  4  
ATOM 6925  H HB3  . HIS A 1 89  ? -1.386  -2.418  -8.771  1.00 0.00 ? 89  HIS A HB3  4  
ATOM 6926  H HD1  . HIS A 1 89  ? -4.714  -2.021  -10.476 1.00 0.00 ? 89  HIS A HD1  4  
ATOM 6927  H HD2  . HIS A 1 89  ? -0.837  -3.224  -11.362 1.00 0.00 ? 89  HIS A HD2  4  
ATOM 6928  H HE1  . HIS A 1 89  ? -4.628  -2.220  -12.981 1.00 0.00 ? 89  HIS A HE1  4  
ATOM 6929  H HE2  . HIS A 1 89  ? -2.298  -3.031  -13.488 1.00 0.00 ? 89  HIS A HE2  4  
ATOM 6930  N N    . GLN A 1 90  ? -4.947  -4.447  -9.302  1.00 0.00 ? 90  GLN A N    4  
ATOM 6931  C CA   . GLN A 1 90  ? -6.392  -4.604  -9.413  1.00 0.00 ? 90  GLN A CA   4  
ATOM 6932  C C    . GLN A 1 90  ? -6.946  -5.396  -8.233  1.00 0.00 ? 90  GLN A C    4  
ATOM 6933  O O    . GLN A 1 90  ? -8.037  -5.113  -7.740  1.00 0.00 ? 90  GLN A O    4  
ATOM 6934  C CB   . GLN A 1 90  ? -6.751  -5.303  -10.725 1.00 0.00 ? 90  GLN A CB   4  
ATOM 6935  C CG   . GLN A 1 90  ? -6.723  -4.381  -11.933 1.00 0.00 ? 90  GLN A CG   4  
ATOM 6936  C CD   . GLN A 1 90  ? -6.837  -5.134  -13.244 1.00 0.00 ? 90  GLN A CD   4  
ATOM 6937  O OE1  . GLN A 1 90  ? -6.332  -6.248  -13.379 1.00 0.00 ? 90  GLN A OE1  4  
ATOM 6938  N NE2  . GLN A 1 90  ? -7.504  -4.527  -14.219 1.00 0.00 ? 90  GLN A NE2  4  
ATOM 6939  H H    . GLN A 1 90  ? -4.380  -4.688  -10.063 1.00 0.00 ? 90  GLN A H    4  
ATOM 6940  H HA   . GLN A 1 90  ? -6.834  -3.619  -9.408  1.00 0.00 ? 90  GLN A HA   4  
ATOM 6941  H HB2  . GLN A 1 90  ? -6.050  -6.106  -10.895 1.00 0.00 ? 90  GLN A HB2  4  
ATOM 6942  H HB3  . GLN A 1 90  ? -7.745  -5.717  -10.638 1.00 0.00 ? 90  GLN A HB3  4  
ATOM 6943  H HG2  . GLN A 1 90  ? -7.549  -3.689  -11.861 1.00 0.00 ? 90  GLN A HG2  4  
ATOM 6944  H HG3  . GLN A 1 90  ? -5.793  -3.832  -11.929 1.00 0.00 ? 90  GLN A HG3  4  
ATOM 6945  H HE21 . GLN A 1 90  ? -7.878  -3.638  -14.040 1.00 0.00 ? 90  GLN A HE21 4  
ATOM 6946  H HE22 . GLN A 1 90  ? -7.592  -4.990  -15.077 1.00 0.00 ? 90  GLN A HE22 4  
ATOM 6947  N N    . ASN A 1 91  ? -6.185  -6.390  -7.784  1.00 0.00 ? 91  ASN A N    4  
ATOM 6948  C CA   . ASN A 1 91  ? -6.601  -7.224  -6.662  1.00 0.00 ? 91  ASN A CA   4  
ATOM 6949  C C    . ASN A 1 91  ? -6.599  -6.426  -5.362  1.00 0.00 ? 91  ASN A C    4  
ATOM 6950  O O    . ASN A 1 91  ? -7.561  -6.467  -4.596  1.00 0.00 ? 91  ASN A O    4  
ATOM 6951  C CB   . ASN A 1 91  ? -5.677  -8.436  -6.531  1.00 0.00 ? 91  ASN A CB   4  
ATOM 6952  C CG   . ASN A 1 91  ? -5.815  -9.397  -7.696  1.00 0.00 ? 91  ASN A CG   4  
ATOM 6953  O OD1  . ASN A 1 91  ? -6.220  -9.008  -8.792  1.00 0.00 ? 91  ASN A OD1  4  
ATOM 6954  N ND2  . ASN A 1 91  ? -5.480  -10.661 -7.464  1.00 0.00 ? 91  ASN A ND2  4  
ATOM 6955  H H    . ASN A 1 91  ? -5.325  -6.567  -8.218  1.00 0.00 ? 91  ASN A H    4  
ATOM 6956  H HA   . ASN A 1 91  ? -7.605  -7.567  -6.859  1.00 0.00 ? 91  ASN A HA   4  
ATOM 6957  H HB2  . ASN A 1 91  ? -4.652  -8.097  -6.490  1.00 0.00 ? 91  ASN A HB2  4  
ATOM 6958  H HB3  . ASN A 1 91  ? -5.914  -8.966  -5.621  1.00 0.00 ? 91  ASN A HB3  4  
ATOM 6959  H HD21 . ASN A 1 91  ? -5.166  -10.899 -6.566  1.00 0.00 ? 91  ASN A HD21 4  
ATOM 6960  H HD22 . ASN A 1 91  ? -5.559  -11.303 -8.200  1.00 0.00 ? 91  ASN A HD22 4  
ATOM 6961  N N    . ALA A 1 92  ? -5.512  -5.701  -5.120  1.00 0.00 ? 92  ALA A N    4  
ATOM 6962  C CA   . ALA A 1 92  ? -5.385  -4.892  -3.914  1.00 0.00 ? 92  ALA A CA   4  
ATOM 6963  C C    . ALA A 1 92  ? -6.678  -4.139  -3.621  1.00 0.00 ? 92  ALA A C    4  
ATOM 6964  O O    . ALA A 1 92  ? -7.239  -4.250  -2.530  1.00 0.00 ? 92  ALA A O    4  
ATOM 6965  C CB   . ALA A 1 92  ? -4.224  -3.918  -4.051  1.00 0.00 ? 92  ALA A CB   4  
ATOM 6966  H H    . ALA A 1 92  ? -4.778  -5.710  -5.769  1.00 0.00 ? 92  ALA A H    4  
ATOM 6967  H HA   . ALA A 1 92  ? -5.171  -5.555  -3.088  1.00 0.00 ? 92  ALA A HA   4  
ATOM 6968  H HB1  . ALA A 1 92  ? -4.529  -2.945  -3.696  1.00 0.00 ? 92  ALA A HB1  4  
ATOM 6969  H HB2  . ALA A 1 92  ? -3.388  -4.271  -3.466  1.00 0.00 ? 92  ALA A HB2  4  
ATOM 6970  H HB3  . ALA A 1 92  ? -3.934  -3.849  -5.089  1.00 0.00 ? 92  ALA A HB3  4  
ATOM 6971  N N    . SER A 1 93  ? -7.146  -3.372  -4.600  1.00 0.00 ? 93  SER A N    4  
ATOM 6972  C CA   . SER A 1 93  ? -8.371  -2.596  -4.444  1.00 0.00 ? 93  SER A CA   4  
ATOM 6973  C C    . SER A 1 93  ? -9.519  -3.483  -3.972  1.00 0.00 ? 93  SER A C    4  
ATOM 6974  O O    . SER A 1 93  ? -10.313 -3.087  -3.119  1.00 0.00 ? 93  SER A O    4  
ATOM 6975  C CB   . SER A 1 93  ? -8.744  -1.921  -5.766  1.00 0.00 ? 93  SER A CB   4  
ATOM 6976  O OG   . SER A 1 93  ? -9.761  -0.953  -5.575  1.00 0.00 ? 93  SER A OG   4  
ATOM 6977  H H    . SER A 1 93  ? -6.654  -3.324  -5.446  1.00 0.00 ? 93  SER A H    4  
ATOM 6978  H HA   . SER A 1 93  ? -8.189  -1.835  -3.700  1.00 0.00 ? 93  SER A HA   4  
ATOM 6979  H HB2  . SER A 1 93  ? -7.872  -1.434  -6.176  1.00 0.00 ? 93  SER A HB2  4  
ATOM 6980  H HB3  . SER A 1 93  ? -9.100  -2.668  -6.461  1.00 0.00 ? 93  SER A HB3  4  
ATOM 6981  H HG   . SER A 1 93  ? -10.295 -1.195  -4.815  1.00 0.00 ? 93  SER A HG   4  
ATOM 6982  N N    . ALA A 1 94  ? -9.599  -4.685  -4.532  1.00 0.00 ? 94  ALA A N    4  
ATOM 6983  C CA   . ALA A 1 94  ? -10.648 -5.629  -4.168  1.00 0.00 ? 94  ALA A CA   4  
ATOM 6984  C C    . ALA A 1 94  ? -10.618 -5.934  -2.674  1.00 0.00 ? 94  ALA A C    4  
ATOM 6985  O O    . ALA A 1 94  ? -11.657 -5.954  -2.014  1.00 0.00 ? 94  ALA A O    4  
ATOM 6986  C CB   . ALA A 1 94  ? -10.506 -6.913  -4.973  1.00 0.00 ? 94  ALA A CB   4  
ATOM 6987  H H    . ALA A 1 94  ? -8.936  -4.943  -5.206  1.00 0.00 ? 94  ALA A H    4  
ATOM 6988  H HA   . ALA A 1 94  ? -11.600 -5.182  -4.415  1.00 0.00 ? 94  ALA A HA   4  
ATOM 6989  H HB1  . ALA A 1 94  ? -11.372 -7.037  -5.607  1.00 0.00 ? 94  ALA A HB1  4  
ATOM 6990  H HB2  . ALA A 1 94  ? -9.617  -6.857  -5.584  1.00 0.00 ? 94  ALA A HB2  4  
ATOM 6991  H HB3  . ALA A 1 94  ? -10.428 -7.753  -4.300  1.00 0.00 ? 94  ALA A HB3  4  
ATOM 6992  N N    . ILE A 1 95  ? -9.421  -6.171  -2.148  1.00 0.00 ? 95  ILE A N    4  
ATOM 6993  C CA   . ILE A 1 95  ? -9.257  -6.474  -0.731  1.00 0.00 ? 95  ILE A CA   4  
ATOM 6994  C C    . ILE A 1 95  ? -9.796  -5.344  0.139   1.00 0.00 ? 95  ILE A C    4  
ATOM 6995  O O    . ILE A 1 95  ? -10.470 -5.585  1.140   1.00 0.00 ? 95  ILE A O    4  
ATOM 6996  C CB   . ILE A 1 95  ? -7.778  -6.720  -0.376  1.00 0.00 ? 95  ILE A CB   4  
ATOM 6997  C CG1  . ILE A 1 95  ? -7.226  -7.896  -1.184  1.00 0.00 ? 95  ILE A CG1  4  
ATOM 6998  C CG2  . ILE A 1 95  ? -7.628  -6.978  1.116   1.00 0.00 ? 95  ILE A CG2  4  
ATOM 6999  C CD1  . ILE A 1 95  ? -5.722  -8.033  -1.101  1.00 0.00 ? 95  ILE A CD1  4  
ATOM 7000  H H    . ILE A 1 95  ? -8.630  -6.141  -2.725  1.00 0.00 ? 95  ILE A H    4  
ATOM 7001  H HA   . ILE A 1 95  ? -9.813  -7.376  -0.517  1.00 0.00 ? 95  ILE A HA   4  
ATOM 7002  H HB   . ILE A 1 95  ? -7.219  -5.830  -0.621  1.00 0.00 ? 95  ILE A HB   4  
ATOM 7003  H HG12 . ILE A 1 95  ? -7.662  -8.812  -0.819  1.00 0.00 ? 95  ILE A HG12 4  
ATOM 7004  H HG13 . ILE A 1 95  ? -7.491  -7.765  -2.223  1.00 0.00 ? 95  ILE A HG13 4  
ATOM 7005  H HG21 . ILE A 1 95  ? -7.464  -6.042  1.628   1.00 0.00 ? 95  ILE A HG21 4  
ATOM 7006  H HG22 . ILE A 1 95  ? -8.527  -7.442  1.493   1.00 0.00 ? 95  ILE A HG22 4  
ATOM 7007  H HG23 . ILE A 1 95  ? -6.787  -7.633  1.285   1.00 0.00 ? 95  ILE A HG23 4  
ATOM 7008  H HD11 . ILE A 1 95  ? -5.470  -8.854  -0.447  1.00 0.00 ? 95  ILE A HD11 4  
ATOM 7009  H HD12 . ILE A 1 95  ? -5.322  -8.220  -2.086  1.00 0.00 ? 95  ILE A HD12 4  
ATOM 7010  H HD13 . ILE A 1 95  ? -5.299  -7.119  -0.709  1.00 0.00 ? 95  ILE A HD13 4  
ATOM 7011  N N    . ILE A 1 96  ? -9.495  -4.110  -0.251  1.00 0.00 ? 96  ILE A N    4  
ATOM 7012  C CA   . ILE A 1 96  ? -9.951  -2.942  0.492   1.00 0.00 ? 96  ILE A CA   4  
ATOM 7013  C C    . ILE A 1 96  ? -11.473 -2.842  0.478   1.00 0.00 ? 96  ILE A C    4  
ATOM 7014  O O    . ILE A 1 96  ? -12.099 -2.580  1.506   1.00 0.00 ? 96  ILE A O    4  
ATOM 7015  C CB   . ILE A 1 96  ? -9.358  -1.642  -0.082  1.00 0.00 ? 96  ILE A CB   4  
ATOM 7016  C CG1  . ILE A 1 96  ? -7.846  -1.599  0.153   1.00 0.00 ? 96  ILE A CG1  4  
ATOM 7017  C CG2  . ILE A 1 96  ? -10.031 -0.430  0.545   1.00 0.00 ? 96  ILE A CG2  4  
ATOM 7018  C CD1  . ILE A 1 96  ? -7.135  -0.555  -0.680  1.00 0.00 ? 96  ILE A CD1  4  
ATOM 7019  H H    . ILE A 1 96  ? -8.953  -3.981  -1.057  1.00 0.00 ? 96  ILE A H    4  
ATOM 7020  H HA   . ILE A 1 96  ? -9.617  -3.046  1.515   1.00 0.00 ? 96  ILE A HA   4  
ATOM 7021  H HB   . ILE A 1 96  ? -9.551  -1.622  -1.143  1.00 0.00 ? 96  ILE A HB   4  
ATOM 7022  H HG12 . ILE A 1 96  ? -7.655  -1.380  1.191   1.00 0.00 ? 96  ILE A HG12 4  
ATOM 7023  H HG13 . ILE A 1 96  ? -7.424  -2.563  -0.091  1.00 0.00 ? 96  ILE A HG13 4  
ATOM 7024  H HG21 . ILE A 1 96  ? -9.492  0.464   0.269   1.00 0.00 ? 96  ILE A HG21 4  
ATOM 7025  H HG22 . ILE A 1 96  ? -11.048 -0.360  0.190   1.00 0.00 ? 96  ILE A HG22 4  
ATOM 7026  H HG23 . ILE A 1 96  ? -10.030 -0.533  1.620   1.00 0.00 ? 96  ILE A HG23 4  
ATOM 7027  H HD11 . ILE A 1 96  ? -7.450  0.430   -0.370  1.00 0.00 ? 96  ILE A HD11 4  
ATOM 7028  H HD12 . ILE A 1 96  ? -6.068  -0.653  -0.547  1.00 0.00 ? 96  ILE A HD12 4  
ATOM 7029  H HD13 . ILE A 1 96  ? -7.381  -0.698  -1.723  1.00 0.00 ? 96  ILE A HD13 4  
ATOM 7030  N N    . LYS A 1 97  ? -12.064 -3.054  -0.693  1.00 0.00 ? 97  LYS A N    4  
ATOM 7031  C CA   . LYS A 1 97  ? -13.513 -2.992  -0.842  1.00 0.00 ? 97  LYS A CA   4  
ATOM 7032  C C    . LYS A 1 97  ? -14.203 -3.906  0.165   1.00 0.00 ? 97  LYS A C    4  
ATOM 7033  O O    . LYS A 1 97  ? -15.194 -3.524  0.788   1.00 0.00 ? 97  LYS A O    4  
ATOM 7034  C CB   . LYS A 1 97  ? -13.917 -3.386  -2.265  1.00 0.00 ? 97  LYS A CB   4  
ATOM 7035  C CG   . LYS A 1 97  ? -15.188 -2.707  -2.746  1.00 0.00 ? 97  LYS A CG   4  
ATOM 7036  C CD   . LYS A 1 97  ? -15.390 -2.897  -4.240  1.00 0.00 ? 97  LYS A CD   4  
ATOM 7037  C CE   . LYS A 1 97  ? -14.446 -2.019  -5.046  1.00 0.00 ? 97  LYS A CE   4  
ATOM 7038  N NZ   . LYS A 1 97  ? -14.674 -2.158  -6.511  1.00 0.00 ? 97  LYS A NZ   4  
ATOM 7039  H H    . LYS A 1 97  ? -11.511 -3.259  -1.477  1.00 0.00 ? 97  LYS A H    4  
ATOM 7040  H HA   . LYS A 1 97  ? -13.822 -1.974  -0.658  1.00 0.00 ? 97  LYS A HA   4  
ATOM 7041  H HB2  . LYS A 1 97  ? -13.116 -3.123  -2.940  1.00 0.00 ? 97  LYS A HB2  4  
ATOM 7042  H HB3  . LYS A 1 97  ? -14.069 -4.455  -2.300  1.00 0.00 ? 97  LYS A HB3  4  
ATOM 7043  H HG2  . LYS A 1 97  ? -16.032 -3.131  -2.222  1.00 0.00 ? 97  LYS A HG2  4  
ATOM 7044  H HG3  . LYS A 1 97  ? -15.124 -1.650  -2.532  1.00 0.00 ? 97  LYS A HG3  4  
ATOM 7045  H HD2  . LYS A 1 97  ? -15.205 -3.931  -4.491  1.00 0.00 ? 97  LYS A HD2  4  
ATOM 7046  H HD3  . LYS A 1 97  ? -16.410 -2.640  -4.491  1.00 0.00 ? 97  LYS A HD3  4  
ATOM 7047  H HE2  . LYS A 1 97  ? -14.602 -0.989  -4.762  1.00 0.00 ? 97  LYS A HE2  4  
ATOM 7048  H HE3  . LYS A 1 97  ? -13.429 -2.304  -4.820  1.00 0.00 ? 97  LYS A HE3  4  
ATOM 7049  H HZ1  . LYS A 1 97  ? -14.944 -1.240  -6.919  1.00 0.00 ? 97  LYS A HZ1  4  
ATOM 7050  H HZ2  . LYS A 1 97  ? -15.436 -2.842  -6.690  1.00 0.00 ? 97  LYS A HZ2  4  
ATOM 7051  H HZ3  . LYS A 1 97  ? -13.807 -2.491  -6.978  1.00 0.00 ? 97  LYS A HZ3  4  
ATOM 7052  N N    . THR A 1 98  ? -13.673 -5.115  0.322   1.00 0.00 ? 98  THR A N    4  
ATOM 7053  C CA   . THR A 1 98  ? -14.238 -6.082  1.254   1.00 0.00 ? 98  THR A CA   4  
ATOM 7054  C C    . THR A 1 98  ? -13.898 -5.720  2.695   1.00 0.00 ? 98  THR A C    4  
ATOM 7055  O O    . THR A 1 98  ? -14.634 -6.063  3.620   1.00 0.00 ? 98  THR A O    4  
ATOM 7056  C CB   . THR A 1 98  ? -13.730 -7.507  0.961   1.00 0.00 ? 98  THR A CB   4  
ATOM 7057  O OG1  . THR A 1 98  ? -12.305 -7.557  1.096   1.00 0.00 ? 98  THR A OG1  4  
ATOM 7058  C CG2  . THR A 1 98  ? -14.127 -7.945  -0.441  1.00 0.00 ? 98  THR A CG2  4  
ATOM 7059  H H    . THR A 1 98  ? -12.883 -5.360  -0.203  1.00 0.00 ? 98  THR A H    4  
ATOM 7060  H HA   . THR A 1 98  ? -15.311 -6.073  1.134   1.00 0.00 ? 98  THR A HA   4  
ATOM 7061  H HB   . THR A 1 98  ? -14.176 -8.185  1.674   1.00 0.00 ? 98  THR A HB   4  
ATOM 7062  H HG1  . THR A 1 98  ? -11.934 -6.696  0.890   1.00 0.00 ? 98  THR A HG1  4  
ATOM 7063  H HG21 . THR A 1 98  ? -13.367 -8.600  -0.842  1.00 0.00 ? 98  THR A HG21 4  
ATOM 7064  H HG22 . THR A 1 98  ? -14.225 -7.077  -1.075  1.00 0.00 ? 98  THR A HG22 4  
ATOM 7065  H HG23 . THR A 1 98  ? -15.069 -8.470  -0.400  1.00 0.00 ? 98  THR A HG23 4  
ATOM 7066  N N    . ALA A 1 99  ? -12.780 -5.026  2.878   1.00 0.00 ? 99  ALA A N    4  
ATOM 7067  C CA   . ALA A 1 99  ? -12.345 -4.615  4.208   1.00 0.00 ? 99  ALA A CA   4  
ATOM 7068  C C    . ALA A 1 99  ? -13.299 -3.586  4.804   1.00 0.00 ? 99  ALA A C    4  
ATOM 7069  O O    . ALA A 1 99  ? -13.941 -2.814  4.092   1.00 0.00 ? 99  ALA A O    4  
ATOM 7070  C CB   . ALA A 1 99  ? -10.931 -4.057  4.151   1.00 0.00 ? 99  ALA A CB   4  
ATOM 7071  H H    . ALA A 1 99  ? -12.236 -4.783  2.101   1.00 0.00 ? 99  ALA A H    4  
ATOM 7072  H HA   . ALA A 1 99  ? -12.335 -5.491  4.841   1.00 0.00 ? 99  ALA A HA   4  
ATOM 7073  H HB1  . ALA A 1 99  ? -10.706 -3.555  5.081   1.00 0.00 ? 99  ALA A HB1  4  
ATOM 7074  H HB2  . ALA A 1 99  ? -10.231 -4.864  3.999   1.00 0.00 ? 99  ALA A HB2  4  
ATOM 7075  H HB3  . ALA A 1 99  ? -10.854 -3.354  3.335   1.00 0.00 ? 99  ALA A HB3  4  
ATOM 7076  N N    . PRO A 1 100 ? -13.396 -3.573  6.141   1.00 0.00 ? 100 PRO A N    4  
ATOM 7077  C CA   . PRO A 1 100 ? -14.270 -2.643  6.863   1.00 0.00 ? 100 PRO A CA   4  
ATOM 7078  C C    . PRO A 1 100 ? -13.773 -1.203  6.787   1.00 0.00 ? 100 PRO A C    4  
ATOM 7079  O O    . PRO A 1 100 ? -12.648 -0.947  6.357   1.00 0.00 ? 100 PRO A O    4  
ATOM 7080  C CB   . PRO A 1 100 ? -14.217 -3.152  8.305   1.00 0.00 ? 100 PRO A CB   4  
ATOM 7081  C CG   . PRO A 1 100 ? -12.912 -3.863  8.408   1.00 0.00 ? 100 PRO A CG   4  
ATOM 7082  C CD   . PRO A 1 100 ? -12.660 -4.465  7.053   1.00 0.00 ? 100 PRO A CD   4  
ATOM 7083  H HA   . PRO A 1 100 ? -15.287 -2.691  6.500   1.00 0.00 ? 100 PRO A HA   4  
ATOM 7084  H HB2  . PRO A 1 100 ? -14.266 -2.315  8.987   1.00 0.00 ? 100 PRO A HB2  4  
ATOM 7085  H HB3  . PRO A 1 100 ? -15.045 -3.820  8.486   1.00 0.00 ? 100 PRO A HB3  4  
ATOM 7086  H HG2  . PRO A 1 100 ? -12.130 -3.162  8.657   1.00 0.00 ? 100 PRO A HG2  4  
ATOM 7087  H HG3  . PRO A 1 100 ? -12.974 -4.639  9.156   1.00 0.00 ? 100 PRO A HG3  4  
ATOM 7088  H HD2  . PRO A 1 100 ? -11.604 -4.460  6.828   1.00 0.00 ? 100 PRO A HD2  4  
ATOM 7089  H HD3  . PRO A 1 100 ? -13.053 -5.470  7.008   1.00 0.00 ? 100 PRO A HD3  4  
ATOM 7090  N N    . SER A 1 101 ? -14.618 -0.267  7.208   1.00 0.00 ? 101 SER A N    4  
ATOM 7091  C CA   . SER A 1 101 ? -14.265 1.147   7.184   1.00 0.00 ? 101 SER A CA   4  
ATOM 7092  C C    . SER A 1 101 ? -12.781 1.342   7.482   1.00 0.00 ? 101 SER A C    4  
ATOM 7093  O O    . SER A 1 101 ? -12.041 1.898   6.670   1.00 0.00 ? 101 SER A O    4  
ATOM 7094  C CB   . SER A 1 101 ? -15.106 1.921   8.201   1.00 0.00 ? 101 SER A CB   4  
ATOM 7095  O OG   . SER A 1 101 ? -16.316 2.377   7.621   1.00 0.00 ? 101 SER A OG   4  
ATOM 7096  H H    . SER A 1 101 ? -15.501 -0.535  7.539   1.00 0.00 ? 101 SER A H    4  
ATOM 7097  H HA   . SER A 1 101 ? -14.474 1.525   6.195   1.00 0.00 ? 101 SER A HA   4  
ATOM 7098  H HB2  . SER A 1 101 ? -15.341 1.278   9.035   1.00 0.00 ? 101 SER A HB2  4  
ATOM 7099  H HB3  . SER A 1 101 ? -14.545 2.775   8.552   1.00 0.00 ? 101 SER A HB3  4  
ATOM 7100  H HG   . SER A 1 101 ? -16.836 1.623   7.331   1.00 0.00 ? 101 SER A HG   4  
ATOM 7101  N N    . LYS A 1 102 ? -12.353 0.880   8.652   1.00 0.00 ? 102 LYS A N    4  
ATOM 7102  C CA   . LYS A 1 102 ? -10.958 1.001   9.059   1.00 0.00 ? 102 LYS A CA   4  
ATOM 7103  C C    . LYS A 1 102 ? -10.117 -0.120  8.456   1.00 0.00 ? 102 LYS A C    4  
ATOM 7104  O O    . LYS A 1 102 ? -10.356 -1.299  8.717   1.00 0.00 ? 102 LYS A O    4  
ATOM 7105  C CB   . LYS A 1 102 ? -10.846 0.972   10.584  1.00 0.00 ? 102 LYS A CB   4  
ATOM 7106  C CG   . LYS A 1 102 ? -9.461  1.321   11.099  1.00 0.00 ? 102 LYS A CG   4  
ATOM 7107  C CD   . LYS A 1 102 ? -9.524  1.982   12.466  1.00 0.00 ? 102 LYS A CD   4  
ATOM 7108  C CE   . LYS A 1 102 ? -9.642  3.494   12.349  1.00 0.00 ? 102 LYS A CE   4  
ATOM 7109  N NZ   . LYS A 1 102 ? -8.311  4.143   12.185  1.00 0.00 ? 102 LYS A NZ   4  
ATOM 7110  H H    . LYS A 1 102 ? -12.992 0.446   9.256   1.00 0.00 ? 102 LYS A H    4  
ATOM 7111  H HA   . LYS A 1 102 ? -10.588 1.948   8.696   1.00 0.00 ? 102 LYS A HA   4  
ATOM 7112  H HB2  . LYS A 1 102 ? -11.550 1.679   10.998  1.00 0.00 ? 102 LYS A HB2  4  
ATOM 7113  H HB3  . LYS A 1 102 ? -11.098 -0.019  10.933  1.00 0.00 ? 102 LYS A HB3  4  
ATOM 7114  H HG2  . LYS A 1 102 ? -8.876  0.417   11.176  1.00 0.00 ? 102 LYS A HG2  4  
ATOM 7115  H HG3  . LYS A 1 102 ? -8.988  2.000   10.403  1.00 0.00 ? 102 LYS A HG3  4  
ATOM 7116  H HD2  . LYS A 1 102 ? -10.384 1.606   12.999  1.00 0.00 ? 102 LYS A HD2  4  
ATOM 7117  H HD3  . LYS A 1 102 ? -8.624  1.741   13.015  1.00 0.00 ? 102 LYS A HD3  4  
ATOM 7118  H HE2  . LYS A 1 102 ? -10.255 3.729   11.493  1.00 0.00 ? 102 LYS A HE2  4  
ATOM 7119  H HE3  . LYS A 1 102 ? -10.111 3.875   13.244  1.00 0.00 ? 102 LYS A HE3  4  
ATOM 7120  H HZ1  . LYS A 1 102 ? -7.638  3.757   12.878  1.00 0.00 ? 102 LYS A HZ1  4  
ATOM 7121  H HZ2  . LYS A 1 102 ? -8.393  5.169   12.333  1.00 0.00 ? 102 LYS A HZ2  4  
ATOM 7122  H HZ3  . LYS A 1 102 ? -7.945  3.970   11.227  1.00 0.00 ? 102 LYS A HZ3  4  
ATOM 7123  N N    . VAL A 1 103 ? -9.130  0.256   7.649   1.00 0.00 ? 103 VAL A N    4  
ATOM 7124  C CA   . VAL A 1 103 ? -8.251  -0.717  7.011   1.00 0.00 ? 103 VAL A CA   4  
ATOM 7125  C C    . VAL A 1 103 ? -6.785  -0.392  7.279   1.00 0.00 ? 103 VAL A C    4  
ATOM 7126  O O    . VAL A 1 103 ? -6.358  0.755   7.148   1.00 0.00 ? 103 VAL A O    4  
ATOM 7127  C CB   . VAL A 1 103 ? -8.483  -0.770  5.489   1.00 0.00 ? 103 VAL A CB   4  
ATOM 7128  C CG1  . VAL A 1 103 ? -7.652  -1.878  4.861   1.00 0.00 ? 103 VAL A CG1  4  
ATOM 7129  C CG2  . VAL A 1 103 ? -9.961  -0.963  5.183   1.00 0.00 ? 103 VAL A CG2  4  
ATOM 7130  H H    . VAL A 1 103 ? -8.988  1.211   7.479   1.00 0.00 ? 103 VAL A H    4  
ATOM 7131  H HA   . VAL A 1 103 ? -8.475  -1.690  7.423   1.00 0.00 ? 103 VAL A HA   4  
ATOM 7132  H HB   . VAL A 1 103 ? -8.169  0.171   5.064   1.00 0.00 ? 103 VAL A HB   4  
ATOM 7133  H HG11 . VAL A 1 103 ? -7.867  -1.933  3.804   1.00 0.00 ? 103 VAL A HG11 4  
ATOM 7134  H HG12 . VAL A 1 103 ? -6.602  -1.667  5.006   1.00 0.00 ? 103 VAL A HG12 4  
ATOM 7135  H HG13 . VAL A 1 103 ? -7.898  -2.821  5.327   1.00 0.00 ? 103 VAL A HG13 4  
ATOM 7136  H HG21 . VAL A 1 103 ? -10.375 -1.696  5.859   1.00 0.00 ? 103 VAL A HG21 4  
ATOM 7137  H HG22 . VAL A 1 103 ? -10.480 -0.023  5.308   1.00 0.00 ? 103 VAL A HG22 4  
ATOM 7138  H HG23 . VAL A 1 103 ? -10.077 -1.304  4.166   1.00 0.00 ? 103 VAL A HG23 4  
ATOM 7139  N N    . LYS A 1 104 ? -6.019  -1.411  7.655   1.00 0.00 ? 104 LYS A N    4  
ATOM 7140  C CA   . LYS A 1 104 ? -4.600  -1.236  7.940   1.00 0.00 ? 104 LYS A CA   4  
ATOM 7141  C C    . LYS A 1 104 ? -3.768  -1.377  6.669   1.00 0.00 ? 104 LYS A C    4  
ATOM 7142  O O    . LYS A 1 104 ? -3.783  -2.422  6.017   1.00 0.00 ? 104 LYS A O    4  
ATOM 7143  C CB   . LYS A 1 104 ? -4.138  -2.259  8.980   1.00 0.00 ? 104 LYS A CB   4  
ATOM 7144  C CG   . LYS A 1 104 ? -2.717  -2.033  9.467   1.00 0.00 ? 104 LYS A CG   4  
ATOM 7145  C CD   . LYS A 1 104 ? -2.126  -3.296  10.070  1.00 0.00 ? 104 LYS A CD   4  
ATOM 7146  C CE   . LYS A 1 104 ? -1.105  -2.973  11.149  1.00 0.00 ? 104 LYS A CE   4  
ATOM 7147  N NZ   . LYS A 1 104 ? -1.756  -2.601  12.436  1.00 0.00 ? 104 LYS A NZ   4  
ATOM 7148  H H    . LYS A 1 104 ? -6.418  -2.302  7.741   1.00 0.00 ? 104 LYS A H    4  
ATOM 7149  H HA   . LYS A 1 104 ? -4.461  -0.243  8.338   1.00 0.00 ? 104 LYS A HA   4  
ATOM 7150  H HB2  . LYS A 1 104 ? -4.800  -2.213  9.832   1.00 0.00 ? 104 LYS A HB2  4  
ATOM 7151  H HB3  . LYS A 1 104 ? -4.194  -3.247  8.545   1.00 0.00 ? 104 LYS A HB3  4  
ATOM 7152  H HG2  . LYS A 1 104 ? -2.105  -1.725  8.632   1.00 0.00 ? 104 LYS A HG2  4  
ATOM 7153  H HG3  . LYS A 1 104 ? -2.723  -1.255  10.217  1.00 0.00 ? 104 LYS A HG3  4  
ATOM 7154  H HD2  . LYS A 1 104 ? -2.921  -3.882  10.506  1.00 0.00 ? 104 LYS A HD2  4  
ATOM 7155  H HD3  . LYS A 1 104 ? -1.644  -3.866  9.288   1.00 0.00 ? 104 LYS A HD3  4  
ATOM 7156  H HE2  . LYS A 1 104 ? -0.482  -3.840  11.309  1.00 0.00 ? 104 LYS A HE2  4  
ATOM 7157  H HE3  . LYS A 1 104 ? -0.494  -2.149  10.813  1.00 0.00 ? 104 LYS A HE3  4  
ATOM 7158  H HZ1  . LYS A 1 104 ? -2.520  -1.917  12.264  1.00 0.00 ? 104 LYS A HZ1  4  
ATOM 7159  H HZ2  . LYS A 1 104 ? -1.060  -2.172  13.078  1.00 0.00 ? 104 LYS A HZ2  4  
ATOM 7160  H HZ3  . LYS A 1 104 ? -2.157  -3.446  12.891  1.00 0.00 ? 104 LYS A HZ3  4  
ATOM 7161  N N    . LEU A 1 105 ? -3.042  -0.319  6.322   1.00 0.00 ? 105 LEU A N    4  
ATOM 7162  C CA   . LEU A 1 105 ? -2.203  -0.325  5.130   1.00 0.00 ? 105 LEU A CA   4  
ATOM 7163  C C    . LEU A 1 105 ? -0.724  -0.352  5.505   1.00 0.00 ? 105 LEU A C    4  
ATOM 7164  O O    . LEU A 1 105 ? -0.234  0.537   6.201   1.00 0.00 ? 105 LEU A O    4  
ATOM 7165  C CB   . LEU A 1 105 ? -2.499  0.902   4.267   1.00 0.00 ? 105 LEU A CB   4  
ATOM 7166  C CG   . LEU A 1 105 ? -3.973  1.156   3.945   1.00 0.00 ? 105 LEU A CG   4  
ATOM 7167  C CD1  . LEU A 1 105 ? -4.218  2.637   3.700   1.00 0.00 ? 105 LEU A CD1  4  
ATOM 7168  C CD2  . LEU A 1 105 ? -4.404  0.336   2.738   1.00 0.00 ? 105 LEU A CD2  4  
ATOM 7169  H H    . LEU A 1 105 ? -3.071  0.485   6.881   1.00 0.00 ? 105 LEU A H    4  
ATOM 7170  H HA   . LEU A 1 105 ? -2.435  -1.216  4.566   1.00 0.00 ? 105 LEU A HA   4  
ATOM 7171  H HB2  . LEU A 1 105 ? -2.120  1.770   4.784   1.00 0.00 ? 105 LEU A HB2  4  
ATOM 7172  H HB3  . LEU A 1 105 ? -1.971  0.783   3.331   1.00 0.00 ? 105 LEU A HB3  4  
ATOM 7173  H HG   . LEU A 1 105 ? -4.576  0.854   4.790   1.00 0.00 ? 105 LEU A HG   4  
ATOM 7174  H HD11 . LEU A 1 105 ? -3.325  3.087   3.293   1.00 0.00 ? 105 LEU A HD11 4  
ATOM 7175  H HD12 . LEU A 1 105 ? -4.471  3.119   4.633   1.00 0.00 ? 105 LEU A HD12 4  
ATOM 7176  H HD13 . LEU A 1 105 ? -5.033  2.756   3.002   1.00 0.00 ? 105 LEU A HD13 4  
ATOM 7177  H HD21 . LEU A 1 105 ? -5.481  0.357   2.656   1.00 0.00 ? 105 LEU A HD21 4  
ATOM 7178  H HD22 . LEU A 1 105 ? -4.073  -0.685  2.860   1.00 0.00 ? 105 LEU A HD22 4  
ATOM 7179  H HD23 . LEU A 1 105 ? -3.966  0.753   1.844   1.00 0.00 ? 105 LEU A HD23 4  
ATOM 7180  N N    . VAL A 1 106 ? -0.019  -1.376  5.037   1.00 0.00 ? 106 VAL A N    4  
ATOM 7181  C CA   . VAL A 1 106 ? 1.405   -1.517  5.320   1.00 0.00 ? 106 VAL A CA   4  
ATOM 7182  C C    . VAL A 1 106 ? 2.235   -1.378  4.049   1.00 0.00 ? 106 VAL A C    4  
ATOM 7183  O O    . VAL A 1 106 ? 2.302   -2.298  3.234   1.00 0.00 ? 106 VAL A O    4  
ATOM 7184  C CB   . VAL A 1 106 ? 1.715   -2.876  5.975   1.00 0.00 ? 106 VAL A CB   4  
ATOM 7185  C CG1  . VAL A 1 106 ? 3.207   -3.016  6.236   1.00 0.00 ? 106 VAL A CG1  4  
ATOM 7186  C CG2  . VAL A 1 106 ? 0.922   -3.039  7.264   1.00 0.00 ? 106 VAL A CG2  4  
ATOM 7187  H H    . VAL A 1 106 ? -0.466  -2.053  4.487   1.00 0.00 ? 106 VAL A H    4  
ATOM 7188  H HA   . VAL A 1 106 ? 1.687   -0.736  6.010   1.00 0.00 ? 106 VAL A HA   4  
ATOM 7189  H HB   . VAL A 1 106 ? 1.416   -3.659  5.293   1.00 0.00 ? 106 VAL A HB   4  
ATOM 7190  H HG11 . VAL A 1 106 ? 3.508   -4.039  6.064   1.00 0.00 ? 106 VAL A HG11 4  
ATOM 7191  H HG12 . VAL A 1 106 ? 3.751   -2.362  5.570   1.00 0.00 ? 106 VAL A HG12 4  
ATOM 7192  H HG13 . VAL A 1 106 ? 3.420   -2.746  7.260   1.00 0.00 ? 106 VAL A HG13 4  
ATOM 7193  H HG21 . VAL A 1 106 ? 1.604   -3.098  8.099   1.00 0.00 ? 106 VAL A HG21 4  
ATOM 7194  H HG22 . VAL A 1 106 ? 0.267   -2.190  7.393   1.00 0.00 ? 106 VAL A HG22 4  
ATOM 7195  H HG23 . VAL A 1 106 ? 0.334   -3.943  7.214   1.00 0.00 ? 106 VAL A HG23 4  
ATOM 7196  N N    . PHE A 1 107 ? 2.866   -0.220  3.885   1.00 0.00 ? 107 PHE A N    4  
ATOM 7197  C CA   . PHE A 1 107 ? 3.692   0.041   2.712   1.00 0.00 ? 107 PHE A CA   4  
ATOM 7198  C C    . PHE A 1 107 ? 5.057   0.590   3.119   1.00 0.00 ? 107 PHE A C    4  
ATOM 7199  O O    . PHE A 1 107 ? 5.338   0.766   4.305   1.00 0.00 ? 107 PHE A O    4  
ATOM 7200  C CB   . PHE A 1 107 ? 2.991   1.029   1.778   1.00 0.00 ? 107 PHE A CB   4  
ATOM 7201  C CG   . PHE A 1 107 ? 2.697   2.355   2.418   1.00 0.00 ? 107 PHE A CG   4  
ATOM 7202  C CD1  . PHE A 1 107 ? 3.688   3.316   2.538   1.00 0.00 ? 107 PHE A CD1  4  
ATOM 7203  C CD2  . PHE A 1 107 ? 1.430   2.642   2.901   1.00 0.00 ? 107 PHE A CD2  4  
ATOM 7204  C CE1  . PHE A 1 107 ? 3.421   4.537   3.128   1.00 0.00 ? 107 PHE A CE1  4  
ATOM 7205  C CE2  . PHE A 1 107 ? 1.157   3.861   3.491   1.00 0.00 ? 107 PHE A CE2  4  
ATOM 7206  C CZ   . PHE A 1 107 ? 2.154   4.811   3.604   1.00 0.00 ? 107 PHE A CZ   4  
ATOM 7207  H H    . PHE A 1 107 ? 2.774   0.476   4.570   1.00 0.00 ? 107 PHE A H    4  
ATOM 7208  H HA   . PHE A 1 107 ? 3.834   -0.894  2.193   1.00 0.00 ? 107 PHE A HA   4  
ATOM 7209  H HB2  . PHE A 1 107 ? 3.618   1.208   0.918   1.00 0.00 ? 107 PHE A HB2  4  
ATOM 7210  H HB3  . PHE A 1 107 ? 2.054   0.602   1.452   1.00 0.00 ? 107 PHE A HB3  4  
ATOM 7211  H HD1  . PHE A 1 107 ? 4.680   3.105   2.165   1.00 0.00 ? 107 PHE A HD1  4  
ATOM 7212  H HD2  . PHE A 1 107 ? 0.649   1.899   2.813   1.00 0.00 ? 107 PHE A HD2  4  
ATOM 7213  H HE1  . PHE A 1 107 ? 4.202   5.278   3.214   1.00 0.00 ? 107 PHE A HE1  4  
ATOM 7214  H HE2  . PHE A 1 107 ? 0.165   4.071   3.863   1.00 0.00 ? 107 PHE A HE2  4  
ATOM 7215  H HZ   . PHE A 1 107 ? 1.943   5.764   4.065   1.00 0.00 ? 107 PHE A HZ   4  
ATOM 7216  N N    . ILE A 1 108 ? 5.899   0.859   2.128   1.00 0.00 ? 108 ILE A N    4  
ATOM 7217  C CA   . ILE A 1 108 ? 7.233   1.388   2.382   1.00 0.00 ? 108 ILE A CA   4  
ATOM 7218  C C    . ILE A 1 108 ? 7.453   2.704   1.642   1.00 0.00 ? 108 ILE A C    4  
ATOM 7219  O O    . ILE A 1 108 ? 7.138   2.822   0.458   1.00 0.00 ? 108 ILE A O    4  
ATOM 7220  C CB   . ILE A 1 108 ? 8.326   0.387   1.961   1.00 0.00 ? 108 ILE A CB   4  
ATOM 7221  C CG1  . ILE A 1 108 ? 9.708   0.915   2.350   1.00 0.00 ? 108 ILE A CG1  4  
ATOM 7222  C CG2  . ILE A 1 108 ? 8.255   0.124   0.464   1.00 0.00 ? 108 ILE A CG2  4  
ATOM 7223  C CD1  . ILE A 1 108 ? 10.738  -0.176  2.545   1.00 0.00 ? 108 ILE A CD1  4  
ATOM 7224  H H    . ILE A 1 108 ? 5.617   0.698   1.203   1.00 0.00 ? 108 ILE A H    4  
ATOM 7225  H HA   . ILE A 1 108 ? 7.325   1.565   3.444   1.00 0.00 ? 108 ILE A HA   4  
ATOM 7226  H HB   . ILE A 1 108 ? 8.146   -0.544  2.475   1.00 0.00 ? 108 ILE A HB   4  
ATOM 7227  H HG12 . ILE A 1 108 ? 10.067  1.574   1.574   1.00 0.00 ? 108 ILE A HG12 4  
ATOM 7228  H HG13 . ILE A 1 108 ? 9.628   1.466   3.276   1.00 0.00 ? 108 ILE A HG13 4  
ATOM 7229  H HG21 . ILE A 1 108 ? 8.369   1.055   -0.071  1.00 0.00 ? 108 ILE A HG21 4  
ATOM 7230  H HG22 . ILE A 1 108 ? 9.047   -0.553  0.181   1.00 0.00 ? 108 ILE A HG22 4  
ATOM 7231  H HG23 . ILE A 1 108 ? 7.300   -0.316  0.221   1.00 0.00 ? 108 ILE A HG23 4  
ATOM 7232  H HD11 . ILE A 1 108 ? 11.729  0.240   2.435   1.00 0.00 ? 108 ILE A HD11 4  
ATOM 7233  H HD12 . ILE A 1 108 ? 10.632  -0.600  3.532   1.00 0.00 ? 108 ILE A HD12 4  
ATOM 7234  H HD13 . ILE A 1 108 ? 10.589  -0.948  1.804   1.00 0.00 ? 108 ILE A HD13 4  
ATOM 7235  N N    . ARG A 1 109 ? 7.996   3.690   2.349   1.00 0.00 ? 109 ARG A N    4  
ATOM 7236  C CA   . ARG A 1 109 ? 8.259   4.997   1.759   1.00 0.00 ? 109 ARG A CA   4  
ATOM 7237  C C    . ARG A 1 109 ? 9.665   5.055   1.170   1.00 0.00 ? 109 ARG A C    4  
ATOM 7238  O O    . ARG A 1 109 ? 10.619  5.432   1.850   1.00 0.00 ? 109 ARG A O    4  
ATOM 7239  C CB   . ARG A 1 109 ? 8.088   6.097   2.809   1.00 0.00 ? 109 ARG A CB   4  
ATOM 7240  C CG   . ARG A 1 109 ? 8.423   7.487   2.294   1.00 0.00 ? 109 ARG A CG   4  
ATOM 7241  C CD   . ARG A 1 109 ? 7.205   8.164   1.685   1.00 0.00 ? 109 ARG A CD   4  
ATOM 7242  N NE   . ARG A 1 109 ? 6.368   8.800   2.700   1.00 0.00 ? 109 ARG A NE   4  
ATOM 7243  C CZ   . ARG A 1 109 ? 6.761   9.836   3.432   1.00 0.00 ? 109 ARG A CZ   4  
ATOM 7244  N NH1  . ARG A 1 109 ? 7.970   10.352  3.263   1.00 0.00 ? 109 ARG A NH1  4  
ATOM 7245  N NH2  . ARG A 1 109 ? 5.942   10.359  4.336   1.00 0.00 ? 109 ARG A NH2  4  
ATOM 7246  H H    . ARG A 1 109 ? 8.225   3.535   3.289   1.00 0.00 ? 109 ARG A H    4  
ATOM 7247  H HA   . ARG A 1 109 ? 7.543   5.154   0.967   1.00 0.00 ? 109 ARG A HA   4  
ATOM 7248  H HB2  . ARG A 1 109 ? 7.063   6.100   3.147   1.00 0.00 ? 109 ARG A HB2  4  
ATOM 7249  H HB3  . ARG A 1 109 ? 8.734   5.881   3.646   1.00 0.00 ? 109 ARG A HB3  4  
ATOM 7250  H HG2  . ARG A 1 109 ? 8.782   8.089   3.116   1.00 0.00 ? 109 ARG A HG2  4  
ATOM 7251  H HG3  . ARG A 1 109 ? 9.193   7.406   1.541   1.00 0.00 ? 109 ARG A HG3  4  
ATOM 7252  H HD2  . ARG A 1 109 ? 7.540   8.916   0.986   1.00 0.00 ? 109 ARG A HD2  4  
ATOM 7253  H HD3  . ARG A 1 109 ? 6.621   7.422   1.163   1.00 0.00 ? 109 ARG A HD3  4  
ATOM 7254  H HE   . ARG A 1 109 ? 5.470   8.435   2.841   1.00 0.00 ? 109 ARG A HE   4  
ATOM 7255  H HH11 . ARG A 1 109 ? 8.589   9.960   2.582   1.00 0.00 ? 109 ARG A HH11 4  
ATOM 7256  H HH12 . ARG A 1 109 ? 8.263   11.133  3.815   1.00 0.00 ? 109 ARG A HH12 4  
ATOM 7257  H HH21 . ARG A 1 109 ? 5.029   9.974   4.465   1.00 0.00 ? 109 ARG A HH21 4  
ATOM 7258  H HH22 . ARG A 1 109 ? 6.238   11.139  4.886   1.00 0.00 ? 109 ARG A HH22 4  
ATOM 7259  N N    . ASN A 1 110 ? 9.786   4.679   -0.099  1.00 0.00 ? 110 ASN A N    4  
ATOM 7260  C CA   . ASN A 1 110 ? 11.076  4.687   -0.779  1.00 0.00 ? 110 ASN A CA   4  
ATOM 7261  C C    . ASN A 1 110 ? 11.081  5.697   -1.923  1.00 0.00 ? 110 ASN A C    4  
ATOM 7262  O O    . ASN A 1 110 ? 10.456  5.477   -2.960  1.00 0.00 ? 110 ASN A O    4  
ATOM 7263  C CB   . ASN A 1 110 ? 11.402  3.291   -1.315  1.00 0.00 ? 110 ASN A CB   4  
ATOM 7264  C CG   . ASN A 1 110 ? 12.612  3.291   -2.229  1.00 0.00 ? 110 ASN A CG   4  
ATOM 7265  O OD1  . ASN A 1 110 ? 13.187  4.341   -2.516  1.00 0.00 ? 110 ASN A OD1  4  
ATOM 7266  N ND2  . ASN A 1 110 ? 13.003  2.110   -2.692  1.00 0.00 ? 110 ASN A ND2  4  
ATOM 7267  H H    . ASN A 1 110 ? 8.989   4.388   -0.589  1.00 0.00 ? 110 ASN A H    4  
ATOM 7268  H HA   . ASN A 1 110 ? 11.828  4.972   -0.060  1.00 0.00 ? 110 ASN A HA   4  
ATOM 7269  H HB2  . ASN A 1 110 ? 11.604  2.632   -0.483  1.00 0.00 ? 110 ASN A HB2  4  
ATOM 7270  H HB3  . ASN A 1 110 ? 10.555  2.917   -1.869  1.00 0.00 ? 110 ASN A HB3  4  
ATOM 7271  H HD21 . ASN A 1 110 ? 12.497  1.315   -2.422  1.00 0.00 ? 110 ASN A HD21 4  
ATOM 7272  H HD22 . ASN A 1 110 ? 13.783  2.081   -3.285  1.00 0.00 ? 110 ASN A HD22 4  
ATOM 7273  N N    . GLU A 1 111 ? 11.791  6.803   -1.726  1.00 0.00 ? 111 GLU A N    4  
ATOM 7274  C CA   . GLU A 1 111 ? 11.877  7.846   -2.741  1.00 0.00 ? 111 GLU A CA   4  
ATOM 7275  C C    . GLU A 1 111 ? 12.278  7.259   -4.092  1.00 0.00 ? 111 GLU A C    4  
ATOM 7276  O O    . GLU A 1 111 ? 11.774  7.673   -5.135  1.00 0.00 ? 111 GLU A O    4  
ATOM 7277  C CB   . GLU A 1 111 ? 12.884  8.917   -2.319  1.00 0.00 ? 111 GLU A CB   4  
ATOM 7278  C CG   . GLU A 1 111 ? 14.330  8.452   -2.380  1.00 0.00 ? 111 GLU A CG   4  
ATOM 7279  C CD   . GLU A 1 111 ? 15.268  9.359   -1.608  1.00 0.00 ? 111 GLU A CD   4  
ATOM 7280  O OE1  . GLU A 1 111 ? 14.850  9.890   -0.557  1.00 0.00 ? 111 GLU A OE1  4  
ATOM 7281  O OE2  . GLU A 1 111 ? 16.420  9.538   -2.054  1.00 0.00 ? 111 GLU A OE2  4  
ATOM 7282  H H    . GLU A 1 111 ? 12.268  6.920   -0.878  1.00 0.00 ? 111 GLU A H    4  
ATOM 7283  H HA   . GLU A 1 111 ? 10.902  8.299   -2.835  1.00 0.00 ? 111 GLU A HA   4  
ATOM 7284  H HB2  . GLU A 1 111 ? 12.775  9.773   -2.969  1.00 0.00 ? 111 GLU A HB2  4  
ATOM 7285  H HB3  . GLU A 1 111 ? 12.668  9.218   -1.305  1.00 0.00 ? 111 GLU A HB3  4  
ATOM 7286  H HG2  . GLU A 1 111 ? 14.392  7.458   -1.965  1.00 0.00 ? 111 GLU A HG2  4  
ATOM 7287  H HG3  . GLU A 1 111 ? 14.644  8.430   -3.413  1.00 0.00 ? 111 GLU A HG3  4  
ATOM 7288  N N    . ASP A 1 112 ? 13.190  6.293   -4.063  1.00 0.00 ? 112 ASP A N    4  
ATOM 7289  C CA   . ASP A 1 112 ? 13.659  5.648   -5.284  1.00 0.00 ? 112 ASP A CA   4  
ATOM 7290  C C    . ASP A 1 112 ? 12.514  4.934   -5.996  1.00 0.00 ? 112 ASP A C    4  
ATOM 7291  O O    . ASP A 1 112 ? 12.529  4.781   -7.217  1.00 0.00 ? 112 ASP A O    4  
ATOM 7292  C CB   . ASP A 1 112 ? 14.776  4.653   -4.963  1.00 0.00 ? 112 ASP A CB   4  
ATOM 7293  C CG   . ASP A 1 112 ? 15.494  4.169   -6.207  1.00 0.00 ? 112 ASP A CG   4  
ATOM 7294  O OD1  . ASP A 1 112 ? 14.821  3.966   -7.239  1.00 0.00 ? 112 ASP A OD1  4  
ATOM 7295  O OD2  . ASP A 1 112 ? 16.729  3.991   -6.149  1.00 0.00 ? 112 ASP A OD2  4  
ATOM 7296  H H    . ASP A 1 112 ? 13.555  6.005   -3.199  1.00 0.00 ? 112 ASP A H    4  
ATOM 7297  H HA   . ASP A 1 112 ? 14.049  6.415   -5.935  1.00 0.00 ? 112 ASP A HA   4  
ATOM 7298  H HB2  . ASP A 1 112 ? 15.499  5.130   -4.316  1.00 0.00 ? 112 ASP A HB2  4  
ATOM 7299  H HB3  . ASP A 1 112 ? 14.354  3.798   -4.456  1.00 0.00 ? 112 ASP A HB3  4  
ATOM 7300  N N    . ALA A 1 113 ? 11.525  4.497   -5.224  1.00 0.00 ? 113 ALA A N    4  
ATOM 7301  C CA   . ALA A 1 113 ? 10.372  3.800   -5.781  1.00 0.00 ? 113 ALA A CA   4  
ATOM 7302  C C    . ALA A 1 113 ? 9.754   4.591   -6.929  1.00 0.00 ? 113 ALA A C    4  
ATOM 7303  O O    . ALA A 1 113 ? 9.407   4.029   -7.967  1.00 0.00 ? 113 ALA A O    4  
ATOM 7304  C CB   . ALA A 1 113 ? 9.336   3.543   -4.696  1.00 0.00 ? 113 ALA A CB   4  
ATOM 7305  H H    . ALA A 1 113 ? 11.570  4.649   -4.257  1.00 0.00 ? 113 ALA A H    4  
ATOM 7306  H HA   . ALA A 1 113 ? 10.709  2.844   -6.156  1.00 0.00 ? 113 ALA A HA   4  
ATOM 7307  H HB1  . ALA A 1 113 ? 8.656   2.771   -5.025  1.00 0.00 ? 113 ALA A HB1  4  
ATOM 7308  H HB2  . ALA A 1 113 ? 9.833   3.224   -3.792  1.00 0.00 ? 113 ALA A HB2  4  
ATOM 7309  H HB3  . ALA A 1 113 ? 8.784   4.451   -4.503  1.00 0.00 ? 113 ALA A HB3  4  
ATOM 7310  N N    . VAL A 1 114 ? 9.618   5.899   -6.734  1.00 0.00 ? 114 VAL A N    4  
ATOM 7311  C CA   . VAL A 1 114 ? 9.041   6.768   -7.753  1.00 0.00 ? 114 VAL A CA   4  
ATOM 7312  C C    . VAL A 1 114 ? 9.558   6.405   -9.141  1.00 0.00 ? 114 VAL A C    4  
ATOM 7313  O O    . VAL A 1 114 ? 8.834   6.505   -10.130 1.00 0.00 ? 114 VAL A O    4  
ATOM 7314  C CB   . VAL A 1 114 ? 9.356   8.249   -7.471  1.00 0.00 ? 114 VAL A CB   4  
ATOM 7315  C CG1  . VAL A 1 114 ? 8.754   8.679   -6.143  1.00 0.00 ? 114 VAL A CG1  4  
ATOM 7316  C CG2  . VAL A 1 114 ? 10.858  8.487   -7.487  1.00 0.00 ? 114 VAL A CG2  4  
ATOM 7317  H H    . VAL A 1 114 ? 9.912   6.289   -5.885  1.00 0.00 ? 114 VAL A H    4  
ATOM 7318  H HA   . VAL A 1 114 ? 7.969   6.639   -7.734  1.00 0.00 ? 114 VAL A HA   4  
ATOM 7319  H HB   . VAL A 1 114 ? 8.910   8.846   -8.253  1.00 0.00 ? 114 VAL A HB   4  
ATOM 7320  H HG11 . VAL A 1 114 ? 9.082   8.006   -5.364  1.00 0.00 ? 114 VAL A HG11 4  
ATOM 7321  H HG12 . VAL A 1 114 ? 9.074   9.684   -5.910  1.00 0.00 ? 114 VAL A HG12 4  
ATOM 7322  H HG13 . VAL A 1 114 ? 7.676   8.651   -6.210  1.00 0.00 ? 114 VAL A HG13 4  
ATOM 7323  H HG21 . VAL A 1 114 ? 11.121  9.177   -6.699  1.00 0.00 ? 114 VAL A HG21 4  
ATOM 7324  H HG22 . VAL A 1 114 ? 11.373  7.550   -7.332  1.00 0.00 ? 114 VAL A HG22 4  
ATOM 7325  H HG23 . VAL A 1 114 ? 11.147  8.902   -8.441  1.00 0.00 ? 114 VAL A HG23 4  
ATOM 7326  N N    . ASN A 1 115 ? 10.817  5.982   -9.205  1.00 0.00 ? 115 ASN A N    4  
ATOM 7327  C CA   . ASN A 1 115 ? 11.432  5.604   -10.472 1.00 0.00 ? 115 ASN A CA   4  
ATOM 7328  C C    . ASN A 1 115 ? 11.069  4.170   -10.846 1.00 0.00 ? 115 ASN A C    4  
ATOM 7329  O O    . ASN A 1 115 ? 10.779  3.875   -12.005 1.00 0.00 ? 115 ASN A O    4  
ATOM 7330  C CB   . ASN A 1 115 ? 12.952  5.752   -10.390 1.00 0.00 ? 115 ASN A CB   4  
ATOM 7331  C CG   . ASN A 1 115 ? 13.375  7.142   -9.955  1.00 0.00 ? 115 ASN A CG   4  
ATOM 7332  O OD1  . ASN A 1 115 ? 12.847  8.144   -10.439 1.00 0.00 ? 115 ASN A OD1  4  
ATOM 7333  N ND2  . ASN A 1 115 ? 14.332  7.210   -9.037  1.00 0.00 ? 115 ASN A ND2  4  
ATOM 7334  H H    . ASN A 1 115 ? 11.345  5.923   -8.382  1.00 0.00 ? 115 ASN A H    4  
ATOM 7335  H HA   . ASN A 1 115 ? 11.055  6.269   -11.235 1.00 0.00 ? 115 ASN A HA   4  
ATOM 7336  H HB2  . ASN A 1 115 ? 13.339  5.040   -9.675  1.00 0.00 ? 115 ASN A HB2  4  
ATOM 7337  H HB3  . ASN A 1 115 ? 13.381  5.552   -11.360 1.00 0.00 ? 115 ASN A HB3  4  
ATOM 7338  H HD21 . ASN A 1 115 ? 14.706  6.371   -8.696  1.00 0.00 ? 115 ASN A HD21 4  
ATOM 7339  H HD22 . ASN A 1 115 ? 14.623  8.096   -8.737  1.00 0.00 ? 115 ASN A HD22 4  
ATOM 7340  N N    . GLN A 1 116 ? 11.088  3.283   -9.856  1.00 0.00 ? 116 GLN A N    4  
ATOM 7341  C CA   . GLN A 1 116 ? 10.761  1.880   -10.082 1.00 0.00 ? 116 GLN A CA   4  
ATOM 7342  C C    . GLN A 1 116 ? 9.331   1.729   -10.588 1.00 0.00 ? 116 GLN A C    4  
ATOM 7343  O O    . GLN A 1 116 ? 9.104   1.272   -11.708 1.00 0.00 ? 116 GLN A O    4  
ATOM 7344  C CB   . GLN A 1 116 ? 10.946  1.078   -8.792  1.00 0.00 ? 116 GLN A CB   4  
ATOM 7345  C CG   . GLN A 1 116 ? 12.379  1.063   -8.285  1.00 0.00 ? 116 GLN A CG   4  
ATOM 7346  C CD   . GLN A 1 116 ? 12.574  0.119   -7.115  1.00 0.00 ? 116 GLN A CD   4  
ATOM 7347  O OE1  . GLN A 1 116 ? 11.755  -0.768  -6.875  1.00 0.00 ? 116 GLN A OE1  4  
ATOM 7348  N NE2  . GLN A 1 116 ? 13.663  0.306   -6.379  1.00 0.00 ? 116 GLN A NE2  4  
ATOM 7349  H H    . GLN A 1 116 ? 11.327  3.579   -8.954  1.00 0.00 ? 116 GLN A H    4  
ATOM 7350  H HA   . GLN A 1 116 ? 11.438  1.499   -10.832 1.00 0.00 ? 116 GLN A HA   4  
ATOM 7351  H HB2  . GLN A 1 116 ? 10.319  1.505   -8.024  1.00 0.00 ? 116 GLN A HB2  4  
ATOM 7352  H HB3  . GLN A 1 116 ? 10.640  0.058   -8.970  1.00 0.00 ? 116 GLN A HB3  4  
ATOM 7353  H HG2  . GLN A 1 116 ? 13.029  0.752   -9.090  1.00 0.00 ? 116 GLN A HG2  4  
ATOM 7354  H HG3  . GLN A 1 116 ? 12.647  2.061   -7.972  1.00 0.00 ? 116 GLN A HG3  4  
ATOM 7355  H HE21 . GLN A 1 116 ? 14.271  1.034   -6.628  1.00 0.00 ? 116 GLN A HE21 4  
ATOM 7356  H HE22 . GLN A 1 116 ? 13.814  -0.289  -5.616  1.00 0.00 ? 116 GLN A HE22 4  
ATOM 7357  N N    . MET A 1 117 ? 8.370   2.115   -9.755  1.00 0.00 ? 117 MET A N    4  
ATOM 7358  C CA   . MET A 1 117 ? 6.961   2.023   -10.120 1.00 0.00 ? 117 MET A CA   4  
ATOM 7359  C C    . MET A 1 117 ? 6.716   2.624   -11.500 1.00 0.00 ? 117 MET A C    4  
ATOM 7360  O O    . MET A 1 117 ? 7.367   3.593   -11.890 1.00 0.00 ? 117 MET A O    4  
ATOM 7361  C CB   . MET A 1 117 ? 6.095   2.735   -9.079  1.00 0.00 ? 117 MET A CB   4  
ATOM 7362  C CG   . MET A 1 117 ? 6.201   4.251   -9.135  1.00 0.00 ? 117 MET A CG   4  
ATOM 7363  S SD   . MET A 1 117 ? 5.079   5.068   -7.985  1.00 0.00 ? 117 MET A SD   4  
ATOM 7364  C CE   . MET A 1 117 ? 5.252   6.775   -8.499  1.00 0.00 ? 117 MET A CE   4  
ATOM 7365  H H    . MET A 1 117 ? 8.613   2.472   -8.875  1.00 0.00 ? 117 MET A H    4  
ATOM 7366  H HA   . MET A 1 117 ? 6.693   0.977   -10.143 1.00 0.00 ? 117 MET A HA   4  
ATOM 7367  H HB2  . MET A 1 117 ? 5.063   2.462   -9.240  1.00 0.00 ? 117 MET A HB2  4  
ATOM 7368  H HB3  . MET A 1 117 ? 6.396   2.411   -8.094  1.00 0.00 ? 117 MET A HB3  4  
ATOM 7369  H HG2  . MET A 1 117 ? 7.214   4.537   -8.891  1.00 0.00 ? 117 MET A HG2  4  
ATOM 7370  H HG3  . MET A 1 117 ? 5.969   4.577   -10.138 1.00 0.00 ? 117 MET A HG3  4  
ATOM 7371  H HE1  . MET A 1 117 ? 4.620   6.960   -9.354  1.00 0.00 ? 117 MET A HE1  4  
ATOM 7372  H HE2  . MET A 1 117 ? 4.960   7.426   -7.688  1.00 0.00 ? 117 MET A HE2  4  
ATOM 7373  H HE3  . MET A 1 117 ? 6.282   6.968   -8.764  1.00 0.00 ? 117 MET A HE3  4  
ATOM 7374  N N    . ALA A 1 118 ? 5.773   2.044   -12.235 1.00 0.00 ? 118 ALA A N    4  
ATOM 7375  C CA   . ALA A 1 118 ? 5.441   2.524   -13.571 1.00 0.00 ? 118 ALA A CA   4  
ATOM 7376  C C    . ALA A 1 118 ? 4.467   3.696   -13.507 1.00 0.00 ? 118 ALA A C    4  
ATOM 7377  O O    . ALA A 1 118 ? 3.937   4.017   -12.443 1.00 0.00 ? 118 ALA A O    4  
ATOM 7378  C CB   . ALA A 1 118 ? 4.858   1.396   -14.408 1.00 0.00 ? 118 ALA A CB   4  
ATOM 7379  H H    . ALA A 1 118 ? 5.288   1.275   -11.870 1.00 0.00 ? 118 ALA A H    4  
ATOM 7380  H HA   . ALA A 1 118 ? 6.355   2.854   -14.043 1.00 0.00 ? 118 ALA A HA   4  
ATOM 7381  H HB1  . ALA A 1 118 ? 4.958   1.637   -15.456 1.00 0.00 ? 118 ALA A HB1  4  
ATOM 7382  H HB2  . ALA A 1 118 ? 5.388   0.479   -14.196 1.00 0.00 ? 118 ALA A HB2  4  
ATOM 7383  H HB3  . ALA A 1 118 ? 3.813   1.271   -14.165 1.00 0.00 ? 118 ALA A HB3  4  
ATOM 7384  N N    . SER A 1 119 ? 4.237   4.331   -14.651 1.00 0.00 ? 119 SER A N    4  
ATOM 7385  C CA   . SER A 1 119 ? 3.330   5.471   -14.724 1.00 0.00 ? 119 SER A CA   4  
ATOM 7386  C C    . SER A 1 119 ? 2.169   5.182   -15.671 1.00 0.00 ? 119 SER A C    4  
ATOM 7387  O O    . SER A 1 119 ? 2.369   4.941   -16.860 1.00 0.00 ? 119 SER A O    4  
ATOM 7388  C CB   . SER A 1 119 ? 4.083   6.719   -15.188 1.00 0.00 ? 119 SER A CB   4  
ATOM 7389  O OG   . SER A 1 119 ? 4.673   6.516   -16.460 1.00 0.00 ? 119 SER A OG   4  
ATOM 7390  H H    . SER A 1 119 ? 4.690   4.027   -15.466 1.00 0.00 ? 119 SER A H    4  
ATOM 7391  H HA   . SER A 1 119 ? 2.937   5.645   -13.734 1.00 0.00 ? 119 SER A HA   4  
ATOM 7392  H HB2  . SER A 1 119 ? 3.394   7.548   -15.253 1.00 0.00 ? 119 SER A HB2  4  
ATOM 7393  H HB3  . SER A 1 119 ? 4.861   6.953   -14.476 1.00 0.00 ? 119 SER A HB3  4  
ATOM 7394  H HG   . SER A 1 119 ? 4.072   6.818   -17.145 1.00 0.00 ? 119 SER A HG   4  
ATOM 7395  N N    . GLY A 1 120 ? 0.954   5.208   -15.132 1.00 0.00 ? 120 GLY A N    4  
ATOM 7396  C CA   . GLY A 1 120 ? -0.222  4.946   -15.941 1.00 0.00 ? 120 GLY A CA   4  
ATOM 7397  C C    . GLY A 1 120 ? -1.167  3.957   -15.288 1.00 0.00 ? 120 GLY A C    4  
ATOM 7398  O O    . GLY A 1 120 ? -1.117  2.755   -15.546 1.00 0.00 ? 120 GLY A O    4  
ATOM 7399  H H    . GLY A 1 120 ? 0.855   5.405   -14.177 1.00 0.00 ? 120 GLY A H    4  
ATOM 7400  H HA2  . GLY A 1 120 ? -0.747  5.876   -16.105 1.00 0.00 ? 120 GLY A HA2  4  
ATOM 7401  H HA3  . GLY A 1 120 ? 0.093   4.550   -16.895 1.00 0.00 ? 120 GLY A HA3  4  
ATOM 7402  N N    . PRO A 1 121 ? -2.054  4.465   -14.419 1.00 0.00 ? 121 PRO A N    4  
ATOM 7403  C CA   . PRO A 1 121 ? -3.031  3.635   -13.708 1.00 0.00 ? 121 PRO A CA   4  
ATOM 7404  C C    . PRO A 1 121 ? -4.108  3.085   -14.637 1.00 0.00 ? 121 PRO A C    4  
ATOM 7405  O O    . PRO A 1 121 ? -5.033  2.404   -14.194 1.00 0.00 ? 121 PRO A O    4  
ATOM 7406  C CB   . PRO A 1 121 ? -3.643  4.601   -12.691 1.00 0.00 ? 121 PRO A CB   4  
ATOM 7407  C CG   . PRO A 1 121 ? -3.460  5.951   -13.292 1.00 0.00 ? 121 PRO A CG   4  
ATOM 7408  C CD   . PRO A 1 121 ? -2.171  5.890   -14.064 1.00 0.00 ? 121 PRO A CD   4  
ATOM 7409  H HA   . PRO A 1 121 ? -2.553  2.817   -13.189 1.00 0.00 ? 121 PRO A HA   4  
ATOM 7410  H HB2  . PRO A 1 121 ? -4.690  4.367   -12.554 1.00 0.00 ? 121 PRO A HB2  4  
ATOM 7411  H HB3  . PRO A 1 121 ? -3.123  4.514   -11.749 1.00 0.00 ? 121 PRO A HB3  4  
ATOM 7412  H HG2  . PRO A 1 121 ? -4.283  6.173   -13.954 1.00 0.00 ? 121 PRO A HG2  4  
ATOM 7413  H HG3  . PRO A 1 121 ? -3.394  6.694   -12.512 1.00 0.00 ? 121 PRO A HG3  4  
ATOM 7414  H HD2  . PRO A 1 121 ? -2.231  6.504   -14.950 1.00 0.00 ? 121 PRO A HD2  4  
ATOM 7415  H HD3  . PRO A 1 121 ? -1.344  6.200   -13.442 1.00 0.00 ? 121 PRO A HD3  4  
ATOM 7416  N N    . SER A 1 122 ? -3.982  3.385   -15.925 1.00 0.00 ? 122 SER A N    4  
ATOM 7417  C CA   . SER A 1 122 ? -4.947  2.923   -16.916 1.00 0.00 ? 122 SER A CA   4  
ATOM 7418  C C    . SER A 1 122 ? -4.421  1.698   -17.658 1.00 0.00 ? 122 SER A C    4  
ATOM 7419  O O    . SER A 1 122 ? -4.634  1.548   -18.861 1.00 0.00 ? 122 SER A O    4  
ATOM 7420  C CB   . SER A 1 122 ? -5.262  4.040   -17.912 1.00 0.00 ? 122 SER A CB   4  
ATOM 7421  O OG   . SER A 1 122 ? -6.509  3.820   -18.548 1.00 0.00 ? 122 SER A OG   4  
ATOM 7422  H H    . SER A 1 122 ? -3.223  3.932   -16.216 1.00 0.00 ? 122 SER A H    4  
ATOM 7423  H HA   . SER A 1 122 ? -5.853  2.651   -16.394 1.00 0.00 ? 122 SER A HA   4  
ATOM 7424  H HB2  . SER A 1 122 ? -5.300  4.984   -17.390 1.00 0.00 ? 122 SER A HB2  4  
ATOM 7425  H HB3  . SER A 1 122 ? -4.488  4.076   -18.665 1.00 0.00 ? 122 SER A HB3  4  
ATOM 7426  H HG   . SER A 1 122 ? -6.901  3.010   -18.214 1.00 0.00 ? 122 SER A HG   4  
ATOM 7427  N N    . SER A 1 123 ? -3.731  0.825   -16.931 1.00 0.00 ? 123 SER A N    4  
ATOM 7428  C CA   . SER A 1 123 ? -3.170  -0.385  -17.519 1.00 0.00 ? 123 SER A CA   4  
ATOM 7429  C C    . SER A 1 123 ? -4.233  -1.155  -18.297 1.00 0.00 ? 123 SER A C    4  
ATOM 7430  O O    . SER A 1 123 ? -5.385  -1.244  -17.874 1.00 0.00 ? 123 SER A O    4  
ATOM 7431  C CB   . SER A 1 123 ? -2.573  -1.278  -16.430 1.00 0.00 ? 123 SER A CB   4  
ATOM 7432  O OG   . SER A 1 123 ? -2.032  -2.466  -16.983 1.00 0.00 ? 123 SER A OG   4  
ATOM 7433  H H    . SER A 1 123 ? -3.594  1.001   -15.976 1.00 0.00 ? 123 SER A H    4  
ATOM 7434  H HA   . SER A 1 123 ? -2.386  -0.090  -18.200 1.00 0.00 ? 123 SER A HA   4  
ATOM 7435  H HB2  . SER A 1 123 ? -1.787  -0.743  -15.919 1.00 0.00 ? 123 SER A HB2  4  
ATOM 7436  H HB3  . SER A 1 123 ? -3.346  -1.544  -15.723 1.00 0.00 ? 123 SER A HB3  4  
ATOM 7437  H HG   . SER A 1 123 ? -2.457  -3.228  -16.582 1.00 0.00 ? 123 SER A HG   4  
ATOM 7438  N N    . GLY A 1 124 ? -3.837  -1.709  -19.439 1.00 0.00 ? 124 GLY A N    4  
ATOM 7439  C CA   . GLY A 1 124 ? -4.767  -2.464  -20.259 1.00 0.00 ? 124 GLY A CA   4  
ATOM 7440  C C    . GLY A 1 124 ? -4.160  -3.747  -20.792 1.00 0.00 ? 124 GLY A C    4  
ATOM 7441  O O    . GLY A 1 124 ? -4.377  -4.822  -20.233 1.00 0.00 ? 124 GLY A O    4  
ATOM 7442  H H    . GLY A 1 124 ? -2.906  -1.605  -19.727 1.00 0.00 ? 124 GLY A H    4  
ATOM 7443  H HA2  . GLY A 1 124 ? -5.636  -2.707  -19.667 1.00 0.00 ? 124 GLY A HA2  4  
ATOM 7444  H HA3  . GLY A 1 124 ? -5.072  -1.850  -21.094 1.00 0.00 ? 124 GLY A HA3  4  
ATOM 7445  N N    . GLY A 1 1   ? -3.533  -28.657 11.240  1.00 0.00 ? 1   GLY A N    5  
ATOM 7446  C CA   . GLY A 1 1   ? -3.585  -29.532 12.396  1.00 0.00 ? 1   GLY A CA   5  
ATOM 7447  C C    . GLY A 1 1   ? -2.611  -29.118 13.482  1.00 0.00 ? 1   GLY A C    5  
ATOM 7448  O O    . GLY A 1 1   ? -1.515  -29.668 13.585  1.00 0.00 ? 1   GLY A O    5  
ATOM 7449  H H1   . GLY A 1 1   ? -3.379  -29.034 10.349  1.00 0.00 ? 1   GLY A H1   5  
ATOM 7450  H HA2  . GLY A 1 1   ? -4.586  -29.518 12.800  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7451  H HA3  . GLY A 1 1   ? -3.348  -30.539 12.082  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7452  N N    . SER A 1 2   ? -3.010  -28.143 14.292  1.00 0.00 ? 2   SER A N    5  
ATOM 7453  C CA   . SER A 1 2   ? -2.163  -27.651 15.372  1.00 0.00 ? 2   SER A CA   5  
ATOM 7454  C C    . SER A 1 2   ? -3.007  -27.103 16.518  1.00 0.00 ? 2   SER A C    5  
ATOM 7455  O O    . SER A 1 2   ? -4.166  -26.735 16.330  1.00 0.00 ? 2   SER A O    5  
ATOM 7456  C CB   . SER A 1 2   ? -1.219  -26.564 14.853  1.00 0.00 ? 2   SER A CB   5  
ATOM 7457  O OG   . SER A 1 2   ? -0.472  -25.990 15.911  1.00 0.00 ? 2   SER A OG   5  
ATOM 7458  H H    . SER A 1 2   ? -3.896  -27.743 14.159  1.00 0.00 ? 2   SER A H    5  
ATOM 7459  H HA   . SER A 1 2   ? -1.576  -28.480 15.737  1.00 0.00 ? 2   SER A HA   5  
ATOM 7460  H HB2  . SER A 1 2   ? -0.536  -26.995 14.138  1.00 0.00 ? 2   SER A HB2  5  
ATOM 7461  H HB3  . SER A 1 2   ? -1.798  -25.787 14.374  1.00 0.00 ? 2   SER A HB3  5  
ATOM 7462  H HG   . SER A 1 2   ? -1.065  -25.735 16.621  1.00 0.00 ? 2   SER A HG   5  
ATOM 7463  N N    . SER A 1 3   ? -2.416  -27.051 17.708  1.00 0.00 ? 3   SER A N    5  
ATOM 7464  C CA   . SER A 1 3   ? -3.113  -26.551 18.887  1.00 0.00 ? 3   SER A CA   5  
ATOM 7465  C C    . SER A 1 3   ? -2.733  -25.101 19.169  1.00 0.00 ? 3   SER A C    5  
ATOM 7466  O O    . SER A 1 3   ? -1.814  -24.558 18.557  1.00 0.00 ? 3   SER A O    5  
ATOM 7467  C CB   . SER A 1 3   ? -2.790  -27.421 20.103  1.00 0.00 ? 3   SER A CB   5  
ATOM 7468  O OG   . SER A 1 3   ? -3.415  -28.689 20.003  1.00 0.00 ? 3   SER A OG   5  
ATOM 7469  H H    . SER A 1 3   ? -1.489  -27.358 17.794  1.00 0.00 ? 3   SER A H    5  
ATOM 7470  H HA   . SER A 1 3   ? -4.174  -26.601 18.690  1.00 0.00 ? 3   SER A HA   5  
ATOM 7471  H HB2  . SER A 1 3   ? -1.722  -27.564 20.167  1.00 0.00 ? 3   SER A HB2  5  
ATOM 7472  H HB3  . SER A 1 3   ? -3.142  -26.929 20.998  1.00 0.00 ? 3   SER A HB3  5  
ATOM 7473  H HG   . SER A 1 3   ? -4.241  -28.679 20.494  1.00 0.00 ? 3   SER A HG   5  
ATOM 7474  N N    . GLY A 1 4   ? -3.447  -24.479 20.103  1.00 0.00 ? 4   GLY A N    5  
ATOM 7475  C CA   . GLY A 1 4   ? -3.171  -23.098 20.451  1.00 0.00 ? 4   GLY A CA   5  
ATOM 7476  C C    . GLY A 1 4   ? -3.219  -22.176 19.249  1.00 0.00 ? 4   GLY A C    5  
ATOM 7477  O O    . GLY A 1 4   ? -2.252  -21.470 18.960  1.00 0.00 ? 4   GLY A O    5  
ATOM 7478  H H    . GLY A 1 4   ? -4.168  -24.963 20.558  1.00 0.00 ? 4   GLY A H    5  
ATOM 7479  H HA2  . GLY A 1 4   ? -3.901  -22.767 21.174  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7480  H HA3  . GLY A 1 4   ? -2.188  -23.040 20.895  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7481  N N    . SER A 1 5   ? -4.346  -22.183 18.544  1.00 0.00 ? 5   SER A N    5  
ATOM 7482  C CA   . SER A 1 5   ? -4.514  -21.345 17.362  1.00 0.00 ? 5   SER A CA   5  
ATOM 7483  C C    . SER A 1 5   ? -4.079  -19.911 17.647  1.00 0.00 ? 5   SER A C    5  
ATOM 7484  O O    . SER A 1 5   ? -4.714  -19.202 18.428  1.00 0.00 ? 5   SER A O    5  
ATOM 7485  C CB   . SER A 1 5   ? -5.972  -21.366 16.899  1.00 0.00 ? 5   SER A CB   5  
ATOM 7486  O OG   . SER A 1 5   ? -6.846  -21.002 17.953  1.00 0.00 ? 5   SER A OG   5  
ATOM 7487  H H    . SER A 1 5   ? -5.080  -22.768 18.824  1.00 0.00 ? 5   SER A H    5  
ATOM 7488  H HA   . SER A 1 5   ? -3.890  -21.749 16.578  1.00 0.00 ? 5   SER A HA   5  
ATOM 7489  H HB2  . SER A 1 5   ? -6.098  -20.669 16.086  1.00 0.00 ? 5   SER A HB2  5  
ATOM 7490  H HB3  . SER A 1 5   ? -6.225  -22.361 16.564  1.00 0.00 ? 5   SER A HB3  5  
ATOM 7491  H HG   . SER A 1 5   ? -6.333  -20.762 18.727  1.00 0.00 ? 5   SER A HG   5  
ATOM 7492  N N    . SER A 1 6   ? -2.992  -19.490 17.008  1.00 0.00 ? 6   SER A N    5  
ATOM 7493  C CA   . SER A 1 6   ? -2.469  -18.142 17.195  1.00 0.00 ? 6   SER A CA   5  
ATOM 7494  C C    . SER A 1 6   ? -1.584  -17.735 16.021  1.00 0.00 ? 6   SER A C    5  
ATOM 7495  O O    . SER A 1 6   ? -0.495  -18.275 15.833  1.00 0.00 ? 6   SER A O    5  
ATOM 7496  C CB   . SER A 1 6   ? -1.676  -18.056 18.500  1.00 0.00 ? 6   SER A CB   5  
ATOM 7497  O OG   . SER A 1 6   ? -2.537  -18.095 19.624  1.00 0.00 ? 6   SER A OG   5  
ATOM 7498  H H    . SER A 1 6   ? -2.530  -20.103 16.398  1.00 0.00 ? 6   SER A H    5  
ATOM 7499  H HA   . SER A 1 6   ? -3.309  -17.465 17.249  1.00 0.00 ? 6   SER A HA   5  
ATOM 7500  H HB2  . SER A 1 6   ? -0.991  -18.889 18.558  1.00 0.00 ? 6   SER A HB2  5  
ATOM 7501  H HB3  . SER A 1 6   ? -1.119  -17.131 18.519  1.00 0.00 ? 6   SER A HB3  5  
ATOM 7502  H HG   . SER A 1 6   ? -3.445  -17.975 19.336  1.00 0.00 ? 6   SER A HG   5  
ATOM 7503  N N    . GLY A 1 7   ? -2.062  -16.777 15.232  1.00 0.00 ? 7   GLY A N    5  
ATOM 7504  C CA   . GLY A 1 7   ? -1.302  -16.313 14.085  1.00 0.00 ? 7   GLY A CA   5  
ATOM 7505  C C    . GLY A 1 7   ? -0.940  -14.845 14.186  1.00 0.00 ? 7   GLY A C    5  
ATOM 7506  O O    . GLY A 1 7   ? -1.538  -14.003 13.516  1.00 0.00 ? 7   GLY A O    5  
ATOM 7507  H H    . GLY A 1 7   ? -2.937  -16.382 15.430  1.00 0.00 ? 7   GLY A H    5  
ATOM 7508  H HA2  . GLY A 1 7   ? -0.395  -16.893 14.010  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7509  H HA3  . GLY A 1 7   ? -1.891  -16.466 13.193  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7510  N N    . ASP A 1 8   ? 0.043   -14.536 15.026  1.00 0.00 ? 8   ASP A N    5  
ATOM 7511  C CA   . ASP A 1 8   ? 0.484   -13.159 15.212  1.00 0.00 ? 8   ASP A CA   5  
ATOM 7512  C C    . ASP A 1 8   ? 1.677   -12.845 14.315  1.00 0.00 ? 8   ASP A C    5  
ATOM 7513  O O    . ASP A 1 8   ? 2.584   -12.111 14.706  1.00 0.00 ? 8   ASP A O    5  
ATOM 7514  C CB   . ASP A 1 8   ? 0.853   -12.913 16.676  1.00 0.00 ? 8   ASP A CB   5  
ATOM 7515  C CG   . ASP A 1 8   ? -0.159  -13.508 17.636  1.00 0.00 ? 8   ASP A CG   5  
ATOM 7516  O OD1  . ASP A 1 8   ? -1.199  -12.860 17.880  1.00 0.00 ? 8   ASP A OD1  5  
ATOM 7517  O OD2  . ASP A 1 8   ? 0.088   -14.622 18.142  1.00 0.00 ? 8   ASP A OD2  5  
ATOM 7518  H H    . ASP A 1 8   ? 0.482   -15.252 15.532  1.00 0.00 ? 8   ASP A H    5  
ATOM 7519  H HA   . ASP A 1 8   ? -0.334  -12.509 14.943  1.00 0.00 ? 8   ASP A HA   5  
ATOM 7520  H HB2  . ASP A 1 8   ? 1.816   -13.358 16.878  1.00 0.00 ? 8   ASP A HB2  5  
ATOM 7521  H HB3  . ASP A 1 8   ? 0.907   -11.849 16.853  1.00 0.00 ? 8   ASP A HB3  5  
ATOM 7522  N N    . ALA A 1 9   ? 1.669   -13.406 13.111  1.00 0.00 ? 9   ALA A N    5  
ATOM 7523  C CA   . ALA A 1 9   ? 2.750   -13.185 12.158  1.00 0.00 ? 9   ALA A CA   5  
ATOM 7524  C C    . ALA A 1 9   ? 2.566   -11.865 11.416  1.00 0.00 ? 9   ALA A C    5  
ATOM 7525  O O    . ALA A 1 9   ? 3.428   -11.452 10.639  1.00 0.00 ? 9   ALA A O    5  
ATOM 7526  C CB   . ALA A 1 9   ? 2.829   -14.340 11.171  1.00 0.00 ? 9   ALA A CB   5  
ATOM 7527  H H    . ALA A 1 9   ? 0.918   -13.981 12.856  1.00 0.00 ? 9   ALA A H    5  
ATOM 7528  H HA   . ALA A 1 9   ? 3.679   -13.150 12.709  1.00 0.00 ? 9   ALA A HA   5  
ATOM 7529  H HB1  . ALA A 1 9   ? 3.154   -13.970 10.210  1.00 0.00 ? 9   ALA A HB1  5  
ATOM 7530  H HB2  . ALA A 1 9   ? 3.534   -15.074 11.532  1.00 0.00 ? 9   ALA A HB2  5  
ATOM 7531  H HB3  . ALA A 1 9   ? 1.854   -14.795 11.072  1.00 0.00 ? 9   ALA A HB3  5  
ATOM 7532  N N    . PHE A 1 10  ? 1.437   -11.207 11.659  1.00 0.00 ? 10  PHE A N    5  
ATOM 7533  C CA   . PHE A 1 10  ? 1.139   -9.935  11.012  1.00 0.00 ? 10  PHE A CA   5  
ATOM 7534  C C    . PHE A 1 10  ? 1.282   -8.778  11.996  1.00 0.00 ? 10  PHE A C    5  
ATOM 7535  O O    . PHE A 1 10  ? 0.793   -7.675  11.752  1.00 0.00 ? 10  PHE A O    5  
ATOM 7536  C CB   . PHE A 1 10  ? -0.276  -9.953  10.431  1.00 0.00 ? 10  PHE A CB   5  
ATOM 7537  C CG   . PHE A 1 10  ? -0.456  -10.949 9.321   1.00 0.00 ? 10  PHE A CG   5  
ATOM 7538  C CD1  . PHE A 1 10  ? -0.788  -12.265 9.600   1.00 0.00 ? 10  PHE A CD1  5  
ATOM 7539  C CD2  . PHE A 1 10  ? -0.292  -10.569 7.998   1.00 0.00 ? 10  PHE A CD2  5  
ATOM 7540  C CE1  . PHE A 1 10  ? -0.955  -13.183 8.581   1.00 0.00 ? 10  PHE A CE1  5  
ATOM 7541  C CE2  . PHE A 1 10  ? -0.458  -11.484 6.975   1.00 0.00 ? 10  PHE A CE2  5  
ATOM 7542  C CZ   . PHE A 1 10  ? -0.789  -12.793 7.267   1.00 0.00 ? 10  PHE A CZ   5  
ATOM 7543  H H    . PHE A 1 10  ? 0.788   -11.588 12.288  1.00 0.00 ? 10  PHE A H    5  
ATOM 7544  H HA   . PHE A 1 10  ? 1.847   -9.799  10.209  1.00 0.00 ? 10  PHE A HA   5  
ATOM 7545  H HB2  . PHE A 1 10  ? -0.976  -10.200 11.214  1.00 0.00 ? 10  PHE A HB2  5  
ATOM 7546  H HB3  . PHE A 1 10  ? -0.510  -8.974  10.041  1.00 0.00 ? 10  PHE A HB3  5  
ATOM 7547  H HD1  . PHE A 1 10  ? -0.919  -12.572 10.628  1.00 0.00 ? 10  PHE A HD1  5  
ATOM 7548  H HD2  . PHE A 1 10  ? -0.033  -9.546  7.769   1.00 0.00 ? 10  PHE A HD2  5  
ATOM 7549  H HE1  . PHE A 1 10  ? -1.214  -14.206 8.813   1.00 0.00 ? 10  PHE A HE1  5  
ATOM 7550  H HE2  . PHE A 1 10  ? -0.327  -11.175 5.949   1.00 0.00 ? 10  PHE A HE2  5  
ATOM 7551  H HZ   . PHE A 1 10  ? -0.919  -13.509 6.470   1.00 0.00 ? 10  PHE A HZ   5  
ATOM 7552  N N    . THR A 1 11  ? 1.957   -9.038  13.112  1.00 0.00 ? 11  THR A N    5  
ATOM 7553  C CA   . THR A 1 11  ? 2.164   -8.020  14.135  1.00 0.00 ? 11  THR A CA   5  
ATOM 7554  C C    . THR A 1 11  ? 3.181   -6.981  13.678  1.00 0.00 ? 11  THR A C    5  
ATOM 7555  O O    . THR A 1 11  ? 4.224   -7.322  13.121  1.00 0.00 ? 11  THR A O    5  
ATOM 7556  C CB   . THR A 1 11  ? 2.644   -8.644  15.459  1.00 0.00 ? 11  THR A CB   5  
ATOM 7557  O OG1  . THR A 1 11  ? 3.729   -9.546  15.211  1.00 0.00 ? 11  THR A OG1  5  
ATOM 7558  C CG2  . THR A 1 11  ? 1.510   -9.386  16.150  1.00 0.00 ? 11  THR A CG2  5  
ATOM 7559  H H    . THR A 1 11  ? 2.323   -9.936  13.249  1.00 0.00 ? 11  THR A H    5  
ATOM 7560  H HA   . THR A 1 11  ? 1.218   -7.530  14.314  1.00 0.00 ? 11  THR A HA   5  
ATOM 7561  H HB   . THR A 1 11  ? 2.985   -7.852  16.109  1.00 0.00 ? 11  THR A HB   5  
ATOM 7562  H HG1  . THR A 1 11  ? 4.536   -9.187  15.588  1.00 0.00 ? 11  THR A HG1  5  
ATOM 7563  H HG21 . THR A 1 11  ? 0.884   -8.679  16.674  1.00 0.00 ? 11  THR A HG21 5  
ATOM 7564  H HG22 . THR A 1 11  ? 1.919   -10.095 16.854  1.00 0.00 ? 11  THR A HG22 5  
ATOM 7565  H HG23 . THR A 1 11  ? 0.921   -9.910  15.412  1.00 0.00 ? 11  THR A HG23 5  
ATOM 7566  N N    . ASP A 1 12  ? 2.871   -5.711  13.918  1.00 0.00 ? 12  ASP A N    5  
ATOM 7567  C CA   . ASP A 1 12  ? 3.759   -4.621  13.532  1.00 0.00 ? 12  ASP A CA   5  
ATOM 7568  C C    . ASP A 1 12  ? 5.220   -5.040  13.661  1.00 0.00 ? 12  ASP A C    5  
ATOM 7569  O O    . ASP A 1 12  ? 6.011   -4.859  12.736  1.00 0.00 ? 12  ASP A O    5  
ATOM 7570  C CB   . ASP A 1 12  ? 3.491   -3.387  14.395  1.00 0.00 ? 12  ASP A CB   5  
ATOM 7571  C CG   . ASP A 1 12  ? 2.011   -3.146  14.616  1.00 0.00 ? 12  ASP A CG   5  
ATOM 7572  O OD1  . ASP A 1 12  ? 1.352   -4.016  15.222  1.00 0.00 ? 12  ASP A OD1  5  
ATOM 7573  O OD2  . ASP A 1 12  ? 1.511   -2.086  14.183  1.00 0.00 ? 12  ASP A OD2  5  
ATOM 7574  H H    . ASP A 1 12  ? 2.024   -5.503  14.365  1.00 0.00 ? 12  ASP A H    5  
ATOM 7575  H HA   . ASP A 1 12  ? 3.557   -4.378  12.500  1.00 0.00 ? 12  ASP A HA   5  
ATOM 7576  H HB2  . ASP A 1 12  ? 3.962   -3.520  15.358  1.00 0.00 ? 12  ASP A HB2  5  
ATOM 7577  H HB3  . ASP A 1 12  ? 3.911   -2.519  13.910  1.00 0.00 ? 12  ASP A HB3  5  
ATOM 7578  N N    . GLN A 1 13  ? 5.571   -5.598  14.815  1.00 0.00 ? 13  GLN A N    5  
ATOM 7579  C CA   . GLN A 1 13  ? 6.938   -6.041  15.065  1.00 0.00 ? 13  GLN A CA   5  
ATOM 7580  C C    . GLN A 1 13  ? 7.428   -6.953  13.945  1.00 0.00 ? 13  GLN A C    5  
ATOM 7581  O O    . GLN A 1 13  ? 8.506   -6.745  13.387  1.00 0.00 ? 13  GLN A O    5  
ATOM 7582  C CB   . GLN A 1 13  ? 7.023   -6.770  16.407  1.00 0.00 ? 13  GLN A CB   5  
ATOM 7583  C CG   . GLN A 1 13  ? 8.419   -7.275  16.737  1.00 0.00 ? 13  GLN A CG   5  
ATOM 7584  C CD   . GLN A 1 13  ? 8.605   -7.551  18.216  1.00 0.00 ? 13  GLN A CD   5  
ATOM 7585  O OE1  . GLN A 1 13  ? 7.718   -8.095  18.874  1.00 0.00 ? 13  GLN A OE1  5  
ATOM 7586  N NE2  . GLN A 1 13  ? 9.763   -7.175  18.747  1.00 0.00 ? 13  GLN A NE2  5  
ATOM 7587  H H    . GLN A 1 13  ? 4.895   -5.716  15.514  1.00 0.00 ? 13  GLN A H    5  
ATOM 7588  H HA   . GLN A 1 13  ? 7.568   -5.165  15.100  1.00 0.00 ? 13  GLN A HA   5  
ATOM 7589  H HB2  . GLN A 1 13  ? 6.714   -6.094  17.190  1.00 0.00 ? 13  GLN A HB2  5  
ATOM 7590  H HB3  . GLN A 1 13  ? 6.353   -7.616  16.386  1.00 0.00 ? 13  GLN A HB3  5  
ATOM 7591  H HG2  . GLN A 1 13  ? 8.594   -8.191  16.191  1.00 0.00 ? 13  GLN A HG2  5  
ATOM 7592  H HG3  . GLN A 1 13  ? 9.139   -6.531  16.430  1.00 0.00 ? 13  GLN A HG3  5  
ATOM 7593  H HE21 . GLN A 1 13  ? 10.422  -6.746  18.162  1.00 0.00 ? 13  GLN A HE21 5  
ATOM 7594  H HE22 . GLN A 1 13  ? 9.909   -7.340  19.701  1.00 0.00 ? 13  GLN A HE22 5  
ATOM 7595  N N    . LYS A 1 14  ? 6.630   -7.964  13.620  1.00 0.00 ? 14  LYS A N    5  
ATOM 7596  C CA   . LYS A 1 14  ? 6.981   -8.908  12.566  1.00 0.00 ? 14  LYS A CA   5  
ATOM 7597  C C    . LYS A 1 14  ? 6.904   -8.246  11.194  1.00 0.00 ? 14  LYS A C    5  
ATOM 7598  O O    . LYS A 1 14  ? 7.643   -8.608  10.278  1.00 0.00 ? 14  LYS A O    5  
ATOM 7599  C CB   . LYS A 1 14  ? 6.051   -10.123 12.611  1.00 0.00 ? 14  LYS A CB   5  
ATOM 7600  C CG   . LYS A 1 14  ? 6.324   -11.055 13.779  1.00 0.00 ? 14  LYS A CG   5  
ATOM 7601  C CD   . LYS A 1 14  ? 7.461   -12.016 13.472  1.00 0.00 ? 14  LYS A CD   5  
ATOM 7602  C CE   . LYS A 1 14  ? 8.112   -12.534 14.745  1.00 0.00 ? 14  LYS A CE   5  
ATOM 7603  N NZ   . LYS A 1 14  ? 9.073   -11.550 15.317  1.00 0.00 ? 14  LYS A NZ   5  
ATOM 7604  H H    . LYS A 1 14  ? 5.783   -8.078  14.101  1.00 0.00 ? 14  LYS A H    5  
ATOM 7605  H HA   . LYS A 1 14  ? 7.995   -9.236  12.738  1.00 0.00 ? 14  LYS A HA   5  
ATOM 7606  H HB2  . LYS A 1 14  ? 5.031   -9.778  12.684  1.00 0.00 ? 14  LYS A HB2  5  
ATOM 7607  H HB3  . LYS A 1 14  ? 6.168   -10.684 11.695  1.00 0.00 ? 14  LYS A HB3  5  
ATOM 7608  H HG2  . LYS A 1 14  ? 6.589   -10.466 14.644  1.00 0.00 ? 14  LYS A HG2  5  
ATOM 7609  H HG3  . LYS A 1 14  ? 5.430   -11.625 13.989  1.00 0.00 ? 14  LYS A HG3  5  
ATOM 7610  H HD2  . LYS A 1 14  ? 7.071   -12.854 12.914  1.00 0.00 ? 14  LYS A HD2  5  
ATOM 7611  H HD3  . LYS A 1 14  ? 8.205   -11.502 12.881  1.00 0.00 ? 14  LYS A HD3  5  
ATOM 7612  H HE2  . LYS A 1 14  ? 7.340   -12.735 15.473  1.00 0.00 ? 14  LYS A HE2  5  
ATOM 7613  H HE3  . LYS A 1 14  ? 8.639   -13.449 14.518  1.00 0.00 ? 14  LYS A HE3  5  
ATOM 7614  H HZ1  . LYS A 1 14  ? 8.955   -10.626 14.854  1.00 0.00 ? 14  LYS A HZ1  5  
ATOM 7615  H HZ2  . LYS A 1 14  ? 10.049  -11.877 15.169  1.00 0.00 ? 14  LYS A HZ2  5  
ATOM 7616  H HZ3  . LYS A 1 14  ? 8.906   -11.439 16.337  1.00 0.00 ? 14  LYS A HZ3  5  
ATOM 7617  N N    . ILE A 1 15  ? 6.007   -7.275  11.061  1.00 0.00 ? 15  ILE A N    5  
ATOM 7618  C CA   . ILE A 1 15  ? 5.837   -6.561  9.802   1.00 0.00 ? 15  ILE A CA   5  
ATOM 7619  C C    . ILE A 1 15  ? 7.085   -5.759  9.451   1.00 0.00 ? 15  ILE A C    5  
ATOM 7620  O O    . ILE A 1 15  ? 7.571   -5.809  8.320   1.00 0.00 ? 15  ILE A O    5  
ATOM 7621  C CB   . ILE A 1 15  ? 4.627   -5.610  9.853   1.00 0.00 ? 15  ILE A CB   5  
ATOM 7622  C CG1  . ILE A 1 15  ? 3.349   -6.391  10.164  1.00 0.00 ? 15  ILE A CG1  5  
ATOM 7623  C CG2  . ILE A 1 15  ? 4.488   -4.858  8.538   1.00 0.00 ? 15  ILE A CG2  5  
ATOM 7624  C CD1  . ILE A 1 15  ? 2.128   -5.513  10.330  1.00 0.00 ? 15  ILE A CD1  5  
ATOM 7625  H H    . ILE A 1 15  ? 5.448   -7.032  11.828  1.00 0.00 ? 15  ILE A H    5  
ATOM 7626  H HA   . ILE A 1 15  ? 5.662   -7.292  9.026   1.00 0.00 ? 15  ILE A HA   5  
ATOM 7627  H HB   . ILE A 1 15  ? 4.798   -4.887  10.636  1.00 0.00 ? 15  ILE A HB   5  
ATOM 7628  H HG12 . ILE A 1 15  ? 3.152   -7.082  9.359   1.00 0.00 ? 15  ILE A HG12 5  
ATOM 7629  H HG13 . ILE A 1 15  ? 3.488   -6.944  11.082  1.00 0.00 ? 15  ILE A HG13 5  
ATOM 7630  H HG21 . ILE A 1 15  ? 4.182   -3.841  8.735   1.00 0.00 ? 15  ILE A HG21 5  
ATOM 7631  H HG22 . ILE A 1 15  ? 5.437   -4.854  8.024   1.00 0.00 ? 15  ILE A HG22 5  
ATOM 7632  H HG23 . ILE A 1 15  ? 3.746   -5.343  7.922   1.00 0.00 ? 15  ILE A HG23 5  
ATOM 7633  H HD11 . ILE A 1 15  ? 2.214   -4.651  9.684   1.00 0.00 ? 15  ILE A HD11 5  
ATOM 7634  H HD12 . ILE A 1 15  ? 1.243   -6.073  10.069  1.00 0.00 ? 15  ILE A HD12 5  
ATOM 7635  H HD13 . ILE A 1 15  ? 2.058   -5.185  11.357  1.00 0.00 ? 15  ILE A HD13 5  
ATOM 7636  N N    . ARG A 1 16  ? 7.602   -5.021  10.428  1.00 0.00 ? 16  ARG A N    5  
ATOM 7637  C CA   . ARG A 1 16  ? 8.795   -4.208  10.223  1.00 0.00 ? 16  ARG A CA   5  
ATOM 7638  C C    . ARG A 1 16  ? 10.024  -5.089  10.017  1.00 0.00 ? 16  ARG A C    5  
ATOM 7639  O O    . ARG A 1 16  ? 10.908  -4.761  9.226   1.00 0.00 ? 16  ARG A O    5  
ATOM 7640  C CB   . ARG A 1 16  ? 9.016   -3.278  11.417  1.00 0.00 ? 16  ARG A CB   5  
ATOM 7641  C CG   . ARG A 1 16  ? 9.271   -4.013  12.722  1.00 0.00 ? 16  ARG A CG   5  
ATOM 7642  C CD   . ARG A 1 16  ? 9.666   -3.053  13.834  1.00 0.00 ? 16  ARG A CD   5  
ATOM 7643  N NE   . ARG A 1 16  ? 11.105  -2.807  13.858  1.00 0.00 ? 16  ARG A NE   5  
ATOM 7644  C CZ   . ARG A 1 16  ? 11.985  -3.642  14.400  1.00 0.00 ? 16  ARG A CZ   5  
ATOM 7645  N NH1  . ARG A 1 16  ? 11.574  -4.772  14.958  1.00 0.00 ? 16  ARG A NH1  5  
ATOM 7646  N NH2  . ARG A 1 16  ? 13.278  -3.348  14.383  1.00 0.00 ? 16  ARG A NH2  5  
ATOM 7647  H H    . ARG A 1 16  ? 7.170   -5.022  11.308  1.00 0.00 ? 16  ARG A H    5  
ATOM 7648  H HA   . ARG A 1 16  ? 8.642   -3.612  9.336   1.00 0.00 ? 16  ARG A HA   5  
ATOM 7649  H HB2  . ARG A 1 16  ? 9.867   -2.645  11.213  1.00 0.00 ? 16  ARG A HB2  5  
ATOM 7650  H HB3  . ARG A 1 16  ? 8.140   -2.660  11.542  1.00 0.00 ? 16  ARG A HB3  5  
ATOM 7651  H HG2  . ARG A 1 16  ? 8.371   -4.533  13.014  1.00 0.00 ? 16  ARG A HG2  5  
ATOM 7652  H HG3  . ARG A 1 16  ? 10.068  -4.725  12.573  1.00 0.00 ? 16  ARG A HG3  5  
ATOM 7653  H HD2  . ARG A 1 16  ? 9.153   -2.115  13.681  1.00 0.00 ? 16  ARG A HD2  5  
ATOM 7654  H HD3  . ARG A 1 16  ? 9.366   -3.477  14.780  1.00 0.00 ? 16  ARG A HD3  5  
ATOM 7655  H HE   . ARG A 1 16  ? 11.431  -1.977  13.451  1.00 0.00 ? 16  ARG A HE   5  
ATOM 7656  H HH11 . ARG A 1 16  ? 10.599  -4.997  14.971  1.00 0.00 ? 16  ARG A HH11 5  
ATOM 7657  H HH12 . ARG A 1 16  ? 12.238  -5.400  15.364  1.00 0.00 ? 16  ARG A HH12 5  
ATOM 7658  H HH21 . ARG A 1 16  ? 13.592  -2.497  13.963  1.00 0.00 ? 16  ARG A HH21 5  
ATOM 7659  H HH22 . ARG A 1 16  ? 13.939  -3.977  14.791  1.00 0.00 ? 16  ARG A HH22 5  
ATOM 7660  N N    . GLN A 1 17  ? 10.071  -6.207  10.734  1.00 0.00 ? 17  GLN A N    5  
ATOM 7661  C CA   . GLN A 1 17  ? 11.192  -7.134  10.630  1.00 0.00 ? 17  GLN A CA   5  
ATOM 7662  C C    . GLN A 1 17  ? 11.097  -7.962  9.353   1.00 0.00 ? 17  GLN A C    5  
ATOM 7663  O O    . GLN A 1 17  ? 12.111  -8.395  8.805   1.00 0.00 ? 17  GLN A O    5  
ATOM 7664  C CB   . GLN A 1 17  ? 11.233  -8.057  11.849  1.00 0.00 ? 17  GLN A CB   5  
ATOM 7665  C CG   . GLN A 1 17  ? 11.978  -7.467  13.035  1.00 0.00 ? 17  GLN A CG   5  
ATOM 7666  C CD   . GLN A 1 17  ? 12.618  -8.527  13.909  1.00 0.00 ? 17  GLN A CD   5  
ATOM 7667  O OE1  . GLN A 1 17  ? 12.278  -9.707  13.822  1.00 0.00 ? 17  GLN A OE1  5  
ATOM 7668  N NE2  . GLN A 1 17  ? 13.550  -8.112  14.758  1.00 0.00 ? 17  GLN A NE2  5  
ATOM 7669  H H    . GLN A 1 17  ? 9.336   -6.413  11.347  1.00 0.00 ? 17  GLN A H    5  
ATOM 7670  H HA   . GLN A 1 17  ? 12.101  -6.552  10.600  1.00 0.00 ? 17  GLN A HA   5  
ATOM 7671  H HB2  . GLN A 1 17  ? 10.220  -8.271  12.158  1.00 0.00 ? 17  GLN A HB2  5  
ATOM 7672  H HB3  . GLN A 1 17  ? 11.718  -8.981  11.570  1.00 0.00 ? 17  GLN A HB3  5  
ATOM 7673  H HG2  . GLN A 1 17  ? 12.753  -6.811  12.666  1.00 0.00 ? 17  GLN A HG2  5  
ATOM 7674  H HG3  . GLN A 1 17  ? 11.283  -6.898  13.634  1.00 0.00 ? 17  GLN A HG3  5  
ATOM 7675  H HE21 . GLN A 1 17  ? 13.769  -7.156  14.773  1.00 0.00 ? 17  GLN A HE21 5  
ATOM 7676  H HE22 . GLN A 1 17  ? 13.979  -8.775  15.336  1.00 0.00 ? 17  GLN A HE22 5  
ATOM 7677  N N    . ARG A 1 18  ? 9.873   -8.180  8.885   1.00 0.00 ? 18  ARG A N    5  
ATOM 7678  C CA   . ARG A 1 18  ? 9.645   -8.958  7.673   1.00 0.00 ? 18  ARG A CA   5  
ATOM 7679  C C    . ARG A 1 18  ? 10.147  -8.208  6.443   1.00 0.00 ? 18  ARG A C    5  
ATOM 7680  O O    . ARG A 1 18  ? 10.806  -8.784  5.577   1.00 0.00 ? 18  ARG A O    5  
ATOM 7681  C CB   . ARG A 1 18  ? 8.157   -9.277  7.517   1.00 0.00 ? 18  ARG A CB   5  
ATOM 7682  C CG   . ARG A 1 18  ? 7.798   -9.861  6.161   1.00 0.00 ? 18  ARG A CG   5  
ATOM 7683  C CD   . ARG A 1 18  ? 6.551   -10.729 6.240   1.00 0.00 ? 18  ARG A CD   5  
ATOM 7684  N NE   . ARG A 1 18  ? 6.833   -12.039 6.820   1.00 0.00 ? 18  ARG A NE   5  
ATOM 7685  C CZ   . ARG A 1 18  ? 5.896   -12.843 7.310   1.00 0.00 ? 18  ARG A CZ   5  
ATOM 7686  N NH1  . ARG A 1 18  ? 4.623   -12.472 7.290   1.00 0.00 ? 18  ARG A NH1  5  
ATOM 7687  N NH2  . ARG A 1 18  ? 6.231   -14.021 7.821   1.00 0.00 ? 18  ARG A NH2  5  
ATOM 7688  H H    . ARG A 1 18  ? 9.103   -7.809  9.366   1.00 0.00 ? 18  ARG A H    5  
ATOM 7689  H HA   . ARG A 1 18  ? 10.195  -9.883  7.765   1.00 0.00 ? 18  ARG A HA   5  
ATOM 7690  H HB2  . ARG A 1 18  ? 7.872   -9.989  8.278   1.00 0.00 ? 18  ARG A HB2  5  
ATOM 7691  H HB3  . ARG A 1 18  ? 7.591   -8.369  7.656   1.00 0.00 ? 18  ARG A HB3  5  
ATOM 7692  H HG2  . ARG A 1 18  ? 7.616   -9.052  5.468   1.00 0.00 ? 18  ARG A HG2  5  
ATOM 7693  H HG3  . ARG A 1 18  ? 8.623   -10.462 5.808   1.00 0.00 ? 18  ARG A HG3  5  
ATOM 7694  H HD2  . ARG A 1 18  ? 5.817   -10.226 6.852   1.00 0.00 ? 18  ARG A HD2  5  
ATOM 7695  H HD3  . ARG A 1 18  ? 6.159   -10.863 5.244   1.00 0.00 ? 18  ARG A HD3  5  
ATOM 7696  H HE   . ARG A 1 18  ? 7.767   -12.333 6.845   1.00 0.00 ? 18  ARG A HE   5  
ATOM 7697  H HH11 . ARG A 1 18  ? 4.367   -11.585 6.904   1.00 0.00 ? 18  ARG A HH11 5  
ATOM 7698  H HH12 . ARG A 1 18  ? 3.919   -13.079 7.658   1.00 0.00 ? 18  ARG A HH12 5  
ATOM 7699  H HH21 . ARG A 1 18  ? 7.189   -14.304 7.837   1.00 0.00 ? 18  ARG A HH21 5  
ATOM 7700  H HH22 . ARG A 1 18  ? 5.525   -14.625 8.189   1.00 0.00 ? 18  ARG A HH22 5  
ATOM 7701  N N    . TYR A 1 19  ? 9.830   -6.920  6.372   1.00 0.00 ? 19  TYR A N    5  
ATOM 7702  C CA   . TYR A 1 19  ? 10.246  -6.091  5.247   1.00 0.00 ? 19  TYR A CA   5  
ATOM 7703  C C    . TYR A 1 19  ? 11.417  -5.194  5.635   1.00 0.00 ? 19  TYR A C    5  
ATOM 7704  O O    . TYR A 1 19  ? 11.717  -4.216  4.951   1.00 0.00 ? 19  TYR A O    5  
ATOM 7705  C CB   . TYR A 1 19  ? 9.076   -5.237  4.755   1.00 0.00 ? 19  TYR A CB   5  
ATOM 7706  C CG   . TYR A 1 19  ? 7.910   -6.049  4.237   1.00 0.00 ? 19  TYR A CG   5  
ATOM 7707  C CD1  . TYR A 1 19  ? 7.919   -6.570  2.949   1.00 0.00 ? 19  TYR A CD1  5  
ATOM 7708  C CD2  . TYR A 1 19  ? 6.800   -6.295  5.035   1.00 0.00 ? 19  TYR A CD2  5  
ATOM 7709  C CE1  . TYR A 1 19  ? 6.856   -7.311  2.471   1.00 0.00 ? 19  TYR A CE1  5  
ATOM 7710  C CE2  . TYR A 1 19  ? 5.733   -7.037  4.566   1.00 0.00 ? 19  TYR A CE2  5  
ATOM 7711  C CZ   . TYR A 1 19  ? 5.765   -7.542  3.283   1.00 0.00 ? 19  TYR A CZ   5  
ATOM 7712  O OH   . TYR A 1 19  ? 4.705   -8.281  2.811   1.00 0.00 ? 19  TYR A OH   5  
ATOM 7713  H H    . TYR A 1 19  ? 9.303   -6.517  7.093   1.00 0.00 ? 19  TYR A H    5  
ATOM 7714  H HA   . TYR A 1 19  ? 10.559  -6.748  4.449   1.00 0.00 ? 19  TYR A HA   5  
ATOM 7715  H HB2  . TYR A 1 19  ? 8.717   -4.627  5.570   1.00 0.00 ? 19  TYR A HB2  5  
ATOM 7716  H HB3  . TYR A 1 19  ? 9.417   -4.598  3.955   1.00 0.00 ? 19  TYR A HB3  5  
ATOM 7717  H HD1  . TYR A 1 19  ? 8.775   -6.388  2.316   1.00 0.00 ? 19  TYR A HD1  5  
ATOM 7718  H HD2  . TYR A 1 19  ? 6.777   -5.898  6.040   1.00 0.00 ? 19  TYR A HD2  5  
ATOM 7719  H HE1  . TYR A 1 19  ? 6.881   -7.708  1.467   1.00 0.00 ? 19  TYR A HE1  5  
ATOM 7720  H HE2  . TYR A 1 19  ? 4.878   -7.217  5.202   1.00 0.00 ? 19  TYR A HE2  5  
ATOM 7721  H HH   . TYR A 1 19  ? 5.020   -9.137  2.510   1.00 0.00 ? 19  TYR A HH   5  
ATOM 7722  N N    . ALA A 1 20  ? 12.075  -5.535  6.738   1.00 0.00 ? 20  ALA A N    5  
ATOM 7723  C CA   . ALA A 1 20  ? 13.216  -4.763  7.216   1.00 0.00 ? 20  ALA A CA   5  
ATOM 7724  C C    . ALA A 1 20  ? 14.369  -4.812  6.220   1.00 0.00 ? 20  ALA A C    5  
ATOM 7725  O O    . ALA A 1 20  ? 15.277  -3.982  6.266   1.00 0.00 ? 20  ALA A O    5  
ATOM 7726  C CB   . ALA A 1 20  ? 13.667  -5.276  8.576   1.00 0.00 ? 20  ALA A CB   5  
ATOM 7727  H H    . ALA A 1 20  ? 11.789  -6.325  7.240   1.00 0.00 ? 20  ALA A H    5  
ATOM 7728  H HA   . ALA A 1 20  ? 12.898  -3.737  7.334   1.00 0.00 ? 20  ALA A HA   5  
ATOM 7729  H HB1  . ALA A 1 20  ? 13.430  -4.543  9.333   1.00 0.00 ? 20  ALA A HB1  5  
ATOM 7730  H HB2  . ALA A 1 20  ? 13.158  -6.202  8.798   1.00 0.00 ? 20  ALA A HB2  5  
ATOM 7731  H HB3  . ALA A 1 20  ? 14.733  -5.446  8.560   1.00 0.00 ? 20  ALA A HB3  5  
ATOM 7732  N N    . ASP A 1 21  ? 14.328  -5.790  5.322   1.00 0.00 ? 21  ASP A N    5  
ATOM 7733  C CA   . ASP A 1 21  ? 15.370  -5.947  4.314   1.00 0.00 ? 21  ASP A CA   5  
ATOM 7734  C C    . ASP A 1 21  ? 15.255  -4.869  3.241   1.00 0.00 ? 21  ASP A C    5  
ATOM 7735  O O    . ASP A 1 21  ? 16.247  -4.492  2.616   1.00 0.00 ? 21  ASP A O    5  
ATOM 7736  C CB   . ASP A 1 21  ? 15.285  -7.334  3.674   1.00 0.00 ? 21  ASP A CB   5  
ATOM 7737  C CG   . ASP A 1 21  ? 15.691  -8.438  4.629   1.00 0.00 ? 21  ASP A CG   5  
ATOM 7738  O OD1  . ASP A 1 21  ? 16.607  -8.209  5.446   1.00 0.00 ? 21  ASP A OD1  5  
ATOM 7739  O OD2  . ASP A 1 21  ? 15.094  -9.533  4.559   1.00 0.00 ? 21  ASP A OD2  5  
ATOM 7740  H H    . ASP A 1 21  ? 13.578  -6.421  5.337   1.00 0.00 ? 21  ASP A H    5  
ATOM 7741  H HA   . ASP A 1 21  ? 16.325  -5.846  4.807   1.00 0.00 ? 21  ASP A HA   5  
ATOM 7742  H HB2  . ASP A 1 21  ? 14.268  -7.514  3.356   1.00 0.00 ? 21  ASP A HB2  5  
ATOM 7743  H HB3  . ASP A 1 21  ? 15.938  -7.367  2.815   1.00 0.00 ? 21  ASP A HB3  5  
ATOM 7744  N N    . LEU A 1 22  ? 14.038  -4.379  3.031   1.00 0.00 ? 22  LEU A N    5  
ATOM 7745  C CA   . LEU A 1 22  ? 13.792  -3.344  2.032   1.00 0.00 ? 22  LEU A CA   5  
ATOM 7746  C C    . LEU A 1 22  ? 14.664  -2.119  2.290   1.00 0.00 ? 22  LEU A C    5  
ATOM 7747  O O    . LEU A 1 22  ? 15.041  -1.824  3.424   1.00 0.00 ? 22  LEU A O    5  
ATOM 7748  C CB   . LEU A 1 22  ? 12.316  -2.944  2.036   1.00 0.00 ? 22  LEU A CB   5  
ATOM 7749  C CG   . LEU A 1 22  ? 11.310  -4.088  1.903   1.00 0.00 ? 22  LEU A CG   5  
ATOM 7750  C CD1  . LEU A 1 22  ? 9.900   -3.543  1.739   1.00 0.00 ? 22  LEU A CD1  5  
ATOM 7751  C CD2  . LEU A 1 22  ? 11.676  -4.987  0.731   1.00 0.00 ? 22  LEU A CD2  5  
ATOM 7752  H H    . LEU A 1 22  ? 13.287  -4.719  3.560   1.00 0.00 ? 22  LEU A H    5  
ATOM 7753  H HA   . LEU A 1 22  ? 14.044  -3.752  1.064   1.00 0.00 ? 22  LEU A HA   5  
ATOM 7754  H HB2  . LEU A 1 22  ? 12.115  -2.433  2.965   1.00 0.00 ? 22  LEU A HB2  5  
ATOM 7755  H HB3  . LEU A 1 22  ? 12.156  -2.264  1.211   1.00 0.00 ? 22  LEU A HB3  5  
ATOM 7756  H HG   . LEU A 1 22  ? 11.333  -4.686  2.804   1.00 0.00 ? 22  LEU A HG   5  
ATOM 7757  H HD11 . LEU A 1 22  ? 9.722   -2.777  2.479   1.00 0.00 ? 22  LEU A HD11 5  
ATOM 7758  H HD12 . LEU A 1 22  ? 9.187   -4.343  1.870   1.00 0.00 ? 22  LEU A HD12 5  
ATOM 7759  H HD13 . LEU A 1 22  ? 9.790   -3.122  0.751   1.00 0.00 ? 22  LEU A HD13 5  
ATOM 7760  H HD21 . LEU A 1 22  ? 10.778  -5.423  0.319   1.00 0.00 ? 22  LEU A HD21 5  
ATOM 7761  H HD22 . LEU A 1 22  ? 12.335  -5.773  1.072   1.00 0.00 ? 22  LEU A HD22 5  
ATOM 7762  H HD23 . LEU A 1 22  ? 12.174  -4.403  -0.028  1.00 0.00 ? 22  LEU A HD23 5  
ATOM 7763  N N    . PRO A 1 23  ? 14.990  -1.387  1.215   1.00 0.00 ? 23  PRO A N    5  
ATOM 7764  C CA   . PRO A 1 23  ? 15.818  -0.181  1.300   1.00 0.00 ? 23  PRO A CA   5  
ATOM 7765  C C    . PRO A 1 23  ? 15.094  0.972   1.987   1.00 0.00 ? 23  PRO A C    5  
ATOM 7766  O O    . PRO A 1 23  ? 15.630  1.599   2.900   1.00 0.00 ? 23  PRO A O    5  
ATOM 7767  C CB   . PRO A 1 23  ? 16.098  0.161   -0.165  1.00 0.00 ? 23  PRO A CB   5  
ATOM 7768  C CG   . PRO A 1 23  ? 14.960  -0.436  -0.918  1.00 0.00 ? 23  PRO A CG   5  
ATOM 7769  C CD   . PRO A 1 23  ? 14.575  -1.681  -0.167  1.00 0.00 ? 23  PRO A CD   5  
ATOM 7770  H HA   . PRO A 1 23  ? 16.750  -0.374  1.811   1.00 0.00 ? 23  PRO A HA   5  
ATOM 7771  H HB2  . PRO A 1 23  ? 16.133  1.235   -0.287  1.00 0.00 ? 23  PRO A HB2  5  
ATOM 7772  H HB3  . PRO A 1 23  ? 17.041  -0.271  -0.466  1.00 0.00 ? 23  PRO A HB3  5  
ATOM 7773  H HG2  . PRO A 1 23  ? 14.133  0.257   -0.945  1.00 0.00 ? 23  PRO A HG2  5  
ATOM 7774  H HG3  . PRO A 1 23  ? 15.275  -0.686  -1.921  1.00 0.00 ? 23  PRO A HG3  5  
ATOM 7775  H HD2  . PRO A 1 23  ? 13.508  -1.841  -0.224  1.00 0.00 ? 23  PRO A HD2  5  
ATOM 7776  H HD3  . PRO A 1 23  ? 15.108  -2.536  -0.556  1.00 0.00 ? 23  PRO A HD3  5  
ATOM 7777  N N    . GLY A 1 24  ? 13.871  1.246   1.542   1.00 0.00 ? 24  GLY A N    5  
ATOM 7778  C CA   . GLY A 1 24  ? 13.093  2.324   2.126   1.00 0.00 ? 24  GLY A CA   5  
ATOM 7779  C C    . GLY A 1 24  ? 12.720  2.053   3.570   1.00 0.00 ? 24  GLY A C    5  
ATOM 7780  O O    . GLY A 1 24  ? 13.169  1.070   4.159   1.00 0.00 ? 24  GLY A O    5  
ATOM 7781  H H    . GLY A 1 24  ? 13.494  0.713   0.811   1.00 0.00 ? 24  GLY A H    5  
ATOM 7782  H HA2  . GLY A 1 24  ? 13.670  3.236   2.078   1.00 0.00 ? 24  GLY A HA2  5  
ATOM 7783  H HA3  . GLY A 1 24  ? 12.188  2.451   1.550   1.00 0.00 ? 24  GLY A HA3  5  
ATOM 7784  N N    . GLU A 1 25  ? 11.898  2.927   4.141   1.00 0.00 ? 25  GLU A N    5  
ATOM 7785  C CA   . GLU A 1 25  ? 11.468  2.778   5.526   1.00 0.00 ? 25  GLU A CA   5  
ATOM 7786  C C    . GLU A 1 25  ? 10.001  2.363   5.599   1.00 0.00 ? 25  GLU A C    5  
ATOM 7787  O O    . GLU A 1 25  ? 9.117   3.081   5.129   1.00 0.00 ? 25  GLU A O    5  
ATOM 7788  C CB   . GLU A 1 25  ? 11.678  4.086   6.292   1.00 0.00 ? 25  GLU A CB   5  
ATOM 7789  C CG   . GLU A 1 25  ? 11.851  3.893   7.790   1.00 0.00 ? 25  GLU A CG   5  
ATOM 7790  C CD   . GLU A 1 25  ? 12.080  5.200   8.524   1.00 0.00 ? 25  GLU A CD   5  
ATOM 7791  O OE1  . GLU A 1 25  ? 11.089  5.912   8.789   1.00 0.00 ? 25  GLU A OE1  5  
ATOM 7792  O OE2  . GLU A 1 25  ? 13.250  5.510   8.832   1.00 0.00 ? 25  GLU A OE2  5  
ATOM 7793  H H    . GLU A 1 25  ? 11.574  3.691   3.619   1.00 0.00 ? 25  GLU A H    5  
ATOM 7794  H HA   . GLU A 1 25  ? 12.071  2.006   5.979   1.00 0.00 ? 25  GLU A HA   5  
ATOM 7795  H HB2  . GLU A 1 25  ? 12.560  4.576   5.909   1.00 0.00 ? 25  GLU A HB2  5  
ATOM 7796  H HB3  . GLU A 1 25  ? 10.823  4.725   6.130   1.00 0.00 ? 25  GLU A HB3  5  
ATOM 7797  H HG2  . GLU A 1 25  ? 10.960  3.427   8.185   1.00 0.00 ? 25  GLU A HG2  5  
ATOM 7798  H HG3  . GLU A 1 25  ? 12.699  3.247   7.961   1.00 0.00 ? 25  GLU A HG3  5  
ATOM 7799  N N    . LEU A 1 26  ? 9.750   1.200   6.189   1.00 0.00 ? 26  LEU A N    5  
ATOM 7800  C CA   . LEU A 1 26  ? 8.391   0.687   6.323   1.00 0.00 ? 26  LEU A CA   5  
ATOM 7801  C C    . LEU A 1 26  ? 7.528   1.642   7.141   1.00 0.00 ? 26  LEU A C    5  
ATOM 7802  O O    . LEU A 1 26  ? 7.901   2.044   8.244   1.00 0.00 ? 26  LEU A O    5  
ATOM 7803  C CB   . LEU A 1 26  ? 8.408   -0.693  6.981   1.00 0.00 ? 26  LEU A CB   5  
ATOM 7804  C CG   . LEU A 1 26  ? 7.112   -1.498  6.886   1.00 0.00 ? 26  LEU A CG   5  
ATOM 7805  C CD1  . LEU A 1 26  ? 7.107   -2.356  5.630   1.00 0.00 ? 26  LEU A CD1  5  
ATOM 7806  C CD2  . LEU A 1 26  ? 6.928   -2.362  8.125   1.00 0.00 ? 26  LEU A CD2  5  
ATOM 7807  H H    . LEU A 1 26  ? 10.496  0.672   6.544   1.00 0.00 ? 26  LEU A H    5  
ATOM 7808  H HA   . LEU A 1 26  ? 7.971   0.600   5.332   1.00 0.00 ? 26  LEU A HA   5  
ATOM 7809  H HB2  . LEU A 1 26  ? 9.191   -1.272  6.515   1.00 0.00 ? 26  LEU A HB2  5  
ATOM 7810  H HB3  . LEU A 1 26  ? 8.638   -0.557  8.028   1.00 0.00 ? 26  LEU A HB3  5  
ATOM 7811  H HG   . LEU A 1 26  ? 6.275   -0.816  6.826   1.00 0.00 ? 26  LEU A HG   5  
ATOM 7812  H HD11 . LEU A 1 26  ? 6.691   -3.326  5.859   1.00 0.00 ? 26  LEU A HD11 5  
ATOM 7813  H HD12 . LEU A 1 26  ? 8.118   -2.474  5.271   1.00 0.00 ? 26  LEU A HD12 5  
ATOM 7814  H HD13 . LEU A 1 26  ? 6.508   -1.877  4.869   1.00 0.00 ? 26  LEU A HD13 5  
ATOM 7815  H HD21 . LEU A 1 26  ? 5.894   -2.331  8.435   1.00 0.00 ? 26  LEU A HD21 5  
ATOM 7816  H HD22 . LEU A 1 26  ? 7.554   -1.986  8.922   1.00 0.00 ? 26  LEU A HD22 5  
ATOM 7817  H HD23 . LEU A 1 26  ? 7.206   -3.381  7.899   1.00 0.00 ? 26  LEU A HD23 5  
ATOM 7818  N N    . HIS A 1 27  ? 6.370   2.001   6.594   1.00 0.00 ? 27  HIS A N    5  
ATOM 7819  C CA   . HIS A 1 27  ? 5.451   2.907   7.275   1.00 0.00 ? 27  HIS A CA   5  
ATOM 7820  C C    . HIS A 1 27  ? 4.055   2.299   7.363   1.00 0.00 ? 27  HIS A C    5  
ATOM 7821  O O    . HIS A 1 27  ? 3.358   2.172   6.356   1.00 0.00 ? 27  HIS A O    5  
ATOM 7822  C CB   . HIS A 1 27  ? 5.390   4.249   6.545   1.00 0.00 ? 27  HIS A CB   5  
ATOM 7823  C CG   . HIS A 1 27  ? 6.400   5.242   7.032   1.00 0.00 ? 27  HIS A CG   5  
ATOM 7824  N ND1  . HIS A 1 27  ? 6.159   6.109   8.076   1.00 0.00 ? 27  HIS A ND1  5  
ATOM 7825  C CD2  . HIS A 1 27  ? 7.660   5.502   6.612   1.00 0.00 ? 27  HIS A CD2  5  
ATOM 7826  C CE1  . HIS A 1 27  ? 7.227   6.861   8.277   1.00 0.00 ? 27  HIS A CE1  5  
ATOM 7827  N NE2  . HIS A 1 27  ? 8.153   6.511   7.401   1.00 0.00 ? 27  HIS A NE2  5  
ATOM 7828  H H    . HIS A 1 27  ? 6.128   1.648   5.713   1.00 0.00 ? 27  HIS A H    5  
ATOM 7829  H HA   . HIS A 1 27  ? 5.824   3.068   8.275   1.00 0.00 ? 27  HIS A HA   5  
ATOM 7830  H HB2  . HIS A 1 27  ? 5.567   4.086   5.492   1.00 0.00 ? 27  HIS A HB2  5  
ATOM 7831  H HB3  . HIS A 1 27  ? 4.409   4.680   6.678   1.00 0.00 ? 27  HIS A HB3  5  
ATOM 7832  H HD1  . HIS A 1 27  ? 5.329   6.167   8.592   1.00 0.00 ? 27  HIS A HD1  5  
ATOM 7833  H HD2  . HIS A 1 27  ? 8.183   5.007   5.805   1.00 0.00 ? 27  HIS A HD2  5  
ATOM 7834  H HE1  . HIS A 1 27  ? 7.328   7.629   9.028   1.00 0.00 ? 27  HIS A HE1  5  
ATOM 7835  H HE2  . HIS A 1 27  ? 9.010   6.968   7.275   1.00 0.00 ? 27  HIS A HE2  5  
ATOM 7836  N N    . ILE A 1 28  ? 3.654   1.924   8.573   1.00 0.00 ? 28  ILE A N    5  
ATOM 7837  C CA   . ILE A 1 28  ? 2.341   1.329   8.792   1.00 0.00 ? 28  ILE A CA   5  
ATOM 7838  C C    . ILE A 1 28  ? 1.350   2.363   9.315   1.00 0.00 ? 28  ILE A C    5  
ATOM 7839  O O    . ILE A 1 28  ? 1.335   2.677   10.506  1.00 0.00 ? 28  ILE A O    5  
ATOM 7840  C CB   . ILE A 1 28  ? 2.413   0.155   9.787   1.00 0.00 ? 28  ILE A CB   5  
ATOM 7841  C CG1  . ILE A 1 28  ? 3.404   -0.900  9.293   1.00 0.00 ? 28  ILE A CG1  5  
ATOM 7842  C CG2  . ILE A 1 28  ? 1.035   -0.456  9.985   1.00 0.00 ? 28  ILE A CG2  5  
ATOM 7843  C CD1  . ILE A 1 28  ? 3.635   -2.022  10.280  1.00 0.00 ? 28  ILE A CD1  5  
ATOM 7844  H H    . ILE A 1 28  ? 4.255   2.050   9.337   1.00 0.00 ? 28  ILE A H    5  
ATOM 7845  H HA   . ILE A 1 28  ? 1.985   0.951   7.845   1.00 0.00 ? 28  ILE A HA   5  
ATOM 7846  H HB   . ILE A 1 28  ? 2.751   0.539   10.738  1.00 0.00 ? 28  ILE A HB   5  
ATOM 7847  H HG12 . ILE A 1 28  ? 3.032   -1.335  8.379   1.00 0.00 ? 28  ILE A HG12 5  
ATOM 7848  H HG13 . ILE A 1 28  ? 4.356   -0.427  9.099   1.00 0.00 ? 28  ILE A HG13 5  
ATOM 7849  H HG21 . ILE A 1 28  ? 0.788   -0.455  11.037  1.00 0.00 ? 28  ILE A HG21 5  
ATOM 7850  H HG22 . ILE A 1 28  ? 0.303   0.124   9.445   1.00 0.00 ? 28  ILE A HG22 5  
ATOM 7851  H HG23 . ILE A 1 28  ? 1.034   -1.471  9.617   1.00 0.00 ? 28  ILE A HG23 5  
ATOM 7852  H HD11 . ILE A 1 28  ? 4.650   -2.380  10.189  1.00 0.00 ? 28  ILE A HD11 5  
ATOM 7853  H HD12 . ILE A 1 28  ? 3.470   -1.659  11.284  1.00 0.00 ? 28  ILE A HD12 5  
ATOM 7854  H HD13 . ILE A 1 28  ? 2.949   -2.831  10.073  1.00 0.00 ? 28  ILE A HD13 5  
ATOM 7855  N N    . ILE A 1 29  ? 0.522   2.888   8.418   1.00 0.00 ? 29  ILE A N    5  
ATOM 7856  C CA   . ILE A 1 29  ? -0.475  3.884   8.789   1.00 0.00 ? 29  ILE A CA   5  
ATOM 7857  C C    . ILE A 1 29  ? -1.888  3.356   8.568   1.00 0.00 ? 29  ILE A C    5  
ATOM 7858  O O    . ILE A 1 29  ? -2.166  2.699   7.566   1.00 0.00 ? 29  ILE A O    5  
ATOM 7859  C CB   . ILE A 1 29  ? -0.294  5.187   7.988   1.00 0.00 ? 29  ILE A CB   5  
ATOM 7860  C CG1  . ILE A 1 29  ? -0.640  4.957   6.515   1.00 0.00 ? 29  ILE A CG1  5  
ATOM 7861  C CG2  . ILE A 1 29  ? 1.130   5.702   8.128   1.00 0.00 ? 29  ILE A CG2  5  
ATOM 7862  C CD1  . ILE A 1 29  ? -0.508  6.200   5.663   1.00 0.00 ? 29  ILE A CD1  5  
ATOM 7863  H H    . ILE A 1 29  ? 0.583   2.597   7.484   1.00 0.00 ? 29  ILE A H    5  
ATOM 7864  H HA   . ILE A 1 29  ? -0.346  4.109   9.838   1.00 0.00 ? 29  ILE A HA   5  
ATOM 7865  H HB   . ILE A 1 29  ? -0.962  5.930   8.396   1.00 0.00 ? 29  ILE A HB   5  
ATOM 7866  H HG12 . ILE A 1 29  ? 0.019   4.206   6.109   1.00 0.00 ? 29  ILE A HG12 5  
ATOM 7867  H HG13 . ILE A 1 29  ? -1.661  4.611   6.443   1.00 0.00 ? 29  ILE A HG13 5  
ATOM 7868  H HG21 . ILE A 1 29  ? 1.765   5.206   7.409   1.00 0.00 ? 29  ILE A HG21 5  
ATOM 7869  H HG22 . ILE A 1 29  ? 1.147   6.767   7.948   1.00 0.00 ? 29  ILE A HG22 5  
ATOM 7870  H HG23 . ILE A 1 29  ? 1.490   5.500   9.126   1.00 0.00 ? 29  ILE A HG23 5  
ATOM 7871  H HD11 . ILE A 1 29  ? 0.053   6.949   6.202   1.00 0.00 ? 29  ILE A HD11 5  
ATOM 7872  H HD12 . ILE A 1 29  ? 0.004   5.955   4.745   1.00 0.00 ? 29  ILE A HD12 5  
ATOM 7873  H HD13 . ILE A 1 29  ? -1.492  6.585   5.433   1.00 0.00 ? 29  ILE A HD13 5  
ATOM 7874  N N    . GLU A 1 30  ? -2.778  3.650   9.511   1.00 0.00 ? 30  GLU A N    5  
ATOM 7875  C CA   . GLU A 1 30  ? -4.164  3.206   9.418   1.00 0.00 ? 30  GLU A CA   5  
ATOM 7876  C C    . GLU A 1 30  ? -5.066  4.336   8.930   1.00 0.00 ? 30  GLU A C    5  
ATOM 7877  O O    . GLU A 1 30  ? -5.191  5.372   9.583   1.00 0.00 ? 30  GLU A O    5  
ATOM 7878  C CB   . GLU A 1 30  ? -4.652  2.700   10.777  1.00 0.00 ? 30  GLU A CB   5  
ATOM 7879  C CG   . GLU A 1 30  ? -4.401  1.218   11.000  1.00 0.00 ? 30  GLU A CG   5  
ATOM 7880  C CD   . GLU A 1 30  ? -4.190  0.876   12.463  1.00 0.00 ? 30  GLU A CD   5  
ATOM 7881  O OE1  . GLU A 1 30  ? -5.173  0.931   13.232  1.00 0.00 ? 30  GLU A OE1  5  
ATOM 7882  O OE2  . GLU A 1 30  ? -3.044  0.553   12.838  1.00 0.00 ? 30  GLU A OE2  5  
ATOM 7883  H H    . GLU A 1 30  ? -2.496  4.178   10.287  1.00 0.00 ? 30  GLU A H    5  
ATOM 7884  H HA   . GLU A 1 30  ? -4.205  2.395   8.707   1.00 0.00 ? 30  GLU A HA   5  
ATOM 7885  H HB2  . GLU A 1 30  ? -4.147  3.251   11.556  1.00 0.00 ? 30  GLU A HB2  5  
ATOM 7886  H HB3  . GLU A 1 30  ? -5.715  2.878   10.853  1.00 0.00 ? 30  GLU A HB3  5  
ATOM 7887  H HG2  . GLU A 1 30  ? -5.252  0.662   10.636  1.00 0.00 ? 30  GLU A HG2  5  
ATOM 7888  H HG3  . GLU A 1 30  ? -3.520  0.927   10.447  1.00 0.00 ? 30  GLU A HG3  5  
ATOM 7889  N N    . LEU A 1 31  ? -5.692  4.128   7.777   1.00 0.00 ? 31  LEU A N    5  
ATOM 7890  C CA   . LEU A 1 31  ? -6.583  5.128   7.199   1.00 0.00 ? 31  LEU A CA   5  
ATOM 7891  C C    . LEU A 1 31  ? -8.020  4.618   7.157   1.00 0.00 ? 31  LEU A C    5  
ATOM 7892  O O    . LEU A 1 31  ? -8.293  3.548   6.615   1.00 0.00 ? 31  LEU A O    5  
ATOM 7893  C CB   . LEU A 1 31  ? -6.120  5.499   5.789   1.00 0.00 ? 31  LEU A CB   5  
ATOM 7894  C CG   . LEU A 1 31  ? -4.635  5.829   5.636   1.00 0.00 ? 31  LEU A CG   5  
ATOM 7895  C CD1  . LEU A 1 31  ? -4.296  6.099   4.178   1.00 0.00 ? 31  LEU A CD1  5  
ATOM 7896  C CD2  . LEU A 1 31  ? -4.261  7.023   6.502   1.00 0.00 ? 31  LEU A CD2  5  
ATOM 7897  H H    . LEU A 1 31  ? -5.553  3.282   7.302   1.00 0.00 ? 31  LEU A H    5  
ATOM 7898  H HA   . LEU A 1 31  ? -6.544  6.007   7.825   1.00 0.00 ? 31  LEU A HA   5  
ATOM 7899  H HB2  . LEU A 1 31  ? -6.343  4.667   5.139   1.00 0.00 ? 31  LEU A HB2  5  
ATOM 7900  H HB3  . LEU A 1 31  ? -6.687  6.363   5.473   1.00 0.00 ? 31  LEU A HB3  5  
ATOM 7901  H HG   . LEU A 1 31  ? -4.049  4.981   5.963   1.00 0.00 ? 31  LEU A HG   5  
ATOM 7902  H HD11 . LEU A 1 31  ? -5.208  6.177   3.605   1.00 0.00 ? 31  LEU A HD11 5  
ATOM 7903  H HD12 . LEU A 1 31  ? -3.696  5.288   3.792   1.00 0.00 ? 31  LEU A HD12 5  
ATOM 7904  H HD13 . LEU A 1 31  ? -3.742  7.023   4.103   1.00 0.00 ? 31  LEU A HD13 5  
ATOM 7905  H HD21 . LEU A 1 31  ? -4.452  7.936   5.957   1.00 0.00 ? 31  LEU A HD21 5  
ATOM 7906  H HD22 . LEU A 1 31  ? -3.213  6.968   6.757   1.00 0.00 ? 31  LEU A HD22 5  
ATOM 7907  H HD23 . LEU A 1 31  ? -4.853  7.011   7.405   1.00 0.00 ? 31  LEU A HD23 5  
ATOM 7908  N N    . GLU A 1 32  ? -8.935  5.394   7.731   1.00 0.00 ? 32  GLU A N    5  
ATOM 7909  C CA   . GLU A 1 32  ? -10.344 5.020   7.757   1.00 0.00 ? 32  GLU A CA   5  
ATOM 7910  C C    . GLU A 1 32  ? -11.027 5.378   6.440   1.00 0.00 ? 32  GLU A C    5  
ATOM 7911  O O    . GLU A 1 32  ? -11.223 6.553   6.128   1.00 0.00 ? 32  GLU A O    5  
ATOM 7912  C CB   . GLU A 1 32  ? -11.057 5.715   8.919   1.00 0.00 ? 32  GLU A CB   5  
ATOM 7913  C CG   . GLU A 1 32  ? -12.220 4.917   9.485   1.00 0.00 ? 32  GLU A CG   5  
ATOM 7914  C CD   . GLU A 1 32  ? -13.195 5.779   10.263  1.00 0.00 ? 32  GLU A CD   5  
ATOM 7915  O OE1  . GLU A 1 32  ? -12.877 6.144   11.414  1.00 0.00 ? 32  GLU A OE1  5  
ATOM 7916  O OE2  . GLU A 1 32  ? -14.277 6.087   9.721   1.00 0.00 ? 32  GLU A OE2  5  
ATOM 7917  H H    . GLU A 1 32  ? -8.656  6.236   8.147   1.00 0.00 ? 32  GLU A H    5  
ATOM 7918  H HA   . GLU A 1 32  ? -10.402 3.952   7.900   1.00 0.00 ? 32  GLU A HA   5  
ATOM 7919  H HB2  . GLU A 1 32  ? -10.345 5.886   9.713   1.00 0.00 ? 32  GLU A HB2  5  
ATOM 7920  H HB3  . GLU A 1 32  ? -11.435 6.667   8.576   1.00 0.00 ? 32  GLU A HB3  5  
ATOM 7921  H HG2  . GLU A 1 32  ? -12.750 4.449   8.668   1.00 0.00 ? 32  GLU A HG2  5  
ATOM 7922  H HG3  . GLU A 1 32  ? -11.830 4.155   10.143  1.00 0.00 ? 32  GLU A HG3  5  
ATOM 7923  N N    . LYS A 1 33  ? -11.386 4.356   5.670   1.00 0.00 ? 33  LYS A N    5  
ATOM 7924  C CA   . LYS A 1 33  ? -12.047 4.560   4.387   1.00 0.00 ? 33  LYS A CA   5  
ATOM 7925  C C    . LYS A 1 33  ? -13.164 5.592   4.508   1.00 0.00 ? 33  LYS A C    5  
ATOM 7926  O O    . LYS A 1 33  ? -14.018 5.495   5.389   1.00 0.00 ? 33  LYS A O    5  
ATOM 7927  C CB   . LYS A 1 33  ? -12.614 3.238   3.866   1.00 0.00 ? 33  LYS A CB   5  
ATOM 7928  C CG   . LYS A 1 33  ? -11.548 2.254   3.417   1.00 0.00 ? 33  LYS A CG   5  
ATOM 7929  C CD   . LYS A 1 33  ? -12.071 1.321   2.337   1.00 0.00 ? 33  LYS A CD   5  
ATOM 7930  C CE   . LYS A 1 33  ? -12.678 0.061   2.935   1.00 0.00 ? 33  LYS A CE   5  
ATOM 7931  N NZ   . LYS A 1 33  ? -11.641 -0.962  3.246   1.00 0.00 ? 33  LYS A NZ   5  
ATOM 7932  H H    . LYS A 1 33  ? -11.203 3.442   5.974   1.00 0.00 ? 33  LYS A H    5  
ATOM 7933  H HA   . LYS A 1 33  ? -11.309 4.926   3.688   1.00 0.00 ? 33  LYS A HA   5  
ATOM 7934  H HB2  . LYS A 1 33  ? -13.194 2.775   4.651   1.00 0.00 ? 33  LYS A HB2  5  
ATOM 7935  H HB3  . LYS A 1 33  ? -13.262 3.444   3.026   1.00 0.00 ? 33  LYS A HB3  5  
ATOM 7936  H HG2  . LYS A 1 33  ? -10.705 2.803   3.026   1.00 0.00 ? 33  LYS A HG2  5  
ATOM 7937  H HG3  . LYS A 1 33  ? -11.234 1.665   4.267   1.00 0.00 ? 33  LYS A HG3  5  
ATOM 7938  H HD2  . LYS A 1 33  ? -12.828 1.835   1.764   1.00 0.00 ? 33  LYS A HD2  5  
ATOM 7939  H HD3  . LYS A 1 33  ? -11.253 1.042   1.688   1.00 0.00 ? 33  LYS A HD3  5  
ATOM 7940  H HE2  . LYS A 1 33  ? -13.196 0.324   3.844   1.00 0.00 ? 33  LYS A HE2  5  
ATOM 7941  H HE3  . LYS A 1 33  ? -13.381 -0.354  2.228   1.00 0.00 ? 33  LYS A HE3  5  
ATOM 7942  H HZ1  . LYS A 1 33  ? -11.872 -1.445  4.137   1.00 0.00 ? 33  LYS A HZ1  5  
ATOM 7943  H HZ2  . LYS A 1 33  ? -10.710 -0.508  3.342   1.00 0.00 ? 33  LYS A HZ2  5  
ATOM 7944  H HZ3  . LYS A 1 33  ? -11.594 -1.667  2.483   1.00 0.00 ? 33  LYS A HZ3  5  
ATOM 7945  N N    . ASP A 1 34  ? -13.151 6.578   3.618   1.00 0.00 ? 34  ASP A N    5  
ATOM 7946  C CA   . ASP A 1 34  ? -14.164 7.627   3.623   1.00 0.00 ? 34  ASP A CA   5  
ATOM 7947  C C    . ASP A 1 34  ? -15.355 7.236   2.754   1.00 0.00 ? 34  ASP A C    5  
ATOM 7948  O O    . ASP A 1 34  ? -15.345 6.193   2.100   1.00 0.00 ? 34  ASP A O    5  
ATOM 7949  C CB   . ASP A 1 34  ? -13.567 8.945   3.129   1.00 0.00 ? 34  ASP A CB   5  
ATOM 7950  C CG   . ASP A 1 34  ? -14.459 10.134  3.430   1.00 0.00 ? 34  ASP A CG   5  
ATOM 7951  O OD1  . ASP A 1 34  ? -15.050 10.169  4.530   1.00 0.00 ? 34  ASP A OD1  5  
ATOM 7952  O OD2  . ASP A 1 34  ? -14.567 11.028  2.566   1.00 0.00 ? 34  ASP A OD2  5  
ATOM 7953  H H    . ASP A 1 34  ? -12.443 6.601   2.940   1.00 0.00 ? 34  ASP A H    5  
ATOM 7954  H HA   . ASP A 1 34  ? -14.504 7.755   4.640   1.00 0.00 ? 34  ASP A HA   5  
ATOM 7955  H HB2  . ASP A 1 34  ? -12.613 9.104   3.611   1.00 0.00 ? 34  ASP A HB2  5  
ATOM 7956  H HB3  . ASP A 1 34  ? -13.421 8.889   2.061   1.00 0.00 ? 34  ASP A HB3  5  
ATOM 7957  N N    . LYS A 1 35  ? -16.382 8.079   2.752   1.00 0.00 ? 35  LYS A N    5  
ATOM 7958  C CA   . LYS A 1 35  ? -17.582 7.824   1.964   1.00 0.00 ? 35  LYS A CA   5  
ATOM 7959  C C    . LYS A 1 35  ? -17.234 7.115   0.659   1.00 0.00 ? 35  LYS A C    5  
ATOM 7960  O O    . LYS A 1 35  ? -17.946 6.211   0.224   1.00 0.00 ? 35  LYS A O    5  
ATOM 7961  C CB   . LYS A 1 35  ? -18.310 9.136   1.666   1.00 0.00 ? 35  LYS A CB   5  
ATOM 7962  C CG   . LYS A 1 35  ? -19.814 8.978   1.521   1.00 0.00 ? 35  LYS A CG   5  
ATOM 7963  C CD   . LYS A 1 35  ? -20.492 8.837   2.873   1.00 0.00 ? 35  LYS A CD   5  
ATOM 7964  C CE   . LYS A 1 35  ? -20.825 10.194  3.474   1.00 0.00 ? 35  LYS A CE   5  
ATOM 7965  N NZ   . LYS A 1 35  ? -22.059 10.777  2.878   1.00 0.00 ? 35  LYS A NZ   5  
ATOM 7966  H H    . LYS A 1 35  ? -16.331 8.895   3.295   1.00 0.00 ? 35  LYS A H    5  
ATOM 7967  H HA   . LYS A 1 35  ? -18.230 7.185   2.545   1.00 0.00 ? 35  LYS A HA   5  
ATOM 7968  H HB2  . LYS A 1 35  ? -18.118 9.831   2.470   1.00 0.00 ? 35  LYS A HB2  5  
ATOM 7969  H HB3  . LYS A 1 35  ? -17.923 9.548   0.745   1.00 0.00 ? 35  LYS A HB3  5  
ATOM 7970  H HG2  . LYS A 1 35  ? -20.212 9.847   1.020   1.00 0.00 ? 35  LYS A HG2  5  
ATOM 7971  H HG3  . LYS A 1 35  ? -20.019 8.095   0.932   1.00 0.00 ? 35  LYS A HG3  5  
ATOM 7972  H HD2  . LYS A 1 35  ? -21.407 8.276   2.751   1.00 0.00 ? 35  LYS A HD2  5  
ATOM 7973  H HD3  . LYS A 1 35  ? -19.831 8.308   3.545   1.00 0.00 ? 35  LYS A HD3  5  
ATOM 7974  H HE2  . LYS A 1 35  ? -20.969 10.077  4.537   1.00 0.00 ? 35  LYS A HE2  5  
ATOM 7975  H HE3  . LYS A 1 35  ? -19.998 10.865  3.295   1.00 0.00 ? 35  LYS A HE3  5  
ATOM 7976  H HZ1  . LYS A 1 35  ? -22.495 10.097  2.223   1.00 0.00 ? 35  LYS A HZ1  5  
ATOM 7977  H HZ2  . LYS A 1 35  ? -21.828 11.646  2.355   1.00 0.00 ? 35  LYS A HZ2  5  
ATOM 7978  H HZ3  . LYS A 1 35  ? -22.743 11.008  3.627   1.00 0.00 ? 35  LYS A HZ3  5  
ATOM 7979  N N    . ASN A 1 36  ? -16.134 7.531   0.040   1.00 0.00 ? 36  ASN A N    5  
ATOM 7980  C CA   . ASN A 1 36  ? -15.692 6.935   -1.216  1.00 0.00 ? 36  ASN A CA   5  
ATOM 7981  C C    . ASN A 1 36  ? -14.700 5.804   -0.961  1.00 0.00 ? 36  ASN A C    5  
ATOM 7982  O O    . ASN A 1 36  ? -14.752 4.761   -1.611  1.00 0.00 ? 36  ASN A O    5  
ATOM 7983  C CB   . ASN A 1 36  ? -15.052 7.998   -2.112  1.00 0.00 ? 36  ASN A CB   5  
ATOM 7984  C CG   . ASN A 1 36  ? -16.083 8.891   -2.774  1.00 0.00 ? 36  ASN A CG   5  
ATOM 7985  O OD1  . ASN A 1 36  ? -16.072 10.109  -2.594  1.00 0.00 ? 36  ASN A OD1  5  
ATOM 7986  N ND2  . ASN A 1 36  ? -16.979 8.289   -3.546  1.00 0.00 ? 36  ASN A ND2  5  
ATOM 7987  H H    . ASN A 1 36  ? -15.607 8.256   0.436   1.00 0.00 ? 36  ASN A H    5  
ATOM 7988  H HA   . ASN A 1 36  ? -16.560 6.531   -1.715  1.00 0.00 ? 36  ASN A HA   5  
ATOM 7989  H HB2  . ASN A 1 36  ? -14.398 8.617   -1.515  1.00 0.00 ? 36  ASN A HB2  5  
ATOM 7990  H HB3  . ASN A 1 36  ? -14.475 7.510   -2.883  1.00 0.00 ? 36  ASN A HB3  5  
ATOM 7991  H HD21 . ASN A 1 36  ? -16.927 7.315   -3.644  1.00 0.00 ? 36  ASN A HD21 5  
ATOM 7992  H HD22 . ASN A 1 36  ? -17.657 8.843   -3.988  1.00 0.00 ? 36  ASN A HD22 5  
ATOM 7993  N N    . GLY A 1 37  ? -13.796 6.020   -0.010  1.00 0.00 ? 37  GLY A N    5  
ATOM 7994  C CA   . GLY A 1 37  ? -12.805 5.011   0.314   1.00 0.00 ? 37  GLY A CA   5  
ATOM 7995  C C    . GLY A 1 37  ? -11.387 5.534   0.205   1.00 0.00 ? 37  GLY A C    5  
ATOM 7996  O O    . GLY A 1 37  ? -11.170 6.692   -0.155  1.00 0.00 ? 37  GLY A O    5  
ATOM 7997  H H    . GLY A 1 37  ? -13.802 6.872   0.475   1.00 0.00 ? 37  GLY A H    5  
ATOM 7998  H HA2  . GLY A 1 37  ? -12.974 4.667   1.323   1.00 0.00 ? 37  GLY A HA2  5  
ATOM 7999  H HA3  . GLY A 1 37  ? -12.921 4.177   -0.364  1.00 0.00 ? 37  GLY A HA3  5  
ATOM 8000  N N    . LEU A 1 38  ? -10.417 4.682   0.517   1.00 0.00 ? 38  LEU A N    5  
ATOM 8001  C CA   . LEU A 1 38  ? -9.011  5.065   0.454   1.00 0.00 ? 38  LEU A CA   5  
ATOM 8002  C C    . LEU A 1 38  ? -8.720  5.862   -0.814  1.00 0.00 ? 38  LEU A C    5  
ATOM 8003  O O    . LEU A 1 38  ? -8.113  6.930   -0.762  1.00 0.00 ? 38  LEU A O    5  
ATOM 8004  C CB   . LEU A 1 38  ? -8.120  3.822   0.504   1.00 0.00 ? 38  LEU A CB   5  
ATOM 8005  C CG   . LEU A 1 38  ? -8.174  3.010   1.799   1.00 0.00 ? 38  LEU A CG   5  
ATOM 8006  C CD1  . LEU A 1 38  ? -7.063  1.973   1.825   1.00 0.00 ? 38  LEU A CD1  5  
ATOM 8007  C CD2  . LEU A 1 38  ? -8.078  3.928   3.009   1.00 0.00 ? 38  LEU A CD2  5  
ATOM 8008  H H    . LEU A 1 38  ? -10.651 3.772   0.797   1.00 0.00 ? 38  LEU A H    5  
ATOM 8009  H HA   . LEU A 1 38  ? -8.798  5.686   1.311   1.00 0.00 ? 38  LEU A HA   5  
ATOM 8010  H HB2  . LEU A 1 38  ? -8.413  3.173   -0.306  1.00 0.00 ? 38  LEU A HB2  5  
ATOM 8011  H HB3  . LEU A 1 38  ? -7.099  4.143   0.356   1.00 0.00 ? 38  LEU A HB3  5  
ATOM 8012  H HG   . LEU A 1 38  ? -9.120  2.487   1.849   1.00 0.00 ? 38  LEU A HG   5  
ATOM 8013  H HD11 . LEU A 1 38  ? -6.742  1.814   2.843   1.00 0.00 ? 38  LEU A HD11 5  
ATOM 8014  H HD12 . LEU A 1 38  ? -6.229  2.324   1.235   1.00 0.00 ? 38  LEU A HD12 5  
ATOM 8015  H HD13 . LEU A 1 38  ? -7.428  1.043   1.413   1.00 0.00 ? 38  LEU A HD13 5  
ATOM 8016  H HD21 . LEU A 1 38  ? -7.516  4.811   2.746   1.00 0.00 ? 38  LEU A HD21 5  
ATOM 8017  H HD22 . LEU A 1 38  ? -7.579  3.410   3.815   1.00 0.00 ? 38  LEU A HD22 5  
ATOM 8018  H HD23 . LEU A 1 38  ? -9.071  4.213   3.324   1.00 0.00 ? 38  LEU A HD23 5  
ATOM 8019  N N    . GLY A 1 39  ? -9.161  5.334   -1.952  1.00 0.00 ? 39  GLY A N    5  
ATOM 8020  C CA   . GLY A 1 39  ? -8.940  6.010   -3.217  1.00 0.00 ? 39  GLY A CA   5  
ATOM 8021  C C    . GLY A 1 39  ? -7.472  6.280   -3.482  1.00 0.00 ? 39  GLY A C    5  
ATOM 8022  O O    . GLY A 1 39  ? -6.962  7.353   -3.157  1.00 0.00 ? 39  GLY A O    5  
ATOM 8023  H H    . GLY A 1 39  ? -9.639  4.479   -1.933  1.00 0.00 ? 39  GLY A H    5  
ATOM 8024  H HA2  . GLY A 1 39  ? -9.332  5.397   -4.014  1.00 0.00 ? 39  GLY A HA2  5  
ATOM 8025  H HA3  . GLY A 1 39  ? -9.471  6.951   -3.207  1.00 0.00 ? 39  GLY A HA3  5  
ATOM 8026  N N    . LEU A 1 40  ? -6.790  5.305   -4.073  1.00 0.00 ? 40  LEU A N    5  
ATOM 8027  C CA   . LEU A 1 40  ? -5.371  5.441   -4.380  1.00 0.00 ? 40  LEU A CA   5  
ATOM 8028  C C    . LEU A 1 40  ? -5.065  4.928   -5.783  1.00 0.00 ? 40  LEU A C    5  
ATOM 8029  O O    . LEU A 1 40  ? -5.598  3.903   -6.210  1.00 0.00 ? 40  LEU A O    5  
ATOM 8030  C CB   . LEU A 1 40  ? -4.531  4.681   -3.352  1.00 0.00 ? 40  LEU A CB   5  
ATOM 8031  C CG   . LEU A 1 40  ? -4.678  5.132   -1.899  1.00 0.00 ? 40  LEU A CG   5  
ATOM 8032  C CD1  . LEU A 1 40  ? -4.449  3.965   -0.951  1.00 0.00 ? 40  LEU A CD1  5  
ATOM 8033  C CD2  . LEU A 1 40  ? -3.712  6.267   -1.592  1.00 0.00 ? 40  LEU A CD2  5  
ATOM 8034  H H    . LEU A 1 40  ? -7.251  4.473   -4.308  1.00 0.00 ? 40  LEU A H    5  
ATOM 8035  H HA   . LEU A 1 40  ? -5.121  6.491   -4.331  1.00 0.00 ? 40  LEU A HA   5  
ATOM 8036  H HB2  . LEU A 1 40  ? -4.808  3.639   -3.404  1.00 0.00 ? 40  LEU A HB2  5  
ATOM 8037  H HB3  . LEU A 1 40  ? -3.492  4.790   -3.630  1.00 0.00 ? 40  LEU A HB3  5  
ATOM 8038  H HG   . LEU A 1 40  ? -5.684  5.496   -1.742  1.00 0.00 ? 40  LEU A HG   5  
ATOM 8039  H HD11 . LEU A 1 40  ? -3.451  4.020   -0.546  1.00 0.00 ? 40  LEU A HD11 5  
ATOM 8040  H HD12 . LEU A 1 40  ? -4.569  3.036   -1.490  1.00 0.00 ? 40  LEU A HD12 5  
ATOM 8041  H HD13 . LEU A 1 40  ? -5.168  4.008   -0.146  1.00 0.00 ? 40  LEU A HD13 5  
ATOM 8042  H HD21 . LEU A 1 40  ? -4.245  7.207   -1.608  1.00 0.00 ? 40  LEU A HD21 5  
ATOM 8043  H HD22 . LEU A 1 40  ? -2.930  6.285   -2.337  1.00 0.00 ? 40  LEU A HD22 5  
ATOM 8044  H HD23 . LEU A 1 40  ? -3.277  6.116   -0.615  1.00 0.00 ? 40  LEU A HD23 5  
ATOM 8045  N N    . SER A 1 41  ? -4.203  5.645   -6.496  1.00 0.00 ? 41  SER A N    5  
ATOM 8046  C CA   . SER A 1 41  ? -3.828  5.263   -7.852  1.00 0.00 ? 41  SER A CA   5  
ATOM 8047  C C    . SER A 1 41  ? -2.704  4.231   -7.834  1.00 0.00 ? 41  SER A C    5  
ATOM 8048  O O    . SER A 1 41  ? -1.594  4.513   -7.380  1.00 0.00 ? 41  SER A O    5  
ATOM 8049  C CB   . SER A 1 41  ? -3.393  6.494   -8.650  1.00 0.00 ? 41  SER A CB   5  
ATOM 8050  O OG   . SER A 1 41  ? -4.497  7.336   -8.931  1.00 0.00 ? 41  SER A OG   5  
ATOM 8051  H H    . SER A 1 41  ? -3.812  6.453   -6.101  1.00 0.00 ? 41  SER A H    5  
ATOM 8052  H HA   . SER A 1 41  ? -4.694  4.826   -8.325  1.00 0.00 ? 41  SER A HA   5  
ATOM 8053  H HB2  . SER A 1 41  ? -2.667  7.052   -8.078  1.00 0.00 ? 41  SER A HB2  5  
ATOM 8054  H HB3  . SER A 1 41  ? -2.950  6.177   -9.583  1.00 0.00 ? 41  SER A HB3  5  
ATOM 8055  H HG   . SER A 1 41  ? -5.166  7.225   -8.252  1.00 0.00 ? 41  SER A HG   5  
ATOM 8056  N N    . LEU A 1 42  ? -2.999  3.035   -8.332  1.00 0.00 ? 42  LEU A N    5  
ATOM 8057  C CA   . LEU A 1 42  ? -2.015  1.960   -8.374  1.00 0.00 ? 42  LEU A CA   5  
ATOM 8058  C C    . LEU A 1 42  ? -1.526  1.724   -9.800  1.00 0.00 ? 42  LEU A C    5  
ATOM 8059  O O    . LEU A 1 42  ? -2.238  2.003   -10.764 1.00 0.00 ? 42  LEU A O    5  
ATOM 8060  C CB   . LEU A 1 42  ? -2.614  0.671   -7.808  1.00 0.00 ? 42  LEU A CB   5  
ATOM 8061  C CG   . LEU A 1 42  ? -3.299  0.791   -6.446  1.00 0.00 ? 42  LEU A CG   5  
ATOM 8062  C CD1  . LEU A 1 42  ? -3.941  -0.531  -6.054  1.00 0.00 ? 42  LEU A CD1  5  
ATOM 8063  C CD2  . LEU A 1 42  ? -2.303  1.237   -5.386  1.00 0.00 ? 42  LEU A CD2  5  
ATOM 8064  H H    . LEU A 1 42  ? -3.900  2.871   -8.679  1.00 0.00 ? 42  LEU A H    5  
ATOM 8065  H HA   . LEU A 1 42  ? -1.175  2.255   -7.763  1.00 0.00 ? 42  LEU A HA   5  
ATOM 8066  H HB2  . LEU A 1 42  ? -3.344  0.308   -8.515  1.00 0.00 ? 42  LEU A HB2  5  
ATOM 8067  H HB3  . LEU A 1 42  ? -1.815  -0.051  -7.715  1.00 0.00 ? 42  LEU A HB3  5  
ATOM 8068  H HG   . LEU A 1 42  ? -4.080  1.536   -6.508  1.00 0.00 ? 42  LEU A HG   5  
ATOM 8069  H HD11 . LEU A 1 42  ? -4.101  -0.551  -4.987  1.00 0.00 ? 42  LEU A HD11 5  
ATOM 8070  H HD12 . LEU A 1 42  ? -3.290  -1.345  -6.336  1.00 0.00 ? 42  LEU A HD12 5  
ATOM 8071  H HD13 . LEU A 1 42  ? -4.889  -0.635  -6.563  1.00 0.00 ? 42  LEU A HD13 5  
ATOM 8072  H HD21 . LEU A 1 42  ? -2.763  1.172   -4.411  1.00 0.00 ? 42  LEU A HD21 5  
ATOM 8073  H HD22 . LEU A 1 42  ? -2.008  2.259   -5.577  1.00 0.00 ? 42  LEU A HD22 5  
ATOM 8074  H HD23 . LEU A 1 42  ? -1.433  0.599   -5.417  1.00 0.00 ? 42  LEU A HD23 5  
ATOM 8075  N N    . ALA A 1 43  ? -0.308  1.207   -9.925  1.00 0.00 ? 43  ALA A N    5  
ATOM 8076  C CA   . ALA A 1 43  ? 0.273   0.930   -11.232 1.00 0.00 ? 43  ALA A CA   5  
ATOM 8077  C C    . ALA A 1 43  ? 1.362   -0.134  -11.134 1.00 0.00 ? 43  ALA A C    5  
ATOM 8078  O O    . ALA A 1 43  ? 2.420   0.099   -10.551 1.00 0.00 ? 43  ALA A O    5  
ATOM 8079  C CB   . ALA A 1 43  ? 0.832   2.206   -11.843 1.00 0.00 ? 43  ALA A CB   5  
ATOM 8080  H H    . ALA A 1 43  ? 0.211   1.006   -9.118  1.00 0.00 ? 43  ALA A H    5  
ATOM 8081  H HA   . ALA A 1 43  ? -0.514  0.566   -11.877 1.00 0.00 ? 43  ALA A HA   5  
ATOM 8082  H HB1  . ALA A 1 43  ? 0.958   2.070   -12.907 1.00 0.00 ? 43  ALA A HB1  5  
ATOM 8083  H HB2  . ALA A 1 43  ? 0.148   3.021   -11.661 1.00 0.00 ? 43  ALA A HB2  5  
ATOM 8084  H HB3  . ALA A 1 43  ? 1.788   2.431   -11.393 1.00 0.00 ? 43  ALA A HB3  5  
ATOM 8085  N N    . GLY A 1 44  ? 1.095   -1.303  -11.709 1.00 0.00 ? 44  GLY A N    5  
ATOM 8086  C CA   . GLY A 1 44  ? 2.062   -2.384  -11.674 1.00 0.00 ? 44  GLY A CA   5  
ATOM 8087  C C    . GLY A 1 44  ? 3.471   -1.912  -11.971 1.00 0.00 ? 44  GLY A C    5  
ATOM 8088  O O    . GLY A 1 44  ? 3.694   -1.159  -12.918 1.00 0.00 ? 44  GLY A O    5  
ATOM 8089  H H    . GLY A 1 44  ? 0.234   -1.431  -12.160 1.00 0.00 ? 44  GLY A H    5  
ATOM 8090  H HA2  . GLY A 1 44  ? 2.044   -2.837  -10.694 1.00 0.00 ? 44  GLY A HA2  5  
ATOM 8091  H HA3  . GLY A 1 44  ? 1.781   -3.126  -12.407 1.00 0.00 ? 44  GLY A HA3  5  
ATOM 8092  N N    . ASN A 1 45  ? 4.425   -2.354  -11.158 1.00 0.00 ? 45  ASN A N    5  
ATOM 8093  C CA   . ASN A 1 45  ? 5.821   -1.970  -11.337 1.00 0.00 ? 45  ASN A CA   5  
ATOM 8094  C C    . ASN A 1 45  ? 6.157   -1.815  -12.817 1.00 0.00 ? 45  ASN A C    5  
ATOM 8095  O O    . ASN A 1 45  ? 5.750   -2.630  -13.646 1.00 0.00 ? 45  ASN A O    5  
ATOM 8096  C CB   . ASN A 1 45  ? 6.744   -3.010  -10.699 1.00 0.00 ? 45  ASN A CB   5  
ATOM 8097  C CG   . ASN A 1 45  ? 8.210   -2.704  -10.935 1.00 0.00 ? 45  ASN A CG   5  
ATOM 8098  O OD1  . ASN A 1 45  ? 8.656   -2.591  -12.077 1.00 0.00 ? 45  ASN A OD1  5  
ATOM 8099  N ND2  . ASN A 1 45  ? 8.968   -2.568  -9.853  1.00 0.00 ? 45  ASN A ND2  5  
ATOM 8100  H H    . ASN A 1 45  ? 4.186   -2.953  -10.420 1.00 0.00 ? 45  ASN A H    5  
ATOM 8101  H HA   . ASN A 1 45  ? 5.969   -1.020  -10.845 1.00 0.00 ? 45  ASN A HA   5  
ATOM 8102  H HB2  . ASN A 1 45  ? 6.568   -3.033  -9.633  1.00 0.00 ? 45  ASN A HB2  5  
ATOM 8103  H HB3  . ASN A 1 45  ? 6.526   -3.981  -11.117 1.00 0.00 ? 45  ASN A HB3  5  
ATOM 8104  H HD21 . ASN A 1 45  ? 8.544   -2.672  -8.975  1.00 0.00 ? 45  ASN A HD21 5  
ATOM 8105  H HD22 . ASN A 1 45  ? 9.919   -2.369  -9.976  1.00 0.00 ? 45  ASN A HD22 5  
ATOM 8106  N N    . LYS A 1 46  ? 6.902   -0.765  -13.143 1.00 0.00 ? 46  LYS A N    5  
ATOM 8107  C CA   . LYS A 1 46  ? 7.296   -0.503  -14.522 1.00 0.00 ? 46  LYS A CA   5  
ATOM 8108  C C    . LYS A 1 46  ? 7.513   -1.807  -15.283 1.00 0.00 ? 46  LYS A C    5  
ATOM 8109  O O    . LYS A 1 46  ? 6.945   -2.012  -16.356 1.00 0.00 ? 46  LYS A O    5  
ATOM 8110  C CB   . LYS A 1 46  ? 8.573   0.340   -14.558 1.00 0.00 ? 46  LYS A CB   5  
ATOM 8111  C CG   . LYS A 1 46  ? 8.383   1.754   -14.038 1.00 0.00 ? 46  LYS A CG   5  
ATOM 8112  C CD   . LYS A 1 46  ? 9.679   2.324   -13.486 1.00 0.00 ? 46  LYS A CD   5  
ATOM 8113  C CE   . LYS A 1 46  ? 10.477  3.042   -14.563 1.00 0.00 ? 46  LYS A CE   5  
ATOM 8114  N NZ   . LYS A 1 46  ? 10.063  4.466   -14.703 1.00 0.00 ? 46  LYS A NZ   5  
ATOM 8115  H H    . LYS A 1 46  ? 7.196   -0.151  -12.437 1.00 0.00 ? 46  LYS A H    5  
ATOM 8116  H HA   . LYS A 1 46  ? 6.497   0.048   -14.996 1.00 0.00 ? 46  LYS A HA   5  
ATOM 8117  H HB2  . LYS A 1 46  ? 9.327   -0.145  -13.956 1.00 0.00 ? 46  LYS A HB2  5  
ATOM 8118  H HB3  . LYS A 1 46  ? 8.922   0.398   -15.579 1.00 0.00 ? 46  LYS A HB3  5  
ATOM 8119  H HG2  . LYS A 1 46  ? 8.043   2.383   -14.847 1.00 0.00 ? 46  LYS A HG2  5  
ATOM 8120  H HG3  . LYS A 1 46  ? 7.642   1.742   -13.252 1.00 0.00 ? 46  LYS A HG3  5  
ATOM 8121  H HD2  . LYS A 1 46  ? 9.447   3.025   -12.698 1.00 0.00 ? 46  LYS A HD2  5  
ATOM 8122  H HD3  . LYS A 1 46  ? 10.276  1.515   -13.087 1.00 0.00 ? 46  LYS A HD3  5  
ATOM 8123  H HE2  . LYS A 1 46  ? 11.523  3.004   -14.304 1.00 0.00 ? 46  LYS A HE2  5  
ATOM 8124  H HE3  . LYS A 1 46  ? 10.321  2.536   -15.505 1.00 0.00 ? 46  LYS A HE3  5  
ATOM 8125  H HZ1  . LYS A 1 46  ? 9.025   4.538   -14.697 1.00 0.00 ? 46  LYS A HZ1  5  
ATOM 8126  H HZ2  . LYS A 1 46  ? 10.421  4.855   -15.598 1.00 0.00 ? 46  LYS A HZ2  5  
ATOM 8127  H HZ3  . LYS A 1 46  ? 10.444  5.028   -13.916 1.00 0.00 ? 46  LYS A HZ3  5  
ATOM 8128  N N    . ASP A 1 47  ? 8.336   -2.685  -14.721 1.00 0.00 ? 47  ASP A N    5  
ATOM 8129  C CA   . ASP A 1 47  ? 8.626   -3.970  -15.345 1.00 0.00 ? 47  ASP A CA   5  
ATOM 8130  C C    . ASP A 1 47  ? 7.456   -4.934  -15.173 1.00 0.00 ? 47  ASP A C    5  
ATOM 8131  O O    . ASP A 1 47  ? 6.983   -5.159  -14.059 1.00 0.00 ? 47  ASP A O    5  
ATOM 8132  C CB   . ASP A 1 47  ? 9.895   -4.578  -14.746 1.00 0.00 ? 47  ASP A CB   5  
ATOM 8133  C CG   . ASP A 1 47  ? 10.646  -5.445  -15.738 1.00 0.00 ? 47  ASP A CG   5  
ATOM 8134  O OD1  . ASP A 1 47  ? 10.558  -5.169  -16.953 1.00 0.00 ? 47  ASP A OD1  5  
ATOM 8135  O OD2  . ASP A 1 47  ? 11.321  -6.399  -15.299 1.00 0.00 ? 47  ASP A OD2  5  
ATOM 8136  H H    . ASP A 1 47  ? 8.759   -2.463  -13.864 1.00 0.00 ? 47  ASP A H    5  
ATOM 8137  H HA   . ASP A 1 47  ? 8.783   -3.799  -16.399 1.00 0.00 ? 47  ASP A HA   5  
ATOM 8138  H HB2  . ASP A 1 47  ? 10.551  -3.781  -14.425 1.00 0.00 ? 47  ASP A HB2  5  
ATOM 8139  H HB3  . ASP A 1 47  ? 9.628   -5.185  -13.894 1.00 0.00 ? 47  ASP A HB3  5  
ATOM 8140  N N    . ARG A 1 48  ? 6.993   -5.498  -16.284 1.00 0.00 ? 48  ARG A N    5  
ATOM 8141  C CA   . ARG A 1 48  ? 5.877   -6.436  -16.256 1.00 0.00 ? 48  ARG A CA   5  
ATOM 8142  C C    . ARG A 1 48  ? 6.202   -7.643  -15.382 1.00 0.00 ? 48  ARG A C    5  
ATOM 8143  O O    . ARG A 1 48  ? 5.383   -8.073  -14.570 1.00 0.00 ? 48  ARG A O    5  
ATOM 8144  C CB   . ARG A 1 48  ? 5.535   -6.897  -17.674 1.00 0.00 ? 48  ARG A CB   5  
ATOM 8145  C CG   . ARG A 1 48  ? 4.146   -7.501  -17.800 1.00 0.00 ? 48  ARG A CG   5  
ATOM 8146  C CD   . ARG A 1 48  ? 3.802   -7.810  -19.249 1.00 0.00 ? 48  ARG A CD   5  
ATOM 8147  N NE   . ARG A 1 48  ? 3.196   -6.666  -19.924 1.00 0.00 ? 48  ARG A NE   5  
ATOM 8148  C CZ   . ARG A 1 48  ? 2.996   -6.608  -21.236 1.00 0.00 ? 48  ARG A CZ   5  
ATOM 8149  N NH1  . ARG A 1 48  ? 3.350   -7.625  -22.009 1.00 0.00 ? 48  ARG A NH1  5  
ATOM 8150  N NH2  . ARG A 1 48  ? 2.439   -5.532  -21.777 1.00 0.00 ? 48  ARG A NH2  5  
ATOM 8151  H H    . ARG A 1 48  ? 7.411   -5.279  -17.142 1.00 0.00 ? 48  ARG A H    5  
ATOM 8152  H HA   . ARG A 1 48  ? 5.023   -5.923  -15.838 1.00 0.00 ? 48  ARG A HA   5  
ATOM 8153  H HB2  . ARG A 1 48  ? 5.596   -6.049  -18.341 1.00 0.00 ? 48  ARG A HB2  5  
ATOM 8154  H HB3  . ARG A 1 48  ? 6.255   -7.639  -17.982 1.00 0.00 ? 48  ARG A HB3  5  
ATOM 8155  H HG2  . ARG A 1 48  ? 4.108   -8.417  -17.229 1.00 0.00 ? 48  ARG A HG2  5  
ATOM 8156  H HG3  . ARG A 1 48  ? 3.422   -6.801  -17.409 1.00 0.00 ? 48  ARG A HG3  5  
ATOM 8157  H HD2  . ARG A 1 48  ? 4.707   -8.085  -19.769 1.00 0.00 ? 48  ARG A HD2  5  
ATOM 8158  H HD3  . ARG A 1 48  ? 3.108   -8.638  -19.271 1.00 0.00 ? 48  ARG A HD3  5  
ATOM 8159  H HE   . ARG A 1 48  ? 2.927   -5.903  -19.372 1.00 0.00 ? 48  ARG A HE   5  
ATOM 8160  H HH11 . ARG A 1 48  ? 3.769   -8.438  -21.604 1.00 0.00 ? 48  ARG A HH11 5  
ATOM 8161  H HH12 . ARG A 1 48  ? 3.197   -7.580  -22.997 1.00 0.00 ? 48  ARG A HH12 5  
ATOM 8162  H HH21 . ARG A 1 48  ? 2.170   -4.764  -21.197 1.00 0.00 ? 48  ARG A HH21 5  
ATOM 8163  H HH22 . ARG A 1 48  ? 2.289   -5.490  -22.764 1.00 0.00 ? 48  ARG A HH22 5  
ATOM 8164  N N    . SER A 1 49  ? 7.403   -8.186  -15.556 1.00 0.00 ? 49  SER A N    5  
ATOM 8165  C CA   . SER A 1 49  ? 7.835   -9.347  -14.786 1.00 0.00 ? 49  SER A CA   5  
ATOM 8166  C C    . SER A 1 49  ? 7.929   -9.010  -13.301 1.00 0.00 ? 49  SER A C    5  
ATOM 8167  O O    . SER A 1 49  ? 7.976   -9.901  -12.453 1.00 0.00 ? 49  SER A O    5  
ATOM 8168  C CB   . SER A 1 49  ? 9.189   -9.847  -15.294 1.00 0.00 ? 49  SER A CB   5  
ATOM 8169  O OG   . SER A 1 49  ? 9.038   -10.623 -16.469 1.00 0.00 ? 49  SER A OG   5  
ATOM 8170  H H    . SER A 1 49  ? 8.011   -7.798  -16.219 1.00 0.00 ? 49  SER A H    5  
ATOM 8171  H HA   . SER A 1 49  ? 7.100   -10.127 -14.921 1.00 0.00 ? 49  SER A HA   5  
ATOM 8172  H HB2  . SER A 1 49  ? 9.822   -9.001  -15.515 1.00 0.00 ? 49  SER A HB2  5  
ATOM 8173  H HB3  . SER A 1 49  ? 9.654   -10.455 -14.531 1.00 0.00 ? 49  SER A HB3  5  
ATOM 8174  H HG   . SER A 1 49  ? 9.820   -11.165 -16.598 1.00 0.00 ? 49  SER A HG   5  
ATOM 8175  N N    . ARG A 1 50  ? 7.956   -7.717  -12.995 1.00 0.00 ? 50  ARG A N    5  
ATOM 8176  C CA   . ARG A 1 50  ? 8.045   -7.261  -11.613 1.00 0.00 ? 50  ARG A CA   5  
ATOM 8177  C C    . ARG A 1 50  ? 6.660   -7.173  -10.979 1.00 0.00 ? 50  ARG A C    5  
ATOM 8178  O O    . ARG A 1 50  ? 5.949   -6.183  -11.153 1.00 0.00 ? 50  ARG A O    5  
ATOM 8179  C CB   . ARG A 1 50  ? 8.736   -5.898  -11.547 1.00 0.00 ? 50  ARG A CB   5  
ATOM 8180  C CG   . ARG A 1 50  ? 10.249  -5.975  -11.670 1.00 0.00 ? 50  ARG A CG   5  
ATOM 8181  C CD   . ARG A 1 50  ? 10.911  -6.122  -10.309 1.00 0.00 ? 50  ARG A CD   5  
ATOM 8182  N NE   . ARG A 1 50  ? 12.188  -6.827  -10.395 1.00 0.00 ? 50  ARG A NE   5  
ATOM 8183  C CZ   . ARG A 1 50  ? 12.832  -7.313  -9.340  1.00 0.00 ? 50  ARG A CZ   5  
ATOM 8184  N NH1  . ARG A 1 50  ? 12.321  -7.172  -8.125  1.00 0.00 ? 50  ARG A NH1  5  
ATOM 8185  N NH2  . ARG A 1 50  ? 13.989  -7.942  -9.499  1.00 0.00 ? 50  ARG A NH2  5  
ATOM 8186  H H    . ARG A 1 50  ? 7.915   -7.054  -13.715 1.00 0.00 ? 50  ARG A H    5  
ATOM 8187  H HA   . ARG A 1 50  ? 8.634   -7.980  -11.064 1.00 0.00 ? 50  ARG A HA   5  
ATOM 8188  H HB2  . ARG A 1 50  ? 8.363   -5.279  -12.350 1.00 0.00 ? 50  ARG A HB2  5  
ATOM 8189  H HB3  . ARG A 1 50  ? 8.496   -5.432  -10.603 1.00 0.00 ? 50  ARG A HB3  5  
ATOM 8190  H HG2  . ARG A 1 50  ? 10.508  -6.828  -12.279 1.00 0.00 ? 50  ARG A HG2  5  
ATOM 8191  H HG3  . ARG A 1 50  ? 10.609  -5.072  -12.140 1.00 0.00 ? 50  ARG A HG3  5  
ATOM 8192  H HD2  . ARG A 1 50  ? 11.081  -5.139  -9.898  1.00 0.00 ? 50  ARG A HD2  5  
ATOM 8193  H HD3  . ARG A 1 50  ? 10.249  -6.675  -9.659  1.00 0.00 ? 50  ARG A HD3  5  
ATOM 8194  H HE   . ARG A 1 50  ? 12.583  -6.942  -11.284 1.00 0.00 ? 50  ARG A HE   5  
ATOM 8195  H HH11 . ARG A 1 50  ? 11.448  -6.699  -8.002  1.00 0.00 ? 50  ARG A HH11 5  
ATOM 8196  H HH12 . ARG A 1 50  ? 12.807  -7.540  -7.332  1.00 0.00 ? 50  ARG A HH12 5  
ATOM 8197  H HH21 . ARG A 1 50  ? 14.377  -8.051  -10.414 1.00 0.00 ? 50  ARG A HH21 5  
ATOM 8198  H HH22 . ARG A 1 50  ? 14.473  -8.308  -8.705  1.00 0.00 ? 50  ARG A HH22 5  
ATOM 8199  N N    . MET A 1 51  ? 6.284   -8.214  -10.244 1.00 0.00 ? 51  MET A N    5  
ATOM 8200  C CA   . MET A 1 51  ? 4.984   -8.253  -9.583  1.00 0.00 ? 51  MET A CA   5  
ATOM 8201  C C    . MET A 1 51  ? 4.997   -7.418  -8.307  1.00 0.00 ? 51  MET A C    5  
ATOM 8202  O O    . MET A 1 51  ? 5.482   -7.864  -7.267  1.00 0.00 ? 51  MET A O    5  
ATOM 8203  C CB   . MET A 1 51  ? 4.597   -9.697  -9.258  1.00 0.00 ? 51  MET A CB   5  
ATOM 8204  C CG   . MET A 1 51  ? 3.198   -9.835  -8.680  1.00 0.00 ? 51  MET A CG   5  
ATOM 8205  S SD   . MET A 1 51  ? 1.960   -8.937  -9.636  1.00 0.00 ? 51  MET A SD   5  
ATOM 8206  C CE   . MET A 1 51  ? 2.061   -9.790  -11.208 1.00 0.00 ? 51  MET A CE   5  
ATOM 8207  H H    . MET A 1 51  ? 6.894   -8.974  -10.141 1.00 0.00 ? 51  MET A H    5  
ATOM 8208  H HA   . MET A 1 51  ? 4.255   -7.839  -10.263 1.00 0.00 ? 51  MET A HA   5  
ATOM 8209  H HB2  . MET A 1 51  ? 4.649   -10.284 -10.163 1.00 0.00 ? 51  MET A HB2  5  
ATOM 8210  H HB3  . MET A 1 51  ? 5.299   -10.093 -8.540  1.00 0.00 ? 51  MET A HB3  5  
ATOM 8211  H HG2  . MET A 1 51  ? 2.930   -10.881 -8.666  1.00 0.00 ? 51  MET A HG2  5  
ATOM 8212  H HG3  . MET A 1 51  ? 3.201   -9.452  -7.671  1.00 0.00 ? 51  MET A HG3  5  
ATOM 8213  H HE1  . MET A 1 51  ? 1.856   -10.840 -11.061 1.00 0.00 ? 51  MET A HE1  5  
ATOM 8214  H HE2  . MET A 1 51  ? 1.336   -9.373  -11.890 1.00 0.00 ? 51  MET A HE2  5  
ATOM 8215  H HE3  . MET A 1 51  ? 3.053   -9.671  -11.618 1.00 0.00 ? 51  MET A HE3  5  
ATOM 8216  N N    . SER A 1 52  ? 4.463   -6.204  -8.393  1.00 0.00 ? 52  SER A N    5  
ATOM 8217  C CA   . SER A 1 52  ? 4.417   -5.305  -7.246  1.00 0.00 ? 52  SER A CA   5  
ATOM 8218  C C    . SER A 1 52  ? 3.475   -4.135  -7.510  1.00 0.00 ? 52  SER A C    5  
ATOM 8219  O O    . SER A 1 52  ? 3.278   -3.728  -8.655  1.00 0.00 ? 52  SER A O    5  
ATOM 8220  C CB   . SER A 1 52  ? 5.819   -4.783  -6.924  1.00 0.00 ? 52  SER A CB   5  
ATOM 8221  O OG   . SER A 1 52  ? 6.604   -4.674  -8.099  1.00 0.00 ? 52  SER A OG   5  
ATOM 8222  H H    . SER A 1 52  ? 4.092   -5.905  -9.250  1.00 0.00 ? 52  SER A H    5  
ATOM 8223  H HA   . SER A 1 52  ? 4.048   -5.866  -6.400  1.00 0.00 ? 52  SER A HA   5  
ATOM 8224  H HB2  . SER A 1 52  ? 5.741   -3.810  -6.465  1.00 0.00 ? 52  SER A HB2  5  
ATOM 8225  H HB3  . SER A 1 52  ? 6.306   -5.465  -6.242  1.00 0.00 ? 52  SER A HB3  5  
ATOM 8226  H HG   . SER A 1 52  ? 6.308   -5.321  -8.743  1.00 0.00 ? 52  SER A HG   5  
ATOM 8227  N N    . ILE A 1 53  ? 2.894   -3.598  -6.442  1.00 0.00 ? 53  ILE A N    5  
ATOM 8228  C CA   . ILE A 1 53  ? 1.974   -2.474  -6.557  1.00 0.00 ? 53  ILE A CA   5  
ATOM 8229  C C    . ILE A 1 53  ? 2.589   -1.199  -5.991  1.00 0.00 ? 53  ILE A C    5  
ATOM 8230  O O    . ILE A 1 53  ? 3.187   -1.210  -4.915  1.00 0.00 ? 53  ILE A O    5  
ATOM 8231  C CB   . ILE A 1 53  ? 0.646   -2.757  -5.829  1.00 0.00 ? 53  ILE A CB   5  
ATOM 8232  C CG1  . ILE A 1 53  ? -0.026  -4.002  -6.412  1.00 0.00 ? 53  ILE A CG1  5  
ATOM 8233  C CG2  . ILE A 1 53  ? -0.279  -1.554  -5.927  1.00 0.00 ? 53  ILE A CG2  5  
ATOM 8234  C CD1  . ILE A 1 53  ? -1.115  -4.570  -5.530  1.00 0.00 ? 53  ILE A CD1  5  
ATOM 8235  H H    . ILE A 1 53  ? 3.091   -3.966  -5.555  1.00 0.00 ? 53  ILE A H    5  
ATOM 8236  H HA   . ILE A 1 53  ? 1.761   -2.324  -7.605  1.00 0.00 ? 53  ILE A HA   5  
ATOM 8237  H HB   . ILE A 1 53  ? 0.863   -2.930  -4.786  1.00 0.00 ? 53  ILE A HB   5  
ATOM 8238  H HG12 . ILE A 1 53  ? -0.467  -3.752  -7.364  1.00 0.00 ? 53  ILE A HG12 5  
ATOM 8239  H HG13 . ILE A 1 53  ? 0.720   -4.770  -6.556  1.00 0.00 ? 53  ILE A HG13 5  
ATOM 8240  H HG21 . ILE A 1 53  ? -0.281  -1.023  -4.987  1.00 0.00 ? 53  ILE A HG21 5  
ATOM 8241  H HG22 . ILE A 1 53  ? 0.069   -0.896  -6.709  1.00 0.00 ? 53  ILE A HG22 5  
ATOM 8242  H HG23 . ILE A 1 53  ? -1.280  -1.887  -6.156  1.00 0.00 ? 53  ILE A HG23 5  
ATOM 8243  H HD11 . ILE A 1 53  ? -1.927  -3.862  -5.459  1.00 0.00 ? 53  ILE A HD11 5  
ATOM 8244  H HD12 . ILE A 1 53  ? -1.477  -5.494  -5.954  1.00 0.00 ? 53  ILE A HD12 5  
ATOM 8245  H HD13 . ILE A 1 53  ? -0.717  -4.760  -4.543  1.00 0.00 ? 53  ILE A HD13 5  
ATOM 8246  N N    . PHE A 1 54  ? 2.437   -0.100  -6.722  1.00 0.00 ? 54  PHE A N    5  
ATOM 8247  C CA   . PHE A 1 54  ? 2.977   1.185   -6.293  1.00 0.00 ? 54  PHE A CA   5  
ATOM 8248  C C    . PHE A 1 54  ? 1.887   2.253   -6.272  1.00 0.00 ? 54  PHE A C    5  
ATOM 8249  O O    . PHE A 1 54  ? 0.806   2.064   -6.830  1.00 0.00 ? 54  PHE A O    5  
ATOM 8250  C CB   . PHE A 1 54  ? 4.115   1.619   -7.220  1.00 0.00 ? 54  PHE A CB   5  
ATOM 8251  C CG   . PHE A 1 54  ? 5.393   0.863   -6.993  1.00 0.00 ? 54  PHE A CG   5  
ATOM 8252  C CD1  . PHE A 1 54  ? 6.326   1.314   -6.074  1.00 0.00 ? 54  PHE A CD1  5  
ATOM 8253  C CD2  . PHE A 1 54  ? 5.661   -0.298  -7.700  1.00 0.00 ? 54  PHE A CD2  5  
ATOM 8254  C CE1  . PHE A 1 54  ? 7.504   0.621   -5.863  1.00 0.00 ? 54  PHE A CE1  5  
ATOM 8255  C CE2  . PHE A 1 54  ? 6.836   -0.996  -7.493  1.00 0.00 ? 54  PHE A CE2  5  
ATOM 8256  C CZ   . PHE A 1 54  ? 7.759   -0.535  -6.575  1.00 0.00 ? 54  PHE A CZ   5  
ATOM 8257  H H    . PHE A 1 54  ? 1.950   -0.155  -7.571  1.00 0.00 ? 54  PHE A H    5  
ATOM 8258  H HA   . PHE A 1 54  ? 3.364   1.063   -5.294  1.00 0.00 ? 54  PHE A HA   5  
ATOM 8259  H HB2  . PHE A 1 54  ? 3.814   1.462   -8.245  1.00 0.00 ? 54  PHE A HB2  5  
ATOM 8260  H HB3  . PHE A 1 54  ? 4.316   2.668   -7.064  1.00 0.00 ? 54  PHE A HB3  5  
ATOM 8261  H HD1  . PHE A 1 54  ? 6.127   2.219   -5.517  1.00 0.00 ? 54  PHE A HD1  5  
ATOM 8262  H HD2  . PHE A 1 54  ? 4.941   -0.659  -8.420  1.00 0.00 ? 54  PHE A HD2  5  
ATOM 8263  H HE1  . PHE A 1 54  ? 8.223   0.984   -5.144  1.00 0.00 ? 54  PHE A HE1  5  
ATOM 8264  H HE2  . PHE A 1 54  ? 7.034   -1.899  -8.051  1.00 0.00 ? 54  PHE A HE2  5  
ATOM 8265  H HZ   . PHE A 1 54  ? 8.678   -1.078  -6.411  1.00 0.00 ? 54  PHE A HZ   5  
ATOM 8266  N N    . VAL A 1 55  ? 2.180   3.376   -5.624  1.00 0.00 ? 55  VAL A N    5  
ATOM 8267  C CA   . VAL A 1 55  ? 1.227   4.475   -5.530  1.00 0.00 ? 55  VAL A CA   5  
ATOM 8268  C C    . VAL A 1 55  ? 1.619   5.623   -6.455  1.00 0.00 ? 55  VAL A C    5  
ATOM 8269  O O    . VAL A 1 55  ? 2.551   6.374   -6.169  1.00 0.00 ? 55  VAL A O    5  
ATOM 8270  C CB   . VAL A 1 55  ? 1.123   5.006   -4.088  1.00 0.00 ? 55  VAL A CB   5  
ATOM 8271  C CG1  . VAL A 1 55  ? 0.167   6.187   -4.022  1.00 0.00 ? 55  VAL A CG1  5  
ATOM 8272  C CG2  . VAL A 1 55  ? 0.681   3.898   -3.144  1.00 0.00 ? 55  VAL A CG2  5  
ATOM 8273  H H    . VAL A 1 55  ? 3.059   3.468   -5.200  1.00 0.00 ? 55  VAL A H    5  
ATOM 8274  H HA   . VAL A 1 55  ? 0.257   4.103   -5.826  1.00 0.00 ? 55  VAL A HA   5  
ATOM 8275  H HB   . VAL A 1 55  ? 2.101   5.345   -3.779  1.00 0.00 ? 55  VAL A HB   5  
ATOM 8276  H HG11 . VAL A 1 55  ? 0.731   7.099   -3.891  1.00 0.00 ? 55  VAL A HG11 5  
ATOM 8277  H HG12 . VAL A 1 55  ? -0.402  6.242   -4.938  1.00 0.00 ? 55  VAL A HG12 5  
ATOM 8278  H HG13 . VAL A 1 55  ? -0.506  6.059   -3.186  1.00 0.00 ? 55  VAL A HG13 5  
ATOM 8279  H HG21 . VAL A 1 55  ? -0.372  4.006   -2.931  1.00 0.00 ? 55  VAL A HG21 5  
ATOM 8280  H HG22 . VAL A 1 55  ? 0.857   2.938   -3.608  1.00 0.00 ? 55  VAL A HG22 5  
ATOM 8281  H HG23 . VAL A 1 55  ? 1.243   3.962   -2.225  1.00 0.00 ? 55  VAL A HG23 5  
ATOM 8282  N N    . VAL A 1 56  ? 0.900   5.753   -7.565  1.00 0.00 ? 56  VAL A N    5  
ATOM 8283  C CA   . VAL A 1 56  ? 1.171   6.810   -8.532  1.00 0.00 ? 56  VAL A CA   5  
ATOM 8284  C C    . VAL A 1 56  ? 0.133   7.922   -8.435  1.00 0.00 ? 56  VAL A C    5  
ATOM 8285  O O    . VAL A 1 56  ? -0.050  8.698   -9.372  1.00 0.00 ? 56  VAL A O    5  
ATOM 8286  C CB   . VAL A 1 56  ? 1.187   6.263   -9.972  1.00 0.00 ? 56  VAL A CB   5  
ATOM 8287  C CG1  . VAL A 1 56  ? 2.108   5.056   -10.075 1.00 0.00 ? 56  VAL A CG1  5  
ATOM 8288  C CG2  . VAL A 1 56  ? -0.222  5.908   -10.423 1.00 0.00 ? 56  VAL A CG2  5  
ATOM 8289  H H    . VAL A 1 56  ? 0.169   5.123   -7.738  1.00 0.00 ? 56  VAL A H    5  
ATOM 8290  H HA   . VAL A 1 56  ? 2.146   7.220   -8.314  1.00 0.00 ? 56  VAL A HA   5  
ATOM 8291  H HB   . VAL A 1 56  ? 1.568   7.034   -10.625 1.00 0.00 ? 56  VAL A HB   5  
ATOM 8292  H HG11 . VAL A 1 56  ? 2.284   4.653   -9.088  1.00 0.00 ? 56  VAL A HG11 5  
ATOM 8293  H HG12 . VAL A 1 56  ? 1.647   4.303   -10.696 1.00 0.00 ? 56  VAL A HG12 5  
ATOM 8294  H HG13 . VAL A 1 56  ? 3.048   5.358   -10.512 1.00 0.00 ? 56  VAL A HG13 5  
ATOM 8295  H HG21 . VAL A 1 56  ? -0.297  4.840   -10.561 1.00 0.00 ? 56  VAL A HG21 5  
ATOM 8296  H HG22 . VAL A 1 56  ? -0.931  6.224   -9.671  1.00 0.00 ? 56  VAL A HG22 5  
ATOM 8297  H HG23 . VAL A 1 56  ? -0.439  6.408   -11.355 1.00 0.00 ? 56  VAL A HG23 5  
ATOM 8298  N N    . GLY A 1 57  ? -0.544  7.995   -7.293  1.00 0.00 ? 57  GLY A N    5  
ATOM 8299  C CA   . GLY A 1 57  ? -1.555  9.016   -7.094  1.00 0.00 ? 57  GLY A CA   5  
ATOM 8300  C C    . GLY A 1 57  ? -2.369  8.788   -5.835  1.00 0.00 ? 57  GLY A C    5  
ATOM 8301  O O    . GLY A 1 57  ? -2.534  7.651   -5.392  1.00 0.00 ? 57  GLY A O    5  
ATOM 8302  H H    . GLY A 1 57  ? -0.355  7.349   -6.580  1.00 0.00 ? 57  GLY A H    5  
ATOM 8303  H HA2  . GLY A 1 57  ? -1.070  9.979   -7.027  1.00 0.00 ? 57  GLY A HA2  5  
ATOM 8304  H HA3  . GLY A 1 57  ? -2.221  9.018   -7.944  1.00 0.00 ? 57  GLY A HA3  5  
ATOM 8305  N N    . ILE A 1 58  ? -2.879  9.871   -5.258  1.00 0.00 ? 58  ILE A N    5  
ATOM 8306  C CA   . ILE A 1 58  ? -3.680  9.783   -4.043  1.00 0.00 ? 58  ILE A CA   5  
ATOM 8307  C C    . ILE A 1 58  ? -4.920  10.666  -4.137  1.00 0.00 ? 58  ILE A C    5  
ATOM 8308  O O    . ILE A 1 58  ? -4.823  11.892  -4.125  1.00 0.00 ? 58  ILE A O    5  
ATOM 8309  C CB   . ILE A 1 58  ? -2.865  10.192  -2.802  1.00 0.00 ? 58  ILE A CB   5  
ATOM 8310  C CG1  . ILE A 1 58  ? -1.731  9.194   -2.558  1.00 0.00 ? 58  ILE A CG1  5  
ATOM 8311  C CG2  . ILE A 1 58  ? -3.770  10.282  -1.582  1.00 0.00 ? 58  ILE A CG2  5  
ATOM 8312  C CD1  . ILE A 1 58  ? -0.720  9.666   -1.536  1.00 0.00 ? 58  ILE A CD1  5  
ATOM 8313  H H    . ILE A 1 58  ? -2.713  10.750  -5.659  1.00 0.00 ? 58  ILE A H    5  
ATOM 8314  H HA   . ILE A 1 58  ? -3.991  8.756   -3.923  1.00 0.00 ? 58  ILE A HA   5  
ATOM 8315  H HB   . ILE A 1 58  ? -2.443  11.169  -2.981  1.00 0.00 ? 58  ILE A HB   5  
ATOM 8316  H HG12 . ILE A 1 58  ? -2.148  8.264   -2.205  1.00 0.00 ? 58  ILE A HG12 5  
ATOM 8317  H HG13 . ILE A 1 58  ? -1.209  9.020   -3.487  1.00 0.00 ? 58  ILE A HG13 5  
ATOM 8318  H HG21 . ILE A 1 58  ? -4.181  9.308   -1.365  1.00 0.00 ? 58  ILE A HG21 5  
ATOM 8319  H HG22 . ILE A 1 58  ? -3.196  10.626  -0.734  1.00 0.00 ? 58  ILE A HG22 5  
ATOM 8320  H HG23 . ILE A 1 58  ? -4.573  10.976  -1.779  1.00 0.00 ? 58  ILE A HG23 5  
ATOM 8321  H HD11 . ILE A 1 58  ? 0.251   9.748   -2.002  1.00 0.00 ? 58  ILE A HD11 5  
ATOM 8322  H HD12 . ILE A 1 58  ? -1.019  10.629  -1.152  1.00 0.00 ? 58  ILE A HD12 5  
ATOM 8323  H HD13 . ILE A 1 58  ? -0.670  8.954   -0.725  1.00 0.00 ? 58  ILE A HD13 5  
ATOM 8324  N N    . ASN A 1 59  ? -6.085  10.033  -4.229  1.00 0.00 ? 59  ASN A N    5  
ATOM 8325  C CA   . ASN A 1 59  ? -7.345  10.761  -4.324  1.00 0.00 ? 59  ASN A CA   5  
ATOM 8326  C C    . ASN A 1 59  ? -7.408  11.876  -3.284  1.00 0.00 ? 59  ASN A C    5  
ATOM 8327  O O    . ASN A 1 59  ? -7.295  11.643  -2.080  1.00 0.00 ? 59  ASN A O    5  
ATOM 8328  C CB   . ASN A 1 59  ? -8.525  9.806   -4.136  1.00 0.00 ? 59  ASN A CB   5  
ATOM 8329  C CG   . ASN A 1 59  ? -9.790  10.312  -4.802  1.00 0.00 ? 59  ASN A CG   5  
ATOM 8330  O OD1  . ASN A 1 59  ? -10.681 10.846  -4.142  1.00 0.00 ? 59  ASN A OD1  5  
ATOM 8331  N ND2  . ASN A 1 59  ? -9.873  10.145  -6.117  1.00 0.00 ? 59  ASN A ND2  5  
ATOM 8332  H H    . ASN A 1 59  ? -6.097  9.053   -4.234  1.00 0.00 ? 59  ASN A H    5  
ATOM 8333  H HA   . ASN A 1 59  ? -7.401  11.200  -5.309  1.00 0.00 ? 59  ASN A HA   5  
ATOM 8334  H HB2  . ASN A 1 59  ? -8.275  8.846   -4.565  1.00 0.00 ? 59  ASN A HB2  5  
ATOM 8335  H HB3  . ASN A 1 59  ? -8.719  9.685   -3.081  1.00 0.00 ? 59  ASN A HB3  5  
ATOM 8336  H HD21 . ASN A 1 59  ? -9.125  9.712   -6.578  1.00 0.00 ? 59  ASN A HD21 5  
ATOM 8337  H HD22 . ASN A 1 59  ? -10.680 10.464  -6.573  1.00 0.00 ? 59  ASN A HD22 5  
ATOM 8338  N N    . PRO A 1 60  ? -7.594  13.117  -3.758  1.00 0.00 ? 60  PRO A N    5  
ATOM 8339  C CA   . PRO A 1 60  ? -7.678  14.292  -2.886  1.00 0.00 ? 60  PRO A CA   5  
ATOM 8340  C C    . PRO A 1 60  ? -8.959  14.311  -2.059  1.00 0.00 ? 60  PRO A C    5  
ATOM 8341  O O    . PRO A 1 60  ? -9.134  15.163  -1.189  1.00 0.00 ? 60  PRO A O    5  
ATOM 8342  C CB   . PRO A 1 60  ? -7.660  15.465  -3.869  1.00 0.00 ? 60  PRO A CB   5  
ATOM 8343  C CG   . PRO A 1 60  ? -8.191  14.901  -5.142  1.00 0.00 ? 60  PRO A CG   5  
ATOM 8344  C CD   . PRO A 1 60  ? -7.737  13.468  -5.181  1.00 0.00 ? 60  PRO A CD   5  
ATOM 8345  H HA   . PRO A 1 60  ? -6.825  14.360  -2.227  1.00 0.00 ? 60  PRO A HA   5  
ATOM 8346  H HB2  . PRO A 1 60  ? -8.289  16.261  -3.496  1.00 0.00 ? 60  PRO A HB2  5  
ATOM 8347  H HB3  . PRO A 1 60  ? -6.649  15.824  -3.989  1.00 0.00 ? 60  PRO A HB3  5  
ATOM 8348  H HG2  . PRO A 1 60  ? -9.269  14.953  -5.145  1.00 0.00 ? 60  PRO A HG2  5  
ATOM 8349  H HG3  . PRO A 1 60  ? -7.785  15.445  -5.982  1.00 0.00 ? 60  PRO A HG3  5  
ATOM 8350  H HD2  . PRO A 1 60  ? -8.483  12.849  -5.657  1.00 0.00 ? 60  PRO A HD2  5  
ATOM 8351  H HD3  . PRO A 1 60  ? -6.791  13.386  -5.694  1.00 0.00 ? 60  PRO A HD3  5  
ATOM 8352  N N    . GLU A 1 61  ? -9.851  13.365  -2.337  1.00 0.00 ? 61  GLU A N    5  
ATOM 8353  C CA   . GLU A 1 61  ? -11.117 13.274  -1.618  1.00 0.00 ? 61  GLU A CA   5  
ATOM 8354  C C    . GLU A 1 61  ? -11.094 12.119  -0.621  1.00 0.00 ? 61  GLU A C    5  
ATOM 8355  O O    . GLU A 1 61  ? -11.864 12.097  0.338   1.00 0.00 ? 61  GLU A O    5  
ATOM 8356  C CB   . GLU A 1 61  ? -12.275 13.091  -2.600  1.00 0.00 ? 61  GLU A CB   5  
ATOM 8357  C CG   . GLU A 1 61  ? -12.296 14.123  -3.716  1.00 0.00 ? 61  GLU A CG   5  
ATOM 8358  C CD   . GLU A 1 61  ? -13.029 13.634  -4.949  1.00 0.00 ? 61  GLU A CD   5  
ATOM 8359  O OE1  . GLU A 1 61  ? -12.656 12.566  -5.478  1.00 0.00 ? 61  GLU A OE1  5  
ATOM 8360  O OE2  . GLU A 1 61  ? -13.978 14.319  -5.386  1.00 0.00 ? 61  GLU A OE2  5  
ATOM 8361  H H    . GLU A 1 61  ? -9.654  12.714  -3.042  1.00 0.00 ? 61  GLU A H    5  
ATOM 8362  H HA   . GLU A 1 61  ? -11.258 14.197  -1.077  1.00 0.00 ? 61  GLU A HA   5  
ATOM 8363  H HB2  . GLU A 1 61  ? -12.202 12.110  -3.046  1.00 0.00 ? 61  GLU A HB2  5  
ATOM 8364  H HB3  . GLU A 1 61  ? -13.206 13.161  -2.057  1.00 0.00 ? 61  GLU A HB3  5  
ATOM 8365  H HG2  . GLU A 1 61  ? -12.785 15.015  -3.355  1.00 0.00 ? 61  GLU A HG2  5  
ATOM 8366  H HG3  . GLU A 1 61  ? -11.278 14.358  -3.990  1.00 0.00 ? 61  GLU A HG3  5  
ATOM 8367  N N    . GLY A 1 62  ? -10.204 11.159  -0.856  1.00 0.00 ? 62  GLY A N    5  
ATOM 8368  C CA   . GLY A 1 62  ? -10.098 10.013  0.028   1.00 0.00 ? 62  GLY A CA   5  
ATOM 8369  C C    . GLY A 1 62  ? -9.379  10.344  1.321   1.00 0.00 ? 62  GLY A C    5  
ATOM 8370  O O    . GLY A 1 62  ? -8.885  11.455  1.515   1.00 0.00 ? 62  GLY A O    5  
ATOM 8371  H H    . GLY A 1 62  ? -9.616  11.229  -1.637  1.00 0.00 ? 62  GLY A H    5  
ATOM 8372  H HA2  . GLY A 1 62  ? -11.090 9.658   0.261   1.00 0.00 ? 62  GLY A HA2  5  
ATOM 8373  H HA3  . GLY A 1 62  ? -9.556  9.229   -0.481  1.00 0.00 ? 62  GLY A HA3  5  
ATOM 8374  N N    . PRO A 1 63  ? -9.315  9.364   2.235   1.00 0.00 ? 63  PRO A N    5  
ATOM 8375  C CA   . PRO A 1 63  ? -8.654  9.533   3.532   1.00 0.00 ? 63  PRO A CA   5  
ATOM 8376  C C    . PRO A 1 63  ? -7.139  9.644   3.401   1.00 0.00 ? 63  PRO A C    5  
ATOM 8377  O O    . PRO A 1 63  ? -6.496  10.387  4.142   1.00 0.00 ? 63  PRO A O    5  
ATOM 8378  C CB   . PRO A 1 63  ? -9.034  8.259   4.292   1.00 0.00 ? 63  PRO A CB   5  
ATOM 8379  C CG   . PRO A 1 63  ? -9.303  7.250   3.229   1.00 0.00 ? 63  PRO A CG   5  
ATOM 8380  C CD   . PRO A 1 63  ? -9.881  8.014   2.070   1.00 0.00 ? 63  PRO A CD   5  
ATOM 8381  H HA   . PRO A 1 63  ? -9.033  10.395  4.061   1.00 0.00 ? 63  PRO A HA   5  
ATOM 8382  H HB2  . PRO A 1 63  ? -8.212  7.957   4.925   1.00 0.00 ? 63  PRO A HB2  5  
ATOM 8383  H HB3  . PRO A 1 63  ? -9.911  8.442   4.894   1.00 0.00 ? 63  PRO A HB3  5  
ATOM 8384  H HG2  . PRO A 1 63  ? -8.383  6.768   2.939   1.00 0.00 ? 63  PRO A HG2  5  
ATOM 8385  H HG3  . PRO A 1 63  ? -10.014 6.521   3.588   1.00 0.00 ? 63  PRO A HG3  5  
ATOM 8386  H HD2  . PRO A 1 63  ? -9.567  7.576   1.135   1.00 0.00 ? 63  PRO A HD2  5  
ATOM 8387  H HD3  . PRO A 1 63  ? -10.959 8.039   2.135   1.00 0.00 ? 63  PRO A HD3  5  
ATOM 8388  N N    . ALA A 1 64  ? -6.575  8.901   2.455   1.00 0.00 ? 64  ALA A N    5  
ATOM 8389  C CA   . ALA A 1 64  ? -5.136  8.918   2.226   1.00 0.00 ? 64  ALA A CA   5  
ATOM 8390  C C    . ALA A 1 64  ? -4.627  10.343  2.038   1.00 0.00 ? 64  ALA A C    5  
ATOM 8391  O O    . ALA A 1 64  ? -3.487  10.655  2.380   1.00 0.00 ? 64  ALA A O    5  
ATOM 8392  C CB   . ALA A 1 64  ? -4.784  8.066   1.015   1.00 0.00 ? 64  ALA A CB   5  
ATOM 8393  H H    . ALA A 1 64  ? -7.141  8.328   1.896   1.00 0.00 ? 64  ALA A H    5  
ATOM 8394  H HA   . ALA A 1 64  ? -4.655  8.486   3.092   1.00 0.00 ? 64  ALA A HA   5  
ATOM 8395  H HB1  . ALA A 1 64  ? -5.461  8.295   0.206   1.00 0.00 ? 64  ALA A HB1  5  
ATOM 8396  H HB2  . ALA A 1 64  ? -3.771  8.279   0.709   1.00 0.00 ? 64  ALA A HB2  5  
ATOM 8397  H HB3  . ALA A 1 64  ? -4.871  7.021   1.273   1.00 0.00 ? 64  ALA A HB3  5  
ATOM 8398  N N    . ALA A 1 65  ? -5.480  11.204  1.493   1.00 0.00 ? 65  ALA A N    5  
ATOM 8399  C CA   . ALA A 1 65  ? -5.117  12.597  1.261   1.00 0.00 ? 65  ALA A CA   5  
ATOM 8400  C C    . ALA A 1 65  ? -5.383  13.447  2.499   1.00 0.00 ? 65  ALA A C    5  
ATOM 8401  O O    . ALA A 1 65  ? -4.634  14.377  2.797   1.00 0.00 ? 65  ALA A O    5  
ATOM 8402  C CB   . ALA A 1 65  ? -5.879  13.149  0.065   1.00 0.00 ? 65  ALA A CB   5  
ATOM 8403  H H    . ALA A 1 65  ? -6.375  10.896  1.242   1.00 0.00 ? 65  ALA A H    5  
ATOM 8404  H HA   . ALA A 1 65  ? -4.061  12.633  1.032   1.00 0.00 ? 65  ALA A HA   5  
ATOM 8405  H HB1  . ALA A 1 65  ? -6.814  12.619  -0.040  1.00 0.00 ? 65  ALA A HB1  5  
ATOM 8406  H HB2  . ALA A 1 65  ? -6.075  14.200  0.218   1.00 0.00 ? 65  ALA A HB2  5  
ATOM 8407  H HB3  . ALA A 1 65  ? -5.288  13.019  -0.829  1.00 0.00 ? 65  ALA A HB3  5  
ATOM 8408  N N    . ALA A 1 66  ? -6.453  13.121  3.216   1.00 0.00 ? 66  ALA A N    5  
ATOM 8409  C CA   . ALA A 1 66  ? -6.817  13.854  4.422   1.00 0.00 ? 66  ALA A CA   5  
ATOM 8410  C C    . ALA A 1 66  ? -5.778  13.654  5.520   1.00 0.00 ? 66  ALA A C    5  
ATOM 8411  O O    . ALA A 1 66  ? -5.256  14.620  6.078   1.00 0.00 ? 66  ALA A O    5  
ATOM 8412  C CB   . ALA A 1 66  ? -8.192  13.421  4.908   1.00 0.00 ? 66  ALA A CB   5  
ATOM 8413  H H    . ALA A 1 66  ? -7.011  12.369  2.927   1.00 0.00 ? 66  ALA A H    5  
ATOM 8414  H HA   . ALA A 1 66  ? -6.865  14.905  4.172   1.00 0.00 ? 66  ALA A HA   5  
ATOM 8415  H HB1  . ALA A 1 66  ? -8.086  12.837  5.811   1.00 0.00 ? 66  ALA A HB1  5  
ATOM 8416  H HB2  . ALA A 1 66  ? -8.793  14.295  5.113   1.00 0.00 ? 66  ALA A HB2  5  
ATOM 8417  H HB3  . ALA A 1 66  ? -8.671  12.824  4.147   1.00 0.00 ? 66  ALA A HB3  5  
ATOM 8418  N N    . ASP A 1 67  ? -5.483  12.396  5.826   1.00 0.00 ? 67  ASP A N    5  
ATOM 8419  C CA   . ASP A 1 67  ? -4.505  12.069  6.858   1.00 0.00 ? 67  ASP A CA   5  
ATOM 8420  C C    . ASP A 1 67  ? -3.164  12.733  6.565   1.00 0.00 ? 67  ASP A C    5  
ATOM 8421  O O    . ASP A 1 67  ? -2.448  13.139  7.480   1.00 0.00 ? 67  ASP A O    5  
ATOM 8422  C CB   . ASP A 1 67  ? -4.327  10.553  6.959   1.00 0.00 ? 67  ASP A CB   5  
ATOM 8423  C CG   . ASP A 1 67  ? -3.805  10.122  8.316   1.00 0.00 ? 67  ASP A CG   5  
ATOM 8424  O OD1  . ASP A 1 67  ? -3.729  10.977  9.223   1.00 0.00 ? 67  ASP A OD1  5  
ATOM 8425  O OD2  . ASP A 1 67  ? -3.473  8.928   8.471   1.00 0.00 ? 67  ASP A OD2  5  
ATOM 8426  H H    . ASP A 1 67  ? -5.932  11.669  5.346   1.00 0.00 ? 67  ASP A H    5  
ATOM 8427  H HA   . ASP A 1 67  ? -4.880  12.442  7.799   1.00 0.00 ? 67  ASP A HA   5  
ATOM 8428  H HB2  . ASP A 1 67  ? -5.280  10.073  6.792   1.00 0.00 ? 67  ASP A HB2  5  
ATOM 8429  H HB3  . ASP A 1 67  ? -3.626  10.229  6.204   1.00 0.00 ? 67  ASP A HB3  5  
ATOM 8430  N N    . GLY A 1 68  ? -2.829  12.840  5.283   1.00 0.00 ? 68  GLY A N    5  
ATOM 8431  C CA   . GLY A 1 68  ? -1.573  13.454  4.893   1.00 0.00 ? 68  GLY A CA   5  
ATOM 8432  C C    . GLY A 1 68  ? -0.372  12.615  5.279   1.00 0.00 ? 68  GLY A C    5  
ATOM 8433  O O    . GLY A 1 68  ? 0.633   13.140  5.758   1.00 0.00 ? 68  GLY A O    5  
ATOM 8434  H H    . GLY A 1 68  ? -3.439  12.498  4.596   1.00 0.00 ? 68  GLY A H    5  
ATOM 8435  H HA2  . GLY A 1 68  ? -1.571  13.596  3.822   1.00 0.00 ? 68  GLY A HA2  5  
ATOM 8436  H HA3  . GLY A 1 68  ? -1.493  14.419  5.373   1.00 0.00 ? 68  GLY A HA3  5  
ATOM 8437  N N    . ARG A 1 69  ? -0.476  11.306  5.073   1.00 0.00 ? 69  ARG A N    5  
ATOM 8438  C CA   . ARG A 1 69  ? 0.610   10.392  5.406   1.00 0.00 ? 69  ARG A CA   5  
ATOM 8439  C C    . ARG A 1 69  ? 1.126   9.683   4.157   1.00 0.00 ? 69  ARG A C    5  
ATOM 8440  O O    . ARG A 1 69  ? 2.307   9.775   3.823   1.00 0.00 ? 69  ARG A O    5  
ATOM 8441  C CB   . ARG A 1 69  ? 0.139   9.360   6.433   1.00 0.00 ? 69  ARG A CB   5  
ATOM 8442  C CG   . ARG A 1 69  ? -0.325  9.973   7.743   1.00 0.00 ? 69  ARG A CG   5  
ATOM 8443  C CD   . ARG A 1 69  ? 0.833   10.166  8.710   1.00 0.00 ? 69  ARG A CD   5  
ATOM 8444  N NE   . ARG A 1 69  ? 1.483   11.462  8.535   1.00 0.00 ? 69  ARG A NE   5  
ATOM 8445  C CZ   . ARG A 1 69  ? 2.277   12.015  9.445   1.00 0.00 ? 69  ARG A CZ   5  
ATOM 8446  N NH1  . ARG A 1 69  ? 2.518   11.388  10.588  1.00 0.00 ? 69  ARG A NH1  5  
ATOM 8447  N NH2  . ARG A 1 69  ? 2.832   13.198  9.212   1.00 0.00 ? 69  ARG A NH2  5  
ATOM 8448  H H    . ARG A 1 69  ? -1.302  10.946  4.688   1.00 0.00 ? 69  ARG A H    5  
ATOM 8449  H HA   . ARG A 1 69  ? 1.413   10.972  5.834   1.00 0.00 ? 69  ARG A HA   5  
ATOM 8450  H HB2  . ARG A 1 69  ? -0.683  8.799   6.012   1.00 0.00 ? 69  ARG A HB2  5  
ATOM 8451  H HB3  . ARG A 1 69  ? 0.954   8.684   6.645   1.00 0.00 ? 69  ARG A HB3  5  
ATOM 8452  H HG2  . ARG A 1 69  ? -0.774  10.935  7.541   1.00 0.00 ? 69  ARG A HG2  5  
ATOM 8453  H HG3  . ARG A 1 69  ? -1.057  9.320   8.196   1.00 0.00 ? 69  ARG A HG3  5  
ATOM 8454  H HD2  . ARG A 1 69  ? 0.457   10.096  9.720   1.00 0.00 ? 69  ARG A HD2  5  
ATOM 8455  H HD3  . ARG A 1 69  ? 1.558   9.384   8.542   1.00 0.00 ? 69  ARG A HD3  5  
ATOM 8456  H HE   . ARG A 1 69  ? 1.318   11.942  7.697   1.00 0.00 ? 69  ARG A HE   5  
ATOM 8457  H HH11 . ARG A 1 69  ? 2.102   10.497  10.766  1.00 0.00 ? 69  ARG A HH11 5  
ATOM 8458  H HH12 . ARG A 1 69  ? 3.117   11.807  11.271  1.00 0.00 ? 69  ARG A HH12 5  
ATOM 8459  H HH21 . ARG A 1 69  ? 2.652   13.673  8.351   1.00 0.00 ? 69  ARG A HH21 5  
ATOM 8460  H HH22 . ARG A 1 69  ? 3.429   13.613  9.897   1.00 0.00 ? 69  ARG A HH22 5  
ATOM 8461  N N    . MET A 1 70  ? 0.233   8.976   3.472   1.00 0.00 ? 70  MET A N    5  
ATOM 8462  C CA   . MET A 1 70  ? 0.599   8.252   2.260   1.00 0.00 ? 70  MET A CA   5  
ATOM 8463  C C    . MET A 1 70  ? 1.098   9.211   1.184   1.00 0.00 ? 70  MET A C    5  
ATOM 8464  O O    . MET A 1 70  ? 0.668   10.363  1.118   1.00 0.00 ? 70  MET A O    5  
ATOM 8465  C CB   . MET A 1 70  ? -0.598  7.457   1.735   1.00 0.00 ? 70  MET A CB   5  
ATOM 8466  C CG   . MET A 1 70  ? -0.678  6.043   2.289   1.00 0.00 ? 70  MET A CG   5  
ATOM 8467  S SD   . MET A 1 70  ? -1.446  4.888   1.137   1.00 0.00 ? 70  MET A SD   5  
ATOM 8468  C CE   . MET A 1 70  ? -0.018  4.342   0.204   1.00 0.00 ? 70  MET A CE   5  
ATOM 8469  H H    . MET A 1 70  ? -0.694  8.940   3.789   1.00 0.00 ? 70  MET A H    5  
ATOM 8470  H HA   . MET A 1 70  ? 1.394   7.566   2.511   1.00 0.00 ? 70  MET A HA   5  
ATOM 8471  H HB2  . MET A 1 70  ? -1.506  7.977   2.001   1.00 0.00 ? 70  MET A HB2  5  
ATOM 8472  H HB3  . MET A 1 70  ? -0.530  7.394   0.659   1.00 0.00 ? 70  MET A HB3  5  
ATOM 8473  H HG2  . MET A 1 70  ? 0.322   5.699   2.508   1.00 0.00 ? 70  MET A HG2  5  
ATOM 8474  H HG3  . MET A 1 70  ? -1.258  6.061   3.200   1.00 0.00 ? 70  MET A HG3  5  
ATOM 8475  H HE1  . MET A 1 70  ? 0.740   5.111   0.222   1.00 0.00 ? 70  MET A HE1  5  
ATOM 8476  H HE2  . MET A 1 70  ? 0.375   3.437   0.644   1.00 0.00 ? 70  MET A HE2  5  
ATOM 8477  H HE3  . MET A 1 70  ? -0.309  4.148   -0.819  1.00 0.00 ? 70  MET A HE3  5  
ATOM 8478  N N    . ARG A 1 71  ? 2.007   8.729   0.344   1.00 0.00 ? 71  ARG A N    5  
ATOM 8479  C CA   . ARG A 1 71  ? 2.566   9.545   -0.728  1.00 0.00 ? 71  ARG A CA   5  
ATOM 8480  C C    . ARG A 1 71  ? 2.702   8.734   -2.014  1.00 0.00 ? 71  ARG A C    5  
ATOM 8481  O O    . ARG A 1 71  ? 2.445   7.530   -2.030  1.00 0.00 ? 71  ARG A O    5  
ATOM 8482  C CB   . ARG A 1 71  ? 3.931   10.100  -0.317  1.00 0.00 ? 71  ARG A CB   5  
ATOM 8483  C CG   . ARG A 1 71  ? 3.883   10.973  0.927   1.00 0.00 ? 71  ARG A CG   5  
ATOM 8484  C CD   . ARG A 1 71  ? 3.646   12.433  0.575   1.00 0.00 ? 71  ARG A CD   5  
ATOM 8485  N NE   . ARG A 1 71  ? 4.711   12.973  -0.266  1.00 0.00 ? 71  ARG A NE   5  
ATOM 8486  C CZ   . ARG A 1 71  ? 4.623   14.131  -0.911  1.00 0.00 ? 71  ARG A CZ   5  
ATOM 8487  N NH1  . ARG A 1 71  ? 3.525   14.868  -0.810  1.00 0.00 ? 71  ARG A NH1  5  
ATOM 8488  N NH2  . ARG A 1 71  ? 5.635   14.555  -1.657  1.00 0.00 ? 71  ARG A NH2  5  
ATOM 8489  H H    . ARG A 1 71  ? 2.311   7.803   0.447   1.00 0.00 ? 71  ARG A H    5  
ATOM 8490  H HA   . ARG A 1 71  ? 1.890   10.368  -0.905  1.00 0.00 ? 71  ARG A HA   5  
ATOM 8491  H HB2  . ARG A 1 71  ? 4.600   9.275   -0.125  1.00 0.00 ? 71  ARG A HB2  5  
ATOM 8492  H HB3  . ARG A 1 71  ? 4.325   10.691  -1.130  1.00 0.00 ? 71  ARG A HB3  5  
ATOM 8493  H HG2  . ARG A 1 71  ? 3.079   10.633  1.564   1.00 0.00 ? 71  ARG A HG2  5  
ATOM 8494  H HG3  . ARG A 1 71  ? 4.822   10.886  1.452   1.00 0.00 ? 71  ARG A HG3  5  
ATOM 8495  H HD2  . ARG A 1 71  ? 2.708   12.514  0.047   1.00 0.00 ? 71  ARG A HD2  5  
ATOM 8496  H HD3  . ARG A 1 71  ? 3.596   13.006  1.488   1.00 0.00 ? 71  ARG A HD3  5  
ATOM 8497  H HE   . ARG A 1 71  ? 5.532   12.445  -0.354  1.00 0.00 ? 71  ARG A HE   5  
ATOM 8498  H HH11 . ARG A 1 71  ? 2.761   14.551  -0.248  1.00 0.00 ? 71  ARG A HH11 5  
ATOM 8499  H HH12 . ARG A 1 71  ? 3.462   15.740  -1.296  1.00 0.00 ? 71  ARG A HH12 5  
ATOM 8500  H HH21 . ARG A 1 71  ? 6.465   14.003  -1.734  1.00 0.00 ? 71  ARG A HH21 5  
ATOM 8501  H HH22 . ARG A 1 71  ? 5.568   15.427  -2.141  1.00 0.00 ? 71  ARG A HH22 5  
ATOM 8502  N N    . ILE A 1 72  ? 3.105   9.403   -3.089  1.00 0.00 ? 72  ILE A N    5  
ATOM 8503  C CA   . ILE A 1 72  ? 3.275   8.744   -4.378  1.00 0.00 ? 72  ILE A CA   5  
ATOM 8504  C C    . ILE A 1 72  ? 4.614   8.018   -4.452  1.00 0.00 ? 72  ILE A C    5  
ATOM 8505  O O    . ILE A 1 72  ? 5.672   8.630   -4.316  1.00 0.00 ? 72  ILE A O    5  
ATOM 8506  C CB   . ILE A 1 72  ? 3.185   9.751   -5.540  1.00 0.00 ? 72  ILE A CB   5  
ATOM 8507  C CG1  . ILE A 1 72  ? 2.011   10.708  -5.325  1.00 0.00 ? 72  ILE A CG1  5  
ATOM 8508  C CG2  . ILE A 1 72  ? 3.042   9.018   -6.866  1.00 0.00 ? 72  ILE A CG2  5  
ATOM 8509  C CD1  . ILE A 1 72  ? 0.759   10.025  -4.820  1.00 0.00 ? 72  ILE A CD1  5  
ATOM 8510  H H    . ILE A 1 72  ? 3.294   10.361  -3.013  1.00 0.00 ? 72  ILE A H    5  
ATOM 8511  H HA   . ILE A 1 72  ? 2.479   8.023   -4.491  1.00 0.00 ? 72  ILE A HA   5  
ATOM 8512  H HB   . ILE A 1 72  ? 4.103   10.319  -5.567  1.00 0.00 ? 72  ILE A HB   5  
ATOM 8513  H HG12 . ILE A 1 72  ? 2.293   11.458  -4.603  1.00 0.00 ? 72  ILE A HG12 5  
ATOM 8514  H HG13 . ILE A 1 72  ? 1.772   11.189  -6.263  1.00 0.00 ? 72  ILE A HG13 5  
ATOM 8515  H HG21 . ILE A 1 72  ? 2.012   8.725   -7.006  1.00 0.00 ? 72  ILE A HG21 5  
ATOM 8516  H HG22 . ILE A 1 72  ? 3.343   9.671   -7.672  1.00 0.00 ? 72  ILE A HG22 5  
ATOM 8517  H HG23 . ILE A 1 72  ? 3.669   8.139   -6.861  1.00 0.00 ? 72  ILE A HG23 5  
ATOM 8518  H HD11 . ILE A 1 72  ? -0.005  10.765  -4.633  1.00 0.00 ? 72  ILE A HD11 5  
ATOM 8519  H HD12 . ILE A 1 72  ? 0.408   9.322   -5.561  1.00 0.00 ? 72  ILE A HD12 5  
ATOM 8520  H HD13 . ILE A 1 72  ? 0.982   9.499   -3.903  1.00 0.00 ? 72  ILE A HD13 5  
ATOM 8521  N N    . GLY A 1 73  ? 4.558   6.707   -4.670  1.00 0.00 ? 73  GLY A N    5  
ATOM 8522  C CA   . GLY A 1 73  ? 5.773   5.918   -4.761  1.00 0.00 ? 73  GLY A CA   5  
ATOM 8523  C C    . GLY A 1 73  ? 5.782   4.755   -3.789  1.00 0.00 ? 73  GLY A C    5  
ATOM 8524  O O    . GLY A 1 73  ? 6.533   3.796   -3.966  1.00 0.00 ? 73  GLY A O    5  
ATOM 8525  H H    . GLY A 1 73  ? 3.686   6.273   -4.771  1.00 0.00 ? 73  GLY A H    5  
ATOM 8526  H HA2  . GLY A 1 73  ? 5.867   5.535   -5.766  1.00 0.00 ? 73  GLY A HA2  5  
ATOM 8527  H HA3  . GLY A 1 73  ? 6.619   6.556   -4.549  1.00 0.00 ? 73  GLY A HA3  5  
ATOM 8528  N N    . ASP A 1 74  ? 4.948   4.840   -2.759  1.00 0.00 ? 74  ASP A N    5  
ATOM 8529  C CA   . ASP A 1 74  ? 4.863   3.786   -1.755  1.00 0.00 ? 74  ASP A CA   5  
ATOM 8530  C C    . ASP A 1 74  ? 4.468   2.458   -2.393  1.00 0.00 ? 74  ASP A C    5  
ATOM 8531  O O    . ASP A 1 74  ? 3.506   2.388   -3.157  1.00 0.00 ? 74  ASP A O    5  
ATOM 8532  C CB   . ASP A 1 74  ? 3.853   4.165   -0.670  1.00 0.00 ? 74  ASP A CB   5  
ATOM 8533  C CG   . ASP A 1 74  ? 4.302   5.362   0.145   1.00 0.00 ? 74  ASP A CG   5  
ATOM 8534  O OD1  . ASP A 1 74  ? 5.451   5.350   0.634   1.00 0.00 ? 74  ASP A OD1  5  
ATOM 8535  O OD2  . ASP A 1 74  ? 3.504   6.311   0.294   1.00 0.00 ? 74  ASP A OD2  5  
ATOM 8536  H H    . ASP A 1 74  ? 4.374   5.630   -2.673  1.00 0.00 ? 74  ASP A H    5  
ATOM 8537  H HA   . ASP A 1 74  ? 5.838   3.678   -1.304  1.00 0.00 ? 74  ASP A HA   5  
ATOM 8538  H HB2  . ASP A 1 74  ? 2.908   4.405   -1.135  1.00 0.00 ? 74  ASP A HB2  5  
ATOM 8539  H HB3  . ASP A 1 74  ? 3.720   3.327   -0.003  1.00 0.00 ? 74  ASP A HB3  5  
ATOM 8540  N N    . GLU A 1 75  ? 5.217   1.407   -2.074  1.00 0.00 ? 75  GLU A N    5  
ATOM 8541  C CA   . GLU A 1 75  ? 4.945   0.082   -2.618  1.00 0.00 ? 75  GLU A CA   5  
ATOM 8542  C C    . GLU A 1 75  ? 4.155   -0.763  -1.623  1.00 0.00 ? 75  GLU A C    5  
ATOM 8543  O O    . GLU A 1 75  ? 4.731   -1.432  -0.763  1.00 0.00 ? 75  GLU A O    5  
ATOM 8544  C CB   . GLU A 1 75  ? 6.254   -0.624  -2.978  1.00 0.00 ? 75  GLU A CB   5  
ATOM 8545  C CG   . GLU A 1 75  ? 6.059   -2.039  -3.498  1.00 0.00 ? 75  GLU A CG   5  
ATOM 8546  C CD   . GLU A 1 75  ? 7.364   -2.696  -3.902  1.00 0.00 ? 75  GLU A CD   5  
ATOM 8547  O OE1  . GLU A 1 75  ? 8.203   -2.947  -3.012  1.00 0.00 ? 75  GLU A OE1  5  
ATOM 8548  O OE2  . GLU A 1 75  ? 7.547   -2.961  -5.109  1.00 0.00 ? 75  GLU A OE2  5  
ATOM 8549  H H    . GLU A 1 75  ? 5.970   1.526   -1.458  1.00 0.00 ? 75  GLU A H    5  
ATOM 8550  H HA   . GLU A 1 75  ? 4.356   0.206   -3.514  1.00 0.00 ? 75  GLU A HA   5  
ATOM 8551  H HB2  . GLU A 1 75  ? 6.762   -0.049  -3.737  1.00 0.00 ? 75  GLU A HB2  5  
ATOM 8552  H HB3  . GLU A 1 75  ? 6.877   -0.670  -2.097  1.00 0.00 ? 75  GLU A HB3  5  
ATOM 8553  H HG2  . GLU A 1 75  ? 5.599   -2.633  -2.724  1.00 0.00 ? 75  GLU A HG2  5  
ATOM 8554  H HG3  . GLU A 1 75  ? 5.408   -2.005  -4.360  1.00 0.00 ? 75  GLU A HG3  5  
ATOM 8555  N N    . LEU A 1 76  ? 2.833   -0.728  -1.745  1.00 0.00 ? 76  LEU A N    5  
ATOM 8556  C CA   . LEU A 1 76  ? 1.962   -1.490  -0.856  1.00 0.00 ? 76  LEU A CA   5  
ATOM 8557  C C    . LEU A 1 76  ? 2.495   -2.905  -0.654  1.00 0.00 ? 76  LEU A C    5  
ATOM 8558  O O    . LEU A 1 76  ? 2.916   -3.564  -1.606  1.00 0.00 ? 76  LEU A O    5  
ATOM 8559  C CB   . LEU A 1 76  ? 0.543   -1.544  -1.424  1.00 0.00 ? 76  LEU A CB   5  
ATOM 8560  C CG   . LEU A 1 76  ? -0.257  -0.242  -1.355  1.00 0.00 ? 76  LEU A CG   5  
ATOM 8561  C CD1  . LEU A 1 76  ? -1.527  -0.352  -2.186  1.00 0.00 ? 76  LEU A CD1  5  
ATOM 8562  C CD2  . LEU A 1 76  ? -0.590  0.103   0.089   1.00 0.00 ? 76  LEU A CD2  5  
ATOM 8563  H H    . LEU A 1 76  ? 2.432   -0.178  -2.449  1.00 0.00 ? 76  LEU A H    5  
ATOM 8564  H HA   . LEU A 1 76  ? 1.940   -0.986  0.098   1.00 0.00 ? 76  LEU A HA   5  
ATOM 8565  H HB2  . LEU A 1 76  ? 0.612   -1.835  -2.461  1.00 0.00 ? 76  LEU A HB2  5  
ATOM 8566  H HB3  . LEU A 1 76  ? -0.004  -2.298  -0.876  1.00 0.00 ? 76  LEU A HB3  5  
ATOM 8567  H HG   . LEU A 1 76  ? 0.340   0.562   -1.764  1.00 0.00 ? 76  LEU A HG   5  
ATOM 8568  H HD11 . LEU A 1 76  ? -1.739  -1.391  -2.384  1.00 0.00 ? 76  LEU A HD11 5  
ATOM 8569  H HD12 . LEU A 1 76  ? -1.392  0.173   -3.120  1.00 0.00 ? 76  LEU A HD12 5  
ATOM 8570  H HD13 . LEU A 1 76  ? -2.351  0.087   -1.642  1.00 0.00 ? 76  LEU A HD13 5  
ATOM 8571  H HD21 . LEU A 1 76  ? -1.321  0.899   0.108   1.00 0.00 ? 76  LEU A HD21 5  
ATOM 8572  H HD22 . LEU A 1 76  ? 0.307   0.426   0.598   1.00 0.00 ? 76  LEU A HD22 5  
ATOM 8573  H HD23 . LEU A 1 76  ? -0.993  -0.768  0.584   1.00 0.00 ? 76  LEU A HD23 5  
ATOM 8574  N N    . LEU A 1 77  ? 2.470   -3.368  0.591   1.00 0.00 ? 77  LEU A N    5  
ATOM 8575  C CA   . LEU A 1 77  ? 2.949   -4.707  0.919   1.00 0.00 ? 77  LEU A CA   5  
ATOM 8576  C C    . LEU A 1 77  ? 1.831   -5.552  1.522   1.00 0.00 ? 77  LEU A C    5  
ATOM 8577  O O    . LEU A 1 77  ? 1.762   -6.759  1.295   1.00 0.00 ? 77  LEU A O    5  
ATOM 8578  C CB   . LEU A 1 77  ? 4.124   -4.625  1.894   1.00 0.00 ? 77  LEU A CB   5  
ATOM 8579  C CG   . LEU A 1 77  ? 5.298   -3.748  1.458   1.00 0.00 ? 77  LEU A CG   5  
ATOM 8580  C CD1  . LEU A 1 77  ? 6.184   -3.411  2.648   1.00 0.00 ? 77  LEU A CD1  5  
ATOM 8581  C CD2  . LEU A 1 77  ? 6.105   -4.440  0.369   1.00 0.00 ? 77  LEU A CD2  5  
ATOM 8582  H H    . LEU A 1 77  ? 2.123   -2.797  1.307   1.00 0.00 ? 77  LEU A H    5  
ATOM 8583  H HA   . LEU A 1 77  ? 3.282   -5.173  0.004   1.00 0.00 ? 77  LEU A HA   5  
ATOM 8584  H HB2  . LEU A 1 77  ? 3.751   -4.237  2.830   1.00 0.00 ? 77  LEU A HB2  5  
ATOM 8585  H HB3  . LEU A 1 77  ? 4.498   -5.628  2.046   1.00 0.00 ? 77  LEU A HB3  5  
ATOM 8586  H HG   . LEU A 1 77  ? 4.916   -2.820  1.054   1.00 0.00 ? 77  LEU A HG   5  
ATOM 8587  H HD11 . LEU A 1 77  ? 6.924   -4.186  2.777   1.00 0.00 ? 77  LEU A HD11 5  
ATOM 8588  H HD12 . LEU A 1 77  ? 5.578   -3.340  3.539   1.00 0.00 ? 77  LEU A HD12 5  
ATOM 8589  H HD13 . LEU A 1 77  ? 6.678   -2.466  2.473   1.00 0.00 ? 77  LEU A HD13 5  
ATOM 8590  H HD21 . LEU A 1 77  ? 7.090   -4.675  0.746   1.00 0.00 ? 77  LEU A HD21 5  
ATOM 8591  H HD22 . LEU A 1 77  ? 6.195   -3.784  -0.485  1.00 0.00 ? 77  LEU A HD22 5  
ATOM 8592  H HD23 . LEU A 1 77  ? 5.605   -5.350  0.074   1.00 0.00 ? 77  LEU A HD23 5  
ATOM 8593  N N    . GLU A 1 78  ? 0.957   -4.908  2.289   1.00 0.00 ? 78  GLU A N    5  
ATOM 8594  C CA   . GLU A 1 78  ? -0.158  -5.601  2.923   1.00 0.00 ? 78  GLU A CA   5  
ATOM 8595  C C    . GLU A 1 78  ? -1.336  -4.655  3.136   1.00 0.00 ? 78  GLU A C    5  
ATOM 8596  O O    . GLU A 1 78  ? -1.158  -3.443  3.262   1.00 0.00 ? 78  GLU A O    5  
ATOM 8597  C CB   . GLU A 1 78  ? 0.279   -6.199  4.262   1.00 0.00 ? 78  GLU A CB   5  
ATOM 8598  C CG   . GLU A 1 78  ? 1.611   -6.927  4.198   1.00 0.00 ? 78  GLU A CG   5  
ATOM 8599  C CD   . GLU A 1 78  ? 1.878   -7.763  5.435   1.00 0.00 ? 78  GLU A CD   5  
ATOM 8600  O OE1  . GLU A 1 78  ? 1.119   -7.631  6.417   1.00 0.00 ? 78  GLU A OE1  5  
ATOM 8601  O OE2  . GLU A 1 78  ? 2.847   -8.551  5.419   1.00 0.00 ? 78  GLU A OE2  5  
ATOM 8602  H H    . GLU A 1 78  ? 1.066   -3.944  2.433   1.00 0.00 ? 78  GLU A H    5  
ATOM 8603  H HA   . GLU A 1 78  ? -0.468  -6.400  2.267   1.00 0.00 ? 78  GLU A HA   5  
ATOM 8604  H HB2  . GLU A 1 78  ? 0.361   -5.403  4.988   1.00 0.00 ? 78  GLU A HB2  5  
ATOM 8605  H HB3  . GLU A 1 78  ? -0.475  -6.898  4.593   1.00 0.00 ? 78  GLU A HB3  5  
ATOM 8606  H HG2  . GLU A 1 78  ? 1.610   -7.577  3.336   1.00 0.00 ? 78  GLU A HG2  5  
ATOM 8607  H HG3  . GLU A 1 78  ? 2.401   -6.198  4.097   1.00 0.00 ? 78  GLU A HG3  5  
ATOM 8608  N N    . ILE A 1 79  ? -2.539  -5.217  3.175   1.00 0.00 ? 79  ILE A N    5  
ATOM 8609  C CA   . ILE A 1 79  ? -3.747  -4.425  3.373   1.00 0.00 ? 79  ILE A CA   5  
ATOM 8610  C C    . ILE A 1 79  ? -4.841  -5.248  4.045   1.00 0.00 ? 79  ILE A C    5  
ATOM 8611  O O    . ILE A 1 79  ? -5.155  -6.355  3.609   1.00 0.00 ? 79  ILE A O    5  
ATOM 8612  C CB   . ILE A 1 79  ? -4.282  -3.872  2.039   1.00 0.00 ? 79  ILE A CB   5  
ATOM 8613  C CG1  . ILE A 1 79  ? -3.208  -3.035  1.341   1.00 0.00 ? 79  ILE A CG1  5  
ATOM 8614  C CG2  . ILE A 1 79  ? -5.536  -3.044  2.275   1.00 0.00 ? 79  ILE A CG2  5  
ATOM 8615  C CD1  . ILE A 1 79  ? -3.672  -2.420  0.040   1.00 0.00 ? 79  ILE A CD1  5  
ATOM 8616  H H    . ILE A 1 79  ? -2.617  -6.188  3.069   1.00 0.00 ? 79  ILE A H    5  
ATOM 8617  H HA   . ILE A 1 79  ? -3.496  -3.590  4.012   1.00 0.00 ? 79  ILE A HA   5  
ATOM 8618  H HB   . ILE A 1 79  ? -4.544  -4.707  1.408   1.00 0.00 ? 79  ILE A HB   5  
ATOM 8619  H HG12 . ILE A 1 79  ? -2.903  -2.234  1.996   1.00 0.00 ? 79  ILE A HG12 5  
ATOM 8620  H HG13 . ILE A 1 79  ? -2.356  -3.663  1.127   1.00 0.00 ? 79  ILE A HG13 5  
ATOM 8621  H HG21 . ILE A 1 79  ? -5.298  -1.994  2.180   1.00 0.00 ? 79  ILE A HG21 5  
ATOM 8622  H HG22 . ILE A 1 79  ? -6.285  -3.309  1.543   1.00 0.00 ? 79  ILE A HG22 5  
ATOM 8623  H HG23 . ILE A 1 79  ? -5.916  -3.239  3.266   1.00 0.00 ? 79  ILE A HG23 5  
ATOM 8624  H HD11 . ILE A 1 79  ? -3.331  -3.025  -0.787  1.00 0.00 ? 79  ILE A HD11 5  
ATOM 8625  H HD12 . ILE A 1 79  ? -4.750  -2.369  0.029   1.00 0.00 ? 79  ILE A HD12 5  
ATOM 8626  H HD13 . ILE A 1 79  ? -3.264  -1.423  -0.053  1.00 0.00 ? 79  ILE A HD13 5  
ATOM 8627  N N    . ASN A 1 80  ? -5.418  -4.699  5.108   1.00 0.00 ? 80  ASN A N    5  
ATOM 8628  C CA   . ASN A 1 80  ? -6.479  -5.382  5.840   1.00 0.00 ? 80  ASN A CA   5  
ATOM 8629  C C    . ASN A 1 80  ? -6.075  -6.815  6.172   1.00 0.00 ? 80  ASN A C    5  
ATOM 8630  O O    . ASN A 1 80  ? -6.916  -7.711  6.224   1.00 0.00 ? 80  ASN A O    5  
ATOM 8631  C CB   . ASN A 1 80  ? -7.773  -5.381  5.024   1.00 0.00 ? 80  ASN A CB   5  
ATOM 8632  C CG   . ASN A 1 80  ? -8.927  -6.024  5.768   1.00 0.00 ? 80  ASN A CG   5  
ATOM 8633  O OD1  . ASN A 1 80  ? -9.511  -7.003  5.305   1.00 0.00 ? 80  ASN A OD1  5  
ATOM 8634  N ND2  . ASN A 1 80  ? -9.261  -5.473  6.930   1.00 0.00 ? 80  ASN A ND2  5  
ATOM 8635  H H    . ASN A 1 80  ? -5.124  -3.813  5.408   1.00 0.00 ? 80  ASN A H    5  
ATOM 8636  H HA   . ASN A 1 80  ? -6.645  -4.844  6.762   1.00 0.00 ? 80  ASN A HA   5  
ATOM 8637  H HB2  . ASN A 1 80  ? -8.044  -4.361  4.791   1.00 0.00 ? 80  ASN A HB2  5  
ATOM 8638  H HB3  . ASN A 1 80  ? -7.613  -5.925  4.105   1.00 0.00 ? 80  ASN A HB3  5  
ATOM 8639  H HD21 . ASN A 1 80  ? -8.751  -4.695  7.237   1.00 0.00 ? 80  ASN A HD21 5  
ATOM 8640  H HD22 . ASN A 1 80  ? -10.003 -5.869  7.433   1.00 0.00 ? 80  ASN A HD22 5  
ATOM 8641  N N    . ASN A 1 81  ? -4.781  -7.022  6.397   1.00 0.00 ? 81  ASN A N    5  
ATOM 8642  C CA   . ASN A 1 81  ? -4.265  -8.346  6.724   1.00 0.00 ? 81  ASN A CA   5  
ATOM 8643  C C    . ASN A 1 81  ? -4.226  -9.236  5.486   1.00 0.00 ? 81  ASN A C    5  
ATOM 8644  O O    . ASN A 1 81  ? -4.626  -10.399 5.533   1.00 0.00 ? 81  ASN A O    5  
ATOM 8645  C CB   . ASN A 1 81  ? -5.126  -8.999  7.808   1.00 0.00 ? 81  ASN A CB   5  
ATOM 8646  C CG   . ASN A 1 81  ? -5.521  -8.022  8.899   1.00 0.00 ? 81  ASN A CG   5  
ATOM 8647  O OD1  . ASN A 1 81  ? -4.665  -7.452  9.576   1.00 0.00 ? 81  ASN A OD1  5  
ATOM 8648  N ND2  . ASN A 1 81  ? -6.822  -7.825  9.075   1.00 0.00 ? 81  ASN A ND2  5  
ATOM 8649  H H    . ASN A 1 81  ? -4.159  -6.267  6.341   1.00 0.00 ? 81  ASN A H    5  
ATOM 8650  H HA   . ASN A 1 81  ? -3.260  -8.227  7.100   1.00 0.00 ? 81  ASN A HA   5  
ATOM 8651  H HB2  . ASN A 1 81  ? -6.028  -9.388  7.357   1.00 0.00 ? 81  ASN A HB2  5  
ATOM 8652  H HB3  . ASN A 1 81  ? -4.575  -9.810  8.258   1.00 0.00 ? 81  ASN A HB3  5  
ATOM 8653  H HD21 . ASN A 1 81  ? -7.446  -8.314  8.498   1.00 0.00 ? 81  ASN A HD21 5  
ATOM 8654  H HD22 . ASN A 1 81  ? -7.105  -7.198  9.773   1.00 0.00 ? 81  ASN A HD22 5  
ATOM 8655  N N    . GLN A 1 82  ? -3.741  -8.681  4.380   1.00 0.00 ? 82  GLN A N    5  
ATOM 8656  C CA   . GLN A 1 82  ? -3.650  -9.425  3.129   1.00 0.00 ? 82  GLN A CA   5  
ATOM 8657  C C    . GLN A 1 82  ? -2.398  -9.032  2.352   1.00 0.00 ? 82  GLN A C    5  
ATOM 8658  O O    . GLN A 1 82  ? -2.336  -7.954  1.760   1.00 0.00 ? 82  GLN A O    5  
ATOM 8659  C CB   . GLN A 1 82  ? -4.894  -9.179  2.273   1.00 0.00 ? 82  GLN A CB   5  
ATOM 8660  C CG   . GLN A 1 82  ? -6.112  -9.964  2.731   1.00 0.00 ? 82  GLN A CG   5  
ATOM 8661  C CD   . GLN A 1 82  ? -6.214  -11.323 2.068   1.00 0.00 ? 82  GLN A CD   5  
ATOM 8662  O OE1  . GLN A 1 82  ? -5.910  -12.349 2.678   1.00 0.00 ? 82  GLN A OE1  5  
ATOM 8663  N NE2  . GLN A 1 82  ? -6.643  -11.339 0.811   1.00 0.00 ? 82  GLN A NE2  5  
ATOM 8664  H H    . GLN A 1 82  ? -3.439  -7.750  4.406   1.00 0.00 ? 82  GLN A H    5  
ATOM 8665  H HA   . GLN A 1 82  ? -3.593  -10.475 3.371   1.00 0.00 ? 82  GLN A HA   5  
ATOM 8666  H HB2  . GLN A 1 82  ? -5.136  -8.127  2.306   1.00 0.00 ? 82  GLN A HB2  5  
ATOM 8667  H HB3  . GLN A 1 82  ? -4.675  -9.458  1.253   1.00 0.00 ? 82  GLN A HB3  5  
ATOM 8668  H HG2  . GLN A 1 82  ? -6.053  -10.106 3.800   1.00 0.00 ? 82  GLN A HG2  5  
ATOM 8669  H HG3  . GLN A 1 82  ? -7.000  -9.396  2.493   1.00 0.00 ? 82  GLN A HG3  5  
ATOM 8670  H HE21 . GLN A 1 82  ? -6.865  -10.482 0.388   1.00 0.00 ? 82  GLN A HE21 5  
ATOM 8671  H HE22 . GLN A 1 82  ? -6.717  -12.203 0.358   1.00 0.00 ? 82  GLN A HE22 5  
ATOM 8672  N N    . ILE A 1 83  ? -1.403  -9.912  2.359   1.00 0.00 ? 83  ILE A N    5  
ATOM 8673  C CA   . ILE A 1 83  ? -0.153  -9.657  1.654   1.00 0.00 ? 83  ILE A CA   5  
ATOM 8674  C C    . ILE A 1 83  ? -0.378  -9.570  0.149   1.00 0.00 ? 83  ILE A C    5  
ATOM 8675  O O    . ILE A 1 83  ? -0.908  -10.497 -0.465  1.00 0.00 ? 83  ILE A O    5  
ATOM 8676  C CB   . ILE A 1 83  ? 0.891   -10.752 1.943   1.00 0.00 ? 83  ILE A CB   5  
ATOM 8677  C CG1  . ILE A 1 83  ? 1.216   -10.795 3.438   1.00 0.00 ? 83  ILE A CG1  5  
ATOM 8678  C CG2  . ILE A 1 83  ? 2.152   -10.511 1.128   1.00 0.00 ? 83  ILE A CG2  5  
ATOM 8679  C CD1  . ILE A 1 83  ? 2.322   -11.766 3.788   1.00 0.00 ? 83  ILE A CD1  5  
ATOM 8680  H H    . ILE A 1 83  ? -1.512  -10.753 2.849   1.00 0.00 ? 83  ILE A H    5  
ATOM 8681  H HA   . ILE A 1 83  ? 0.240   -8.713  2.004   1.00 0.00 ? 83  ILE A HA   5  
ATOM 8682  H HB   . ILE A 1 83  ? 0.474   -11.702 1.646   1.00 0.00 ? 83  ILE A HB   5  
ATOM 8683  H HG12 . ILE A 1 83  ? 1.524   -9.813  3.761   1.00 0.00 ? 83  ILE A HG12 5  
ATOM 8684  H HG13 . ILE A 1 83  ? 0.331   -11.089 3.983   1.00 0.00 ? 83  ILE A HG13 5  
ATOM 8685  H HG21 . ILE A 1 83  ? 2.944   -10.174 1.780   1.00 0.00 ? 83  ILE A HG21 5  
ATOM 8686  H HG22 . ILE A 1 83  ? 2.450   -11.431 0.646   1.00 0.00 ? 83  ILE A HG22 5  
ATOM 8687  H HG23 . ILE A 1 83  ? 1.958   -9.758  0.378   1.00 0.00 ? 83  ILE A HG23 5  
ATOM 8688  H HD11 . ILE A 1 83  ? 1.908   -12.757 3.905   1.00 0.00 ? 83  ILE A HD11 5  
ATOM 8689  H HD12 . ILE A 1 83  ? 3.059   -11.774 2.998   1.00 0.00 ? 83  ILE A HD12 5  
ATOM 8690  H HD13 . ILE A 1 83  ? 2.789   -11.461 4.713   1.00 0.00 ? 83  ILE A HD13 5  
ATOM 8691  N N    . LEU A 1 84  ? 0.029   -8.451  -0.441  1.00 0.00 ? 84  LEU A N    5  
ATOM 8692  C CA   . LEU A 1 84  ? -0.127  -8.243  -1.877  1.00 0.00 ? 84  LEU A CA   5  
ATOM 8693  C C    . LEU A 1 84  ? 1.133   -8.661  -2.627  1.00 0.00 ? 84  LEU A C    5  
ATOM 8694  O O    . LEU A 1 84  ? 1.075   -9.035  -3.799  1.00 0.00 ? 84  LEU A O    5  
ATOM 8695  C CB   . LEU A 1 84  ? -0.444  -6.775  -2.168  1.00 0.00 ? 84  LEU A CB   5  
ATOM 8696  C CG   . LEU A 1 84  ? -1.457  -6.110  -1.235  1.00 0.00 ? 84  LEU A CG   5  
ATOM 8697  C CD1  . LEU A 1 84  ? -1.596  -4.632  -1.566  1.00 0.00 ? 84  LEU A CD1  5  
ATOM 8698  C CD2  . LEU A 1 84  ? -2.806  -6.808  -1.328  1.00 0.00 ? 84  LEU A CD2  5  
ATOM 8699  H H    . LEU A 1 84  ? 0.444   -7.748  0.100   1.00 0.00 ? 84  LEU A H    5  
ATOM 8700  H HA   . LEU A 1 84  ? -0.951  -8.855  -2.213  1.00 0.00 ? 84  LEU A HA   5  
ATOM 8701  H HB2  . LEU A 1 84  ? 0.478   -6.219  -2.104  1.00 0.00 ? 84  LEU A HB2  5  
ATOM 8702  H HB3  . LEU A 1 84  ? -0.831  -6.715  -3.175  1.00 0.00 ? 84  LEU A HB3  5  
ATOM 8703  H HG   . LEU A 1 84  ? -1.106  -6.192  -0.216  1.00 0.00 ? 84  LEU A HG   5  
ATOM 8704  H HD11 . LEU A 1 84  ? -1.467  -4.048  -0.667  1.00 0.00 ? 84  LEU A HD11 5  
ATOM 8705  H HD12 . LEU A 1 84  ? -2.577  -4.446  -1.978  1.00 0.00 ? 84  LEU A HD12 5  
ATOM 8706  H HD13 . LEU A 1 84  ? -0.844  -4.352  -2.289  1.00 0.00 ? 84  LEU A HD13 5  
ATOM 8707  H HD21 . LEU A 1 84  ? -3.592  -6.069  -1.357  1.00 0.00 ? 84  LEU A HD21 5  
ATOM 8708  H HD22 . LEU A 1 84  ? -2.942  -7.444  -0.465  1.00 0.00 ? 84  LEU A HD22 5  
ATOM 8709  H HD23 . LEU A 1 84  ? -2.841  -7.407  -2.226  1.00 0.00 ? 84  LEU A HD23 5  
ATOM 8710  N N    . TYR A 1 85  ? 2.271   -8.597  -1.944  1.00 0.00 ? 85  TYR A N    5  
ATOM 8711  C CA   . TYR A 1 85  ? 3.546   -8.969  -2.546  1.00 0.00 ? 85  TYR A CA   5  
ATOM 8712  C C    . TYR A 1 85  ? 3.403   -10.233 -3.389  1.00 0.00 ? 85  TYR A C    5  
ATOM 8713  O O    . TYR A 1 85  ? 3.483   -11.348 -2.875  1.00 0.00 ? 85  TYR A O    5  
ATOM 8714  C CB   . TYR A 1 85  ? 4.603   -9.183  -1.462  1.00 0.00 ? 85  TYR A CB   5  
ATOM 8715  C CG   . TYR A 1 85  ? 5.989   -9.439  -2.009  1.00 0.00 ? 85  TYR A CG   5  
ATOM 8716  C CD1  . TYR A 1 85  ? 6.361   -10.704 -2.448  1.00 0.00 ? 85  TYR A CD1  5  
ATOM 8717  C CD2  . TYR A 1 85  ? 6.927   -8.417  -2.087  1.00 0.00 ? 85  TYR A CD2  5  
ATOM 8718  C CE1  . TYR A 1 85  ? 7.626   -10.943 -2.948  1.00 0.00 ? 85  TYR A CE1  5  
ATOM 8719  C CE2  . TYR A 1 85  ? 8.194   -8.646  -2.587  1.00 0.00 ? 85  TYR A CE2  5  
ATOM 8720  C CZ   . TYR A 1 85  ? 8.539   -9.911  -3.016  1.00 0.00 ? 85  TYR A CZ   5  
ATOM 8721  O OH   . TYR A 1 85  ? 9.800   -10.144 -3.513  1.00 0.00 ? 85  TYR A OH   5  
ATOM 8722  H H    . TYR A 1 85  ? 2.254   -8.291  -1.014  1.00 0.00 ? 85  TYR A H    5  
ATOM 8723  H HA   . TYR A 1 85  ? 3.860   -8.157  -3.186  1.00 0.00 ? 85  TYR A HA   5  
ATOM 8724  H HB2  . TYR A 1 85  ? 4.651   -8.304  -0.837  1.00 0.00 ? 85  TYR A HB2  5  
ATOM 8725  H HB3  . TYR A 1 85  ? 4.322   -10.033 -0.858  1.00 0.00 ? 85  TYR A HB3  5  
ATOM 8726  H HD1  . TYR A 1 85  ? 5.644   -11.510 -2.393  1.00 0.00 ? 85  TYR A HD1  5  
ATOM 8727  H HD2  . TYR A 1 85  ? 6.653   -7.427  -1.749  1.00 0.00 ? 85  TYR A HD2  5  
ATOM 8728  H HE1  . TYR A 1 85  ? 7.897   -11.933 -3.284  1.00 0.00 ? 85  TYR A HE1  5  
ATOM 8729  H HE2  . TYR A 1 85  ? 8.909   -7.839  -2.640  1.00 0.00 ? 85  TYR A HE2  5  
ATOM 8730  H HH   . TYR A 1 85  ? 10.437  -9.607  -3.035  1.00 0.00 ? 85  TYR A HH   5  
ATOM 8731  N N    . GLY A 1 86  ? 3.190   -10.049 -4.688  1.00 0.00 ? 86  GLY A N    5  
ATOM 8732  C CA   . GLY A 1 86  ? 3.039   -11.182 -5.583  1.00 0.00 ? 86  GLY A CA   5  
ATOM 8733  C C    . GLY A 1 86  ? 1.690   -11.200 -6.273  1.00 0.00 ? 86  GLY A C    5  
ATOM 8734  O O    . GLY A 1 86  ? 1.302   -12.207 -6.866  1.00 0.00 ? 86  GLY A O    5  
ATOM 8735  H H    . GLY A 1 86  ? 3.135   -9.137  -5.043  1.00 0.00 ? 86  GLY A H    5  
ATOM 8736  H HA2  . GLY A 1 86  ? 3.815   -11.140 -6.333  1.00 0.00 ? 86  GLY A HA2  5  
ATOM 8737  H HA3  . GLY A 1 86  ? 3.152   -12.093 -5.013  1.00 0.00 ? 86  GLY A HA3  5  
ATOM 8738  N N    . ARG A 1 87  ? 0.972   -10.085 -6.195  1.00 0.00 ? 87  ARG A N    5  
ATOM 8739  C CA   . ARG A 1 87  ? -0.343  -9.977  -6.815  1.00 0.00 ? 87  ARG A CA   5  
ATOM 8740  C C    . ARG A 1 87  ? -0.455  -8.695  -7.634  1.00 0.00 ? 87  ARG A C    5  
ATOM 8741  O O    . ARG A 1 87  ? 0.331   -7.765  -7.460  1.00 0.00 ? 87  ARG A O    5  
ATOM 8742  C CB   . ARG A 1 87  ? -1.438  -10.010 -5.747  1.00 0.00 ? 87  ARG A CB   5  
ATOM 8743  C CG   . ARG A 1 87  ? -1.546  -11.344 -5.025  1.00 0.00 ? 87  ARG A CG   5  
ATOM 8744  C CD   . ARG A 1 87  ? -2.282  -11.203 -3.702  1.00 0.00 ? 87  ARG A CD   5  
ATOM 8745  N NE   . ARG A 1 87  ? -2.470  -12.492 -3.041  1.00 0.00 ? 87  ARG A NE   5  
ATOM 8746  C CZ   . ARG A 1 87  ? -3.360  -13.396 -3.433  1.00 0.00 ? 87  ARG A CZ   5  
ATOM 8747  N NH1  . ARG A 1 87  ? -4.139  -13.154 -4.478  1.00 0.00 ? 87  ARG A NH1  5  
ATOM 8748  N NH2  . ARG A 1 87  ? -3.472  -14.546 -2.781  1.00 0.00 ? 87  ARG A NH2  5  
ATOM 8749  H H    . ARG A 1 87  ? 1.335   -9.315  -5.708  1.00 0.00 ? 87  ARG A H    5  
ATOM 8750  H HA   . ARG A 1 87  ? -0.470  -10.824 -7.473  1.00 0.00 ? 87  ARG A HA   5  
ATOM 8751  H HB2  . ARG A 1 87  ? -1.232  -9.245  -5.013  1.00 0.00 ? 87  ARG A HB2  5  
ATOM 8752  H HB3  . ARG A 1 87  ? -2.388  -9.801  -6.216  1.00 0.00 ? 87  ARG A HB3  5  
ATOM 8753  H HG2  . ARG A 1 87  ? -2.084  -12.039 -5.652  1.00 0.00 ? 87  ARG A HG2  5  
ATOM 8754  H HG3  . ARG A 1 87  ? -0.552  -11.721 -4.836  1.00 0.00 ? 87  ARG A HG3  5  
ATOM 8755  H HD2  . ARG A 1 87  ? -1.709  -10.557 -3.053  1.00 0.00 ? 87  ARG A HD2  5  
ATOM 8756  H HD3  . ARG A 1 87  ? -3.248  -10.760 -3.889  1.00 0.00 ? 87  ARG A HD3  5  
ATOM 8757  H HE   . ARG A 1 87  ? -1.904  -12.691 -2.266  1.00 0.00 ? 87  ARG A HE   5  
ATOM 8758  H HH11 . ARG A 1 87  ? -4.057  -12.289 -4.973  1.00 0.00 ? 87  ARG A HH11 5  
ATOM 8759  H HH12 . ARG A 1 87  ? -4.808  -13.837 -4.773  1.00 0.00 ? 87  ARG A HH12 5  
ATOM 8760  H HH21 . ARG A 1 87  ? -2.886  -14.732 -1.992  1.00 0.00 ? 87  ARG A HH21 5  
ATOM 8761  H HH22 . ARG A 1 87  ? -4.142  -15.225 -3.077  1.00 0.00 ? 87  ARG A HH22 5  
ATOM 8762  N N    . SER A 1 88  ? -1.438  -8.655  -8.529  1.00 0.00 ? 88  SER A N    5  
ATOM 8763  C CA   . SER A 1 88  ? -1.650  -7.489  -9.379  1.00 0.00 ? 88  SER A CA   5  
ATOM 8764  C C    . SER A 1 88  ? -2.405  -6.398  -8.626  1.00 0.00 ? 88  SER A C    5  
ATOM 8765  O O    . SER A 1 88  ? -3.146  -6.678  -7.682  1.00 0.00 ? 88  SER A O    5  
ATOM 8766  C CB   . SER A 1 88  ? -2.423  -7.884  -10.638 1.00 0.00 ? 88  SER A CB   5  
ATOM 8767  O OG   . SER A 1 88  ? -2.719  -6.748  -11.432 1.00 0.00 ? 88  SER A OG   5  
ATOM 8768  H H    . SER A 1 88  ? -2.032  -9.429  -8.621  1.00 0.00 ? 88  SER A H    5  
ATOM 8769  H HA   . SER A 1 88  ? -0.682  -7.107  -9.666  1.00 0.00 ? 88  SER A HA   5  
ATOM 8770  H HB2  . SER A 1 88  ? -1.829  -8.571  -11.222 1.00 0.00 ? 88  SER A HB2  5  
ATOM 8771  H HB3  . SER A 1 88  ? -3.350  -8.361  -10.354 1.00 0.00 ? 88  SER A HB3  5  
ATOM 8772  H HG   . SER A 1 88  ? -3.403  -6.971  -12.068 1.00 0.00 ? 88  SER A HG   5  
ATOM 8773  N N    . HIS A 1 89  ? -2.212  -5.153  -9.049  1.00 0.00 ? 89  HIS A N    5  
ATOM 8774  C CA   . HIS A 1 89  ? -2.875  -4.019  -8.416  1.00 0.00 ? 89  HIS A CA   5  
ATOM 8775  C C    . HIS A 1 89  ? -4.387  -4.223  -8.382  1.00 0.00 ? 89  HIS A C    5  
ATOM 8776  O O    . HIS A 1 89  ? -5.038  -3.934  -7.378  1.00 0.00 ? 89  HIS A O    5  
ATOM 8777  C CB   . HIS A 1 89  ? -2.540  -2.725  -9.159  1.00 0.00 ? 89  HIS A CB   5  
ATOM 8778  C CG   . HIS A 1 89  ? -2.922  -2.750  -10.607 1.00 0.00 ? 89  HIS A CG   5  
ATOM 8779  N ND1  . HIS A 1 89  ? -4.167  -2.374  -11.064 1.00 0.00 ? 89  HIS A ND1  5  
ATOM 8780  C CD2  . HIS A 1 89  ? -2.213  -3.109  -11.704 1.00 0.00 ? 89  HIS A CD2  5  
ATOM 8781  C CE1  . HIS A 1 89  ? -4.209  -2.501  -12.378 1.00 0.00 ? 89  HIS A CE1  5  
ATOM 8782  N NE2  . HIS A 1 89  ? -3.036  -2.945  -12.791 1.00 0.00 ? 89  HIS A NE2  5  
ATOM 8783  H H    . HIS A 1 89  ? -1.610  -4.994  -9.806  1.00 0.00 ? 89  HIS A H    5  
ATOM 8784  H HA   . HIS A 1 89  ? -2.511  -3.946  -7.402  1.00 0.00 ? 89  HIS A HA   5  
ATOM 8785  H HB2  . HIS A 1 89  ? -3.064  -1.904  -8.693  1.00 0.00 ? 89  HIS A HB2  5  
ATOM 8786  H HB3  . HIS A 1 89  ? -1.476  -2.548  -9.099  1.00 0.00 ? 89  HIS A HB3  5  
ATOM 8787  H HD1  . HIS A 1 89  ? -4.910  -2.061  -10.507 1.00 0.00 ? 89  HIS A HD1  5  
ATOM 8788  H HD2  . HIS A 1 89  ? -1.191  -3.459  -11.721 1.00 0.00 ? 89  HIS A HD2  5  
ATOM 8789  H HE1  . HIS A 1 89  ? -5.057  -2.279  -13.008 1.00 0.00 ? 89  HIS A HE1  5  
ATOM 8790  H HE2  . HIS A 1 89  ? -2.824  -3.207  -13.711 1.00 0.00 ? 89  HIS A HE2  5  
ATOM 8791  N N    . GLN A 1 90  ? -4.937  -4.721  -9.484  1.00 0.00 ? 90  GLN A N    5  
ATOM 8792  C CA   . GLN A 1 90  ? -6.372  -4.961  -9.580  1.00 0.00 ? 90  GLN A CA   5  
ATOM 8793  C C    . GLN A 1 90  ? -6.875  -5.739  -8.368  1.00 0.00 ? 90  GLN A C    5  
ATOM 8794  O O    . GLN A 1 90  ? -7.937  -5.441  -7.824  1.00 0.00 ? 90  GLN A O    5  
ATOM 8795  C CB   . GLN A 1 90  ? -6.698  -5.726  -10.864 1.00 0.00 ? 90  GLN A CB   5  
ATOM 8796  C CG   . GLN A 1 90  ? -8.082  -5.426  -11.416 1.00 0.00 ? 90  GLN A CG   5  
ATOM 8797  C CD   . GLN A 1 90  ? -9.147  -6.346  -10.854 1.00 0.00 ? 90  GLN A CD   5  
ATOM 8798  O OE1  . GLN A 1 90  ? -9.299  -6.469  -9.638  1.00 0.00 ? 90  GLN A OE1  5  
ATOM 8799  N NE2  . GLN A 1 90  ? -9.893  -6.999  -11.738 1.00 0.00 ? 90  GLN A NE2  5  
ATOM 8800  H H    . GLN A 1 90  ? -4.365  -4.931  -10.251 1.00 0.00 ? 90  GLN A H    5  
ATOM 8801  H HA   . GLN A 1 90  ? -6.867  -4.003  -9.607  1.00 0.00 ? 90  GLN A HA   5  
ATOM 8802  H HB2  . GLN A 1 90  ? -5.969  -5.469  -11.617 1.00 0.00 ? 90  GLN A HB2  5  
ATOM 8803  H HB3  . GLN A 1 90  ? -6.637  -6.786  -10.662 1.00 0.00 ? 90  GLN A HB3  5  
ATOM 8804  H HG2  . GLN A 1 90  ? -8.341  -4.407  -11.168 1.00 0.00 ? 90  GLN A HG2  5  
ATOM 8805  H HG3  . GLN A 1 90  ? -8.059  -5.539  -12.490 1.00 0.00 ? 90  GLN A HG3  5  
ATOM 8806  H HE21 . GLN A 1 90  ? -9.714  -6.853  -12.691 1.00 0.00 ? 90  GLN A HE21 5  
ATOM 8807  H HE22 . GLN A 1 90  ? -10.588 -7.601  -11.402 1.00 0.00 ? 90  GLN A HE22 5  
ATOM 8808  N N    . ASN A 1 91  ? -6.105  -6.739  -7.952  1.00 0.00 ? 91  ASN A N    5  
ATOM 8809  C CA   . ASN A 1 91  ? -6.473  -7.561  -6.805  1.00 0.00 ? 91  ASN A CA   5  
ATOM 8810  C C    . ASN A 1 91  ? -6.526  -6.725  -5.530  1.00 0.00 ? 91  ASN A C    5  
ATOM 8811  O O    . ASN A 1 91  ? -7.490  -6.794  -4.769  1.00 0.00 ? 91  ASN A O    5  
ATOM 8812  C CB   . ASN A 1 91  ? -5.478  -8.710  -6.634  1.00 0.00 ? 91  ASN A CB   5  
ATOM 8813  C CG   . ASN A 1 91  ? -5.775  -9.876  -7.557  1.00 0.00 ? 91  ASN A CG   5  
ATOM 8814  O OD1  . ASN A 1 91  ? -6.922  -10.305 -7.683  1.00 0.00 ? 91  ASN A OD1  5  
ATOM 8815  N ND2  . ASN A 1 91  ? -4.740  -10.395 -8.207  1.00 0.00 ? 91  ASN A ND2  5  
ATOM 8816  H H    . ASN A 1 91  ? -5.269  -6.929  -8.427  1.00 0.00 ? 91  ASN A H    5  
ATOM 8817  H HA   . ASN A 1 91  ? -7.454  -7.972  -6.993  1.00 0.00 ? 91  ASN A HA   5  
ATOM 8818  H HB2  . ASN A 1 91  ? -4.482  -8.351  -6.849  1.00 0.00 ? 91  ASN A HB2  5  
ATOM 8819  H HB3  . ASN A 1 91  ? -5.516  -9.063  -5.614  1.00 0.00 ? 91  ASN A HB3  5  
ATOM 8820  H HD21 . ASN A 1 91  ? -3.855  -10.002 -8.058  1.00 0.00 ? 91  ASN A HD21 5  
ATOM 8821  H HD22 . ASN A 1 91  ? -4.904  -11.149 -8.812  1.00 0.00 ? 91  ASN A HD22 5  
ATOM 8822  N N    . ALA A 1 92  ? -5.482  -5.934  -5.305  1.00 0.00 ? 92  ALA A N    5  
ATOM 8823  C CA   . ALA A 1 92  ? -5.410  -5.082  -4.124  1.00 0.00 ? 92  ALA A CA   5  
ATOM 8824  C C    . ALA A 1 92  ? -6.733  -4.362  -3.886  1.00 0.00 ? 92  ALA A C    5  
ATOM 8825  O O    . ALA A 1 92  ? -7.344  -4.502  -2.827  1.00 0.00 ? 92  ALA A O    5  
ATOM 8826  C CB   . ALA A 1 92  ? -4.277  -4.076  -4.268  1.00 0.00 ? 92  ALA A CB   5  
ATOM 8827  H H    . ALA A 1 92  ? -4.743  -5.922  -5.948  1.00 0.00 ? 92  ALA A H    5  
ATOM 8828  H HA   . ALA A 1 92  ? -5.194  -5.710  -3.272  1.00 0.00 ? 92  ALA A HA   5  
ATOM 8829  H HB1  . ALA A 1 92  ? -4.184  -3.786  -5.305  1.00 0.00 ? 92  ALA A HB1  5  
ATOM 8830  H HB2  . ALA A 1 92  ? -4.492  -3.204  -3.669  1.00 0.00 ? 92  ALA A HB2  5  
ATOM 8831  H HB3  . ALA A 1 92  ? -3.354  -4.524  -3.934  1.00 0.00 ? 92  ALA A HB3  5  
ATOM 8832  N N    . SER A 1 93  ? -7.168  -3.589  -4.876  1.00 0.00 ? 93  SER A N    5  
ATOM 8833  C CA   . SER A 1 93  ? -8.416  -2.843  -4.771  1.00 0.00 ? 93  SER A CA   5  
ATOM 8834  C C    . SER A 1 93  ? -9.538  -3.733  -4.244  1.00 0.00 ? 93  SER A C    5  
ATOM 8835  O O    . SER A 1 93  ? -10.280 -3.346  -3.342  1.00 0.00 ? 93  SER A O    5  
ATOM 8836  C CB   . SER A 1 93  ? -8.806  -2.266  -6.134  1.00 0.00 ? 93  SER A CB   5  
ATOM 8837  O OG   . SER A 1 93  ? -9.254  -3.285  -7.010  1.00 0.00 ? 93  SER A OG   5  
ATOM 8838  H H    . SER A 1 93  ? -6.635  -3.518  -5.696  1.00 0.00 ? 93  SER A H    5  
ATOM 8839  H HA   . SER A 1 93  ? -8.260  -2.031  -4.077  1.00 0.00 ? 93  SER A HA   5  
ATOM 8840  H HB2  . SER A 1 93  ? -9.599  -1.546  -6.003  1.00 0.00 ? 93  SER A HB2  5  
ATOM 8841  H HB3  . SER A 1 93  ? -7.947  -1.780  -6.574  1.00 0.00 ? 93  SER A HB3  5  
ATOM 8842  H HG   . SER A 1 93  ? -9.020  -3.056  -7.913  1.00 0.00 ? 93  SER A HG   5  
ATOM 8843  N N    . ALA A 1 94  ? -9.656  -4.927  -4.815  1.00 0.00 ? 94  ALA A N    5  
ATOM 8844  C CA   . ALA A 1 94  ? -10.685 -5.873  -4.402  1.00 0.00 ? 94  ALA A CA   5  
ATOM 8845  C C    . ALA A 1 94  ? -10.665 -6.082  -2.892  1.00 0.00 ? 94  ALA A C    5  
ATOM 8846  O O    . ALA A 1 94  ? -11.710 -6.070  -2.240  1.00 0.00 ? 94  ALA A O    5  
ATOM 8847  C CB   . ALA A 1 94  ? -10.501 -7.201  -5.123  1.00 0.00 ? 94  ALA A CB   5  
ATOM 8848  H H    . ALA A 1 94  ? -9.034  -5.179  -5.530  1.00 0.00 ? 94  ALA A H    5  
ATOM 8849  H HA   . ALA A 1 94  ? -11.645 -5.467  -4.687  1.00 0.00 ? 94  ALA A HA   5  
ATOM 8850  H HB1  . ALA A 1 94  ? -11.388 -7.804  -4.995  1.00 0.00 ? 94  ALA A HB1  5  
ATOM 8851  H HB2  . ALA A 1 94  ? -10.336 -7.020  -6.174  1.00 0.00 ? 94  ALA A HB2  5  
ATOM 8852  H HB3  . ALA A 1 94  ? -9.649  -7.720  -4.708  1.00 0.00 ? 94  ALA A HB3  5  
ATOM 8853  N N    . ILE A 1 95  ? -9.471  -6.274  -2.341  1.00 0.00 ? 95  ILE A N    5  
ATOM 8854  C CA   . ILE A 1 95  ? -9.316  -6.485  -0.907  1.00 0.00 ? 95  ILE A CA   5  
ATOM 8855  C C    . ILE A 1 95  ? -9.902  -5.321  -0.114  1.00 0.00 ? 95  ILE A C    5  
ATOM 8856  O O    . ILE A 1 95  ? -10.625 -5.524  0.861   1.00 0.00 ? 95  ILE A O    5  
ATOM 8857  C CB   . ILE A 1 95  ? -7.835  -6.661  -0.521  1.00 0.00 ? 95  ILE A CB   5  
ATOM 8858  C CG1  . ILE A 1 95  ? -7.220  -7.829  -1.293  1.00 0.00 ? 95  ILE A CG1  5  
ATOM 8859  C CG2  . ILE A 1 95  ? -7.702  -6.881  0.979   1.00 0.00 ? 95  ILE A CG2  5  
ATOM 8860  C CD1  . ILE A 1 95  ? -5.707  -7.822  -1.294  1.00 0.00 ? 95  ILE A CD1  5  
ATOM 8861  H H    . ILE A 1 95  ? -8.675  -6.273  -2.913  1.00 0.00 ? 95  ILE A H    5  
ATOM 8862  H HA   . ILE A 1 95  ? -9.846  -7.389  -0.645  1.00 0.00 ? 95  ILE A HA   5  
ATOM 8863  H HB   . ILE A 1 95  ? -7.310  -5.753  -0.775  1.00 0.00 ? 95  ILE A HB   5  
ATOM 8864  H HG12 . ILE A 1 95  ? -7.546  -8.757  -0.851  1.00 0.00 ? 95  ILE A HG12 5  
ATOM 8865  H HG13 . ILE A 1 95  ? -7.553  -7.788  -2.320  1.00 0.00 ? 95  ILE A HG13 5  
ATOM 8866  H HG21 . ILE A 1 95  ? -7.438  -7.911  1.169   1.00 0.00 ? 95  ILE A HG21 5  
ATOM 8867  H HG22 . ILE A 1 95  ? -6.931  -6.235  1.370   1.00 0.00 ? 95  ILE A HG22 5  
ATOM 8868  H HG23 . ILE A 1 95  ? -8.641  -6.655  1.461   1.00 0.00 ? 95  ILE A HG23 5  
ATOM 8869  H HD11 . ILE A 1 95  ? -5.350  -7.019  -0.668  1.00 0.00 ? 95  ILE A HD11 5  
ATOM 8870  H HD12 . ILE A 1 95  ? -5.342  -8.765  -0.916  1.00 0.00 ? 95  ILE A HD12 5  
ATOM 8871  H HD13 . ILE A 1 95  ? -5.349  -7.677  -2.303  1.00 0.00 ? 95  ILE A HD13 5  
ATOM 8872  N N    . ILE A 1 96  ? -9.586  -4.103  -0.541  1.00 0.00 ? 96  ILE A N    5  
ATOM 8873  C CA   . ILE A 1 96  ? -10.084 -2.907  0.128   1.00 0.00 ? 96  ILE A CA   5  
ATOM 8874  C C    . ILE A 1 96  ? -11.607 -2.845  0.081   1.00 0.00 ? 96  ILE A C    5  
ATOM 8875  O O    . ILE A 1 96  ? -12.260 -2.587  1.092   1.00 0.00 ? 96  ILE A O    5  
ATOM 8876  C CB   . ILE A 1 96  ? -9.509  -1.627  -0.506  1.00 0.00 ? 96  ILE A CB   5  
ATOM 8877  C CG1  . ILE A 1 96  ? -7.989  -1.587  -0.338  1.00 0.00 ? 96  ILE A CG1  5  
ATOM 8878  C CG2  . ILE A 1 96  ? -10.149 -0.395  0.115   1.00 0.00 ? 96  ILE A CG2  5  
ATOM 8879  C CD1  . ILE A 1 96  ? -7.317  -0.514  -1.166  1.00 0.00 ? 96  ILE A CD1  5  
ATOM 8880  H H    . ILE A 1 96  ? -9.005  -4.006  -1.324  1.00 0.00 ? 96  ILE A H    5  
ATOM 8881  H HA   . ILE A 1 96  ? -9.767  -2.947  1.160   1.00 0.00 ? 96  ILE A HA   5  
ATOM 8882  H HB   . ILE A 1 96  ? -9.747  -1.635  -1.559  1.00 0.00 ? 96  ILE A HB   5  
ATOM 8883  H HG12 . ILE A 1 96  ? -7.752  -1.401  0.698   1.00 0.00 ? 96  ILE A HG12 5  
ATOM 8884  H HG13 . ILE A 1 96  ? -7.576  -2.541  -0.632  1.00 0.00 ? 96  ILE A HG13 5  
ATOM 8885  H HG21 . ILE A 1 96  ? -9.930  -0.369  1.172   1.00 0.00 ? 96  ILE A HG21 5  
ATOM 8886  H HG22 . ILE A 1 96  ? -9.752  0.492   -0.356  1.00 0.00 ? 96  ILE A HG22 5  
ATOM 8887  H HG23 . ILE A 1 96  ? -11.218 -0.432  -0.031  1.00 0.00 ? 96  ILE A HG23 5  
ATOM 8888  H HD11 . ILE A 1 96  ? -7.555  0.458   -0.758  1.00 0.00 ? 96  ILE A HD11 5  
ATOM 8889  H HD12 . ILE A 1 96  ? -6.248  -0.661  -1.149  1.00 0.00 ? 96  ILE A HD12 5  
ATOM 8890  H HD13 . ILE A 1 96  ? -7.672  -0.571  -2.185  1.00 0.00 ? 96  ILE A HD13 5  
ATOM 8891  N N    . LYS A 1 97  ? -12.167 -3.085  -1.100  1.00 0.00 ? 97  LYS A N    5  
ATOM 8892  C CA   . LYS A 1 97  ? -13.614 -3.060  -1.280  1.00 0.00 ? 97  LYS A CA   5  
ATOM 8893  C C    . LYS A 1 97  ? -14.305 -3.962  -0.262  1.00 0.00 ? 97  LYS A C    5  
ATOM 8894  O O    . LYS A 1 97  ? -15.386 -3.642  0.233   1.00 0.00 ? 97  LYS A O    5  
ATOM 8895  C CB   . LYS A 1 97  ? -13.979 -3.501  -2.699  1.00 0.00 ? 97  LYS A CB   5  
ATOM 8896  C CG   . LYS A 1 97  ? -15.271 -2.888  -3.212  1.00 0.00 ? 97  LYS A CG   5  
ATOM 8897  C CD   . LYS A 1 97  ? -15.419 -3.076  -4.713  1.00 0.00 ? 97  LYS A CD   5  
ATOM 8898  C CE   . LYS A 1 97  ? -14.569 -2.080  -5.486  1.00 0.00 ? 97  LYS A CE   5  
ATOM 8899  N NZ   . LYS A 1 97  ? -15.312 -0.822  -5.773  1.00 0.00 ? 97  LYS A NZ   5  
ATOM 8900  H H    . LYS A 1 97  ? -11.593 -3.285  -1.869  1.00 0.00 ? 97  LYS A H    5  
ATOM 8901  H HA   . LYS A 1 97  ? -13.949 -2.045  -1.130  1.00 0.00 ? 97  LYS A HA   5  
ATOM 8902  H HB2  . LYS A 1 97  ? -13.180 -3.218  -3.368  1.00 0.00 ? 97  LYS A HB2  5  
ATOM 8903  H HB3  . LYS A 1 97  ? -14.085 -4.576  -2.713  1.00 0.00 ? 97  LYS A HB3  5  
ATOM 8904  H HG2  . LYS A 1 97  ? -16.105 -3.362  -2.717  1.00 0.00 ? 97  LYS A HG2  5  
ATOM 8905  H HG3  . LYS A 1 97  ? -15.270 -1.830  -2.989  1.00 0.00 ? 97  LYS A HG3  5  
ATOM 8906  H HD2  . LYS A 1 97  ? -15.108 -4.076  -4.975  1.00 0.00 ? 97  LYS A HD2  5  
ATOM 8907  H HD3  . LYS A 1 97  ? -16.456 -2.937  -4.984  1.00 0.00 ? 97  LYS A HD3  5  
ATOM 8908  H HE2  . LYS A 1 97  ? -13.692 -1.844  -4.902  1.00 0.00 ? 97  LYS A HE2  5  
ATOM 8909  H HE3  . LYS A 1 97  ? -14.268 -2.531  -6.420  1.00 0.00 ? 97  LYS A HE3  5  
ATOM 8910  H HZ1  . LYS A 1 97  ? -14.769 -0.001  -5.435  1.00 0.00 ? 97  LYS A HZ1  5  
ATOM 8911  H HZ2  . LYS A 1 97  ? -16.234 -0.834  -5.293  1.00 0.00 ? 97  LYS A HZ2  5  
ATOM 8912  H HZ3  . LYS A 1 97  ? -15.467 -0.723  -6.797  1.00 0.00 ? 97  LYS A HZ3  5  
ATOM 8913  N N    . THR A 1 98  ? -13.673 -5.090  0.048   1.00 0.00 ? 98  THR A N    5  
ATOM 8914  C CA   . THR A 1 98  ? -14.227 -6.037  1.007   1.00 0.00 ? 98  THR A CA   5  
ATOM 8915  C C    . THR A 1 98  ? -13.799 -5.694  2.429   1.00 0.00 ? 98  THR A C    5  
ATOM 8916  O O    . THR A 1 98  ? -14.459 -6.074  3.395   1.00 0.00 ? 98  THR A O    5  
ATOM 8917  C CB   . THR A 1 98  ? -13.792 -7.480  0.686   1.00 0.00 ? 98  THR A CB   5  
ATOM 8918  O OG1  . THR A 1 98  ? -12.370 -7.601  0.805   1.00 0.00 ? 98  THR A OG1  5  
ATOM 8919  C CG2  . THR A 1 98  ? -14.224 -7.876  -0.718  1.00 0.00 ? 98  THR A CG2  5  
ATOM 8920  H H    . THR A 1 98  ? -12.814 -5.288  -0.381  1.00 0.00 ? 98  THR A H    5  
ATOM 8921  H HA   . THR A 1 98  ? -15.304 -5.985  0.943   1.00 0.00 ? 98  THR A HA   5  
ATOM 8922  H HB   . THR A 1 98  ? -14.263 -8.147  1.394   1.00 0.00 ? 98  THR A HB   5  
ATOM 8923  H HG1  . THR A 1 98  ? -11.955 -6.777  0.537   1.00 0.00 ? 98  THR A HG1  5  
ATOM 8924  H HG21 . THR A 1 98  ? -13.524 -8.592  -1.122  1.00 0.00 ? 98  THR A HG21 5  
ATOM 8925  H HG22 . THR A 1 98  ? -14.248 -6.999  -1.348  1.00 0.00 ? 98  THR A HG22 5  
ATOM 8926  H HG23 . THR A 1 98  ? -15.208 -8.318  -0.679  1.00 0.00 ? 98  THR A HG23 5  
ATOM 8927  N N    . ALA A 1 99  ? -12.689 -4.972  2.550   1.00 0.00 ? 99  ALA A N    5  
ATOM 8928  C CA   . ALA A 1 99  ? -12.175 -4.575  3.855   1.00 0.00 ? 99  ALA A CA   5  
ATOM 8929  C C    . ALA A 1 99  ? -13.076 -3.531  4.506   1.00 0.00 ? 99  ALA A C    5  
ATOM 8930  O O    . ALA A 1 99  ? -13.715 -2.722  3.833   1.00 0.00 ? 99  ALA A O    5  
ATOM 8931  C CB   . ALA A 1 99  ? -10.756 -4.041  3.722   1.00 0.00 ? 99  ALA A CB   5  
ATOM 8932  H H    . ALA A 1 99  ? -12.206 -4.699  1.742   1.00 0.00 ? 99  ALA A H    5  
ATOM 8933  H HA   . ALA A 1 99  ? -12.146 -5.454  4.483   1.00 0.00 ? 99  ALA A HA   5  
ATOM 8934  H HB1  . ALA A 1 99  ? -10.091 -4.851  3.458   1.00 0.00 ? 99  ALA A HB1  5  
ATOM 8935  H HB2  . ALA A 1 99  ? -10.727 -3.285  2.953   1.00 0.00 ? 99  ALA A HB2  5  
ATOM 8936  H HB3  . ALA A 1 99  ? -10.444 -3.612  4.663   1.00 0.00 ? 99  ALA A HB3  5  
ATOM 8937  N N    . PRO A 1 100 ? -13.131 -3.549  5.846   1.00 0.00 ? 100 PRO A N    5  
ATOM 8938  C CA   . PRO A 1 100 ? -13.951 -2.610  6.617   1.00 0.00 ? 100 PRO A CA   5  
ATOM 8939  C C    . PRO A 1 100 ? -13.411 -1.185  6.560   1.00 0.00 ? 100 PRO A C    5  
ATOM 8940  O O    . PRO A 1 100 ? -12.378 -0.928  5.942   1.00 0.00 ? 100 PRO A O    5  
ATOM 8941  C CB   . PRO A 1 100 ? -13.868 -3.156  8.044   1.00 0.00 ? 100 PRO A CB   5  
ATOM 8942  C CG   . PRO A 1 100 ? -12.584 -3.910  8.088   1.00 0.00 ? 100 PRO A CG   5  
ATOM 8943  C CD   . PRO A 1 100 ? -12.395 -4.486  6.711   1.00 0.00 ? 100 PRO A CD   5  
ATOM 8944  H HA   . PRO A 1 100 ? -14.979 -2.617  6.286   1.00 0.00 ? 100 PRO A HA   5  
ATOM 8945  H HB2  . PRO A 1 100 ? -13.870 -2.335  8.747   1.00 0.00 ? 100 PRO A HB2  5  
ATOM 8946  H HB3  . PRO A 1 100 ? -14.712 -3.803  8.236   1.00 0.00 ? 100 PRO A HB3  5  
ATOM 8947  H HG2  . PRO A 1 100 ? -11.773 -3.240  8.328   1.00 0.00 ? 100 PRO A HG2  5  
ATOM 8948  H HG3  . PRO A 1 100 ? -12.648 -4.702  8.819   1.00 0.00 ? 100 PRO A HG3  5  
ATOM 8949  H HD2  . PRO A 1 100 ? -11.347 -4.508  6.452   1.00 0.00 ? 100 PRO A HD2  5  
ATOM 8950  H HD3  . PRO A 1 100 ? -12.821 -5.477  6.655   1.00 0.00 ? 100 PRO A HD3  5  
ATOM 8951  N N    . SER A 1 101 ? -14.115 -0.264  7.208   1.00 0.00 ? 101 SER A N    5  
ATOM 8952  C CA   . SER A 1 101 ? -13.707 1.136   7.228   1.00 0.00 ? 101 SER A CA   5  
ATOM 8953  C C    . SER A 1 101 ? -12.240 1.269   7.624   1.00 0.00 ? 101 SER A C    5  
ATOM 8954  O O    . SER A 1 101 ? -11.411 1.727   6.837   1.00 0.00 ? 101 SER A O    5  
ATOM 8955  C CB   . SER A 1 101 ? -14.583 1.931   8.199   1.00 0.00 ? 101 SER A CB   5  
ATOM 8956  O OG   . SER A 1 101 ? -15.838 2.240   7.618   1.00 0.00 ? 101 SER A OG   5  
ATOM 8957  H H    . SER A 1 101 ? -14.930 -0.531  7.682   1.00 0.00 ? 101 SER A H    5  
ATOM 8958  H HA   . SER A 1 101 ? -13.837 1.533   6.232   1.00 0.00 ? 101 SER A HA   5  
ATOM 8959  H HB2  . SER A 1 101 ? -14.747 1.347   9.092   1.00 0.00 ? 101 SER A HB2  5  
ATOM 8960  H HB3  . SER A 1 101 ? -14.083 2.853   8.458   1.00 0.00 ? 101 SER A HB3  5  
ATOM 8961  H HG   . SER A 1 101 ? -15.710 2.514   6.707   1.00 0.00 ? 101 SER A HG   5  
ATOM 8962  N N    . LYS A 1 102 ? -11.926 0.865   8.850   1.00 0.00 ? 102 LYS A N    5  
ATOM 8963  C CA   . LYS A 1 102 ? -10.559 0.937   9.353   1.00 0.00 ? 102 LYS A CA   5  
ATOM 8964  C C    . LYS A 1 102 ? -9.687  -0.140  8.715   1.00 0.00 ? 102 LYS A C    5  
ATOM 8965  O O    . LYS A 1 102 ? -9.823  -1.325  9.022   1.00 0.00 ? 102 LYS A O    5  
ATOM 8966  C CB   . LYS A 1 102 ? -10.545 0.783   10.876  1.00 0.00 ? 102 LYS A CB   5  
ATOM 8967  C CG   . LYS A 1 102 ? -9.239  1.215   11.519  1.00 0.00 ? 102 LYS A CG   5  
ATOM 8968  C CD   . LYS A 1 102 ? -9.439  1.625   12.968  1.00 0.00 ? 102 LYS A CD   5  
ATOM 8969  C CE   . LYS A 1 102 ? -9.750  3.109   13.090  1.00 0.00 ? 102 LYS A CE   5  
ATOM 8970  N NZ   . LYS A 1 102 ? -10.088 3.492   14.488  1.00 0.00 ? 102 LYS A NZ   5  
ATOM 8971  H H    . LYS A 1 102 ? -12.631 0.509   9.431   1.00 0.00 ? 102 LYS A H    5  
ATOM 8972  H HA   . LYS A 1 102 ? -10.160 1.906   9.094   1.00 0.00 ? 102 LYS A HA   5  
ATOM 8973  H HB2  . LYS A 1 102 ? -11.342 1.381   11.293  1.00 0.00 ? 102 LYS A HB2  5  
ATOM 8974  H HB3  . LYS A 1 102 ? -10.718 -0.254  11.122  1.00 0.00 ? 102 LYS A HB3  5  
ATOM 8975  H HG2  . LYS A 1 102 ? -8.540  0.392   11.482  1.00 0.00 ? 102 LYS A HG2  5  
ATOM 8976  H HG3  . LYS A 1 102 ? -8.837  2.054   10.969  1.00 0.00 ? 102 LYS A HG3  5  
ATOM 8977  H HD2  . LYS A 1 102 ? -10.262 1.062   13.382  1.00 0.00 ? 102 LYS A HD2  5  
ATOM 8978  H HD3  . LYS A 1 102 ? -8.537  1.408   13.522  1.00 0.00 ? 102 LYS A HD3  5  
ATOM 8979  H HE2  . LYS A 1 102 ? -8.886  3.672   12.770  1.00 0.00 ? 102 LYS A HE2  5  
ATOM 8980  H HE3  . LYS A 1 102 ? -10.587 3.341   12.449  1.00 0.00 ? 102 LYS A HE3  5  
ATOM 8981  H HZ1  . LYS A 1 102 ? -10.813 2.851   14.869  1.00 0.00 ? 102 LYS A HZ1  5  
ATOM 8982  H HZ2  . LYS A 1 102 ? -10.454 4.465   14.514  1.00 0.00 ? 102 LYS A HZ2  5  
ATOM 8983  H HZ3  . LYS A 1 102 ? -9.241  3.436   15.089  1.00 0.00 ? 102 LYS A HZ3  5  
ATOM 8984  N N    . VAL A 1 103 ? -8.792  0.279   7.827   1.00 0.00 ? 103 VAL A N    5  
ATOM 8985  C CA   . VAL A 1 103 ? -7.896  -0.650  7.148   1.00 0.00 ? 103 VAL A CA   5  
ATOM 8986  C C    . VAL A 1 103 ? -6.437  -0.267  7.369   1.00 0.00 ? 103 VAL A C    5  
ATOM 8987  O O    . VAL A 1 103 ? -6.096  0.914   7.438   1.00 0.00 ? 103 VAL A O    5  
ATOM 8988  C CB   . VAL A 1 103 ? -8.179  -0.697  5.634   1.00 0.00 ? 103 VAL A CB   5  
ATOM 8989  C CG1  . VAL A 1 103 ? -7.407  -1.834  4.982   1.00 0.00 ? 103 VAL A CG1  5  
ATOM 8990  C CG2  . VAL A 1 103 ? -9.671  -0.837  5.376   1.00 0.00 ? 103 VAL A CG2  5  
ATOM 8991  H H    . VAL A 1 103 ? -8.731  1.236   7.624   1.00 0.00 ? 103 VAL A H    5  
ATOM 8992  H HA   . VAL A 1 103 ? -8.066  -1.636  7.555   1.00 0.00 ? 103 VAL A HA   5  
ATOM 8993  H HB   . VAL A 1 103 ? -7.844  0.232   5.197   1.00 0.00 ? 103 VAL A HB   5  
ATOM 8994  H HG11 . VAL A 1 103 ? -6.468  -1.460  4.601   1.00 0.00 ? 103 VAL A HG11 5  
ATOM 8995  H HG12 . VAL A 1 103 ? -7.219  -2.607  5.713   1.00 0.00 ? 103 VAL A HG12 5  
ATOM 8996  H HG13 . VAL A 1 103 ? -7.988  -2.242  4.168   1.00 0.00 ? 103 VAL A HG13 5  
ATOM 8997  H HG21 . VAL A 1 103 ? -10.063 0.104   5.019   1.00 0.00 ? 103 VAL A HG21 5  
ATOM 8998  H HG22 . VAL A 1 103 ? -9.838  -1.601  4.631   1.00 0.00 ? 103 VAL A HG22 5  
ATOM 8999  H HG23 . VAL A 1 103 ? -10.172 -1.112  6.292   1.00 0.00 ? 103 VAL A HG23 5  
ATOM 9000  N N    . LYS A 1 104 ? -5.577  -1.275  7.481   1.00 0.00 ? 104 LYS A N    5  
ATOM 9001  C CA   . LYS A 1 104 ? -4.153  -1.046  7.693   1.00 0.00 ? 104 LYS A CA   5  
ATOM 9002  C C    . LYS A 1 104 ? -3.384  -1.148  6.380   1.00 0.00 ? 104 LYS A C    5  
ATOM 9003  O O    . LYS A 1 104 ? -3.402  -2.186  5.717   1.00 0.00 ? 104 LYS A O    5  
ATOM 9004  C CB   . LYS A 1 104 ? -3.598  -2.055  8.701   1.00 0.00 ? 104 LYS A CB   5  
ATOM 9005  C CG   . LYS A 1 104 ? -2.083  -2.037  8.808   1.00 0.00 ? 104 LYS A CG   5  
ATOM 9006  C CD   . LYS A 1 104 ? -1.541  -3.382  9.261   1.00 0.00 ? 104 LYS A CD   5  
ATOM 9007  C CE   . LYS A 1 104 ? -1.435  -3.459  10.776  1.00 0.00 ? 104 LYS A CE   5  
ATOM 9008  N NZ   . LYS A 1 104 ? -1.617  -4.849  11.276  1.00 0.00 ? 104 LYS A NZ   5  
ATOM 9009  H H    . LYS A 1 104 ? -5.909  -2.195  7.417   1.00 0.00 ? 104 LYS A H    5  
ATOM 9010  H HA   . LYS A 1 104 ? -4.033  -0.049  8.090   1.00 0.00 ? 104 LYS A HA   5  
ATOM 9011  H HB2  . LYS A 1 104 ? -4.010  -1.836  9.675   1.00 0.00 ? 104 LYS A HB2  5  
ATOM 9012  H HB3  . LYS A 1 104 ? -3.906  -3.047  8.405   1.00 0.00 ? 104 LYS A HB3  5  
ATOM 9013  H HG2  . LYS A 1 104 ? -1.666  -1.801  7.840   1.00 0.00 ? 104 LYS A HG2  5  
ATOM 9014  H HG3  . LYS A 1 104 ? -1.790  -1.282  9.523   1.00 0.00 ? 104 LYS A HG3  5  
ATOM 9015  H HD2  . LYS A 1 104 ? -2.204  -4.163  8.919   1.00 0.00 ? 104 LYS A HD2  5  
ATOM 9016  H HD3  . LYS A 1 104 ? -0.559  -3.528  8.832   1.00 0.00 ? 104 LYS A HD3  5  
ATOM 9017  H HE2  . LYS A 1 104 ? -0.460  -3.103  11.074  1.00 0.00 ? 104 LYS A HE2  5  
ATOM 9018  H HE3  . LYS A 1 104 ? -2.196  -2.827  11.209  1.00 0.00 ? 104 LYS A HE3  5  
ATOM 9019  H HZ1  . LYS A 1 104 ? -0.789  -5.139  11.835  1.00 0.00 ? 104 LYS A HZ1  5  
ATOM 9020  H HZ2  . LYS A 1 104 ? -1.727  -5.505  10.476  1.00 0.00 ? 104 LYS A HZ2  5  
ATOM 9021  H HZ3  . LYS A 1 104 ? -2.464  -4.906  11.877  1.00 0.00 ? 104 LYS A HZ3  5  
ATOM 9022  N N    . LEU A 1 105 ? -2.709  -0.066  6.009   1.00 0.00 ? 105 LEU A N    5  
ATOM 9023  C CA   . LEU A 1 105 ? -1.932  -0.034  4.775   1.00 0.00 ? 105 LEU A CA   5  
ATOM 9024  C C    . LEU A 1 105 ? -0.436  -0.092  5.072   1.00 0.00 ? 105 LEU A C    5  
ATOM 9025  O O    . LEU A 1 105 ? 0.179   0.917   5.416   1.00 0.00 ? 105 LEU A O    5  
ATOM 9026  C CB   . LEU A 1 105 ? -2.256  1.230   3.977   1.00 0.00 ? 105 LEU A CB   5  
ATOM 9027  C CG   . LEU A 1 105 ? -3.709  1.385   3.526   1.00 0.00 ? 105 LEU A CG   5  
ATOM 9028  C CD1  . LEU A 1 105 ? -4.072  2.856   3.393   1.00 0.00 ? 105 LEU A CD1  5  
ATOM 9029  C CD2  . LEU A 1 105 ? -3.940  0.656   2.211   1.00 0.00 ? 105 LEU A CD2  5  
ATOM 9030  H H    . LEU A 1 105 ? -2.733  0.731   6.578   1.00 0.00 ? 105 LEU A H    5  
ATOM 9031  H HA   . LEU A 1 105 ? -2.204  -0.899  4.189   1.00 0.00 ? 105 LEU A HA   5  
ATOM 9032  H HB2  . LEU A 1 105 ? -2.008  2.082   4.592   1.00 0.00 ? 105 LEU A HB2  5  
ATOM 9033  H HB3  . LEU A 1 105 ? -1.632  1.232   3.094   1.00 0.00 ? 105 LEU A HB3  5  
ATOM 9034  H HG   . LEU A 1 105 ? -4.359  0.947   4.271   1.00 0.00 ? 105 LEU A HG   5  
ATOM 9035  H HD11 . LEU A 1 105 ? -3.497  3.298   2.594   1.00 0.00 ? 105 LEU A HD11 5  
ATOM 9036  H HD12 . LEU A 1 105 ? -3.852  3.366   4.319   1.00 0.00 ? 105 LEU A HD12 5  
ATOM 9037  H HD13 . LEU A 1 105 ? -5.126  2.948   3.174   1.00 0.00 ? 105 LEU A HD13 5  
ATOM 9038  H HD21 . LEU A 1 105 ? -4.964  0.795   1.898   1.00 0.00 ? 105 LEU A HD21 5  
ATOM 9039  H HD22 . LEU A 1 105 ? -3.745  -0.399  2.345   1.00 0.00 ? 105 LEU A HD22 5  
ATOM 9040  H HD23 . LEU A 1 105 ? -3.275  1.052   1.458   1.00 0.00 ? 105 LEU A HD23 5  
ATOM 9041  N N    . VAL A 1 106 ? 0.143   -1.281  4.933   1.00 0.00 ? 106 VAL A N    5  
ATOM 9042  C CA   . VAL A 1 106 ? 1.567   -1.470  5.183   1.00 0.00 ? 106 VAL A CA   5  
ATOM 9043  C C    . VAL A 1 106 ? 2.377   -1.298  3.903   1.00 0.00 ? 106 VAL A C    5  
ATOM 9044  O O    . VAL A 1 106 ? 2.336   -2.145  3.010   1.00 0.00 ? 106 VAL A O    5  
ATOM 9045  C CB   . VAL A 1 106 ? 1.852   -2.864  5.774   1.00 0.00 ? 106 VAL A CB   5  
ATOM 9046  C CG1  . VAL A 1 106 ? 3.338   -3.031  6.054   1.00 0.00 ? 106 VAL A CG1  5  
ATOM 9047  C CG2  . VAL A 1 106 ? 1.035   -3.083  7.038   1.00 0.00 ? 106 VAL A CG2  5  
ATOM 9048  H H    . VAL A 1 106 ? -0.400  -2.048  4.655   1.00 0.00 ? 106 VAL A H    5  
ATOM 9049  H HA   . VAL A 1 106 ? 1.882   -0.727  5.900   1.00 0.00 ? 106 VAL A HA   5  
ATOM 9050  H HB   . VAL A 1 106 ? 1.560   -3.608  5.047   1.00 0.00 ? 106 VAL A HB   5  
ATOM 9051  H HG11 . VAL A 1 106 ? 3.648   -4.026  5.769   1.00 0.00 ? 106 VAL A HG11 5  
ATOM 9052  H HG12 . VAL A 1 106 ? 3.896   -2.301  5.486   1.00 0.00 ? 106 VAL A HG12 5  
ATOM 9053  H HG13 . VAL A 1 106 ? 3.524   -2.886  7.108   1.00 0.00 ? 106 VAL A HG13 5  
ATOM 9054  H HG21 . VAL A 1 106 ? 1.454   -2.499  7.843   1.00 0.00 ? 106 VAL A HG21 5  
ATOM 9055  H HG22 . VAL A 1 106 ? 0.014   -2.776  6.864   1.00 0.00 ? 106 VAL A HG22 5  
ATOM 9056  H HG23 . VAL A 1 106 ? 1.055   -4.130  7.303   1.00 0.00 ? 106 VAL A HG23 5  
ATOM 9057  N N    . PHE A 1 107 ? 3.115   -0.196  3.820   1.00 0.00 ? 107 PHE A N    5  
ATOM 9058  C CA   . PHE A 1 107 ? 3.935   0.089   2.649   1.00 0.00 ? 107 PHE A CA   5  
ATOM 9059  C C    . PHE A 1 107 ? 5.321   0.577   3.061   1.00 0.00 ? 107 PHE A C    5  
ATOM 9060  O O    . PHE A 1 107 ? 5.647   0.622   4.247   1.00 0.00 ? 107 PHE A O    5  
ATOM 9061  C CB   . PHE A 1 107 ? 3.255   1.137   1.765   1.00 0.00 ? 107 PHE A CB   5  
ATOM 9062  C CG   . PHE A 1 107 ? 3.114   2.478   2.427   1.00 0.00 ? 107 PHE A CG   5  
ATOM 9063  C CD1  . PHE A 1 107 ? 4.113   3.431   2.309   1.00 0.00 ? 107 PHE A CD1  5  
ATOM 9064  C CD2  . PHE A 1 107 ? 1.983   2.786   3.165   1.00 0.00 ? 107 PHE A CD2  5  
ATOM 9065  C CE1  . PHE A 1 107 ? 3.987   4.666   2.918   1.00 0.00 ? 107 PHE A CE1  5  
ATOM 9066  C CE2  . PHE A 1 107 ? 1.851   4.020   3.775   1.00 0.00 ? 107 PHE A CE2  5  
ATOM 9067  C CZ   . PHE A 1 107 ? 2.854   4.961   3.650   1.00 0.00 ? 107 PHE A CZ   5  
ATOM 9068  H H    . PHE A 1 107 ? 3.107   0.442   4.565   1.00 0.00 ? 107 PHE A H    5  
ATOM 9069  H HA   . PHE A 1 107 ? 4.041   -0.827  2.089   1.00 0.00 ? 107 PHE A HA   5  
ATOM 9070  H HB2  . PHE A 1 107 ? 3.836   1.271   0.865   1.00 0.00 ? 107 PHE A HB2  5  
ATOM 9071  H HB3  . PHE A 1 107 ? 2.267   0.790   1.503   1.00 0.00 ? 107 PHE A HB3  5  
ATOM 9072  H HD1  . PHE A 1 107 ? 5.000   3.203   1.736   1.00 0.00 ? 107 PHE A HD1  5  
ATOM 9073  H HD2  . PHE A 1 107 ? 1.198   2.050   3.263   1.00 0.00 ? 107 PHE A HD2  5  
ATOM 9074  H HE1  . PHE A 1 107 ? 4.772   5.400   2.818   1.00 0.00 ? 107 PHE A HE1  5  
ATOM 9075  H HE2  . PHE A 1 107 ? 0.963   4.247   4.347   1.00 0.00 ? 107 PHE A HE2  5  
ATOM 9076  H HZ   . PHE A 1 107 ? 2.753   5.925   4.127   1.00 0.00 ? 107 PHE A HZ   5  
ATOM 9077  N N    . ILE A 1 108 ? 6.132   0.941   2.073   1.00 0.00 ? 108 ILE A N    5  
ATOM 9078  C CA   . ILE A 1 108 ? 7.481   1.427   2.332   1.00 0.00 ? 108 ILE A CA   5  
ATOM 9079  C C    . ILE A 1 108 ? 7.688   2.818   1.744   1.00 0.00 ? 108 ILE A C    5  
ATOM 9080  O O    . ILE A 1 108 ? 7.292   3.089   0.610   1.00 0.00 ? 108 ILE A O    5  
ATOM 9081  C CB   . ILE A 1 108 ? 8.543   0.473   1.753   1.00 0.00 ? 108 ILE A CB   5  
ATOM 9082  C CG1  . ILE A 1 108 ? 9.948   0.964   2.108   1.00 0.00 ? 108 ILE A CG1  5  
ATOM 9083  C CG2  . ILE A 1 108 ? 8.383   0.356   0.244   1.00 0.00 ? 108 ILE A CG2  5  
ATOM 9084  C CD1  . ILE A 1 108 ? 10.960  -0.152  2.251   1.00 0.00 ? 108 ILE A CD1  5  
ATOM 9085  H H    . ILE A 1 108 ? 5.814   0.883   1.148   1.00 0.00 ? 108 ILE A H    5  
ATOM 9086  H HA   . ILE A 1 108 ? 7.617   1.476   3.403   1.00 0.00 ? 108 ILE A HA   5  
ATOM 9087  H HB   . ILE A 1 108 ? 8.391   -0.504  2.184   1.00 0.00 ? 108 ILE A HB   5  
ATOM 9088  H HG12 . ILE A 1 108 ? 10.297  1.629   1.334   1.00 0.00 ? 108 ILE A HG12 5  
ATOM 9089  H HG13 . ILE A 1 108 ? 9.908   1.498   3.046   1.00 0.00 ? 108 ILE A HG13 5  
ATOM 9090  H HG21 . ILE A 1 108 ? 9.314   0.617   -0.238  1.00 0.00 ? 108 ILE A HG21 5  
ATOM 9091  H HG22 . ILE A 1 108 ? 8.118   -0.659  -0.011  1.00 0.00 ? 108 ILE A HG22 5  
ATOM 9092  H HG23 . ILE A 1 108 ? 7.605   1.026   -0.089  1.00 0.00 ? 108 ILE A HG23 5  
ATOM 9093  H HD11 . ILE A 1 108 ? 10.634  -1.009  1.679   1.00 0.00 ? 108 ILE A HD11 5  
ATOM 9094  H HD12 . ILE A 1 108 ? 11.919  0.182   1.886   1.00 0.00 ? 108 ILE A HD12 5  
ATOM 9095  H HD13 . ILE A 1 108 ? 11.046  -0.428  3.292   1.00 0.00 ? 108 ILE A HD13 5  
ATOM 9096  N N    . ARG A 1 109 ? 8.312   3.697   2.521   1.00 0.00 ? 109 ARG A N    5  
ATOM 9097  C CA   . ARG A 1 109 ? 8.572   5.061   2.077   1.00 0.00 ? 109 ARG A CA   5  
ATOM 9098  C C    . ARG A 1 109 ? 9.977   5.184   1.494   1.00 0.00 ? 109 ARG A C    5  
ATOM 9099  O O    . ARG A 1 109 ? 10.969  5.080   2.213   1.00 0.00 ? 109 ARG A O    5  
ATOM 9100  C CB   . ARG A 1 109 ? 8.403   6.040   3.240   1.00 0.00 ? 109 ARG A CB   5  
ATOM 9101  C CG   . ARG A 1 109 ? 8.337   7.495   2.807   1.00 0.00 ? 109 ARG A CG   5  
ATOM 9102  C CD   . ARG A 1 109 ? 7.725   8.371   3.889   1.00 0.00 ? 109 ARG A CD   5  
ATOM 9103  N NE   . ARG A 1 109 ? 7.133   9.588   3.338   1.00 0.00 ? 109 ARG A NE   5  
ATOM 9104  C CZ   . ARG A 1 109 ? 7.824   10.696  3.095   1.00 0.00 ? 109 ARG A CZ   5  
ATOM 9105  N NH1  . ARG A 1 109 ? 9.124   10.741  3.352   1.00 0.00 ? 109 ARG A NH1  5  
ATOM 9106  N NH2  . ARG A 1 109 ? 7.214   11.762  2.593   1.00 0.00 ? 109 ARG A NH2  5  
ATOM 9107  H H    . ARG A 1 109 ? 8.603   3.422   3.416   1.00 0.00 ? 109 ARG A H    5  
ATOM 9108  H HA   . ARG A 1 109 ? 7.853   5.302   1.308   1.00 0.00 ? 109 ARG A HA   5  
ATOM 9109  H HB2  . ARG A 1 109 ? 7.490   5.802   3.766   1.00 0.00 ? 109 ARG A HB2  5  
ATOM 9110  H HB3  . ARG A 1 109 ? 9.238   5.925   3.915   1.00 0.00 ? 109 ARG A HB3  5  
ATOM 9111  H HG2  . ARG A 1 109 ? 9.338   7.845   2.599   1.00 0.00 ? 109 ARG A HG2  5  
ATOM 9112  H HG3  . ARG A 1 109 ? 7.736   7.568   1.913   1.00 0.00 ? 109 ARG A HG3  5  
ATOM 9113  H HD2  . ARG A 1 109 ? 6.958   7.808   4.398   1.00 0.00 ? 109 ARG A HD2  5  
ATOM 9114  H HD3  . ARG A 1 109 ? 8.498   8.644   4.592   1.00 0.00 ? 109 ARG A HD3  5  
ATOM 9115  H HE   . ARG A 1 109 ? 6.174   9.576   3.141   1.00 0.00 ? 109 ARG A HE   5  
ATOM 9116  H HH11 . ARG A 1 109 ? 9.586   9.939   3.729   1.00 0.00 ? 109 ARG A HH11 5  
ATOM 9117  H HH12 . ARG A 1 109 ? 9.641   11.577  3.167   1.00 0.00 ? 109 ARG A HH12 5  
ATOM 9118  H HH21 . ARG A 1 109 ? 6.234   11.732  2.398   1.00 0.00 ? 109 ARG A HH21 5  
ATOM 9119  H HH22 . ARG A 1 109 ? 7.734   12.596  2.411   1.00 0.00 ? 109 ARG A HH22 5  
ATOM 9120  N N    . ASN A 1 110 ? 10.052  5.405   0.186   1.00 0.00 ? 110 ASN A N    5  
ATOM 9121  C CA   . ASN A 1 110 ? 11.334  5.542   -0.494  1.00 0.00 ? 110 ASN A CA   5  
ATOM 9122  C C    . ASN A 1 110 ? 11.242  6.554   -1.632  1.00 0.00 ? 110 ASN A C    5  
ATOM 9123  O O    . ASN A 1 110 ? 10.197  6.697   -2.266  1.00 0.00 ? 110 ASN A O    5  
ATOM 9124  C CB   . ASN A 1 110 ? 11.793  4.187   -1.038  1.00 0.00 ? 110 ASN A CB   5  
ATOM 9125  C CG   . ASN A 1 110 ? 13.233  4.212   -1.513  1.00 0.00 ? 110 ASN A CG   5  
ATOM 9126  O OD1  . ASN A 1 110 ? 13.819  5.279   -1.699  1.00 0.00 ? 110 ASN A OD1  5  
ATOM 9127  N ND2  . ASN A 1 110 ? 13.812  3.033   -1.711  1.00 0.00 ? 110 ASN A ND2  5  
ATOM 9128  H H    . ASN A 1 110 ? 9.225   5.479   -0.335  1.00 0.00 ? 110 ASN A H    5  
ATOM 9129  H HA   . ASN A 1 110 ? 12.056  5.893   0.227   1.00 0.00 ? 110 ASN A HA   5  
ATOM 9130  H HB2  . ASN A 1 110 ? 11.705  3.444   -0.259  1.00 0.00 ? 110 ASN A HB2  5  
ATOM 9131  H HB3  . ASN A 1 110 ? 11.164  3.907   -1.870  1.00 0.00 ? 110 ASN A HB3  5  
ATOM 9132  H HD21 . ASN A 1 110 ? 13.284  2.225   -1.543  1.00 0.00 ? 110 ASN A HD21 5  
ATOM 9133  H HD22 . ASN A 1 110 ? 14.742  3.021   -2.017  1.00 0.00 ? 110 ASN A HD22 5  
ATOM 9134  N N    . GLU A 1 111 ? 12.344  7.254   -1.884  1.00 0.00 ? 111 GLU A N    5  
ATOM 9135  C CA   . GLU A 1 111 ? 12.387  8.254   -2.945  1.00 0.00 ? 111 GLU A CA   5  
ATOM 9136  C C    . GLU A 1 111 ? 12.682  7.603   -4.294  1.00 0.00 ? 111 GLU A C    5  
ATOM 9137  O O    . GLU A 1 111 ? 12.251  8.091   -5.338  1.00 0.00 ? 111 GLU A O    5  
ATOM 9138  C CB   . GLU A 1 111 ? 13.445  9.314   -2.635  1.00 0.00 ? 111 GLU A CB   5  
ATOM 9139  C CG   . GLU A 1 111 ? 14.871  8.794   -2.718  1.00 0.00 ? 111 GLU A CG   5  
ATOM 9140  C CD   . GLU A 1 111 ? 15.867  9.711   -2.035  1.00 0.00 ? 111 GLU A CD   5  
ATOM 9141  O OE1  . GLU A 1 111 ? 15.900  9.729   -0.787  1.00 0.00 ? 111 GLU A OE1  5  
ATOM 9142  O OE2  . GLU A 1 111 ? 16.614  10.410  -2.751  1.00 0.00 ? 111 GLU A OE2  5  
ATOM 9143  H H    . GLU A 1 111 ? 13.146  7.095   -1.344  1.00 0.00 ? 111 GLU A H    5  
ATOM 9144  H HA   . GLU A 1 111 ? 11.418  8.728   -2.993  1.00 0.00 ? 111 GLU A HA   5  
ATOM 9145  H HB2  . GLU A 1 111 ? 13.339  10.127  -3.338  1.00 0.00 ? 111 GLU A HB2  5  
ATOM 9146  H HB3  . GLU A 1 111 ? 13.279  9.689   -1.636  1.00 0.00 ? 111 GLU A HB3  5  
ATOM 9147  H HG2  . GLU A 1 111 ? 14.914  7.824   -2.244  1.00 0.00 ? 111 GLU A HG2  5  
ATOM 9148  H HG3  . GLU A 1 111 ? 15.146  8.697   -3.758  1.00 0.00 ? 111 GLU A HG3  5  
ATOM 9149  N N    . ASP A 1 112 ? 13.421  6.500   -4.262  1.00 0.00 ? 112 ASP A N    5  
ATOM 9150  C CA   . ASP A 1 112 ? 13.775  5.781   -5.481  1.00 0.00 ? 112 ASP A CA   5  
ATOM 9151  C C    . ASP A 1 112 ? 12.573  5.018   -6.030  1.00 0.00 ? 112 ASP A C    5  
ATOM 9152  O O    . ASP A 1 112 ? 12.519  4.698   -7.217  1.00 0.00 ? 112 ASP A O    5  
ATOM 9153  C CB   . ASP A 1 112 ? 14.929  4.814   -5.212  1.00 0.00 ? 112 ASP A CB   5  
ATOM 9154  C CG   . ASP A 1 112 ? 15.563  4.299   -6.489  1.00 0.00 ? 112 ASP A CG   5  
ATOM 9155  O OD1  . ASP A 1 112 ? 15.672  5.083   -7.455  1.00 0.00 ? 112 ASP A OD1  5  
ATOM 9156  O OD2  . ASP A 1 112 ? 15.951  3.113   -6.522  1.00 0.00 ? 112 ASP A OD2  5  
ATOM 9157  H H    . ASP A 1 112 ? 13.736  6.160   -3.398  1.00 0.00 ? 112 ASP A H    5  
ATOM 9158  H HA   . ASP A 1 112 ? 14.090  6.508   -6.215  1.00 0.00 ? 112 ASP A HA   5  
ATOM 9159  H HB2  . ASP A 1 112 ? 15.688  5.321   -4.634  1.00 0.00 ? 112 ASP A HB2  5  
ATOM 9160  H HB3  . ASP A 1 112 ? 14.558  3.970   -4.649  1.00 0.00 ? 112 ASP A HB3  5  
ATOM 9161  N N    . ALA A 1 113 ? 11.612  4.730   -5.158  1.00 0.00 ? 113 ALA A N    5  
ATOM 9162  C CA   . ALA A 1 113 ? 10.411  4.006   -5.556  1.00 0.00 ? 113 ALA A CA   5  
ATOM 9163  C C    . ALA A 1 113 ? 9.751   4.661   -6.764  1.00 0.00 ? 113 ALA A C    5  
ATOM 9164  O O    . ALA A 1 113 ? 9.384   3.985   -7.726  1.00 0.00 ? 113 ALA A O    5  
ATOM 9165  C CB   . ALA A 1 113 ? 9.432   3.930   -4.394  1.00 0.00 ? 113 ALA A CB   5  
ATOM 9166  H H    . ALA A 1 113 ? 11.713  5.013   -4.225  1.00 0.00 ? 113 ALA A H    5  
ATOM 9167  H HA   . ALA A 1 113 ? 10.701  2.999   -5.818  1.00 0.00 ? 113 ALA A HA   5  
ATOM 9168  H HB1  . ALA A 1 113 ? 8.561   4.527   -4.619  1.00 0.00 ? 113 ALA A HB1  5  
ATOM 9169  H HB2  . ALA A 1 113 ? 9.135   2.903   -4.241  1.00 0.00 ? 113 ALA A HB2  5  
ATOM 9170  H HB3  . ALA A 1 113 ? 9.906   4.306   -3.499  1.00 0.00 ? 113 ALA A HB3  5  
ATOM 9171  N N    . VAL A 1 114 ? 9.601   5.981   -6.709  1.00 0.00 ? 114 VAL A N    5  
ATOM 9172  C CA   . VAL A 1 114 ? 8.985   6.727   -7.800  1.00 0.00 ? 114 VAL A CA   5  
ATOM 9173  C C    . VAL A 1 114 ? 9.638   6.388   -9.135  1.00 0.00 ? 114 VAL A C    5  
ATOM 9174  O O    . VAL A 1 114 ? 9.039   6.571   -10.194 1.00 0.00 ? 114 VAL A O    5  
ATOM 9175  C CB   . VAL A 1 114 ? 9.080   8.246   -7.565  1.00 0.00 ? 114 VAL A CB   5  
ATOM 9176  C CG1  . VAL A 1 114 ? 8.390   8.630   -6.265  1.00 0.00 ? 114 VAL A CG1  5  
ATOM 9177  C CG2  . VAL A 1 114 ? 10.534  8.693   -7.558  1.00 0.00 ? 114 VAL A CG2  5  
ATOM 9178  H H    . VAL A 1 114 ? 9.913   6.464   -5.916  1.00 0.00 ? 114 VAL A H    5  
ATOM 9179  H HA   . VAL A 1 114 ? 7.940   6.455   -7.841  1.00 0.00 ? 114 VAL A HA   5  
ATOM 9180  H HB   . VAL A 1 114 ? 8.575   8.748   -8.377  1.00 0.00 ? 114 VAL A HB   5  
ATOM 9181  H HG11 . VAL A 1 114 ? 8.890   8.150   -5.437  1.00 0.00 ? 114 VAL A HG11 5  
ATOM 9182  H HG12 . VAL A 1 114 ? 8.430   9.702   -6.139  1.00 0.00 ? 114 VAL A HG12 5  
ATOM 9183  H HG13 . VAL A 1 114 ? 7.359   8.309   -6.296  1.00 0.00 ? 114 VAL A HG13 5  
ATOM 9184  H HG21 . VAL A 1 114 ? 10.785  9.114   -8.520  1.00 0.00 ? 114 VAL A HG21 5  
ATOM 9185  H HG22 . VAL A 1 114 ? 10.679  9.439   -6.790  1.00 0.00 ? 114 VAL A HG22 5  
ATOM 9186  H HG23 . VAL A 1 114 ? 11.172  7.844   -7.359  1.00 0.00 ? 114 VAL A HG23 5  
ATOM 9187  N N    . ASN A 1 115 ? 10.869  5.892   -9.076  1.00 0.00 ? 115 ASN A N    5  
ATOM 9188  C CA   . ASN A 1 115 ? 11.605  5.527   -10.282 1.00 0.00 ? 115 ASN A CA   5  
ATOM 9189  C C    . ASN A 1 115 ? 11.312  4.084   -10.682 1.00 0.00 ? 115 ASN A C    5  
ATOM 9190  O O    . ASN A 1 115 ? 11.468  3.708   -11.843 1.00 0.00 ? 115 ASN A O    5  
ATOM 9191  C CB   . ASN A 1 115 ? 13.107  5.713   -10.064 1.00 0.00 ? 115 ASN A CB   5  
ATOM 9192  C CG   . ASN A 1 115 ? 13.481  7.162   -9.819  1.00 0.00 ? 115 ASN A CG   5  
ATOM 9193  O OD1  . ASN A 1 115 ? 12.720  8.074   -10.140 1.00 0.00 ? 115 ASN A OD1  5  
ATOM 9194  N ND2  . ASN A 1 115 ? 14.660  7.380   -9.247  1.00 0.00 ? 115 ASN A ND2  5  
ATOM 9195  H H    . ASN A 1 115 ? 11.294  5.769   -8.202  1.00 0.00 ? 115 ASN A H    5  
ATOM 9196  H HA   . ASN A 1 115 ? 11.282  6.181   -11.078 1.00 0.00 ? 115 ASN A HA   5  
ATOM 9197  H HB2  . ASN A 1 115 ? 13.415  5.132   -9.206  1.00 0.00 ? 115 ASN A HB2  5  
ATOM 9198  H HB3  . ASN A 1 115 ? 13.638  5.366   -10.937 1.00 0.00 ? 115 ASN A HB3  5  
ATOM 9199  H HD21 . ASN A 1 115 ? 15.215  6.605   -9.018  1.00 0.00 ? 115 ASN A HD21 5  
ATOM 9200  H HD22 . ASN A 1 115 ? 14.926  8.308   -9.076  1.00 0.00 ? 115 ASN A HD22 5  
ATOM 9201  N N    . GLN A 1 116 ? 10.886  3.282   -9.711  1.00 0.00 ? 116 GLN A N    5  
ATOM 9202  C CA   . GLN A 1 116 ? 10.572  1.880   -9.962  1.00 0.00 ? 116 GLN A CA   5  
ATOM 9203  C C    . GLN A 1 116 ? 9.099   1.708   -10.318 1.00 0.00 ? 116 GLN A C    5  
ATOM 9204  O O    . GLN A 1 116 ? 8.733   0.802   -11.067 1.00 0.00 ? 116 GLN A O    5  
ATOM 9205  C CB   . GLN A 1 116 ? 10.915  1.031   -8.737  1.00 0.00 ? 116 GLN A CB   5  
ATOM 9206  C CG   . GLN A 1 116 ? 12.409  0.874   -8.505  1.00 0.00 ? 116 GLN A CG   5  
ATOM 9207  C CD   . GLN A 1 116 ? 12.742  -0.324  -7.638  1.00 0.00 ? 116 GLN A CD   5  
ATOM 9208  O OE1  . GLN A 1 116 ? 12.311  -1.443  -7.914  1.00 0.00 ? 116 GLN A OE1  5  
ATOM 9209  N NE2  . GLN A 1 116 ? 13.514  -0.094  -6.582  1.00 0.00 ? 116 GLN A NE2  5  
ATOM 9210  H H    . GLN A 1 116 ? 10.781  3.640   -8.806  1.00 0.00 ? 116 GLN A H    5  
ATOM 9211  H HA   . GLN A 1 116 ? 11.172  1.551   -10.797 1.00 0.00 ? 116 GLN A HA   5  
ATOM 9212  H HB2  . GLN A 1 116 ? 10.483  1.492   -7.862  1.00 0.00 ? 116 GLN A HB2  5  
ATOM 9213  H HB3  . GLN A 1 116 ? 10.488  0.048   -8.865  1.00 0.00 ? 116 GLN A HB3  5  
ATOM 9214  H HG2  . GLN A 1 116 ? 12.898  0.755   -9.460  1.00 0.00 ? 116 GLN A HG2  5  
ATOM 9215  H HG3  . GLN A 1 116 ? 12.780  1.766   -8.021  1.00 0.00 ? 116 GLN A HG3  5  
ATOM 9216  H HE21 . GLN A 1 116 ? 13.820  0.824   -6.424  1.00 0.00 ? 116 GLN A HE21 5  
ATOM 9217  H HE22 . GLN A 1 116 ? 13.745  -0.850  -6.004  1.00 0.00 ? 116 GLN A HE22 5  
ATOM 9218  N N    . MET A 1 117 ? 8.258   2.584   -9.777  1.00 0.00 ? 117 MET A N    5  
ATOM 9219  C CA   . MET A 1 117 ? 6.824   2.528   -10.039 1.00 0.00 ? 117 MET A CA   5  
ATOM 9220  C C    . MET A 1 117 ? 6.505   3.063   -11.431 1.00 0.00 ? 117 MET A C    5  
ATOM 9221  O O    . MET A 1 117 ? 7.111   4.031   -11.889 1.00 0.00 ? 117 MET A O    5  
ATOM 9222  C CB   . MET A 1 117 ? 6.060   3.331   -8.984  1.00 0.00 ? 117 MET A CB   5  
ATOM 9223  C CG   . MET A 1 117 ? 6.496   4.784   -8.893  1.00 0.00 ? 117 MET A CG   5  
ATOM 9224  S SD   . MET A 1 117 ? 5.549   5.863   -9.985  1.00 0.00 ? 117 MET A SD   5  
ATOM 9225  C CE   . MET A 1 117 ? 5.081   7.167   -8.849  1.00 0.00 ? 117 MET A CE   5  
ATOM 9226  H H    . MET A 1 117 ? 8.609   3.284   -9.188  1.00 0.00 ? 117 MET A H    5  
ATOM 9227  H HA   . MET A 1 117 ? 6.517   1.495   -9.984  1.00 0.00 ? 117 MET A HA   5  
ATOM 9228  H HB2  . MET A 1 117 ? 5.008   3.308   -9.224  1.00 0.00 ? 117 MET A HB2  5  
ATOM 9229  H HB3  . MET A 1 117 ? 6.212   2.871   -8.019  1.00 0.00 ? 117 MET A HB3  5  
ATOM 9230  H HG2  . MET A 1 117 ? 6.366   5.123   -7.876  1.00 0.00 ? 117 MET A HG2  5  
ATOM 9231  H HG3  . MET A 1 117 ? 7.540   4.850   -9.161  1.00 0.00 ? 117 MET A HG3  5  
ATOM 9232  H HE1  . MET A 1 117 ? 4.462   7.887   -9.363  1.00 0.00 ? 117 MET A HE1  5  
ATOM 9233  H HE2  . MET A 1 117 ? 4.530   6.743   -8.022  1.00 0.00 ? 117 MET A HE2  5  
ATOM 9234  H HE3  . MET A 1 117 ? 5.970   7.656   -8.477  1.00 0.00 ? 117 MET A HE3  5  
ATOM 9235  N N    . ALA A 1 118 ? 5.550   2.425   -12.101 1.00 0.00 ? 118 ALA A N    5  
ATOM 9236  C CA   . ALA A 1 118 ? 5.150   2.838   -13.440 1.00 0.00 ? 118 ALA A CA   5  
ATOM 9237  C C    . ALA A 1 118 ? 4.314   4.112   -13.394 1.00 0.00 ? 118 ALA A C    5  
ATOM 9238  O O    . ALA A 1 118 ? 4.132   4.710   -12.334 1.00 0.00 ? 118 ALA A O    5  
ATOM 9239  C CB   . ALA A 1 118 ? 4.378   1.722   -14.127 1.00 0.00 ? 118 ALA A CB   5  
ATOM 9240  H H    . ALA A 1 118 ? 5.104   1.660   -11.683 1.00 0.00 ? 118 ALA A H    5  
ATOM 9241  H HA   . ALA A 1 118 ? 6.046   3.028   -14.013 1.00 0.00 ? 118 ALA A HA   5  
ATOM 9242  H HB1  . ALA A 1 118 ? 3.436   2.107   -14.490 1.00 0.00 ? 118 ALA A HB1  5  
ATOM 9243  H HB2  . ALA A 1 118 ? 4.955   1.343   -14.957 1.00 0.00 ? 118 ALA A HB2  5  
ATOM 9244  H HB3  . ALA A 1 118 ? 4.193   0.925   -13.423 1.00 0.00 ? 118 ALA A HB3  5  
ATOM 9245  N N    . SER A 1 119 ? 3.807   4.524   -14.552 1.00 0.00 ? 119 SER A N    5  
ATOM 9246  C CA   . SER A 1 119 ? 2.993   5.730   -14.645 1.00 0.00 ? 119 SER A CA   5  
ATOM 9247  C C    . SER A 1 119 ? 1.897   5.567   -15.693 1.00 0.00 ? 119 SER A C    5  
ATOM 9248  O O    . SER A 1 119 ? 2.175   5.443   -16.885 1.00 0.00 ? 119 SER A O    5  
ATOM 9249  C CB   . SER A 1 119 ? 3.869   6.936   -14.991 1.00 0.00 ? 119 SER A CB   5  
ATOM 9250  O OG   . SER A 1 119 ? 4.466   6.783   -16.267 1.00 0.00 ? 119 SER A OG   5  
ATOM 9251  H H    . SER A 1 119 ? 3.987   4.004   -15.364 1.00 0.00 ? 119 SER A H    5  
ATOM 9252  H HA   . SER A 1 119 ? 2.533   5.895   -13.682 1.00 0.00 ? 119 SER A HA   5  
ATOM 9253  H HB2  . SER A 1 119 ? 3.263   7.829   -14.995 1.00 0.00 ? 119 SER A HB2  5  
ATOM 9254  H HB3  . SER A 1 119 ? 4.650   7.034   -14.251 1.00 0.00 ? 119 SER A HB3  5  
ATOM 9255  H HG   . SER A 1 119 ? 3.781   6.665   -16.929 1.00 0.00 ? 119 SER A HG   5  
ATOM 9256  N N    . GLY A 1 120 ? 0.647   5.567   -15.238 1.00 0.00 ? 120 GLY A N    5  
ATOM 9257  C CA   . GLY A 1 120 ? -0.474  5.418   -16.148 1.00 0.00 ? 120 GLY A CA   5  
ATOM 9258  C C    . GLY A 1 120 ? -1.455  4.358   -15.690 1.00 0.00 ? 120 GLY A C    5  
ATOM 9259  O O    . GLY A 1 120 ? -1.393  3.201   -16.108 1.00 0.00 ? 120 GLY A O    5  
ATOM 9260  H H    . GLY A 1 120 ? 0.485   5.670   -14.277 1.00 0.00 ? 120 GLY A H    5  
ATOM 9261  H HA2  . GLY A 1 120 ? -0.990  6.363   -16.223 1.00 0.00 ? 120 GLY A HA2  5  
ATOM 9262  H HA3  . GLY A 1 120 ? -0.097  5.146   -17.123 1.00 0.00 ? 120 GLY A HA3  5  
ATOM 9263  N N    . PRO A 1 121 ? -2.387  4.750   -14.808 1.00 0.00 ? 121 PRO A N    5  
ATOM 9264  C CA   . PRO A 1 121 ? -3.403  3.839   -14.272 1.00 0.00 ? 121 PRO A CA   5  
ATOM 9265  C C    . PRO A 1 121 ? -4.429  3.432   -15.324 1.00 0.00 ? 121 PRO A C    5  
ATOM 9266  O O    . PRO A 1 121 ? -5.382  2.711   -15.029 1.00 0.00 ? 121 PRO A O    5  
ATOM 9267  C CB   . PRO A 1 121 ? -4.068  4.661   -13.166 1.00 0.00 ? 121 PRO A CB   5  
ATOM 9268  C CG   . PRO A 1 121 ? -3.850  6.080   -13.564 1.00 0.00 ? 121 PRO A CG   5  
ATOM 9269  C CD   . PRO A 1 121 ? -2.521  6.112   -14.266 1.00 0.00 ? 121 PRO A CD   5  
ATOM 9270  H HA   . PRO A 1 121 ? -2.956  2.953   -13.845 1.00 0.00 ? 121 PRO A HA   5  
ATOM 9271  H HB2  . PRO A 1 121 ? -5.121  4.420   -13.119 1.00 0.00 ? 121 PRO A HB2  5  
ATOM 9272  H HB3  . PRO A 1 121 ? -3.601  4.441   -12.218 1.00 0.00 ? 121 PRO A HB3  5  
ATOM 9273  H HG2  . PRO A 1 121 ? -4.635  6.398   -14.233 1.00 0.00 ? 121 PRO A HG2  5  
ATOM 9274  H HG3  . PRO A 1 121 ? -3.825  6.708   -12.686 1.00 0.00 ? 121 PRO A HG3  5  
ATOM 9275  H HD2  . PRO A 1 121 ? -2.531  6.844   -15.061 1.00 0.00 ? 121 PRO A HD2  5  
ATOM 9276  H HD3  . PRO A 1 121 ? -1.728  6.327   -13.564 1.00 0.00 ? 121 PRO A HD3  5  
ATOM 9277  N N    . SER A 1 122 ? -4.228  3.899   -16.552 1.00 0.00 ? 122 SER A N    5  
ATOM 9278  C CA   . SER A 1 122 ? -5.138  3.586   -17.648 1.00 0.00 ? 122 SER A CA   5  
ATOM 9279  C C    . SER A 1 122 ? -4.534  2.534   -18.573 1.00 0.00 ? 122 SER A C    5  
ATOM 9280  O O    . SER A 1 122 ? -3.885  2.863   -19.566 1.00 0.00 ? 122 SER A O    5  
ATOM 9281  C CB   . SER A 1 122 ? -5.467  4.851   -18.442 1.00 0.00 ? 122 SER A CB   5  
ATOM 9282  O OG   . SER A 1 122 ? -6.082  4.531   -19.679 1.00 0.00 ? 122 SER A OG   5  
ATOM 9283  H H    . SER A 1 122 ? -3.450  4.470   -16.725 1.00 0.00 ? 122 SER A H    5  
ATOM 9284  H HA   . SER A 1 122 ? -6.048  3.193   -17.220 1.00 0.00 ? 122 SER A HA   5  
ATOM 9285  H HB2  . SER A 1 122 ? -6.141  5.469   -17.868 1.00 0.00 ? 122 SER A HB2  5  
ATOM 9286  H HB3  . SER A 1 122 ? -4.556  5.398   -18.637 1.00 0.00 ? 122 SER A HB3  5  
ATOM 9287  H HG   . SER A 1 122 ? -7.034  4.618   -19.595 1.00 0.00 ? 122 SER A HG   5  
ATOM 9288  N N    . SER A 1 123 ? -4.751  1.266   -18.238 1.00 0.00 ? 123 SER A N    5  
ATOM 9289  C CA   . SER A 1 123 ? -4.226  0.164   -19.036 1.00 0.00 ? 123 SER A CA   5  
ATOM 9290  C C    . SER A 1 123 ? -4.894  0.118   -20.406 1.00 0.00 ? 123 SER A C    5  
ATOM 9291  O O    . SER A 1 123 ? -4.226  -0.013  -21.431 1.00 0.00 ? 123 SER A O    5  
ATOM 9292  C CB   . SER A 1 123 ? -4.436  -1.165  -18.308 1.00 0.00 ? 123 SER A CB   5  
ATOM 9293  O OG   . SER A 1 123 ? -5.815  -1.448  -18.150 1.00 0.00 ? 123 SER A OG   5  
ATOM 9294  H H    . SER A 1 123 ? -5.276  1.067   -17.434 1.00 0.00 ? 123 SER A H    5  
ATOM 9295  H HA   . SER A 1 123 ? -3.167  0.328   -19.170 1.00 0.00 ? 123 SER A HA   5  
ATOM 9296  H HB2  . SER A 1 123 ? -3.981  -1.961  -18.878 1.00 0.00 ? 123 SER A HB2  5  
ATOM 9297  H HB3  . SER A 1 123 ? -3.976  -1.114  -17.331 1.00 0.00 ? 123 SER A HB3  5  
ATOM 9298  H HG   . SER A 1 123 ? -6.271  -0.659  -17.847 1.00 0.00 ? 123 SER A HG   5  
ATOM 9299  N N    . GLY A 1 124 ? -6.219  0.227   -20.415 1.00 0.00 ? 124 GLY A N    5  
ATOM 9300  C CA   . GLY A 1 124 ? -6.958  0.195   -21.664 1.00 0.00 ? 124 GLY A CA   5  
ATOM 9301  C C    . GLY A 1 124 ? -7.669  1.503   -21.950 1.00 0.00 ? 124 GLY A C    5  
ATOM 9302  O O    . GLY A 1 124 ? -7.363  2.182   -22.930 1.00 0.00 ? 124 GLY A O    5  
ATOM 9303  H H    . GLY A 1 124 ? -6.700  0.330   -19.567 1.00 0.00 ? 124 GLY A H    5  
ATOM 9304  H HA2  . GLY A 1 124 ? -6.270  -0.013  -22.471 1.00 0.00 ? 124 GLY A HA2  5  
ATOM 9305  H HA3  . GLY A 1 124 ? -7.690  -0.597  -21.616 1.00 0.00 ? 124 GLY A HA3  5  
ATOM 9306  N N    . GLY A 1 1   ? -11.797 -20.922 22.695  1.00 0.00 ? 1   GLY A N    6  
ATOM 9307  C CA   . GLY A 1 1   ? -11.118 -19.936 23.516  1.00 0.00 ? 1   GLY A CA   6  
ATOM 9308  C C    . GLY A 1 1   ? -11.003 -18.590 22.828  1.00 0.00 ? 1   GLY A C    6  
ATOM 9309  O O    . GLY A 1 1   ? -10.386 -18.477 21.769  1.00 0.00 ? 1   GLY A O    6  
ATOM 9310  H H1   . GLY A 1 1   ? -11.958 -21.822 23.047  1.00 0.00 ? 1   GLY A H1   6  
ATOM 9311  H HA2  . GLY A 1 1   ? -11.667 -19.812 24.438  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 9312  H HA3  . GLY A 1 1   ? -10.126 -20.296 23.744  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 9313  N N    . SER A 1 2   ? -11.599 -17.566 23.431  1.00 0.00 ? 2   SER A N    6  
ATOM 9314  C CA   . SER A 1 2   ? -11.565 -16.222 22.867  1.00 0.00 ? 2   SER A CA   6  
ATOM 9315  C C    . SER A 1 2   ? -10.132 -15.794 22.570  1.00 0.00 ? 2   SER A C    6  
ATOM 9316  O O    . SER A 1 2   ? -9.800  -15.438 21.439  1.00 0.00 ? 2   SER A O    6  
ATOM 9317  C CB   . SER A 1 2   ? -12.218 -15.226 23.828  1.00 0.00 ? 2   SER A CB   6  
ATOM 9318  O OG   . SER A 1 2   ? -12.690 -14.083 23.135  1.00 0.00 ? 2   SER A OG   6  
ATOM 9319  H H    . SER A 1 2   ? -12.076 -17.720 24.274  1.00 0.00 ? 2   SER A H    6  
ATOM 9320  H HA   . SER A 1 2   ? -12.124 -16.236 21.943  1.00 0.00 ? 2   SER A HA   6  
ATOM 9321  H HB2  . SER A 1 2   ? -13.051 -15.701 24.323  1.00 0.00 ? 2   SER A HB2  6  
ATOM 9322  H HB3  . SER A 1 2   ? -11.493 -14.913 24.564  1.00 0.00 ? 2   SER A HB3  6  
ATOM 9323  H HG   . SER A 1 2   ? -12.028 -13.389 23.175  1.00 0.00 ? 2   SER A HG   6  
ATOM 9324  N N    . SER A 1 3   ? -9.285  -15.830 23.594  1.00 0.00 ? 3   SER A N    6  
ATOM 9325  C CA   . SER A 1 3   ? -7.888  -15.442 23.445  1.00 0.00 ? 3   SER A CA   6  
ATOM 9326  C C    . SER A 1 3   ? -7.041  -16.627 22.990  1.00 0.00 ? 3   SER A C    6  
ATOM 9327  O O    . SER A 1 3   ? -7.140  -17.723 23.539  1.00 0.00 ? 3   SER A O    6  
ATOM 9328  C CB   . SER A 1 3   ? -7.346  -14.891 24.765  1.00 0.00 ? 3   SER A CB   6  
ATOM 9329  O OG   . SER A 1 3   ? -6.293  -13.969 24.539  1.00 0.00 ? 3   SER A OG   6  
ATOM 9330  H H    . SER A 1 3   ? -9.610  -16.122 24.471  1.00 0.00 ? 3   SER A H    6  
ATOM 9331  H HA   . SER A 1 3   ? -7.837  -14.668 22.693  1.00 0.00 ? 3   SER A HA   6  
ATOM 9332  H HB2  . SER A 1 3   ? -8.140  -14.388 25.295  1.00 0.00 ? 3   SER A HB2  6  
ATOM 9333  H HB3  . SER A 1 3   ? -6.971  -15.707 25.366  1.00 0.00 ? 3   SER A HB3  6  
ATOM 9334  H HG   . SER A 1 3   ? -6.509  -13.415 23.786  1.00 0.00 ? 3   SER A HG   6  
ATOM 9335  N N    . GLY A 1 4   ? -6.207  -16.397 21.980  1.00 0.00 ? 4   GLY A N    6  
ATOM 9336  C CA   . GLY A 1 4   ? -5.354  -17.453 21.467  1.00 0.00 ? 4   GLY A CA   6  
ATOM 9337  C C    . GLY A 1 4   ? -4.879  -17.180 20.053  1.00 0.00 ? 4   GLY A C    6  
ATOM 9338  O O    . GLY A 1 4   ? -5.397  -17.753 19.095  1.00 0.00 ? 4   GLY A O    6  
ATOM 9339  H H    . GLY A 1 4   ? -6.170  -15.503 21.580  1.00 0.00 ? 4   GLY A H    6  
ATOM 9340  H HA2  . GLY A 1 4   ? -4.494  -17.552 22.112  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 9341  H HA3  . GLY A 1 4   ? -5.906  -18.382 21.475  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 9342  N N    . SER A 1 5   ? -3.892  -16.300 19.923  1.00 0.00 ? 5   SER A N    6  
ATOM 9343  C CA   . SER A 1 5   ? -3.350  -15.947 18.615  1.00 0.00 ? 5   SER A CA   6  
ATOM 9344  C C    . SER A 1 5   ? -2.549  -17.105 18.029  1.00 0.00 ? 5   SER A C    6  
ATOM 9345  O O    . SER A 1 5   ? -1.380  -17.299 18.365  1.00 0.00 ? 5   SER A O    6  
ATOM 9346  C CB   . SER A 1 5   ? -2.466  -14.704 18.725  1.00 0.00 ? 5   SER A CB   6  
ATOM 9347  O OG   . SER A 1 5   ? -3.249  -13.531 18.864  1.00 0.00 ? 5   SER A OG   6  
ATOM 9348  H H    . SER A 1 5   ? -3.520  -15.876 20.725  1.00 0.00 ? 5   SER A H    6  
ATOM 9349  H HA   . SER A 1 5   ? -4.181  -15.731 17.960  1.00 0.00 ? 5   SER A HA   6  
ATOM 9350  H HB2  . SER A 1 5   ? -1.823  -14.797 19.587  1.00 0.00 ? 5   SER A HB2  6  
ATOM 9351  H HB3  . SER A 1 5   ? -1.862  -14.616 17.833  1.00 0.00 ? 5   SER A HB3  6  
ATOM 9352  H HG   . SER A 1 5   ? -2.686  -12.758 18.781  1.00 0.00 ? 5   SER A HG   6  
ATOM 9353  N N    . SER A 1 6   ? -3.186  -17.873 17.150  1.00 0.00 ? 6   SER A N    6  
ATOM 9354  C CA   . SER A 1 6   ? -2.535  -19.014 16.519  1.00 0.00 ? 6   SER A CA   6  
ATOM 9355  C C    . SER A 1 6   ? -1.496  -18.553 15.501  1.00 0.00 ? 6   SER A C    6  
ATOM 9356  O O    . SER A 1 6   ? -0.380  -19.068 15.459  1.00 0.00 ? 6   SER A O    6  
ATOM 9357  C CB   . SER A 1 6   ? -3.573  -19.907 15.836  1.00 0.00 ? 6   SER A CB   6  
ATOM 9358  O OG   . SER A 1 6   ? -4.277  -20.688 16.786  1.00 0.00 ? 6   SER A OG   6  
ATOM 9359  H H    . SER A 1 6   ? -4.117  -17.667 16.923  1.00 0.00 ? 6   SER A H    6  
ATOM 9360  H HA   . SER A 1 6   ? -2.037  -19.581 17.291  1.00 0.00 ? 6   SER A HA   6  
ATOM 9361  H HB2  . SER A 1 6   ? -4.279  -19.290 15.301  1.00 0.00 ? 6   SER A HB2  6  
ATOM 9362  H HB3  . SER A 1 6   ? -3.074  -20.569 15.142  1.00 0.00 ? 6   SER A HB3  6  
ATOM 9363  H HG   . SER A 1 6   ? -5.222  -20.576 16.656  1.00 0.00 ? 6   SER A HG   6  
ATOM 9364  N N    . GLY A 1 7   ? -1.874  -17.578 14.680  1.00 0.00 ? 7   GLY A N    6  
ATOM 9365  C CA   . GLY A 1 7   ? -0.965  -17.062 13.673  1.00 0.00 ? 7   GLY A CA   6  
ATOM 9366  C C    . GLY A 1 7   ? -0.641  -15.596 13.879  1.00 0.00 ? 7   GLY A C    6  
ATOM 9367  O O    . GLY A 1 7   ? -1.274  -14.724 13.285  1.00 0.00 ? 7   GLY A O    6  
ATOM 9368  H H    . GLY A 1 7   ? -2.777  -17.205 14.759  1.00 0.00 ? 7   GLY A H    6  
ATOM 9369  H HA2  . GLY A 1 7   ? -0.048  -17.631 13.706  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 9370  H HA3  . GLY A 1 7   ? -1.417  -17.185 12.699  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 9371  N N    . ASP A 1 8   ? 0.346   -15.324 14.726  1.00 0.00 ? 8   ASP A N    6  
ATOM 9372  C CA   . ASP A 1 8   ? 0.753   -13.953 15.010  1.00 0.00 ? 8   ASP A CA   6  
ATOM 9373  C C    . ASP A 1 8   ? 1.899   -13.525 14.099  1.00 0.00 ? 8   ASP A C    6  
ATOM 9374  O O    . ASP A 1 8   ? 2.637   -12.591 14.410  1.00 0.00 ? 8   ASP A O    6  
ATOM 9375  C CB   . ASP A 1 8   ? 1.171   -13.816 16.475  1.00 0.00 ? 8   ASP A CB   6  
ATOM 9376  C CG   . ASP A 1 8   ? 1.748   -15.101 17.035  1.00 0.00 ? 8   ASP A CG   6  
ATOM 9377  O OD1  . ASP A 1 8   ? 1.003   -16.100 17.118  1.00 0.00 ? 8   ASP A OD1  6  
ATOM 9378  O OD2  . ASP A 1 8   ? 2.945   -15.109 17.389  1.00 0.00 ? 8   ASP A OD2  6  
ATOM 9379  H H    . ASP A 1 8   ? 0.813   -16.063 15.169  1.00 0.00 ? 8   ASP A H    6  
ATOM 9380  H HA   . ASP A 1 8   ? -0.095  -13.310 14.826  1.00 0.00 ? 8   ASP A HA   6  
ATOM 9381  H HB2  . ASP A 1 8   ? 1.920   -13.041 16.558  1.00 0.00 ? 8   ASP A HB2  6  
ATOM 9382  H HB3  . ASP A 1 8   ? 0.309   -13.542 17.065  1.00 0.00 ? 8   ASP A HB3  6  
ATOM 9383  N N    . ALA A 1 9   ? 2.043   -14.217 12.973  1.00 0.00 ? 9   ALA A N    6  
ATOM 9384  C CA   . ALA A 1 9   ? 3.098   -13.909 12.017  1.00 0.00 ? 9   ALA A CA   6  
ATOM 9385  C C    . ALA A 1 9   ? 2.809   -12.605 11.281  1.00 0.00 ? 9   ALA A C    6  
ATOM 9386  O O    . ALA A 1 9   ? 3.576   -12.186 10.414  1.00 0.00 ? 9   ALA A O    6  
ATOM 9387  C CB   . ALA A 1 9   ? 3.262   -15.051 11.025  1.00 0.00 ? 9   ALA A CB   6  
ATOM 9388  H H    . ALA A 1 9   ? 1.423   -14.951 12.781  1.00 0.00 ? 9   ALA A H    6  
ATOM 9389  H HA   . ALA A 1 9   ? 4.024   -13.804 12.564  1.00 0.00 ? 9   ALA A HA   6  
ATOM 9390  H HB1  . ALA A 1 9   ? 2.322   -15.228 10.523  1.00 0.00 ? 9   ALA A HB1  6  
ATOM 9391  H HB2  . ALA A 1 9   ? 4.016   -14.791 10.297  1.00 0.00 ? 9   ALA A HB2  6  
ATOM 9392  H HB3  . ALA A 1 9   ? 3.563   -15.944 11.552  1.00 0.00 ? 9   ALA A HB3  6  
ATOM 9393  N N    . PHE A 1 10  ? 1.697   -11.967 11.633  1.00 0.00 ? 10  PHE A N    6  
ATOM 9394  C CA   . PHE A 1 10  ? 1.306   -10.710 11.004  1.00 0.00 ? 10  PHE A CA   6  
ATOM 9395  C C    . PHE A 1 10  ? 1.450   -9.546  11.980  1.00 0.00 ? 10  PHE A C    6  
ATOM 9396  O O    . PHE A 1 10  ? 0.870   -8.478  11.781  1.00 0.00 ? 10  PHE A O    6  
ATOM 9397  C CB   . PHE A 1 10  ? -0.138  -10.794 10.503  1.00 0.00 ? 10  PHE A CB   6  
ATOM 9398  C CG   . PHE A 1 10  ? -0.315  -11.728 9.340   1.00 0.00 ? 10  PHE A CG   6  
ATOM 9399  C CD1  . PHE A 1 10  ? -0.154  -11.276 8.041   1.00 0.00 ? 10  PHE A CD1  6  
ATOM 9400  C CD2  . PHE A 1 10  ? -0.643  -13.059 9.547   1.00 0.00 ? 10  PHE A CD2  6  
ATOM 9401  C CE1  . PHE A 1 10  ? -0.317  -12.133 6.969   1.00 0.00 ? 10  PHE A CE1  6  
ATOM 9402  C CE2  . PHE A 1 10  ? -0.808  -13.921 8.479   1.00 0.00 ? 10  PHE A CE2  6  
ATOM 9403  C CZ   . PHE A 1 10  ? -0.643  -13.457 7.189   1.00 0.00 ? 10  PHE A CZ   6  
ATOM 9404  H H    . PHE A 1 10  ? 1.126   -12.351 12.331  1.00 0.00 ? 10  PHE A H    6  
ATOM 9405  H HA   . PHE A 1 10  ? 1.960   -10.543 10.163  1.00 0.00 ? 10  PHE A HA   6  
ATOM 9406  H HB2  . PHE A 1 10  ? -0.770  -11.141 11.306  1.00 0.00 ? 10  PHE A HB2  6  
ATOM 9407  H HB3  . PHE A 1 10  ? -0.461  -9.812  10.194  1.00 0.00 ? 10  PHE A HB3  6  
ATOM 9408  H HD1  . PHE A 1 10  ? 0.103   -10.241 7.867   1.00 0.00 ? 10  PHE A HD1  6  
ATOM 9409  H HD2  . PHE A 1 10  ? -0.772  -13.422 10.557  1.00 0.00 ? 10  PHE A HD2  6  
ATOM 9410  H HE1  . PHE A 1 10  ? -0.188  -11.769 5.961   1.00 0.00 ? 10  PHE A HE1  6  
ATOM 9411  H HE2  . PHE A 1 10  ? -1.063  -14.955 8.655   1.00 0.00 ? 10  PHE A HE2  6  
ATOM 9412  H HZ   . PHE A 1 10  ? -0.772  -14.129 6.353   1.00 0.00 ? 10  PHE A HZ   6  
ATOM 9413  N N    . THR A 1 11  ? 2.229   -9.760  13.036  1.00 0.00 ? 11  THR A N    6  
ATOM 9414  C CA   . THR A 1 11  ? 2.450   -8.730  14.043  1.00 0.00 ? 11  THR A CA   6  
ATOM 9415  C C    . THR A 1 11  ? 3.411   -7.661  13.536  1.00 0.00 ? 11  THR A C    6  
ATOM 9416  O O    . THR A 1 11  ? 4.354   -7.959  12.803  1.00 0.00 ? 11  THR A O    6  
ATOM 9417  C CB   . THR A 1 11  ? 3.009   -9.331  15.347  1.00 0.00 ? 11  THR A CB   6  
ATOM 9418  O OG1  . THR A 1 11  ? 4.053   -10.265 15.048  1.00 0.00 ? 11  THR A OG1  6  
ATOM 9419  C CG2  . THR A 1 11  ? 1.911   -10.026 16.137  1.00 0.00 ? 11  THR A CG2  6  
ATOM 9420  H H    . THR A 1 11  ? 2.665   -10.631 13.138  1.00 0.00 ? 11  THR A H    6  
ATOM 9421  H HA   . THR A 1 11  ? 1.498   -8.270  14.264  1.00 0.00 ? 11  THR A HA   6  
ATOM 9422  H HB   . THR A 1 11  ? 3.415   -8.531  15.949  1.00 0.00 ? 11  THR A HB   6  
ATOM 9423  H HG1  . THR A 1 11  ? 4.828   -9.790  14.738  1.00 0.00 ? 11  THR A HG1  6  
ATOM 9424  H HG21 . THR A 1 11  ? 2.352   -10.596 16.942  1.00 0.00 ? 11  THR A HG21 6  
ATOM 9425  H HG22 . THR A 1 11  ? 1.363   -10.689 15.485  1.00 0.00 ? 11  THR A HG22 6  
ATOM 9426  H HG23 . THR A 1 11  ? 1.239   -9.287  16.547  1.00 0.00 ? 11  THR A HG23 6  
ATOM 9427  N N    . ASP A 1 12  ? 3.166   -6.417  13.932  1.00 0.00 ? 12  ASP A N    6  
ATOM 9428  C CA   . ASP A 1 12  ? 4.012   -5.303  13.518  1.00 0.00 ? 12  ASP A CA   6  
ATOM 9429  C C    . ASP A 1 12  ? 5.488   -5.679  13.608  1.00 0.00 ? 12  ASP A C    6  
ATOM 9430  O O    . ASP A 1 12  ? 6.218   -5.603  12.621  1.00 0.00 ? 12  ASP A O    6  
ATOM 9431  C CB   . ASP A 1 12  ? 3.732   -4.074  14.384  1.00 0.00 ? 12  ASP A CB   6  
ATOM 9432  C CG   . ASP A 1 12  ? 3.360   -4.440  15.807  1.00 0.00 ? 12  ASP A CG   6  
ATOM 9433  O OD1  . ASP A 1 12  ? 3.735   -5.545  16.252  1.00 0.00 ? 12  ASP A OD1  6  
ATOM 9434  O OD2  . ASP A 1 12  ? 2.694   -3.623  16.476  1.00 0.00 ? 12  ASP A OD2  6  
ATOM 9435  H H    . ASP A 1 12  ? 2.399   -6.243  14.516  1.00 0.00 ? 12  ASP A H    6  
ATOM 9436  H HA   . ASP A 1 12  ? 3.775   -5.070  12.491  1.00 0.00 ? 12  ASP A HA   6  
ATOM 9437  H HB2  . ASP A 1 12  ? 4.615   -3.452  14.411  1.00 0.00 ? 12  ASP A HB2  6  
ATOM 9438  H HB3  . ASP A 1 12  ? 2.916   -3.514  13.950  1.00 0.00 ? 12  ASP A HB3  6  
ATOM 9439  N N    . GLN A 1 13  ? 5.919   -6.082  14.799  1.00 0.00 ? 13  GLN A N    6  
ATOM 9440  C CA   . GLN A 1 13  ? 7.308   -6.467  15.018  1.00 0.00 ? 13  GLN A CA   6  
ATOM 9441  C C    . GLN A 1 13  ? 7.802   -7.380  13.901  1.00 0.00 ? 13  GLN A C    6  
ATOM 9442  O O    . GLN A 1 13  ? 8.965   -7.316  13.500  1.00 0.00 ? 13  GLN A O    6  
ATOM 9443  C CB   . GLN A 1 13  ? 7.458   -7.168  16.369  1.00 0.00 ? 13  GLN A CB   6  
ATOM 9444  C CG   . GLN A 1 13  ? 8.831   -7.785  16.586  1.00 0.00 ? 13  GLN A CG   6  
ATOM 9445  C CD   . GLN A 1 13  ? 8.802   -8.946  17.560  1.00 0.00 ? 13  GLN A CD   6  
ATOM 9446  O OE1  . GLN A 1 13  ? 7.954   -9.003  18.450  1.00 0.00 ? 13  GLN A OE1  6  
ATOM 9447  N NE2  . GLN A 1 13  ? 9.732   -9.880  17.396  1.00 0.00 ? 13  GLN A NE2  6  
ATOM 9448  H H    . GLN A 1 13  ? 5.289   -6.120  15.548  1.00 0.00 ? 13  GLN A H    6  
ATOM 9449  H HA   . GLN A 1 13  ? 7.905   -5.568  15.021  1.00 0.00 ? 13  GLN A HA   6  
ATOM 9450  H HB2  . GLN A 1 13  ? 7.281   -6.450  17.156  1.00 0.00 ? 13  GLN A HB2  6  
ATOM 9451  H HB3  . GLN A 1 13  ? 6.720   -7.954  16.437  1.00 0.00 ? 13  GLN A HB3  6  
ATOM 9452  H HG2  . GLN A 1 13  ? 9.206   -8.140  15.637  1.00 0.00 ? 13  GLN A HG2  6  
ATOM 9453  H HG3  . GLN A 1 13  ? 9.495   -7.025  16.972  1.00 0.00 ? 13  GLN A HG3  6  
ATOM 9454  H HE21 . GLN A 1 13  ? 10.376  -9.767  16.665  1.00 0.00 ? 13  GLN A HE21 6  
ATOM 9455  H HE22 . GLN A 1 13  ? 9.737   -10.641 18.011  1.00 0.00 ? 13  GLN A HE22 6  
ATOM 9456  N N    . LYS A 1 14  ? 6.912   -8.230  13.400  1.00 0.00 ? 14  LYS A N    6  
ATOM 9457  C CA   . LYS A 1 14  ? 7.256   -9.156  12.328  1.00 0.00 ? 14  LYS A CA   6  
ATOM 9458  C C    . LYS A 1 14  ? 7.210   -8.459  10.972  1.00 0.00 ? 14  LYS A C    6  
ATOM 9459  O O    . LYS A 1 14  ? 8.019   -8.746  10.089  1.00 0.00 ? 14  LYS A O    6  
ATOM 9460  C CB   . LYS A 1 14  ? 6.300   -10.351 12.332  1.00 0.00 ? 14  LYS A CB   6  
ATOM 9461  C CG   . LYS A 1 14  ? 6.639   -11.397 13.379  1.00 0.00 ? 14  LYS A CG   6  
ATOM 9462  C CD   . LYS A 1 14  ? 7.710   -12.355 12.885  1.00 0.00 ? 14  LYS A CD   6  
ATOM 9463  C CE   . LYS A 1 14  ? 8.478   -12.976 14.041  1.00 0.00 ? 14  LYS A CE   6  
ATOM 9464  N NZ   . LYS A 1 14  ? 9.553   -12.075 14.541  1.00 0.00 ? 14  LYS A NZ   6  
ATOM 9465  H H    . LYS A 1 14  ? 6.000   -8.234  13.761  1.00 0.00 ? 14  LYS A H    6  
ATOM 9466  H HA   . LYS A 1 14  ? 8.261   -9.509  12.504  1.00 0.00 ? 14  LYS A HA   6  
ATOM 9467  H HB2  . LYS A 1 14  ? 5.298   -9.994  12.520  1.00 0.00 ? 14  LYS A HB2  6  
ATOM 9468  H HB3  . LYS A 1 14  ? 6.329   -10.822 11.360  1.00 0.00 ? 14  LYS A HB3  6  
ATOM 9469  H HG2  . LYS A 1 14  ? 6.998   -10.900 14.268  1.00 0.00 ? 14  LYS A HG2  6  
ATOM 9470  H HG3  . LYS A 1 14  ? 5.746   -11.959 13.615  1.00 0.00 ? 14  LYS A HG3  6  
ATOM 9471  H HD2  . LYS A 1 14  ? 7.240   -13.143 12.315  1.00 0.00 ? 14  LYS A HD2  6  
ATOM 9472  H HD3  . LYS A 1 14  ? 8.401   -11.814 12.254  1.00 0.00 ? 14  LYS A HD3  6  
ATOM 9473  H HE2  . LYS A 1 14  ? 7.789   -13.181 14.846  1.00 0.00 ? 14  LYS A HE2  6  
ATOM 9474  H HE3  . LYS A 1 14  ? 8.923   -13.901 13.704  1.00 0.00 ? 14  LYS A HE3  6  
ATOM 9475  H HZ1  . LYS A 1 14  ? 9.462   -11.947 15.569  1.00 0.00 ? 14  LYS A HZ1  6  
ATOM 9476  H HZ2  . LYS A 1 14  ? 9.482   -11.145 14.081  1.00 0.00 ? 14  LYS A HZ2  6  
ATOM 9477  H HZ3  . LYS A 1 14  ? 10.487  -12.483 14.334  1.00 0.00 ? 14  LYS A HZ3  6  
ATOM 9478  N N    . ILE A 1 15  ? 6.261   -7.543  10.814  1.00 0.00 ? 15  ILE A N    6  
ATOM 9479  C CA   . ILE A 1 15  ? 6.112   -6.804  9.566   1.00 0.00 ? 15  ILE A CA   6  
ATOM 9480  C C    . ILE A 1 15  ? 7.334   -5.933  9.295   1.00 0.00 ? 15  ILE A C    6  
ATOM 9481  O O    . ILE A 1 15  ? 7.855   -5.907  8.179   1.00 0.00 ? 15  ILE A O    6  
ATOM 9482  C CB   . ILE A 1 15  ? 4.855   -5.914  9.585   1.00 0.00 ? 15  ILE A CB   6  
ATOM 9483  C CG1  . ILE A 1 15  ? 3.607   -6.763  9.838   1.00 0.00 ? 15  ILE A CG1  6  
ATOM 9484  C CG2  . ILE A 1 15  ? 4.727   -5.151  8.275   1.00 0.00 ? 15  ILE A CG2  6  
ATOM 9485  C CD1  . ILE A 1 15  ? 2.352   -5.944  10.043  1.00 0.00 ? 15  ILE A CD1  6  
ATOM 9486  H H    . ILE A 1 15  ? 5.646   -7.359  11.554  1.00 0.00 ? 15  ILE A H    6  
ATOM 9487  H HA   . ILE A 1 15  ? 6.010   -7.521  8.765   1.00 0.00 ? 15  ILE A HA   6  
ATOM 9488  H HB   . ILE A 1 15  ? 4.962   -5.196  10.383  1.00 0.00 ? 15  ILE A HB   6  
ATOM 9489  H HG12 . ILE A 1 15  ? 3.444   -7.413  8.994   1.00 0.00 ? 15  ILE A HG12 6  
ATOM 9490  H HG13 . ILE A 1 15  ? 3.762   -7.362  10.724  1.00 0.00 ? 15  ILE A HG13 6  
ATOM 9491  H HG21 . ILE A 1 15  ? 4.318   -4.170  8.468   1.00 0.00 ? 15  ILE A HG21 6  
ATOM 9492  H HG22 . ILE A 1 15  ? 5.701   -5.051  7.820   1.00 0.00 ? 15  ILE A HG22 6  
ATOM 9493  H HG23 . ILE A 1 15  ? 4.071   -5.689  7.607   1.00 0.00 ? 15  ILE A HG23 6  
ATOM 9494  H HD11 . ILE A 1 15  ? 2.201   -5.774  11.099  1.00 0.00 ? 15  ILE A HD11 6  
ATOM 9495  H HD12 . ILE A 1 15  ? 2.452   -4.997  9.535   1.00 0.00 ? 15  ILE A HD12 6  
ATOM 9496  H HD13 . ILE A 1 15  ? 1.504   -6.480  9.641   1.00 0.00 ? 15  ILE A HD13 6  
ATOM 9497  N N    . ARG A 1 16  ? 7.787   -5.222  10.322  1.00 0.00 ? 16  ARG A N    6  
ATOM 9498  C CA   . ARG A 1 16  ? 8.949   -4.350  10.194  1.00 0.00 ? 16  ARG A CA   6  
ATOM 9499  C C    . ARG A 1 16  ? 10.218  -5.165  9.967   1.00 0.00 ? 16  ARG A C    6  
ATOM 9500  O O    . ARG A 1 16  ? 11.057  -4.806  9.141   1.00 0.00 ? 16  ARG A O    6  
ATOM 9501  C CB   . ARG A 1 16  ? 9.103   -3.484  11.446  1.00 0.00 ? 16  ARG A CB   6  
ATOM 9502  C CG   . ARG A 1 16  ? 9.420   -4.280  12.702  1.00 0.00 ? 16  ARG A CG   6  
ATOM 9503  C CD   . ARG A 1 16  ? 9.459   -3.387  13.932  1.00 0.00 ? 16  ARG A CD   6  
ATOM 9504  N NE   . ARG A 1 16  ? 10.201  -4.000  15.030  1.00 0.00 ? 16  ARG A NE   6  
ATOM 9505  C CZ   . ARG A 1 16  ? 10.053  -3.650  16.303  1.00 0.00 ? 16  ARG A CZ   6  
ATOM 9506  N NH1  . ARG A 1 16  ? 9.194   -2.698  16.637  1.00 0.00 ? 16  ARG A NH1  6  
ATOM 9507  N NH2  . ARG A 1 16  ? 10.765  -4.255  17.245  1.00 0.00 ? 16  ARG A NH2  6  
ATOM 9508  H H    . ARG A 1 16  ? 7.330   -5.285  11.186  1.00 0.00 ? 16  ARG A H    6  
ATOM 9509  H HA   . ARG A 1 16  ? 8.790   -3.708  9.341   1.00 0.00 ? 16  ARG A HA   6  
ATOM 9510  H HB2  . ARG A 1 16  ? 9.903   -2.776  11.284  1.00 0.00 ? 16  ARG A HB2  6  
ATOM 9511  H HB3  . ARG A 1 16  ? 8.183   -2.944  11.611  1.00 0.00 ? 16  ARG A HB3  6  
ATOM 9512  H HG2  . ARG A 1 16  ? 8.658   -5.033  12.842  1.00 0.00 ? 16  ARG A HG2  6  
ATOM 9513  H HG3  . ARG A 1 16  ? 10.381  -4.756  12.582  1.00 0.00 ? 16  ARG A HG3  6  
ATOM 9514  H HD2  . ARG A 1 16  ? 9.932   -2.453  13.668  1.00 0.00 ? 16  ARG A HD2  6  
ATOM 9515  H HD3  . ARG A 1 16  ? 8.446   -3.198  14.256  1.00 0.00 ? 16  ARG A HD3  6  
ATOM 9516  H HE   . ARG A 1 16  ? 10.842  -4.706  14.806  1.00 0.00 ? 16  ARG A HE   6  
ATOM 9517  H HH11 . ARG A 1 16  ? 8.655   -2.241  15.929  1.00 0.00 ? 16  ARG A HH11 6  
ATOM 9518  H HH12 . ARG A 1 16  ? 9.083   -2.437  17.596  1.00 0.00 ? 16  ARG A HH12 6  
ATOM 9519  H HH21 . ARG A 1 16  ? 11.414  -4.974  16.998  1.00 0.00 ? 16  ARG A HH21 6  
ATOM 9520  H HH22 . ARG A 1 16  ? 10.653  -3.991  18.203  1.00 0.00 ? 16  ARG A HH22 6  
ATOM 9521  N N    . GLN A 1 17  ? 10.351  -6.262  10.706  1.00 0.00 ? 17  GLN A N    6  
ATOM 9522  C CA   . GLN A 1 17  ? 11.519  -7.127  10.585  1.00 0.00 ? 17  GLN A CA   6  
ATOM 9523  C C    . GLN A 1 17  ? 11.495  -7.894  9.268   1.00 0.00 ? 17  GLN A C    6  
ATOM 9524  O O    . GLN A 1 17  ? 12.542  -8.205  8.700   1.00 0.00 ? 17  GLN A O    6  
ATOM 9525  C CB   . GLN A 1 17  ? 11.578  -8.106  11.759  1.00 0.00 ? 17  GLN A CB   6  
ATOM 9526  C CG   . GLN A 1 17  ? 12.346  -7.574  12.958  1.00 0.00 ? 17  GLN A CG   6  
ATOM 9527  C CD   . GLN A 1 17  ? 12.983  -8.677  13.779  1.00 0.00 ? 17  GLN A CD   6  
ATOM 9528  O OE1  . GLN A 1 17  ? 13.097  -9.817  13.327  1.00 0.00 ? 17  GLN A OE1  6  
ATOM 9529  N NE2  . GLN A 1 17  ? 13.403  -8.344  14.994  1.00 0.00 ? 17  GLN A NE2  6  
ATOM 9530  H H    . GLN A 1 17  ? 9.648   -6.495  11.347  1.00 0.00 ? 17  GLN A H    6  
ATOM 9531  H HA   . GLN A 1 17  ? 12.398  -6.501  10.607  1.00 0.00 ? 17  GLN A HA   6  
ATOM 9532  H HB2  . GLN A 1 17  ? 10.571  -8.332  12.075  1.00 0.00 ? 17  GLN A HB2  6  
ATOM 9533  H HB3  . GLN A 1 17  ? 12.056  -9.017  11.428  1.00 0.00 ? 17  GLN A HB3  6  
ATOM 9534  H HG2  . GLN A 1 17  ? 13.124  -6.913  12.606  1.00 0.00 ? 17  GLN A HG2  6  
ATOM 9535  H HG3  . GLN A 1 17  ? 11.665  -7.023  13.589  1.00 0.00 ? 17  GLN A HG3  6  
ATOM 9536  H HE21 . GLN A 1 17  ? 13.278  -7.417  15.288  1.00 0.00 ? 17  GLN A HE21 6  
ATOM 9537  H HE22 . GLN A 1 17  ? 13.818  -9.037  15.547  1.00 0.00 ? 17  GLN A HE22 6  
ATOM 9538  N N    . ARG A 1 18  ? 10.293  -8.196  8.787   1.00 0.00 ? 18  ARG A N    6  
ATOM 9539  C CA   . ARG A 1 18  ? 10.133  -8.929  7.536   1.00 0.00 ? 18  ARG A CA   6  
ATOM 9540  C C    . ARG A 1 18  ? 10.537  -8.065  6.345   1.00 0.00 ? 18  ARG A C    6  
ATOM 9541  O O    . ARG A 1 18  ? 11.189  -8.540  5.414   1.00 0.00 ? 18  ARG A O    6  
ATOM 9542  C CB   . ARG A 1 18  ? 8.684   -9.393  7.375   1.00 0.00 ? 18  ARG A CB   6  
ATOM 9543  C CG   . ARG A 1 18  ? 8.392   -10.018 6.021   1.00 0.00 ? 18  ARG A CG   6  
ATOM 9544  C CD   . ARG A 1 18  ? 7.210   -10.971 6.090   1.00 0.00 ? 18  ARG A CD   6  
ATOM 9545  N NE   . ARG A 1 18  ? 7.572   -12.249 6.697   1.00 0.00 ? 18  ARG A NE   6  
ATOM 9546  C CZ   . ARG A 1 18  ? 6.732   -13.272 6.813   1.00 0.00 ? 18  ARG A CZ   6  
ATOM 9547  N NH1  . ARG A 1 18  ? 5.489   -13.167 6.365   1.00 0.00 ? 18  ARG A NH1  6  
ATOM 9548  N NH2  . ARG A 1 18  ? 7.136   -14.403 7.377   1.00 0.00 ? 18  ARG A NH2  6  
ATOM 9549  H H    . ARG A 1 18  ? 9.495   -7.921  9.285   1.00 0.00 ? 18  ARG A H    6  
ATOM 9550  H HA   . ARG A 1 18  ? 10.777  -9.794  7.574   1.00 0.00 ? 18  ARG A HA   6  
ATOM 9551  H HB2  . ARG A 1 18  ? 8.466   -10.126 8.139   1.00 0.00 ? 18  ARG A HB2  6  
ATOM 9552  H HB3  . ARG A 1 18  ? 8.030   -8.544  7.505   1.00 0.00 ? 18  ARG A HB3  6  
ATOM 9553  H HG2  . ARG A 1 18  ? 8.166   -9.233  5.314   1.00 0.00 ? 18  ARG A HG2  6  
ATOM 9554  H HG3  . ARG A 1 18  ? 9.264   -10.562 5.690   1.00 0.00 ? 18  ARG A HG3  6  
ATOM 9555  H HD2  . ARG A 1 18  ? 6.429   -10.513 6.678   1.00 0.00 ? 18  ARG A HD2  6  
ATOM 9556  H HD3  . ARG A 1 18  ? 6.848   -11.149 5.088   1.00 0.00 ? 18  ARG A HD3  6  
ATOM 9557  H HE   . ARG A 1 18  ? 8.486   -12.348 7.035   1.00 0.00 ? 18  ARG A HE   6  
ATOM 9558  H HH11 . ARG A 1 18  ? 5.182   -12.317 5.938   1.00 0.00 ? 18  ARG A HH11 6  
ATOM 9559  H HH12 . ARG A 1 18  ? 4.859   -13.940 6.452   1.00 0.00 ? 18  ARG A HH12 6  
ATOM 9560  H HH21 . ARG A 1 18  ? 8.073   -14.486 7.716   1.00 0.00 ? 18  ARG A HH21 6  
ATOM 9561  H HH22 . ARG A 1 18  ? 6.504   -15.172 7.464   1.00 0.00 ? 18  ARG A HH22 6  
ATOM 9562  N N    . TYR A 1 19  ? 10.145  -6.797  6.380   1.00 0.00 ? 19  TYR A N    6  
ATOM 9563  C CA   . TYR A 1 19  ? 10.463  -5.868  5.302   1.00 0.00 ? 19  TYR A CA   6  
ATOM 9564  C C    . TYR A 1 19  ? 11.587  -4.922  5.713   1.00 0.00 ? 19  TYR A C    6  
ATOM 9565  O O    . TYR A 1 19  ? 11.822  -3.901  5.067   1.00 0.00 ? 19  TYR A O    6  
ATOM 9566  C CB   . TYR A 1 19  ? 9.222   -5.064  4.910   1.00 0.00 ? 19  TYR A CB   6  
ATOM 9567  C CG   . TYR A 1 19  ? 8.093   -5.916  4.376   1.00 0.00 ? 19  TYR A CG   6  
ATOM 9568  C CD1  . TYR A 1 19  ? 8.131   -6.423  3.083   1.00 0.00 ? 19  TYR A CD1  6  
ATOM 9569  C CD2  . TYR A 1 19  ? 6.989   -6.214  5.164   1.00 0.00 ? 19  TYR A CD2  6  
ATOM 9570  C CE1  . TYR A 1 19  ? 7.101   -7.201  2.590   1.00 0.00 ? 19  TYR A CE1  6  
ATOM 9571  C CE2  . TYR A 1 19  ? 5.955   -6.992  4.681   1.00 0.00 ? 19  TYR A CE2  6  
ATOM 9572  C CZ   . TYR A 1 19  ? 6.015   -7.483  3.393   1.00 0.00 ? 19  TYR A CZ   6  
ATOM 9573  O OH   . TYR A 1 19  ? 4.988   -8.259  2.907   1.00 0.00 ? 19  TYR A OH   6  
ATOM 9574  H H    . TYR A 1 19  ? 9.627   -6.477  7.149   1.00 0.00 ? 19  TYR A H    6  
ATOM 9575  H HA   . TYR A 1 19  ? 10.789  -6.447  4.451   1.00 0.00 ? 19  TYR A HA   6  
ATOM 9576  H HB2  . TYR A 1 19  ? 8.856   -4.535  5.776   1.00 0.00 ? 19  TYR A HB2  6  
ATOM 9577  H HB3  . TYR A 1 19  ? 9.491   -4.351  4.145   1.00 0.00 ? 19  TYR A HB3  6  
ATOM 9578  H HD1  . TYR A 1 19  ? 8.983   -6.201  2.457   1.00 0.00 ? 19  TYR A HD1  6  
ATOM 9579  H HD2  . TYR A 1 19  ? 6.944   -5.828  6.173   1.00 0.00 ? 19  TYR A HD2  6  
ATOM 9580  H HE1  . TYR A 1 19  ? 7.149   -7.586  1.582   1.00 0.00 ? 19  TYR A HE1  6  
ATOM 9581  H HE2  . TYR A 1 19  ? 5.104   -7.213  5.309   1.00 0.00 ? 19  TYR A HE2  6  
ATOM 9582  H HH   . TYR A 1 19  ? 4.555   -7.799  2.184   1.00 0.00 ? 19  TYR A HH   6  
ATOM 9583  N N    . ALA A 1 20  ? 12.280  -5.269  6.793   1.00 0.00 ? 20  ALA A N    6  
ATOM 9584  C CA   . ALA A 1 20  ? 13.381  -4.454  7.289   1.00 0.00 ? 20  ALA A CA   6  
ATOM 9585  C C    . ALA A 1 20  ? 14.540  -4.434  6.298   1.00 0.00 ? 20  ALA A C    6  
ATOM 9586  O O    . ALA A 1 20  ? 15.381  -3.535  6.330   1.00 0.00 ? 20  ALA A O    6  
ATOM 9587  C CB   . ALA A 1 20  ? 13.850  -4.968  8.642   1.00 0.00 ? 20  ALA A CB   6  
ATOM 9588  H H    . ALA A 1 20  ? 12.045  -6.095  7.265   1.00 0.00 ? 20  ALA A H    6  
ATOM 9589  H HA   . ALA A 1 20  ? 13.016  -3.445  7.421   1.00 0.00 ? 20  ALA A HA   6  
ATOM 9590  H HB1  . ALA A 1 20  ? 13.322  -5.879  8.883   1.00 0.00 ? 20  ALA A HB1  6  
ATOM 9591  H HB2  . ALA A 1 20  ? 14.911  -5.166  8.604   1.00 0.00 ? 20  ALA A HB2  6  
ATOM 9592  H HB3  . ALA A 1 20  ? 13.649  -4.224  9.399   1.00 0.00 ? 20  ALA A HB3  6  
ATOM 9593  N N    . ASP A 1 21  ? 14.578  -5.430  5.420   1.00 0.00 ? 21  ASP A N    6  
ATOM 9594  C CA   . ASP A 1 21  ? 15.634  -5.526  4.419   1.00 0.00 ? 21  ASP A CA   6  
ATOM 9595  C C    . ASP A 1 21  ? 15.476  -4.443  3.356   1.00 0.00 ? 21  ASP A C    6  
ATOM 9596  O O    . ASP A 1 21  ? 16.462  -3.948  2.808   1.00 0.00 ? 21  ASP A O    6  
ATOM 9597  C CB   . ASP A 1 21  ? 15.619  -6.908  3.763   1.00 0.00 ? 21  ASP A CB   6  
ATOM 9598  C CG   . ASP A 1 21  ? 14.445  -7.089  2.821   1.00 0.00 ? 21  ASP A CG   6  
ATOM 9599  O OD1  . ASP A 1 21  ? 13.299  -7.159  3.310   1.00 0.00 ? 21  ASP A OD1  6  
ATOM 9600  O OD2  . ASP A 1 21  ? 14.673  -7.162  1.595   1.00 0.00 ? 21  ASP A OD2  6  
ATOM 9601  H H    . ASP A 1 21  ? 13.879  -6.116  5.445   1.00 0.00 ? 21  ASP A H    6  
ATOM 9602  H HA   . ASP A 1 21  ? 16.580  -5.386  4.920   1.00 0.00 ? 21  ASP A HA   6  
ATOM 9603  H HB2  . ASP A 1 21  ? 16.532  -7.041  3.200   1.00 0.00 ? 21  ASP A HB2  6  
ATOM 9604  H HB3  . ASP A 1 21  ? 15.561  -7.664  4.532   1.00 0.00 ? 21  ASP A HB3  6  
ATOM 9605  N N    . LEU A 1 22  ? 14.231  -4.080  3.069   1.00 0.00 ? 22  LEU A N    6  
ATOM 9606  C CA   . LEU A 1 22  ? 13.943  -3.056  2.071   1.00 0.00 ? 22  LEU A CA   6  
ATOM 9607  C C    . LEU A 1 22  ? 14.763  -1.796  2.332   1.00 0.00 ? 22  LEU A C    6  
ATOM 9608  O O    . LEU A 1 22  ? 15.096  -1.467  3.470   1.00 0.00 ? 22  LEU A O    6  
ATOM 9609  C CB   . LEU A 1 22  ? 12.452  -2.717  2.075   1.00 0.00 ? 22  LEU A CB   6  
ATOM 9610  C CG   . LEU A 1 22  ? 11.493  -3.903  1.962   1.00 0.00 ? 22  LEU A CG   6  
ATOM 9611  C CD1  . LEU A 1 22  ? 10.058  -3.418  1.824   1.00 0.00 ? 22  LEU A CD1  6  
ATOM 9612  C CD2  . LEU A 1 22  ? 11.876  -4.786  0.783   1.00 0.00 ? 22  LEU A CD2  6  
ATOM 9613  H H    . LEU A 1 22  ? 13.487  -4.510  3.539   1.00 0.00 ? 22  LEU A H    6  
ATOM 9614  H HA   . LEU A 1 22  ? 14.212  -3.452  1.103   1.00 0.00 ? 22  LEU A HA   6  
ATOM 9615  H HB2  . LEU A 1 22  ? 12.232  -2.202  2.998   1.00 0.00 ? 22  LEU A HB2  6  
ATOM 9616  H HB3  . LEU A 1 22  ? 12.262  -2.055  1.242   1.00 0.00 ? 22  LEU A HB3  6  
ATOM 9617  H HG   . LEU A 1 22  ? 11.559  -4.498  2.862   1.00 0.00 ? 22  LEU A HG   6  
ATOM 9618  H HD11 . LEU A 1 22  ? 9.382   -4.212  2.103   1.00 0.00 ? 22  LEU A HD11 6  
ATOM 9619  H HD12 . LEU A 1 22  ? 9.873   -3.131  0.799   1.00 0.00 ? 22  LEU A HD12 6  
ATOM 9620  H HD13 . LEU A 1 22  ? 9.902   -2.567  2.470   1.00 0.00 ? 22  LEU A HD13 6  
ATOM 9621  H HD21 . LEU A 1 22  ? 11.004  -5.324  0.439   1.00 0.00 ? 22  LEU A HD21 6  
ATOM 9622  H HD22 . LEU A 1 22  ? 12.634  -5.491  1.093   1.00 0.00 ? 22  LEU A HD22 6  
ATOM 9623  H HD23 . LEU A 1 22  ? 12.259  -4.172  -0.018  1.00 0.00 ? 22  LEU A HD23 6  
ATOM 9624  N N    . PRO A 1 23  ? 15.096  -1.073  1.252   1.00 0.00 ? 23  PRO A N    6  
ATOM 9625  C CA   . PRO A 1 23  ? 15.879  0.164   1.338   1.00 0.00 ? 23  PRO A CA   6  
ATOM 9626  C C    . PRO A 1 23  ? 15.094  1.303   1.981   1.00 0.00 ? 23  PRO A C    6  
ATOM 9627  O O    . PRO A 1 23  ? 15.579  1.962   2.900   1.00 0.00 ? 23  PRO A O    6  
ATOM 9628  C CB   . PRO A 1 23  ? 16.191  0.489   -0.125  1.00 0.00 ? 23  PRO A CB   6  
ATOM 9629  C CG   . PRO A 1 23  ? 15.097  -0.163  -0.899  1.00 0.00 ? 23  PRO A CG   6  
ATOM 9630  C CD   . PRO A 1 23  ? 14.733  -1.406  -0.136  1.00 0.00 ? 23  PRO A CD   6  
ATOM 9631  H HA   . PRO A 1 23  ? 16.801  0.012   1.880   1.00 0.00 ? 23  PRO A HA   6  
ATOM 9632  H HB2  . PRO A 1 23  ? 16.192  1.560   -0.266  1.00 0.00 ? 23  PRO A HB2  6  
ATOM 9633  H HB3  . PRO A 1 23  ? 17.156  0.084   -0.389  1.00 0.00 ? 23  PRO A HB3  6  
ATOM 9634  H HG2  . PRO A 1 23  ? 14.248  0.500   -0.964  1.00 0.00 ? 23  PRO A HG2  6  
ATOM 9635  H HG3  . PRO A 1 23  ? 15.450  -0.420  -1.887  1.00 0.00 ? 23  PRO A HG3  6  
ATOM 9636  H HD2  . PRO A 1 23  ? 13.675  -1.604  -0.220  1.00 0.00 ? 23  PRO A HD2  6  
ATOM 9637  H HD3  . PRO A 1 23  ? 15.306  -2.249  -0.492  1.00 0.00 ? 23  PRO A HD3  6  
ATOM 9638  N N    . GLY A 1 24  ? 13.879  1.529   1.492   1.00 0.00 ? 24  GLY A N    6  
ATOM 9639  C CA   . GLY A 1 24  ? 13.047  2.588   2.031   1.00 0.00 ? 24  GLY A CA   6  
ATOM 9640  C C    . GLY A 1 24  ? 12.724  2.382   3.498   1.00 0.00 ? 24  GLY A C    6  
ATOM 9641  O O    . GLY A 1 24  ? 13.385  1.601   4.181   1.00 0.00 ? 24  GLY A O    6  
ATOM 9642  H H    . GLY A 1 24  ? 13.544  0.971   0.758   1.00 0.00 ? 24  GLY A H    6  
ATOM 9643  H HA2  . GLY A 1 24  ? 13.563  3.530   1.916   1.00 0.00 ? 24  GLY A HA2  6  
ATOM 9644  H HA3  . GLY A 1 24  ? 12.123  2.625   1.473   1.00 0.00 ? 24  GLY A HA3  6  
ATOM 9645  N N    . GLU A 1 25  ? 11.706  3.086   3.982   1.00 0.00 ? 25  GLU A N    6  
ATOM 9646  C CA   . GLU A 1 25  ? 11.299  2.977   5.378   1.00 0.00 ? 25  GLU A CA   6  
ATOM 9647  C C    . GLU A 1 25  ? 9.840   2.542   5.488   1.00 0.00 ? 25  GLU A C    6  
ATOM 9648  O O    . GLU A 1 25  ? 8.948   3.172   4.919   1.00 0.00 ? 25  GLU A O    6  
ATOM 9649  C CB   . GLU A 1 25  ? 11.498  4.313   6.097   1.00 0.00 ? 25  GLU A CB   6  
ATOM 9650  C CG   . GLU A 1 25  ? 11.712  4.174   7.594   1.00 0.00 ? 25  GLU A CG   6  
ATOM 9651  C CD   . GLU A 1 25  ? 13.095  3.659   7.941   1.00 0.00 ? 25  GLU A CD   6  
ATOM 9652  O OE1  . GLU A 1 25  ? 13.313  2.433   7.849   1.00 0.00 ? 25  GLU A OE1  6  
ATOM 9653  O OE2  . GLU A 1 25  ? 13.960  4.483   8.304   1.00 0.00 ? 25  GLU A OE2  6  
ATOM 9654  H H    . GLU A 1 25  ? 11.217  3.693   3.388   1.00 0.00 ? 25  GLU A H    6  
ATOM 9655  H HA   . GLU A 1 25  ? 11.921  2.230   5.848   1.00 0.00 ? 25  GLU A HA   6  
ATOM 9656  H HB2  . GLU A 1 25  ? 12.360  4.810   5.675   1.00 0.00 ? 25  GLU A HB2  6  
ATOM 9657  H HB3  . GLU A 1 25  ? 10.626  4.929   5.935   1.00 0.00 ? 25  GLU A HB3  6  
ATOM 9658  H HG2  . GLU A 1 25  ? 11.578  5.140   8.056   1.00 0.00 ? 25  GLU A HG2  6  
ATOM 9659  H HG3  . GLU A 1 25  ? 10.978  3.484   7.987   1.00 0.00 ? 25  GLU A HG3  6  
ATOM 9660  N N    . LEU A 1 26  ? 9.606   1.459   6.221   1.00 0.00 ? 26  LEU A N    6  
ATOM 9661  C CA   . LEU A 1 26  ? 8.256   0.937   6.405   1.00 0.00 ? 26  LEU A CA   6  
ATOM 9662  C C    . LEU A 1 26  ? 7.372   1.954   7.121   1.00 0.00 ? 26  LEU A C    6  
ATOM 9663  O O    . LEU A 1 26  ? 7.714   2.439   8.200   1.00 0.00 ? 26  LEU A O    6  
ATOM 9664  C CB   . LEU A 1 26  ? 8.297   -0.369  7.200   1.00 0.00 ? 26  LEU A CB   6  
ATOM 9665  C CG   . LEU A 1 26  ? 7.049   -1.248  7.113   1.00 0.00 ? 26  LEU A CG   6  
ATOM 9666  C CD1  . LEU A 1 26  ? 7.096   -2.119  5.867   1.00 0.00 ? 26  LEU A CD1  6  
ATOM 9667  C CD2  . LEU A 1 26  ? 6.912   -2.105  8.362   1.00 0.00 ? 26  LEU A CD2  6  
ATOM 9668  H H    . LEU A 1 26  ? 10.357  0.999   6.649   1.00 0.00 ? 26  LEU A H    6  
ATOM 9669  H HA   . LEU A 1 26  ? 7.840   0.742   5.428   1.00 0.00 ? 26  LEU A HA   6  
ATOM 9670  H HB2  . LEU A 1 26  ? 9.134   -0.948  6.842   1.00 0.00 ? 26  LEU A HB2  6  
ATOM 9671  H HB3  . LEU A 1 26  ? 8.454   -0.118  8.240   1.00 0.00 ? 26  LEU A HB3  6  
ATOM 9672  H HG   . LEU A 1 26  ? 6.175   -0.614  7.043   1.00 0.00 ? 26  LEU A HG   6  
ATOM 9673  H HD11 . LEU A 1 26  ? 8.118   -2.214  5.533   1.00 0.00 ? 26  LEU A HD11 6  
ATOM 9674  H HD12 . LEU A 1 26  ? 6.503   -1.666  5.087   1.00 0.00 ? 26  LEU A HD12 6  
ATOM 9675  H HD13 . LEU A 1 26  ? 6.700   -3.098  6.098   1.00 0.00 ? 26  LEU A HD13 6  
ATOM 9676  H HD21 . LEU A 1 26  ? 5.877   -2.126  8.672   1.00 0.00 ? 26  LEU A HD21 6  
ATOM 9677  H HD22 . LEU A 1 26  ? 7.517   -1.688  9.153   1.00 0.00 ? 26  LEU A HD22 6  
ATOM 9678  H HD23 . LEU A 1 26  ? 7.243   -3.110  8.146   1.00 0.00 ? 26  LEU A HD23 6  
ATOM 9679  N N    . HIS A 1 27  ? 6.233   2.271   6.514   1.00 0.00 ? 27  HIS A N    6  
ATOM 9680  C CA   . HIS A 1 27  ? 5.298   3.228   7.095   1.00 0.00 ? 27  HIS A CA   6  
ATOM 9681  C C    . HIS A 1 27  ? 3.892   2.641   7.164   1.00 0.00 ? 27  HIS A C    6  
ATOM 9682  O O    . HIS A 1 27  ? 3.182   2.587   6.159   1.00 0.00 ? 27  HIS A O    6  
ATOM 9683  C CB   . HIS A 1 27  ? 5.284   4.520   6.277   1.00 0.00 ? 27  HIS A CB   6  
ATOM 9684  C CG   . HIS A 1 27  ? 6.356   5.490   6.671   1.00 0.00 ? 27  HIS A CG   6  
ATOM 9685  N ND1  . HIS A 1 27  ? 6.207   6.400   7.696   1.00 0.00 ? 27  HIS A ND1  6  
ATOM 9686  C CD2  . HIS A 1 27  ? 7.598   5.687   6.171   1.00 0.00 ? 27  HIS A CD2  6  
ATOM 9687  C CE1  . HIS A 1 27  ? 7.312   7.116   7.809   1.00 0.00 ? 27  HIS A CE1  6  
ATOM 9688  N NE2  . HIS A 1 27  ? 8.172   6.703   6.895   1.00 0.00 ? 27  HIS A NE2  6  
ATOM 9689  H H    . HIS A 1 27  ? 6.016   1.852   5.656   1.00 0.00 ? 27  HIS A H    6  
ATOM 9690  H HA   . HIS A 1 27  ? 5.631   3.451   8.097   1.00 0.00 ? 27  HIS A HA   6  
ATOM 9691  H HB2  . HIS A 1 27  ? 5.423   4.279   5.234   1.00 0.00 ? 27  HIS A HB2  6  
ATOM 9692  H HB3  . HIS A 1 27  ? 4.329   5.010   6.405   1.00 0.00 ? 27  HIS A HB3  6  
ATOM 9693  H HD1  . HIS A 1 27  ? 5.411   6.507   8.256   1.00 0.00 ? 27  HIS A HD1  6  
ATOM 9694  H HD2  . HIS A 1 27  ? 8.055   5.146   5.354   1.00 0.00 ? 27  HIS A HD2  6  
ATOM 9695  H HE1  . HIS A 1 27  ? 7.483   7.905   8.526   1.00 0.00 ? 27  HIS A HE1  6  
ATOM 9696  H HE2  . HIS A 1 27  ? 9.036   7.122   6.704   1.00 0.00 ? 27  HIS A HE2  6  
ATOM 9697  N N    . ILE A 1 28  ? 3.497   2.201   8.354   1.00 0.00 ? 28  ILE A N    6  
ATOM 9698  C CA   . ILE A 1 28  ? 2.176   1.618   8.553   1.00 0.00 ? 28  ILE A CA   6  
ATOM 9699  C C    . ILE A 1 28  ? 1.195   2.651   9.097   1.00 0.00 ? 28  ILE A C    6  
ATOM 9700  O O    . ILE A 1 28  ? 1.305   3.081   10.246  1.00 0.00 ? 28  ILE A O    6  
ATOM 9701  C CB   . ILE A 1 28  ? 2.229   0.419   9.518   1.00 0.00 ? 28  ILE A CB   6  
ATOM 9702  C CG1  . ILE A 1 28  ? 3.181   -0.652  8.983   1.00 0.00 ? 28  ILE A CG1  6  
ATOM 9703  C CG2  . ILE A 1 28  ? 0.837   -0.157  9.725   1.00 0.00 ? 28  ILE A CG2  6  
ATOM 9704  C CD1  . ILE A 1 28  ? 3.639   -1.636  10.038  1.00 0.00 ? 28  ILE A CD1  6  
ATOM 9705  H H    . ILE A 1 28  ? 4.108   2.272   9.116   1.00 0.00 ? 28  ILE A H    6  
ATOM 9706  H HA   . ILE A 1 28  ? 1.819   1.268   7.595   1.00 0.00 ? 28  ILE A HA   6  
ATOM 9707  H HB   . ILE A 1 28  ? 2.593   0.770   10.472  1.00 0.00 ? 28  ILE A HB   6  
ATOM 9708  H HG12 . ILE A 1 28  ? 2.685   -1.209  8.204   1.00 0.00 ? 28  ILE A HG12 6  
ATOM 9709  H HG13 . ILE A 1 28  ? 4.058   -0.172  8.573   1.00 0.00 ? 28  ILE A HG13 6  
ATOM 9710  H HG21 . ILE A 1 28  ? 0.562   -0.071  10.766  1.00 0.00 ? 28  ILE A HG21 6  
ATOM 9711  H HG22 . ILE A 1 28  ? 0.128   0.390   9.121   1.00 0.00 ? 28  ILE A HG22 6  
ATOM 9712  H HG23 . ILE A 1 28  ? 0.830   -1.197  9.435   1.00 0.00 ? 28  ILE A HG23 6  
ATOM 9713  H HD11 . ILE A 1 28  ? 3.413   -2.641  9.715   1.00 0.00 ? 28  ILE A HD11 6  
ATOM 9714  H HD12 . ILE A 1 28  ? 4.703   -1.535  10.187  1.00 0.00 ? 28  ILE A HD12 6  
ATOM 9715  H HD13 . ILE A 1 28  ? 3.124   -1.432  10.966  1.00 0.00 ? 28  ILE A HD13 6  
ATOM 9716  N N    . ILE A 1 29  ? 0.237   3.045   8.265   1.00 0.00 ? 29  ILE A N    6  
ATOM 9717  C CA   . ILE A 1 29  ? -0.765  4.025   8.664   1.00 0.00 ? 29  ILE A CA   6  
ATOM 9718  C C    . ILE A 1 29  ? -2.173  3.535   8.342   1.00 0.00 ? 29  ILE A C    6  
ATOM 9719  O O    . ILE A 1 29  ? -2.380  2.812   7.368   1.00 0.00 ? 29  ILE A O    6  
ATOM 9720  C CB   . ILE A 1 29  ? -0.534  5.381   7.970   1.00 0.00 ? 29  ILE A CB   6  
ATOM 9721  C CG1  . ILE A 1 29  ? -1.006  5.320   6.515   1.00 0.00 ? 29  ILE A CG1  6  
ATOM 9722  C CG2  . ILE A 1 29  ? 0.936   5.768   8.040   1.00 0.00 ? 29  ILE A CG2  6  
ATOM 9723  C CD1  . ILE A 1 29  ? -1.006  6.666   5.824   1.00 0.00 ? 29  ILE A CD1  6  
ATOM 9724  H H    . ILE A 1 29  ? 0.203   2.666   7.362   1.00 0.00 ? 29  ILE A H    6  
ATOM 9725  H HA   . ILE A 1 29  ? -0.682  4.172   9.731   1.00 0.00 ? 29  ILE A HA   6  
ATOM 9726  H HB   . ILE A 1 29  ? -1.105  6.131   8.495   1.00 0.00 ? 29  ILE A HB   6  
ATOM 9727  H HG12 . ILE A 1 29  ? -0.357  4.662   5.960   1.00 0.00 ? 29  ILE A HG12 6  
ATOM 9728  H HG13 . ILE A 1 29  ? -2.014  4.932   6.488   1.00 0.00 ? 29  ILE A HG13 6  
ATOM 9729  H HG21 . ILE A 1 29  ? 1.330   5.867   7.039   1.00 0.00 ? 29  ILE A HG21 6  
ATOM 9730  H HG22 . ILE A 1 29  ? 1.035   6.709   8.559   1.00 0.00 ? 29  ILE A HG22 6  
ATOM 9731  H HG23 . ILE A 1 29  ? 1.485   5.004   8.569   1.00 0.00 ? 29  ILE A HG23 6  
ATOM 9732  H HD11 . ILE A 1 29  ? -1.511  7.390   6.445   1.00 0.00 ? 29  ILE A HD11 6  
ATOM 9733  H HD12 . ILE A 1 29  ? 0.012   6.983   5.653   1.00 0.00 ? 29  ILE A HD12 6  
ATOM 9734  H HD13 . ILE A 1 29  ? -1.521  6.583   4.877   1.00 0.00 ? 29  ILE A HD13 6  
ATOM 9735  N N    . GLU A 1 30  ? -3.136  3.936   9.165   1.00 0.00 ? 30  GLU A N    6  
ATOM 9736  C CA   . GLU A 1 30  ? -4.524  3.538   8.967   1.00 0.00 ? 30  GLU A CA   6  
ATOM 9737  C C    . GLU A 1 30  ? -5.343  4.688   8.386   1.00 0.00 ? 30  GLU A C    6  
ATOM 9738  O O    . GLU A 1 30  ? -5.095  5.856   8.689   1.00 0.00 ? 30  GLU A O    6  
ATOM 9739  C CB   . GLU A 1 30  ? -5.140  3.076   10.290  1.00 0.00 ? 30  GLU A CB   6  
ATOM 9740  C CG   . GLU A 1 30  ? -4.724  1.673   10.698  1.00 0.00 ? 30  GLU A CG   6  
ATOM 9741  C CD   . GLU A 1 30  ? -3.477  1.662   11.561  1.00 0.00 ? 30  GLU A CD   6  
ATOM 9742  O OE1  . GLU A 1 30  ? -2.597  2.521   11.345  1.00 0.00 ? 30  GLU A OE1  6  
ATOM 9743  O OE2  . GLU A 1 30  ? -3.382  0.794   12.454  1.00 0.00 ? 30  GLU A OE2  6  
ATOM 9744  H H    . GLU A 1 30  ? -2.907  4.512   9.924   1.00 0.00 ? 30  GLU A H    6  
ATOM 9745  H HA   . GLU A 1 30  ? -4.537  2.715   8.269   1.00 0.00 ? 30  GLU A HA   6  
ATOM 9746  H HB2  . GLU A 1 30  ? -4.841  3.760   11.070  1.00 0.00 ? 30  GLU A HB2  6  
ATOM 9747  H HB3  . GLU A 1 30  ? -6.216  3.097   10.198  1.00 0.00 ? 30  GLU A HB3  6  
ATOM 9748  H HG2  . GLU A 1 30  ? -5.531  1.219   11.253  1.00 0.00 ? 30  GLU A HG2  6  
ATOM 9749  H HG3  . GLU A 1 30  ? -4.532  1.095   9.806   1.00 0.00 ? 30  GLU A HG3  6  
ATOM 9750  N N    . LEU A 1 31  ? -6.317  4.349   7.550   1.00 0.00 ? 31  LEU A N    6  
ATOM 9751  C CA   . LEU A 1 31  ? -7.173  5.352   6.925   1.00 0.00 ? 31  LEU A CA   6  
ATOM 9752  C C    . LEU A 1 31  ? -8.615  4.861   6.840   1.00 0.00 ? 31  LEU A C    6  
ATOM 9753  O O    . LEU A 1 31  ? -8.894  3.831   6.227   1.00 0.00 ? 31  LEU A O    6  
ATOM 9754  C CB   . LEU A 1 31  ? -6.655  5.694   5.528   1.00 0.00 ? 31  LEU A CB   6  
ATOM 9755  C CG   . LEU A 1 31  ? -5.150  5.939   5.411   1.00 0.00 ? 31  LEU A CG   6  
ATOM 9756  C CD1  . LEU A 1 31  ? -4.761  6.192   3.963   1.00 0.00 ? 31  LEU A CD1  6  
ATOM 9757  C CD2  . LEU A 1 31  ? -4.730  7.108   6.290   1.00 0.00 ? 31  LEU A CD2  6  
ATOM 9758  H H    . LEU A 1 31  ? -6.467  3.402   7.347   1.00 0.00 ? 31  LEU A H    6  
ATOM 9759  H HA   . LEU A 1 31  ? -7.144  6.240   7.539   1.00 0.00 ? 31  LEU A HA   6  
ATOM 9760  H HB2  . LEU A 1 31  ? -6.908  4.875   4.872   1.00 0.00 ? 31  LEU A HB2  6  
ATOM 9761  H HB3  . LEU A 1 31  ? -7.163  6.588   5.197   1.00 0.00 ? 31  LEU A HB3  6  
ATOM 9762  H HG   . LEU A 1 31  ? -4.621  5.058   5.749   1.00 0.00 ? 31  LEU A HG   6  
ATOM 9763  H HD11 . LEU A 1 31  ? -5.578  6.676   3.450   1.00 0.00 ? 31  LEU A HD11 6  
ATOM 9764  H HD12 . LEU A 1 31  ? -4.538  5.252   3.480   1.00 0.00 ? 31  LEU A HD12 6  
ATOM 9765  H HD13 . LEU A 1 31  ? -3.888  6.828   3.931   1.00 0.00 ? 31  LEU A HD13 6  
ATOM 9766  H HD21 . LEU A 1 31  ? -5.479  7.272   7.051   1.00 0.00 ? 31  LEU A HD21 6  
ATOM 9767  H HD22 . LEU A 1 31  ? -4.632  7.997   5.684   1.00 0.00 ? 31  LEU A HD22 6  
ATOM 9768  H HD23 . LEU A 1 31  ? -3.783  6.884   6.758   1.00 0.00 ? 31  LEU A HD23 6  
ATOM 9769  N N    . GLU A 1 32  ? -9.526  5.607   7.457   1.00 0.00 ? 32  GLU A N    6  
ATOM 9770  C CA   . GLU A 1 32  ? -10.939 5.247   7.448   1.00 0.00 ? 32  GLU A CA   6  
ATOM 9771  C C    . GLU A 1 32  ? -11.558 5.504   6.077   1.00 0.00 ? 32  GLU A C    6  
ATOM 9772  O O    . GLU A 1 32  ? -11.708 6.651   5.656   1.00 0.00 ? 32  GLU A O    6  
ATOM 9773  C CB   . GLU A 1 32  ? -11.696 6.038   8.517   1.00 0.00 ? 32  GLU A CB   6  
ATOM 9774  C CG   . GLU A 1 32  ? -12.895 5.299   9.086   1.00 0.00 ? 32  GLU A CG   6  
ATOM 9775  C CD   . GLU A 1 32  ? -13.924 6.235   9.691   1.00 0.00 ? 32  GLU A CD   6  
ATOM 9776  O OE1  . GLU A 1 32  ? -14.435 7.108   8.959   1.00 0.00 ? 32  GLU A OE1  6  
ATOM 9777  O OE2  . GLU A 1 32  ? -14.217 6.094   10.897  1.00 0.00 ? 32  GLU A OE2  6  
ATOM 9778  H H    . GLU A 1 32  ? -9.241  6.417   7.929   1.00 0.00 ? 32  GLU A H    6  
ATOM 9779  H HA   . GLU A 1 32  ? -11.015 4.194   7.672   1.00 0.00 ? 32  GLU A HA   6  
ATOM 9780  H HB2  . GLU A 1 32  ? -11.019 6.263   9.328   1.00 0.00 ? 32  GLU A HB2  6  
ATOM 9781  H HB3  . GLU A 1 32  ? -12.043 6.964   8.084   1.00 0.00 ? 32  GLU A HB3  6  
ATOM 9782  H HG2  . GLU A 1 32  ? -13.366 4.738   8.293   1.00 0.00 ? 32  GLU A HG2  6  
ATOM 9783  H HG3  . GLU A 1 32  ? -12.553 4.619   9.852   1.00 0.00 ? 32  GLU A HG3  6  
ATOM 9784  N N    . LYS A 1 33  ? -11.914 4.428   5.384   1.00 0.00 ? 33  LYS A N    6  
ATOM 9785  C CA   . LYS A 1 33  ? -12.516 4.534   4.061   1.00 0.00 ? 33  LYS A CA   6  
ATOM 9786  C C    . LYS A 1 33  ? -13.512 5.688   4.007   1.00 0.00 ? 33  LYS A C    6  
ATOM 9787  O O    . LYS A 1 33  ? -14.456 5.743   4.795   1.00 0.00 ? 33  LYS A O    6  
ATOM 9788  C CB   . LYS A 1 33  ? -13.217 3.225   3.690   1.00 0.00 ? 33  LYS A CB   6  
ATOM 9789  C CG   . LYS A 1 33  ? -12.260 2.110   3.307   1.00 0.00 ? 33  LYS A CG   6  
ATOM 9790  C CD   . LYS A 1 33  ? -12.910 1.119   2.355   1.00 0.00 ? 33  LYS A CD   6  
ATOM 9791  C CE   . LYS A 1 33  ? -13.841 0.168   3.091   1.00 0.00 ? 33  LYS A CE   6  
ATOM 9792  N NZ   . LYS A 1 33  ? -15.213 0.731   3.229   1.00 0.00 ? 33  LYS A NZ   6  
ATOM 9793  H H    . LYS A 1 33  ? -11.768 3.539   5.773   1.00 0.00 ? 33  LYS A H    6  
ATOM 9794  H HA   . LYS A 1 33  ? -11.726 4.722   3.350   1.00 0.00 ? 33  LYS A HA   6  
ATOM 9795  H HB2  . LYS A 1 33  ? -13.804 2.893   4.535   1.00 0.00 ? 33  LYS A HB2  6  
ATOM 9796  H HB3  . LYS A 1 33  ? -13.877 3.408   2.855   1.00 0.00 ? 33  LYS A HB3  6  
ATOM 9797  H HG2  . LYS A 1 33  ? -11.395 2.540   2.825   1.00 0.00 ? 33  LYS A HG2  6  
ATOM 9798  H HG3  . LYS A 1 33  ? -11.953 1.587   4.202   1.00 0.00 ? 33  LYS A HG3  6  
ATOM 9799  H HD2  . LYS A 1 33  ? -13.480 1.663   1.617   1.00 0.00 ? 33  LYS A HD2  6  
ATOM 9800  H HD3  . LYS A 1 33  ? -12.137 0.545   1.864   1.00 0.00 ? 33  LYS A HD3  6  
ATOM 9801  H HE2  . LYS A 1 33  ? -13.895 -0.759  2.542   1.00 0.00 ? 33  LYS A HE2  6  
ATOM 9802  H HE3  . LYS A 1 33  ? -13.438 -0.019  4.076   1.00 0.00 ? 33  LYS A HE3  6  
ATOM 9803  H HZ1  . LYS A 1 33  ? -15.877 0.205   2.625   1.00 0.00 ? 33  LYS A HZ1  6  
ATOM 9804  H HZ2  . LYS A 1 33  ? -15.220 1.730   2.942   1.00 0.00 ? 33  LYS A HZ2  6  
ATOM 9805  H HZ3  . LYS A 1 33  ? -15.531 0.662   4.216   1.00 0.00 ? 33  LYS A HZ3  6  
ATOM 9806  N N    . ASP A 1 34  ? -13.295 6.607   3.072   1.00 0.00 ? 34  ASP A N    6  
ATOM 9807  C CA   . ASP A 1 34  ? -14.175 7.759   2.915   1.00 0.00 ? 34  ASP A CA   6  
ATOM 9808  C C    . ASP A 1 34  ? -15.427 7.383   2.128   1.00 0.00 ? 34  ASP A C    6  
ATOM 9809  O O    . ASP A 1 34  ? -15.582 6.241   1.695   1.00 0.00 ? 34  ASP A O    6  
ATOM 9810  C CB   . ASP A 1 34  ? -13.437 8.898   2.209   1.00 0.00 ? 34  ASP A CB   6  
ATOM 9811  C CG   . ASP A 1 34  ? -14.077 10.249  2.466   1.00 0.00 ? 34  ASP A CG   6  
ATOM 9812  O OD1  . ASP A 1 34  ? -14.628 10.445  3.569   1.00 0.00 ? 34  ASP A OD1  6  
ATOM 9813  O OD2  . ASP A 1 34  ? -14.026 11.110  1.563   1.00 0.00 ? 34  ASP A OD2  6  
ATOM 9814  H H    . ASP A 1 34  ? -12.525 6.508   2.474   1.00 0.00 ? 34  ASP A H    6  
ATOM 9815  H HA   . ASP A 1 34  ? -14.470 8.089   3.899   1.00 0.00 ? 34  ASP A HA   6  
ATOM 9816  H HB2  . ASP A 1 34  ? -12.417 8.931   2.563   1.00 0.00 ? 34  ASP A HB2  6  
ATOM 9817  H HB3  . ASP A 1 34  ? -13.439 8.715   1.145   1.00 0.00 ? 34  ASP A HB3  6  
ATOM 9818  N N    . LYS A 1 35  ? -16.319 8.351   1.948   1.00 0.00 ? 35  LYS A N    6  
ATOM 9819  C CA   . LYS A 1 35  ? -17.558 8.124   1.214   1.00 0.00 ? 35  LYS A CA   6  
ATOM 9820  C C    . LYS A 1 35  ? -17.325 7.190   0.030   1.00 0.00 ? 35  LYS A C    6  
ATOM 9821  O O    . LYS A 1 35  ? -18.227 6.466   -0.388  1.00 0.00 ? 35  LYS A O    6  
ATOM 9822  C CB   . LYS A 1 35  ? -18.136 9.453   0.723   1.00 0.00 ? 35  LYS A CB   6  
ATOM 9823  C CG   . LYS A 1 35  ? -19.515 9.324   0.099   1.00 0.00 ? 35  LYS A CG   6  
ATOM 9824  C CD   . LYS A 1 35  ? -20.593 9.166   1.158   1.00 0.00 ? 35  LYS A CD   6  
ATOM 9825  C CE   . LYS A 1 35  ? -21.804 8.424   0.614   1.00 0.00 ? 35  LYS A CE   6  
ATOM 9826  N NZ   . LYS A 1 35  ? -23.055 8.809   1.323   1.00 0.00 ? 35  LYS A NZ   6  
ATOM 9827  H H    . LYS A 1 35  ? -16.139 9.242   2.317   1.00 0.00 ? 35  LYS A H    6  
ATOM 9828  H HA   . LYS A 1 35  ? -18.263 7.662   1.888   1.00 0.00 ? 35  LYS A HA   6  
ATOM 9829  H HB2  . LYS A 1 35  ? -18.204 10.133  1.559   1.00 0.00 ? 35  LYS A HB2  6  
ATOM 9830  H HB3  . LYS A 1 35  ? -17.467 9.871   -0.016  1.00 0.00 ? 35  LYS A HB3  6  
ATOM 9831  H HG2  . LYS A 1 35  ? -19.722 10.210  -0.481  1.00 0.00 ? 35  LYS A HG2  6  
ATOM 9832  H HG3  . LYS A 1 35  ? -19.528 8.457   -0.547  1.00 0.00 ? 35  LYS A HG3  6  
ATOM 9833  H HD2  . LYS A 1 35  ? -20.189 8.610   1.991   1.00 0.00 ? 35  LYS A HD2  6  
ATOM 9834  H HD3  . LYS A 1 35  ? -20.903 10.146  1.493   1.00 0.00 ? 35  LYS A HD3  6  
ATOM 9835  H HE2  . LYS A 1 35  ? -21.910 8.654   -0.435  1.00 0.00 ? 35  LYS A HE2  6  
ATOM 9836  H HE3  . LYS A 1 35  ? -21.644 7.363   0.735   1.00 0.00 ? 35  LYS A HE3  6  
ATOM 9837  H HZ1  . LYS A 1 35  ? -23.513 9.604   0.833   1.00 0.00 ? 35  LYS A HZ1  6  
ATOM 9838  H HZ2  . LYS A 1 35  ? -22.839 9.097   2.299   1.00 0.00 ? 35  LYS A HZ2  6  
ATOM 9839  H HZ3  . LYS A 1 35  ? -23.715 8.005   1.348   1.00 0.00 ? 35  LYS A HZ3  6  
ATOM 9840  N N    . ASN A 1 36  ? -16.109 7.212   -0.505  1.00 0.00 ? 36  ASN A N    6  
ATOM 9841  C CA   . ASN A 1 36  ? -15.758 6.367   -1.640  1.00 0.00 ? 36  ASN A CA   6  
ATOM 9842  C C    . ASN A 1 36  ? -14.714 5.327   -1.242  1.00 0.00 ? 36  ASN A C    6  
ATOM 9843  O O    . ASN A 1 36  ? -14.553 4.307   -1.911  1.00 0.00 ? 36  ASN A O    6  
ATOM 9844  C CB   . ASN A 1 36  ? -15.228 7.221   -2.794  1.00 0.00 ? 36  ASN A CB   6  
ATOM 9845  C CG   . ASN A 1 36  ? -16.218 8.285   -3.227  1.00 0.00 ? 36  ASN A CG   6  
ATOM 9846  O OD1  . ASN A 1 36  ? -16.333 9.336   -2.596  1.00 0.00 ? 36  ASN A OD1  6  
ATOM 9847  N ND2  . ASN A 1 36  ? -16.939 8.017   -4.310  1.00 0.00 ? 36  ASN A ND2  6  
ATOM 9848  H H    . ASN A 1 36  ? -15.431 7.812   -0.128  1.00 0.00 ? 36  ASN A H    6  
ATOM 9849  H HA   . ASN A 1 36  ? -16.653 5.857   -1.963  1.00 0.00 ? 36  ASN A HA   6  
ATOM 9850  H HB2  . ASN A 1 36  ? -14.316 7.710   -2.483  1.00 0.00 ? 36  ASN A HB2  6  
ATOM 9851  H HB3  . ASN A 1 36  ? -15.020 6.584   -3.640  1.00 0.00 ? 36  ASN A HB3  6  
ATOM 9852  H HD21 . ASN A 1 36  ? -16.794 7.160   -4.762  1.00 0.00 ? 36  ASN A HD21 6  
ATOM 9853  H HD22 . ASN A 1 36  ? -17.586 8.688   -4.612  1.00 0.00 ? 36  ASN A HD22 6  
ATOM 9854  N N    . GLY A 1 37  ? -14.009 5.594   -0.147  1.00 0.00 ? 37  GLY A N    6  
ATOM 9855  C CA   . GLY A 1 37  ? -12.990 4.672   0.321   1.00 0.00 ? 37  GLY A CA   6  
ATOM 9856  C C    . GLY A 1 37  ? -11.586 5.176   0.055   1.00 0.00 ? 37  GLY A C    6  
ATOM 9857  O O    . GLY A 1 37  ? -11.390 6.346   -0.274  1.00 0.00 ? 37  GLY A O    6  
ATOM 9858  H H    . GLY A 1 37  ? -14.181 6.423   0.346   1.00 0.00 ? 37  GLY A H    6  
ATOM 9859  H HA2  . GLY A 1 37  ? -13.114 4.527   1.384   1.00 0.00 ? 37  GLY A HA2  6  
ATOM 9860  H HA3  . GLY A 1 37  ? -13.121 3.724   -0.179  1.00 0.00 ? 37  GLY A HA3  6  
ATOM 9861  N N    . LEU A 1 38  ? -10.605 4.291   0.198   1.00 0.00 ? 38  LEU A N    6  
ATOM 9862  C CA   . LEU A 1 38  ? -9.210  4.652   -0.028  1.00 0.00 ? 38  LEU A CA   6  
ATOM 9863  C C    . LEU A 1 38  ? -8.951  4.925   -1.507  1.00 0.00 ? 38  LEU A C    6  
ATOM 9864  O O    . LEU A 1 38  ? -8.926  4.005   -2.323  1.00 0.00 ? 38  LEU A O    6  
ATOM 9865  C CB   . LEU A 1 38  ? -8.287  3.537   0.465   1.00 0.00 ? 38  LEU A CB   6  
ATOM 9866  C CG   . LEU A 1 38  ? -8.705  2.846   1.764   1.00 0.00 ? 38  LEU A CG   6  
ATOM 9867  C CD1  . LEU A 1 38  ? -7.729  1.732   2.114   1.00 0.00 ? 38  LEU A CD1  6  
ATOM 9868  C CD2  . LEU A 1 38  ? -8.795  3.854   2.900   1.00 0.00 ? 38  LEU A CD2  6  
ATOM 9869  H H    . LEU A 1 38  ? -10.823 3.373   0.462   1.00 0.00 ? 38  LEU A H    6  
ATOM 9870  H HA   . LEU A 1 38  ? -9.006  5.552   0.533   1.00 0.00 ? 38  LEU A HA   6  
ATOM 9871  H HB2  . LEU A 1 38  ? -8.235  2.785   -0.307  1.00 0.00 ? 38  LEU A HB2  6  
ATOM 9872  H HB3  . LEU A 1 38  ? -7.306  3.963   0.617   1.00 0.00 ? 38  LEU A HB3  6  
ATOM 9873  H HG   . LEU A 1 38  ? -9.682  2.402   1.630   1.00 0.00 ? 38  LEU A HG   6  
ATOM 9874  H HD11 . LEU A 1 38  ? -7.301  1.331   1.208   1.00 0.00 ? 38  LEU A HD11 6  
ATOM 9875  H HD12 . LEU A 1 38  ? -8.252  0.949   2.643   1.00 0.00 ? 38  LEU A HD12 6  
ATOM 9876  H HD13 . LEU A 1 38  ? -6.943  2.127   2.740   1.00 0.00 ? 38  LEU A HD13 6  
ATOM 9877  H HD21 . LEU A 1 38  ? -7.874  4.415   2.957   1.00 0.00 ? 38  LEU A HD21 6  
ATOM 9878  H HD22 . LEU A 1 38  ? -8.958  3.333   3.832   1.00 0.00 ? 38  LEU A HD22 6  
ATOM 9879  H HD23 . LEU A 1 38  ? -9.617  4.530   2.716   1.00 0.00 ? 38  LEU A HD23 6  
ATOM 9880  N N    . GLY A 1 39  ? -8.756  6.197   -1.843  1.00 0.00 ? 39  GLY A N    6  
ATOM 9881  C CA   . GLY A 1 39  ? -8.500  6.568   -3.223  1.00 0.00 ? 39  GLY A CA   6  
ATOM 9882  C C    . GLY A 1 39  ? -7.019  6.701   -3.521  1.00 0.00 ? 39  GLY A C    6  
ATOM 9883  O O    . GLY A 1 39  ? -6.370  7.647   -3.073  1.00 0.00 ? 39  GLY A O    6  
ATOM 9884  H H    . GLY A 1 39  ? -8.788  6.888   -1.149  1.00 0.00 ? 39  GLY A H    6  
ATOM 9885  H HA2  . GLY A 1 39  ? -8.921  5.815   -3.871  1.00 0.00 ? 39  GLY A HA2  6  
ATOM 9886  H HA3  . GLY A 1 39  ? -8.982  7.513   -3.425  1.00 0.00 ? 39  GLY A HA3  6  
ATOM 9887  N N    . LEU A 1 40  ? -6.483  5.750   -4.278  1.00 0.00 ? 40  LEU A N    6  
ATOM 9888  C CA   . LEU A 1 40  ? -5.069  5.763   -4.635  1.00 0.00 ? 40  LEU A CA   6  
ATOM 9889  C C    . LEU A 1 40  ? -4.849  5.145   -6.013  1.00 0.00 ? 40  LEU A C    6  
ATOM 9890  O O    . LEU A 1 40  ? -5.438  4.117   -6.344  1.00 0.00 ? 40  LEU A O    6  
ATOM 9891  C CB   . LEU A 1 40  ? -4.251  5.006   -3.588  1.00 0.00 ? 40  LEU A CB   6  
ATOM 9892  C CG   . LEU A 1 40  ? -4.303  5.563   -2.165  1.00 0.00 ? 40  LEU A CG   6  
ATOM 9893  C CD1  . LEU A 1 40  ? -3.966  4.478   -1.154  1.00 0.00 ? 40  LEU A CD1  6  
ATOM 9894  C CD2  . LEU A 1 40  ? -3.354  6.743   -2.019  1.00 0.00 ? 40  LEU A CD2  6  
ATOM 9895  H H    . LEU A 1 40  ? -7.050  5.022   -4.606  1.00 0.00 ? 40  LEU A H    6  
ATOM 9896  H HA   . LEU A 1 40  ? -4.743  6.792   -4.660  1.00 0.00 ? 40  LEU A HA   6  
ATOM 9897  H HB2  . LEU A 1 40  ? -4.611  3.990   -3.558  1.00 0.00 ? 40  LEU A HB2  6  
ATOM 9898  H HB3  . LEU A 1 40  ? -3.219  5.011   -3.908  1.00 0.00 ? 40  LEU A HB3  6  
ATOM 9899  H HG   . LEU A 1 40  ? -5.306  5.911   -1.958  1.00 0.00 ? 40  LEU A HG   6  
ATOM 9900  H HD11 . LEU A 1 40  ? -2.950  4.146   -1.307  1.00 0.00 ? 40  LEU A HD11 6  
ATOM 9901  H HD12 . LEU A 1 40  ? -4.640  3.644   -1.283  1.00 0.00 ? 40  LEU A HD12 6  
ATOM 9902  H HD13 . LEU A 1 40  ? -4.070  4.873   -0.154  1.00 0.00 ? 40  LEU A HD13 6  
ATOM 9903  H HD21 . LEU A 1 40  ? -3.177  7.185   -2.989  1.00 0.00 ? 40  LEU A HD21 6  
ATOM 9904  H HD22 . LEU A 1 40  ? -2.417  6.403   -1.602  1.00 0.00 ? 40  LEU A HD22 6  
ATOM 9905  H HD23 . LEU A 1 40  ? -3.793  7.480   -1.363  1.00 0.00 ? 40  LEU A HD23 6  
ATOM 9906  N N    . SER A 1 41  ? -3.995  5.779   -6.810  1.00 0.00 ? 41  SER A N    6  
ATOM 9907  C CA   . SER A 1 41  ? -3.698  5.292   -8.153  1.00 0.00 ? 41  SER A CA   6  
ATOM 9908  C C    . SER A 1 41  ? -2.550  4.288   -8.125  1.00 0.00 ? 41  SER A C    6  
ATOM 9909  O O    . SER A 1 41  ? -1.394  4.654   -7.905  1.00 0.00 ? 41  SER A O    6  
ATOM 9910  C CB   . SER A 1 41  ? -3.346  6.461   -9.075  1.00 0.00 ? 41  SER A CB   6  
ATOM 9911  O OG   . SER A 1 41  ? -4.513  7.034   -9.640  1.00 0.00 ? 41  SER A OG   6  
ATOM 9912  H H    . SER A 1 41  ? -3.556  6.594   -6.489  1.00 0.00 ? 41  SER A H    6  
ATOM 9913  H HA   . SER A 1 41  ? -4.582  4.800   -8.530  1.00 0.00 ? 41  SER A HA   6  
ATOM 9914  H HB2  . SER A 1 41  ? -2.825  7.218   -8.510  1.00 0.00 ? 41  SER A HB2  6  
ATOM 9915  H HB3  . SER A 1 41  ? -2.710  6.106   -9.874  1.00 0.00 ? 41  SER A HB3  6  
ATOM 9916  H HG   . SER A 1 41  ? -5.015  6.354   -10.096 1.00 0.00 ? 41  SER A HG   6  
ATOM 9917  N N    . LEU A 1 42  ? -2.876  3.020   -8.349  1.00 0.00 ? 42  LEU A N    6  
ATOM 9918  C CA   . LEU A 1 42  ? -1.873  1.961   -8.351  1.00 0.00 ? 42  LEU A CA   6  
ATOM 9919  C C    . LEU A 1 42  ? -1.405  1.655   -9.770  1.00 0.00 ? 42  LEU A C    6  
ATOM 9920  O O    . LEU A 1 42  ? -2.143  1.855   -10.734 1.00 0.00 ? 42  LEU A O    6  
ATOM 9921  C CB   . LEU A 1 42  ? -2.439  0.695   -7.705  1.00 0.00 ? 42  LEU A CB   6  
ATOM 9922  C CG   . LEU A 1 42  ? -3.183  0.890   -6.383  1.00 0.00 ? 42  LEU A CG   6  
ATOM 9923  C CD1  . LEU A 1 42  ? -3.770  -0.427  -5.901  1.00 0.00 ? 42  LEU A CD1  6  
ATOM 9924  C CD2  . LEU A 1 42  ? -2.255  1.480   -5.331  1.00 0.00 ? 42  LEU A CD2  6  
ATOM 9925  H H    . LEU A 1 42  ? -3.813  2.790   -8.519  1.00 0.00 ? 42  LEU A H    6  
ATOM 9926  H HA   . LEU A 1 42  ? -1.028  2.304   -7.772  1.00 0.00 ? 42  LEU A HA   6  
ATOM 9927  H HB2  . LEU A 1 42  ? -3.124  0.244   -8.406  1.00 0.00 ? 42  LEU A HB2  6  
ATOM 9928  H HB3  . LEU A 1 42  ? -1.615  0.019   -7.525  1.00 0.00 ? 42  LEU A HB3  6  
ATOM 9929  H HG   . LEU A 1 42  ? -3.999  1.583   -6.536  1.00 0.00 ? 42  LEU A HG   6  
ATOM 9930  H HD11 . LEU A 1 42  ? -3.722  -0.470  -4.824  1.00 0.00 ? 42  LEU A HD11 6  
ATOM 9931  H HD12 . LEU A 1 42  ? -3.206  -1.247  -6.320  1.00 0.00 ? 42  LEU A HD12 6  
ATOM 9932  H HD13 . LEU A 1 42  ? -4.800  -0.500  -6.219  1.00 0.00 ? 42  LEU A HD13 6  
ATOM 9933  H HD21 . LEU A 1 42  ? -1.342  0.904   -5.294  1.00 0.00 ? 42  LEU A HD21 6  
ATOM 9934  H HD22 . LEU A 1 42  ? -2.739  1.448   -4.366  1.00 0.00 ? 42  LEU A HD22 6  
ATOM 9935  H HD23 . LEU A 1 42  ? -2.026  2.504   -5.586  1.00 0.00 ? 42  LEU A HD23 6  
ATOM 9936  N N    . ALA A 1 43  ? -0.174  1.169   -9.889  1.00 0.00 ? 43  ALA A N    6  
ATOM 9937  C CA   . ALA A 1 43  ? 0.391   0.832   -11.190 1.00 0.00 ? 43  ALA A CA   6  
ATOM 9938  C C    . ALA A 1 43  ? 1.428   -0.279  -11.067 1.00 0.00 ? 43  ALA A C    6  
ATOM 9939  O O    . ALA A 1 43  ? 2.363   -0.184  -10.273 1.00 0.00 ? 43  ALA A O    6  
ATOM 9940  C CB   . ALA A 1 43  ? 1.009   2.065   -11.832 1.00 0.00 ? 43  ALA A CB   6  
ATOM 9941  H H    . ALA A 1 43  ? 0.366   1.032   -9.084  1.00 0.00 ? 43  ALA A H    6  
ATOM 9942  H HA   . ALA A 1 43  ? -0.414  0.491   -11.825 1.00 0.00 ? 43  ALA A HA   6  
ATOM 9943  H HB1  . ALA A 1 43  ? 1.740   1.759   -12.567 1.00 0.00 ? 43  ALA A HB1  6  
ATOM 9944  H HB2  . ALA A 1 43  ? 0.236   2.646   -12.314 1.00 0.00 ? 43  ALA A HB2  6  
ATOM 9945  H HB3  . ALA A 1 43  ? 1.490   2.663   -11.073 1.00 0.00 ? 43  ALA A HB3  6  
ATOM 9946  N N    . GLY A 1 44  ? 1.256   -1.334  -11.859 1.00 0.00 ? 44  GLY A N    6  
ATOM 9947  C CA   . GLY A 1 44  ? 2.185   -2.448  -11.822 1.00 0.00 ? 44  GLY A CA   6  
ATOM 9948  C C    . GLY A 1 44  ? 3.624   -2.011  -12.013 1.00 0.00 ? 44  GLY A C    6  
ATOM 9949  O O    . GLY A 1 44  ? 3.886   -0.925  -12.529 1.00 0.00 ? 44  GLY A O    6  
ATOM 9950  H H    . GLY A 1 44  ? 0.492   -1.355  -12.472 1.00 0.00 ? 44  GLY A H    6  
ATOM 9951  H HA2  . GLY A 1 44  ? 2.095   -2.946  -10.868 1.00 0.00 ? 44  GLY A HA2  6  
ATOM 9952  H HA3  . GLY A 1 44  ? 1.925   -3.144  -12.606 1.00 0.00 ? 44  GLY A HA3  6  
ATOM 9953  N N    . ASN A 1 45  ? 4.559   -2.858  -11.595 1.00 0.00 ? 45  ASN A N    6  
ATOM 9954  C CA   . ASN A 1 45  ? 5.979   -2.552  -11.722 1.00 0.00 ? 45  ASN A CA   6  
ATOM 9955  C C    . ASN A 1 45  ? 6.390   -2.475  -13.189 1.00 0.00 ? 45  ASN A C    6  
ATOM 9956  O O    . ASN A 1 45  ? 6.012   -3.323  -13.997 1.00 0.00 ? 45  ASN A O    6  
ATOM 9957  C CB   . ASN A 1 45  ? 6.816   -3.609  -11.000 1.00 0.00 ? 45  ASN A CB   6  
ATOM 9958  C CG   . ASN A 1 45  ? 8.299   -3.465  -11.283 1.00 0.00 ? 45  ASN A CG   6  
ATOM 9959  O OD1  . ASN A 1 45  ? 8.817   -4.033  -12.245 1.00 0.00 ? 45  ASN A OD1  6  
ATOM 9960  N ND2  . ASN A 1 45  ? 8.990   -2.702  -10.444 1.00 0.00 ? 45  ASN A ND2  6  
ATOM 9961  H H    . ASN A 1 45  ? 4.288   -3.709  -11.192 1.00 0.00 ? 45  ASN A H    6  
ATOM 9962  H HA   . ASN A 1 45  ? 6.153   -1.591  -11.260 1.00 0.00 ? 45  ASN A HA   6  
ATOM 9963  H HB2  . ASN A 1 45  ? 6.662   -3.517  -9.935  1.00 0.00 ? 45  ASN A HB2  6  
ATOM 9964  H HB3  . ASN A 1 45  ? 6.501   -4.591  -11.322 1.00 0.00 ? 45  ASN A HB3  6  
ATOM 9965  H HD21 . ASN A 1 45  ? 8.511   -2.281  -9.700  1.00 0.00 ? 45  ASN A HD21 6  
ATOM 9966  H HD22 . ASN A 1 45  ? 9.950   -2.590  -10.604 1.00 0.00 ? 45  ASN A HD22 6  
ATOM 9967  N N    . LYS A 1 46  ? 7.169   -1.452  -13.527 1.00 0.00 ? 46  LYS A N    6  
ATOM 9968  C CA   . LYS A 1 46  ? 7.634   -1.264  -14.895 1.00 0.00 ? 46  LYS A CA   6  
ATOM 9969  C C    . LYS A 1 46  ? 8.003   -2.600  -15.533 1.00 0.00 ? 46  LYS A C    6  
ATOM 9970  O O    . LYS A 1 46  ? 7.667   -2.860  -16.689 1.00 0.00 ? 46  LYS A O    6  
ATOM 9971  C CB   . LYS A 1 46  ? 8.842   -0.324  -14.920 1.00 0.00 ? 46  LYS A CB   6  
ATOM 9972  C CG   . LYS A 1 46  ? 8.531   1.079   -14.430 1.00 0.00 ? 46  LYS A CG   6  
ATOM 9973  C CD   . LYS A 1 46  ? 9.745   1.727   -13.785 1.00 0.00 ? 46  LYS A CD   6  
ATOM 9974  C CE   . LYS A 1 46  ? 10.639  2.391   -14.821 1.00 0.00 ? 46  LYS A CE   6  
ATOM 9975  N NZ   . LYS A 1 46  ? 9.946   3.513   -15.513 1.00 0.00 ? 46  LYS A NZ   6  
ATOM 9976  H H    . LYS A 1 46  ? 7.438   -0.808  -12.837 1.00 0.00 ? 46  LYS A H    6  
ATOM 9977  H HA   . LYS A 1 46  ? 6.830   -0.818  -15.461 1.00 0.00 ? 46  LYS A HA   6  
ATOM 9978  H HB2  . LYS A 1 46  ? 9.618   -0.738  -14.294 1.00 0.00 ? 46  LYS A HB2  6  
ATOM 9979  H HB3  . LYS A 1 46  ? 9.209   -0.256  -15.935 1.00 0.00 ? 46  LYS A HB3  6  
ATOM 9980  H HG2  . LYS A 1 46  ? 8.218   1.683   -15.269 1.00 0.00 ? 46  LYS A HG2  6  
ATOM 9981  H HG3  . LYS A 1 46  ? 7.732   1.028   -13.704 1.00 0.00 ? 46  LYS A HG3  6  
ATOM 9982  H HD2  . LYS A 1 46  ? 9.412   2.474   -13.081 1.00 0.00 ? 46  LYS A HD2  6  
ATOM 9983  H HD3  . LYS A 1 46  ? 10.313  0.968   -13.265 1.00 0.00 ? 46  LYS A HD3  6  
ATOM 9984  H HE2  . LYS A 1 46  ? 11.518  2.773   -14.326 1.00 0.00 ? 46  LYS A HE2  6  
ATOM 9985  H HE3  . LYS A 1 46  ? 10.930  1.653   -15.553 1.00 0.00 ? 46  LYS A HE3  6  
ATOM 9986  H HZ1  . LYS A 1 46  ? 9.431   4.096   -14.822 1.00 0.00 ? 46  LYS A HZ1  6  
ATOM 9987  H HZ2  . LYS A 1 46  ? 9.268   3.140   -16.208 1.00 0.00 ? 46  LYS A HZ2  6  
ATOM 9988  H HZ3  . LYS A 1 46  ? 10.639  4.111   -16.006 1.00 0.00 ? 46  LYS A HZ3  6  
ATOM 9989  N N    . ASP A 1 47  ? 8.694   -3.442  -14.773 1.00 0.00 ? 47  ASP A N    6  
ATOM 9990  C CA   . ASP A 1 47  ? 9.106   -4.752  -15.264 1.00 0.00 ? 47  ASP A CA   6  
ATOM 9991  C C    . ASP A 1 47  ? 8.016   -5.792  -15.018 1.00 0.00 ? 47  ASP A C    6  
ATOM 9992  O O    . ASP A 1 47  ? 7.774   -6.194  -13.880 1.00 0.00 ? 47  ASP A O    6  
ATOM 9993  C CB   . ASP A 1 47  ? 10.406  -5.188  -14.587 1.00 0.00 ? 47  ASP A CB   6  
ATOM 9994  C CG   . ASP A 1 47  ? 11.201  -6.163  -15.433 1.00 0.00 ? 47  ASP A CG   6  
ATOM 9995  O OD1  . ASP A 1 47  ? 10.587  -7.086  -16.009 1.00 0.00 ? 47  ASP A OD1  6  
ATOM 9996  O OD2  . ASP A 1 47  ? 12.437  -6.004  -15.519 1.00 0.00 ? 47  ASP A OD2  6  
ATOM 9997  H H    . ASP A 1 47  ? 8.932   -3.177  -13.860 1.00 0.00 ? 47  ASP A H    6  
ATOM 9998  H HA   . ASP A 1 47  ? 9.274   -4.670  -16.327 1.00 0.00 ? 47  ASP A HA   6  
ATOM 9999  H HB2  . ASP A 1 47  ? 11.019  -4.318  -14.403 1.00 0.00 ? 47  ASP A HB2  6  
ATOM 10000 H HB3  . ASP A 1 47  ? 10.172  -5.664  -13.646 1.00 0.00 ? 47  ASP A HB3  6  
ATOM 10001 N N    . ARG A 1 48  ? 7.362   -6.221  -16.093 1.00 0.00 ? 48  ARG A N    6  
ATOM 10002 C CA   . ARG A 1 48  ? 6.297   -7.211  -15.993 1.00 0.00 ? 48  ARG A CA   6  
ATOM 10003 C C    . ARG A 1 48  ? 6.729   -8.389  -15.125 1.00 0.00 ? 48  ARG A C    6  
ATOM 10004 O O    . ARG A 1 48  ? 6.081   -8.710  -14.129 1.00 0.00 ? 48  ARG A O    6  
ATOM 10005 C CB   . ARG A 1 48  ? 5.902   -7.708  -17.385 1.00 0.00 ? 48  ARG A CB   6  
ATOM 10006 C CG   . ARG A 1 48  ? 4.476   -8.229  -17.464 1.00 0.00 ? 48  ARG A CG   6  
ATOM 10007 C CD   . ARG A 1 48  ? 4.009   -8.356  -18.906 1.00 0.00 ? 48  ARG A CD   6  
ATOM 10008 N NE   . ARG A 1 48  ? 3.393   -7.125  -19.393 1.00 0.00 ? 48  ARG A NE   6  
ATOM 10009 C CZ   . ARG A 1 48  ? 2.278   -6.611  -18.886 1.00 0.00 ? 48  ARG A CZ   6  
ATOM 10010 N NH1  . ARG A 1 48  ? 1.660   -7.218  -17.883 1.00 0.00 ? 48  ARG A NH1  6  
ATOM 10011 N NH2  . ARG A 1 48  ? 1.779   -5.486  -19.384 1.00 0.00 ? 48  ARG A NH2  6  
ATOM 10012 H H    . ARG A 1 48  ? 7.601   -5.863  -16.973 1.00 0.00 ? 48  ARG A H    6  
ATOM 10013 H HA   . ARG A 1 48  ? 5.443   -6.736  -15.535 1.00 0.00 ? 48  ARG A HA   6  
ATOM 10014 H HB2  . ARG A 1 48  ? 6.004   -6.894  -18.088 1.00 0.00 ? 48  ARG A HB2  6  
ATOM 10015 H HB3  . ARG A 1 48  ? 6.570   -8.506  -17.672 1.00 0.00 ? 48  ARG A HB3  6  
ATOM 10016 H HG2  . ARG A 1 48  ? 4.431   -9.201  -16.995 1.00 0.00 ? 48  ARG A HG2  6  
ATOM 10017 H HG3  . ARG A 1 48  ? 3.824   -7.544  -16.943 1.00 0.00 ? 48  ARG A HG3  6  
ATOM 10018 H HD2  . ARG A 1 48  ? 4.860   -8.592  -19.527 1.00 0.00 ? 48  ARG A HD2  6  
ATOM 10019 H HD3  . ARG A 1 48  ? 3.287   -9.157  -18.966 1.00 0.00 ? 48  ARG A HD3  6  
ATOM 10020 H HE   . ARG A 1 48  ? 3.834   -6.660  -20.134 1.00 0.00 ? 48  ARG A HE   6  
ATOM 10021 H HH11 . ARG A 1 48  ? 2.034   -8.065  -17.506 1.00 0.00 ? 48  ARG A HH11 6  
ATOM 10022 H HH12 . ARG A 1 48  ? 0.821   -6.828  -17.502 1.00 0.00 ? 48  ARG A HH12 6  
ATOM 10023 H HH21 . ARG A 1 48  ? 2.243   -5.025  -20.140 1.00 0.00 ? 48  ARG A HH21 6  
ATOM 10024 H HH22 . ARG A 1 48  ? 0.940   -5.100  -19.002 1.00 0.00 ? 48  ARG A HH22 6  
ATOM 10025 N N    . SER A 1 49  ? 7.828   -9.031  -15.510 1.00 0.00 ? 49  SER A N    6  
ATOM 10026 C CA   . SER A 1 49  ? 8.344   -10.176 -14.770 1.00 0.00 ? 49  SER A CA   6  
ATOM 10027 C C    . SER A 1 49  ? 8.143   -9.988  -13.269 1.00 0.00 ? 49  SER A C    6  
ATOM 10028 O O    . SER A 1 49  ? 7.836   -10.938 -12.549 1.00 0.00 ? 49  SER A O    6  
ATOM 10029 C CB   . SER A 1 49  ? 9.830   -10.379 -15.075 1.00 0.00 ? 49  SER A CB   6  
ATOM 10030 O OG   . SER A 1 49  ? 10.012  -10.971 -16.350 1.00 0.00 ? 49  SER A OG   6  
ATOM 10031 H H    . SER A 1 49  ? 8.301   -8.727  -16.314 1.00 0.00 ? 49  SER A H    6  
ATOM 10032 H HA   . SER A 1 49  ? 7.797   -11.050 -15.088 1.00 0.00 ? 49  SER A HA   6  
ATOM 10033 H HB2  . SER A 1 49  ? 10.332  -9.424  -15.060 1.00 0.00 ? 49  SER A HB2  6  
ATOM 10034 H HB3  . SER A 1 49  ? 10.263  -11.026 -14.325 1.00 0.00 ? 49  SER A HB3  6  
ATOM 10035 H HG   . SER A 1 49  ? 9.250   -11.516 -16.561 1.00 0.00 ? 49  SER A HG   6  
ATOM 10036 N N    . ARG A 1 50  ? 8.318   -8.755  -12.805 1.00 0.00 ? 50  ARG A N    6  
ATOM 10037 C CA   . ARG A 1 50  ? 8.157   -8.441  -11.390 1.00 0.00 ? 50  ARG A CA   6  
ATOM 10038 C C    . ARG A 1 50  ? 6.697   -8.144  -11.062 1.00 0.00 ? 50  ARG A C    6  
ATOM 10039 O O    . ARG A 1 50  ? 5.925   -7.737  -11.930 1.00 0.00 ? 50  ARG A O    6  
ATOM 10040 C CB   . ARG A 1 50  ? 9.030   -7.244  -11.009 1.00 0.00 ? 50  ARG A CB   6  
ATOM 10041 C CG   . ARG A 1 50  ? 10.481  -7.609  -10.741 1.00 0.00 ? 50  ARG A CG   6  
ATOM 10042 C CD   . ARG A 1 50  ? 11.271  -6.414  -10.233 1.00 0.00 ? 50  ARG A CD   6  
ATOM 10043 N NE   . ARG A 1 50  ? 12.680  -6.738  -10.024 1.00 0.00 ? 50  ARG A NE   6  
ATOM 10044 C CZ   . ARG A 1 50  ? 13.583  -5.857  -9.607  1.00 0.00 ? 50  ARG A CZ   6  
ATOM 10045 N NH1  . ARG A 1 50  ? 13.226  -4.605  -9.356  1.00 0.00 ? 50  ARG A NH1  6  
ATOM 10046 N NH2  . ARG A 1 50  ? 14.846  -6.228  -9.440  1.00 0.00 ? 50  ARG A NH2  6  
ATOM 10047 H H    . ARG A 1 50  ? 8.562   -8.039  -13.428 1.00 0.00 ? 50  ARG A H    6  
ATOM 10048 H HA   . ARG A 1 50  ? 8.474   -9.302  -10.821 1.00 0.00 ? 50  ARG A HA   6  
ATOM 10049 H HB2  . ARG A 1 50  ? 9.006   -6.525  -11.814 1.00 0.00 ? 50  ARG A HB2  6  
ATOM 10050 H HB3  . ARG A 1 50  ? 8.625   -6.789  -10.118 1.00 0.00 ? 50  ARG A HB3  6  
ATOM 10051 H HG2  . ARG A 1 50  ? 10.514  -8.391  -9.996  1.00 0.00 ? 50  ARG A HG2  6  
ATOM 10052 H HG3  . ARG A 1 50  ? 10.928  -7.963  -11.657 1.00 0.00 ? 50  ARG A HG3  6  
ATOM 10053 H HD2  . ARG A 1 50  ? 11.199  -5.617  -10.958 1.00 0.00 ? 50  ARG A HD2  6  
ATOM 10054 H HD3  . ARG A 1 50  ? 10.843  -6.088  -9.297  1.00 0.00 ? 50  ARG A HD3  6  
ATOM 10055 H HE   . ARG A 1 50  ? 12.965  -7.658  -10.203 1.00 0.00 ? 50  ARG A HE   6  
ATOM 10056 H HH11 . ARG A 1 50  ? 12.274  -4.323  -9.479  1.00 0.00 ? 50  ARG A HH11 6  
ATOM 10057 H HH12 . ARG A 1 50  ? 13.907  -3.944  -9.041  1.00 0.00 ? 50  ARG A HH12 6  
ATOM 10058 H HH21 . ARG A 1 50  ? 15.119  -7.171  -9.628  1.00 0.00 ? 50  ARG A HH21 6  
ATOM 10059 H HH22 . ARG A 1 50  ? 15.524  -5.565  -9.127  1.00 0.00 ? 50  ARG A HH22 6  
ATOM 10060 N N    . MET A 1 51  ? 6.325   -8.352  -9.803  1.00 0.00 ? 51  MET A N    6  
ATOM 10061 C CA   . MET A 1 51  ? 4.957   -8.106  -9.360  1.00 0.00 ? 51  MET A CA   6  
ATOM 10062 C C    . MET A 1 51  ? 4.941   -7.272  -8.083  1.00 0.00 ? 51  MET A C    6  
ATOM 10063 O O    . MET A 1 51  ? 5.176   -7.789  -6.990  1.00 0.00 ? 51  MET A O    6  
ATOM 10064 C CB   . MET A 1 51  ? 4.227   -9.431  -9.128  1.00 0.00 ? 51  MET A CB   6  
ATOM 10065 C CG   . MET A 1 51  ? 2.778   -9.260  -8.702  1.00 0.00 ? 51  MET A CG   6  
ATOM 10066 S SD   . MET A 1 51  ? 1.792   -8.383  -9.931  1.00 0.00 ? 51  MET A SD   6  
ATOM 10067 C CE   . MET A 1 51  ? 1.945   -9.484  -11.335 1.00 0.00 ? 51  MET A CE   6  
ATOM 10068 H H    . MET A 1 51  ? 6.985   -8.677  -9.156  1.00 0.00 ? 51  MET A H    6  
ATOM 10069 H HA   . MET A 1 51  ? 4.450   -7.558  -10.140 1.00 0.00 ? 51  MET A HA   6  
ATOM 10070 H HB2  . MET A 1 51  ? 4.246   -10.003 -10.043 1.00 0.00 ? 51  MET A HB2  6  
ATOM 10071 H HB3  . MET A 1 51  ? 4.744   -9.982  -8.356  1.00 0.00 ? 51  MET A HB3  6  
ATOM 10072 H HG2  . MET A 1 51  ? 2.345   -10.236 -8.544  1.00 0.00 ? 51  MET A HG2  6  
ATOM 10073 H HG3  . MET A 1 51  ? 2.753   -8.703  -7.776  1.00 0.00 ? 51  MET A HG3  6  
ATOM 10074 H HE1  . MET A 1 51  ? 1.024   -9.479  -11.899 1.00 0.00 ? 51  MET A HE1  6  
ATOM 10075 H HE2  . MET A 1 51  ? 2.755   -9.151  -11.966 1.00 0.00 ? 51  MET A HE2  6  
ATOM 10076 H HE3  . MET A 1 51  ? 2.147   -10.486 -10.986 1.00 0.00 ? 51  MET A HE3  6  
ATOM 10077 N N    . SER A 1 52  ? 4.662   -5.981  -8.228  1.00 0.00 ? 52  SER A N    6  
ATOM 10078 C CA   . SER A 1 52  ? 4.620   -5.075  -7.086  1.00 0.00 ? 52  SER A CA   6  
ATOM 10079 C C    . SER A 1 52  ? 3.606   -3.958  -7.316  1.00 0.00 ? 52  SER A C    6  
ATOM 10080 O O    . SER A 1 52  ? 3.349   -3.563  -8.453  1.00 0.00 ? 52  SER A O    6  
ATOM 10081 C CB   . SER A 1 52  ? 6.005   -4.477  -6.831  1.00 0.00 ? 52  SER A CB   6  
ATOM 10082 O OG   . SER A 1 52  ? 6.758   -5.292  -5.949  1.00 0.00 ? 52  SER A OG   6  
ATOM 10083 H H    . SER A 1 52  ? 4.484   -5.628  -9.125  1.00 0.00 ? 52  SER A H    6  
ATOM 10084 H HA   . SER A 1 52  ? 4.319   -5.647  -6.221  1.00 0.00 ? 52  SER A HA   6  
ATOM 10085 H HB2  . SER A 1 52  ? 6.536   -4.394  -7.766  1.00 0.00 ? 52  SER A HB2  6  
ATOM 10086 H HB3  . SER A 1 52  ? 5.895   -3.497  -6.390  1.00 0.00 ? 52  SER A HB3  6  
ATOM 10087 H HG   . SER A 1 52  ? 6.629   -4.991  -5.046  1.00 0.00 ? 52  SER A HG   6  
ATOM 10088 N N    . ILE A 1 53  ? 3.033   -3.455  -6.227  1.00 0.00 ? 53  ILE A N    6  
ATOM 10089 C CA   . ILE A 1 53  ? 2.048   -2.384  -6.309  1.00 0.00 ? 53  ILE A CA   6  
ATOM 10090 C C    . ILE A 1 53  ? 2.595   -1.088  -5.719  1.00 0.00 ? 53  ILE A C    6  
ATOM 10091 O O    . ILE A 1 53  ? 3.081   -1.065  -4.588  1.00 0.00 ? 53  ILE A O    6  
ATOM 10092 C CB   . ILE A 1 53  ? 0.746   -2.759  -5.577  1.00 0.00 ? 53  ILE A CB   6  
ATOM 10093 C CG1  . ILE A 1 53  ? 0.180   -4.066  -6.136  1.00 0.00 ? 53  ILE A CG1  6  
ATOM 10094 C CG2  . ILE A 1 53  ? -0.274  -1.637  -5.702  1.00 0.00 ? 53  ILE A CG2  6  
ATOM 10095 C CD1  . ILE A 1 53  ? -0.735  -4.789  -5.172  1.00 0.00 ? 53  ILE A CD1  6  
ATOM 10096 H H    . ILE A 1 53  ? 3.279   -3.812  -5.349  1.00 0.00 ? 53  ILE A H    6  
ATOM 10097 H HA   . ILE A 1 53  ? 1.818   -2.223  -7.353  1.00 0.00 ? 53  ILE A HA   6  
ATOM 10098 H HB   . ILE A 1 53  ? 0.973   -2.892  -4.531  1.00 0.00 ? 53  ILE A HB   6  
ATOM 10099 H HG12 . ILE A 1 53  ? -0.384  -3.853  -7.031  1.00 0.00 ? 53  ILE A HG12 6  
ATOM 10100 H HG13 . ILE A 1 53  ? 0.997   -4.729  -6.380  1.00 0.00 ? 53  ILE A HG13 6  
ATOM 10101 H HG21 . ILE A 1 53  ? -1.269  -2.042  -5.593  1.00 0.00 ? 53  ILE A HG21 6  
ATOM 10102 H HG22 . ILE A 1 53  ? -0.098  -0.904  -4.929  1.00 0.00 ? 53  ILE A HG22 6  
ATOM 10103 H HG23 . ILE A 1 53  ? -0.179  -1.170  -6.671  1.00 0.00 ? 53  ILE A HG23 6  
ATOM 10104 H HD11 . ILE A 1 53  ? -1.145  -4.083  -4.466  1.00 0.00 ? 53  ILE A HD11 6  
ATOM 10105 H HD12 . ILE A 1 53  ? -1.537  -5.259  -5.720  1.00 0.00 ? 53  ILE A HD12 6  
ATOM 10106 H HD13 . ILE A 1 53  ? -0.173  -5.543  -4.640  1.00 0.00 ? 53  ILE A HD13 6  
ATOM 10107 N N    . PHE A 1 54  ? 2.510   -0.011  -6.492  1.00 0.00 ? 54  PHE A N    6  
ATOM 10108 C CA   . PHE A 1 54  ? 2.996   1.290   -6.046  1.00 0.00 ? 54  PHE A CA   6  
ATOM 10109 C C    . PHE A 1 54  ? 1.871   2.322   -6.052  1.00 0.00 ? 54  PHE A C    6  
ATOM 10110 O O    . PHE A 1 54  ? 0.758   2.040   -6.495  1.00 0.00 ? 54  PHE A O    6  
ATOM 10111 C CB   . PHE A 1 54  ? 4.143   1.765   -6.941  1.00 0.00 ? 54  PHE A CB   6  
ATOM 10112 C CG   . PHE A 1 54  ? 5.312   0.822   -6.967  1.00 0.00 ? 54  PHE A CG   6  
ATOM 10113 C CD1  . PHE A 1 54  ? 6.113   0.659   -5.849  1.00 0.00 ? 54  PHE A CD1  6  
ATOM 10114 C CD2  . PHE A 1 54  ? 5.609   0.098   -8.111  1.00 0.00 ? 54  PHE A CD2  6  
ATOM 10115 C CE1  . PHE A 1 54  ? 7.189   -0.208  -5.870  1.00 0.00 ? 54  PHE A CE1  6  
ATOM 10116 C CE2  . PHE A 1 54  ? 6.684   -0.770  -8.138  1.00 0.00 ? 54  PHE A CE2  6  
ATOM 10117 C CZ   . PHE A 1 54  ? 7.476   -0.923  -7.016  1.00 0.00 ? 54  PHE A CZ   6  
ATOM 10118 H H    . PHE A 1 54  ? 2.113   -0.092  -7.385  1.00 0.00 ? 54  PHE A H    6  
ATOM 10119 H HA   . PHE A 1 54  ? 3.360   1.179   -5.037  1.00 0.00 ? 54  PHE A HA   6  
ATOM 10120 H HB2  . PHE A 1 54  ? 3.781   1.871   -7.952  1.00 0.00 ? 54  PHE A HB2  6  
ATOM 10121 H HB3  . PHE A 1 54  ? 4.494   2.721   -6.586  1.00 0.00 ? 54  PHE A HB3  6  
ATOM 10122 H HD1  . PHE A 1 54  ? 5.890   1.219   -4.951  1.00 0.00 ? 54  PHE A HD1  6  
ATOM 10123 H HD2  . PHE A 1 54  ? 4.992   0.217   -8.989  1.00 0.00 ? 54  PHE A HD2  6  
ATOM 10124 H HE1  . PHE A 1 54  ? 7.806   -0.324  -4.991  1.00 0.00 ? 54  PHE A HE1  6  
ATOM 10125 H HE2  . PHE A 1 54  ? 6.906   -1.328  -9.035  1.00 0.00 ? 54  PHE A HE2  6  
ATOM 10126 H HZ   . PHE A 1 54  ? 8.316   -1.601  -7.034  1.00 0.00 ? 54  PHE A HZ   6  
ATOM 10127 N N    . VAL A 1 55  ? 2.171   3.518   -5.556  1.00 0.00 ? 55  VAL A N    6  
ATOM 10128 C CA   . VAL A 1 55  ? 1.187   4.592   -5.504  1.00 0.00 ? 55  VAL A CA   6  
ATOM 10129 C C    . VAL A 1 55  ? 1.624   5.780   -6.354  1.00 0.00 ? 55  VAL A C    6  
ATOM 10130 O O    . VAL A 1 55  ? 2.378   6.640   -5.898  1.00 0.00 ? 55  VAL A O    6  
ATOM 10131 C CB   . VAL A 1 55  ? 0.952   5.069   -4.059  1.00 0.00 ? 55  VAL A CB   6  
ATOM 10132 C CG1  . VAL A 1 55  ? -0.050  6.213   -4.030  1.00 0.00 ? 55  VAL A CG1  6  
ATOM 10133 C CG2  . VAL A 1 55  ? 0.480   3.914   -3.188  1.00 0.00 ? 55  VAL A CG2  6  
ATOM 10134 H H    . VAL A 1 55  ? 3.076   3.682   -5.218  1.00 0.00 ? 55  VAL A H    6  
ATOM 10135 H HA   . VAL A 1 55  ? 0.254   4.210   -5.891  1.00 0.00 ? 55  VAL A HA   6  
ATOM 10136 H HB   . VAL A 1 55  ? 1.890   5.430   -3.663  1.00 0.00 ? 55  VAL A HB   6  
ATOM 10137 H HG11 . VAL A 1 55  ? -0.886  5.943   -3.402  1.00 0.00 ? 55  VAL A HG11 6  
ATOM 10138 H HG12 . VAL A 1 55  ? 0.427   7.099   -3.635  1.00 0.00 ? 55  VAL A HG12 6  
ATOM 10139 H HG13 . VAL A 1 55  ? -0.401  6.409   -5.032  1.00 0.00 ? 55  VAL A HG13 6  
ATOM 10140 H HG21 . VAL A 1 55  ? 0.982   3.956   -2.233  1.00 0.00 ? 55  VAL A HG21 6  
ATOM 10141 H HG22 . VAL A 1 55  ? -0.588  3.989   -3.037  1.00 0.00 ? 55  VAL A HG22 6  
ATOM 10142 H HG23 . VAL A 1 55  ? 0.709   2.978   -3.675  1.00 0.00 ? 55  VAL A HG23 6  
ATOM 10143 N N    . VAL A 1 56  ? 1.146   5.822   -7.594  1.00 0.00 ? 56  VAL A N    6  
ATOM 10144 C CA   . VAL A 1 56  ? 1.486   6.905   -8.508  1.00 0.00 ? 56  VAL A CA   6  
ATOM 10145 C C    . VAL A 1 56  ? 0.429   8.004   -8.476  1.00 0.00 ? 56  VAL A C    6  
ATOM 10146 O O    . VAL A 1 56  ? 0.283   8.768   -9.429  1.00 0.00 ? 56  VAL A O    6  
ATOM 10147 C CB   . VAL A 1 56  ? 1.635   6.394   -9.954  1.00 0.00 ? 56  VAL A CB   6  
ATOM 10148 C CG1  . VAL A 1 56  ? 2.582   5.205   -10.005 1.00 0.00 ? 56  VAL A CG1  6  
ATOM 10149 C CG2  . VAL A 1 56  ? 0.276   6.029   -10.531 1.00 0.00 ? 56  VAL A CG2  6  
ATOM 10150 H H    . VAL A 1 56  ? 0.549   5.108   -7.900  1.00 0.00 ? 56  VAL A H    6  
ATOM 10151 H HA   . VAL A 1 56  ? 2.433   7.321   -8.196  1.00 0.00 ? 56  VAL A HA   6  
ATOM 10152 H HB   . VAL A 1 56  ? 2.056   7.188   -10.553 1.00 0.00 ? 56  VAL A HB   6  
ATOM 10153 H HG11 . VAL A 1 56  ? 2.283   4.541   -10.803 1.00 0.00 ? 56  VAL A HG11 6  
ATOM 10154 H HG12 . VAL A 1 56  ? 3.589   5.554   -10.182 1.00 0.00 ? 56  VAL A HG12 6  
ATOM 10155 H HG13 . VAL A 1 56  ? 2.545   4.675   -9.064  1.00 0.00 ? 56  VAL A HG13 6  
ATOM 10156 H HG21 . VAL A 1 56  ? 0.266   4.981   -10.792 1.00 0.00 ? 56  VAL A HG21 6  
ATOM 10157 H HG22 . VAL A 1 56  ? -0.493  6.224   -9.797  1.00 0.00 ? 56  VAL A HG22 6  
ATOM 10158 H HG23 . VAL A 1 56  ? 0.088   6.621   -11.414 1.00 0.00 ? 56  VAL A HG23 6  
ATOM 10159 N N    . GLY A 1 57  ? -0.306  8.078   -7.370  1.00 0.00 ? 57  GLY A N    6  
ATOM 10160 C CA   . GLY A 1 57  ? -1.340  9.087   -7.234  1.00 0.00 ? 57  GLY A CA   6  
ATOM 10161 C C    . GLY A 1 57  ? -2.176  8.895   -5.984  1.00 0.00 ? 57  GLY A C    6  
ATOM 10162 O O    . GLY A 1 57  ? -2.390  7.767   -5.540  1.00 0.00 ? 57  GLY A O    6  
ATOM 10163 H H    . GLY A 1 57  ? -0.145  7.442   -6.642  1.00 0.00 ? 57  GLY A H    6  
ATOM 10164 H HA2  . GLY A 1 57  ? -0.875  10.061  -7.198  1.00 0.00 ? 57  GLY A HA2  6  
ATOM 10165 H HA3  . GLY A 1 57  ? -1.989  9.041   -8.096  1.00 0.00 ? 57  GLY A HA3  6  
ATOM 10166 N N    . ILE A 1 58  ? -2.647  9.999   -5.414  1.00 0.00 ? 58  ILE A N    6  
ATOM 10167 C CA   . ILE A 1 58  ? -3.463  9.947   -4.207  1.00 0.00 ? 58  ILE A CA   6  
ATOM 10168 C C    . ILE A 1 58  ? -4.717  10.801  -4.354  1.00 0.00 ? 58  ILE A C    6  
ATOM 10169 O O    . ILE A 1 58  ? -4.666  12.023  -4.222  1.00 0.00 ? 58  ILE A O    6  
ATOM 10170 C CB   . ILE A 1 58  ? -2.673  10.421  -2.973  1.00 0.00 ? 58  ILE A CB   6  
ATOM 10171 C CG1  . ILE A 1 58  ? -1.461  9.519   -2.737  1.00 0.00 ? 58  ILE A CG1  6  
ATOM 10172 C CG2  . ILE A 1 58  ? -3.572  10.441  -1.745  1.00 0.00 ? 58  ILE A CG2  6  
ATOM 10173 C CD1  . ILE A 1 58  ? -0.538  10.018  -1.648  1.00 0.00 ? 58  ILE A CD1  6  
ATOM 10174 H H    . ILE A 1 58  ? -2.441  10.869  -5.814  1.00 0.00 ? 58  ILE A H    6  
ATOM 10175 H HA   . ILE A 1 58  ? -3.756  8.919   -4.048  1.00 0.00 ? 58  ILE A HA   6  
ATOM 10176 H HB   . ILE A 1 58  ? -2.333  11.429  -3.156  1.00 0.00 ? 58  ILE A HB   6  
ATOM 10177 H HG12 . ILE A 1 58  ? -1.801  8.535   -2.457  1.00 0.00 ? 58  ILE A HG12 6  
ATOM 10178 H HG13 . ILE A 1 58  ? -0.889  9.450   -3.652  1.00 0.00 ? 58  ILE A HG13 6  
ATOM 10179 H HG21 . ILE A 1 58  ? -4.488  9.912   -1.961  1.00 0.00 ? 58  ILE A HG21 6  
ATOM 10180 H HG22 . ILE A 1 58  ? -3.065  9.962   -0.921  1.00 0.00 ? 58  ILE A HG22 6  
ATOM 10181 H HG23 . ILE A 1 58  ? -3.800  11.463  -1.482  1.00 0.00 ? 58  ILE A HG23 6  
ATOM 10182 H HD11 . ILE A 1 58  ? 0.350   10.442  -2.094  1.00 0.00 ? 58  ILE A HD11 6  
ATOM 10183 H HD12 . ILE A 1 58  ? -1.044  10.772  -1.064  1.00 0.00 ? 58  ILE A HD12 6  
ATOM 10184 H HD13 . ILE A 1 58  ? -0.258  9.194   -1.007  1.00 0.00 ? 58  ILE A HD13 6  
ATOM 10185 N N    . ASN A 1 59  ? -5.842  10.149  -4.625  1.00 0.00 ? 59  ASN A N    6  
ATOM 10186 C CA   . ASN A 1 59  ? -7.111  10.849  -4.789  1.00 0.00 ? 59  ASN A CA   6  
ATOM 10187 C C    . ASN A 1 59  ? -7.292  11.908  -3.706  1.00 0.00 ? 59  ASN A C    6  
ATOM 10188 O O    . ASN A 1 59  ? -7.273  11.618  -2.509  1.00 0.00 ? 59  ASN A O    6  
ATOM 10189 C CB   . ASN A 1 59  ? -8.275  9.856   -4.746  1.00 0.00 ? 59  ASN A CB   6  
ATOM 10190 C CG   . ASN A 1 59  ? -9.492  10.358  -5.498  1.00 0.00 ? 59  ASN A CG   6  
ATOM 10191 O OD1  . ASN A 1 59  ? -9.372  10.933  -6.580  1.00 0.00 ? 59  ASN A OD1  6  
ATOM 10192 N ND2  . ASN A 1 59  ? -10.671 10.142  -4.927  1.00 0.00 ? 59  ASN A ND2  6  
ATOM 10193 H H    . ASN A 1 59  ? -5.819  9.173   -4.719  1.00 0.00 ? 59  ASN A H    6  
ATOM 10194 H HA   . ASN A 1 59  ? -7.100  11.334  -5.753  1.00 0.00 ? 59  ASN A HA   6  
ATOM 10195 H HB2  . ASN A 1 59  ? -7.960  8.922   -5.190  1.00 0.00 ? 59  ASN A HB2  6  
ATOM 10196 H HB3  . ASN A 1 59  ? -8.556  9.683   -3.718  1.00 0.00 ? 59  ASN A HB3  6  
ATOM 10197 H HD21 . ASN A 1 59  ? -10.690 9.677   -4.064  1.00 0.00 ? 59  ASN A HD21 6  
ATOM 10198 H HD22 . ASN A 1 59  ? -11.474 10.455  -5.393  1.00 0.00 ? 59  ASN A HD22 6  
ATOM 10199 N N    . PRO A 1 60  ? -7.472  13.166  -4.133  1.00 0.00 ? 60  PRO A N    6  
ATOM 10200 C CA   . PRO A 1 60  ? -7.661  14.294  -3.216  1.00 0.00 ? 60  PRO A CA   6  
ATOM 10201 C C    . PRO A 1 60  ? -9.006  14.241  -2.500  1.00 0.00 ? 60  PRO A C    6  
ATOM 10202 O O    . PRO A 1 60  ? -9.220  14.938  -1.509  1.00 0.00 ? 60  PRO A O    6  
ATOM 10203 C CB   . PRO A 1 60  ? -7.594  15.515  -4.137  1.00 0.00 ? 60  PRO A CB   6  
ATOM 10204 C CG   . PRO A 1 60  ? -8.002  15.003  -5.476  1.00 0.00 ? 60  PRO A CG   6  
ATOM 10205 C CD   . PRO A 1 60  ? -7.507  13.585  -5.545  1.00 0.00 ? 60  PRO A CD   6  
ATOM 10206 H HA   . PRO A 1 60  ? -6.867  14.349  -2.486  1.00 0.00 ? 60  PRO A HA   6  
ATOM 10207 H HB2  . PRO A 1 60  ? -8.274  16.276  -3.781  1.00 0.00 ? 60  PRO A HB2  6  
ATOM 10208 H HB3  . PRO A 1 60  ? -6.587  15.903  -4.154  1.00 0.00 ? 60  PRO A HB3  6  
ATOM 10209 H HG2  . PRO A 1 60  ? -9.077  15.030  -5.567  1.00 0.00 ? 60  PRO A HG2  6  
ATOM 10210 H HG3  . PRO A 1 60  ? -7.543  15.598  -6.251  1.00 0.00 ? 60  PRO A HG3  6  
ATOM 10211 H HD2  . PRO A 1 60  ? -8.192  12.973  -6.112  1.00 0.00 ? 60  PRO A HD2  6  
ATOM 10212 H HD3  . PRO A 1 60  ? -6.519  13.551  -5.980  1.00 0.00 ? 60  PRO A HD3  6  
ATOM 10213 N N    . GLU A 1 61  ? -9.910  13.409  -3.009  1.00 0.00 ? 61  GLU A N    6  
ATOM 10214 C CA   . GLU A 1 61  ? -11.234 13.265  -2.417  1.00 0.00 ? 61  GLU A CA   6  
ATOM 10215 C C    . GLU A 1 61  ? -11.260 12.116  -1.413  1.00 0.00 ? 61  GLU A C    6  
ATOM 10216 O O    . GLU A 1 61  ? -12.093 12.087  -0.508  1.00 0.00 ? 61  GLU A O    6  
ATOM 10217 C CB   . GLU A 1 61  ? -12.282 13.028  -3.507  1.00 0.00 ? 61  GLU A CB   6  
ATOM 10218 C CG   . GLU A 1 61  ? -12.349 14.141  -4.539  1.00 0.00 ? 61  GLU A CG   6  
ATOM 10219 C CD   . GLU A 1 61  ? -13.332 13.844  -5.655  1.00 0.00 ? 61  GLU A CD   6  
ATOM 10220 O OE1  . GLU A 1 61  ? -14.495 13.509  -5.346  1.00 0.00 ? 61  GLU A OE1  6  
ATOM 10221 O OE2  . GLU A 1 61  ? -12.938 13.945  -6.835  1.00 0.00 ? 61  GLU A OE2  6  
ATOM 10222 H H    . GLU A 1 61  ? -9.680  12.879  -3.801  1.00 0.00 ? 61  GLU A H    6  
ATOM 10223 H HA   . GLU A 1 61  ? -11.468 14.184  -1.900  1.00 0.00 ? 61  GLU A HA   6  
ATOM 10224 H HB2  . GLU A 1 61  ? -12.050 12.105  -4.017  1.00 0.00 ? 61  GLU A HB2  6  
ATOM 10225 H HB3  . GLU A 1 61  ? -13.252 12.938  -3.042  1.00 0.00 ? 61  GLU A HB3  6  
ATOM 10226 H HG2  . GLU A 1 61  ? -12.653 15.053  -4.047  1.00 0.00 ? 61  GLU A HG2  6  
ATOM 10227 H HG3  . GLU A 1 61  ? -11.368 14.276  -4.969  1.00 0.00 ? 61  GLU A HG3  6  
ATOM 10228 N N    . GLY A 1 62  ? -10.341 11.170  -1.581  1.00 0.00 ? 62  GLY A N    6  
ATOM 10229 C CA   . GLY A 1 62  ? -10.276 10.032  -0.683  1.00 0.00 ? 62  GLY A CA   6  
ATOM 10230 C C    . GLY A 1 62  ? -9.639  10.379  0.648   1.00 0.00 ? 62  GLY A C    6  
ATOM 10231 O O    . GLY A 1 62  ? -9.233  11.516  0.888   1.00 0.00 ? 62  GLY A O    6  
ATOM 10232 H H    . GLY A 1 62  ? -9.702  11.246  -2.321  1.00 0.00 ? 62  GLY A H    6  
ATOM 10233 H HA2  . GLY A 1 62  ? -11.277 9.667   -0.508  1.00 0.00 ? 62  GLY A HA2  6  
ATOM 10234 H HA3  . GLY A 1 62  ? -9.696  9.251   -1.153  1.00 0.00 ? 62  GLY A HA3  6  
ATOM 10235 N N    . PRO A 1 63  ? -9.548  9.383   1.542   1.00 0.00 ? 63  PRO A N    6  
ATOM 10236 C CA   . PRO A 1 63  ? -8.959  9.565   2.872   1.00 0.00 ? 63  PRO A CA   6  
ATOM 10237 C C    . PRO A 1 63  ? -7.451  9.782   2.813   1.00 0.00 ? 63  PRO A C    6  
ATOM 10238 O O    . PRO A 1 63  ? -6.921  10.695  3.445   1.00 0.00 ? 63  PRO A O    6  
ATOM 10239 C CB   . PRO A 1 63  ? -9.283  8.250   3.586   1.00 0.00 ? 63  PRO A CB   6  
ATOM 10240 C CG   . PRO A 1 63  ? -9.435  7.252   2.491   1.00 0.00 ? 63  PRO A CG   6  
ATOM 10241 C CD   . PRO A 1 63  ? -10.013 8.003   1.323   1.00 0.00 ? 63  PRO A CD   6  
ATOM 10242 H HA   . PRO A 1 63  ? -9.419  10.387  3.401   1.00 0.00 ? 63  PRO A HA   6  
ATOM 10243 H HB2  . PRO A 1 63  ? -8.471  7.989   4.250   1.00 0.00 ? 63  PRO A HB2  6  
ATOM 10244 H HB3  . PRO A 1 63  ? -10.196 8.359   4.151   1.00 0.00 ? 63  PRO A HB3  6  
ATOM 10245 H HG2  . PRO A 1 63  ? -8.471  6.840   2.232   1.00 0.00 ? 63  PRO A HG2  6  
ATOM 10246 H HG3  . PRO A 1 63  ? -10.109 6.467   2.801   1.00 0.00 ? 63  PRO A HG3  6  
ATOM 10247 H HD2  . PRO A 1 63  ? -9.628  7.609   0.394   1.00 0.00 ? 63  PRO A HD2  6  
ATOM 10248 H HD3  . PRO A 1 63  ? -11.091 7.953   1.339   1.00 0.00 ? 63  PRO A HD3  6  
ATOM 10249 N N    . ALA A 1 64  ? -6.765  8.937   2.050   1.00 0.00 ? 64  ALA A N    6  
ATOM 10250 C CA   . ALA A 1 64  ? -5.318  9.039   1.907   1.00 0.00 ? 64  ALA A CA   6  
ATOM 10251 C C    . ALA A 1 64  ? -4.883  10.492  1.751   1.00 0.00 ? 64  ALA A C    6  
ATOM 10252 O O    . ALA A 1 64  ? -3.797  10.874  2.186   1.00 0.00 ? 64  ALA A O    6  
ATOM 10253 C CB   . ALA A 1 64  ? -4.846  8.214   0.719   1.00 0.00 ? 64  ALA A CB   6  
ATOM 10254 H H    . ALA A 1 64  ? -7.245  8.230   1.570   1.00 0.00 ? 64  ALA A H    6  
ATOM 10255 H HA   . ALA A 1 64  ? -4.865  8.631   2.799   1.00 0.00 ? 64  ALA A HA   6  
ATOM 10256 H HB1  . ALA A 1 64  ? -5.586  8.260   -0.067  1.00 0.00 ? 64  ALA A HB1  6  
ATOM 10257 H HB2  . ALA A 1 64  ? -3.909  8.609   0.356   1.00 0.00 ? 64  ALA A HB2  6  
ATOM 10258 H HB3  . ALA A 1 64  ? -4.710  7.187   1.025   1.00 0.00 ? 64  ALA A HB3  6  
ATOM 10259 N N    . ALA A 1 65  ? -5.736  11.297  1.126   1.00 0.00 ? 65  ALA A N    6  
ATOM 10260 C CA   . ALA A 1 65  ? -5.439  12.708  0.914   1.00 0.00 ? 65  ALA A CA   6  
ATOM 10261 C C    . ALA A 1 65  ? -5.805  13.536  2.141   1.00 0.00 ? 65  ALA A C    6  
ATOM 10262 O O    . ALA A 1 65  ? -5.117  14.499  2.479   1.00 0.00 ? 65  ALA A O    6  
ATOM 10263 C CB   . ALA A 1 65  ? -6.177  13.224  -0.312  1.00 0.00 ? 65  ALA A CB   6  
ATOM 10264 H H    . ALA A 1 65  ? -6.586  10.933  0.802   1.00 0.00 ? 65  ALA A H    6  
ATOM 10265 H HA   . ALA A 1 65  ? -4.378  12.802  0.732   1.00 0.00 ? 65  ALA A HA   6  
ATOM 10266 H HB1  . ALA A 1 65  ? -5.516  13.197  -1.167  1.00 0.00 ? 65  ALA A HB1  6  
ATOM 10267 H HB2  . ALA A 1 65  ? -7.038  12.601  -0.503  1.00 0.00 ? 65  ALA A HB2  6  
ATOM 10268 H HB3  . ALA A 1 65  ? -6.499  14.239  -0.138  1.00 0.00 ? 65  ALA A HB3  6  
ATOM 10269 N N    . ALA A 1 66  ? -6.892  13.156  2.804   1.00 0.00 ? 66  ALA A N    6  
ATOM 10270 C CA   . ALA A 1 66  ? -7.349  13.863  3.994   1.00 0.00 ? 66  ALA A CA   6  
ATOM 10271 C C    . ALA A 1 66  ? -6.329  13.752  5.122   1.00 0.00 ? 66  ALA A C    6  
ATOM 10272 O O    . ALA A 1 66  ? -5.901  14.760  5.686   1.00 0.00 ? 66  ALA A O    6  
ATOM 10273 C CB   . ALA A 1 66  ? -8.698  13.322  4.444   1.00 0.00 ? 66  ALA A CB   6  
ATOM 10274 H H    . ALA A 1 66  ? -7.399  12.380  2.485   1.00 0.00 ? 66  ALA A H    6  
ATOM 10275 H HA   . ALA A 1 66  ? -7.473  14.905  3.736   1.00 0.00 ? 66  ALA A HA   6  
ATOM 10276 H HB1  . ALA A 1 66  ? -9.202  14.069  5.041   1.00 0.00 ? 66  ALA A HB1  6  
ATOM 10277 H HB2  . ALA A 1 66  ? -9.298  13.087  3.578   1.00 0.00 ? 66  ALA A HB2  6  
ATOM 10278 H HB3  . ALA A 1 66  ? -8.549  12.430  5.034   1.00 0.00 ? 66  ALA A HB3  6  
ATOM 10279 N N    . ASP A 1 67  ? -5.944  12.523  5.448   1.00 0.00 ? 67  ASP A N    6  
ATOM 10280 C CA   . ASP A 1 67  ? -4.974  12.281  6.509   1.00 0.00 ? 67  ASP A CA   6  
ATOM 10281 C C    . ASP A 1 67  ? -3.671  13.026  6.235   1.00 0.00 ? 67  ASP A C    6  
ATOM 10282 O O    . ASP A 1 67  ? -3.055  13.576  7.147   1.00 0.00 ? 67  ASP A O    6  
ATOM 10283 C CB   . ASP A 1 67  ? -4.700  10.783  6.647   1.00 0.00 ? 67  ASP A CB   6  
ATOM 10284 C CG   . ASP A 1 67  ? -4.264  10.400  8.048   1.00 0.00 ? 67  ASP A CG   6  
ATOM 10285 O OD1  . ASP A 1 67  ? -4.210  11.295  8.918   1.00 0.00 ? 67  ASP A OD1  6  
ATOM 10286 O OD2  . ASP A 1 67  ? -3.978  9.206   8.275   1.00 0.00 ? 67  ASP A OD2  6  
ATOM 10287 H H    . ASP A 1 67  ? -6.321  11.760  4.961   1.00 0.00 ? 67  ASP A H    6  
ATOM 10288 H HA   . ASP A 1 67  ? -5.396  12.647  7.433   1.00 0.00 ? 67  ASP A HA   6  
ATOM 10289 H HB2  . ASP A 1 67  ? -5.601  10.235  6.409   1.00 0.00 ? 67  ASP A HB2  6  
ATOM 10290 H HB3  . ASP A 1 67  ? -3.919  10.501  5.957   1.00 0.00 ? 67  ASP A HB3  6  
ATOM 10291 N N    . GLY A 1 68  ? -3.257  13.038  4.971   1.00 0.00 ? 68  GLY A N    6  
ATOM 10292 C CA   . GLY A 1 68  ? -2.029  13.717  4.600   1.00 0.00 ? 68  GLY A CA   6  
ATOM 10293 C C    . GLY A 1 68  ? -0.792  12.938  5.002   1.00 0.00 ? 68  GLY A C    6  
ATOM 10294 O O    . GLY A 1 68  ? 0.182   13.515  5.485   1.00 0.00 ? 68  GLY A O    6  
ATOM 10295 H H    . GLY A 1 68  ? -3.789  12.582  4.286   1.00 0.00 ? 68  GLY A H    6  
ATOM 10296 H HA2  . GLY A 1 68  ? -2.020  13.860  3.530   1.00 0.00 ? 68  GLY A HA2  6  
ATOM 10297 H HA3  . GLY A 1 68  ? -2.005  14.683  5.083   1.00 0.00 ? 68  GLY A HA3  6  
ATOM 10298 N N    . ARG A 1 69  ? -0.831  11.625  4.803   1.00 0.00 ? 69  ARG A N    6  
ATOM 10299 C CA   . ARG A 1 69  ? 0.295   10.766  5.151   1.00 0.00 ? 69  ARG A CA   6  
ATOM 10300 C C    . ARG A 1 69  ? 0.837   10.054  3.915   1.00 0.00 ? 69  ARG A C    6  
ATOM 10301 O O    . ARG A 1 69  ? 1.980   10.269  3.515   1.00 0.00 ? 69  ARG A O    6  
ATOM 10302 C CB   . ARG A 1 69  ? -0.127  9.738   6.202   1.00 0.00 ? 69  ARG A CB   6  
ATOM 10303 C CG   . ARG A 1 69  ? -0.433  10.346  7.561   1.00 0.00 ? 69  ARG A CG   6  
ATOM 10304 C CD   . ARG A 1 69  ? -0.316  9.315   8.672   1.00 0.00 ? 69  ARG A CD   6  
ATOM 10305 N NE   . ARG A 1 69  ? -1.557  8.569   8.860   1.00 0.00 ? 69  ARG A NE   6  
ATOM 10306 C CZ   . ARG A 1 69  ? -1.842  7.881   9.960   1.00 0.00 ? 69  ARG A CZ   6  
ATOM 10307 N NH1  . ARG A 1 69  ? -0.978  7.845   10.966  1.00 0.00 ? 69  ARG A NH1  6  
ATOM 10308 N NH2  . ARG A 1 69  ? -2.993  7.228   10.057  1.00 0.00 ? 69  ARG A NH2  6  
ATOM 10309 H H    . ARG A 1 69  ? -1.636  11.223  4.414   1.00 0.00 ? 69  ARG A H    6  
ATOM 10310 H HA   . ARG A 1 69  ? 1.073   11.390  5.563   1.00 0.00 ? 69  ARG A HA   6  
ATOM 10311 H HB2  . ARG A 1 69  ? -1.012  9.226   5.854   1.00 0.00 ? 69  ARG A HB2  6  
ATOM 10312 H HB3  . ARG A 1 69  ? 0.670   9.019   6.325   1.00 0.00 ? 69  ARG A HB3  6  
ATOM 10313 H HG2  . ARG A 1 69  ? 0.266   11.146  7.753   1.00 0.00 ? 69  ARG A HG2  6  
ATOM 10314 H HG3  . ARG A 1 69  ? -1.439  10.739  7.550   1.00 0.00 ? 69  ARG A HG3  6  
ATOM 10315 H HD2  . ARG A 1 69  ? 0.474   8.623   8.421   1.00 0.00 ? 69  ARG A HD2  6  
ATOM 10316 H HD3  . ARG A 1 69  ? -0.069  9.823   9.592   1.00 0.00 ? 69  ARG A HD3  6  
ATOM 10317 H HE   . ARG A 1 69  ? -2.209  8.582   8.130   1.00 0.00 ? 69  ARG A HE   6  
ATOM 10318 H HH11 . ARG A 1 69  ? -0.111  8.337   10.897  1.00 0.00 ? 69  ARG A HH11 6  
ATOM 10319 H HH12 . ARG A 1 69  ? -1.196  7.328   11.794  1.00 0.00 ? 69  ARG A HH12 6  
ATOM 10320 H HH21 . ARG A 1 69  ? -3.646  7.253   9.301   1.00 0.00 ? 69  ARG A HH21 6  
ATOM 10321 H HH22 . ARG A 1 69  ? -3.206  6.710   10.885  1.00 0.00 ? 69  ARG A HH22 6  
ATOM 10322 N N    . MET A 1 70  ? 0.008   9.204   3.317   1.00 0.00 ? 70  MET A N    6  
ATOM 10323 C CA   . MET A 1 70  ? 0.405   8.461   2.127   1.00 0.00 ? 70  MET A CA   6  
ATOM 10324 C C    . MET A 1 70  ? 0.992   9.394   1.073   1.00 0.00 ? 70  MET A C    6  
ATOM 10325 O O    . MET A 1 70  ? 0.503   10.506  0.874   1.00 0.00 ? 70  MET A O    6  
ATOM 10326 C CB   . MET A 1 70  ? -0.794  7.708   1.547   1.00 0.00 ? 70  MET A CB   6  
ATOM 10327 C CG   . MET A 1 70  ? -0.904  6.272   2.035   1.00 0.00 ? 70  MET A CG   6  
ATOM 10328 S SD   . MET A 1 70  ? -1.635  5.175   0.805   1.00 0.00 ? 70  MET A SD   6  
ATOM 10329 C CE   . MET A 1 70  ? -0.164  4.514   0.025   1.00 0.00 ? 70  MET A CE   6  
ATOM 10330 H H    . MET A 1 70  ? -0.891  9.074   3.684   1.00 0.00 ? 70  MET A H    6  
ATOM 10331 H HA   . MET A 1 70  ? 1.160   7.746   2.419   1.00 0.00 ? 70  MET A HA   6  
ATOM 10332 H HB2  . MET A 1 70  ? -1.699  8.229   1.822   1.00 0.00 ? 70  MET A HB2  6  
ATOM 10333 H HB3  . MET A 1 70  ? -0.709  7.693   0.470   1.00 0.00 ? 70  MET A HB3  6  
ATOM 10334 H HG2  . MET A 1 70  ? 0.084   5.911   2.276   1.00 0.00 ? 70  MET A HG2  6  
ATOM 10335 H HG3  . MET A 1 70  ? -1.519  6.255   2.923   1.00 0.00 ? 70  MET A HG3  6  
ATOM 10336 H HE1  . MET A 1 70  ? 0.432   3.995   0.761   1.00 0.00 ? 70  MET A HE1  6  
ATOM 10337 H HE2  . MET A 1 70  ? -0.450  3.826   -0.757  1.00 0.00 ? 70  MET A HE2  6  
ATOM 10338 H HE3  . MET A 1 70  ? 0.413   5.323   -0.400  1.00 0.00 ? 70  MET A HE3  6  
ATOM 10339 N N    . ARG A 1 71  ? 2.043   8.935   0.402   1.00 0.00 ? 71  ARG A N    6  
ATOM 10340 C CA   . ARG A 1 71  ? 2.698   9.730   -0.630  1.00 0.00 ? 71  ARG A CA   6  
ATOM 10341 C C    . ARG A 1 71  ? 2.902   8.910   -1.901  1.00 0.00 ? 71  ARG A C    6  
ATOM 10342 O O    . ARG A 1 71  ? 2.679   7.699   -1.912  1.00 0.00 ? 71  ARG A O    6  
ATOM 10343 C CB   . ARG A 1 71  ? 4.044   10.251  -0.125  1.00 0.00 ? 71  ARG A CB   6  
ATOM 10344 C CG   . ARG A 1 71  ? 3.922   11.252  1.012   1.00 0.00 ? 71  ARG A CG   6  
ATOM 10345 C CD   . ARG A 1 71  ? 3.802   12.675  0.490   1.00 0.00 ? 71  ARG A CD   6  
ATOM 10346 N NE   . ARG A 1 71  ? 2.534   12.900  -0.199  1.00 0.00 ? 71  ARG A NE   6  
ATOM 10347 C CZ   . ARG A 1 71  ? 2.347   13.858  -1.100  1.00 0.00 ? 71  ARG A CZ   6  
ATOM 10348 N NH1  . ARG A 1 71  ? 3.341   14.675  -1.420  1.00 0.00 ? 71  ARG A NH1  6  
ATOM 10349 N NH2  . ARG A 1 71  ? 1.164   13.999  -1.685  1.00 0.00 ? 71  ARG A NH2  6  
ATOM 10350 H H    . ARG A 1 71  ? 2.387   8.040   0.606   1.00 0.00 ? 71  ARG A H    6  
ATOM 10351 H HA   . ARG A 1 71  ? 2.059   10.570  -0.857  1.00 0.00 ? 71  ARG A HA   6  
ATOM 10352 H HB2  . ARG A 1 71  ? 4.633   9.415   0.223   1.00 0.00 ? 71  ARG A HB2  6  
ATOM 10353 H HB3  . ARG A 1 71  ? 4.561   10.729  -0.943  1.00 0.00 ? 71  ARG A HB3  6  
ATOM 10354 H HG2  . ARG A 1 71  ? 3.043   11.018  1.593   1.00 0.00 ? 71  ARG A HG2  6  
ATOM 10355 H HG3  . ARG A 1 71  ? 4.799   11.180  1.638   1.00 0.00 ? 71  ARG A HG3  6  
ATOM 10356 H HD2  . ARG A 1 71  ? 3.873   13.357  1.324   1.00 0.00 ? 71  ARG A HD2  6  
ATOM 10357 H HD3  . ARG A 1 71  ? 4.613   12.862  -0.197  1.00 0.00 ? 71  ARG A HD3  6  
ATOM 10358 H HE   . ARG A 1 71  ? 1.786   12.307  0.022   1.00 0.00 ? 71  ARG A HE   6  
ATOM 10359 H HH11 . ARG A 1 71  ? 4.234   14.570  -0.982  1.00 0.00 ? 71  ARG A HH11 6  
ATOM 10360 H HH12 . ARG A 1 71  ? 3.198   15.395  -2.100  1.00 0.00 ? 71  ARG A HH12 6  
ATOM 10361 H HH21 . ARG A 1 71  ? 0.413   13.384  -1.447  1.00 0.00 ? 71  ARG A HH21 6  
ATOM 10362 H HH22 . ARG A 1 71  ? 1.025   14.720  -2.363  1.00 0.00 ? 71  ARG A HH22 6  
ATOM 10363 N N    . ILE A 1 72  ? 3.326   9.578   -2.968  1.00 0.00 ? 72  ILE A N    6  
ATOM 10364 C CA   . ILE A 1 72  ? 3.560   8.911   -4.243  1.00 0.00 ? 72  ILE A CA   6  
ATOM 10365 C C    . ILE A 1 72  ? 4.863   8.120   -4.218  1.00 0.00 ? 72  ILE A C    6  
ATOM 10366 O O    . ILE A 1 72  ? 5.915   8.647   -3.858  1.00 0.00 ? 72  ILE A O    6  
ATOM 10367 C CB   . ILE A 1 72  ? 3.607   9.919   -5.406  1.00 0.00 ? 72  ILE A CB   6  
ATOM 10368 C CG1  . ILE A 1 72  ? 2.445   10.909  -5.298  1.00 0.00 ? 72  ILE A CG1  6  
ATOM 10369 C CG2  . ILE A 1 72  ? 3.567   9.190   -6.741  1.00 0.00 ? 72  ILE A CG2  6  
ATOM 10370 C CD1  . ILE A 1 72  ? 1.125   10.256  -4.951  1.00 0.00 ? 72  ILE A CD1  6  
ATOM 10371 H H    . ILE A 1 72  ? 3.486   10.541  -2.896  1.00 0.00 ? 72  ILE A H    6  
ATOM 10372 H HA   . ILE A 1 72  ? 2.740   8.228   -4.417  1.00 0.00 ? 72  ILE A HA   6  
ATOM 10373 H HB   . ILE A 1 72  ? 4.538   10.461  -5.346  1.00 0.00 ? 72  ILE A HB   6  
ATOM 10374 H HG12 . ILE A 1 72  ? 2.667   11.634  -4.531  1.00 0.00 ? 72  ILE A HG12 6  
ATOM 10375 H HG13 . ILE A 1 72  ? 2.326   11.417  -6.244  1.00 0.00 ? 72  ILE A HG13 6  
ATOM 10376 H HG21 . ILE A 1 72  ? 2.540   9.031   -7.033  1.00 0.00 ? 72  ILE A HG21 6  
ATOM 10377 H HG22 . ILE A 1 72  ? 4.066   9.786   -7.490  1.00 0.00 ? 72  ILE A HG22 6  
ATOM 10378 H HG23 . ILE A 1 72  ? 4.066   8.238   -6.646  1.00 0.00 ? 72  ILE A HG23 6  
ATOM 10379 H HD11 . ILE A 1 72  ? 0.888   9.507   -5.693  1.00 0.00 ? 72  ILE A HD11 6  
ATOM 10380 H HD12 . ILE A 1 72  ? 1.197   9.792   -3.979  1.00 0.00 ? 72  ILE A HD12 6  
ATOM 10381 H HD13 . ILE A 1 72  ? 0.346   11.005  -4.936  1.00 0.00 ? 72  ILE A HD13 6  
ATOM 10382 N N    . GLY A 1 73  ? 4.786   6.850   -4.605  1.00 0.00 ? 73  GLY A N    6  
ATOM 10383 C CA   . GLY A 1 73  ? 5.967   6.007   -4.622  1.00 0.00 ? 73  GLY A CA   6  
ATOM 10384 C C    . GLY A 1 73  ? 5.874   4.859   -3.636  1.00 0.00 ? 73  GLY A C    6  
ATOM 10385 O O    . GLY A 1 73  ? 6.537   3.835   -3.801  1.00 0.00 ? 73  GLY A O    6  
ATOM 10386 H H    . GLY A 1 73  ? 3.921   6.483   -4.882  1.00 0.00 ? 73  GLY A H    6  
ATOM 10387 H HA2  . GLY A 1 73  ? 6.095   5.605   -5.616  1.00 0.00 ? 73  GLY A HA2  6  
ATOM 10388 H HA3  . GLY A 1 73  ? 6.829   6.609   -4.374  1.00 0.00 ? 73  GLY A HA3  6  
ATOM 10389 N N    . ASP A 1 74  ? 5.050   5.029   -2.608  1.00 0.00 ? 74  ASP A N    6  
ATOM 10390 C CA   . ASP A 1 74  ? 4.872   3.999   -1.591  1.00 0.00 ? 74  ASP A CA   6  
ATOM 10391 C C    . ASP A 1 74  ? 4.498   2.665   -2.229  1.00 0.00 ? 74  ASP A C    6  
ATOM 10392 O O    . ASP A 1 74  ? 3.670   2.611   -3.137  1.00 0.00 ? 74  ASP A O    6  
ATOM 10393 C CB   . ASP A 1 74  ? 3.795   4.420   -0.591  1.00 0.00 ? 74  ASP A CB   6  
ATOM 10394 C CG   . ASP A 1 74  ? 4.240   5.572   0.289   1.00 0.00 ? 74  ASP A CG   6  
ATOM 10395 O OD1  . ASP A 1 74  ? 5.234   5.405   1.027   1.00 0.00 ? 74  ASP A OD1  6  
ATOM 10396 O OD2  . ASP A 1 74  ? 3.595   6.640   0.239   1.00 0.00 ? 74  ASP A OD2  6  
ATOM 10397 H H    . ASP A 1 74  ? 4.548   5.868   -2.532  1.00 0.00 ? 74  ASP A H    6  
ATOM 10398 H HA   . ASP A 1 74  ? 5.810   3.884   -1.069  1.00 0.00 ? 74  ASP A HA   6  
ATOM 10399 H HB2  . ASP A 1 74  ? 2.911   4.726   -1.132  1.00 0.00 ? 74  ASP A HB2  6  
ATOM 10400 H HB3  . ASP A 1 74  ? 3.552   3.579   0.042   1.00 0.00 ? 74  ASP A HB3  6  
ATOM 10401 N N    . GLU A 1 75  ? 5.116   1.591   -1.748  1.00 0.00 ? 75  GLU A N    6  
ATOM 10402 C CA   . GLU A 1 75  ? 4.849   0.257   -2.273  1.00 0.00 ? 75  GLU A CA   6  
ATOM 10403 C C    . GLU A 1 75  ? 4.047   -0.571  -1.273  1.00 0.00 ? 75  GLU A C    6  
ATOM 10404 O O    . GLU A 1 75  ? 4.590   -1.069  -0.285  1.00 0.00 ? 75  GLU A O    6  
ATOM 10405 C CB   . GLU A 1 75  ? 6.161   -0.456  -2.607  1.00 0.00 ? 75  GLU A CB   6  
ATOM 10406 C CG   . GLU A 1 75  ? 5.973   -1.893  -3.064  1.00 0.00 ? 75  GLU A CG   6  
ATOM 10407 C CD   . GLU A 1 75  ? 7.278   -2.553  -3.466  1.00 0.00 ? 75  GLU A CD   6  
ATOM 10408 O OE1  . GLU A 1 75  ? 8.021   -2.997  -2.567  1.00 0.00 ? 75  GLU A OE1  6  
ATOM 10409 O OE2  . GLU A 1 75  ? 7.555   -2.625  -4.682  1.00 0.00 ? 75  GLU A OE2  6  
ATOM 10410 H H    . GLU A 1 75  ? 5.767   1.698   -1.023  1.00 0.00 ? 75  GLU A H    6  
ATOM 10411 H HA   . GLU A 1 75  ? 4.269   0.366   -3.177  1.00 0.00 ? 75  GLU A HA   6  
ATOM 10412 H HB2  . GLU A 1 75  ? 6.662   0.088   -3.393  1.00 0.00 ? 75  GLU A HB2  6  
ATOM 10413 H HB3  . GLU A 1 75  ? 6.788   -0.460  -1.727  1.00 0.00 ? 75  GLU A HB3  6  
ATOM 10414 H HG2  . GLU A 1 75  ? 5.536   -2.460  -2.256  1.00 0.00 ? 75  GLU A HG2  6  
ATOM 10415 H HG3  . GLU A 1 75  ? 5.305   -1.903  -3.912  1.00 0.00 ? 75  GLU A HG3  6  
ATOM 10416 N N    . LEU A 1 76  ? 2.753   -0.714  -1.534  1.00 0.00 ? 76  LEU A N    6  
ATOM 10417 C CA   . LEU A 1 76  ? 1.875   -1.481  -0.658  1.00 0.00 ? 76  LEU A CA   6  
ATOM 10418 C C    . LEU A 1 76  ? 2.395   -2.903  -0.475  1.00 0.00 ? 76  LEU A C    6  
ATOM 10419 O O    . LEU A 1 76  ? 2.863   -3.531  -1.425  1.00 0.00 ? 76  LEU A O    6  
ATOM 10420 C CB   . LEU A 1 76  ? 0.455   -1.514  -1.227  1.00 0.00 ? 76  LEU A CB   6  
ATOM 10421 C CG   . LEU A 1 76  ? -0.286  -0.177  -1.261  1.00 0.00 ? 76  LEU A CG   6  
ATOM 10422 C CD1  . LEU A 1 76  ? -1.529  -0.277  -2.132  1.00 0.00 ? 76  LEU A CD1  6  
ATOM 10423 C CD2  . LEU A 1 76  ? -0.654  0.264   0.148   1.00 0.00 ? 76  LEU A CD2  6  
ATOM 10424 H H    . LEU A 1 76  ? 2.378   -0.294  -2.336  1.00 0.00 ? 76  LEU A H    6  
ATOM 10425 H HA   . LEU A 1 76  ? 1.857   -0.990  0.304   1.00 0.00 ? 76  LEU A HA   6  
ATOM 10426 H HB2  . LEU A 1 76  ? 0.514   -1.885  -2.239  1.00 0.00 ? 76  LEU A HB2  6  
ATOM 10427 H HB3  . LEU A 1 76  ? -0.125  -2.200  -0.627  1.00 0.00 ? 76  LEU A HB3  6  
ATOM 10428 H HG   . LEU A 1 76  ? 0.362   0.576   -1.690  1.00 0.00 ? 76  LEU A HG   6  
ATOM 10429 H HD11 . LEU A 1 76  ? -1.239  -0.490  -3.149  1.00 0.00 ? 76  LEU A HD11 6  
ATOM 10430 H HD12 . LEU A 1 76  ? -2.068  0.658   -2.099  1.00 0.00 ? 76  LEU A HD12 6  
ATOM 10431 H HD13 . LEU A 1 76  ? -2.162  -1.071  -1.764  1.00 0.00 ? 76  LEU A HD13 6  
ATOM 10432 H HD21 . LEU A 1 76  ? 0.206   0.717   0.619   1.00 0.00 ? 76  LEU A HD21 6  
ATOM 10433 H HD22 . LEU A 1 76  ? -0.969  -0.594  0.724   1.00 0.00 ? 76  LEU A HD22 6  
ATOM 10434 H HD23 . LEU A 1 76  ? -1.459  0.983   0.102   1.00 0.00 ? 76  LEU A HD23 6  
ATOM 10435 N N    . LEU A 1 77  ? 2.308   -3.406  0.752   1.00 0.00 ? 77  LEU A N    6  
ATOM 10436 C CA   . LEU A 1 77  ? 2.768   -4.756  1.059   1.00 0.00 ? 77  LEU A CA   6  
ATOM 10437 C C    . LEU A 1 77  ? 1.640   -5.593  1.652   1.00 0.00 ? 77  LEU A C    6  
ATOM 10438 O O    . LEU A 1 77  ? 1.508   -6.778  1.347   1.00 0.00 ? 77  LEU A O    6  
ATOM 10439 C CB   . LEU A 1 77  ? 3.947   -4.704  2.033   1.00 0.00 ? 77  LEU A CB   6  
ATOM 10440 C CG   . LEU A 1 77  ? 5.141   -3.854  1.598   1.00 0.00 ? 77  LEU A CG   6  
ATOM 10441 C CD1  . LEU A 1 77  ? 5.984   -3.462  2.802   1.00 0.00 ? 77  LEU A CD1  6  
ATOM 10442 C CD2  . LEU A 1 77  ? 5.983   -4.601  0.575   1.00 0.00 ? 77  LEU A CD2  6  
ATOM 10443 H H    . LEU A 1 77  ? 1.926   -2.857  1.468   1.00 0.00 ? 77  LEU A H    6  
ATOM 10444 H HA   . LEU A 1 77  ? 3.094   -5.213  0.137   1.00 0.00 ? 77  LEU A HA   6  
ATOM 10445 H HB2  . LEU A 1 77  ? 3.584   -4.311  2.970   1.00 0.00 ? 77  LEU A HB2  6  
ATOM 10446 H HB3  . LEU A 1 77  ? 4.297   -5.716  2.181   1.00 0.00 ? 77  LEU A HB3  6  
ATOM 10447 H HG   . LEU A 1 77  ? 4.778   -2.946  1.136   1.00 0.00 ? 77  LEU A HG   6  
ATOM 10448 H HD11 . LEU A 1 77  ? 5.354   -3.393  3.676   1.00 0.00 ? 77  LEU A HD11 6  
ATOM 10449 H HD12 . LEU A 1 77  ? 6.450   -2.505  2.618   1.00 0.00 ? 77  LEU A HD12 6  
ATOM 10450 H HD13 . LEU A 1 77  ? 6.747   -4.209  2.965   1.00 0.00 ? 77  LEU A HD13 6  
ATOM 10451 H HD21 . LEU A 1 77  ? 6.790   -5.112  1.078   1.00 0.00 ? 77  LEU A HD21 6  
ATOM 10452 H HD22 . LEU A 1 77  ? 6.391   -3.898  -0.137  1.00 0.00 ? 77  LEU A HD22 6  
ATOM 10453 H HD23 . LEU A 1 77  ? 5.367   -5.321  0.058   1.00 0.00 ? 77  LEU A HD23 6  
ATOM 10454 N N    . GLU A 1 78  ? 0.828   -4.969  2.499   1.00 0.00 ? 78  GLU A N    6  
ATOM 10455 C CA   . GLU A 1 78  ? -0.290  -5.657  3.134   1.00 0.00 ? 78  GLU A CA   6  
ATOM 10456 C C    . GLU A 1 78  ? -1.464  -4.706  3.347   1.00 0.00 ? 78  GLU A C    6  
ATOM 10457 O O    . GLU A 1 78  ? -1.276  -3.503  3.532   1.00 0.00 ? 78  GLU A O    6  
ATOM 10458 C CB   . GLU A 1 78  ? 0.145   -6.257  4.472   1.00 0.00 ? 78  GLU A CB   6  
ATOM 10459 C CG   . GLU A 1 78  ? 1.380   -7.136  4.372   1.00 0.00 ? 78  GLU A CG   6  
ATOM 10460 C CD   . GLU A 1 78  ? 1.545   -8.049  5.572   1.00 0.00 ? 78  GLU A CD   6  
ATOM 10461 O OE1  . GLU A 1 78  ? 0.558   -8.241  6.312   1.00 0.00 ? 78  GLU A OE1  6  
ATOM 10462 O OE2  . GLU A 1 78  ? 2.662   -8.572  5.770   1.00 0.00 ? 78  GLU A OE2  6  
ATOM 10463 H H    . GLU A 1 78  ? 0.985   -4.023  2.703   1.00 0.00 ? 78  GLU A H    6  
ATOM 10464 H HA   . GLU A 1 78  ? -0.604  -6.455  2.477   1.00 0.00 ? 78  GLU A HA   6  
ATOM 10465 H HB2  . GLU A 1 78  ? 0.354   -5.454  5.162   1.00 0.00 ? 78  GLU A HB2  6  
ATOM 10466 H HB3  . GLU A 1 78  ? -0.665  -6.855  4.865   1.00 0.00 ? 78  GLU A HB3  6  
ATOM 10467 H HG2  . GLU A 1 78  ? 1.303   -7.745  3.484   1.00 0.00 ? 78  GLU A HG2  6  
ATOM 10468 H HG3  . GLU A 1 78  ? 2.252   -6.503  4.298   1.00 0.00 ? 78  GLU A HG3  6  
ATOM 10469 N N    . ILE A 1 79  ? -2.674  -5.254  3.320   1.00 0.00 ? 79  ILE A N    6  
ATOM 10470 C CA   . ILE A 1 79  ? -3.878  -4.456  3.512   1.00 0.00 ? 79  ILE A CA   6  
ATOM 10471 C C    . ILE A 1 79  ? -4.988  -5.279  4.157   1.00 0.00 ? 79  ILE A C    6  
ATOM 10472 O O    . ILE A 1 79  ? -5.511  -6.215  3.554   1.00 0.00 ? 79  ILE A O    6  
ATOM 10473 C CB   . ILE A 1 79  ? -4.391  -3.881  2.178   1.00 0.00 ? 79  ILE A CB   6  
ATOM 10474 C CG1  . ILE A 1 79  ? -3.435  -2.805  1.660   1.00 0.00 ? 79  ILE A CG1  6  
ATOM 10475 C CG2  . ILE A 1 79  ? -5.793  -3.315  2.349   1.00 0.00 ? 79  ILE A CG2  6  
ATOM 10476 C CD1  . ILE A 1 79  ? -3.848  -2.220  0.327   1.00 0.00 ? 79  ILE A CD1  6  
ATOM 10477 H H    . ILE A 1 79  ? -2.759  -6.218  3.169   1.00 0.00 ? 79  ILE A H    6  
ATOM 10478 H HA   . ILE A 1 79  ? -3.631  -3.631  4.164   1.00 0.00 ? 79  ILE A HA   6  
ATOM 10479 H HB   . ILE A 1 79  ? -4.439  -4.686  1.460   1.00 0.00 ? 79  ILE A HB   6  
ATOM 10480 H HG12 . ILE A 1 79  ? -3.389  -1.999  2.375   1.00 0.00 ? 79  ILE A HG12 6  
ATOM 10481 H HG13 . ILE A 1 79  ? -2.450  -3.234  1.544   1.00 0.00 ? 79  ILE A HG13 6  
ATOM 10482 H HG21 . ILE A 1 79  ? -6.505  -4.125  2.398   1.00 0.00 ? 79  ILE A HG21 6  
ATOM 10483 H HG22 . ILE A 1 79  ? -5.839  -2.740  3.262   1.00 0.00 ? 79  ILE A HG22 6  
ATOM 10484 H HG23 . ILE A 1 79  ? -6.029  -2.678  1.510   1.00 0.00 ? 79  ILE A HG23 6  
ATOM 10485 H HD11 . ILE A 1 79  ? -4.203  -1.211  0.471   1.00 0.00 ? 79  ILE A HD11 6  
ATOM 10486 H HD12 . ILE A 1 79  ? -3.000  -2.213  -0.341  1.00 0.00 ? 79  ILE A HD12 6  
ATOM 10487 H HD13 . ILE A 1 79  ? -4.638  -2.822  -0.100  1.00 0.00 ? 79  ILE A HD13 6  
ATOM 10488 N N    . ASN A 1 80  ? -5.342  -4.923  5.388   1.00 0.00 ? 80  ASN A N    6  
ATOM 10489 C CA   . ASN A 1 80  ? -6.390  -5.629  6.116   1.00 0.00 ? 80  ASN A CA   6  
ATOM 10490 C C    . ASN A 1 80  ? -5.980  -7.070  6.400   1.00 0.00 ? 80  ASN A C    6  
ATOM 10491 O O    . ASN A 1 80  ? -6.760  -8.000  6.199   1.00 0.00 ? 80  ASN A O    6  
ATOM 10492 C CB   . ASN A 1 80  ? -7.697  -5.606  5.319   1.00 0.00 ? 80  ASN A CB   6  
ATOM 10493 C CG   . ASN A 1 80  ? -8.872  -6.132  6.121   1.00 0.00 ? 80  ASN A CG   6  
ATOM 10494 O OD1  . ASN A 1 80  ? -9.355  -7.239  5.882   1.00 0.00 ? 80  ASN A OD1  6  
ATOM 10495 N ND2  . ASN A 1 80  ? -9.337  -5.338  7.078   1.00 0.00 ? 80  ASN A ND2  6  
ATOM 10496 H H    . ASN A 1 80  ? -4.887  -4.168  5.817   1.00 0.00 ? 80  ASN A H    6  
ATOM 10497 H HA   . ASN A 1 80  ? -6.543  -5.118  7.055   1.00 0.00 ? 80  ASN A HA   6  
ATOM 10498 H HB2  . ASN A 1 80  ? -7.913  -4.590  5.024   1.00 0.00 ? 80  ASN A HB2  6  
ATOM 10499 H HB3  . ASN A 1 80  ? -7.584  -6.217  4.436   1.00 0.00 ? 80  ASN A HB3  6  
ATOM 10500 H HD21 . ASN A 1 80  ? -8.903  -4.470  7.212   1.00 0.00 ? 80  ASN A HD21 6  
ATOM 10501 H HD22 . ASN A 1 80  ? -10.096 -5.654  7.612   1.00 0.00 ? 80  ASN A HD22 6  
ATOM 10502 N N    . ASN A 1 81  ? -4.749  -7.248  6.869   1.00 0.00 ? 81  ASN A N    6  
ATOM 10503 C CA   . ASN A 1 81  ? -4.234  -8.576  7.181   1.00 0.00 ? 81  ASN A CA   6  
ATOM 10504 C C    . ASN A 1 81  ? -4.188  -9.449  5.930   1.00 0.00 ? 81  ASN A C    6  
ATOM 10505 O O    . ASN A 1 81  ? -4.571  -10.619 5.964   1.00 0.00 ? 81  ASN A O    6  
ATOM 10506 C CB   . ASN A 1 81  ? -5.101  -9.244  8.251   1.00 0.00 ? 81  ASN A CB   6  
ATOM 10507 C CG   . ASN A 1 81  ? -4.635  -8.918  9.657   1.00 0.00 ? 81  ASN A CG   6  
ATOM 10508 O OD1  . ASN A 1 81  ? -4.210  -7.798  9.939   1.00 0.00 ? 81  ASN A OD1  6  
ATOM 10509 N ND2  . ASN A 1 81  ? -4.713  -9.900  10.548  1.00 0.00 ? 81  ASN A ND2  6  
ATOM 10510 H H    . ASN A 1 81  ? -4.173  -6.467  7.008   1.00 0.00 ? 81  ASN A H    6  
ATOM 10511 H HA   . ASN A 1 81  ? -3.231  -8.462  7.563   1.00 0.00 ? 81  ASN A HA   6  
ATOM 10512 H HB2  . ASN A 1 81  ? -6.120  -8.904  8.143   1.00 0.00 ? 81  ASN A HB2  6  
ATOM 10513 H HB3  . ASN A 1 81  ? -5.066  -10.314 8.118   1.00 0.00 ? 81  ASN A HB3  6  
ATOM 10514 H HD21 . ASN A 1 81  ? -5.061  -10.767 10.252  1.00 0.00 ? 81  ASN A HD21 6  
ATOM 10515 H HD22 . ASN A 1 81  ? -4.419  -9.717  11.465  1.00 0.00 ? 81  ASN A HD22 6  
ATOM 10516 N N    . GLN A 1 82  ? -3.717  -8.873  4.830   1.00 0.00 ? 82  GLN A N    6  
ATOM 10517 C CA   . GLN A 1 82  ? -3.621  -9.599  3.569   1.00 0.00 ? 82  GLN A CA   6  
ATOM 10518 C C    . GLN A 1 82  ? -2.389  -9.164  2.783   1.00 0.00 ? 82  GLN A C    6  
ATOM 10519 O O    . GLN A 1 82  ? -2.265  -8.002  2.396   1.00 0.00 ? 82  GLN A O    6  
ATOM 10520 C CB   . GLN A 1 82  ? -4.881  -9.375  2.730   1.00 0.00 ? 82  GLN A CB   6  
ATOM 10521 C CG   . GLN A 1 82  ? -6.080  -10.177 3.208   1.00 0.00 ? 82  GLN A CG   6  
ATOM 10522 C CD   . GLN A 1 82  ? -6.168  -11.541 2.554   1.00 0.00 ? 82  GLN A CD   6  
ATOM 10523 O OE1  . GLN A 1 82  ? -5.714  -12.541 3.112   1.00 0.00 ? 82  GLN A OE1  6  
ATOM 10524 N NE2  . GLN A 1 82  ? -6.755  -11.591 1.363   1.00 0.00 ? 82  GLN A NE2  6  
ATOM 10525 H H    . GLN A 1 82  ? -3.427  -7.938  4.866   1.00 0.00 ? 82  GLN A H    6  
ATOM 10526 H HA   . GLN A 1 82  ? -3.535  -10.650 3.797   1.00 0.00 ? 82  GLN A HA   6  
ATOM 10527 H HB2  . GLN A 1 82  ? -5.139  -8.327  2.763   1.00 0.00 ? 82  GLN A HB2  6  
ATOM 10528 H HB3  . GLN A 1 82  ? -4.672  -9.654  1.708   1.00 0.00 ? 82  GLN A HB3  6  
ATOM 10529 H HG2  . GLN A 1 82  ? -6.005  -10.311 4.277   1.00 0.00 ? 82  GLN A HG2  6  
ATOM 10530 H HG3  . GLN A 1 82  ? -6.980  -9.625  2.978   1.00 0.00 ? 82  GLN A HG3  6  
ATOM 10531 H HE21 . GLN A 1 82  ? -7.092  -10.754 0.979   1.00 0.00 ? 82  GLN A HE21 6  
ATOM 10532 H HE22 . GLN A 1 82  ? -6.824  -12.460 0.917   1.00 0.00 ? 82  GLN A HE22 6  
ATOM 10533 N N    . ILE A 1 83  ? -1.479  -10.105 2.550   1.00 0.00 ? 83  ILE A N    6  
ATOM 10534 C CA   . ILE A 1 83  ? -0.257  -9.819  1.810   1.00 0.00 ? 83  ILE A CA   6  
ATOM 10535 C C    . ILE A 1 83  ? -0.537  -9.689  0.316   1.00 0.00 ? 83  ILE A C    6  
ATOM 10536 O O    . ILE A 1 83  ? -1.131  -10.578 -0.295  1.00 0.00 ? 83  ILE A O    6  
ATOM 10537 C CB   . ILE A 1 83  ? 0.803   -10.914 2.029   1.00 0.00 ? 83  ILE A CB   6  
ATOM 10538 C CG1  . ILE A 1 83  ? 1.077   -11.099 3.523   1.00 0.00 ? 83  ILE A CG1  6  
ATOM 10539 C CG2  . ILE A 1 83  ? 2.086   -10.565 1.289   1.00 0.00 ? 83  ILE A CG2  6  
ATOM 10540 C CD1  . ILE A 1 83  ? 2.207   -12.060 3.816   1.00 0.00 ? 83  ILE A CD1  6  
ATOM 10541 H H    . ILE A 1 83  ? -1.635  -11.013 2.884   1.00 0.00 ? 83  ILE A H    6  
ATOM 10542 H HA   . ILE A 1 83  ? 0.141   -8.883  2.174   1.00 0.00 ? 83  ILE A HA   6  
ATOM 10543 H HB   . ILE A 1 83  ? 0.422   -11.839 1.623   1.00 0.00 ? 83  ILE A HB   6  
ATOM 10544 H HG12 . ILE A 1 83  ? 1.334   -10.145 3.956   1.00 0.00 ? 83  ILE A HG12 6  
ATOM 10545 H HG13 . ILE A 1 83  ? 0.185   -11.478 4.000   1.00 0.00 ? 83  ILE A HG13 6  
ATOM 10546 H HG21 . ILE A 1 83  ? 2.517   -11.464 0.872   1.00 0.00 ? 83  ILE A HG21 6  
ATOM 10547 H HG22 . ILE A 1 83  ? 1.864   -9.871  0.492   1.00 0.00 ? 83  ILE A HG22 6  
ATOM 10548 H HG23 . ILE A 1 83  ? 2.787   -10.114 1.975   1.00 0.00 ? 83  ILE A HG23 6  
ATOM 10549 H HD11 . ILE A 1 83  ? 1.806   -13.051 3.973   1.00 0.00 ? 83  ILE A HD11 6  
ATOM 10550 H HD12 . ILE A 1 83  ? 2.892   -12.077 2.982   1.00 0.00 ? 83  ILE A HD12 6  
ATOM 10551 H HD13 . ILE A 1 83  ? 2.731   -11.740 4.705   1.00 0.00 ? 83  ILE A HD13 6  
ATOM 10552 N N    . LEU A 1 84  ? -0.103  -8.576  -0.266  1.00 0.00 ? 84  LEU A N    6  
ATOM 10553 C CA   . LEU A 1 84  ? -0.305  -8.330  -1.690  1.00 0.00 ? 84  LEU A CA   6  
ATOM 10554 C C    . LEU A 1 84  ? 0.952   -8.669  -2.485  1.00 0.00 ? 84  LEU A C    6  
ATOM 10555 O O    . LEU A 1 84  ? 0.882   -8.975  -3.675  1.00 0.00 ? 84  LEU A O    6  
ATOM 10556 C CB   . LEU A 1 84  ? -0.691  -6.868  -1.925  1.00 0.00 ? 84  LEU A CB   6  
ATOM 10557 C CG   . LEU A 1 84  ? -1.678  -6.266  -0.924  1.00 0.00 ? 84  LEU A CG   6  
ATOM 10558 C CD1  . LEU A 1 84  ? -1.746  -4.755  -1.084  1.00 0.00 ? 84  LEU A CD1  6  
ATOM 10559 C CD2  . LEU A 1 84  ? -3.058  -6.885  -1.098  1.00 0.00 ? 84  LEU A CD2  6  
ATOM 10560 H H    . LEU A 1 84  ? 0.364   -7.905  0.273   1.00 0.00 ? 84  LEU A H    6  
ATOM 10561 H HA   . LEU A 1 84  ? -1.111  -8.965  -2.025  1.00 0.00 ? 84  LEU A HA   6  
ATOM 10562 H HB2  . LEU A 1 84  ? 0.212   -6.279  -1.894  1.00 0.00 ? 84  LEU A HB2  6  
ATOM 10563 H HB3  . LEU A 1 84  ? -1.132  -6.798  -2.909  1.00 0.00 ? 84  LEU A HB3  6  
ATOM 10564 H HG   . LEU A 1 84  ? -1.339  -6.480  0.080   1.00 0.00 ? 84  LEU A HG   6  
ATOM 10565 H HD11 . LEU A 1 84  ? -2.722  -4.475  -1.450  1.00 0.00 ? 84  LEU A HD11 6  
ATOM 10566 H HD12 . LEU A 1 84  ? -0.992  -4.434  -1.788  1.00 0.00 ? 84  LEU A HD12 6  
ATOM 10567 H HD13 . LEU A 1 84  ? -1.570  -4.284  -0.128  1.00 0.00 ? 84  LEU A HD13 6  
ATOM 10568 H HD21 . LEU A 1 84  ? -3.142  -7.302  -2.091  1.00 0.00 ? 84  LEU A HD21 6  
ATOM 10569 H HD22 . LEU A 1 84  ? -3.813  -6.124  -0.962  1.00 0.00 ? 84  LEU A HD22 6  
ATOM 10570 H HD23 . LEU A 1 84  ? -3.197  -7.666  -0.366  1.00 0.00 ? 84  LEU A HD23 6  
ATOM 10571 N N    . TYR A 1 85  ? 2.100   -8.615  -1.818  1.00 0.00 ? 85  TYR A N    6  
ATOM 10572 C CA   . TYR A 1 85  ? 3.373   -8.917  -2.462  1.00 0.00 ? 85  TYR A CA   6  
ATOM 10573 C C    . TYR A 1 85  ? 3.240   -10.115 -3.397  1.00 0.00 ? 85  TYR A C    6  
ATOM 10574 O O    . TYR A 1 85  ? 3.270   -11.264 -2.961  1.00 0.00 ? 85  TYR A O    6  
ATOM 10575 C CB   . TYR A 1 85  ? 4.448   -9.194  -1.410  1.00 0.00 ? 85  TYR A CB   6  
ATOM 10576 C CG   . TYR A 1 85  ? 5.819   -9.444  -1.996  1.00 0.00 ? 85  TYR A CG   6  
ATOM 10577 C CD1  . TYR A 1 85  ? 6.193   -10.712 -2.423  1.00 0.00 ? 85  TYR A CD1  6  
ATOM 10578 C CD2  . TYR A 1 85  ? 6.741   -8.412  -2.122  1.00 0.00 ? 85  TYR A CD2  6  
ATOM 10579 C CE1  . TYR A 1 85  ? 7.445   -10.946 -2.958  1.00 0.00 ? 85  TYR A CE1  6  
ATOM 10580 C CE2  . TYR A 1 85  ? 7.994   -8.636  -2.658  1.00 0.00 ? 85  TYR A CE2  6  
ATOM 10581 C CZ   . TYR A 1 85  ? 8.341   -9.904  -3.074  1.00 0.00 ? 85  TYR A CZ   6  
ATOM 10582 O OH   . TYR A 1 85  ? 9.590   -10.131 -3.607  1.00 0.00 ? 85  TYR A OH   6  
ATOM 10583 H H    . TYR A 1 85  ? 2.092   -8.365  -0.871  1.00 0.00 ? 85  TYR A H    6  
ATOM 10584 H HA   . TYR A 1 85  ? 3.664   -8.053  -3.041  1.00 0.00 ? 85  TYR A HA   6  
ATOM 10585 H HB2  . TYR A 1 85  ? 4.521   -8.346  -0.747  1.00 0.00 ? 85  TYR A HB2  6  
ATOM 10586 H HB3  . TYR A 1 85  ? 4.166   -10.067 -0.839  1.00 0.00 ? 85  TYR A HB3  6  
ATOM 10587 H HD1  . TYR A 1 85  ? 5.488   -11.526 -2.331  1.00 0.00 ? 85  TYR A HD1  6  
ATOM 10588 H HD2  . TYR A 1 85  ? 6.466   -7.420  -1.795  1.00 0.00 ? 85  TYR A HD2  6  
ATOM 10589 H HE1  . TYR A 1 85  ? 7.717   -11.939 -3.285  1.00 0.00 ? 85  TYR A HE1  6  
ATOM 10590 H HE2  . TYR A 1 85  ? 8.697   -7.821  -2.748  1.00 0.00 ? 85  TYR A HE2  6  
ATOM 10591 H HH   . TYR A 1 85  ? 10.203  -10.354 -2.903  1.00 0.00 ? 85  TYR A HH   6  
ATOM 10592 N N    . GLY A 1 86  ? 3.093   -9.835  -4.689  1.00 0.00 ? 86  GLY A N    6  
ATOM 10593 C CA   . GLY A 1 86  ? 2.958   -10.899 -5.667  1.00 0.00 ? 86  GLY A CA   6  
ATOM 10594 C C    . GLY A 1 86  ? 1.563   -10.970 -6.258  1.00 0.00 ? 86  GLY A C    6  
ATOM 10595 O O    . GLY A 1 86  ? 1.088   -12.048 -6.615  1.00 0.00 ? 86  GLY A O    6  
ATOM 10596 H H    . GLY A 1 86  ? 3.075   -8.899  -4.980  1.00 0.00 ? 86  GLY A H    6  
ATOM 10597 H HA2  . GLY A 1 86  ? 3.667   -10.732 -6.464  1.00 0.00 ? 86  GLY A HA2  6  
ATOM 10598 H HA3  . GLY A 1 86  ? 3.182   -11.842 -5.190  1.00 0.00 ? 86  GLY A HA3  6  
ATOM 10599 N N    . ARG A 1 87  ? 0.906   -9.819  -6.359  1.00 0.00 ? 87  ARG A N    6  
ATOM 10600 C CA   . ARG A 1 87  ? -0.444  -9.756  -6.907  1.00 0.00 ? 87  ARG A CA   6  
ATOM 10601 C C    . ARG A 1 87  ? -0.646  -8.473  -7.707  1.00 0.00 ? 87  ARG A C    6  
ATOM 10602 O O    . ARG A 1 87  ? 0.021   -7.467  -7.465  1.00 0.00 ? 87  ARG A O    6  
ATOM 10603 C CB   . ARG A 1 87  ? -1.478  -9.838  -5.783  1.00 0.00 ? 87  ARG A CB   6  
ATOM 10604 C CG   . ARG A 1 87  ? -1.495  -11.178 -5.068  1.00 0.00 ? 87  ARG A CG   6  
ATOM 10605 C CD   . ARG A 1 87  ? -2.370  -11.135 -3.825  1.00 0.00 ? 87  ARG A CD   6  
ATOM 10606 N NE   . ARG A 1 87  ? -2.004  -12.169 -2.861  1.00 0.00 ? 87  ARG A NE   6  
ATOM 10607 C CZ   . ARG A 1 87  ? -2.408  -13.432 -2.949  1.00 0.00 ? 87  ARG A CZ   6  
ATOM 10608 N NH1  . ARG A 1 87  ? -3.186  -13.814 -3.951  1.00 0.00 ? 87  ARG A NH1  6  
ATOM 10609 N NH2  . ARG A 1 87  ? -2.032  -14.315 -2.032  1.00 0.00 ? 87  ARG A NH2  6  
ATOM 10610 H H    . ARG A 1 87  ? 1.338   -8.993  -6.057  1.00 0.00 ? 87  ARG A H    6  
ATOM 10611 H HA   . ARG A 1 87  ? -0.574  -10.602 -7.566  1.00 0.00 ? 87  ARG A HA   6  
ATOM 10612 H HB2  . ARG A 1 87  ? -1.263  -9.069  -5.056  1.00 0.00 ? 87  ARG A HB2  6  
ATOM 10613 H HB3  . ARG A 1 87  ? -2.459  -9.664  -6.200  1.00 0.00 ? 87  ARG A HB3  6  
ATOM 10614 H HG2  . ARG A 1 87  ? -1.882  -11.930 -5.740  1.00 0.00 ? 87  ARG A HG2  6  
ATOM 10615 H HG3  . ARG A 1 87  ? -0.487  -11.435 -4.779  1.00 0.00 ? 87  ARG A HG3  6  
ATOM 10616 H HD2  . ARG A 1 87  ? -2.262  -10.167 -3.358  1.00 0.00 ? 87  ARG A HD2  6  
ATOM 10617 H HD3  . ARG A 1 87  ? -3.399  -11.279 -4.120  1.00 0.00 ? 87  ARG A HD3  6  
ATOM 10618 H HE   . ARG A 1 87  ? -1.429  -11.909 -2.112  1.00 0.00 ? 87  ARG A HE   6  
ATOM 10619 H HH11 . ARG A 1 87  ? -3.470  -13.151 -4.644  1.00 0.00 ? 87  ARG A HH11 6  
ATOM 10620 H HH12 . ARG A 1 87  ? -3.488  -14.766 -4.016  1.00 0.00 ? 87  ARG A HH12 6  
ATOM 10621 H HH21 . ARG A 1 87  ? -1.445  -14.031 -1.275  1.00 0.00 ? 87  ARG A HH21 6  
ATOM 10622 H HH22 . ARG A 1 87  ? -2.336  -15.265 -2.099  1.00 0.00 ? 87  ARG A HH22 6  
ATOM 10623 N N    . SER A 1 88  ? -1.570  -8.516  -8.662  1.00 0.00 ? 88  SER A N    6  
ATOM 10624 C CA   . SER A 1 88  ? -1.857  -7.358  -9.501  1.00 0.00 ? 88  SER A CA   6  
ATOM 10625 C C    . SER A 1 88  ? -2.573  -6.273  -8.702  1.00 0.00 ? 88  SER A C    6  
ATOM 10626 O O    . SER A 1 88  ? -3.447  -6.563  -7.884  1.00 0.00 ? 88  SER A O    6  
ATOM 10627 C CB   . SER A 1 88  ? -2.711  -7.771  -10.701 1.00 0.00 ? 88  SER A CB   6  
ATOM 10628 O OG   . SER A 1 88  ? -3.023  -6.652  -11.514 1.00 0.00 ? 88  SER A OG   6  
ATOM 10629 H H    . SER A 1 88  ? -2.069  -9.347  -8.807  1.00 0.00 ? 88  SER A H    6  
ATOM 10630 H HA   . SER A 1 88  ? -0.916  -6.965  -9.856  1.00 0.00 ? 88  SER A HA   6  
ATOM 10631 H HB2  . SER A 1 88  ? -2.168  -8.491  -11.295 1.00 0.00 ? 88  SER A HB2  6  
ATOM 10632 H HB3  . SER A 1 88  ? -3.631  -8.214  -10.350 1.00 0.00 ? 88  SER A HB3  6  
ATOM 10633 H HG   . SER A 1 88  ? -3.692  -6.119  -11.080 1.00 0.00 ? 88  SER A HG   6  
ATOM 10634 N N    . HIS A 1 89  ? -2.197  -5.022  -8.946  1.00 0.00 ? 89  HIS A N    6  
ATOM 10635 C CA   . HIS A 1 89  ? -2.803  -3.892  -8.251  1.00 0.00 ? 89  HIS A CA   6  
ATOM 10636 C C    . HIS A 1 89  ? -4.311  -4.082  -8.116  1.00 0.00 ? 89  HIS A C    6  
ATOM 10637 O O    . HIS A 1 89  ? -4.867  -3.947  -7.027  1.00 0.00 ? 89  HIS A O    6  
ATOM 10638 C CB   . HIS A 1 89  ? -2.506  -2.589  -8.995  1.00 0.00 ? 89  HIS A CB   6  
ATOM 10639 C CG   . HIS A 1 89  ? -2.927  -2.611  -10.432 1.00 0.00 ? 89  HIS A CG   6  
ATOM 10640 N ND1  . HIS A 1 89  ? -4.161  -2.169  -10.861 1.00 0.00 ? 89  HIS A ND1  6  
ATOM 10641 C CD2  . HIS A 1 89  ? -2.270  -3.023  -11.541 1.00 0.00 ? 89  HIS A CD2  6  
ATOM 10642 C CE1  . HIS A 1 89  ? -4.245  -2.310  -12.172 1.00 0.00 ? 89  HIS A CE1  6  
ATOM 10643 N NE2  . HIS A 1 89  ? -3.111  -2.826  -12.609 1.00 0.00 ? 89  HIS A NE2  6  
ATOM 10644 H H    . HIS A 1 89  ? -1.496  -4.855  -9.610  1.00 0.00 ? 89  HIS A H    6  
ATOM 10645 H HA   . HIS A 1 89  ? -2.370  -3.839  -7.264  1.00 0.00 ? 89  HIS A HA   6  
ATOM 10646 H HB2  . HIS A 1 89  ? -3.027  -1.778  -8.509  1.00 0.00 ? 89  HIS A HB2  6  
ATOM 10647 H HB3  . HIS A 1 89  ? -1.443  -2.398  -8.962  1.00 0.00 ? 89  HIS A HB3  6  
ATOM 10648 H HD1  . HIS A 1 89  ? -4.870  -1.808  -10.289 1.00 0.00 ? 89  HIS A HD1  6  
ATOM 10649 H HD2  . HIS A 1 89  ? -1.270  -3.432  -11.580 1.00 0.00 ? 89  HIS A HD2  6  
ATOM 10650 H HE1  . HIS A 1 89  ? -5.096  -2.048  -12.782 1.00 0.00 ? 89  HIS A HE1  6  
ATOM 10651 H HE2  . HIS A 1 89  ? -2.939  -3.111  -13.530 1.00 0.00 ? 89  HIS A HE2  6  
ATOM 10652 N N    . GLN A 1 90  ? -4.965  -4.395  -9.230  1.00 0.00 ? 90  GLN A N    6  
ATOM 10653 C CA   . GLN A 1 90  ? -6.408  -4.602  -9.236  1.00 0.00 ? 90  GLN A CA   6  
ATOM 10654 C C    . GLN A 1 90  ? -6.845  -5.423  -8.027  1.00 0.00 ? 90  GLN A C    6  
ATOM 10655 O O    . GLN A 1 90  ? -7.857  -5.125  -7.395  1.00 0.00 ? 90  GLN A O    6  
ATOM 10656 C CB   . GLN A 1 90  ? -6.839  -5.301  -10.526 1.00 0.00 ? 90  GLN A CB   6  
ATOM 10657 C CG   . GLN A 1 90  ? -6.973  -4.360  -11.713 1.00 0.00 ? 90  GLN A CG   6  
ATOM 10658 C CD   . GLN A 1 90  ? -7.130  -5.099  -13.027 1.00 0.00 ? 90  GLN A CD   6  
ATOM 10659 O OE1  . GLN A 1 90  ? -7.872  -6.077  -13.118 1.00 0.00 ? 90  GLN A OE1  6  
ATOM 10660 N NE2  . GLN A 1 90  ? -6.431  -4.632  -14.056 1.00 0.00 ? 90  GLN A NE2  6  
ATOM 10661 H H    . GLN A 1 90  ? -4.465  -4.488  -10.068 1.00 0.00 ? 90  GLN A H    6  
ATOM 10662 H HA   . GLN A 1 90  ? -6.882  -3.633  -9.187  1.00 0.00 ? 90  GLN A HA   6  
ATOM 10663 H HB2  . GLN A 1 90  ? -6.109  -6.057  -10.773 1.00 0.00 ? 90  GLN A HB2  6  
ATOM 10664 H HB3  . GLN A 1 90  ? -7.796  -5.776  -10.362 1.00 0.00 ? 90  GLN A HB3  6  
ATOM 10665 H HG2  . GLN A 1 90  ? -7.840  -3.734  -11.564 1.00 0.00 ? 90  GLN A HG2  6  
ATOM 10666 H HG3  . GLN A 1 90  ? -6.088  -3.743  -11.767 1.00 0.00 ? 90  GLN A HG3  6  
ATOM 10667 H HE21 . GLN A 1 90  ? -5.860  -3.849  -13.909 1.00 0.00 ? 90  GLN A HE21 6  
ATOM 10668 H HE22 . GLN A 1 90  ? -6.513  -5.090  -14.917 1.00 0.00 ? 90  GLN A HE22 6  
ATOM 10669 N N    . ASN A 1 91  ? -6.074  -6.459  -7.713  1.00 0.00 ? 91  ASN A N    6  
ATOM 10670 C CA   . ASN A 1 91  ? -6.382  -7.325  -6.580  1.00 0.00 ? 91  ASN A CA   6  
ATOM 10671 C C    . ASN A 1 91  ? -6.439  -6.524  -5.283  1.00 0.00 ? 91  ASN A C    6  
ATOM 10672 O O    . ASN A 1 91  ? -7.440  -6.552  -4.567  1.00 0.00 ? 91  ASN A O    6  
ATOM 10673 C CB   . ASN A 1 91  ? -5.337  -8.436  -6.462  1.00 0.00 ? 91  ASN A CB   6  
ATOM 10674 C CG   . ASN A 1 91  ? -5.385  -9.402  -7.631  1.00 0.00 ? 91  ASN A CG   6  
ATOM 10675 O OD1  . ASN A 1 91  ? -5.152  -9.018  -8.777  1.00 0.00 ? 91  ASN A OD1  6  
ATOM 10676 N ND2  . ASN A 1 91  ? -5.688  -10.663 -7.344  1.00 0.00 ? 91  ASN A ND2  6  
ATOM 10677 H H    . ASN A 1 91  ? -5.280  -6.647  -8.255  1.00 0.00 ? 91  ASN A H    6  
ATOM 10678 H HA   . ASN A 1 91  ? -7.350  -7.770  -6.757  1.00 0.00 ? 91  ASN A HA   6  
ATOM 10679 H HB2  . ASN A 1 91  ? -4.353  -7.994  -6.426  1.00 0.00 ? 91  ASN A HB2  6  
ATOM 10680 H HB3  . ASN A 1 91  ? -5.512  -8.991  -5.553  1.00 0.00 ? 91  ASN A HB3  6  
ATOM 10681 H HD21 . ASN A 1 91  ? -5.862  -10.896 -6.408  1.00 0.00 ? 91  ASN A HD21 6  
ATOM 10682 H HD22 . ASN A 1 91  ? -5.725  -11.308 -8.081  1.00 0.00 ? 91  ASN A HD22 6  
ATOM 10683 N N    . ALA A 1 92  ? -5.357  -5.811  -4.987  1.00 0.00 ? 92  ALA A N    6  
ATOM 10684 C CA   . ALA A 1 92  ? -5.284  -5.000  -3.778  1.00 0.00 ? 92  ALA A CA   6  
ATOM 10685 C C    . ALA A 1 92  ? -6.603  -4.278  -3.521  1.00 0.00 ? 92  ALA A C    6  
ATOM 10686 O O    . ALA A 1 92  ? -7.232  -4.467  -2.480  1.00 0.00 ? 92  ALA A O    6  
ATOM 10687 C CB   . ALA A 1 92  ? -4.143  -3.999  -3.882  1.00 0.00 ? 92  ALA A CB   6  
ATOM 10688 H H    . ALA A 1 92  ? -4.591  -5.830  -5.597  1.00 0.00 ? 92  ALA A H    6  
ATOM 10689 H HA   . ALA A 1 92  ? -5.078  -5.659  -2.946  1.00 0.00 ? 92  ALA A HA   6  
ATOM 10690 H HB1  . ALA A 1 92  ? -3.965  -3.765  -4.921  1.00 0.00 ? 92  ALA A HB1  6  
ATOM 10691 H HB2  . ALA A 1 92  ? -4.406  -3.098  -3.348  1.00 0.00 ? 92  ALA A HB2  6  
ATOM 10692 H HB3  . ALA A 1 92  ? -3.250  -4.426  -3.451  1.00 0.00 ? 92  ALA A HB3  6  
ATOM 10693 N N    . SER A 1 93  ? -7.014  -3.450  -4.476  1.00 0.00 ? 93  SER A N    6  
ATOM 10694 C CA   . SER A 1 93  ? -8.256  -2.696  -4.350  1.00 0.00 ? 93  SER A CA   6  
ATOM 10695 C C    . SER A 1 93  ? -9.399  -3.602  -3.904  1.00 0.00 ? 93  SER A C    6  
ATOM 10696 O O    . SER A 1 93  ? -10.168 -3.255  -3.008  1.00 0.00 ? 93  SER A O    6  
ATOM 10697 C CB   . SER A 1 93  ? -8.608  -2.028  -5.681  1.00 0.00 ? 93  SER A CB   6  
ATOM 10698 O OG   . SER A 1 93  ? -9.913  -1.476  -5.644  1.00 0.00 ? 93  SER A OG   6  
ATOM 10699 H H    . SER A 1 93  ? -6.468  -3.342  -5.282  1.00 0.00 ? 93  SER A H    6  
ATOM 10700 H HA   . SER A 1 93  ? -8.105  -1.932  -3.602  1.00 0.00 ? 93  SER A HA   6  
ATOM 10701 H HB2  . SER A 1 93  ? -7.902  -1.237  -5.882  1.00 0.00 ? 93  SER A HB2  6  
ATOM 10702 H HB3  . SER A 1 93  ? -8.562  -2.762  -6.472  1.00 0.00 ? 93  SER A HB3  6  
ATOM 10703 H HG   . SER A 1 93  ? -9.930  -0.734  -5.037  1.00 0.00 ? 93  SER A HG   6  
ATOM 10704 N N    . ALA A 1 94  ? -9.505  -4.766  -4.537  1.00 0.00 ? 94  ALA A N    6  
ATOM 10705 C CA   . ALA A 1 94  ? -10.552 -5.724  -4.205  1.00 0.00 ? 94  ALA A CA   6  
ATOM 10706 C C    . ALA A 1 94  ? -10.585 -6.005  -2.707  1.00 0.00 ? 94  ALA A C    6  
ATOM 10707 O O    . ALA A 1 94  ? -11.640 -5.941  -2.077  1.00 0.00 ? 94  ALA A O    6  
ATOM 10708 C CB   . ALA A 1 94  ? -10.351 -7.016  -4.982  1.00 0.00 ? 94  ALA A CB   6  
ATOM 10709 H H    . ALA A 1 94  ? -8.861  -4.986  -5.242  1.00 0.00 ? 94  ALA A H    6  
ATOM 10710 H HA   . ALA A 1 94  ? -11.500 -5.298  -4.502  1.00 0.00 ? 94  ALA A HA   6  
ATOM 10711 H HB1  . ALA A 1 94  ? -9.876  -6.797  -5.928  1.00 0.00 ? 94  ALA A HB1  6  
ATOM 10712 H HB2  . ALA A 1 94  ? -9.725  -7.686  -4.411  1.00 0.00 ? 94  ALA A HB2  6  
ATOM 10713 H HB3  . ALA A 1 94  ? -11.308 -7.482  -5.160  1.00 0.00 ? 94  ALA A HB3  6  
ATOM 10714 N N    . ILE A 1 95  ? -9.423  -6.317  -2.143  1.00 0.00 ? 95  ILE A N    6  
ATOM 10715 C CA   . ILE A 1 95  ? -9.319  -6.608  -0.718  1.00 0.00 ? 95  ILE A CA   6  
ATOM 10716 C C    . ILE A 1 95  ? -9.874  -5.460  0.118   1.00 0.00 ? 95  ILE A C    6  
ATOM 10717 O O    . ILE A 1 95  ? -10.543 -5.681  1.128   1.00 0.00 ? 95  ILE A O    6  
ATOM 10718 C CB   . ILE A 1 95  ? -7.860  -6.873  -0.302  1.00 0.00 ? 95  ILE A CB   6  
ATOM 10719 C CG1  . ILE A 1 95  ? -7.290  -8.056  -1.088  1.00 0.00 ? 95  ILE A CG1  6  
ATOM 10720 C CG2  . ILE A 1 95  ? -7.775  -7.134  1.194   1.00 0.00 ? 95  ILE A CG2  6  
ATOM 10721 C CD1  . ILE A 1 95  ? -5.782  -8.153  -1.024  1.00 0.00 ? 95  ILE A CD1  6  
ATOM 10722 H H    . ILE A 1 95  ? -8.616  -6.352  -2.698  1.00 0.00 ? 95  ILE A H    6  
ATOM 10723 H HA   . ILE A 1 95  ? -9.898  -7.498  -0.517  1.00 0.00 ? 95  ILE A HA   6  
ATOM 10724 H HB   . ILE A 1 95  ? -7.280  -5.990  -0.523  1.00 0.00 ? 95  ILE A HB   6  
ATOM 10725 H HG12 . ILE A 1 95  ? -7.698  -8.973  -0.693  1.00 0.00 ? 95  ILE A HG12 6  
ATOM 10726 H HG13 . ILE A 1 95  ? -7.573  -7.958  -2.126  1.00 0.00 ? 95  ILE A HG13 6  
ATOM 10727 H HG21 . ILE A 1 95  ? -7.657  -8.194  1.368   1.00 0.00 ? 95  ILE A HG21 6  
ATOM 10728 H HG22 . ILE A 1 95  ? -6.927  -6.606  1.603   1.00 0.00 ? 95  ILE A HG22 6  
ATOM 10729 H HG23 . ILE A 1 95  ? -8.680  -6.790  1.672   1.00 0.00 ? 95  ILE A HG23 6  
ATOM 10730 H HD11 . ILE A 1 95  ? -5.392  -7.332  -0.441  1.00 0.00 ? 95  ILE A HD11 6  
ATOM 10731 H HD12 . ILE A 1 95  ? -5.500  -9.088  -0.565  1.00 0.00 ? 95  ILE A HD12 6  
ATOM 10732 H HD13 . ILE A 1 95  ? -5.376  -8.107  -2.025  1.00 0.00 ? 95  ILE A HD13 6  
ATOM 10733 N N    . ILE A 1 96  ? -9.593  -4.234  -0.309  1.00 0.00 ? 96  ILE A N    6  
ATOM 10734 C CA   . ILE A 1 96  ? -10.066 -3.051  0.399   1.00 0.00 ? 96  ILE A CA   6  
ATOM 10735 C C    . ILE A 1 96  ? -11.588 -2.956  0.354   1.00 0.00 ? 96  ILE A C    6  
ATOM 10736 O O    . ILE A 1 96  ? -12.235 -2.706  1.371   1.00 0.00 ? 96  ILE A O    6  
ATOM 10737 C CB   . ILE A 1 96  ? -9.465  -1.762  -0.193  1.00 0.00 ? 96  ILE A CB   6  
ATOM 10738 C CG1  . ILE A 1 96  ? -7.943  -1.767  -0.040  1.00 0.00 ? 96  ILE A CG1  6  
ATOM 10739 C CG2  . ILE A 1 96  ? -10.067 -0.539  0.482   1.00 0.00 ? 96  ILE A CG2  6  
ATOM 10740 C CD1  . ILE A 1 96  ? -7.243  -0.760  -0.926  1.00 0.00 ? 96  ILE A CD1  6  
ATOM 10741 H H    . ILE A 1 96  ? -9.055  -4.122  -1.121  1.00 0.00 ? 96  ILE A H    6  
ATOM 10742 H HA   . ILE A 1 96  ? -9.751  -3.131  1.429   1.00 0.00 ? 96  ILE A HA   6  
ATOM 10743 H HB   . ILE A 1 96  ? -9.714  -1.724  -1.242  1.00 0.00 ? 96  ILE A HB   6  
ATOM 10744 H HG12 . ILE A 1 96  ? -7.689  -1.540  0.983   1.00 0.00 ? 96  ILE A HG12 6  
ATOM 10745 H HG13 . ILE A 1 96  ? -7.566  -2.749  -0.290  1.00 0.00 ? 96  ILE A HG13 6  
ATOM 10746 H HG21 . ILE A 1 96  ? -10.982 -0.264  -0.021  1.00 0.00 ? 96  ILE A HG21 6  
ATOM 10747 H HG22 . ILE A 1 96  ? -10.279 -0.767  1.516   1.00 0.00 ? 96  ILE A HG22 6  
ATOM 10748 H HG23 . ILE A 1 96  ? -9.367  0.282   0.431   1.00 0.00 ? 96  ILE A HG23 6  
ATOM 10749 H HD11 . ILE A 1 96  ? -6.296  -0.489  -0.485  1.00 0.00 ? 96  ILE A HD11 6  
ATOM 10750 H HD12 . ILE A 1 96  ? -7.077  -1.192  -1.901  1.00 0.00 ? 96  ILE A HD12 6  
ATOM 10751 H HD13 . ILE A 1 96  ? -7.860  0.122   -1.024  1.00 0.00 ? 96  ILE A HD13 6  
ATOM 10752 N N    . LYS A 1 97  ? -12.153 -3.158  -0.831  1.00 0.00 ? 97  LYS A N    6  
ATOM 10753 C CA   . LYS A 1 97  ? -13.599 -3.098  -1.009  1.00 0.00 ? 97  LYS A CA   6  
ATOM 10754 C C    . LYS A 1 97  ? -14.310 -3.986  0.007   1.00 0.00 ? 97  LYS A C    6  
ATOM 10755 O O    . LYS A 1 97  ? -15.294 -3.578  0.623   1.00 0.00 ? 97  LYS A O    6  
ATOM 10756 C CB   . LYS A 1 97  ? -13.976 -3.527  -2.429  1.00 0.00 ? 97  LYS A CB   6  
ATOM 10757 C CG   . LYS A 1 97  ? -15.242 -2.867  -2.947  1.00 0.00 ? 97  LYS A CG   6  
ATOM 10758 C CD   . LYS A 1 97  ? -15.407 -3.074  -4.444  1.00 0.00 ? 97  LYS A CD   6  
ATOM 10759 C CE   . LYS A 1 97  ? -14.480 -2.167  -5.238  1.00 0.00 ? 97  LYS A CE   6  
ATOM 10760 N NZ   . LYS A 1 97  ? -15.111 -0.850  -5.532  1.00 0.00 ? 97  LYS A NZ   6  
ATOM 10761 H H    . LYS A 1 97  ? -11.584 -3.353  -1.605  1.00 0.00 ? 97  LYS A H    6  
ATOM 10762 H HA   . LYS A 1 97  ? -13.910 -2.076  -0.856  1.00 0.00 ? 97  LYS A HA   6  
ATOM 10763 H HB2  . LYS A 1 97  ? -13.165 -3.275  -3.096  1.00 0.00 ? 97  LYS A HB2  6  
ATOM 10764 H HB3  . LYS A 1 97  ? -14.122 -4.597  -2.442  1.00 0.00 ? 97  LYS A HB3  6  
ATOM 10765 H HG2  . LYS A 1 97  ? -16.094 -3.294  -2.440  1.00 0.00 ? 97  LYS A HG2  6  
ATOM 10766 H HG3  . LYS A 1 97  ? -15.194 -1.806  -2.743  1.00 0.00 ? 97  LYS A HG3  6  
ATOM 10767 H HD2  . LYS A 1 97  ? -15.178 -4.102  -4.683  1.00 0.00 ? 97  LYS A HD2  6  
ATOM 10768 H HD3  . LYS A 1 97  ? -16.430 -2.858  -4.718  1.00 0.00 ? 97  LYS A HD3  6  
ATOM 10769 H HE2  . LYS A 1 97  ? -13.580 -2.004  -4.666  1.00 0.00 ? 97  LYS A HE2  6  
ATOM 10770 H HE3  . LYS A 1 97  ? -14.232 -2.654  -6.169  1.00 0.00 ? 97  LYS A HE3  6  
ATOM 10771 H HZ1  . LYS A 1 97  ? -15.989 -0.745  -4.985  1.00 0.00 ? 97  LYS A HZ1  6  
ATOM 10772 H HZ2  . LYS A 1 97  ? -15.337 -0.781  -6.545  1.00 0.00 ? 97  LYS A HZ2  6  
ATOM 10773 H HZ3  . LYS A 1 97  ? -14.463 -0.078  -5.279  1.00 0.00 ? 97  LYS A HZ3  6  
ATOM 10774 N N    . THR A 1 98  ? -13.804 -5.204  0.179   1.00 0.00 ? 98  THR A N    6  
ATOM 10775 C CA   . THR A 1 98  ? -14.390 -6.149  1.120   1.00 0.00 ? 98  THR A CA   6  
ATOM 10776 C C    . THR A 1 98  ? -13.997 -5.812  2.554   1.00 0.00 ? 98  THR A C    6  
ATOM 10777 O O    . THR A 1 98  ? -14.645 -6.249  3.504   1.00 0.00 ? 98  THR A O    6  
ATOM 10778 C CB   . THR A 1 98  ? -13.957 -7.594  0.808   1.00 0.00 ? 98  THR A CB   6  
ATOM 10779 O OG1  . THR A 1 98  ? -12.556 -7.751  1.057   1.00 0.00 ? 98  THR A OG1  6  
ATOM 10780 C CG2  . THR A 1 98  ? -14.263 -7.949  -0.640  1.00 0.00 ? 98  THR A CG2  6  
ATOM 10781 H H    . THR A 1 98  ? -13.018 -5.471  -0.342  1.00 0.00 ? 98  THR A H    6  
ATOM 10782 H HA   . THR A 1 98  ? -15.464 -6.089  1.028   1.00 0.00 ? 98  THR A HA   6  
ATOM 10783 H HB   . THR A 1 98  ? -14.508 -8.266  1.451   1.00 0.00 ? 98  THR A HB   6  
ATOM 10784 H HG1  . THR A 1 98  ? -12.267 -8.607  0.733   1.00 0.00 ? 98  THR A HG1  6  
ATOM 10785 H HG21 . THR A 1 98  ? -14.352 -7.044  -1.221  1.00 0.00 ? 98  THR A HG21 6  
ATOM 10786 H HG22 . THR A 1 98  ? -15.190 -8.501  -0.687  1.00 0.00 ? 98  THR A HG22 6  
ATOM 10787 H HG23 . THR A 1 98  ? -13.463 -8.555  -1.038  1.00 0.00 ? 98  THR A HG23 6  
ATOM 10788 N N    . ALA A 1 99  ? -12.932 -5.031  2.703   1.00 0.00 ? 99  ALA A N    6  
ATOM 10789 C CA   . ALA A 1 99  ? -12.455 -4.633  4.022   1.00 0.00 ? 99  ALA A CA   6  
ATOM 10790 C C    . ALA A 1 99  ? -13.397 -3.620  4.663   1.00 0.00 ? 99  ALA A C    6  
ATOM 10791 O O    . ALA A 1 99  ? -14.090 -2.863  3.983   1.00 0.00 ? 99  ALA A O    6  
ATOM 10792 C CB   . ALA A 1 99  ? -11.048 -4.062  3.923   1.00 0.00 ? 99  ALA A CB   6  
ATOM 10793 H H    . ALA A 1 99  ? -12.457 -4.714  1.907   1.00 0.00 ? 99  ALA A H    6  
ATOM 10794 H HA   . ALA A 1 99  ? -12.415 -5.517  4.643   1.00 0.00 ? 99  ALA A HA   6  
ATOM 10795 H HB1  . ALA A 1 99  ? -10.761 -3.649  4.880   1.00 0.00 ? 99  ALA A HB1  6  
ATOM 10796 H HB2  . ALA A 1 99  ? -10.360 -4.846  3.648   1.00 0.00 ? 99  ALA A HB2  6  
ATOM 10797 H HB3  . ALA A 1 99  ? -11.028 -3.284  3.175   1.00 0.00 ? 99  ALA A HB3  6  
ATOM 10798 N N    . PRO A 1 100 ? -13.424 -3.603  6.004   1.00 0.00 ? 100 PRO A N    6  
ATOM 10799 C CA   . PRO A 1 100 ? -14.277 -2.687  6.767   1.00 0.00 ? 100 PRO A CA   6  
ATOM 10800 C C    . PRO A 1 100 ? -13.813 -1.238  6.661   1.00 0.00 ? 100 PRO A C    6  
ATOM 10801 O O    . PRO A 1 100 ? -12.703 -0.964  6.204   1.00 0.00 ? 100 PRO A O    6  
ATOM 10802 C CB   . PRO A 1 100 ? -14.139 -3.189  8.206   1.00 0.00 ? 100 PRO A CB   6  
ATOM 10803 C CG   . PRO A 1 100 ? -12.816 -3.874  8.243   1.00 0.00 ? 100 PRO A CG   6  
ATOM 10804 C CD   . PRO A 1 100 ? -12.624 -4.477  6.879   1.00 0.00 ? 100 PRO A CD   6  
ATOM 10805 H HA   . PRO A 1 100 ? -15.310 -2.756  6.458   1.00 0.00 ? 100 PRO A HA   6  
ATOM 10806 H HB2  . PRO A 1 100 ? -14.169 -2.350  8.887   1.00 0.00 ? 100 PRO A HB2  6  
ATOM 10807 H HB3  . PRO A 1 100 ? -14.943 -3.872  8.432   1.00 0.00 ? 100 PRO A HB3  6  
ATOM 10808 H HG2  . PRO A 1 100 ? -12.037 -3.156  8.449   1.00 0.00 ? 100 PRO A HG2  6  
ATOM 10809 H HG3  . PRO A 1 100 ? -12.825 -4.647  8.996   1.00 0.00 ? 100 PRO A HG3  6  
ATOM 10810 H HD2  . PRO A 1 100 ? -11.582 -4.452  6.599   1.00 0.00 ? 100 PRO A HD2  6  
ATOM 10811 H HD3  . PRO A 1 100 ? -12.999 -5.489  6.858   1.00 0.00 ? 100 PRO A HD3  6  
ATOM 10812 N N    . SER A 1 101 ? -14.669 -0.315  7.086   1.00 0.00 ? 101 SER A N    6  
ATOM 10813 C CA   . SER A 1 101 ? -14.347 1.107   7.035   1.00 0.00 ? 101 SER A CA   6  
ATOM 10814 C C    . SER A 1 101 ? -12.863 1.338   7.305   1.00 0.00 ? 101 SER A C    6  
ATOM 10815 O O    . SER A 1 101 ? -12.155 1.925   6.487   1.00 0.00 ? 101 SER A O    6  
ATOM 10816 C CB   . SER A 1 101 ? -15.189 1.879   8.053   1.00 0.00 ? 101 SER A CB   6  
ATOM 10817 O OG   . SER A 1 101 ? -16.560 1.868   7.694   1.00 0.00 ? 101 SER A OG   6  
ATOM 10818 H H    . SER A 1 101 ? -15.539 -0.596  7.439   1.00 0.00 ? 101 SER A H    6  
ATOM 10819 H HA   . SER A 1 101 ? -14.580 1.464   6.043   1.00 0.00 ? 101 SER A HA   6  
ATOM 10820 H HB2  . SER A 1 101 ? -15.080 1.423   9.025   1.00 0.00 ? 101 SER A HB2  6  
ATOM 10821 H HB3  . SER A 1 101 ? -14.848 2.903   8.095   1.00 0.00 ? 101 SER A HB3  6  
ATOM 10822 H HG   . SER A 1 101 ? -17.099 1.910   8.487   1.00 0.00 ? 101 SER A HG   6  
ATOM 10823 N N    . LYS A 1 102 ? -12.399 0.872   8.460   1.00 0.00 ? 102 LYS A N    6  
ATOM 10824 C CA   . LYS A 1 102 ? -11.000 1.025   8.841   1.00 0.00 ? 102 LYS A CA   6  
ATOM 10825 C C    . LYS A 1 102 ? -10.139 -0.056  8.195   1.00 0.00 ? 102 LYS A C    6  
ATOM 10826 O O    . LYS A 1 102 ? -10.373 -1.249  8.390   1.00 0.00 ? 102 LYS A O    6  
ATOM 10827 C CB   . LYS A 1 102 ? -10.855 0.966   10.363  1.00 0.00 ? 102 LYS A CB   6  
ATOM 10828 C CG   . LYS A 1 102 ? -9.691  1.784   10.895  1.00 0.00 ? 102 LYS A CG   6  
ATOM 10829 C CD   . LYS A 1 102 ? -9.906  2.180   12.346  1.00 0.00 ? 102 LYS A CD   6  
ATOM 10830 C CE   . LYS A 1 102 ? -9.175  3.470   12.686  1.00 0.00 ? 102 LYS A CE   6  
ATOM 10831 N NZ   . LYS A 1 102 ? -9.041  3.661   14.157  1.00 0.00 ? 102 LYS A NZ   6  
ATOM 10832 H H    . LYS A 1 102 ? -13.014 0.412   9.071   1.00 0.00 ? 102 LYS A H    6  
ATOM 10833 H HA   . LYS A 1 102 ? -10.666 1.991   8.493   1.00 0.00 ? 102 LYS A HA   6  
ATOM 10834 H HB2  . LYS A 1 102 ? -11.764 1.336   10.814  1.00 0.00 ? 102 LYS A HB2  6  
ATOM 10835 H HB3  . LYS A 1 102 ? -10.710 -0.063  10.659  1.00 0.00 ? 102 LYS A HB3  6  
ATOM 10836 H HG2  . LYS A 1 102 ? -8.788  1.197   10.824  1.00 0.00 ? 102 LYS A HG2  6  
ATOM 10837 H HG3  . LYS A 1 102 ? -9.589  2.679   10.298  1.00 0.00 ? 102 LYS A HG3  6  
ATOM 10838 H HD2  . LYS A 1 102 ? -10.962 2.323   12.519  1.00 0.00 ? 102 LYS A HD2  6  
ATOM 10839 H HD3  . LYS A 1 102 ? -9.538  1.389   12.985  1.00 0.00 ? 102 LYS A HD3  6  
ATOM 10840 H HE2  . LYS A 1 102 ? -8.190  3.437   12.245  1.00 0.00 ? 102 LYS A HE2  6  
ATOM 10841 H HE3  . LYS A 1 102 ? -9.727  4.301   12.272  1.00 0.00 ? 102 LYS A HE3  6  
ATOM 10842 H HZ1  . LYS A 1 102 ? -9.613  4.474   14.464  1.00 0.00 ? 102 LYS A HZ1  6  
ATOM 10843 H HZ2  . LYS A 1 102 ? -8.047  3.838   14.405  1.00 0.00 ? 102 LYS A HZ2  6  
ATOM 10844 H HZ3  . LYS A 1 102 ? -9.367  2.811   14.659  1.00 0.00 ? 102 LYS A HZ3  6  
ATOM 10845 N N    . VAL A 1 103 ? -9.142  0.370   7.426   1.00 0.00 ? 103 VAL A N    6  
ATOM 10846 C CA   . VAL A 1 103 ? -8.244  -0.562  6.753   1.00 0.00 ? 103 VAL A CA   6  
ATOM 10847 C C    . VAL A 1 103 ? -6.785  -0.209  7.021   1.00 0.00 ? 103 VAL A C    6  
ATOM 10848 O O    . VAL A 1 103 ? -6.368  0.935   6.839   1.00 0.00 ? 103 VAL A O    6  
ATOM 10849 C CB   . VAL A 1 103 ? -8.487  -0.577  5.232   1.00 0.00 ? 103 VAL A CB   6  
ATOM 10850 C CG1  . VAL A 1 103 ? -7.622  -1.634  4.564   1.00 0.00 ? 103 VAL A CG1  6  
ATOM 10851 C CG2  . VAL A 1 103 ? -9.959  -0.812  4.931   1.00 0.00 ? 103 VAL A CG2  6  
ATOM 10852 H H    . VAL A 1 103 ? -9.006  1.333   7.308   1.00 0.00 ? 103 VAL A H    6  
ATOM 10853 H HA   . VAL A 1 103 ? -8.441  -1.552  7.138   1.00 0.00 ? 103 VAL A HA   6  
ATOM 10854 H HB   . VAL A 1 103 ? -8.209  0.388   4.835   1.00 0.00 ? 103 VAL A HB   6  
ATOM 10855 H HG11 . VAL A 1 103 ? -7.454  -1.361  3.532   1.00 0.00 ? 103 VAL A HG11 6  
ATOM 10856 H HG12 . VAL A 1 103 ? -6.675  -1.703  5.078   1.00 0.00 ? 103 VAL A HG12 6  
ATOM 10857 H HG13 . VAL A 1 103 ? -8.125  -2.589  4.605   1.00 0.00 ? 103 VAL A HG13 6  
ATOM 10858 H HG21 . VAL A 1 103 ? -10.372 -1.491  5.661   1.00 0.00 ? 103 VAL A HG21 6  
ATOM 10859 H HG22 . VAL A 1 103 ? -10.491 0.128   4.974   1.00 0.00 ? 103 VAL A HG22 6  
ATOM 10860 H HG23 . VAL A 1 103 ? -10.061 -1.238  3.944   1.00 0.00 ? 103 VAL A HG23 6  
ATOM 10861 N N    . LYS A 1 104 ? -6.013  -1.200  7.454   1.00 0.00 ? 104 LYS A N    6  
ATOM 10862 C CA   . LYS A 1 104 ? -4.598  -0.996  7.745   1.00 0.00 ? 104 LYS A CA   6  
ATOM 10863 C C    . LYS A 1 104 ? -3.757  -1.132  6.480   1.00 0.00 ? 104 LYS A C    6  
ATOM 10864 O O    . LYS A 1 104 ? -3.763  -2.177  5.828   1.00 0.00 ? 104 LYS A O    6  
ATOM 10865 C CB   . LYS A 1 104 ? -4.123  -2.001  8.797   1.00 0.00 ? 104 LYS A CB   6  
ATOM 10866 C CG   . LYS A 1 104 ? -2.842  -1.587  9.499   1.00 0.00 ? 104 LYS A CG   6  
ATOM 10867 C CD   . LYS A 1 104 ? -2.207  -2.755  10.235  1.00 0.00 ? 104 LYS A CD   6  
ATOM 10868 C CE   . LYS A 1 104 ? -1.236  -3.514  9.342   1.00 0.00 ? 104 LYS A CE   6  
ATOM 10869 N NZ   . LYS A 1 104 ? -1.141  -4.951  9.723   1.00 0.00 ? 104 LYS A NZ   6  
ATOM 10870 H H    . LYS A 1 104 ? -6.403  -2.090  7.580   1.00 0.00 ? 104 LYS A H    6  
ATOM 10871 H HA   . LYS A 1 104 ? -4.481  0.003   8.135   1.00 0.00 ? 104 LYS A HA   6  
ATOM 10872 H HB2  . LYS A 1 104 ? -4.897  -2.117  9.542   1.00 0.00 ? 104 LYS A HB2  6  
ATOM 10873 H HB3  . LYS A 1 104 ? -3.954  -2.954  8.316   1.00 0.00 ? 104 LYS A HB3  6  
ATOM 10874 H HG2  . LYS A 1 104 ? -2.143  -1.215  8.764   1.00 0.00 ? 104 LYS A HG2  6  
ATOM 10875 H HG3  . LYS A 1 104 ? -3.069  -0.806  10.210  1.00 0.00 ? 104 LYS A HG3  6  
ATOM 10876 H HD2  . LYS A 1 104 ? -1.670  -2.380  11.093  1.00 0.00 ? 104 LYS A HD2  6  
ATOM 10877 H HD3  . LYS A 1 104 ? -2.985  -3.430  10.561  1.00 0.00 ? 104 LYS A HD3  6  
ATOM 10878 H HE2  . LYS A 1 104 ? -1.576  -3.443  8.321   1.00 0.00 ? 104 LYS A HE2  6  
ATOM 10879 H HE3  . LYS A 1 104 ? -0.259  -3.062  9.429   1.00 0.00 ? 104 LYS A HE3  6  
ATOM 10880 H HZ1  . LYS A 1 104 ? -1.344  -5.552  8.900   1.00 0.00 ? 104 LYS A HZ1  6  
ATOM 10881 H HZ2  . LYS A 1 104 ? -1.826  -5.167  10.474  1.00 0.00 ? 104 LYS A HZ2  6  
ATOM 10882 H HZ3  . LYS A 1 104 ? -0.184  -5.166  10.069  1.00 0.00 ? 104 LYS A HZ3  6  
ATOM 10883 N N    . LEU A 1 105 ? -3.034  -0.071  6.139   1.00 0.00 ? 105 LEU A N    6  
ATOM 10884 C CA   . LEU A 1 105 ? -2.185  -0.073  4.952   1.00 0.00 ? 105 LEU A CA   6  
ATOM 10885 C C    . LEU A 1 105 ? -0.710  -0.128  5.338   1.00 0.00 ? 105 LEU A C    6  
ATOM 10886 O O    . LEU A 1 105 ? -0.219  0.723   6.080   1.00 0.00 ? 105 LEU A O    6  
ATOM 10887 C CB   . LEU A 1 105 ? -2.457  1.171   4.105   1.00 0.00 ? 105 LEU A CB   6  
ATOM 10888 C CG   . LEU A 1 105 ? -3.911  1.397   3.691   1.00 0.00 ? 105 LEU A CG   6  
ATOM 10889 C CD1  . LEU A 1 105 ? -4.192  2.881   3.516   1.00 0.00 ? 105 LEU A CD1  6  
ATOM 10890 C CD2  . LEU A 1 105 ? -4.225  0.638   2.410   1.00 0.00 ? 105 LEU A CD2  6  
ATOM 10891 H H    . LEU A 1 105 ? -3.070  0.732   6.698   1.00 0.00 ? 105 LEU A H    6  
ATOM 10892 H HA   . LEU A 1 105 ? -2.427  -0.952  4.374   1.00 0.00 ? 105 LEU A HA   6  
ATOM 10893 H HB2  . LEU A 1 105 ? -2.137  2.033   4.671   1.00 0.00 ? 105 LEU A HB2  6  
ATOM 10894 H HB3  . LEU A 1 105 ? -1.864  1.094   3.205   1.00 0.00 ? 105 LEU A HB3  6  
ATOM 10895 H HG   . LEU A 1 105 ? -4.563  1.024   4.470   1.00 0.00 ? 105 LEU A HG   6  
ATOM 10896 H HD11 . LEU A 1 105 ? -3.332  3.450   3.835   1.00 0.00 ? 105 LEU A HD11 6  
ATOM 10897 H HD12 . LEU A 1 105 ? -5.049  3.158   4.113   1.00 0.00 ? 105 LEU A HD12 6  
ATOM 10898 H HD13 . LEU A 1 105 ? -4.397  3.089   2.476   1.00 0.00 ? 105 LEU A HD13 6  
ATOM 10899 H HD21 . LEU A 1 105 ? -4.963  1.184   1.841   1.00 0.00 ? 105 LEU A HD21 6  
ATOM 10900 H HD22 . LEU A 1 105 ? -4.612  -0.340  2.657   1.00 0.00 ? 105 LEU A HD22 6  
ATOM 10901 H HD23 . LEU A 1 105 ? -3.324  0.533   1.825   1.00 0.00 ? 105 LEU A HD23 6  
ATOM 10902 N N    . VAL A 1 106 ? -0.008  -1.134  4.827   1.00 0.00 ? 106 VAL A N    6  
ATOM 10903 C CA   . VAL A 1 106 ? 1.412   -1.299  5.114   1.00 0.00 ? 106 VAL A CA   6  
ATOM 10904 C C    . VAL A 1 106 ? 2.251   -1.130  3.853   1.00 0.00 ? 106 VAL A C    6  
ATOM 10905 O O    . VAL A 1 106 ? 2.325   -2.031  3.017   1.00 0.00 ? 106 VAL A O    6  
ATOM 10906 C CB   . VAL A 1 106 ? 1.704   -2.680  5.730   1.00 0.00 ? 106 VAL A CB   6  
ATOM 10907 C CG1  . VAL A 1 106 ? 3.193   -2.844  5.993   1.00 0.00 ? 106 VAL A CG1  6  
ATOM 10908 C CG2  . VAL A 1 106 ? 0.904   -2.872  7.010   1.00 0.00 ? 106 VAL A CG2  6  
ATOM 10909 H H    . VAL A 1 106 ? -0.455  -1.781  4.242   1.00 0.00 ? 106 VAL A H    6  
ATOM 10910 H HA   . VAL A 1 106 ? 1.698   -0.541  5.829   1.00 0.00 ? 106 VAL A HA   6  
ATOM 10911 H HB   . VAL A 1 106 ? 1.400   -3.438  5.023   1.00 0.00 ? 106 VAL A HB   6  
ATOM 10912 H HG11 . VAL A 1 106 ? 3.743   -2.120  5.410   1.00 0.00 ? 106 VAL A HG11 6  
ATOM 10913 H HG12 . VAL A 1 106 ? 3.393   -2.688  7.043   1.00 0.00 ? 106 VAL A HG12 6  
ATOM 10914 H HG13 . VAL A 1 106 ? 3.501   -3.840  5.711   1.00 0.00 ? 106 VAL A HG13 6  
ATOM 10915 H HG21 . VAL A 1 106 ? -0.120  -3.110  6.761   1.00 0.00 ? 106 VAL A HG21 6  
ATOM 10916 H HG22 . VAL A 1 106 ? 1.331   -3.680  7.584   1.00 0.00 ? 106 VAL A HG22 6  
ATOM 10917 H HG23 . VAL A 1 106 ? 0.931   -1.963  7.592   1.00 0.00 ? 106 VAL A HG23 6  
ATOM 10918 N N    . PHE A 1 107 ? 2.884   0.032   3.720   1.00 0.00 ? 107 PHE A N    6  
ATOM 10919 C CA   . PHE A 1 107 ? 3.718   0.320   2.560   1.00 0.00 ? 107 PHE A CA   6  
ATOM 10920 C C    . PHE A 1 107 ? 5.084   0.847   2.990   1.00 0.00 ? 107 PHE A C    6  
ATOM 10921 O O    . PHE A 1 107 ? 5.308   1.134   4.166   1.00 0.00 ? 107 PHE A O    6  
ATOM 10922 C CB   . PHE A 1 107 ? 3.029   1.339   1.650   1.00 0.00 ? 107 PHE A CB   6  
ATOM 10923 C CG   . PHE A 1 107 ? 2.805   2.672   2.305   1.00 0.00 ? 107 PHE A CG   6  
ATOM 10924 C CD1  . PHE A 1 107 ? 3.851   3.567   2.460   1.00 0.00 ? 107 PHE A CD1  6  
ATOM 10925 C CD2  . PHE A 1 107 ? 1.548   3.030   2.764   1.00 0.00 ? 107 PHE A CD2  6  
ATOM 10926 C CE1  . PHE A 1 107 ? 3.647   4.794   3.063   1.00 0.00 ? 107 PHE A CE1  6  
ATOM 10927 C CE2  . PHE A 1 107 ? 1.338   4.256   3.368   1.00 0.00 ? 107 PHE A CE2  6  
ATOM 10928 C CZ   . PHE A 1 107 ? 2.389   5.140   3.516   1.00 0.00 ? 107 PHE A CZ   6  
ATOM 10929 H H    . PHE A 1 107 ? 2.786   0.712   4.420   1.00 0.00 ? 107 PHE A H    6  
ATOM 10930 H HA   . PHE A 1 107 ? 3.857   -0.601  2.015   1.00 0.00 ? 107 PHE A HA   6  
ATOM 10931 H HB2  . PHE A 1 107 ? 3.639   1.499   0.774   1.00 0.00 ? 107 PHE A HB2  6  
ATOM 10932 H HB3  . PHE A 1 107 ? 2.069   0.950   1.349   1.00 0.00 ? 107 PHE A HB3  6  
ATOM 10933 H HD1  . PHE A 1 107 ? 4.835   3.299   2.105   1.00 0.00 ? 107 PHE A HD1  6  
ATOM 10934 H HD2  . PHE A 1 107 ? 0.724   2.340   2.648   1.00 0.00 ? 107 PHE A HD2  6  
ATOM 10935 H HE1  . PHE A 1 107 ? 4.471   5.483   3.178   1.00 0.00 ? 107 PHE A HE1  6  
ATOM 10936 H HE2  . PHE A 1 107 ? 0.353   4.523   3.721   1.00 0.00 ? 107 PHE A HE2  6  
ATOM 10937 H HZ   . PHE A 1 107 ? 2.228   6.097   3.988   1.00 0.00 ? 107 PHE A HZ   6  
ATOM 10938 N N    . ILE A 1 108 ? 5.993   0.971   2.029   1.00 0.00 ? 108 ILE A N    6  
ATOM 10939 C CA   . ILE A 1 108 ? 7.336   1.464   2.307   1.00 0.00 ? 108 ILE A CA   6  
ATOM 10940 C C    . ILE A 1 108 ? 7.603   2.777   1.578   1.00 0.00 ? 108 ILE A C    6  
ATOM 10941 O O    . ILE A 1 108 ? 7.234   2.938   0.414   1.00 0.00 ? 108 ILE A O    6  
ATOM 10942 C CB   . ILE A 1 108 ? 8.409   0.437   1.900   1.00 0.00 ? 108 ILE A CB   6  
ATOM 10943 C CG1  . ILE A 1 108 ? 9.799   0.927   2.310   1.00 0.00 ? 108 ILE A CG1  6  
ATOM 10944 C CG2  . ILE A 1 108 ? 8.353   0.179   0.402   1.00 0.00 ? 108 ILE A CG2  6  
ATOM 10945 C CD1  . ILE A 1 108 ? 10.809  -0.187  2.475   1.00 0.00 ? 108 ILE A CD1  6  
ATOM 10946 H H    . ILE A 1 108 ? 5.755   0.727   1.111   1.00 0.00 ? 108 ILE A H    6  
ATOM 10947 H HA   . ILE A 1 108 ? 7.415   1.634   3.372   1.00 0.00 ? 108 ILE A HA   6  
ATOM 10948 H HB   . ILE A 1 108 ? 8.198   -0.491  2.409   1.00 0.00 ? 108 ILE A HB   6  
ATOM 10949 H HG12 . ILE A 1 108 ? 10.172  1.603   1.557   1.00 0.00 ? 108 ILE A HG12 6  
ATOM 10950 H HG13 . ILE A 1 108 ? 9.724   1.451   3.252   1.00 0.00 ? 108 ILE A HG13 6  
ATOM 10951 H HG21 . ILE A 1 108 ? 8.385   1.120   -0.127  1.00 0.00 ? 108 ILE A HG21 6  
ATOM 10952 H HG22 . ILE A 1 108 ? 9.198   -0.426  0.109   1.00 0.00 ? 108 ILE A HG22 6  
ATOM 10953 H HG23 . ILE A 1 108 ? 7.438   -0.340  0.159   1.00 0.00 ? 108 ILE A HG23 6  
ATOM 10954 H HD11 . ILE A 1 108 ? 11.807  0.223   2.437   1.00 0.00 ? 108 ILE A HD11 6  
ATOM 10955 H HD12 . ILE A 1 108 ? 10.655  -0.675  3.426   1.00 0.00 ? 108 ILE A HD12 6  
ATOM 10956 H HD13 . ILE A 1 108 ? 10.685  -0.905  1.678   1.00 0.00 ? 108 ILE A HD13 6  
ATOM 10957 N N    . ARG A 1 109 ? 8.247   3.711   2.269   1.00 0.00 ? 109 ARG A N    6  
ATOM 10958 C CA   . ARG A 1 109 ? 8.564   5.010   1.687   1.00 0.00 ? 109 ARG A CA   6  
ATOM 10959 C C    . ARG A 1 109 ? 9.980   5.020   1.119   1.00 0.00 ? 109 ARG A C    6  
ATOM 10960 O O    . ARG A 1 109 ? 10.946  5.266   1.840   1.00 0.00 ? 109 ARG A O    6  
ATOM 10961 C CB   . ARG A 1 109 ? 8.415   6.113   2.736   1.00 0.00 ? 109 ARG A CB   6  
ATOM 10962 C CG   . ARG A 1 109 ? 8.606   7.514   2.178   1.00 0.00 ? 109 ARG A CG   6  
ATOM 10963 C CD   . ARG A 1 109 ? 7.296   8.092   1.665   1.00 0.00 ? 109 ARG A CD   6  
ATOM 10964 N NE   . ARG A 1 109 ? 6.577   8.824   2.705   1.00 0.00 ? 109 ARG A NE   6  
ATOM 10965 C CZ   . ARG A 1 109 ? 7.056   9.906   3.308   1.00 0.00 ? 109 ARG A CZ   6  
ATOM 10966 N NH1  . ARG A 1 109 ? 8.249   10.380  2.976   1.00 0.00 ? 109 ARG A NH1  6  
ATOM 10967 N NH2  . ARG A 1 109 ? 6.342   10.516  4.245   1.00 0.00 ? 109 ARG A NH2  6  
ATOM 10968 H H    . ARG A 1 109 ? 8.515   3.524   3.193   1.00 0.00 ? 109 ARG A H    6  
ATOM 10969 H HA   . ARG A 1 109 ? 7.866   5.192   0.883   1.00 0.00 ? 109 ARG A HA   6  
ATOM 10970 H HB2  . ARG A 1 109 ? 7.426   6.053   3.167   1.00 0.00 ? 109 ARG A HB2  6  
ATOM 10971 H HB3  . ARG A 1 109 ? 9.148   5.955   3.512   1.00 0.00 ? 109 ARG A HB3  6  
ATOM 10972 H HG2  . ARG A 1 109 ? 8.987   8.154   2.960   1.00 0.00 ? 109 ARG A HG2  6  
ATOM 10973 H HG3  . ARG A 1 109 ? 9.314   7.474   1.364   1.00 0.00 ? 109 ARG A HG3  6  
ATOM 10974 H HD2  . ARG A 1 109 ? 7.510   8.765   0.848   1.00 0.00 ? 109 ARG A HD2  6  
ATOM 10975 H HD3  . ARG A 1 109 ? 6.675   7.283   1.312   1.00 0.00 ? 109 ARG A HD3  6  
ATOM 10976 H HE   . ARG A 1 109 ? 5.693   8.491   2.965   1.00 0.00 ? 109 ARG A HE   6  
ATOM 10977 H HH11 . ARG A 1 109 ? 8.789   9.922   2.270   1.00 0.00 ? 109 ARG A HH11 6  
ATOM 10978 H HH12 . ARG A 1 109 ? 8.608   11.195  3.431   1.00 0.00 ? 109 ARG A HH12 6  
ATOM 10979 H HH21 . ARG A 1 109 ? 5.442   10.162  4.497   1.00 0.00 ? 109 ARG A HH21 6  
ATOM 10980 H HH22 . ARG A 1 109 ? 6.704   11.330  4.698   1.00 0.00 ? 109 ARG A HH22 6  
ATOM 10981 N N    . ASN A 1 110 ? 10.095  4.751   -0.177  1.00 0.00 ? 110 ASN A N    6  
ATOM 10982 C CA   . ASN A 1 110 ? 11.393  4.728   -0.841  1.00 0.00 ? 110 ASN A CA   6  
ATOM 10983 C C    . ASN A 1 110 ? 11.450  5.763   -1.961  1.00 0.00 ? 110 ASN A C    6  
ATOM 10984 O O    . ASN A 1 110 ? 10.623  5.751   -2.872  1.00 0.00 ? 110 ASN A O    6  
ATOM 10985 C CB   . ASN A 1 110 ? 11.677  3.334   -1.404  1.00 0.00 ? 110 ASN A CB   6  
ATOM 10986 C CG   . ASN A 1 110 ? 13.087  3.207   -1.948  1.00 0.00 ? 110 ASN A CG   6  
ATOM 10987 O OD1  . ASN A 1 110 ? 13.865  4.160   -1.917  1.00 0.00 ? 110 ASN A OD1  6  
ATOM 10988 N ND2  . ASN A 1 110 ? 13.422  2.024   -2.451  1.00 0.00 ? 110 ASN A ND2  6  
ATOM 10989 H H    . ASN A 1 110 ? 9.288   4.563   -0.700  1.00 0.00 ? 110 ASN A H    6  
ATOM 10990 H HA   . ASN A 1 110 ? 12.146  4.969   -0.105  1.00 0.00 ? 110 ASN A HA   6  
ATOM 10991 H HB2  . ASN A 1 110 ? 11.547  2.602   -0.621  1.00 0.00 ? 110 ASN A HB2  6  
ATOM 10992 H HB3  . ASN A 1 110 ? 10.982  3.127   -2.204  1.00 0.00 ? 110 ASN A HB3  6  
ATOM 10993 H HD21 . ASN A 1 110 ? 12.751  1.310   -2.443  1.00 0.00 ? 110 ASN A HD21 6  
ATOM 10994 H HD22 . ASN A 1 110 ? 14.328  1.913   -2.809  1.00 0.00 ? 110 ASN A HD22 6  
ATOM 10995 N N    . GLU A 1 111 ? 12.432  6.656   -1.885  1.00 0.00 ? 111 GLU A N    6  
ATOM 10996 C CA   . GLU A 1 111 ? 12.596  7.698   -2.892  1.00 0.00 ? 111 GLU A CA   6  
ATOM 10997 C C    . GLU A 1 111 ? 12.951  7.093   -4.247  1.00 0.00 ? 111 GLU A C    6  
ATOM 10998 O O    . GLU A 1 111 ? 12.931  7.779   -5.270  1.00 0.00 ? 111 GLU A O    6  
ATOM 10999 C CB   . GLU A 1 111 ? 13.681  8.687   -2.463  1.00 0.00 ? 111 GLU A CB   6  
ATOM 11000 C CG   . GLU A 1 111 ? 13.656  9.992   -3.240  1.00 0.00 ? 111 GLU A CG   6  
ATOM 11001 C CD   . GLU A 1 111 ? 12.726  11.020  -2.626  1.00 0.00 ? 111 GLU A CD   6  
ATOM 11002 O OE1  . GLU A 1 111 ? 13.174  11.765  -1.729  1.00 0.00 ? 111 GLU A OE1  6  
ATOM 11003 O OE2  . GLU A 1 111 ? 11.550  11.079  -3.042  1.00 0.00 ? 111 GLU A OE2  6  
ATOM 11004 H H    . GLU A 1 111 ? 13.060  6.614   -1.134  1.00 0.00 ? 111 GLU A H    6  
ATOM 11005 H HA   . GLU A 1 111 ? 11.657  8.223   -2.981  1.00 0.00 ? 111 GLU A HA   6  
ATOM 11006 H HB2  . GLU A 1 111 ? 13.551  8.913   -1.415  1.00 0.00 ? 111 GLU A HB2  6  
ATOM 11007 H HB3  . GLU A 1 111 ? 14.647  8.226   -2.605  1.00 0.00 ? 111 GLU A HB3  6  
ATOM 11008 H HG2  . GLU A 1 111 ? 14.655  10.402  -3.263  1.00 0.00 ? 111 GLU A HG2  6  
ATOM 11009 H HG3  . GLU A 1 111 ? 13.328  9.790   -4.249  1.00 0.00 ? 111 GLU A HG3  6  
ATOM 11010 N N    . ASP A 1 112 ? 13.276  5.805   -4.247  1.00 0.00 ? 112 ASP A N    6  
ATOM 11011 C CA   . ASP A 1 112 ? 13.635  5.106   -5.475  1.00 0.00 ? 112 ASP A CA   6  
ATOM 11012 C C    . ASP A 1 112 ? 12.431  4.372   -6.055  1.00 0.00 ? 112 ASP A C    6  
ATOM 11013 O O    . ASP A 1 112 ? 12.418  4.012   -7.232  1.00 0.00 ? 112 ASP A O    6  
ATOM 11014 C CB   . ASP A 1 112 ? 14.772  4.117   -5.211  1.00 0.00 ? 112 ASP A CB   6  
ATOM 11015 C CG   . ASP A 1 112 ? 16.056  4.809   -4.796  1.00 0.00 ? 112 ASP A CG   6  
ATOM 11016 O OD1  . ASP A 1 112 ? 16.488  5.736   -5.512  1.00 0.00 ? 112 ASP A OD1  6  
ATOM 11017 O OD2  . ASP A 1 112 ? 16.629  4.422   -3.755  1.00 0.00 ? 112 ASP A OD2  6  
ATOM 11018 H H    . ASP A 1 112 ? 13.273  5.312   -3.399  1.00 0.00 ? 112 ASP A H    6  
ATOM 11019 H HA   . ASP A 1 112 ? 13.970  5.843   -6.190  1.00 0.00 ? 112 ASP A HA   6  
ATOM 11020 H HB2  . ASP A 1 112 ? 14.477  3.442   -4.421  1.00 0.00 ? 112 ASP A HB2  6  
ATOM 11021 H HB3  . ASP A 1 112 ? 14.964  3.551   -6.110  1.00 0.00 ? 112 ASP A HB3  6  
ATOM 11022 N N    . ALA A 1 113 ? 11.420  4.151   -5.221  1.00 0.00 ? 113 ALA A N    6  
ATOM 11023 C CA   . ALA A 1 113 ? 10.211  3.461   -5.651  1.00 0.00 ? 113 ALA A CA   6  
ATOM 11024 C C    . ALA A 1 113 ? 9.392   4.328   -6.601  1.00 0.00 ? 113 ALA A C    6  
ATOM 11025 O O    . ALA A 1 113 ? 8.531   3.830   -7.326  1.00 0.00 ? 113 ALA A O    6  
ATOM 11026 C CB   . ALA A 1 113 ? 9.374   3.061   -4.444  1.00 0.00 ? 113 ALA A CB   6  
ATOM 11027 H H    . ALA A 1 113 ? 11.489  4.462   -4.294  1.00 0.00 ? 113 ALA A H    6  
ATOM 11028 H HA   . ALA A 1 113 ? 10.507  2.559   -6.168  1.00 0.00 ? 113 ALA A HA   6  
ATOM 11029 H HB1  . ALA A 1 113 ? 9.902   2.311   -3.874  1.00 0.00 ? 113 ALA A HB1  6  
ATOM 11030 H HB2  . ALA A 1 113 ? 9.199   3.928   -3.825  1.00 0.00 ? 113 ALA A HB2  6  
ATOM 11031 H HB3  . ALA A 1 113 ? 8.429   2.660   -4.779  1.00 0.00 ? 113 ALA A HB3  6  
ATOM 11032 N N    . VAL A 1 114 ? 9.665   5.629   -6.591  1.00 0.00 ? 114 VAL A N    6  
ATOM 11033 C CA   . VAL A 1 114 ? 8.953   6.566   -7.452  1.00 0.00 ? 114 VAL A CA   6  
ATOM 11034 C C    . VAL A 1 114 ? 9.396   6.423   -8.904  1.00 0.00 ? 114 VAL A C    6  
ATOM 11035 O O    . VAL A 1 114 ? 8.730   6.908   -9.817  1.00 0.00 ? 114 VAL A O    6  
ATOM 11036 C CB   . VAL A 1 114 ? 9.174   8.022   -7.001  1.00 0.00 ? 114 VAL A CB   6  
ATOM 11037 C CG1  . VAL A 1 114 ? 8.587   8.247   -5.616  1.00 0.00 ? 114 VAL A CG1  6  
ATOM 11038 C CG2  . VAL A 1 114 ? 10.655  8.368   -7.023  1.00 0.00 ? 114 VAL A CG2  6  
ATOM 11039 H H    . VAL A 1 114 ? 10.362  5.967   -5.991  1.00 0.00 ? 114 VAL A H    6  
ATOM 11040 H HA   . VAL A 1 114 ? 7.898   6.347   -7.384  1.00 0.00 ? 114 VAL A HA   6  
ATOM 11041 H HB   . VAL A 1 114 ? 8.664   8.674   -7.694  1.00 0.00 ? 114 VAL A HB   6  
ATOM 11042 H HG11 . VAL A 1 114 ? 8.941   7.478   -4.945  1.00 0.00 ? 114 VAL A HG11 6  
ATOM 11043 H HG12 . VAL A 1 114 ? 8.892   9.216   -5.248  1.00 0.00 ? 114 VAL A HG12 6  
ATOM 11044 H HG13 . VAL A 1 114 ? 7.509   8.206   -5.671  1.00 0.00 ? 114 VAL A HG13 6  
ATOM 11045 H HG21 . VAL A 1 114 ? 11.231  7.499   -6.739  1.00 0.00 ? 114 VAL A HG21 6  
ATOM 11046 H HG22 . VAL A 1 114 ? 10.939  8.677   -8.019  1.00 0.00 ? 114 VAL A HG22 6  
ATOM 11047 H HG23 . VAL A 1 114 ? 10.849  9.171   -6.328  1.00 0.00 ? 114 VAL A HG23 6  
ATOM 11048 N N    . ASN A 1 115 ? 10.525  5.753   -9.109  1.00 0.00 ? 115 ASN A N    6  
ATOM 11049 C CA   . ASN A 1 115 ? 11.058  5.545   -10.451 1.00 0.00 ? 115 ASN A CA   6  
ATOM 11050 C C    . ASN A 1 115 ? 10.817  4.113   -10.916 1.00 0.00 ? 115 ASN A C    6  
ATOM 11051 O O    . ASN A 1 115 ? 10.858  3.823   -12.111 1.00 0.00 ? 115 ASN A O    6  
ATOM 11052 C CB   . ASN A 1 115 ? 12.555  5.859   -10.482 1.00 0.00 ? 115 ASN A CB   6  
ATOM 11053 C CG   . ASN A 1 115 ? 12.870  7.232   -9.920  1.00 0.00 ? 115 ASN A CG   6  
ATOM 11054 O OD1  . ASN A 1 115 ? 12.490  8.252   -10.494 1.00 0.00 ? 115 ASN A OD1  6  
ATOM 11055 N ND2  . ASN A 1 115 ? 13.568  7.263   -8.791  1.00 0.00 ? 115 ASN A ND2  6  
ATOM 11056 H H    . ASN A 1 115 ? 11.012  5.389   -8.340  1.00 0.00 ? 115 ASN A H    6  
ATOM 11057 H HA   . ASN A 1 115 ? 10.544  6.220   -11.119 1.00 0.00 ? 115 ASN A HA   6  
ATOM 11058 H HB2  . ASN A 1 115 ? 13.083  5.121   -9.896  1.00 0.00 ? 115 ASN A HB2  6  
ATOM 11059 H HB3  . ASN A 1 115 ? 12.904  5.819   -11.503 1.00 0.00 ? 115 ASN A HB3  6  
ATOM 11060 H HD21 . ASN A 1 115 ? 13.837  6.410   -8.389  1.00 0.00 ? 115 ASN A HD21 6  
ATOM 11061 H HD22 . ASN A 1 115 ? 13.785  8.137   -8.405  1.00 0.00 ? 115 ASN A HD22 6  
ATOM 11062 N N    . GLN A 1 116 ? 10.566  3.221   -9.963  1.00 0.00 ? 116 GLN A N    6  
ATOM 11063 C CA   . GLN A 1 116 ? 10.318  1.819   -10.275 1.00 0.00 ? 116 GLN A CA   6  
ATOM 11064 C C    . GLN A 1 116 ? 8.885   1.612   -10.755 1.00 0.00 ? 116 GLN A C    6  
ATOM 11065 O O    . GLN A 1 116 ? 8.620   0.754   -11.596 1.00 0.00 ? 116 GLN A O    6  
ATOM 11066 C CB   . GLN A 1 116 ? 10.589  0.945   -9.049  1.00 0.00 ? 116 GLN A CB   6  
ATOM 11067 C CG   . GLN A 1 116 ? 12.063  0.836   -8.693  1.00 0.00 ? 116 GLN A CG   6  
ATOM 11068 C CD   . GLN A 1 116 ? 12.317  -0.120  -7.544  1.00 0.00 ? 116 GLN A CD   6  
ATOM 11069 O OE1  . GLN A 1 116 ? 11.780  -1.227  -7.513  1.00 0.00 ? 116 GLN A OE1  6  
ATOM 11070 N NE2  . GLN A 1 116 ? 13.140  0.304   -6.592  1.00 0.00 ? 116 GLN A NE2  6  
ATOM 11071 H H    . GLN A 1 116 ? 10.546  3.513   -9.028  1.00 0.00 ? 116 GLN A H    6  
ATOM 11072 H HA   . GLN A 1 116 ? 10.994  1.531   -11.066 1.00 0.00 ? 116 GLN A HA   6  
ATOM 11073 H HB2  . GLN A 1 116 ? 10.066  1.363   -8.202  1.00 0.00 ? 116 GLN A HB2  6  
ATOM 11074 H HB3  . GLN A 1 116 ? 10.213  -0.049  -9.239  1.00 0.00 ? 116 GLN A HB3  6  
ATOM 11075 H HG2  . GLN A 1 116 ? 12.604  0.485   -9.559  1.00 0.00 ? 116 GLN A HG2  6  
ATOM 11076 H HG3  . GLN A 1 116 ? 12.426  1.815   -8.415  1.00 0.00 ? 116 GLN A HG3  6  
ATOM 11077 H HE21 . GLN A 1 116 ? 13.530  1.199   -6.683  1.00 0.00 ? 116 GLN A HE21 6  
ATOM 11078 H HE22 . GLN A 1 116 ? 13.321  -0.293  -5.837  1.00 0.00 ? 116 GLN A HE22 6  
ATOM 11079 N N    . MET A 1 117 ? 7.966   2.404   -10.213 1.00 0.00 ? 117 MET A N    6  
ATOM 11080 C CA   . MET A 1 117 ? 6.559   2.307   -10.587 1.00 0.00 ? 117 MET A CA   6  
ATOM 11081 C C    . MET A 1 117 ? 6.330   2.866   -11.988 1.00 0.00 ? 117 MET A C    6  
ATOM 11082 O O    . MET A 1 117 ? 6.698   4.003   -12.280 1.00 0.00 ? 117 MET A O    6  
ATOM 11083 C CB   . MET A 1 117 ? 5.689   3.057   -9.577  1.00 0.00 ? 117 MET A CB   6  
ATOM 11084 C CG   . MET A 1 117 ? 6.063   4.522   -9.421  1.00 0.00 ? 117 MET A CG   6  
ATOM 11085 S SD   . MET A 1 117 ? 5.195   5.320   -8.057  1.00 0.00 ? 117 MET A SD   6  
ATOM 11086 C CE   . MET A 1 117 ? 5.701   7.023   -8.283  1.00 0.00 ? 117 MET A CE   6  
ATOM 11087 H H    . MET A 1 117 ? 8.238   3.069   -9.547  1.00 0.00 ? 117 MET A H    6  
ATOM 11088 H HA   . MET A 1 117 ? 6.285   1.263   -10.579 1.00 0.00 ? 117 MET A HA   6  
ATOM 11089 H HB2  . MET A 1 117 ? 4.659   3.004   -9.898  1.00 0.00 ? 117 MET A HB2  6  
ATOM 11090 H HB3  . MET A 1 117 ? 5.783   2.580   -8.613  1.00 0.00 ? 117 MET A HB3  6  
ATOM 11091 H HG2  . MET A 1 117 ? 7.126   4.591   -9.241  1.00 0.00 ? 117 MET A HG2  6  
ATOM 11092 H HG3  . MET A 1 117 ? 5.821   5.041   -10.337 1.00 0.00 ? 117 MET A HG3  6  
ATOM 11093 H HE1  . MET A 1 117 ? 6.455   7.075   -9.054  1.00 0.00 ? 117 MET A HE1  6  
ATOM 11094 H HE2  . MET A 1 117 ? 4.847   7.616   -8.573  1.00 0.00 ? 117 MET A HE2  6  
ATOM 11095 H HE3  . MET A 1 117 ? 6.107   7.404   -7.357  1.00 0.00 ? 117 MET A HE3  6  
ATOM 11096 N N    . ALA A 1 118 ? 5.719   2.059   -12.849 1.00 0.00 ? 118 ALA A N    6  
ATOM 11097 C CA   . ALA A 1 118 ? 5.439   2.474   -14.218 1.00 0.00 ? 118 ALA A CA   6  
ATOM 11098 C C    . ALA A 1 118 ? 4.989   3.930   -14.269 1.00 0.00 ? 118 ALA A C    6  
ATOM 11099 O O    . ALA A 1 118 ? 5.355   4.672   -15.181 1.00 0.00 ? 118 ALA A O    6  
ATOM 11100 C CB   . ALA A 1 118 ? 4.383   1.571   -14.838 1.00 0.00 ? 118 ALA A CB   6  
ATOM 11101 H H    . ALA A 1 118 ? 5.449   1.164   -12.557 1.00 0.00 ? 118 ALA A H    6  
ATOM 11102 H HA   . ALA A 1 118 ? 6.349   2.369   -14.791 1.00 0.00 ? 118 ALA A HA   6  
ATOM 11103 H HB1  . ALA A 1 118 ? 4.230   0.710   -14.204 1.00 0.00 ? 118 ALA A HB1  6  
ATOM 11104 H HB2  . ALA A 1 118 ? 3.456   2.116   -14.936 1.00 0.00 ? 118 ALA A HB2  6  
ATOM 11105 H HB3  . ALA A 1 118 ? 4.715   1.246   -15.813 1.00 0.00 ? 118 ALA A HB3  6  
ATOM 11106 N N    . SER A 1 119 ? 4.191   4.333   -13.285 1.00 0.00 ? 119 SER A N    6  
ATOM 11107 C CA   . SER A 1 119 ? 3.687   5.699   -13.221 1.00 0.00 ? 119 SER A CA   6  
ATOM 11108 C C    . SER A 1 119 ? 2.825   6.018   -14.438 1.00 0.00 ? 119 SER A C    6  
ATOM 11109 O O    . SER A 1 119 ? 2.905   7.109   -15.001 1.00 0.00 ? 119 SER A O    6  
ATOM 11110 C CB   . SER A 1 119 ? 4.848   6.691   -13.130 1.00 0.00 ? 119 SER A CB   6  
ATOM 11111 O OG   . SER A 1 119 ? 4.393   7.976   -12.744 1.00 0.00 ? 119 SER A OG   6  
ATOM 11112 H H    . SER A 1 119 ? 3.934   3.694   -12.587 1.00 0.00 ? 119 SER A H    6  
ATOM 11113 H HA   . SER A 1 119 ? 3.080   5.787   -12.332 1.00 0.00 ? 119 SER A HA   6  
ATOM 11114 H HB2  . SER A 1 119 ? 5.561   6.340   -12.400 1.00 0.00 ? 119 SER A HB2  6  
ATOM 11115 H HB3  . SER A 1 119 ? 5.329   6.766   -14.095 1.00 0.00 ? 119 SER A HB3  6  
ATOM 11116 H HG   . SER A 1 119 ? 3.725   7.887   -12.062 1.00 0.00 ? 119 SER A HG   6  
ATOM 11117 N N    . GLY A 1 120 ? 1.999   5.056   -14.840 1.00 0.00 ? 120 GLY A N    6  
ATOM 11118 C CA   . GLY A 1 120 ? 1.134   5.253   -15.988 1.00 0.00 ? 120 GLY A CA   6  
ATOM 11119 C C    . GLY A 1 120 ? -0.107  4.384   -15.934 1.00 0.00 ? 120 GLY A C    6  
ATOM 11120 O O    . GLY A 1 120 ? -0.162  3.305   -16.523 1.00 0.00 ? 120 GLY A O    6  
ATOM 11121 H H    . GLY A 1 120 ? 1.978   4.206   -14.352 1.00 0.00 ? 120 GLY A H    6  
ATOM 11122 H HA2  . GLY A 1 120 ? 0.834   6.289   -16.026 1.00 0.00 ? 120 GLY A HA2  6  
ATOM 11123 H HA3  . GLY A 1 120 ? 1.686   5.015   -16.886 1.00 0.00 ? 120 GLY A HA3  6  
ATOM 11124 N N    . PRO A 1 121 ? -1.134  4.857   -15.211 1.00 0.00 ? 121 PRO A N    6  
ATOM 11125 C CA   . PRO A 1 121 ? -2.399  4.131   -15.064 1.00 0.00 ? 121 PRO A CA   6  
ATOM 11126 C C    . PRO A 1 121 ? -3.201  4.095   -16.360 1.00 0.00 ? 121 PRO A C    6  
ATOM 11127 O O    . PRO A 1 121 ? -3.993  4.996   -16.637 1.00 0.00 ? 121 PRO A O    6  
ATOM 11128 C CB   . PRO A 1 121 ? -3.146  4.933   -13.995 1.00 0.00 ? 121 PRO A CB   6  
ATOM 11129 C CG   . PRO A 1 121 ? -2.580  6.307   -14.089 1.00 0.00 ? 121 PRO A CG   6  
ATOM 11130 C CD   . PRO A 1 121 ? -1.139  6.136   -14.482 1.00 0.00 ? 121 PRO A CD   6  
ATOM 11131 H HA   . PRO A 1 121 ? -2.239  3.122   -14.713 1.00 0.00 ? 121 PRO A HA   6  
ATOM 11132 H HB2  . PRO A 1 121 ? -4.205  4.925   -14.211 1.00 0.00 ? 121 PRO A HB2  6  
ATOM 11133 H HB3  . PRO A 1 121 ? -2.967  4.498   -13.023 1.00 0.00 ? 121 PRO A HB3  6  
ATOM 11134 H HG2  . PRO A 1 121 ? -3.109  6.872   -14.841 1.00 0.00 ? 121 PRO A HG2  6  
ATOM 11135 H HG3  . PRO A 1 121 ? -2.650  6.799   -13.130 1.00 0.00 ? 121 PRO A HG3  6  
ATOM 11136 H HD2  . PRO A 1 121 ? -0.824  6.946   -15.123 1.00 0.00 ? 121 PRO A HD2  6  
ATOM 11137 H HD3  . PRO A 1 121 ? -0.512  6.081   -13.605 1.00 0.00 ? 121 PRO A HD3  6  
ATOM 11138 N N    . SER A 1 122 ? -2.991  3.048   -17.152 1.00 0.00 ? 122 SER A N    6  
ATOM 11139 C CA   . SER A 1 122 ? -3.692  2.896   -18.421 1.00 0.00 ? 122 SER A CA   6  
ATOM 11140 C C    . SER A 1 122 ? -4.921  2.007   -18.260 1.00 0.00 ? 122 SER A C    6  
ATOM 11141 O O    . SER A 1 122 ? -4.931  1.085   -17.444 1.00 0.00 ? 122 SER A O    6  
ATOM 11142 C CB   . SER A 1 122 ? -2.757  2.307   -19.478 1.00 0.00 ? 122 SER A CB   6  
ATOM 11143 O OG   . SER A 1 122 ? -1.741  3.229   -19.832 1.00 0.00 ? 122 SER A OG   6  
ATOM 11144 H H    . SER A 1 122 ? -2.347  2.362   -16.876 1.00 0.00 ? 122 SER A H    6  
ATOM 11145 H HA   . SER A 1 122 ? -4.012  3.877   -18.742 1.00 0.00 ? 122 SER A HA   6  
ATOM 11146 H HB2  . SER A 1 122 ? -2.294  1.413   -19.088 1.00 0.00 ? 122 SER A HB2  6  
ATOM 11147 H HB3  . SER A 1 122 ? -3.327  2.060   -20.362 1.00 0.00 ? 122 SER A HB3  6  
ATOM 11148 H HG   . SER A 1 122 ? -1.718  3.330   -20.786 1.00 0.00 ? 122 SER A HG   6  
ATOM 11149 N N    . SER A 1 123 ? -5.956  2.290   -19.045 1.00 0.00 ? 123 SER A N    6  
ATOM 11150 C CA   . SER A 1 123 ? -7.192  1.518   -18.988 1.00 0.00 ? 123 SER A CA   6  
ATOM 11151 C C    . SER A 1 123 ? -6.935  0.054   -19.330 1.00 0.00 ? 123 SER A C    6  
ATOM 11152 O O    . SER A 1 123 ? -5.822  -0.324  -19.693 1.00 0.00 ? 123 SER A O    6  
ATOM 11153 C CB   . SER A 1 123 ? -8.229  2.104   -19.949 1.00 0.00 ? 123 SER A CB   6  
ATOM 11154 O OG   . SER A 1 123 ? -8.859  3.242   -19.386 1.00 0.00 ? 123 SER A OG   6  
ATOM 11155 H H    . SER A 1 123 ? -5.887  3.037   -19.676 1.00 0.00 ? 123 SER A H    6  
ATOM 11156 H HA   . SER A 1 123 ? -7.574  1.578   -17.980 1.00 0.00 ? 123 SER A HA   6  
ATOM 11157 H HB2  . SER A 1 123 ? -7.741  2.395   -20.866 1.00 0.00 ? 123 SER A HB2  6  
ATOM 11158 H HB3  . SER A 1 123 ? -8.981  1.358   -20.161 1.00 0.00 ? 123 SER A HB3  6  
ATOM 11159 H HG   . SER A 1 123 ? -8.364  4.031   -19.618 1.00 0.00 ? 123 SER A HG   6  
ATOM 11160 N N    . GLY A 1 124 ? -7.975  -0.766  -19.212 1.00 0.00 ? 124 GLY A N    6  
ATOM 11161 C CA   . GLY A 1 124 ? -7.843  -2.180  -19.513 1.00 0.00 ? 124 GLY A CA   6  
ATOM 11162 C C    . GLY A 1 124 ? -8.725  -2.613  -20.666 1.00 0.00 ? 124 GLY A C    6  
ATOM 11163 O O    . GLY A 1 124 ? -9.598  -1.863  -21.104 1.00 0.00 ? 124 GLY A O    6  
ATOM 11164 H H    . GLY A 1 124 ? -8.839  -0.408  -18.919 1.00 0.00 ? 124 GLY A H    6  
ATOM 11165 H HA2  . GLY A 1 124 ? -6.813  -2.389  -19.762 1.00 0.00 ? 124 GLY A HA2  6  
ATOM 11166 H HA3  . GLY A 1 124 ? -8.112  -2.749  -18.635 1.00 0.00 ? 124 GLY A HA3  6  
ATOM 11167 N N    . GLY A 1 1   ? -8.507  -23.108 28.474  1.00 0.00 ? 1   GLY A N    7  
ATOM 11168 C CA   . GLY A 1 1   ? -8.519  -21.786 27.877  1.00 0.00 ? 1   GLY A CA   7  
ATOM 11169 C C    . GLY A 1 1   ? -7.985  -21.785 26.458  1.00 0.00 ? 1   GLY A C    7  
ATOM 11170 O O    . GLY A 1 1   ? -6.877  -22.258 26.205  1.00 0.00 ? 1   GLY A O    7  
ATOM 11171 H H1   . GLY A 1 1   ? -8.865  -23.872 27.974  1.00 0.00 ? 1   GLY A H1   7  
ATOM 11172 H HA2  . GLY A 1 1   ? -9.533  -21.415 27.868  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 11173 H HA3  . GLY A 1 1   ? -7.911  -21.126 28.478  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 11174 N N    . SER A 1 2   ? -8.775  -21.254 25.530  1.00 0.00 ? 2   SER A N    7  
ATOM 11175 C CA   . SER A 1 2   ? -8.377  -21.199 24.128  1.00 0.00 ? 2   SER A CA   7  
ATOM 11176 C C    . SER A 1 2   ? -7.211  -20.235 23.932  1.00 0.00 ? 2   SER A C    7  
ATOM 11177 O O    . SER A 1 2   ? -7.160  -19.171 24.549  1.00 0.00 ? 2   SER A O    7  
ATOM 11178 C CB   . SER A 1 2   ? -9.560  -20.772 23.257  1.00 0.00 ? 2   SER A CB   7  
ATOM 11179 O OG   . SER A 1 2   ? -9.747  -19.368 23.305  1.00 0.00 ? 2   SER A OG   7  
ATOM 11180 H H    . SER A 1 2   ? -9.647  -20.893 25.795  1.00 0.00 ? 2   SER A H    7  
ATOM 11181 H HA   . SER A 1 2   ? -8.063  -22.190 23.834  1.00 0.00 ? 2   SER A HA   7  
ATOM 11182 H HB2  . SER A 1 2   ? -9.374  -21.063 22.235  1.00 0.00 ? 2   SER A HB2  7  
ATOM 11183 H HB3  . SER A 1 2   ? -10.458 -21.256 23.612  1.00 0.00 ? 2   SER A HB3  7  
ATOM 11184 H HG   . SER A 1 2   ? -10.284 -19.142 24.068  1.00 0.00 ? 2   SER A HG   7  
ATOM 11185 N N    . SER A 1 3   ? -6.276  -20.615 23.067  1.00 0.00 ? 3   SER A N    7  
ATOM 11186 C CA   . SER A 1 3   ? -5.108  -19.787 22.791  1.00 0.00 ? 3   SER A CA   7  
ATOM 11187 C C    . SER A 1 3   ? -5.515  -18.336 22.553  1.00 0.00 ? 3   SER A C    7  
ATOM 11188 O O    . SER A 1 3   ? -5.000  -17.422 23.195  1.00 0.00 ? 3   SER A O    7  
ATOM 11189 C CB   . SER A 1 3   ? -4.353  -20.323 21.573  1.00 0.00 ? 3   SER A CB   7  
ATOM 11190 O OG   . SER A 1 3   ? -3.451  -21.351 21.944  1.00 0.00 ? 3   SER A OG   7  
ATOM 11191 H H    . SER A 1 3   ? -6.373  -21.475 22.606  1.00 0.00 ? 3   SER A H    7  
ATOM 11192 H HA   . SER A 1 3   ? -4.460  -19.830 23.653  1.00 0.00 ? 3   SER A HA   7  
ATOM 11193 H HB2  . SER A 1 3   ? -5.060  -20.721 20.861  1.00 0.00 ? 3   SER A HB2  7  
ATOM 11194 H HB3  . SER A 1 3   ? -3.795  -19.519 21.116  1.00 0.00 ? 3   SER A HB3  7  
ATOM 11195 H HG   . SER A 1 3   ? -2.700  -21.350 21.346  1.00 0.00 ? 3   SER A HG   7  
ATOM 11196 N N    . GLY A 1 4   ? -6.444  -18.133 21.624  1.00 0.00 ? 4   GLY A N    7  
ATOM 11197 C CA   . GLY A 1 4   ? -6.906  -16.792 21.316  1.00 0.00 ? 4   GLY A CA   7  
ATOM 11198 C C    . GLY A 1 4   ? -6.158  -16.175 20.151  1.00 0.00 ? 4   GLY A C    7  
ATOM 11199 O O    . GLY A 1 4   ? -6.770  -15.652 19.219  1.00 0.00 ? 4   GLY A O    7  
ATOM 11200 H H    . GLY A 1 4   ? -6.820  -18.901 21.143  1.00 0.00 ? 4   GLY A H    7  
ATOM 11201 H HA2  . GLY A 1 4   ? -7.958  -16.831 21.076  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 11202 H HA3  . GLY A 1 4   ? -6.768  -16.168 22.187  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 11203 N N    . SER A 1 5   ? -4.832  -16.234 20.202  1.00 0.00 ? 5   SER A N    7  
ATOM 11204 C CA   . SER A 1 5   ? -4.000  -15.672 19.145  1.00 0.00 ? 5   SER A CA   7  
ATOM 11205 C C    . SER A 1 5   ? -3.361  -16.778 18.310  1.00 0.00 ? 5   SER A C    7  
ATOM 11206 O O    . SER A 1 5   ? -2.548  -17.557 18.808  1.00 0.00 ? 5   SER A O    7  
ATOM 11207 C CB   . SER A 1 5   ? -2.912  -14.778 19.744  1.00 0.00 ? 5   SER A CB   7  
ATOM 11208 O OG   . SER A 1 5   ? -2.194  -14.099 18.728  1.00 0.00 ? 5   SER A OG   7  
ATOM 11209 H H    . SER A 1 5   ? -4.402  -16.665 20.971  1.00 0.00 ? 5   SER A H    7  
ATOM 11210 H HA   . SER A 1 5   ? -4.634  -15.075 18.506  1.00 0.00 ? 5   SER A HA   7  
ATOM 11211 H HB2  . SER A 1 5   ? -3.369  -14.047 20.395  1.00 0.00 ? 5   SER A HB2  7  
ATOM 11212 H HB3  . SER A 1 5   ? -2.223  -15.385 20.312  1.00 0.00 ? 5   SER A HB3  7  
ATOM 11213 H HG   . SER A 1 5   ? -2.679  -13.314 18.462  1.00 0.00 ? 5   SER A HG   7  
ATOM 11214 N N    . SER A 1 6   ? -3.736  -16.840 17.036  1.00 0.00 ? 6   SER A N    7  
ATOM 11215 C CA   . SER A 1 6   ? -3.204  -17.852 16.131  1.00 0.00 ? 6   SER A CA   7  
ATOM 11216 C C    . SER A 1 6   ? -2.556  -17.204 14.912  1.00 0.00 ? 6   SER A C    7  
ATOM 11217 O O    . SER A 1 6   ? -3.167  -16.379 14.235  1.00 0.00 ? 6   SER A O    7  
ATOM 11218 C CB   . SER A 1 6   ? -4.316  -18.804 15.686  1.00 0.00 ? 6   SER A CB   7  
ATOM 11219 O OG   . SER A 1 6   ? -4.547  -19.809 16.659  1.00 0.00 ? 6   SER A OG   7  
ATOM 11220 H H    . SER A 1 6   ? -4.388  -16.191 16.698  1.00 0.00 ? 6   SER A H    7  
ATOM 11221 H HA   . SER A 1 6   ? -2.454  -18.414 16.667  1.00 0.00 ? 6   SER A HA   7  
ATOM 11222 H HB2  . SER A 1 6   ? -5.228  -18.245 15.541  1.00 0.00 ? 6   SER A HB2  7  
ATOM 11223 H HB3  . SER A 1 6   ? -4.031  -19.277 14.758  1.00 0.00 ? 6   SER A HB3  7  
ATOM 11224 H HG   . SER A 1 6   ? -4.870  -20.604 16.228  1.00 0.00 ? 6   SER A HG   7  
ATOM 11225 N N    . GLY A 1 7   ? -1.312  -17.585 14.638  1.00 0.00 ? 7   GLY A N    7  
ATOM 11226 C CA   . GLY A 1 7   ? -0.600  -17.032 13.500  1.00 0.00 ? 7   GLY A CA   7  
ATOM 11227 C C    . GLY A 1 7   ? -0.254  -15.568 13.689  1.00 0.00 ? 7   GLY A C    7  
ATOM 11228 O O    . GLY A 1 7   ? -0.927  -14.690 13.149  1.00 0.00 ? 7   GLY A O    7  
ATOM 11229 H H    . GLY A 1 7   ? -0.874  -18.247 15.212  1.00 0.00 ? 7   GLY A H    7  
ATOM 11230 H HA2  . GLY A 1 7   ? 0.312   -17.591 13.354  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 11231 H HA3  . GLY A 1 7   ? -1.217  -17.133 12.620  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 11232 N N    . ASP A 1 8   ? 0.796   -15.305 14.458  1.00 0.00 ? 8   ASP A N    7  
ATOM 11233 C CA   . ASP A 1 8   ? 1.230   -13.937 14.718  1.00 0.00 ? 8   ASP A CA   7  
ATOM 11234 C C    . ASP A 1 8   ? 2.277   -13.497 13.699  1.00 0.00 ? 8   ASP A C    7  
ATOM 11235 O O    . ASP A 1 8   ? 3.007   -12.531 13.923  1.00 0.00 ? 8   ASP A O    7  
ATOM 11236 C CB   . ASP A 1 8   ? 1.797   -13.819 16.134  1.00 0.00 ? 8   ASP A CB   7  
ATOM 11237 C CG   . ASP A 1 8   ? 2.448   -15.104 16.606  1.00 0.00 ? 8   ASP A CG   7  
ATOM 11238 O OD1  . ASP A 1 8   ? 3.400   -15.564 15.942  1.00 0.00 ? 8   ASP A OD1  7  
ATOM 11239 O OD2  . ASP A 1 8   ? 2.005   -15.649 17.638  1.00 0.00 ? 8   ASP A OD2  7  
ATOM 11240 H H    . ASP A 1 8   ? 1.293   -16.048 14.861  1.00 0.00 ? 8   ASP A H    7  
ATOM 11241 H HA   . ASP A 1 8   ? 0.368   -13.293 14.630  1.00 0.00 ? 8   ASP A HA   7  
ATOM 11242 H HB2  . ASP A 1 8   ? 2.538   -13.033 16.154  1.00 0.00 ? 8   ASP A HB2  7  
ATOM 11243 H HB3  . ASP A 1 8   ? 0.996   -13.570 16.815  1.00 0.00 ? 8   ASP A HB3  7  
ATOM 11244 N N    . ALA A 1 9   ? 2.346   -14.212 12.582  1.00 0.00 ? 9   ALA A N    7  
ATOM 11245 C CA   . ALA A 1 9   ? 3.302   -13.895 11.529  1.00 0.00 ? 9   ALA A CA   7  
ATOM 11246 C C    . ALA A 1 9   ? 2.962   -12.567 10.860  1.00 0.00 ? 9   ALA A C    7  
ATOM 11247 O O    . ALA A 1 9   ? 3.751   -12.033 10.080  1.00 0.00 ? 9   ALA A O    7  
ATOM 11248 C CB   . ALA A 1 9   ? 3.342   -15.012 10.497  1.00 0.00 ? 9   ALA A CB   7  
ATOM 11249 H H    . ALA A 1 9   ? 1.737   -14.971 12.462  1.00 0.00 ? 9   ALA A H    7  
ATOM 11250 H HA   . ALA A 1 9   ? 4.282   -13.819 11.979  1.00 0.00 ? 9   ALA A HA   7  
ATOM 11251 H HB1  . ALA A 1 9   ? 4.276   -14.968 9.955   1.00 0.00 ? 9   ALA A HB1  7  
ATOM 11252 H HB2  . ALA A 1 9   ? 3.260   -15.966 10.997  1.00 0.00 ? 9   ALA A HB2  7  
ATOM 11253 H HB3  . ALA A 1 9   ? 2.520   -14.895 9.808   1.00 0.00 ? 9   ALA A HB3  7  
ATOM 11254 N N    . PHE A 1 10  ? 1.783   -12.039 11.170  1.00 0.00 ? 10  PHE A N    7  
ATOM 11255 C CA   . PHE A 1 10  ? 1.338   -10.773 10.598  1.00 0.00 ? 10  PHE A CA   7  
ATOM 11256 C C    . PHE A 1 10  ? 1.494   -9.636  11.604  1.00 0.00 ? 10  PHE A C    7  
ATOM 11257 O O    . PHE A 1 10  ? 1.177   -8.483  11.310  1.00 0.00 ? 10  PHE A O    7  
ATOM 11258 C CB   . PHE A 1 10  ? -0.122  -10.877 10.151  1.00 0.00 ? 10  PHE A CB   7  
ATOM 11259 C CG   . PHE A 1 10  ? -0.336  -11.848 9.025   1.00 0.00 ? 10  PHE A CG   7  
ATOM 11260 C CD1  . PHE A 1 10  ? -0.236  -11.433 7.707   1.00 0.00 ? 10  PHE A CD1  7  
ATOM 11261 C CD2  . PHE A 1 10  ? -0.637  -13.175 9.285   1.00 0.00 ? 10  PHE A CD2  7  
ATOM 11262 C CE1  . PHE A 1 10  ? -0.434  -12.325 6.669   1.00 0.00 ? 10  PHE A CE1  7  
ATOM 11263 C CE2  . PHE A 1 10  ? -0.836  -14.071 8.252   1.00 0.00 ? 10  PHE A CE2  7  
ATOM 11264 C CZ   . PHE A 1 10  ? -0.733  -13.645 6.942   1.00 0.00 ? 10  PHE A CZ   7  
ATOM 11265 H H    . PHE A 1 10  ? 1.198   -12.511 11.799  1.00 0.00 ? 10  PHE A H    7  
ATOM 11266 H HA   . PHE A 1 10  ? 1.955   -10.564 9.738   1.00 0.00 ? 10  PHE A HA   7  
ATOM 11267 H HB2  . PHE A 1 10  ? -0.724  -11.200 10.986  1.00 0.00 ? 10  PHE A HB2  7  
ATOM 11268 H HB3  . PHE A 1 10  ? -0.459  -9.906  9.822   1.00 0.00 ? 10  PHE A HB3  7  
ATOM 11269 H HD1  . PHE A 1 10  ? -0.001  -10.401 7.492   1.00 0.00 ? 10  PHE A HD1  7  
ATOM 11270 H HD2  . PHE A 1 10  ? -0.718  -13.509 10.310  1.00 0.00 ? 10  PHE A HD2  7  
ATOM 11271 H HE1  . PHE A 1 10  ? -0.353  -11.990 5.646   1.00 0.00 ? 10  PHE A HE1  7  
ATOM 11272 H HE2  . PHE A 1 10  ? -1.070  -15.103 8.469   1.00 0.00 ? 10  PHE A HE2  7  
ATOM 11273 H HZ   . PHE A 1 10  ? -0.888  -14.344 6.133   1.00 0.00 ? 10  PHE A HZ   7  
ATOM 11274 N N    . THR A 1 11  ? 1.985   -9.970  12.793  1.00 0.00 ? 11  THR A N    7  
ATOM 11275 C CA   . THR A 1 11  ? 2.182   -8.979  13.844  1.00 0.00 ? 11  THR A CA   7  
ATOM 11276 C C    . THR A 1 11  ? 3.157   -7.895  13.401  1.00 0.00 ? 11  THR A C    7  
ATOM 11277 O O    . THR A 1 11  ? 4.204   -8.186  12.823  1.00 0.00 ? 11  THR A O    7  
ATOM 11278 C CB   . THR A 1 11  ? 2.707   -9.629  15.138  1.00 0.00 ? 11  THR A CB   7  
ATOM 11279 O OG1  . THR A 1 11  ? 3.860   -10.430 14.851  1.00 0.00 ? 11  THR A OG1  7  
ATOM 11280 C CG2  . THR A 1 11  ? 1.634   -10.490 15.786  1.00 0.00 ? 11  THR A CG2  7  
ATOM 11281 H H    . THR A 1 11  ? 2.218   -10.906 12.967  1.00 0.00 ? 11  THR A H    7  
ATOM 11282 H HA   . THR A 1 11  ? 1.225   -8.525  14.057  1.00 0.00 ? 11  THR A HA   7  
ATOM 11283 H HB   . THR A 1 11  ? 2.986   -8.846  15.829  1.00 0.00 ? 11  THR A HB   7  
ATOM 11284 H HG1  . THR A 1 11  ? 4.581   -9.862  14.569  1.00 0.00 ? 11  THR A HG1  7  
ATOM 11285 H HG21 . THR A 1 11  ? 1.850   -10.605 16.838  1.00 0.00 ? 11  THR A HG21 7  
ATOM 11286 H HG22 . THR A 1 11  ? 1.618   -11.462 15.314  1.00 0.00 ? 11  THR A HG22 7  
ATOM 11287 H HG23 . THR A 1 11  ? 0.672   -10.016 15.666  1.00 0.00 ? 11  THR A HG23 7  
ATOM 11288 N N    . ASP A 1 12  ? 2.807   -6.643  13.675  1.00 0.00 ? 12  ASP A N    7  
ATOM 11289 C CA   . ASP A 1 12  ? 3.653   -5.514  13.306  1.00 0.00 ? 12  ASP A CA   7  
ATOM 11290 C C    . ASP A 1 12  ? 5.129   -5.881  13.421  1.00 0.00 ? 12  ASP A C    7  
ATOM 11291 O O    . ASP A 1 12  ? 5.860   -5.865  12.432  1.00 0.00 ? 12  ASP A O    7  
ATOM 11292 C CB   . ASP A 1 12  ? 3.344   -4.306  14.193  1.00 0.00 ? 12  ASP A CB   7  
ATOM 11293 C CG   . ASP A 1 12  ? 2.872   -4.710  15.576  1.00 0.00 ? 12  ASP A CG   7  
ATOM 11294 O OD1  . ASP A 1 12  ? 1.762   -5.273  15.684  1.00 0.00 ? 12  ASP A OD1  7  
ATOM 11295 O OD2  . ASP A 1 12  ? 3.612   -4.463  16.551  1.00 0.00 ? 12  ASP A OD2  7  
ATOM 11296 H H    . ASP A 1 12  ? 1.959   -6.474  14.138  1.00 0.00 ? 12  ASP A H    7  
ATOM 11297 H HA   . ASP A 1 12  ? 3.437   -5.259  12.280  1.00 0.00 ? 12  ASP A HA   7  
ATOM 11298 H HB2  . ASP A 1 12  ? 4.237   -3.708  14.299  1.00 0.00 ? 12  ASP A HB2  7  
ATOM 11299 H HB3  . ASP A 1 12  ? 2.571   -3.714  13.727  1.00 0.00 ? 12  ASP A HB3  7  
ATOM 11300 N N    . GLN A 1 13  ? 5.559   -6.209  14.635  1.00 0.00 ? 13  GLN A N    7  
ATOM 11301 C CA   . GLN A 1 13  ? 6.949   -6.578  14.879  1.00 0.00 ? 13  GLN A CA   7  
ATOM 11302 C C    . GLN A 1 13  ? 7.485   -7.453  13.751  1.00 0.00 ? 13  GLN A C    7  
ATOM 11303 O O    . GLN A 1 13  ? 8.574   -7.212  13.228  1.00 0.00 ? 13  GLN A O    7  
ATOM 11304 C CB   . GLN A 1 13  ? 7.077   -7.312  16.214  1.00 0.00 ? 13  GLN A CB   7  
ATOM 11305 C CG   . GLN A 1 13  ? 6.202   -8.551  16.314  1.00 0.00 ? 13  GLN A CG   7  
ATOM 11306 C CD   . GLN A 1 13  ? 5.991   -9.002  17.746  1.00 0.00 ? 13  GLN A CD   7  
ATOM 11307 O OE1  . GLN A 1 13  ? 6.742   -9.828  18.266  1.00 0.00 ? 13  GLN A OE1  7  
ATOM 11308 N NE2  . GLN A 1 13  ? 4.964   -8.462  18.392  1.00 0.00 ? 13  GLN A NE2  7  
ATOM 11309 H H    . GLN A 1 13  ? 4.928   -6.203  15.384  1.00 0.00 ? 13  GLN A H    7  
ATOM 11310 H HA   . GLN A 1 13  ? 7.530   -5.669  14.920  1.00 0.00 ? 13  GLN A HA   7  
ATOM 11311 H HB2  . GLN A 1 13  ? 8.105   -7.612  16.350  1.00 0.00 ? 13  GLN A HB2  7  
ATOM 11312 H HB3  . GLN A 1 13  ? 6.799   -6.637  17.011  1.00 0.00 ? 13  GLN A HB3  7  
ATOM 11313 H HG2  . GLN A 1 13  ? 5.239   -8.333  15.876  1.00 0.00 ? 13  GLN A HG2  7  
ATOM 11314 H HG3  . GLN A 1 13  ? 6.672   -9.353  15.765  1.00 0.00 ? 13  GLN A HG3  7  
ATOM 11315 H HE21 . GLN A 1 13  ? 4.407   -7.812  17.913  1.00 0.00 ? 13  GLN A HE21 7  
ATOM 11316 H HE22 . GLN A 1 13  ? 4.803   -8.736  19.318  1.00 0.00 ? 13  GLN A HE22 7  
ATOM 11317 N N    . LYS A 1 14  ? 6.715   -8.470  13.380  1.00 0.00 ? 14  LYS A N    7  
ATOM 11318 C CA   . LYS A 1 14  ? 7.111   -9.381  12.313  1.00 0.00 ? 14  LYS A CA   7  
ATOM 11319 C C    . LYS A 1 14  ? 7.097   -8.675  10.961  1.00 0.00 ? 14  LYS A C    7  
ATOM 11320 O O    . LYS A 1 14  ? 7.908   -8.977  10.084  1.00 0.00 ? 14  LYS A O    7  
ATOM 11321 C CB   . LYS A 1 14  ? 6.178   -10.594 12.277  1.00 0.00 ? 14  LYS A CB   7  
ATOM 11322 C CG   . LYS A 1 14  ? 6.525   -11.659 13.302  1.00 0.00 ? 14  LYS A CG   7  
ATOM 11323 C CD   . LYS A 1 14  ? 7.789   -12.410 12.920  1.00 0.00 ? 14  LYS A CD   7  
ATOM 11324 C CE   . LYS A 1 14  ? 8.427   -13.080 14.128  1.00 0.00 ? 14  LYS A CE   7  
ATOM 11325 N NZ   . LYS A 1 14  ? 9.906   -13.184 13.988  1.00 0.00 ? 14  LYS A NZ   7  
ATOM 11326 H H    . LYS A 1 14  ? 5.858   -8.610  13.834  1.00 0.00 ? 14  LYS A H    7  
ATOM 11327 H HA   . LYS A 1 14  ? 8.116   -9.717  12.520  1.00 0.00 ? 14  LYS A HA   7  
ATOM 11328 H HB2  . LYS A 1 14  ? 5.168   -10.261 12.462  1.00 0.00 ? 14  LYS A HB2  7  
ATOM 11329 H HB3  . LYS A 1 14  ? 6.226   -11.041 11.294  1.00 0.00 ? 14  LYS A HB3  7  
ATOM 11330 H HG2  . LYS A 1 14  ? 6.677   -11.187 14.262  1.00 0.00 ? 14  LYS A HG2  7  
ATOM 11331 H HG3  . LYS A 1 14  ? 5.706   -12.361 13.370  1.00 0.00 ? 14  LYS A HG3  7  
ATOM 11332 H HD2  . LYS A 1 14  ? 7.541   -13.168 12.192  1.00 0.00 ? 14  LYS A HD2  7  
ATOM 11333 H HD3  . LYS A 1 14  ? 8.496   -11.714 12.491  1.00 0.00 ? 14  LYS A HD3  7  
ATOM 11334 H HE2  . LYS A 1 14  ? 8.197   -12.499 15.008  1.00 0.00 ? 14  LYS A HE2  7  
ATOM 11335 H HE3  . LYS A 1 14  ? 8.013   -14.072 14.233  1.00 0.00 ? 14  LYS A HE3  7  
ATOM 11336 H HZ1  . LYS A 1 14  ? 10.301  -12.270 13.685  1.00 0.00 ? 14  LYS A HZ1  7  
ATOM 11337 H HZ2  . LYS A 1 14  ? 10.148  -13.905 13.280  1.00 0.00 ? 14  LYS A HZ2  7  
ATOM 11338 H HZ3  . LYS A 1 14  ? 10.333  -13.450 14.898  1.00 0.00 ? 14  LYS A HZ3  7  
ATOM 11339 N N    . ILE A 1 15  ? 6.174   -7.734  10.799  1.00 0.00 ? 15  ILE A N    7  
ATOM 11340 C CA   . ILE A 1 15  ? 6.057   -6.984  9.555   1.00 0.00 ? 15  ILE A CA   7  
ATOM 11341 C C    . ILE A 1 15  ? 7.278   -6.099  9.330   1.00 0.00 ? 15  ILE A C    7  
ATOM 11342 O O    . ILE A 1 15  ? 7.902   -6.142  8.270   1.00 0.00 ? 15  ILE A O    7  
ATOM 11343 C CB   . ILE A 1 15  ? 4.791   -6.106  9.543   1.00 0.00 ? 15  ILE A CB   7  
ATOM 11344 C CG1  . ILE A 1 15  ? 3.539   -6.978  9.651   1.00 0.00 ? 15  ILE A CG1  7  
ATOM 11345 C CG2  . ILE A 1 15  ? 4.747   -5.259  8.281   1.00 0.00 ? 15  ILE A CG2  7  
ATOM 11346 C CD1  . ILE A 1 15  ? 2.268   -6.186  9.869   1.00 0.00 ? 15  ILE A CD1  7  
ATOM 11347 H H    . ILE A 1 15  ? 5.556   -7.539  11.535  1.00 0.00 ? 15  ILE A H    7  
ATOM 11348 H HA   . ILE A 1 15  ? 5.986   -7.694  8.744   1.00 0.00 ? 15  ILE A HA   7  
ATOM 11349 H HB   . ILE A 1 15  ? 4.833   -5.442  10.393  1.00 0.00 ? 15  ILE A HB   7  
ATOM 11350 H HG12 . ILE A 1 15  ? 3.423   -7.546  8.741   1.00 0.00 ? 15  ILE A HG12 7  
ATOM 11351 H HG13 . ILE A 1 15  ? 3.653   -7.658  10.483  1.00 0.00 ? 15  ILE A HG13 7  
ATOM 11352 H HG21 . ILE A 1 15  ? 4.507   -5.886  7.435   1.00 0.00 ? 15  ILE A HG21 7  
ATOM 11353 H HG22 . ILE A 1 15  ? 3.991   -4.495  8.387   1.00 0.00 ? 15  ILE A HG22 7  
ATOM 11354 H HG23 . ILE A 1 15  ? 5.709   -4.795  8.124   1.00 0.00 ? 15  ILE A HG23 7  
ATOM 11355 H HD11 . ILE A 1 15  ? 2.103   -6.054  10.928  1.00 0.00 ? 15  ILE A HD11 7  
ATOM 11356 H HD12 . ILE A 1 15  ? 2.359   -5.221  9.394   1.00 0.00 ? 15  ILE A HD12 7  
ATOM 11357 H HD13 . ILE A 1 15  ? 1.433   -6.721  9.440   1.00 0.00 ? 15  ILE A HD13 7  
ATOM 11358 N N    . ARG A 1 16  ? 7.615   -5.298  10.336  1.00 0.00 ? 16  ARG A N    7  
ATOM 11359 C CA   . ARG A 1 16  ? 8.762   -4.403  10.248  1.00 0.00 ? 16  ARG A CA   7  
ATOM 11360 C C    . ARG A 1 16  ? 10.055  -5.193  10.065  1.00 0.00 ? 16  ARG A C    7  
ATOM 11361 O O    . ARG A 1 16  ? 11.006  -4.710  9.451   1.00 0.00 ? 16  ARG A O    7  
ATOM 11362 C CB   . ARG A 1 16  ? 8.856   -3.535  11.505  1.00 0.00 ? 16  ARG A CB   7  
ATOM 11363 C CG   . ARG A 1 16  ? 9.089   -4.331  12.779  1.00 0.00 ? 16  ARG A CG   7  
ATOM 11364 C CD   . ARG A 1 16  ? 9.402   -3.419  13.955  1.00 0.00 ? 16  ARG A CD   7  
ATOM 11365 N NE   . ARG A 1 16  ? 10.822  -3.084  14.026  1.00 0.00 ? 16  ARG A NE   7  
ATOM 11366 C CZ   . ARG A 1 16  ? 11.337  -2.254  14.926  1.00 0.00 ? 16  ARG A CZ   7  
ATOM 11367 N NH1  . ARG A 1 16  ? 10.552  -1.678  15.827  1.00 0.00 ? 16  ARG A NH1  7  
ATOM 11368 N NH2  . ARG A 1 16  ? 12.639  -1.999  14.927  1.00 0.00 ? 16  ARG A NH2  7  
ATOM 11369 H H    . ARG A 1 16  ? 7.079   -5.309  11.156  1.00 0.00 ? 16  ARG A H    7  
ATOM 11370 H HA   . ARG A 1 16  ? 8.620   -3.764  9.390   1.00 0.00 ? 16  ARG A HA   7  
ATOM 11371 H HB2  . ARG A 1 16  ? 9.673   -2.838  11.387  1.00 0.00 ? 16  ARG A HB2  7  
ATOM 11372 H HB3  . ARG A 1 16  ? 7.935   -2.982  11.615  1.00 0.00 ? 16  ARG A HB3  7  
ATOM 11373 H HG2  . ARG A 1 16  ? 8.200   -4.900  13.005  1.00 0.00 ? 16  ARG A HG2  7  
ATOM 11374 H HG3  . ARG A 1 16  ? 9.920   -5.003  12.624  1.00 0.00 ? 16  ARG A HG3  7  
ATOM 11375 H HD2  . ARG A 1 16  ? 8.832   -2.508  13.849  1.00 0.00 ? 16  ARG A HD2  7  
ATOM 11376 H HD3  . ARG A 1 16  ? 9.113   -3.920  14.867  1.00 0.00 ? 16  ARG A HD3  7  
ATOM 11377 H HE   . ARG A 1 16  ? 11.419  -3.499  13.370  1.00 0.00 ? 16  ARG A HE   7  
ATOM 11378 H HH11 . ARG A 1 16  ? 9.571   -1.869  15.830  1.00 0.00 ? 16  ARG A HH11 7  
ATOM 11379 H HH12 . ARG A 1 16  ? 10.943  -1.055  16.505  1.00 0.00 ? 16  ARG A HH12 7  
ATOM 11380 H HH21 . ARG A 1 16  ? 13.233  -2.432  14.250  1.00 0.00 ? 16  ARG A HH21 7  
ATOM 11381 H HH22 . ARG A 1 16  ? 13.025  -1.375  15.605  1.00 0.00 ? 16  ARG A HH22 7  
ATOM 11382 N N    . GLN A 1 17  ? 10.081  -6.408  10.602  1.00 0.00 ? 17  GLN A N    7  
ATOM 11383 C CA   . GLN A 1 17  ? 11.258  -7.263  10.499  1.00 0.00 ? 17  GLN A CA   7  
ATOM 11384 C C    . GLN A 1 17  ? 11.277  -8.004  9.166   1.00 0.00 ? 17  GLN A C    7  
ATOM 11385 O O    . GLN A 1 17  ? 12.341  -8.263  8.604   1.00 0.00 ? 17  GLN A O    7  
ATOM 11386 C CB   . GLN A 1 17  ? 11.289  -8.266  11.654  1.00 0.00 ? 17  GLN A CB   7  
ATOM 11387 C CG   . GLN A 1 17  ? 11.891  -7.703  12.932  1.00 0.00 ? 17  GLN A CG   7  
ATOM 11388 C CD   . GLN A 1 17  ? 12.560  -8.767  13.779  1.00 0.00 ? 17  GLN A CD   7  
ATOM 11389 O OE1  . GLN A 1 17  ? 12.913  -9.838  13.286  1.00 0.00 ? 17  GLN A OE1  7  
ATOM 11390 N NE2  . GLN A 1 17  ? 12.737  -8.477  15.063  1.00 0.00 ? 17  GLN A NE2  7  
ATOM 11391 H H    . GLN A 1 17  ? 9.292   -6.737  11.080  1.00 0.00 ? 17  GLN A H    7  
ATOM 11392 H HA   . GLN A 1 17  ? 12.132  -6.633  10.558  1.00 0.00 ? 17  GLN A HA   7  
ATOM 11393 H HB2  . GLN A 1 17  ? 10.279  -8.584  11.866  1.00 0.00 ? 17  GLN A HB2  7  
ATOM 11394 H HB3  . GLN A 1 17  ? 11.873  -9.123  11.354  1.00 0.00 ? 17  GLN A HB3  7  
ATOM 11395 H HG2  . GLN A 1 17  ? 12.627  -6.958  12.670  1.00 0.00 ? 17  GLN A HG2  7  
ATOM 11396 H HG3  . GLN A 1 17  ? 11.104  -7.243  13.512  1.00 0.00 ? 17  GLN A HG3  7  
ATOM 11397 H HE21 . GLN A 1 17  ? 12.429  -7.604  15.386  1.00 0.00 ? 17  GLN A HE21 7  
ATOM 11398 H HE22 . GLN A 1 17  ? 13.166  -9.146  15.634  1.00 0.00 ? 17  GLN A HE22 7  
ATOM 11399 N N    . ARG A 1 18  ? 10.093  -8.343  8.666   1.00 0.00 ? 18  ARG A N    7  
ATOM 11400 C CA   . ARG A 1 18  ? 9.973   -9.056  7.400   1.00 0.00 ? 18  ARG A CA   7  
ATOM 11401 C C    . ARG A 1 18  ? 10.438  -8.182  6.239   1.00 0.00 ? 18  ARG A C    7  
ATOM 11402 O O    . ARG A 1 18  ? 11.185  -8.633  5.370   1.00 0.00 ? 18  ARG A O    7  
ATOM 11403 C CB   . ARG A 1 18  ? 8.526   -9.498  7.174   1.00 0.00 ? 18  ARG A CB   7  
ATOM 11404 C CG   . ARG A 1 18  ? 8.266   -10.036 5.776   1.00 0.00 ? 18  ARG A CG   7  
ATOM 11405 C CD   . ARG A 1 18  ? 7.082   -10.990 5.759   1.00 0.00 ? 18  ARG A CD   7  
ATOM 11406 N NE   . ARG A 1 18  ? 7.392   -12.260 6.410   1.00 0.00 ? 18  ARG A NE   7  
ATOM 11407 C CZ   . ARG A 1 18  ? 8.147   -13.204 5.858   1.00 0.00 ? 18  ARG A CZ   7  
ATOM 11408 N NH1  . ARG A 1 18  ? 8.666   -13.021 4.651   1.00 0.00 ? 18  ARG A NH1  7  
ATOM 11409 N NH2  . ARG A 1 18  ? 8.385   -14.333 6.513   1.00 0.00 ? 18  ARG A NH2  7  
ATOM 11410 H H    . ARG A 1 18  ? 9.280   -8.109  9.161   1.00 0.00 ? 18  ARG A H    7  
ATOM 11411 H HA   . ARG A 1 18  ? 10.604  -9.931  7.452   1.00 0.00 ? 18  ARG A HA   7  
ATOM 11412 H HB2  . ARG A 1 18  ? 8.283   -10.273 7.885   1.00 0.00 ? 18  ARG A HB2  7  
ATOM 11413 H HB3  . ARG A 1 18  ? 7.875   -8.653  7.338   1.00 0.00 ? 18  ARG A HB3  7  
ATOM 11414 H HG2  . ARG A 1 18  ? 8.056   -9.208  5.115   1.00 0.00 ? 18  ARG A HG2  7  
ATOM 11415 H HG3  . ARG A 1 18  ? 9.145   -10.560 5.433   1.00 0.00 ? 18  ARG A HG3  7  
ATOM 11416 H HD2  . ARG A 1 18  ? 6.254   -10.526 6.274   1.00 0.00 ? 18  ARG A HD2  7  
ATOM 11417 H HD3  . ARG A 1 18  ? 6.805   -11.180 4.733   1.00 0.00 ? 18  ARG A HD3  7  
ATOM 11418 H HE   . ARG A 1 18  ? 7.019   -12.416 7.302   1.00 0.00 ? 18  ARG A HE   7  
ATOM 11419 H HH11 . ARG A 1 18  ? 8.489   -12.171 4.156   1.00 0.00 ? 18  ARG A HH11 7  
ATOM 11420 H HH12 . ARG A 1 18  ? 9.235   -13.732 4.238   1.00 0.00 ? 18  ARG A HH12 7  
ATOM 11421 H HH21 . ARG A 1 18  ? 7.996   -14.474 7.423   1.00 0.00 ? 18  ARG A HH21 7  
ATOM 11422 H HH22 . ARG A 1 18  ? 8.953   -15.042 6.097   1.00 0.00 ? 18  ARG A HH22 7  
ATOM 11423 N N    . TYR A 1 19  ? 9.990   -6.932  6.230   1.00 0.00 ? 19  TYR A N    7  
ATOM 11424 C CA   . TYR A 1 19  ? 10.357  -5.996  5.174   1.00 0.00 ? 19  TYR A CA   7  
ATOM 11425 C C    . TYR A 1 19  ? 11.489  -5.079  5.628   1.00 0.00 ? 19  TYR A C    7  
ATOM 11426 O O    . TYR A 1 19  ? 11.772  -4.063  4.993   1.00 0.00 ? 19  TYR A O    7  
ATOM 11427 C CB   . TYR A 1 19  ? 9.144   -5.160  4.760   1.00 0.00 ? 19  TYR A CB   7  
ATOM 11428 C CG   . TYR A 1 19  ? 8.013   -5.980  4.183   1.00 0.00 ? 19  TYR A CG   7  
ATOM 11429 C CD1  . TYR A 1 19  ? 8.105   -6.529  2.909   1.00 0.00 ? 19  TYR A CD1  7  
ATOM 11430 C CD2  . TYR A 1 19  ? 6.851   -6.208  4.911   1.00 0.00 ? 19  TYR A CD2  7  
ATOM 11431 C CE1  . TYR A 1 19  ? 7.074   -7.278  2.378   1.00 0.00 ? 19  TYR A CE1  7  
ATOM 11432 C CE2  . TYR A 1 19  ? 5.815   -6.957  4.388   1.00 0.00 ? 19  TYR A CE2  7  
ATOM 11433 C CZ   . TYR A 1 19  ? 5.931   -7.489  3.120   1.00 0.00 ? 19  TYR A CZ   7  
ATOM 11434 O OH   . TYR A 1 19  ? 4.902   -8.236  2.595   1.00 0.00 ? 19  TYR A OH   7  
ATOM 11435 H H    . TYR A 1 19  ? 9.397   -6.631  6.950   1.00 0.00 ? 19  TYR A H    7  
ATOM 11436 H HA   . TYR A 1 19  ? 10.693  -6.571  4.324   1.00 0.00 ? 19  TYR A HA   7  
ATOM 11437 H HB2  . TYR A 1 19  ? 8.765   -4.636  5.624   1.00 0.00 ? 19  TYR A HB2  7  
ATOM 11438 H HB3  . TYR A 1 19  ? 9.449   -4.442  4.013   1.00 0.00 ? 19  TYR A HB3  7  
ATOM 11439 H HD1  . TYR A 1 19  ? 9.002   -6.362  2.330   1.00 0.00 ? 19  TYR A HD1  7  
ATOM 11440 H HD2  . TYR A 1 19  ? 6.764   -5.789  5.903   1.00 0.00 ? 19  TYR A HD2  7  
ATOM 11441 H HE1  . TYR A 1 19  ? 7.164   -7.695  1.386   1.00 0.00 ? 19  TYR A HE1  7  
ATOM 11442 H HE2  . TYR A 1 19  ? 4.920   -7.122  4.969   1.00 0.00 ? 19  TYR A HE2  7  
ATOM 11443 H HH   . TYR A 1 19  ? 5.170   -8.599  1.747   1.00 0.00 ? 19  TYR A HH   7  
ATOM 11444 N N    . ALA A 1 20  ? 12.134  -5.447  6.730   1.00 0.00 ? 20  ALA A N    7  
ATOM 11445 C CA   . ALA A 1 20  ? 13.237  -4.661  7.268   1.00 0.00 ? 20  ALA A CA   7  
ATOM 11446 C C    . ALA A 1 20  ? 14.456  -4.727  6.353   1.00 0.00 ? 20  ALA A C    7  
ATOM 11447 O O    . ALA A 1 20  ? 15.442  -4.022  6.567   1.00 0.00 ? 20  ALA A O    7  
ATOM 11448 C CB   . ALA A 1 20  ? 13.597  -5.143  8.665   1.00 0.00 ? 20  ALA A CB   7  
ATOM 11449 H H    . ALA A 1 20  ? 11.862  -6.268  7.191   1.00 0.00 ? 20  ALA A H    7  
ATOM 11450 H HA   . ALA A 1 20  ? 12.910  -3.634  7.341   1.00 0.00 ? 20  ALA A HA   7  
ATOM 11451 H HB1  . ALA A 1 20  ? 14.672  -5.185  8.765   1.00 0.00 ? 20  ALA A HB1  7  
ATOM 11452 H HB2  . ALA A 1 20  ? 13.193  -4.460  9.397   1.00 0.00 ? 20  ALA A HB2  7  
ATOM 11453 H HB3  . ALA A 1 20  ? 13.182  -6.127  8.824   1.00 0.00 ? 20  ALA A HB3  7  
ATOM 11454 N N    . ASP A 1 21  ? 14.380  -5.578  5.336   1.00 0.00 ? 21  ASP A N    7  
ATOM 11455 C CA   . ASP A 1 21  ? 15.478  -5.736  4.388   1.00 0.00 ? 21  ASP A CA   7  
ATOM 11456 C C    . ASP A 1 21  ? 15.374  -4.712  3.262   1.00 0.00 ? 21  ASP A C    7  
ATOM 11457 O O    . ASP A 1 21  ? 16.355  -4.432  2.571   1.00 0.00 ? 21  ASP A O    7  
ATOM 11458 C CB   . ASP A 1 21  ? 15.480  -7.151  3.810   1.00 0.00 ? 21  ASP A CB   7  
ATOM 11459 C CG   . ASP A 1 21  ? 16.848  -7.567  3.303   1.00 0.00 ? 21  ASP A CG   7  
ATOM 11460 O OD1  . ASP A 1 21  ? 17.858  -7.132  3.896   1.00 0.00 ? 21  ASP A OD1  7  
ATOM 11461 O OD2  . ASP A 1 21  ? 16.908  -8.328  2.315   1.00 0.00 ? 21  ASP A OD2  7  
ATOM 11462 H H    . ASP A 1 21  ? 13.567  -6.112  5.219   1.00 0.00 ? 21  ASP A H    7  
ATOM 11463 H HA   . ASP A 1 21  ? 16.402  -5.573  4.921   1.00 0.00 ? 21  ASP A HA   7  
ATOM 11464 H HB2  . ASP A 1 21  ? 15.175  -7.848  4.577   1.00 0.00 ? 21  ASP A HB2  7  
ATOM 11465 H HB3  . ASP A 1 21  ? 14.782  -7.198  2.988   1.00 0.00 ? 21  ASP A HB3  7  
ATOM 11466 N N    . LEU A 1 22  ? 14.180  -4.158  3.081   1.00 0.00 ? 22  LEU A N    7  
ATOM 11467 C CA   . LEU A 1 22  ? 13.948  -3.166  2.037   1.00 0.00 ? 22  LEU A CA   7  
ATOM 11468 C C    . LEU A 1 22  ? 14.760  -1.902  2.296   1.00 0.00 ? 22  LEU A C    7  
ATOM 11469 O O    . LEU A 1 22  ? 15.069  -1.556  3.436   1.00 0.00 ? 22  LEU A O    7  
ATOM 11470 C CB   . LEU A 1 22  ? 12.459  -2.822  1.956   1.00 0.00 ? 22  LEU A CB   7  
ATOM 11471 C CG   . LEU A 1 22  ? 11.500  -4.009  1.859   1.00 0.00 ? 22  LEU A CG   7  
ATOM 11472 C CD1  . LEU A 1 22  ? 10.059  -3.527  1.796   1.00 0.00 ? 22  LEU A CD1  7  
ATOM 11473 C CD2  . LEU A 1 22  ? 11.832  -4.865  0.645   1.00 0.00 ? 22  LEU A CD2  7  
ATOM 11474 H H    . LEU A 1 22  ? 13.437  -4.422  3.662   1.00 0.00 ? 22  LEU A H    7  
ATOM 11475 H HA   . LEU A 1 22  ? 14.261  -3.595  1.096   1.00 0.00 ? 22  LEU A HA   7  
ATOM 11476 H HB2  . LEU A 1 22  ? 12.202  -2.260  2.840   1.00 0.00 ? 22  LEU A HB2  7  
ATOM 11477 H HB3  . LEU A 1 22  ? 12.311  -2.203  1.082   1.00 0.00 ? 22  LEU A HB3  7  
ATOM 11478 H HG   . LEU A 1 22  ? 11.607  -4.623  2.742   1.00 0.00 ? 22  LEU A HG   7  
ATOM 11479 H HD11 . LEU A 1 22  ? 9.876   -2.833  2.602   1.00 0.00 ? 22  LEU A HD11 7  
ATOM 11480 H HD12 . LEU A 1 22  ? 9.393   -4.371  1.889   1.00 0.00 ? 22  LEU A HD12 7  
ATOM 11481 H HD13 . LEU A 1 22  ? 9.886   -3.035  0.850   1.00 0.00 ? 22  LEU A HD13 7  
ATOM 11482 H HD21 . LEU A 1 22  ? 10.926  -5.310  0.261   1.00 0.00 ? 22  LEU A HD21 7  
ATOM 11483 H HD22 . LEU A 1 22  ? 12.522  -5.645  0.933   1.00 0.00 ? 22  LEU A HD22 7  
ATOM 11484 H HD23 . LEU A 1 22  ? 12.282  -4.248  -0.118  1.00 0.00 ? 22  LEU A HD23 7  
ATOM 11485 N N    . PRO A 1 23  ? 15.115  -1.194  1.213   1.00 0.00 ? 23  PRO A N    7  
ATOM 11486 C CA   . PRO A 1 23  ? 15.894  0.045   1.298   1.00 0.00 ? 23  PRO A CA   7  
ATOM 11487 C C    . PRO A 1 23  ? 15.095  1.192   1.908   1.00 0.00 ? 23  PRO A C    7  
ATOM 11488 O O    . PRO A 1 23  ? 15.552  1.854   2.839   1.00 0.00 ? 23  PRO A O    7  
ATOM 11489 C CB   . PRO A 1 23  ? 16.236  0.350   -0.163  1.00 0.00 ? 23  PRO A CB   7  
ATOM 11490 C CG   . PRO A 1 23  ? 15.160  -0.314  -0.950  1.00 0.00 ? 23  PRO A CG   7  
ATOM 11491 C CD   . PRO A 1 23  ? 14.781  -1.547  -0.177  1.00 0.00 ? 23  PRO A CD   7  
ATOM 11492 H HA   . PRO A 1 23  ? 16.805  -0.097  1.861   1.00 0.00 ? 23  PRO A HA   7  
ATOM 11493 H HB2  . PRO A 1 23  ? 16.239  1.419   -0.319  1.00 0.00 ? 23  PRO A HB2  7  
ATOM 11494 H HB3  . PRO A 1 23  ? 17.207  -0.057  -0.401  1.00 0.00 ? 23  PRO A HB3  7  
ATOM 11495 H HG2  . PRO A 1 23  ? 14.311  0.346   -1.042  1.00 0.00 ? 23  PRO A HG2  7  
ATOM 11496 H HG3  . PRO A 1 23  ? 15.534  -0.585  -1.926  1.00 0.00 ? 23  PRO A HG3  7  
ATOM 11497 H HD2  . PRO A 1 23  ? 13.725  -1.748  -0.281  1.00 0.00 ? 23  PRO A HD2  7  
ATOM 11498 H HD3  . PRO A 1 23  ? 15.363  -2.394  -0.508  1.00 0.00 ? 23  PRO A HD3  7  
ATOM 11499 N N    . GLY A 1 24  ? 13.897  1.421   1.377   1.00 0.00 ? 24  GLY A N    7  
ATOM 11500 C CA   . GLY A 1 24  ? 13.054  2.488   1.883   1.00 0.00 ? 24  GLY A CA   7  
ATOM 11501 C C    . GLY A 1 24  ? 12.690  2.298   3.342   1.00 0.00 ? 24  GLY A C    7  
ATOM 11502 O O    . GLY A 1 24  ? 13.244  1.432   4.018   1.00 0.00 ? 24  GLY A O    7  
ATOM 11503 H H    . GLY A 1 24  ? 13.584  0.861   0.637   1.00 0.00 ? 24  GLY A H    7  
ATOM 11504 H HA2  . GLY A 1 24  ? 13.575  3.428   1.772   1.00 0.00 ? 24  GLY A HA2  7  
ATOM 11505 H HA3  . GLY A 1 24  ? 12.146  2.521   1.299   1.00 0.00 ? 24  GLY A HA3  7  
ATOM 11506 N N    . GLU A 1 25  ? 11.756  3.110   3.828   1.00 0.00 ? 25  GLU A N    7  
ATOM 11507 C CA   . GLU A 1 25  ? 11.321  3.027   5.218   1.00 0.00 ? 25  GLU A CA   7  
ATOM 11508 C C    . GLU A 1 25  ? 9.872   2.557   5.307   1.00 0.00 ? 25  GLU A C    7  
ATOM 11509 O O    . GLU A 1 25  ? 8.998   3.064   4.602   1.00 0.00 ? 25  GLU A O    7  
ATOM 11510 C CB   . GLU A 1 25  ? 11.471  4.387   5.904   1.00 0.00 ? 25  GLU A CB   7  
ATOM 11511 C CG   . GLU A 1 25  ? 11.707  4.289   7.402   1.00 0.00 ? 25  GLU A CG   7  
ATOM 11512 C CD   . GLU A 1 25  ? 13.144  3.947   7.745   1.00 0.00 ? 25  GLU A CD   7  
ATOM 11513 O OE1  . GLU A 1 25  ? 13.682  2.986   7.158   1.00 0.00 ? 25  GLU A OE1  7  
ATOM 11514 O OE2  . GLU A 1 25  ? 13.730  4.642   8.602   1.00 0.00 ? 25  GLU A OE2  7  
ATOM 11515 H H    . GLU A 1 25  ? 11.351  3.780   3.239   1.00 0.00 ? 25  GLU A H    7  
ATOM 11516 H HA   . GLU A 1 25  ? 11.951  2.309   5.720   1.00 0.00 ? 25  GLU A HA   7  
ATOM 11517 H HB2  . GLU A 1 25  ? 12.306  4.910   5.461   1.00 0.00 ? 25  GLU A HB2  7  
ATOM 11518 H HB3  . GLU A 1 25  ? 10.571  4.960   5.739   1.00 0.00 ? 25  GLU A HB3  7  
ATOM 11519 H HG2  . GLU A 1 25  ? 11.462  5.238   7.854   1.00 0.00 ? 25  GLU A HG2  7  
ATOM 11520 H HG3  . GLU A 1 25  ? 11.063  3.522   7.806   1.00 0.00 ? 25  GLU A HG3  7  
ATOM 11521 N N    . LEU A 1 26  ? 9.625   1.585   6.178   1.00 0.00 ? 26  LEU A N    7  
ATOM 11522 C CA   . LEU A 1 26  ? 8.282   1.045   6.361   1.00 0.00 ? 26  LEU A CA   7  
ATOM 11523 C C    . LEU A 1 26  ? 7.411   2.009   7.160   1.00 0.00 ? 26  LEU A C    7  
ATOM 11524 O O    . LEU A 1 26  ? 7.808   2.483   8.225   1.00 0.00 ? 26  LEU A O    7  
ATOM 11525 C CB   . LEU A 1 26  ? 8.348   -0.309  7.070   1.00 0.00 ? 26  LEU A CB   7  
ATOM 11526 C CG   . LEU A 1 26  ? 7.091   -1.175  6.981   1.00 0.00 ? 26  LEU A CG   7  
ATOM 11527 C CD1  . LEU A 1 26  ? 7.139   -2.059  5.744   1.00 0.00 ? 26  LEU A CD1  7  
ATOM 11528 C CD2  . LEU A 1 26  ? 6.935   -2.020  8.237   1.00 0.00 ? 26  LEU A CD2  7  
ATOM 11529 H H    . LEU A 1 26  ? 10.362  1.221   6.711   1.00 0.00 ? 26  LEU A H    7  
ATOM 11530 H HA   . LEU A 1 26  ? 7.844   0.909   5.383   1.00 0.00 ? 26  LEU A HA   7  
ATOM 11531 H HB2  . LEU A 1 26  ? 9.165   -0.867  6.642   1.00 0.00 ? 26  LEU A HB2  7  
ATOM 11532 H HB3  . LEU A 1 26  ? 8.549   -0.124  8.116   1.00 0.00 ? 26  LEU A HB3  7  
ATOM 11533 H HG   . LEU A 1 26  ? 6.224   -0.534  6.898   1.00 0.00 ? 26  LEU A HG   7  
ATOM 11534 H HD11 . LEU A 1 26  ? 8.124   -2.011  5.305   1.00 0.00 ? 26  LEU A HD11 7  
ATOM 11535 H HD12 . LEU A 1 26  ? 6.408   -1.715  5.027   1.00 0.00 ? 26  LEU A HD12 7  
ATOM 11536 H HD13 . LEU A 1 26  ? 6.917   -3.079  6.022   1.00 0.00 ? 26  LEU A HD13 7  
ATOM 11537 H HD21 . LEU A 1 26  ? 7.473   -1.557  9.051   1.00 0.00 ? 26  LEU A HD21 7